4NKIL

Crystal structure of a fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
SALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Epitope characterization of an anti-PD-L1 antibody using orthogonal approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiL02
5HYJE 5EWIL 5E2TL 4OLWL 2JIXD 3QQ4A 2RBLA 3O3DA 5DGQA 2Y5TB 4I3SL 4NCC1 3BKYL 3EFFB 4I2XB 4MVBD 3AY4A 3KPMB 1X5HA 3UTSE 1INEH 4O2EA 1QP1A 2CK2A 4XCYA 5CJOL 3B3IA 3DVGA 2BERA 2X4SA 4CW1A 4KUZH 3DBXB 5IGXL 5C0AE 5DD6B 2VN4A 32C2A 4OZIF 3T2PA 2BHYA 4MQ7A 5I17A 3PHOA 1LGVA 3DHJA 3DGCR 1SYSB 4Y16B 4UT9H 15C8H 1ZS8A 4P23C 4JKWA 2XPGB 2Q3ZA 4GUPA 4K7FB 1HHGB 1LO2L 5D6DA 5KTEH 2Y5EA 4LQFL 2EYTB 3FO1B 1ZA3A 2E3VA 1YEJH 5FOBA 3CFEB 5D1ZB 1OP9A 3QO0B 1IGFH 5IB1A 4ZFGL 3TVMD 1UM6H 1KIPA 1U8MB 2ARJB 3R0NA 4QOKD 3JV6A 3KXFD 1BVLB 3CDYA 5GPRA 3C6SB 2CKBB 4IMLB 3VGBA 5E4EB 5I75C 3GSQB 4K3HA 3ZLQC 4NUJA 3P0GB 1NGZA 4DGYL 3KPRA 3NPSB 4H8WL 2R2BB 1NDMA 4M93C 3SOBH 2QR0B 5E99L 4MX7A 3FN0L 2G5RA 5JXED 1PG7L 3MV7B 4OQTH 5L9DL 2HLAB 4X6DF 1RJYB 1LE5A 2VXUL 1CFBA 5CUSL 4GG6E 4PRPB 2FEEL 5KVFH 1O5DT 1PDKA 1WAAF 3PGCB 4UZGA 4OCSH 5D7LB 3FT2A 1YECL 4HMEA 1P84K 4MA1C 4EDXA 2AS5M 5EBWB 1LO3H 1TTFA 4RMTA 3C60B 2Y4SA 2HWZL 2GCYB 2Y07H 1GC1L 4Y5YC 2MQCA 2XI9A 3V5DA 2B1AL 1ZSDA 4OD1L 4HUWA 1C5CH 5JDJA 4QXUL 4X83A 1CFVH 2BC4A 1T0NA 1XMWA 5GS0C 3TNMB 1J8HD 1SY6A 4UMGA 1IAMA 4PUBH 3IB4A 3N06B 3RWFB 1ZGLA 2IBZX 1NGQH 3BP4B 5L2KB 4F9PA 1EO8L 4P5TB 4KDWA 3QPQD 4RGNC 1KB5L 4JJ5A 2F5BL 1QHOA 4ESKA 3CCHA 2ZUYA 2VZOA 2YRLA 4LLMA 2FO4B 1IEAB 3O41A 4L4TE 2AEWA 3BH8A 3K3QA 2OXHA 5I76A 4Q6YA 3RNQB 1AJ7H 3P4MA 2FATL 3QPXL 2ESVD 3HZVA 1NFDF 3HAEG 4JGJA 2X42A 4WWKB 3CMOL 4PJ9C 3QXDB 1QLRB 4FMFA 3X12B 3GJFH 1PEWA 3CFCH 3AUVA 3JWDC 1NEUA 5BRZA 2DBLH 3MV9D 1A7PH 4KK8C 4JLRA 4RQQB 2ZKHL 2QADD 3TJHC 3VG9C 1YEKL 4CVWA 3IDGB 1Q8MA 1BAFL 4LVNC 3KNBA 5I1GL 2PCPA 