4NKIL

Crystal structure of a fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
SALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Fab light chain
publication title Epitope characterization of an anti-PD-L1 antibody using orthogonal approaches.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiL02
4NQEE 4RGMB 4N8PA 4OZHA 5EOTA 4UIMB 4NQVA 1UCTA 3STZA 1B4JL 4G6JH 3LVEA 5EOCJ 1UJTA 4QRRE 5DGRA 3IDGA 4DGVL 3TJHC 1PDKA 1H15B 5GRYA 4LL9A 3QUMB 1RJYB 5J6GA 3T2QA 2PYEA 1UM6L 3CU1A 1MHHB 2CK0L 5DMKA 1KJMA 1U3ZA 1SJEA 3X14B 4JN2B 1XCQB 5JUEL 3WD5H 3Q6FA 5INDB 5HY9A 2CQVA 1WWAX 4YHPB 4DFIA 3QHFL 1P7QB 5SWSE 3QIBB 3O6FB 5L9DL 2WK2A 1MLCB 1UM5H 1WICA 5E9DB 4RNRB 4R0LC 5FIEA 4MNGA 2V2WA 1HEZB 4MB3A 4ZXBA 1YYLH 1PYWB 1FCGA 4UOW1 3AMKA 1YEEH 1YMMB 1HINL 3GIZL 4UINH 3UXFA 2J88L 4DKEH 4PLKD 3GJEA 5ITFB 1OP5H 3O2VL 5JZ7D 5HHXH 5FGBC 1A5FL 1KN2L 2ZUTA 1CDUA 3EW3B 3UTSE 2NY6C 1G7HA 1RSFA 3I3EA 5AAMA 5MERB 3L6FB 4F33B 1V7MH 4URTB 3VGFA 4ZD3L 4FQXD 1F3DJ 5D7LE 4OGAD 4ZFGL 3DRQA 5I1LA 5AUMB 3UTQB 4OUUB 1D9KA 1KN4L 1KYOJ 3ZE1F 3K46A 3STBA 4LVOC 5L7XH 1CE6A 1WCQA 4HS6B 4WWKB 3DECA 4J3UA 5CJQH 1HHIA 2ZJSH 3CZFB 1PKQB 3LD8C 1JYWA 4PRPB 4RX4A 1PZ5B 3TO2A 1GGBL 2PR4L 5IT2L 1N26A 4P46A 2BRRH 3QIWB 5GRJH 3MGOA 4M5ZL 3KLHD 3INUL 1BZ7B 1CR9H 3FFCE 3QUMH 1JRHL 2IFFL 3U1SL 1J1PH 3TVMB 1FH5L 1RZJH 4X80H 2XTJC 2XV6B 1IL1B 3ARDA 2IPUG 4G6FB 3UCRA 2XZCL 1GOHA 4U0RC 4H88H 3BXNA 3KGRA 3WIHA 4YC2C 3T1WA 1E4KA 5HBBA 4LF3B 5C0JA 2IPTL 1FO0H 1CS6A 2R2HA 2GJ6A 5GS1C 3RVVD 4XNQB 3N1GC 4Z8FH 1DUZA 1UH4A 5F1IA 1HHKB 5D8JH 4DKDC 1ZA3B 1BHGA 4QYOA 1FPTL 5DFVC 5F7UA 4MLIA 2DQJH 2FIKB 1CFVL 1R6VA 2X1PA 4PB9L 4JM4H 4PD4K 3I6KA 3F7RA 5CHNA 3SQOH 3MRFA 4MAUL 4G9FE 5E6IC 5F9OH 1PZUB 5GGVL 4FQHA 2IH3A 4KKLC 1LP9F 4UT6H 1A6PA 4PJFE 4CJ1A 4P2CG 4FMFA 3QCTL 4WO4A 1CIUA 3Q6GL 1ZHKB 4U31A 2C7UB 4ZPVB 3FHAA 3PG2A 3HNTL 2HKFL 4PJIE 5FEBA 1UADC 4XI5C 2QKIB 5IHZA 1BIIB 3IDJB 2C3GA 4P2QA 4EKXA 5HHNB 4NNYB 1CD1A 2EDLA 1UA6L 1RFDL 2OL3A 1OTTD 3HUJE 4WTZA 5L0QC 3PL6A 3SDAD 5DD0H 4CL7A 2XXMB 3GSNB 4YO0A 4IOFD 1FL3A 3BEWA 4QRPE 5DK3A 4NQDA 1X5IA 1SYVB 3RVXD 1F90H 5DURD 3LIZL 4NOFA 2X1XR 1CLZL 4XBGA 2QEJA 3GBNL 3EYVB 3JZ7A 4HF5L 3SJVB 1KTDA 4D8PA 3GHBH 5FYJU 3ULUH 4WNQA 1T1XA 4IM8A 1JL8A 1B4RA 1I3GH 1YECL 2ADIA 2H41A 1G0XA 3VCLB 4DGYH 1S9WA 4JANA 1RJLB 4OZIA 1VFAA 2A1WL 3RVWD 3VWJA 1IC5H 1MNUH 2RGSA 3MV9D 5D4QA 2HT3D 1CFNA 4GS7B 4LLYB 2ITCB 5SX5H 3KPQA 1EFXB 2CD0A 3MODH 3U46A 1W72H 4K94L 5EC2B 5C0NC 4E42B 3SQBA 5F7DB 3L95A 4HMDA 4XAWH 4HWNA 4NQUA 4P2RB 4YAQA 4ZNEE 1NGWB 4PRHD 1GZPB 3H9ZA 3KYOB 1U8MA 3U36B 4CADB 2C4XA 5I1GH 1A9BA 1IAII 3U0PB 2E6JA 2A6KA 4WWID 3HC3H 3RTQD 4JQXC 1V5JA 3T2PA 3MRMA 3L3OA 4CDGC 2VDLH 1TTUA 2R2EB 4ODVH 5FXCH 3TA3A 1WLHA 3PWVA 1XR8B 1JN6A 1JNNH 2GITB 3BZ4B 1YEGH 2CO6B 4PTUA 1R0AH 4UMGA 5HVGB 4WU5A 5FV2A 1EO8H 1MCOH 3T08A 4U1KA 3GSNH 1XFPA 2KKQA 3SBWC 4ZUUB 3EGSB 5FKAA 4ONHA 5KZCB 4LU5L 2XOTA 1VDGA 2VLKD 4HPYL 3CPLA 3H9SB 5D1XA 5DZOA 4O2FA 3BGFC 3TESA 2ZPKH 1J10A 1BJ1H 1YEHL 5F72S 5T5NG 9CGTA 5MEOA 1MJJA 3RVTD 2K7PA 1XGYL 1AGFB 3M8OL 4JG1L 5EO1B 4UQ2B 4NO2A 1P53A 1LP9B 1CGVA 1WIPA 1OAZL 1T20A 1JWUA 2OBGA 4GLRI 2I07B 3WDIA 2J8HA 1A3LH 3O45B 2MFNA 5BZDA 2X4QA 4YDVA 3DI2B 2LU7A 2C26A 5IFJB 3UDWC 2C4FU 3C08H 4X0KB 1A7QL 1S7RB 4OCLC 3RUGF 5HDLA 5FYKD 2CUIA 1A02N 3FT4A 4LCCA 3SY0B 4MWFA 4NKOA 3GJFA 1JVKA 2AKRB 2C3XA 2ZCHL 5L2KD 5D2NA 1LQSR 3REWB 2IALA 2ESVD 4PRBA 4CDHA 3O4OC 5CJOH 3HCVB 5I76A 2OJZH 1P4BH 2VC2H 1U42A 1U8HB 2AJUH 3MRRB 1NFDB 2CK2A 3VFVA 4RA0C 1GJIA 5GRVL 5I8EB 4H1LH 3NZ8B 4ZYKA 1XGUB 4L3EB 4LSSL 3KYMB 5F1SA 5HHVL 4R26L 4NWTH 3MOAH 4P3WA 3M1BA 1FZOA 3O8XD 3H8NA 2JIXA 5GJTH 3MV01 5BMFH 3U9PH 4E41A 1N59B 4KKBD 4Y1AA 3CUPA 4NC1E 2LU3A 2FLBT 3BDYH 3OKOB 1JUFB 3PP3H 1JPSH 1UM4H 4HX1B 2VDNH 1ETZA 4O2CB 1FNSL 2VAAB 1DL7L 4J4PD 4K7FB 1YYMH 5IB3A 2DQUH 1KG0B 4X6CE 4X98B 2F54A 5TQ2H 5EC1A 4AMKH 3EYQC 2XPGB 5GZNC 1UJ3B 3FTGB 4GQPH 3SKJL 3W2DH 1WAAE 1JGUL 2XG5A 5HGBA 4IMLB 4S1RL 1WCBB 3ARBD 4NQCA 2PW2A 4PJBF 5C09A 3U79A 1G6RL 1GH7A 2W0KA 1FDLH 3QDJA 4L8DB 4PPTA 4KH2A 3B5TA 3QDME 5J56B 1MIMH 5D5MF 1OB1B 2J12B 2BVQB 3ARQA 2WMPA 2YEZA 2NZIA 1UWEL 4X6DA 3BKCH 5I9QB 5L88L 5FM4A 3LKQA 4OTXL 4G8GA 1EXUB 3PUCA 3TIEA 3B8SA 2QSCL 5GGQL 2DM7A 5D70H 3EO0B 2EDHA 4QXUH 3D9AH 5IVXA 3AS3A 3GO1L 5J3HC 1G7MA 1FSKC 4PJ7E 1RJCA 4FQLH 2RCSH 5D1QB 5F88B 1ZEAH 3K81A 4GT7A 4KROD 4CMHB 3WHXB 3RZCA 3MLRH 3S96B 3KR3L 2X70B 4P0DA 1SBSH 4C83B 2KZWA 2APTA 3RL2B 2OCFD 3DURA 4YDKL 5IW1B 1BBDL 1EHNA 3MJ8A 3H3PL 5I2IB 4R7DA 1DFBL 1AGCA 2RJMA 4PYHA 1CTNA 5DUMH 5CEYB 4NHUB 4JRXA 5GGVY 4ZAKC 3SE8H 5HYQB 5E94B 3TNNB 4C56D 4PJ5B 1ZA6B 4J1UA 4KTYA 3VXMB 3CXHJ 3AS0A 4UIMA 1SEQH 1P4IL 5JDSA 3F7PC 1JGDB 5HVWA 2A0LD 4L8SA 4K7PH 1H15A 3KWWB 4JFFE 3QUMA 1EO5A 4NRYB 1RJYA 1IRAY 4WI9A 3Q5OA 2FJFB 5GS2D 5CGTA 4Y2OA 4OCXH 2IBZY 1CFSB 3LY6A 2WAHA 3QUKB 1MHHA 5HHPB 3IS0X 1FC1A 5KN5B 4D9QE 3WLWD 3RGVB 3X14A 4Y4FC 4JN2A 1CGUA 4JDTH 5INDA 2R4SH 3JV5A 3V5HB 1OAXL 3V4UL 1CQKA 1V8HA 1JYXA 1KNOB 