1WF5A 4MCZB 5DD0L 3QQ3A 5JORB 5E70A 3VCLB 3JWOC 5J11C 5BO1H 1X5LA 3GJEB 3O2WH 4DAGH 2X5PA 4DKAA 1JF5A 2A6DB 4PP1C 4LLDA 1BGXH 1RURH 3WS3A 3B9KD 5C0AB 1MOEA 4XNUH 2PYFA 4LIQH 2BNUA 4KK9C 1CDHA 1OM3L 4YDJA 2QJDA 4DOHB 3VD3A 3MYJA 3AREA 5I73C 2W65A 3J8F7 2ZUTA 3D2UD 2PETA 4O2FB 4TNWF 2PTVA 1DQJA 2OR7A 4LRIC 5BV7H 3V7AG 1MCNA 2O5ZL 4JGUA 1MVFA 4P2OC 4EDWL 3MO1A 2IQAB 5CILH 1W2KT 3OKOA 4LASL 1KTLA 2DQGH 4XVJL 4LCIL 3U9UA 1BF2A 1EGJH 1CGWA 1KJMA 3TH4T 1ADQL 3X11B 1IAOA 4UNVA 1MJ7H 1R3LA 5ALBH 3MNVB 3MUGB 1T5WB 1HSBA 4X4YB 5EZOL 5IKCB 2YXMA 2DMBA 1SQ2N 4FRWA 3HI5H 3U6RA 1CDCA 2CO6B 5MEQB 5FO7B 1CDIA 3M1BA 1ORQA 2WQ8A 2NXYD 1MRDL 1NCCL 2IH1B 3ZKMD 5I8KL 2YPVH 4FFVD 4GG6B 2EEBA 2NY7L 1QNZH 2RB8A 5CIPB 2VABB 4CMMA 4NRZB 1X5GA 2WNGA 3MRNA 3AU1A 2VSCA 2MNUA 3MFGB 1DBML 4UOJA 1E6JL 3QFJD 3PP3K 2C1PA 4QHNA 2LABA 2B4CH 1I1AB 2V9QA 4DZBB 4ODHH 3MFFA 4MA8H 1X9QA 2DLEA 3ULVL 5AZ2H 5FCUH 1YZZA 2P8MB 4LLUB 5KS9B 5CGYD 4P2QA 2MPAH 1JV5B 1YN6B 1QPPA 1CVRA 2VLME 3BRDA 3C2AH 4XWOD 2EH7H 1I8LC 3B6SB 5DRWB 3TO4D 5C3LD 4NM8L 1PKQB 5E2JA 3DETD 1OAKH 4EXPX 5IJVB 5J89A 4RWYL 3PV6A 4WFFD 1HQRB 2JJWA 1AIFA 3CVIH 3PIQA 1V7ML 1LD9B 1FC2D 2R0LL 3ZT7A 4ZOEA 2C4FT 4L8SB 1IJ9A 4N8PA 2QQLL 1IC7H 4TTGA 4NQDE 5JW3H 2VITA 3BGAA 2DD8H 4IIQA 3L9RA 5DVKA 2MTPA 1YQVH 2NCMA 1JYVA 1S7RA 3Q6GL 2F54A 4Z5RA 1T4KB 5J9PA 3QEGL 3IDMB 5GRVL 1BVZA 1NGWA 1RU9L 3JTSA 2ADJA 4F7MA 4P46B 1JHTA 2EDBA 5GIRA 4HBCH 1CT8B 5EU6E 4Q74A 2UVFA 4YHOL 2D03L 5E8PB 4C4KO 1FYTA 4GAFB 4LVEA 1GOGA 4XVUC 5JOPE 5C8JB 1FDLL 2IPTH 2FB4L 4FMKA 3G6JA 4G8FB 3NZ8B 5C6TL 4MJ2A 4H8WC 4QHMB 5LAXB 4WTWA 1JNNH 3FT4B 5I8CA 4NNPH 2AABH 2H2PC 4KKAC 3L5JA 2M2DA 4PJDA 1QFOA 5DK3A 5KJRH 3T1FA 2L7JA 3UBXA 4HUXA 2FLRT 1RK1A 4Y4HB 4YBLB 1KC5L 1JMXA 3PHQB 5DJYA 4KHTL 4P59L 5IG7B 2FYYA 4ZUTB 1T22B 3UTPE 1HKFA 3FMGL 1GC1C 4ZDHA 2HFEB 4HH8A 4PJEA 5D6CA 1OAZH 3IU3A 3CD4A 3VFVA 1H8NA 3SE9H 3TBTB 4F9LC 1RZFL 5CJ5A 2PW1B 4UV7L 1TDQA 4FQHA 3EO9L 1EXUA 4X4ME 1T7WA 4H20H 4ZD3L 2FEDC 2DKSA 1CGUA 3WHXB 4NUGL 3MJ6A 3MBEA 4GBXA 1J1OL 2IAMA 3ARZA 4O2CA 3OPZL 5EC2B 1CDUA 4F7CB 2Q8AH 3C8DA 5ALCH 5T5FL 3SQOH 1RJZB 1UA6L 1KCUL 4Z95H 1KTKE 5HHNA 1MI5D 3VFTB 4XNZB 1OF2B 1KIQB 2HA1A 3HRZA 3STZA 3H8NA 3GDBA 4MXVE 2J7LA 1LO5A 1JPTL 1FIGL 2BXZA 3EYOB 4OCXL 1FE8L 1ZLWH 4HGWB 4N9GB 1WC7B 3MRQA 1TPXC 2GFBA 1AE6L 3O4OC 1JMZA 1D5BA 4OM0H 4I5BB 1F5WA 1NGPH 3DI2B 4J3TA 4POUB 4CJ0A 1N7ML 3TA3B 2P45B 4LEXL 1SJEB 1SJVA 6FABH 2B5IC 1BEYL 3ARFA 3CLFH 4XP4L 4PJ5B 4ZMAT 2YWZA 1M7XA 1XF2A 1HCVA 2VDRL 4WUUA 3KXFE 1GRWA 4D0CB 1UWGH 2XWJB 4U2YA 4L3EA 1UT9A 3TT3H 4U6YB 4Y2DA 3IDIB 4UTAL 3MLRL 4UV4H 3T0WA 4LGRB 1OSPH 3BSZH 2A77H 4MDJA 1KIUA 1DQQA 4UILH 3NIDE 4NQDB 5I1JL 4JGMA 5J6GB 4MZ3A 1JZ7A 2VL5A 2ICES 3LKRA 3O3BB 4WW2B 2IPUG 1KT2B 2DQTL 5ESVB 3T3PF 3OHXB 5K9KB 4PJFA 5EUKA 3NABH 1H3WM 2E9IA 2Y06L 3S5LG 4NQSB 4IRJA 5EU6B 3EHBC 2XWBA 5F7EL 3LRGA 2ILLA 2YHGA 2DKMA 3NIFE 4G43A 4KKBD 5HD8C 3NFPB 5JIHA 2WK2A 3EYQC 1UG9A 5CBAB 1VFBB 4FA8A 4YHMH 4K2UL 3RTQA 3BHBB 5HPOA 1RSFA 4NJAL 1QBLH 5GXBB 3UJIH 3QQNA 5BVPL 4JHWL 4UOW1 3F65A 4RNRA 2NY3B 2OJZL 2D0FA 2VDQH 1IGJA 1N6UA 1G9NL 2I24N 1U8HA 1BOGB 5FYJU 4ZFFA 3GHBH 3QIUA 4PB9H 1D9KB 2PXYC 3H42H 4HLZH 1C12B 1RZIB 1AY1L 1G6RB 2KH2B 4H88L 1YEHH 1YNLH 1KXQE 4YX2H 2BNQE 3FONB 5CWSB 1UXSA 5MENB 1UKTA 5C09D 2HT3D 4ZS6C 1QQDA 3TIEA 4OZIA 1U3HD 3ULVC 5IQ7H 3V6FA 3CDFA 2NYYD 3DXAA 1IC4H 2E6PA 4ZOAA 1P84J 5A3IC 3AMLA 4F15B 1Z0NA 4Z76A 3MV9E 1GHFL 4LSPH 5E2VL 3WS6C 1IEBA 2NY1C 3WIHA 1MJ8H 3NVQA 2JB6A 1JPST 2VSDA 5DVOA 3C8KB 4PJ7F 4O4YH 3O2VH 3I2CH 1A6PA 5HYSB 5F96L 2OI9B 2P24A 3WYRA 3U46B 5A16A 1IQWL 1K4DB 3DX8A 4MAYC 1I7ZA 2V2TB 3RA7H 5DEFA 1SYVB 1ZGLP 2D9QB 4DN4L 3WNOA 3BKML 4MD4B 3L7EB 3K2UH 2MKLC 43CAB 2FX7L 1YPZF 3OKKA 5KW9H 1P7HL 5MEOB 4P5MA 5ITFB 