4YHPA 2R8SL 2W9EH 1P7QA 2WV3A 3QUYD 3QIBA 2W9DH 3O6FA 4JO2L 5D7IF 4UTAL 5L2JB 4RNRA 1IGIH 4G6KL 1HEZA 4PRID 4KWUA 3TM6A 4G7YH 3K4AA 3D18B 3RIFF 3KPOB 4K8RD 2Z31B 3QFJA 4LSUL 3VFGL 4N9OB 4JR9L 4LLWB 5DFWH 1SJVA 1TQBB 3A67L 4OD2B 2BZDA 3QH3A 1MFEH 2HG5A 4FFZL 3EOTH 1MIEH 5E2WL 5T5NF 4U1NA 5ITFA 3FJTA 1I8MB 3N0PB 4JZNB 5AD0B 2LVEA 4E5XA 2ARJB 3MREB 3LRGA 1KCVL 1HHGA 2GHWB 1U92B 3L6FA 4F33A 1DBAH 3Q2CA 4QNPF 1R5IB 2X5PA 4HH8A 3GSOB 2WINB 1DUYB 3UTQA 4OUUA 3HB3D 2QLVB 3T3ME 2NX5E 4HS6A 1JP5A 2WBKA 4JM2D 5D5MB 1PKQA 2W0PA 3SOBL 3P3YA 4FG6D 3GI9H 3L7FB 3BD4A 4TRPH 2IFGA 3QIWA 2AJXH 2B20A 2BOBB 3W9DB 5LGHH 1ND0B 4AEFA 3VD7A 2UUDK 1NGZB 3SDXE 2X1WL 2HVJB 3TVMA 1JGVH 3VFRA 5JQHC 1IL1A 5C0CD 2VDQH 4RAHA 5CGMA 5DEGB 4PGCB 2XACC 3HFML 4LF3A 3AB0B 1EH9A 2E5EA 5HGHB 4Z7QE 4UT9H 4XNQA 5DK0B 4Z78B 3S3SA 1HHKA 5FYJH 4NO0D 5B39G 4JFHD 1ZA3A 4K71B 2AI0H 2R9HC 2VE6B 2JLLA 3GMMA 5D71H 4MA7H 5T3XE 2FIKA 3JTTB 2V2TA 4PJDE 4D2NA 4WV1C 1NCAH 3BWUC 3ZT5A 4P23A 1OAYL 3ARFC 4O5LL 3BWAB 3W11C 5I1KH 4BZYA 3VMOA 1HOCB 4HHAB 1ZHKA 2C7UA 2GK0A 4ZPVA 3PWPD 1K85A 4HWBL 3IDJA 2H6PB 1QSFA 4POZC 1MFNA 3RWDB 5HHNA 2EH7H 5B8CB 4YXLL 4LSVL 2A9MH 2R1XB 1GC1C 2XI9A 2D7PA 3FFDB 4OB5H 1IBGH 1F45A 2MJWA 4YFEA 3GSNA 3S34H 3AVEA 2HWZH 5D7JC 2WWMC 1SYVA 1YEJH 1GSMA 5D7IB 4JO1H 3V6OC 3HE6D 1F4XH 2DQCL 3OKDB 1U3HB 5I1JH 3HZMB 3MA9H 4OD3H 3LMJH 4OLUH 3SJVA 1P2CB 4UTBL 5I1IL 4JVPA 1FC2D 1NLBL 4PJFF 1IGCH 4OT1L 4KKCD 2WWKT 1U2CA 5JHDA 3LHPL 5E8NB 4QRRB 3T0ED 1MCWM 2VH5H 4KMTH 4EN3D 1RJLA 3DSFH 4W4OA 2I9TB 4Q9QH 5I1AB 1U3YA 1QFUL 4LLYA 3RU8H 2ITCA 2MHAB 4M03A 1EFXA 5D7SH 2HFGH 3OAYH 3QEGH 3LS5H 1NCNA 3H9HA 3Q5TA 5A2IH 1N5AA 4E42A 1DBBL 5F7DA 1ZTXL 1T5XB 3N1QC 3NCEB 2RAMA 2ADJB 4OM0L 4P2RA 4ONFH 3DBXB 1NGWA 1GZPA 3U36A 3KYOA 4CADA 1RZ7L 3U0PA 1IC1A 3MLZL 1CT8B 4KK5C 4MNQD 1TJIH 3MR9B 4NRXB 3G5ZB 1PX3A 2AJYL 1F02I 2R2EA 4MZ2A 1FFNB 5I73B 4FP8H 3FN0H 4LCIL 3P0GB 4YHML 1KJ2H 3T65B 5ALBL 3O6LL 1U9KA 25C8L 1NH6A 2GITA 1CZ8H 3BZ4A 4QXGL 4Y88A 3CMOL 3WNMA 4X9FA 1S9XB 4ZS7H 2VXSL 2VXTH 2E7HA 1FV1A 1W0VB 5T5FH 5FO8B 1NMCC 2ARWA 5C3LD 2JCCE 2NY5H 5I1EL 3G6JB 2YA0A 1KENH 4PJ9C 3EGSA 4ZUUA 4D0BA 1K6QL 1NGPH 1LO3H 2P5EB 3PQYD 3SE3C 5BZWB 5B21A 4W6WB 3THML 3UTSB 1BEYH 1T1WB 1U8LB 3LEVL 4FQ2L 4KVCL 2F19H 5D96C 3T0WA 4OZFG 3T0BA 4LHUD 3QCUL 5EZIH 1AQKL 2QQNH 4TVSa 3RWGB 3SGKC 1CGSL 4XNMB 3W0WE 4NFCA 3ZE0E 4M7LL 2V5RA 3N50A 2PXYB 1IGMH 1WV7T 1RMFL 5IHUH 5DMGC 5GIRB 3S4SG 2DI7A 5EO1A 4UQ2A 1MRDL 3W82A 5L8JB 4U1JB 1LP9A 1OD7A 1X4ZA 2KUTA 3WIHL 2C9AA 1YC7A 2I07A 2DN7A 2CGRL 3FFCB 4JN1H 5TFSH 1CDJA 3O45A 3C09C 1I9RL 1GPOL 4LLDB 2DKMA 1KFAL 3KS0H 5IFJA 4ZTOL 3BRGC 4KY1H 3PGCB 1INEL 4XX1G 1DP0A 4X0KA 1S7RA 1JE6A 2AJVH 2CJUL 3FQRB 3ULVF 5ITBH 3AGVA 3SY0A 4OD1H 5HI5D 1HHJB 1YA5A 4YBLC 2A38A 4J23A 5IB1B 5E03A 1F6FB 1MFCL 3WFCL 1A3QA 2QHRL 1T0NB 2X10A 3C2AH 4M48L 1SJHA 3QDGE 4GQ9L 1TFHA 1YN6A 3X3GL 5GGSY 3B83A 4PGDB 3MSPA 2AQ1A 3HCVA 1RULH 2O5ZL 4Y4HB 5IBTL 2BSSB 1DQMH 1JFQH 2YD4A 1VENA 3D3VA 4G9FB 3NIGE 3FMGH 1JWSB 5DD3H 1U8HA 1J05A 3MRRA 1NCTA 1NFDA 1BBJB 4OJFL 5ALCL 3V5KA 5GXBB 2G60L 3RX8A 5I8EA 2V7NB 2OL3L 3NZ8A 1XGUA 4L3EA 4G6AD 5IEHB 3QNXB 3X11B 1TZHB 3KYMA 2ENYA 2JJSA 2X89A 2YD5A 3VWKA 2CXGA 5IM7B 3FRPG 4GKZB 5HTSA 3TO4C 5HYIA 1E6JH 5BS0D 5D93C 4DZBB 3MLUH 4KVNL 1OQXA 1MRFH 1N59A 4ODSH 5DJ0B 3UC0H 3OKOA 4JRYB 1JUFA 2VDKL 3IAGC 4HX1A 4QGTA 5F9JB 3I6GA 4O2CA 2VAAA 4QRPB 2UVFA 3NH7L 1G84A 4F7CB 1KG0A 4X98A 1ZANL 1H9VA 3GMPB 4Y5XC 3CFKB 2XPGA 2YPLE 4ZS6D 3K2MC 1UJ3A 1KF9B 4ETQB 3FTGA 5TJWK 1QO3A 3UJIL 3QUZD 2YD9A 1QRNB 4K9EC 3T2OA 1HKLL 1T3FB 1N7ML 2X4UB 4F9PA 1J8HD 4I3SL 2PETA 3C6SB 2FYYA 4JLRA 3RVVC 4AL8L 2EDRA 1B6DA 4J3VA 4I0PB 3QWRA 4TPRH 2BVQA 4JRWA 1HH9B 3DVFA 4CN1A 1K2DB 4XCCH 3KHOA 1IKNA 1NGQL 1KEGL 4XVSH 2HA1A 5CP3A 1EXUA 1WT5A 3C6LB 1AD9B 2P43B 3EO0A 3DMMD 3BKJL 3A6OA 5MHSE 4M61B 2HLFD 4X6CF 1ZXQA 5D1QA 2D03L 2VDOH 4FQIH 4YHLH 5BVPL 3WHXA 3S96A 2X70A 4C83A 1D3CA 5IWLC 1V3KA 3B9DA 3RL2A 1MREH 1CK0H 4IDLA 1PX4A 1A64A 5I2IA 1K3ZA 1KELL 1C16B 5HYJB 1X5HA 3MYZA 1YEDB 5DO2C 4RMWA 4NHUA 3BN9D 5ADPL 4RX4D 5HYQA 1OTTC 3R1GH 5E94A 3TNNA 4HSQA 1RZKH 4PJ5A 1ZA6A 2GW5A 3FO0H 5CSBA 1U6AL 3GHEH 2YXFA 1I7RB 3VXMA 3KPNB 1FGNH 5C08A 5FUOH 2F58H 1U8IB 3OHXA 4F7MB 4JHAH 1H3VA 5JTWA 1AXSB 1DDHB 2J4WL 1JGDA 3V52L 1N3NA 1T03L 1E28B 1YNKH 3E2HB 4NRYA 2D0HA 1NC4D 3U7WH 2GJ6D 2FJFA 4R96A 5DVMA 1PQZB 4N5ED 1JNJA 3B9KC 3QUKA 4V2BA 1C5CH 4HIXL 4X4MA 5HHPA 3O6KH 4LSQL 5KN5A 4R4NC 3QXAB 1RZFL 4QWWD 3RGVA 4RGOH 3EO9H 5HYSG 4P57B 3V5HA 4UNTA 2C3VB 2DLHA 1KNOA 4KKAC 3H0TB 1MQKL 4L4TA 4GLRH 3OMZA 1BAFL 1HCFX 1J0KA 2QSQA 5L2JA 5AYUH 1LGVA 4O9HL 2E7MA 3ZHKA 3SDCC 4IJ3C 4WO4D 4GAJL 1XGPB 1CDGA 3D18A 5DA4A 1J5OH 3KPOA 2Z31A 4Y4KB 1RIVL 4WGWB 4KMLB 5B39B 3T2NL 4V1DB 2EXWD 3ARGB 1EHXA 5D2LF 4KJWC 1DBJL 3K8LA 1P4LB 4P4KA 3BJ91 3FN9A 4JZNA 2ARJA 3MREA 3AY4C 1U92A 3KAAA 1R5IA 1M1SA 4U6XA 3ULVH 5T33L 1X5ZA 4M6NH 4NQDD 4PJEE 2WINA 1DUYA 4YPJA 4MDJB 2FHFA 4R2GD 4ETYA 1PBYA 3NACL 4I48B 3LEYH 5D5MA 3RA7H 1G7LB 