1BFVH 7FABH 4PRDB 1A9EA 1NSNH 1ONQA 2EIZA 1XF1A 3UJTL 2Z4QA 3QUMA 1BQHG 4YQXL 5IB2B 4LLYA 5F7FA 5EU4B 3KLDA 1U8KB 2QSCH 4LLVB 3TVMB 3P30L 4WTZA 1L0YA 5D1QC 1GZQB 3KXFB 3SY0A 4G7YH 3KPTA 4LCWA 3CZFB 1Q9WA 2R2EB 1A3RL 4HQQL 5IMLA 4HUUA 5FUCC 4MNQA 4PJHB 3GSRA 3H3KA 2UZIL 5D93C 1FC1A 4G3YL 1CE1L 4KRLB 1A6AB 4Y19E 3FJTA 5FECA 1E27B 5JW4N 1IGML 2P46B 1Z9SA 4G9FA 4FOMA 4P23A 1JVKA 1HHJB 4U0RB 1HZHL 5F88B 1UENA 1TJHL 3QFJE 5CP3A 5ADOH 3MRHA 4XMPH 4Q7DA 2ZG3A 2X70A 4FZEH 3V0WH 1HHKA 1KPRB 1BBJB 5ID0B 4P49A 4QRQB 3VXQB 2JJVA 2OR9H 3QG6B 4KDVA 4DCQB 3OB0K 4M7KH 3HNVH 4ODUB 3GMRA 2XQYG 4WHDA 4A6YA 4F57H 1INEL 4WFFE 3C5ZC 4YLQT 3FB8A 5IB4B 4LRNH 3KWWA 4N8VB 4KUZL 1ORSA 4JZJC 3OF6D 4U1IB 2OYPA 1UZ6F 1NCNA 3KPRD 2Y7QA 2BNQB 3VXOB 2VIRA 1H3TA 3D3VE 1BFOB 3P4LA 4UT9L 3SE4C 3TH3T 15C8L 3L3JA 4P99A 4EIGB 5J13B 3QDJB 5GZOC 4K55A 5D7JC 5TE6H 3G04B 1ZHNA 5KTEL 4XCEA 4HCRH 4YK4C 5IESH 5B38G 3T0BA 1IGFL 3CVHH 3MV9B 4YHIA 4UIMA 1UM6L 4KKNA 1CU4H 1KLGA 4NCC2 5GRWA 4OUOA 1G0XA 2C3HA 3DUSA 5DJDA 1KJ2B 43C9A 4QRTA 1EAPB 5B8CC 2KL6A 3GNML 4JY5H 3SOBL 4ELKB 2VR9A 5JIIA 5DEZA 5KOMC 3F62A 4OQTL 1B0WA 3CX5K 1XGTB 4UU9A 3FO0H 2NY5H 4ONHB 2CRIA 3MNWA 5KVFL 1N64H 5F7YC 3ZSTA 1HQ4B 4PJ9A 1UVQA 4OCSL 5CCKH 2LU7A 2SEBA 5I75B 2B20A 5C07E 1LO3L 2NZ9D 2QTEA 4AEFA 5L6YH 1HOCA 3GRWH 4L8DA 1NAKL 2Y07L 3NCFB 4ZO7A 3SDCB 1C5CL 4L3CA 3FQNB 3WLWC 4AT6A 5GGTH 3HG1E 4R0LC 5KG9B 5D2LA 1YY8B 4U1GB 4PUBL 4FXKA 1Q1JL 2XN9A 2VNCA 3SE3A 4JPIA 4JPKH 2WWMD 1NGQL 3EDFA 2W9DH 3IJYA 1EDQA 1XGRA 4MA1B 2QQKH 1BQUA 2HG5A 1YUHB 1ZT4B 3MRGB 3BIKA 5E94A 1IGTA 1AQDA 1DLHB 4MAUH 2FR4A 1M71B 4Y19B 4KV5E 1OT1A 1AJ7L 4X6CE 1OT2A 3IDNB 3MRDA 1CLOH 4PLOB 1K2DA 2ZG1A 1RIHH 1WWCA 1NLDH 4DGIH 2FIRT 4GAGH 1CG9B 2C26A 4MJIA 4JAMB 4P2OA 2NW3B 5C9JA 3EZJB 3CFCL 3HN3A 2Q7NA 3WXVL 2EDWA 2H32H 5GZND 2I9LA 2J6EA 2DBLL 3NN8A 1U41A 3BPCA 5I9QC 1A7PL 4PGCB 3ARED 4LMQI 5I1LA 2YSSA 1OWWA 5L2JA 2VDLH 3REVA 4WIQA 3BVNA 1LEGA 2AXFB 1KGCE 5BO1L 4GRMB 3MBXH 2OCFD 3O2WL 4DAGL 5I2IA 2WBKA 3OAUH 4KQ4H 1BGXL 4X7TA 1CTNA 1J86A 5IW3A 1BX2B 4EUPG 1H5BC 1RURL 2VZUA 1BBDH 5BVJB 2Y6SC 5A2JH 5HYEA 2B1HH 4PGEA 5MI0B 4G42B 3SQBA 3LVEA 4XNUL 4LIQL 3OG4B 3VH8A 4CBPA 2R29H 1N2RA 5H35A 4X99A 1F4WH 3D3VB 3MTRA 4OTXH 3T77B 2DIJA 3K4AA 4Z0XB 2D31A 3VE0B 5J11B 3E0GA 4XNQA 4G6KH 5BV7L 1CICA 5L88H 4JY6A 2X4OB 4JCMA 4QRSB 4YHLL 5EFIA 5CILL 2NPLX 4YBHA 2IFFH 3LN4B 2AXJA 4XPGH 4YPJA 1RI8A 2OZ4H 2DQGL 4HD9A 4LPCA 4O51A 4PREB 4H25A 1D6VH 1EGJL 4GS7B 4F58H 5BQ7B 2R23B 4RA3A 1HXYB 1MFEH 1G7QB 1I1FA 1MJ7L 5B4MC 5ALBL 1E4XH 5DTFA 5F89A 1N3NA 4D3CH 4D8PB 5IR1B 1RPQA 3TBVB 3HI5L 1A7OH 1VCAA 3Q48A 4P2QD 2YOCA 3L6FB 1JNLH 3WNLA 3WNMA 2FWOB 2BY1A 1RIUH 2HTKC 5KVMC 2W0FB 3QUZB 2QHRH 3OAYK 5E8NA 2D0HA 2MQ3A 2YPVL 5CZXC 5J1AB 4Y8AA 3PXHA 1QNZL 2PNDA 3KLAA 3QWRA 3GKWH 3HLAB 2H45A 3ARGB 4EBQH 2BHUA 5C07B 1CDYA 4QTHA 4Y4KC 3ULUH 5C09E 2B4CL 3WFDH 2R1YB 2XWTB 4ODHL 3N1QC 4MA8L 3FB6A 5AZ2L 3VRJA 4WW1A 3HG1B 5FCUL 4DZ8B 3TLRA 2F54D 4OAWA 2MPAL 1MCHA 3BIAX 2ICWA 2RJMA 1DEEB 3CDGA 3C2AL 3PP4H 2EH7L 5DYOB 5EO1A 3VWKC 4M00A 1Y18B 2HFFB 1X5ZA 1OAKL 1S9VB 2DM3A 2ZUQB 5JDSA 1FYTD 3MNZB 3CVIL 4FFWD 4CNIA 5SWSA 3HUJE 1B0RA 5F9JB 5GHWH 1QD0A 2DQJH 3D48R 3BGFC 2VWEC 1NAMA 1IC7L 4JKMA 3QXAB 3IS0X 5JW3L 1EIBA 1V7NH 4X6CB 4LVOC 5J3HD 5HXMA 2DD8L 1K8IA 1UXWA 3VI4E 1YQVL 1RD6A 1J0HA 3GMPA 4MZ2A 3UTTA 3LKPA 4Z7UA 2XNAA 4KVNH 2OJEA 3W0WE 4HK0B 4APQD 4BKLB 3EYFA 1B90A 5EORH 1EHLH 5JQHC 4HBCL 2BY2A 1KPVA 3GM0A 1KN2L 4MQXD 4KUCD 1CN4A 1M6OB 3UPRB 4J7RA 4OJFH 1EUUA 1H3PH 1MCKA 5FYJD 1HH6B 2Y25A 4XI5C 5B39G 5K9OB 3T0EC 5KSVA 5B3JF 4L8BB 5EZJA 5DJ0A 2ZNXA 3ZKQD 1CXEA 3PWLA 2A74A 3PGDB 2ZOLB 1JNNL 1G1CA 1XF5B 1V3JA 5EZLA 4NNPL 3IF1A 3VGHA 3S4SA 5BS0A 3QJFA 2IG2H 2AABL 5SX5K 3QH3A 3D69A 4KQ3H 4GLRH 5KJRL 2CDGB 