3L7FA 2XTJE 1NJ9B 2YD8A 1DVFC 2ZUYA 3DV6B 2BOBA 5E2JA 1ND0A 1MCQA 1BM3L 1NAMB 1NGZA 5HYEA 3OG4B 3DLQR 1CVRA 4J3OC 2D9QB 4N0YH 4Z18A 2NY3C 3L7EA 1IM9B 3MACH 3BD3A 5DEGA 5EU3A 4HPOH 5CP7A 5IV2A 4FHBD 4PGCA 1KEMH 5HGHA 4JFYB 1KPRB 1AD0B 4QHMB 4ACPA 5DK0A 3U82B 1U8JA 4XMKL 3X3FH 2EDKA 3BN3B 4MAYB 2VE6A 2E9JA 1UEMA 1VEPA 2YOCA 1ITBB 3OAZK 3T3MF 4O02L 4U1SB 2UZIH 3UMTA 2E6PA 3HC4H 3B6SB 3TA3D 3BWAA 2DM3A 4QT5B 2CMRL 2DQIH 2MQ0A 1YEEL 5JW4M 1AGEB 5EU4B 3AC0A 3EJJX 2ATPB 4A6YB 5C07D 3FRUB 5FB8B 3VXTA 4KK9C 5BW7A 2O5YH 2H6PA 2NLJB 3U4AA 2PCPB 1KJ2A 1AR1D 5B8CA 5E6YA 3ZDXE 5A40E 4Z7QF 3NBNA 4F15B 5D1XD 3TCLB 3FFDA 2NY0D 3ABZA 3DYMA 4LQ1A 2FX7H 3QI9A 5IJVB 1BJ1J 2N1KA 3MLSL 4LCUA 1FN4B 5L7XL 2FGWH 4PJDF 3VG9B 5F9WC 3LPGA 5D7IA 3M45A 7FABH 2R0ZL 4KKBC 2BRRL 1H5BB 3P4MB 3OKDA 1U3HA 4HIJB 3HZMA 2CLRB 4IS6B 1P2CA 3QUML 1CDCA 3VFPB 4OQ1A 2E7LC 5MI0C 2YD6A 1J1PL 3FB7B 4X80L 5T3ZL 3QIUC 1N0LA 5E8NA 4QRRA 2VN4A 1R5WB 1INDH 5DRWB 4NGHH 4MJ2A 3LSOB 3MUY1 4U6TA 3C9NA 1JMZA 4JFFB 2I9TA 5I1AA 1WSST 5D2LB 2MHAA 4P2OD 4MD0B 2H2SC 1QRKA 3QT2A 4JJHA 4Z8FL 3S4SB 4HEPG 5ADOH 5IK3B 5JW4R 1GHFH 3GMQA 2Q20A 4LSPH 4GKNA 3WIFB 4OCMC 5CD5C 2W65B 4IRSA 2ADJA 3HHRB 2WIIB 5KW9H 3KLSA 4K94C 3MJ6A 2NMSA 3SQOL 4KZEL 5MENB 1CT8A 1P69B 4A6YH 4XAKE 3MR9A 1Y0LA 2P5WD 1EJOH 3EZ8A 1KBGL 1MCFA 1FFNA 3CX2A 3P4NB 5E70A 5KSBE 4AH2B 4G8EB 2E9BA 5J6HB 1S9XA 3NPSB 1J8KA 5IJKA 5IVZB 1W0VA 4X4YB 1UEYA 5FO8A 1WZ1H 3D0VB 4XP4H 4DQOH 2JIXD 4PRDB 1Q8MA 1D6VH 2NY4C 4Q74A 1UG9A 4TNVK 4DTGL 4Y1AD 3KPLA 2P5EA 1F58H 1KTLB 5F7FA 1FG2B 4X7DC 1T89A 4LPUA 3UTSA 1T1WA 1U8LA 2NYYD 4WI6A 3BYTA 1YEIH 3RWGA 3L5HA 4NN5C 4XNMA 4U3HA 4NZRH 4P5TC 4N8VG 1F90L 2PXYA 3OJDB 1KIPB 4J2XA 4G42A 3MPCA 4LSDA 3FQTB 1PY9A 3MX0A 4KDWA 4NQCD 4U1JA 5D72H 5C09D 2JJWA 4BH7B 3FFCA 1QLEH 2GTWB 2VOTA 3QDJD 1PSKH 3V5DB 3K7UA 4HKJB 5EUOE 1MNUL 4YK4B 4X5XB 1XR9B 3BEVB 4C58B 1HWGB 2JCCF 3BSZL 3TF7C 3WJLA 2QADC 3D1MC 3FQRA 4HMCA 4Q9RL 1VACB 3C2SA 3VRLE 1HHJA 4XAWL 3V4VH 3D39E 5IB1A 2FHBA 1BFOA 1T0NA 1FFOA 3OBAA 4F7EA 4ZOCA 5I1GL 3QUYC 1RUKH 1EPFA 5EORH 3ZE0F 4LASH 2UYLB 5ESAA 4PGDA 2VDLL 1YEFH 5E95B 4G43B 4Y4HA 1OP3H 3RZCD 1FL6B 1KLGA 1S7XB 2BSSA 4UDTB 1IKFL 5F6IC 1FHGA 4G9FA 1JWSA 3MBEB 3MUHL 2AABH 3DWTA 4PJFA 3TJEH 1BBJA 2F8OA 4Q58C 2V7NA 4GG6E 1RUMH 5FM8A 5IEHA 1NL0H 3QNXA 1WZLA 4NJ9L 3X11A 1TZHA 1EO8L 4JRXD 5KVDL 3SCMB 3GSNL 4PFEA 4EEEA 3OJ2C 3O9WC 2Z91B 3EDFA 1I9IL 3UYOD 3RDTC 5GS0H 3MV8B 35C8H 4MJIE 1QOKA 4JRYA 2DD8L 3WS6C 4RRPG 5ERWA 4AG4H 4H0GA 3EOBB 5GRUL 5F9JA 3PGFL 3I2CL 2ZPKL 1T83A 4S2SB 4QRPA 1MLBB 4U0QB 1EK3A 2OQJB 5KJRH 4F7CA 1CXIA 3CFKA 1JF5A 1AE6H 2D0GA 1WBXB 4HCRH 5E2TL 4ETQA 2BVPB 3NIGF 1BIHA 4WFEE 3T0DA 2K3TA 2BMKA 2X9YA 4KI5D 1KTKE 1MCWW 1QRNA 5ABDE 3AFLA 2VZ3A 2BFVH 4XTRD 4PS4L 1T3FA 1U93B 2X4UA 4OI8A 5IROC 3BT2H 4M7LT 1T22B 1RK0A 1AXTH 1OPGH 3C6SA 1OTUD 1QD0A 1TDQA 4OGYH 4XZUB 4FXGB 4I0PA 1NMBL 3UTOA 3WDJA 4OF6A 5T3XH 3WNPA 5INCB 4RDQF 3WHE0 5AZEH 1HH9A 2CDFB 3QFJD 1MSPA 1K2DA 1QQDA 4P49A 4ZO9A 5HVHC 5JHLH 5JPNB 4YHZL 3RFZC 2X6MA 5LBSH 4ZNEA 5BQ7A 3C6LA 2BCKB 4B0MM 1AD9A 1N5YH 5JMRA 1ZVHA 2BOCA 5HYSB 2FZ3B 1WWCA 4M61A 4V2CB 5A3ID 4I77H 2OJZL 1JNLL 3U7YL 3BRDA 3L3DB 4CU6A 1T0MB 1Q38A 2NY2C 1B3JA 5DC4B 1HZHL 2JF1A 3I02B 5CINH 4YUEH 4QRQA 2DQFB 1I1AA 5C0AE 4FZ8H 3E8UH 2WQ8A 3RAJL 5H37G 4TSBL 3RP1A 1C16A 5HYJA 1YEDA 4QTIH 1BD2E 2N7BA 5SWQA 4FQXB 5GJTL 3VFTA 3H42L 4W81A 3QIWD 3VGHA 1U8NB 4BELD 5DR5L 3FZUC 1VERA 4EBQL 1QSZA 1I7RA 3BDYL 3CFEB 3QBTB 5EO0B 1JPSL 1UM4L 5JR1L 2C1OA 4LCWE 2VDNL 1U8IA 2VLJD 4ONGH 4F7MA 4F9LA 1AXSA 1DDHA 5DC0A 4G6FD 4G3YH 4OFYA 3DETC 4GRLA 4X7SH 3WKMH 3HE6C 3ULUD 5E8EB 5TQ2L 1MHEB 1UENA 1BVZA 2IEPA 1WJ3A 1PQZA 4LP4A 3W2DL 4HBQA 4OGXH 5LWYL 1MRCL 1ZS8B 1TENA 3VA2C 5HSFA 5JW4N 1I9JL 2G5RA 5FHBH 1MHCB 4LEOB 3QXAA 4B50A 5FUZH 1RUQH 4L8CB 3BUTA 1FDLL 3VXRE 3TT3L 1D5BB 3BPNC 4P57A 1T66D 4QEGA 2APFA 4NZTL 4RWYH 4TUJB 4FMKA 4P23D 3RL1A 2BSED 4RAVB 2HMIC 3H0TA 1KCSH 1MIML 1MAKA 5DZNA 4M9OA 3FO2B 3JV4B 4GRWF 1JHTB 2YS4A 3VXSE 5J1AB 4GOSA 1OW0A 1XGPA 1EMTH 5GRZA 3BPOB 1FJ1B 4OLXH 1DN0B 4AIOA 1ZLUK 5DHVB 5B39A 1OT1A 2IC2A 1QSFD 2D7TH 3D9AL 4V1DA 4N0UE 3QDGB 4JHWL 2LABA 4TYUA 1CIDA 5JIPA 1CBVH 2RCSL 1MCNA 1N8ZB 1Q9KB 3ARGA 1ZEAL 1P4LA 3JV0A 3QR2A 4LPYA 2XN9E 4AY0A 5BO1H 1H8NA 3OB8A 2K9UA 1HIMH 2YN3A 4FNLH 4X99B 4OLZH 1P5VA 1F4WH 4LLUB 4M1CC 2XQBH 3EJYC 5E1AB 3VU2A 4MDJA 4AIZB 2NY7H 1ULVA 5EUKA 1T1ZB 3SDAB 2DQHH 1JZ4A 4I48A 1EAJA 3SJVD 1CYGA 2RIKA 2XWBB 1N0XH 2AEWA 4GSDL 5CGYC 1NCWH 5IP4A 1SEQL 4P9MH 5JHDD 4KRPC 4WHTA 1TQCB 2DMBA 5DURB 5F71A 4XNUH 3MV7E 1IM9A 4K7PL 1GVIA 3HZYB 4DZ8A 1UYWH 4OSUH 1X5XA 4X6CA 1MWAH 2CXKA 3LRSB 1QA9B 4JFYA 1QYGH 1KPRA 3PNWB 1AD0A 4QHMA 2WIMA 2BXYA 1FORH 3UYPA 2AGJH 4P2RD 1WBZB 4NHCH 1IAOB 4F7PB 2R4SL 2BVUA 1A7BA 2HTKD 4PJEF 4OFDA 4NRZB 4OBSA 4MS8C 5CEXB 1ACYL 2EDQA 2C3HA 3IJHB 1C5BH 3B6SA 5DTFB 2XKSA 3V7AE 3G5VB 5F7EH 4G7YL 4QT5A 4I4WB 3RTQB 1AGEA 1RK1B 5EU4A 4Z7UF 5HDBE 4IRZH 1IT9H 2ATPA 4LLQB 4NO5B 4PJGB 4A6YA 3AU1B 3FRUA 5FB8A 2KL6A 4UI2A 