2EKSB 3TV3H 3F6LA 4OZ4A 4NQEA 3KPOA 1NUFA 5HHQB 2G5BA 1ACYL 3MBED 4GBXD 3STLA 1A47A 1ZA6A 2ZOKA 1MJUH 2GSIB 2IAMD 2OK0H 3E6HA 8FABA 4HKZA 5HYQA 4Z7WE 3RWDB 5DJ2A 1QR4A 4XHJC 2O61A 1OAZL 5EOQH 3X3GH 3SE9L 5DHVA 1PSKH 1W0WB 3DTXB 1R3KB 4WENB 1DANT 1KIRA 3I75A 4MMXC 3GMLB 5F3HB 4N0CC 3D1MC 4NKIH 1BFSA 1CYGA 3MLZH 4H20L 3MXVH 4WI9A 4WV1C 1JWMB 1SMAA 1I1CA 2FSEA 4X6EA 3O6FC 3LQZB 4X4XA 5BCAA 3RVWD 4RAUA 4NQXB 5FGBA 4ALAH 2DI7A 3ARFD 4M4RA 3MMEB 2A6KB 1PY4A 2Q8AL 1FAKT 5ALCL 4Y1AA 3SQOL 4C58B 4Z95L 2R39A 3FOLB 4NFCA 4RDQG 4WUUD 5DJ8A 4L3ED 3GGWA 3RL1B 3KYKH 4XRCB 4C83B 4Y2DD 4NO0A 3KR3H 4J4PC 4HHAA 1H9VA 5F9WC 1KB5B 3ZE0F 1TJGH 3SBWC 1HSAA 4OM0L 4BSVB 3L3IB 1HHIB 1NGPL 5C71A 1FRGH 3BXNA 3SDDC 4D94A 1ADQA 2DAVA 1U8QB 4XNMA 6FABL 3NCCB 4P5KB 4S0SD 1KCKA 3CLFL 1CFTA 4ZXBB 3TYFA 4PTUA 3EBAA 4G7VH 4OBRA 1AGBA 4IRJD 3TM6A 2I5YH 3L1OH 3IAGC 2HKFH 3EJYD 4WCYH 3U30B 1UWGL 1X7QB 2P4AB 3OGOE 1X5JA 3F7YB 3TT3L 1H15A 4YHZH 3O4OB 2Q7YA 3HUJB 2EDNA 3H0TA 4UV4L 1HXMA 2EDKA 5C0JA 3BSZL 1OSPL 2DOCA 2A77L 2EDOA 1IMHC 3L3OB 3RTQD 1WWAX 3C87A 4UILL 4KU1A 2MFNA 2FNBA 3GIVB 3L95A 3WLBA 3CXDH 5HTSA 4YFEA 1OARH 2I26N 3BQUA 1OAXH 3VFUA 2ITDA 4IBLT 5HI3D 3W0WB 4JFPB 4R90H 5BV7C 1BZ7A 1W8OA 4D0DA 5DURD 3NABL 4R3SB 4JN2A 3QIUD 4UIKH 1EHAA 1PYWB 1RJLA 1ZT7B 3FB5B 4HH9B 5CSZA 5JW5A 3MRIA 3WE6B 3TIDA 2UY7A 4Y5XB 5I71B 1AKJA 1JJUA 2N56A 4YHML 4BFBD 3G6AB 5JOFA 3K7UA 1VFAA 2B0SH 4QHLA 5E03A 1NBYB 1GL4B 3UJIL 4AL8H 2VH5H 2AKRB 4POYA 2DYPA 3DXAD 4R97C 5INDB 4KI5C 5IF0A 5C0DB 1P1ZB 4MXWH 1JN6A 2VDQL 2CMRH 4MAYA 5ADPH 1ULVA 4M1GH 5CEXB 3HNSH 5I16A 3GHBL 4PB9L 3H42L 5CMAA 3QULA 3S37H 4BSWA 1NJ9A 1YEHL 1YNLL 2Z8WC 3GSNA 3WJJC 3GMOB 4YX2L 1U8IB 4ORZC 4NO5A 1M4KA 2B4CC 1TTGA 1FFNA 4Z7WB 3CX5J 3MRLB 3DRTB 5T5NG 2ADGA 5IMOA 1N59B 4ZYKB 5HHPB 5DSCB 5IQ7L 1T3FA 1IC4L 3LSOB 3Q0HA 3CH1A 2JJUA 4OZGF 1JL8A 1ZLVH 2G75B 2PW2A 