5GZOC 1MFEL 4HJ0D 2PCPA 3JUYA 1CLYH 3IU3B 4RQQA 5DEZA 4F57H 5HHOE 3VD4A 4FXLA 4RFOH 4WIQA 4Y16D 2OS7A 3TC9A 1U95B 3TCLA 1RZIB 2ZWLT 1DBAL 4LPWA 2ERJB 3V6OE 5IJVA 3NTCH 3U4BH 4B41A 2FH6A 3OF6A 4U3XA 3NAAH 4UU9A 2VLKB 3FAXA 4X8XA 3D2UB 4LVEA 5D9SB 4M7KL 1H5BA 4GRWB 2UZYB 2Y7QB 4FFYH 1MH5B 3ARTA 3P4MA 4ORZC 5CUSH 5D1ZA 5D7KE 3O2DL 4HIJA 5I75C 4IS6A 5LGHL 4OCRL 5ESQB 3VFPA 4YFLI 4H8WH 4ZOEA 3LKSB 1JGVL 3TH2T 3FB7A 1HNGA 2IMNA 4XC3L 4B5EA 4HWEL 1EUUA 5A16B 1A0QH 1R5WA 5DRWA 3KS0J 4JPVH 2AEPL 4BH8B 3H6JA 4JFFA 4XVUC 4HFUL 5D2LA 3S6CA 2R2CA 3GI8H 4MD0A 2YBRB 4PR5B 4XVJH 2YMXH 4S0TD 3S4SA 3UBXI 3WFDL 5FYJL 3WIFA 2ZUSA 3EIFA 3HS0A 2W65A 2AI0L 2WIIA 4PJXE 3S5LG 4HUWB 4MA7L 5JXAL 3U83A 1D5MB 2H1PL 2OR7A 4M02A 5IVNA 4R0LB 1NCAL 4F37F 3HR6A 5MENA 5C0RH 4R97C 3VE0B 4ZXBC 3D3VD 1LO0H 2R1YA 1K9TA 1NMAL 3HE7A 2ESVB 1BF8A 1IFHL 1Z6JT 2EE3A 3P4NA 3MXVH 5KTEH 3BQUC 3UX9B 4AH2A 4G8EA 2J8UE 5J6HA 2I5YL 2X89D 4YEEA 3VWKD 3ZYJA 4MYWB 5IVZA 1KYOK 5M7QA 4I2XE 3HPJB 4WUKL 3D0VA 4LHUG 1NBVH 1DSFH 4PRDA 1Q1JH 4M5YH 5BJTB 4FQ1H 3CDGB 3MA7B 5I74C 4C59B 2JELH 1KTLA 3Q1SH 1FG2A 5AAWA 2E27L 4DVBB 3IF1B 4N1HB 4BUHA 3O8XB 1D9KC 4JFED 4OIBA 3ZKSD 3S34L 4KGJA 5KVMC 4GRWH 3CFIC 4WEUD 4JG0L 3GKWH 2UWEE 3LD8B 4N0CC 2EDJA 2HWZL 5KOVC 3VGDA 1AO7E 1YEJL 4P46C 3UAJC 1FBIH 2FX8H 4JO1L 3VDCA 3AUVA 4KK6D 4DW2L 2MQCA 2Y06H 3OJDA 1KIPA 1JTPA 1U91B 4BA8A 2FL5B 1F4XL 1F4YL 5DMIH 1A22B 4NT6B 3FQTA 3MA9L 3LMJL 4OLUL 3LZFL 4TQEL 1IGCL 3ARDC 3C8HA 4U0RB 4KAQL 3IDUA 4Z7UB 4BH7A 4YC2B 4EI5D 4BKLB 5KSBF 2AJZB 3V5DA 3TZVC 3UTTE 4OFKA 3DSFL 4HKJA 4MVBC 2J2ZA 4X5XA 4Q9QL 1XR9A 3ARBB 5EBLB 1A2YB 3UPRB 4CN4A 3VG0H 1GGCH 3BEVA 2FB4H 3QEGL 3MLXH 1VACA 3LN5B 4KQ3L 1ZSDB 3B43A 4WEBH 5GRVK 3WEXA 1FVDB 2H3NB 4XBEH 3F8UB 3U0WH 4MSWA 1Q72L 2ZOKB 4LVHC 5I1HL 4PJDA 4PJCF 2VDPH 5D1QD 2AK4E 2BP3A 3MOBL 4UV7H 1XGRB 3NZHL 1FL6A 1S7XA 2Y36H 4UDTA 1CG9B 2DI9A 2R23B 3FN0L 3PHQB 1GXEA 3TBVA 3KYNB 3NFPB 2W60B 2VISB 3BIAX 4LAJH 4GKSB 5EUOF 3SCMA 3Q3GB 2H2PC 1HK6A 5FDWB 4J6RH 2NY5L 5DT1L 1KENL 3PL6C 1NGPL 4WFHE 3VXMD 2IJ0C 2FEEI 3MV8A 5C08D 1J0HA 5FOBB 4I1NB 4HD9A 5TPWH 3VRLF 1JZ7A 3EOBA 4APQA 3ESVF 5EZIL 3MNZA 4C56B 1KC5H 3ARPA 4G9DB 4S2SA 4J12A 1MLBA 2EDBA 4UBDD 1U8OA 3B3IA 5FECB 3VI3E 2PO6C 3IDIA 3B9AA 5IHUL 5KVEH 4JCMA 4K3DL 3OKYA 2LTQC 3HNSH 1IGJB 3P2TA 4RGNC 2HJKB 1WBXA 1DLFL 3NGBC 4GUPB 4U2YA 1JPTL 3MNWB 4I0KA 3RJQB 3VRIB 2UY6A 2VR4A 5TFSL 3VWJC 2QQKH 2FJGB 2JTDA 2PYFB 5IGXL 2VLLB 1DBKL 4GG6F 1OARL 4MJ5B 1U93A 2NTFB 4CMMB 4LLVB 3EJZC 3NN8A 2UUDH 4L4TD 1LDSA 2EIBA 4RAUB 1T22A 4UNUA 5L8KB 4XCEB 1NSNH 5MEPB 4TULH 4XZUA 2IQAB 4U1GC 1BQHG 5ITBL 5INCA 2VXQH 2CDFA 2Z31D 1EERB 3LDBC 5JPNA 3G6DL 3NIDE 1Q0YH 4K7PY 3C2AL 1N64H 5HHME 2BCKA 1A3RH 3NFNB 1A6VH 5CWSB 4P4KD 1QVOB 2F5BL 1JFQL 3L3DA 1T0MA 3WSQL 5DD3L 2ZG2A 4K23L 1PG7X 3TV3L 2BVTA 3I02A 1VEMA 4PG2C 5F9AC 2MWCA 5LJYH 5E5RB 2R56H 2DQFA 3HKFA 5KSBB 1BVLB 4P9HL 3T0VA 4P4RB 3SGEI 1E4XI 2X44D 4NQXB 5JO5B 5TH2B 1CLOL 1E6JL 3SPVB 4FQXA 4XPTL 3IDNB 3SHSA 5I30H 3BGFB 8CGTA 1PVHA 1T4KB 4ODSL 5DQJB 3CFEA 5EO0A 5EA0L 3QFDB 1VFBB 1RZ8B 4Y2DB 1DLHB 3C5ZC 4YE4H 3F65A 4JM2B 1AQDB 5DVKA 3I9GH 1SM3H 3IAQA 1URLA 4PJCB 5C6WH 1XIWD 4LRIA 4FFWD 2IH1B 1JPFB 1S78D 3OKEA 4JE4B 4K2UL 4ZO8A 4RFEB 1Z0NA 3HI6L 3QRFM 3MV9E 4WHYH 5C0CB 2PTTB 4PJ8C 1WFUA 3X13B 3EDDA 1ZS8A 1MHCA 1F5WA 1QFWL 4HWZB 4LEOA 3WLBB 4LIQL 2XXCB 4XHJC 3BD5A 4L8CA 2FBOJ 1D5BA 2UY7A 2ICES 3HLAB 4TUJA 4RAVA 3GFUA 3ISWA 1KULA 3RJDA 1AI1H 1MAML 1ONQB 3GSUA 3PWNB 1JHTA 1YPZF 4KK8D 4EUPG 2EDFA 4OCSH 2HT4D 4GAGL 1JTTA 4FXKB 1FJ1A 4XVSL 2AERT 4NCDA 1DN0A 1QFHA 3DGGB 1BWMA 3M07A 5GISH 5DHVA 3ZTJH 3MLVH 4XVTH 5EDXA 1JGEB 4HK0B 3A6CL 4KDTC 3ZDYE 3WFEL 3QDGA 3S36L 3L1OL 1N8ZA 1Q9KA 2VDOL 4FQIL 5H8DA 2IWGA 3PWPB 4YPGB 5J13C 1VPOH 1E6OH 4Q97A 3MGAA 1MREL 3QI9D 4OM1H 2OLDA 3WO3B 2J8OA 4U6HB 4HAGA 4I8DA 5E1AA 2P48B 2BHUA 4ODHH 5L8LB 5BVJB 3ZL4L 1T1ZA 3EHBD 3SDAA 4IBLT 4PJAE 2NTSP 1I7UB 3WNOA 2XWBA 4MA1C 1A1MB 3MRGB 1FLRL 3FONB 2F58L 4TVPL 1UT9A 5T1DH 1CU4L 3VFOB 4QRRD 5FHAH 5TF0A 1LEGB 4NSKB 1OGTB 3HZYA 4QRTB 1UKQA 1CL7H 4XWGH 3P77B 2LV4A 3IDYC 4BFGA 4PLJD 2J7LA 3N9GL 2H8PB 4PRAB 3LRSA 3T0EB 1QA9A 1SMAA 5GGSB 2X4PA 2JKXA 4XP6L 4UOW0 3O6KL 1JPST 3QO0B 4IRSD 1ES0A 4UV4H 1IAOA 3TIDB 4JVUA 4F7PA 3SDYH 1WEJL 1GGUA 4YDIH 4OCWL 4Q2ZB 4YWGH 1QBMH 2CUMA 5CEXA 5SWSD 2D4FA 3VXPB 4RCAA 4M1DH 3MLTB 5D6DC 4QKXB 4XPFH 5J12B 2VABA 3IJHA 1FAIL 1CFQB 3ILPB 1WFOA 3SDDD 4R3SB 5DTFA 3G5VA 1N6QL 4RMTA 2EDXA 3B2VL 1J5OL 4I4WA 4JZOA 2MKLC 3RTQA 1FSKB 4LLQA 3MRBB 4NO5A 3AU1A 4NN7C 1O7VA 1U8PA 2DTMH 2WW8A 3QO1B 2RR3A 1UZ6E 4LDOB 3S5LB 5ETUB 5IFAH 3IU3A 3LH2H 1L0QA 3MRCB 5FO7B 3UTSD 1RUAL 1U95A 1JRHI 3GNMH 1CICD 4OF0A 1B9ZA 1RZIA 4JGJA 5ICXB 3RGHA 3HRPA 5D7LD 1OGAB 4YFLF 3ULVL 1Q9WB 3DTXB 4M6NL 5FYLL 4DWHA 5C0AB 2VUYA 1IGFH 3PQYB 5DLMH 1Y18B 3H9YA 2PXYD 2VLKA 4BSWB 1BD2B 4MXQC 3DUHA 4RGMC 4O4YH 3NFSL 3TN0C 5IG7B 3R8QA 3D2UA 2E3VA 4M7ZC 5D9SA 4LHUB 3BE1L 2M1KA 2EKSB 1H0DB 2Y7QA 3OJMB 1YPZB 1MH5A 2J6EH 5HVFB 3KXFE 3FFCD 5ESQA 5JW4Q 1X5YA 5EO9B 1T7VA 3LKSA 5HDBF 4QY8B 4KRNA 2M2DA 2FD6L 1J1XL 3JSSA 3QWOB 3EOAB 1OCWH 4BH8A 3FN3A 1HXMB 1WVZA 2X9XA 4R4BB 5C6TL 3LAFA 1BFTA 4TOYL 5B3NA 2YBRA 4PR5A 3GBML 3FB5A 3VW3L 2P8PB 2RFXA 2VTFA 3WJJC 3X3FL 3DHMA 2O5XL 1TZIB 4ESKA 2DQGH 4ENED 5HGGS 4UQ3B 1XF3B 3VH8G 4HUWA 3QIBC 3O6FC 4H20H 5J06A 3IDXH 1D5MA 2VLRE 4I5BB 1SJXA 4R0LA 1EZVY 3IFLH 3NCYP 3QG6B 2EKJA 4GJTB 3HC4L 4G9FD 1MFAH 1JMXA 2M8XA 1X5FA 5HDOA 1I85A 4Q6IB 2APWA 4LVNC 3CK0H 4JFZL 4LRNL 5DS8B 1KSRA 2CKBB 4HC1H 6CGTA 3ARED 1UACH 3GIVB 3AMLA 4JGMA 5IQ9B 5DVLA 2AEQH 5FFLA 3L9RB 3HPJA 3ARSA 2FATH 5BRZE 3R0NA 3C8KB 5DUBB 3V95A 3JUZA 3CDGA 3MA7A 4ZOBA 2ADFL 2OXHA 3L5WB 3DNKA 4DVBA 2ZUUA 3ZKXB 5HI4D 3IF1A 1C8PA 2CIKB 4WUUE 2Q1EA 4YXKL 3O8XA 2FX7L 4M8QB 2DRUA 3MRPB 5BS0B 4QRPD 1OSZA 2HN7B 4MNHB 4LNRA 4OZHB 4WWKC 5KSUB 2GUOB 1NAML 4XNYH 1F00I 1QNZH 2OP4L 1U91A 7FABL 2FL5A 4G8IA 7CGTA 3IDGB 4NT6A 4J4PA 5E56A 1MI5E 3TVMC 5K9OB 1NBQA 3OV6A 3BW9B 2C5DC 4Z7UA 4BKLA 2AJZA 2J8UF 2VZOA 3BVNB 3EOYG 5IOPB 1KUMA 3W39B 3UPCA 1KJMB 3QUZB 5MP6H 3ARBA 3BP6B 5EBLA 2HTLD 3UPRA 1SJEB 2FX9H 5DI8B 3PDDA 4LEXL 2F74B 4KTEH 3L5XH 5HPOA 5H94B 3OJVC 2J3SA 5ADOL 2ZG3A 3LN5A 5LQBH 5LCVH 1ZSDA 1J8HB 3ET9F 3FQNB 2BSRB 3CLEL 1FVDA 1IILE 2H3NA 4MNGB 4KXZH 3IXAB 2UWEF 2ZOKA 5E6IA 1JGLL 5L6YH 5EZOL 3EYOB 4A6YL 3G04B 1BMGA 2CKBH 1XGRA 4TNVF 2EXYD 1EJOL 4PD4J 1D5ZB 1Q0XH 1CG9A 1H3XA 2R23A 3PHQA 1BQHB 4H26A 3DMMB 3GJEB 4M6MH 1I1AD 5EU6E 5DD1L 2F53E 2IQ9H 3KYNA 3NFPA 4XH2A 3UYRL 2W60A 4Q0XH 2VISA 3MJ9H 3HNVL 4GKSA 1WZ1L 3Q3GA 4DQOL 5FDWA 1KJVB 3KPTA 3TWCL 1VFOA 1VHPA 1F58L 3QHZH 2A2QT 4IOIB 1MY7A 3I50H 4QRUB 4RMQA 5FOBA 5GGTH 5D7JB 1HHIB 1YEIL 3CX5J 1AH1A 3C87A 3TO2B 1FYTE 4C56A 4GRLD 1AXIB 4G9DA 1SHMA 1GIGH 4NZRL 2G2RB 4XWOC 5FECA 4MQXD 1UWXH 1Q94B 4NFBA 3SE4A 1PAMA 5F7YC 4GUPA 2N4IA 3NCJH 5D72L 3LQMA 3I75B 1OP9A 3VRIA 1AFVL 2VQ1A 5C0JB 1X7QB 4DKAA 1QLEL 2FJGA 1LVEA 2PYFA 1NC4B 2R2HB 4W4OC 3PV7A 4I3RH 5J1TC 4GS7C 4MJ5A 2I26N 1RU9L 4CMMA 2GTZB 4X7FC 3HI5L 4RAUA 4YHNB 4XCEA 5MEPA 1AHWC 2DLFH 2AXGB 1ODAA 2PW1A 1B2WL 3KJ6H 2IQAA 3DPBA 3I6KB 2X41A 1SMOA 5CHNB 5HGDA 2P1YA 3CDFA 3V4VL 3MRFB 1FNGB 1J7VR 4JQXA 1A6WL 1KGCE 2FRGP 4KQ4L 2X4RB 2WP3O 2HRPL 3MMEA 1RUKL 2X1QA 1P9MA 5DJXB 4WO4B 5CD3A 3NFNA 2Y07H 3ARGD 3VD3A 2D3VA 2X42A 5C86A 2DQTL 5CWSA 3VI3F 1QVOA 5A2FA 1WISA 5IHZB 2OTUB 3OAZH 2QSTA 2B2XH 3F58H 2AABL 3ARXA 1GC1H 3VFSA 4AEIL 1CD1B 4EUPB 3QQ3B 1BGXH 1R3HB 1G0YR 2F8XC 4Y5VB 5KSBA 4LPCA 1BVLA 2OXGA 2BNRE 3BPCB 4NKQB 4P4RA 3FL7A 4NQXA 5CFHA 5JO5A 4YDJB 5TH2A 4TTDD 3SPVA 2Q3AA 1VFMA 4XPHH 1K4CA 3RBGA 5HDQH 2F5AH 4NQDB 1T4KA 3BX7C 35C8L 4XXDB 4M7JH 2DQEL 2FEDC 5DQJA 3RY6A 3QFDA 4R2GB 1BZ9B 4U49A 2JK5B 3TBTA 4EI6A 5IQ7H 1VFBA 1RZ8A 4Y2DA 1CCZA 1DLHA 3ARVA 1ZOXA 2HT2C 3NIDF 4JM2A 1AQDA 1XGTA 4XBGB 2Q6WB 3OKKB 1S9YB 4OUOA 3GJFK 1KTDB 3CNKA 3B9VA 4NOBA 4PJCA 1ZLWK 1T1XB 3ILQD 4WI7A 1CI5A 4H25B 2IH1A 2H32B 1AE6L 3L3IB 1JPFA 5DD6B 3VGBA 1VFAB 4RFEA 4UT7L 1OAKH 3LRHA 4HW6A 2PTTA 3S37H 4OV5B 2ZUVA 1S7VA 3NA9L 1KXQE 2NW2B 4GW4B 4L3CB 3X13A 2Y5EA 5ILTH 3WLBA 3UDWA 2BFVL 3C60D 3MLYL 3BT2L 3HLAA 1KB9K 2DYPB 3QDMD 5F1KC 4EQ2A 4Y19E 4RMSA 4U4BA 5C2BH 3VDAA 3ZKNC 4YBLB 4YHOH 1S9KC 1U8MB 1NUFA 1ONQA 3PWNA 4P59H 5T3XL 3ZE2E 2YKLH 1M05B 1A9BB 1T04B 3SGJA 3WYRA 1Z9SA 5F7WC 4HS3A 2WUCL 2ZUQC 5JIKA 4FXKA 3RKDD 1ZK9A 2Y5TA 2VSDA 5LBSL 3DGGA 3KLDA 5KANG 3QEQE 4GBXD 3RBSA 3I84A 5J7CC 1I3RB 4X7EC 1BFVL 3MOQA 5FM5M 3IU4L 3MZGB 5C07B 4MD5B 5CAYB 5I66B 3S35X 1FGVH 2VXVH 1KIUA 2JJSC 4FZ8L 1K5NB 3E8UL 5FKAB 4HV8B 4U6HA 4GG6A 2FSEA 4UAOB 4JO3L 1K8IA 3AAZB 5DA0B 2NR6C 4D3CH 4QTIL 5D1XB 5BVJA 2NXYC 3FCTB 2Z8SA 4YHIB 2YUXA 4EOWH 5D1ZD 1I7UA 4G5ZH 1A1MA 2LAAA 3MRGA 1J12A 3FONA 4NN6B 3QZWG 4ONGL 1C5DB 1BOGB 3VFOA 1ZVYA 5IKCA 1LEGA 1I4FB 3UO1L 4NSKA 1OGTA 4TSAH 2ADGB 2JJVA 2J6EA 2OSLA 4X7SL 3RWJB 4JFFD 3ZDYF 3QRGH 4QRTA 4XPAH 1UJ3C 3P77A 3QPXL 3BIBX 5I15H 4O2EB 5ICZB 2FNBA 2X4QB 4PRAA 3WXWL 3D25B 5DMJB 5EPMB 3OTTA 5SWZE 3QO0A 4D9QD 2DIAA 4PUBH 4F9PC 5FUZL 1HILA 4DJMA 4P2OB 5CZXC 4NFDA 3CDCA 3TIDA 4Z95H 2XA8L 3A6BL 4Q2ZA 2DTSA 1PEZA 3NMEA 1O0VA 1CE1L 5FUCC 3MLTA 1OP5K 5E99H 4M1GH 4M3KB 3HE7D 1JHKH 4PJAF 3OB0K 1CFQA 3ILPA 1T5WB 2O26U 4XP5H 5D2NB 3RPKA 1IKNC 4EDWH 3T0XA 4PRBB 1EMTL 1XAUA 4H1LG 1WT5C 5I76B 3T3PF 3OZ9H 2P5WB 3QO1A 3BYYA 3VH8B 5HHMB 5ETUA 1YY9D 2EECA 4R8WH 5I8KH 5K9QG 4HLZH 3MRCA 3QXTA 1QLRB 5FO7A 3MCLH 1XCTB 5ICXA 1EGJH 2A77H 2JIXB 2OMBA 5DQ9B 1OGAA 5C0BE 1KJ3L 1Q9WA 3DTXA 4XCYB 5C0AA 4PP1D 5GS0D 4Y1AB 3FO9B 3PQYA 1Y18A 2NY7L 4TNWK 2DQDH 4LOUC 2ZKHL 2NX5D 4BSWA 1UWGH 1BD2A 2BRQA 5IG7A 2ZSWB 5AWNL 4HUKB 1NCCL 5IB3B 2EKSA 1YPZA 1Y6NR 1A6TB 2BY1A 1U8QB 1E4XH 4P9ML 3SGEH 2PYEE 4GW5B 5EO9A 3UZVB 5HD8C 4WEMB 4K9EH 1YNTA 4M6AA 1YY8B 4LLMA 1UZ6F 3QWOA 3EOAA 1UYWL 5EWIH 4GRMB 2NY1C 1WBYB 4OSUL 1A9EB 4X4XA 5C09B 3TFKD 4XNZB 1HXMA 4QHLB 4R4BA 5AYQA 2MCPH 1QYGL 2CO7B 2X4NA 4Y4FA 3O11B 3RGVC 2P8PA 4M62L 1FORL 3KPPB 4NIKB 4LK4A 4OV6F 1TZIA 1MCIA 4UQ3A 4KJQD 3QUXD 5GGUA 1XF3A 1L7TL 5T3XD 3HPLB 2ZOLB 3QG6A 3LKQB 2CKNA 2UZXB 