5C0IA 1VESA 1U0QA 1Q0YH 1U93A 2FHCA 5D1QA 4LSPL 4YXHH 3H2WA 4N8CH 3V5HB 1M7DA 4DKEH 1MJ8L 4ZFZA 4K3DH 3FQWA 1QR1A 4JZOA 1CVSC 4O4YL 3O2VL 1MHCA 3I2CL 5EC1A 4A2LA 3TBWA 3X3FH 4AMKH 5LVEA 2BOBA 2F53B 3OJVC 4CN6A 2AXGA 4X7DC 3N85H 1KIPB 3MUZ1 4MDIB 5GSVA 3LV3B 3RA7L 3MR9B 4O5LH 4NQVA 2WIIB 2CDFA 1ZE3C 4LCWD 1DN0B 3K2UL 4FFYH 4KVCH 1S7VB 4D2NA 3F5WA 1NDMB 4GMSH 4OBSA 5KW9L 3U0TB 5EN2B 4MX7B 3P9MA 4BYHA 5IBLD 3DMMA 3C9NB 3ARDC 3I3DA 2YN5A 2ID5A 1BFVL 4HPOH 5E6IC 5FUZH 7FABL 4RFNC 2PYEA 2PTTA 5SWQA 1NSNL 2GYSA 4MJ5B 3QXVA 4B7IA 3QBTB 2CDEA 3VXRA 4LLQA 4G9FD 1RVFL 2ADIA 4P23D 1FNGA 2QSCL 3IDUA 2EZ0C 1FVCB 4EDXB 5ACMA 4YGVB 4NPYB 3O9WB 4XP1H 3BPNC 3ZKNC 2MWCA 4G7YL 5E2UH 3HMXH 1MQ8A 3GMNA 3C5ZA 3QUYB 2RHEA 4OLYH 4TUOA 4L4VA 4EN3B 3I9GH 4FQQB 3V5DB 1MY7A 3TO2A 1QA9A 3MZGB 1FVEA 1I9JL 2ERJC 5JW4R 4JZJA 3LDBB 4P2QE 5GGSB 1OVZA 1I85C 3DROB 2R8SH 2C3VB 3OKNA 4RRPG 1VFMA 3HPJA 3FT3B 4KRPC 4PRIA 4WO4A 3VXPB 4J12A 4PJIF 3HE7C 1YEDA 2EDEA 1ZOXA 4L1DA 4S2SA 4NQCE 3TFKC 1JPFB 3VXUE 4GSDH 4XMPL 2CLZA 2ICEA 4PIRF 4FZEL 3HPLA 1ZLSH 3V0WL 1A1OA 3T65A 1GJIA 4HZLB 3K8KA 2OR9L 5B8CA 2Z35A 4LFHG 1RHHB 4M7KL 2FO1A 4Z7VE 1A2YA 5GS0D 3JSSA 4J2XA 5GS1A 5DFTA 3WFHB 4OZHF 3BZFB 4JDVB 3PQYA 4F57L 2P47B 1FYTE 3E6FA 5KSUB 4PPTA 4LRNL 3I6GA 1ZTXH 2EO9A 4RA0C 5DQ9A 5GGUA 3WL9B 2EDQA 4PY7A 1JGDB 4RGND 1KF9B 2VLJA 4R2GD 1MLBB 3VFRA 3QQ3B 2LE9A 4I3GA 2IADA 1B0GA 1UFUA 1IQDA 2FBOJ 3JUYA 2WP3T 4LARH 3RI5F 3OGCB 4QRRD 5TE6L 2DN7A 4R0LA 2AJZB 1UYWH 1VDGA 4G6AC 1J87A 2PYFB 4HCRL 5IESL 2BNUB 4PJ9D 3CVHL 3B4NA 3SJVA 1BIIA 1CU4L 3LPWA 1BJ8A 2VRAA 1QZ1A 3WNPA 1X5FA 5FYJE 3WKNA 3NCJH 3I3BA 4AIZA 2FJHA 4P3CL 3SKOA 1P7QB 2VLKE 2XIDA 2YA1A 4PJEE 4PRBB 3TJHD 4JY5L 1WTGT 5D7JB 2GTZB 2XN9D 1YNTA 5CIPH 5L8JB 2E9BA 5FDWA 4N68A 3M8OH 3N1GC 4JRWA 3RIFK 2AQ1A 1RZGB 3FO0L 1P7KB 1IAOB 2NY5L 1I8MA 1N64L 4PP1D 5CCKL 1D6EA 1XIWC 3TYGH 4GW5B 