4QHUB 5F7EL 2CDEB 3VXSA 5DQDH 4YX2L 3IAPA 3GRWA 1QBAA 3NIFE 4N1EA 4IRZL 2VDRH 5DS8A 3VXOA 4ZTPH 2OYPA 2CKBA 5K9JL 4KJPC 2R0KL 2FR4B 1IC4L 4JQIL 3RZCB 1IQWH 1BF2A 4QTHA 3ZHDA 2IPKB 3L9RA 5DJZA 2YRLA 4F3FB 2EYTA 3C8KA 5DUBA 4R7DB 2ED9A 2R39A 4Y5YB 5KVGH 3L5WA 3MJ9A 1S7UB 4JRXB 4BZ1H 4OCYH 4APQD 2CIKA 3MTRA 4D9LH 1DE4B 4OLVH 4M8QA 3MRPA 1E27B 4KV5E 4L29B 3RHWK 5BS0A 2HN7A 3NTCL 4MNHA 2YPKB 3U4BL 3UPAA 3O2WL 1A1OB 5KSUA 1HQRB 3WFBL 1B4JH 1DVFB 2GUOA 2JJTC 3V9FA 3N1MC 1EX0A 5SX5K 1QKZH 5JDSB 4PJAB 4DGVH 4ZFFA 5E8DL 4L8SB 5DHXB 4RSVA 1YNLL 5K9OA 2GJ6E 4LKXB 3BW9A 1QR1A 1UM6H 3ROLB 4JAMB 1T7WA 3MROA 2GQHA 2YXMA 3BVNA 5HJ3B 5CJ8A 2CK0H 3AB0C 5IOPA 3W39A 3QUZA 2J1KA 3BP6A 2DWDB 3TYGL 3LN9A 1NQBA 3GI8L 5DI8A 5JUEH 2F74A 1FO0B 5H94A 3IB4A 3B4NA 1QBBA 3QHFH 4K71C 4DGIH 1R3IL 2WUBL 1J1OL 1J8HA 3FQNA 2BSRA 3EYUL 4HUUB 5CZKA 4N5UA 3ARFA 5CILH 3IXAA 5ESVB 1HHHB 2B5IB 4JREC 1KCUL 3DX8A 3QFJB 1X4XA 1E4JA 3EYOA 3G04A 3NVQA 1LO0L 1MAJA 4FFVC 5ID0B 4P2QE 1D5ZA 2BNQE 2HT4C 4NQSB 5B4MC 2OR8A 3LQAL 3QH3B 4XC1H 3LB6C 2HG5B 5EZJB 1BQHA 3R06B 3NABL 3DMMA 4X7CC 3UBXA 4XCFL 4U1NB 5BW7C 1DCLA 1A6ZB 5KTEL 2NXZD 5B22A 1A5FH 1KN2H 3BPLC 4GAYA 1TTFA 2CR3A 1JYVA 3SKUD 2FIRT 4E5XB 2W0FB 5B8CC 1HHGB 4ZD3H 3CFDB 1DSFL 1KJVA 3GSVB 4ZFGH 4FQ1L 2JELL 3Q1SL 4IOIA 2AJ3B 3AS2A 2NY5C 4QRUA 1MCCA 4L5FH 5D7JA 4OKVA 2PR4H 5IT2H 3DXAB 1AGBB 4FRWA 3B2UD 3GKWL 4RGNE 4M5ZH 2XYCA 3INUH 1B90A 2F8VA 1UKTA 3NOIA 4WVRA 2G2RA 1JRHH 2FX8L 2IFFH 1U3HC 1FH5H 2VLJB 5DMIL 1Q94A 3VFRB 4OZIE 4YFDB 2NZ9C 3QIUB 3QEHB 3I75A 2OR9H 2VYRE 3WIIL 2IPTH 3WDHA 1X7QA 4BJLA 5K9KB 1NC4A 4MD4B 32C2A 5FGCE 4PJHF 1J0YA 3V6ZB 2GTZA 3OKMB 4U1LB 4YHNA 3VG0L 1FPTH 1GGCL 4I0CC 2AXGA 3W5NA 4YIQB 3GMMB 2BJMH 1CFVH 5FYKL 4PB9H 5IFHL 2G75B 3VGAC 2V2TB 4HS8H 5IBUG 1W72B 2Q8AL 4U6YB 4P23B 4WEBL 3B5HA 1FNGA 3ZKMC 4DOHB 1NANI 2X4RA 3F12B 1S7QB 3QDGD 3QCTH 3EDKA 5DJXA 1ZWIB 3U9UB 2GK0B 3MUGA 4YBHA 1BQSA 5I73C 3HNTH 1NC2A 4F8TA 1MCJA 4RMVA 2Q7NA 2OTUA 3I6LE 1QSFB 1JK8A 1DQJB 3X17A 5CIPB 3PP3K 4ZFOB 2K7QA 3N06B 5GS3A 4EUPA 3QQ3A 1RFDH 1R3HA 5IR1B 1DN2A 5GPRA 4Y5VA 1B88A 2HFFB 4XMPH 2NY4B 4X83A 1ROWA 3BPCA 2ED7A 3SO3B 3GSRB 4LSTH 4I2XA 4YDJA 5F96H 4P9HC 4X9GA 4GXVL 1JYNA 3ZSSA 4XXDA 3P0VL 3SGKA 1BZ9A 2JK5A 2AEIT 1T2JA 1JCKA 3CSBA 3GMLB 2E6QA 2YZ1A 1KC5L 3GBNH 2Q6WA 5JPMB 3OKKA 3LN4B 4F80A 3NCBB 1OTSD 1S9YA 5HYFA 1SVCP 2AXFA 2UWEA 5JXEC 5HI3D 1Z2KA 1YECH 4HK3J 5EOCL 5JHDB 5KVEL 4H25A 4CVZB 2H32A 3L3IA 2A1WH 4LFHD 5DD6A 4KMQA 3BZFB 4HIIA 3DVNB 1MI5B 4OV5A 1EVTC 3IDMB 3QXUA 2NW2A 3PXJA 4GW4A 4L3CA 4OF7A 5ISZE 1TVDA 3DO7B 3QZWB 3O3EB 4WW2C 4K94H 3H9HB 5LKNA 2QADB 1N5AB 1DQQA 3WJLC 1I8LC 2DYPA 5KSAD 3RRQA 4EQ3A 4B7IA 1FRGL 2HP4A 2V5SA 2XQYG 3WL9A 1LEIB 5J0BA 3VD9A 1M05A 2R0WL 1T04A 1NUGA 4EIZC 1B6UA 2EE6A 1Z3GL 1TZGL 1N64L 1QTYT 1BQUA 1NDMB 1DQDL 1LK3L 3S37X 1A3RL 5F6IB 5CIPH 2WSKA 4Y4HC 1A6VL 4DEPC 5MHSD 1I3RA 4U1MA 43CAB 2D31B 4E0RB 5C07A 1FV1B 1NAKL 4MD5A 3SKMA 2VLME 1HSBB 1IGYA 5I66A 3TPKA 3WFZA 3IRPX 4E41E 4D0BB 1IC7H 4H1LB 1K5NA 4PY8I 3O9WB 4HV8A 3QXWA 2I24N 1CVSC 4HPYH 3AAZA 4PJHB 4Y16B 2Z4QB 1U58B 4S1DC 4JO4H 3D2UD 3FCTA 2P47B 3UJJL 4YHIA 3H7LA 1EGJA 5I30L 1YMHB 5C9KA 1S5IL 1YEHH 2OMNA 3ZE2F 5E4IA 4NM8L 2F54E 2HAZA 3TBWB 3TJHD 5J11B 1XGYH 2VDML 1C5DA 2VWEC 3CU7A 1BOGA 3M8OH 5GHWL 1SM3L 2W38A 3OKLB 4JPWL 4NQCE 3L5IA 1I4FA 1OAZH 3CXDL 2ADGA 3RWJA 3ZYIA 4OIIL 2BNUB 5F7HA 3QDJE 4IDJL 1YQVL 4O2EA 5ICZA 4MA3B 3MBXL 3QEUB 2E9IA 2Y25A 3D25A 1RV6X 5EPMA 2A9NH 3RIAK 1JV5B 4P2OA 4NBXB 3FOMB 5F70A 2QQQA 3F7QA 3VA6A 4I0PC 2APBA 3NCFB 3VGGA 4Z6AT 4G8GE 1YC8A 3QWQB 1IAIM 2ZCHH 2DL9A 3BDXA 4X7TA 2ZG1A 4HUVB 1S7SB 5HVHB 4DUVA 1T5WA 1SJHB 2B1HL 1YN6B 4F58H 4K8RL 4L1HA 4NUJB 3C6LC 4HG4K 1SEBB 2I60L 3MLVL 3D3VB 4XVTL 2P5WA 5BXFB 4MDIA 1J05B 1EEZB 1V7NL 1R3LB 3VH8A 2NY6D 2NY2B 3V5KB 1I1RA 4Z76A 5IWLA 4WCYH 1OAUL 5M94B 3GK8H 1QLRA 5E7FA 4R26H 3VWKB 1VPOL 1E6OL 1XCTA 3KPRE 4OM1L 5DQ9A 3QA3B 3T8XB 4XCYA 1CLCA 3SGDH 3FO9A 5AZ2L 5EIIA 3VXQB 1NEUA 4Z7OE 4POUB 3ULVC 1CGTA 3I6GB 1FNSH 3L5JA 1V3JA 1DL7H 4JFEB 4OZGF 1Z0MA 2BDNL 2ZSWA 4HUMB 3FB6B 1O7SA 2XTJD 4MHHI 2ICWI 3TT1L 3VMPA 3JTSB 1A6TA 2IPUK 4LBEB 4F9LC 1U8QA 2EZ0D 2XFXB 3BH9A 5T3ZE 4GW5A 3MRJB 2A6IA 3SKJH 3E2HC 3S9DB 1J86A 1YY8A 1QO3B 4S1RH 1RHHB 1FZKA 1CL7L 1WFTA 1NUDA 5DJCB 4GRMA 1OM3L 5I18L 1WBYA 3KYKH 1A9EA 4A2MA 1OSPL 4QHLA 5ANMB 4ISVA 3PP4L 4EI5B 1L6ZA 1DZBA 2VAJA 5DFVD 1QSEE 2AQ3A 4IIQC 3O11A 1R3JB 5K93A 2VQUA 3KPPA 5E9DE 2FYYB 4JLRB 5FGRA 5BV7B 3PWLB 3SDYL 5E6ID 4O58H 4YDIL 4PGEA 3HPLA 3L3GB 4YWGL 4LGRB 2ZOLA 1QBML 4KKLD 4M1DL 3SDCA 1YMME 2CSPA 1D5IL 4YBQC 5K59E 3B9EA 1KB5B 1A7NH 2QSCH 1T80A 1KCRL 4QHUA 5KAQF 1FIGH 3GO1H 4XI5D 4Y4KC 4P48A 5H2BB 3WS3B 2CDEA 3LQZB 1P1ZA 4HULB 1QACA 2FR4A 3JWOC 2KPNA 4UDUB 5EBGA 3ARGC 5DDHB 1UVQB 3T4YB 3QQ9C 3RNQB 1P7KB 1MJUH 3KPMB 2IPKA 5B38A 5IFAL 1BBDH 5DRZB 5EULV 4F3FA 3D87B 1FNEB 3AY4A 3H3PH 5IB4B 1XF4A 4Y5YA 3GNML 1S7UA 1PKQE 1H3TA 4OLWL 4PRPE 5EU5B 1OVZA 5DUPL 1DE4A 3RUGB 1E27A 3OR6B 2ZCLH 1IGFL 4L29A 2YPKA 5ACLA 1Y6MR 5DLML 1A1OA 4XRCB 2WWKO 1HQRA 5C08B 1P4IH 1X5JA 1DVFA 3OHXB 2IAMC 4MMZC 3CFBB 3ZDZE 4PJAA 4HZAA 4ZG1A 3OAYK 2OZ4L 1N3NB 4HFWA 2L7UA 5E08H 4NKDB 1F6LL 4LKXA 2R15A 3NIFF 4R96B 3ROLA 2HYMA 3ZYZA 1F8TL 4JAMA 5EBMB 1HYSC 1ACZA 5DF0A 5HJ3A 1EEUA 5C0ND 1S7TA 2VIRB 3F6LA 2DWDA 3P0YL 5BV7H 1FO0A 4U7KA 5DEFB 4NUGH 3O0RL 2R8SH 4MAYC 4L4TB 1TPXB 4NKMB 2Q8BH 1KB5H 2DQGL 5EBWB 1A7OL 2V5TA 2Q87A 2XZQH 4HUUA 2FBJL 3I3DA 3IDXL 5IBLC 4KV5F 5ESVA 1HHHA 5DWUL 3IFLL 3I3BA 4AM0A 4ERSL 3VFGH 4U6VH 4JR9H 4WGVB 2YRPA 4XAKD 4OZGB 2D7NA 1MFAL 5ID0A 4NQSA 1MCEA 4JY6B 4M9PA 5EZJA 3QPQC 1ZKAA 3DSNA 3R06A 5IBUB 3U30B 4D9RE 3KPSE 1A6ZA 2PF6A 5DC9B 4P4KB 4C55A 3EFDH 4UB0H 3J7HA 1UACL 3K3QA 2W0FA 1AY1L 3V0WL 2AEQL 3IFNH 1TXKA 3RIFK 4PJBB 3CFDA 1MCSA 3GSVA 4WHDA 4X6EA 4F15C 4U6XB 4P2YA 4TUKH 3P73A 2ZNXA 1YQ2A 1OLLA 1G1YA 2AJ3A 1A14H 1H3PL 4Y2DD 3CVIL 1ZHLB 3K8KA 4QOKB 1IQDB 1X5GA 2HVKB 3DXAA 3O3AB 1AGBA 3VG9C 2XNAB 3GDBA 1T2QL 4BSVB 2J5LB 3O4LB 5CS7A 2BHZA 3CVHB 3QAZC 1WC7A 5IMKB 4IRJC 2VLJA 3G9VA 2B1AL 3L7EB 4YGVA 1MF2L 5TQ0L 3QIUA 5EU3B 2BY3A 5CP7B 5IV2B 3QEHA 1XIWB 4WI2A 5K9KA 1RUPL 3K1DA 3DUUB 4F7TB 4MD4A 1V3MA 3F5WB 2XA3A 4BFEA 1ZGLM 3V6ZA 1U8JB 1SY6H 3OKMA 4NO3B 4U1LA 3ZHLA 2FX9L 2P42B 1N6UA 3V6BR 4ZODA 4YIQA 5E4EC 3ZE1E 1X5LA 2QQLL 2G75A 4WHCA 1W72A 1FZJA 4U6YA 3PHOB 1TJGL 2CRIA 3D39D 3LS4L 2DDQL 4HKZA 4EXPX 2EYSB 4R97B 2AK1L 1LO4L 4HLJA 3SN6N 2EDTA 3F12A 3SEPA 1S7QA 4LPTA 2VLRA 3GRWL 1WITA 4QF1B 1ZWIA 3U9UA 3UZQA 1SVZA 4HT1L 2CKBL 1IEBA 4TTGA 3VXTB 2JB6A 4HWBH 3LPWA 4CJ0A 1DQJA 4UIKL 5CIPA 4ZFOA 3NPSC 1KJ2B 2FHCA 4ALAL 4OCNC 3RVUC 4LSVH 5IR1A 3G9AB 1D5XA 5I71B 1RIHL 2HFFA 3MJ9L 3H9SE 2VNCA 3HMWL 4GMTH 5I74B 5I8OL 1TJHH 3GSRA 4PB0H 4EJ1C 1IARB 1XGQA 3QI9B 4NKIL 2WBJC 4LCUB 3I50L 4MJID 3CVHH 3CD4A 4W68A 5ENWB 3GMLA 4WUUA 4Z0XA 1LP9E 3EYQD 5JPMA 3UTPE 3LN4A 4NQEB 4UTBH 5GZND 4R7NB 5I1IH 3T0AA 4C4KT 2APVA 2NNAB 3CFJB 4Y8DC 1XF5B 1A7RL 4CVZA 1WK0A 4PJIF 4UNVA 3NCJL 3BZFA 4DKFL 2WZPD 3DVNA 3TZVB 3C9NB 5EN2A 1MCBA 4WFED 1MI5A 2IBZX 3IDMA 2V17L 1YJDC 3E3QC 5C0IA 4XNXH 3DO7A 4YK4C 1IGTB 3QZWA 1T2XA 2MPAL 1CD9B 3PHSA 2DJSA 3O3EA 2CRYA 3R4DA 3GMQB 3HUJF 4GKNB 1DBBH 1P7HL 5GJSL 3T77B 4IRSB 3P9MA 2DB8A 3CJJA 4UZGA 3KJ6L 1RZ7H 4MA8L 1LEIA 4U05A 3MRDA 3MLZH 5J3HD 5SWSB 1RPQA 2R4RL 1MCRA 3CH8A 2AJYH 4S1QL 1Y0LB 2Y6SC 1NDMA 1NFDE 2GJJA 3SDDB 2B4CC 5I19L 5DK2B 2W07A 3FOLB 5ALBH 3O6LH 25C8H 4QXGH 4L3EE 3S8WA 3CMOH 1SYSB 3MBEC 2XRAH 43CAA 1QPXA 2D31A 4NJAH 5DJ8B 4RMUA 4DUXA 5GSVB 4E0RA 3LKOA 5A43C 2B2XL 1HSBA 4I18B 4L9LC 5J9PB 1ZT1B 1OGAD 1X6NA 4CN6A 4ZAKD 4JJ5A 1K6QH 3WXVL 5C0AD 3SCMC 4H1LA 5EU6A 4AQ1B 3O9WA 3KPLB 1F97A 4FQ2H 4KVCH 4PJHA 4Y16A 1IMHC 2Z4QA 1BD2D 1U58A 3WO4C 3RDTA 3MFFB 1CICB 1KCKA 5CJXA 3QCUH 2Z8RA 4NWUL 1AQKH 4XPGL 5D7LB 4HBCL 5I1DB 5HDQL 1YMHA 1CGSH 2F5AL 3QQNA 4M7LH 4F2MB 4P3CH 3TBWA 4L1DA 2W1NA 3ZTNH 4LCWD 5J89A 2VR9A 3MV11 4UILL 2PO6B 3HI1A 4G42B 1HI6A 3OKLA 5ICYB 3WIHH 4RGNB 1NEZG 4LDLB 5FM5O 4D0CB 3SKOA 1G9MC 2BNUA 3HA0A 2CGRH 3BMWA 2GAZB 4KHXH 1I9RH 4Y4FD 1OHQA 2YSSB 4MA3A 1KFAH 1OAKL 3CLFL 4ZTOH 3QEUA 5DMYA 4ZUTB 1INEH 4P3DB 5LAXB 4I13B 5CKAA 1HN1A 5FUCE 4X6FB 1JV5A 2CJUH 1F11B 3VXRD 3FOMA 3ETBF 4CU8A 4XMLL 1UQSB 3OGCA 4R4FL 4BQ8A 4KHTL 5C2BL 5I1CH 1JIBA 1BFOB 4HUVA 1S7SA 4M48H 2YPVL 4HJJL 4P59L 1FFOB 4DCQB 4F7EB 4KUCD 3VXSD 4GQ9H 1BOYA 3MFGB 2Z35A 3X3GH 3BP5B 4JFDE 5ESAB 3MC0A 2HH0H 4NUJA 5IBTH 1SEBA 4JZJB 1KLGB 5F97E 3VGEA 1CDIA 5BXFA 1G9NH 3JBG7 1EEZA 1LEKB 1R3LA 4CU7A 2DLGA 4M6OL 4PJFB 3MJ7B 2G60H 4AZ8A 2OL3H 2X1OA 1RZGB 3S7GA 3DRTB 4L8BB 1T6VN 1NANH 3MUZ1 4PJIB 3AREB 2R69L 4PLKC 2XN9D 5F8QC 5JZ7C 3CGTA 3KJ4B 1FGVL 4PJ5E 5TDPA 2X7LA 3OPZH 4TSCH 4KZDL 3QA3A 3T8XA 4BQ9A 4D3CL 3HUJB 1EV2E 4JY5L 4FQXC 4LNVA 3VXQA 4Q6YA 2VDKH 5ERWB 3ARWA 1FE8H 4OGAC 4EOWL 4XP1H 2XG4A 4JFEA 4YLQT 3C5ZB 3FB6A 2OI9C 5I17B 2QV2A 3JTSA 4LBEA 5ACZA 2GK2A 1ZANH 2FWOB 2XFXA 5IMOB 3MRJA 3KLHC 1MELA 1MFBH 2BC4B 4Z0BH 3MV7D 1OAQH 1ADQH 4LRIC 4OI9A 4TSAL 3CFCH 1RHHA 3QRGL 2R0LL 5DJCA 2BMKB 4OLYL 4GMSH 1WFNA 4PJ8B 4NYLB 5ANMA 5I15L 1N7MH 2R9HD 4EI5A 4OAWB 4I3SH 5FYJE 4OLEA 5I6XB 4JB9L 1R3JA 1RK0B 1RJZA 5C3TA 4D94A 4J8RA 4AL8H 5ISZB 3ARFD 3CMGA 4Z95L 4S0SD 1GGYA 3PWLA 3IETB 3W11D 3L3GA 3ZSTA 3ROOB 1QQDB 1NGQH 3FO1B 2EC9T 5E99L 4Z7OF 2QSVA 1KB5A 4WY7H 4XP5L 1KXVC 3K0WA 5BQ7B 1QBLH 4EDWL 3BPOC 3BKJH 2BOCB 3CSYB 4OF8A 5H2BA 3WS3A 3LV3B 3X12B 4LHJB 3GEWB 4DN3H 3LQZA 4POZD 4JKKA 3OZ9L 1E4WL 1YUHB 2F15A 4UDUA 1MJ7L 4TNWF 1IAIH 1UVQA 3NPZB 5DDHA 3T4YA 4R90H 1WAAF 3HZKA 1P7KA 3RNQA 3KPMA 2BSTB 4X8JB 5J13B 4LSRL 1MQ8A 4QRQB 5DRZA 5LXGH 1I1AB 1FNEA 5HHOD 5IB4A 1CGXA 3QCVL 4FABH 4XP9L 1MFDH 3MCLL 5D7JD 2WWMD 3GBLA 4MGXA 1EGJL 1XF1A 5EU5A 5SWQB 3VFTB 5KVFL 2QJDA 3RUGA 1H3WM 3OR6A 3SDAC 1FYHB 1M7DB 4XRCA 1QSVA 2DQDL 4IOFC 4MA1B 2C1OB 4OI7A 3IT8D 4DUWA 2ATKB 4ZFZB 3WE6B 1UXSB 1NBYA 3M17B 5K59F 3CFBA 4ELME 4DAGL 5D7KD 3O6ML 1T03H 1TQCC 3RVXC 4GRLB 4HIEB 3OX8B 1E4XL 3QDHA 4NKDA 4PJ7F 4HKBA 3WNLA 4Z77A 1NCDH 1I7TB 5EBMA 3FQUB 5ELIA 4LPVA 5EWIL 3KDMB 4LSQH 3ECBB 1IM3B 2VIRA 3OXSA 4HKXA 3RVWC 5KSVB 2VXUL 3GJFH 5DEFA 2HT3C 1CXHA 2W91A 3RL1B 2ICWB 3QG7H 1MQKH 4JPKH 3D6GA 1BAFH 4NKMA 1OL0A 4G8FB 1SY6A 4KK5D 2OX5A 5EBWA 3MLWH 5FCUL 4Z5RB 3QXVA 4ODWB 1AIFB 4O9HH 5AG8A 4GAJH 1X5KA 5DJYA 1MUJB 1JZ3A 1NC2D 1RIVH 4OZGA 3ZDZF 3LKRB 3S88H 4HZLB 3T2NH 3CC5B 4NM4L 3RTQC 2Y1VA 4JY6A 4L4VE 3UROR 1ZLSL 4Q7DA 4ZTPL 3RNKB 3RHWF 5JW3H 3BFOA 3LQAC 4PJ9D 3VXUE 5C2UB 1I8IB 1IZJA 1VSCA 2B8OT 4PJBA 3RY4A 3HRZB 3V4PL 4LGPB 1EO7A 3JWDL 4CVUA 3QNYA 5KVGL 3RPIB 2ERJC 3BI9X 5EUKB 3HG1E 3NACH 5TDOB 4BZ1L 2ARJQ 2CLVB 1ZHLA 3ZZ1A 4QOKA 1IQDA 2HVKA 3KPRB 5DMGD 3O3AA 3TN0B 4YNYB 5C0BA 2XNAA 4M7ZB 4BSVA 4K3GA 1AO7D 3O4LA 1BM3H 1UH2A 4G6JL 5DYOB 4WHTB 3CVHA 1QKZL 5IMKA 1NBZB 3TNMA 3LKPB 3RVTC 2DMCA 2VKWA 2DJUA 1NFKA 3K80A 4DZ8B 4X6CB 1XIWA 1UB5B 3DUUA 4F7TA 3UTTD 5T1KA 3F5WA 2ZZUT 5J1SC 2DYPD 4QNPE 5IW3A 4XMKH 2HJLB 4NO3A 3QQ4B 1AC0A 2VKXA 1XT5A 3DO3A 1OP3K 3WD5L 2AJSH 1WUNT 3C60B 4DGIL 2RHEA 1QSEB 1DBMH 4CRPA 4O02H 3PHOA 3QDMB 5I0DA 1UM5L 2EYSA 3ES6B 5CILL 2DBLH 2CMRH 1YYLL 3PABB 4CVWA 3D85D 4QF1A 2AK4D 4LVNB 1L6XA 1I85C 3SDXF 1G7IB 5DJ6B 3AM8A 4QRSB 1FNLA 3BQUA 1FVEB 4N90E 4UINL 4XC1L 1ZGLB 2H45A 4DKEL 3G6JE 4I9WD 3P9WB 4PJ7B 1MCDA 4GBXB 4RQQB 5HHXL 2P5EE 3OB0H 3TO4D 4RDQG 2E8YA 4HGMA 4H5SB 3CDYA 1V7ML 4BZ2H 3MRQB 2XKUA 4RFNB 2C3WA 4HMEA 4IEFB 3LKNB 3MLSH 4WFHD 1WQVT 3O8XC 4UU9B 2Z8VC 4L5FL 5CJQL 2ZJSL 4XXCA 2R0ZH 4LFHG 1A7PH 5ENWA 3GMRB 5D1ZB 5GRJL 5B3JE 2A6DB 4NQEA 4R7NA 1JZ8A 1DANU 1CR9L 2E9WA 4QHNA 4CNIB 2NNAA 3CFJA 4J4PC 1OF2B 5T3ZH 3GSWA 1RZJL 1ZT7A 1XF5A 2P46B 2EZ0C 4H88L 1HKFA 2HJFB 3TZVA 2OR9L 2V5YA 2Q76A 3EUUA 4LIQE 4NBYB 1FO0L 2DLTA 4N0FA 4YHYB 1IGTA 3ARBC 1FNFA 2W0LA 4OKDA 1PGRB 5D8JL 3HS0B 1NEZB 3T77A 2BJML 2DQJL 4JM4L 4HDIB 4HS8L 2LU4A 2W9LA 4KZEH 5SWSA 2R1YB 1YZZA 5F9OL 1KBGH 3HE7B 3RI5K 4B7LA 4UT6L 3SDDA 4HWUA 5HHMD 4YHKH 5DK2A 3FOLA 1FG9C 2DM2A 1SYSA 1W8OA 5A2LH 1BFSA 5DJ8A 5GSVA 2BNQA 3GUTB 4ZQKB 5JOPE 4I18A 5DO2D 5J9PA 4KROC 1ZT1A 5F7NC 3RQ3A 3CX5K 3KPSB 1W8NA 4DTGH 4XMPL 3P30H 5E6ZA 4JRYE 5HPMB 5DD0L 4LSTL 3MFFA 1CICA 5F96L 4H0IA 2VWEE 4PBWD 1FIEA 5F1OB 4HGWB 5D7LA 5I1DA 4LHQB 4OQTH 2Z8WC 4TVPE 4F2MA 1QFWI 2NX5B 1WWBX 3PGDB 2FCBA 2PO6A 4MCZA 5CSZA 2PTUA 5ICYA 1ORQB 5IHBA 1NFDF 2IANE 3B9KD 2BHYA 3SE4C 3GHBL 1QRNE 4D0CA 3ULUL 1I3GL 3P40A 3SDXB 2GAZA 5FK9B 5C6PB 2GYSA 5AEAA 2A0LC 4R4ND 3RWEB 4DGYL 4YDLB 4K55A 2YSSA 1IC5L 1ADQA 3MRHB 4ZUTA 4P3DA 5LAXA 4KKAD 4AENB 3C5SB 2GJZB 5FDYA 3BSZH 1I1YB 3MODL 4X6FA 2IG2H 1F11A 1AHWB 5SV3A 3V8CA 4Q9RH 1W72L 2VUOA 2EE2A 1UQSA 3SDCD 3WLWC 4XHQA 5CCKH 1SQ2N 3WEXB 5J8OA 3MQIA 2DIJA 3QUXB 4MSWB 4DCQA 2DKSA 4PJDB 3HC3L 2YD2A 1TETH 2V9TA 3BP5A 4NCC2 1QG3A 3REVA 5CBAB 1P9MC 4KJWD 4JZJA 1IKFH 4ODVL 4K8RC 1LEKA 4ZFOL 1JNNL 3MJ7A 15C8H 3TBVB 1YEGL 1PLGH 1RZGA 5EH1A 3DRTA 5HYJE 4IMKA 4L8BA 4PG2A 3JVGC 4NJ9H 4WJ5B 1R0AL 4PJIA 1J0ZA 3AREA 5KVDH 1B0RB 1MCOL 4HJGA 1JPGB 3BP7B 3NA4A 2MMXA 1I9IH 2VITB 3ULVE 1I3UA 1IC7L 5FYLE 2IGFH 3U6RB 2BERA 5ID1B 3V7MA 4BYHA 3HUJA 1DVFD 2DD8H 2VZUA 4JO4L 5GRUH 5T1MB 4APQB 3PGFH 3I2CH 1M7IA 3MNZB 1QFWM 3RY6C 3HB3C 3C5ZA 4JGUA 4Y2DC 5I17A 2NY3D 1U8OB 4JM2C 3B3IB 3IDIB 4FG6C 3WN5B 3RIAF 2FWOA 5IMOA 1MHPH 5E2TH 2BC4A 2GT9A 3BAEH 1LO5B 4CVXB 2Z9TA 1PFCA 2FECL 4PJ8A 5C0FB 1A3LL 4NYLA 2CDGA 4PS4H 1LILA 4OAWA 3NN8B 4ORGB 1AP2A 1PG7H 3K1KC 3WUWG 2A9NL 3C08L 5ISZA 1NMBH 4WFFE 2DJ4A 3IETA 3F6IA 4PY7A 3ROOA 4YHZH 3FO1A 2ZUQB 1NLDH 3U2SA 3SGJC 4NP4H 2XWTB 4V1DE 3MGTB 5E8PB 1K4DB 4ODTH 5I0ZA 1ZT4B 3PF2A 4KK9D 2QBWA 3CSYA 2R1WB 4F58L 4KDTA 1LDPH 3LV3A 3X12A 5T1LD 1JNLH 4JFPB 5CJOL 3U7YH 3L3JB 1P4BL 3I85A 5DXWA 2GIYA 4LARH 1YUHA 5IB2B 2VC2L 2EC8A 1EA9C 2AJUL 1HZHH 5F93C 1JTOA 2BSTA 4X8JA 2NXZB 4FA8A 5CSGA 3RAJH 4TSBH 4WCYL 3GK8L 4NWTL 3MOAL 4Z7WE 3NCMA 5IUSA 3MXWH 4NDMB 5GGRB 3DXAD 3H42H 2NXYB 2JCCB 5BMFL 5DR5H 3DVIA 5DRXB 4EBQH 3U9PL 2AV7B 1M7DA 2BXZA 1LD9A 5JR1H 1ORSB 3AXLB 4M93C 4FQPA 3KG5A 2ATKA 4ZFZA 3WE6A 5ECJE 1UXSA 3M17A 4NC2B 1YYML 4WHYG 2YD1A 3QIUD 2DQUL 2EO1A 4HIEA 3W0WB 1OD9A 1ZHBB 3OX8A 1PG7W 3KXFD 5CEZE 4AMKL 3OKEB 1TVBB 2H2SD 1HSAB 1I7TA 2JJUA 3FQUA 1JF6A 4KKCC 5FO9B 5LWYH 1MRCH 3KDMA 3ECBA 1I9JH 3KYKL 4B53A 3T0EC 1IM3A 2B39A 4EN3C 4HUXB 5CD5D 1MWAB 3TT3H 1M4KA 1W0WB 5KSVA 3BUYA 4FQCH 4GXUM 4NZTH 2ICWA 3QHTC 4LCYB 3RWIA 3SKNB 12E8H 4G8FA 1CXEA 3ZTJG 2DLIA 3RKPA 4XB7A 1CD0A 4Z5RA 3GSUB 4ODWA 5D6DA 1AIFA 1NCUA 1BLNB 4O58L 2VLRD 1R24B 3IKCB 5LGKA 5J12C 3ZMRA 2E7CA 1VGEH 1MUJA 3BKCL 3D5OF 5FA3B 3VFMB 4QLRA 1PY4A 5E0QA 1A7NL 1KOAA 3V6FB 3UP1A 3LKRA 3CSGA 4HZLA 4ELMF 1FIGL 1VA9A 3CC5A 3MRIB 4QXUL 5D70L 4JHWH 4S11A 4FQLL 1UXWB 3WNKA 4EVNB 3DX6B 5IW6B 4JFDB 3RNKA 1GYAA 2NY4D 4XT1C 2BY0A 1I9EA 3MLRL 1JWMB 4P5KA 1DQLH 1SBSL 1PKOA 1I8IA 1MJUL 3DUSB 3VDBA 3HRZA 5BRZD 4WFGD 1JNHB 5CJBA 4KU1A 4NC0B 1G6VK 5DUML 3RPIA 2VB5A 3K74B 3N1PC 4P5TD 5TDOA 1RVFH 3SE8L 2CLVA 4WUUD 4IHOA 3KPRA 1UZ8B 2ZCLL 3ARUA 3TN0A 4YNYA 4GSDH 3DARA 1G1CA 3VD5A 1HH6B 1TLKA 5DYOA 1EAPB 1OWWA 2EO9A 1NBZA 1GL4B 3LKPA 4UOJA 4RBPK 5E08L 2RQ8A 1MI5D 3EAKA 5D2LE 3RX5A