1QBBA 4NIKB 4CUCA 3ARWA 3NMEA 1ORQB 4KK9D 4GRWF 5GJSH 1YEGH 3GRWL 5L8LB 2NLJA 4FS0A 2Q8BH 2DI8A 2F5AH 1PW3A 5IWLC 2FIKB 5CS7A 1SJHA 1CD0A 5GGTL 1CL7I 5IB5B 3DURB 4YHNA 4MJID 1L6ZA 5HYFA 4P2OD 3EYVB 4JPKL 4RZCA 3IJHB 5GRVK 4DQOH 4BQ9A 2W9DL 2BFVH 2GITA 5J6HA 2EDTA 5AEAA 4LDLB 3ESVF 3OKLA 2QQKL 1P2CB 4KH2A 4AIXA 3DO3A 1H5BA 1F58H 2HJLB 4P2QB 4HJGB 1FVDA 4MAUL 4L8CB 3RDTB 2NY6B 1I3VA 5I8EA 5ESAA 3VFMA 2QKIA 5EOCJ 1CLOL 4Y4FB 4ZUWA 1FNLA 1RIHL 4MMZC 1S78D 2GJ6A 3SDXE 4WUUE 3ZDXF 3KG5A 1NLDL 4DGIL 4GAGL 4L3EE 2Q20A 4QCIA 1HNGA 1FNSH 3DYPA 5ICZB 1JZ3A 1BM3H 4NQCB 1N6VA 3VXUB 1AH1A 2W38A 1A9BA 2VITB 1MCFA 1X3DA 2DIBA 2WW8A 1HEZB 1II4E 2FL5B 3PWPB 2VDLL 1XF4A 1N5YH 4HT1H 4F7MB 2ADJB 4PJFE 4JRXA 1CICD 4Z7VB 1FL3B 2FH8A 4ONOA 2P8PA 2NY2C 3MBXL 4ENED 5IMMA 1FYTB 1J0KA 4P9MH 3OAUL 4MNGA 1JGLH 4ELMA 2KZ1B 3DX6A 1BBDL 2K3TA 4KXZI 2B1HL 2BVQA 3F12A 1L9NA 2AQ3A 1DJSA 3RHWF 5HYIA 5JNYB 4XPTH 1TMCB 3PWJB 2R29L 4H1LA 4JDZB 3ARBB 2X1QA 2DJSA 2BSED 2V5TA 1F4WL 4U1LA 4OTXL 4Y4KA 1G7MA 1S7UA 4U1KA 3MV11 5IUSA 4APQB 4BH7B 4XCFH 4G6KL 2AP2A 5L88L 3U2SB 2QBWA 1F3JB 3V95A 3QWRD 5D7KD 5EDXA 5HDQH 2PO6C 3O11B 2IFFL 1W0VA 1XGPA 4XPGL 5DJYB 1D7FA 3STBA 2OZ4L 4GJTB 3VWKA 2DQDH 1GSMA 1D6VL 3UYOD 1KEML 3OKDA 5DGRA 4F58L 4KK5C 3QI9C 1MFEL 2DL9A 2L0DA 2UYLB 3B5TA 1N0LA 5I1IH 4XVUD 5C0GA 3HAEA 1E4XL 2VLKB 4OZIE 4D3CL 4JREC 5DUMH 4JFDA 3RUGA 1P4LA 3AFLA 5EO9B 3C5JB 3R06A 4J1UA 2AK4A 1A7OL 3DXAE 1TCRB 1JNLL 4DGVH 4AY0A 5F3BA 1RULH 1YYLH 1RIUL 4M7ZB 5IOPA 5IEKB 2OMNA 3EDEA 3MREA 2QHRL 1I4FB 1F4YH 3RAJH 3FQUA 3CFDB 3ARUA 3GKWL 2XTJD 1PVHA 5SWSD 2X9YA 3QEQB 4ZSOA 4GBXB 4EBQL 1X4ZA 3RY6C 4JO1H 3ULUL 3HE6B 3WFDL 4TVSa 3AM8C 1QHPA 1FIEA 1WCBB 3TZVC 4G8EB 4P3DA 3UTTD 3T0EA 1QVOA 4GKSA 3QUXC 3EOAA 5D7IB 3PP4L 3ARSA 4LKXB 4G8GA 5DMYA 4KMQA 4M3JA 1L0XA 4X6DE 4NRYB 3PDDA 4JG0H 4LOUC 3TNNB 1EBAA 1F11A 4ZNEA 1WAAE 1TZGH 3BJ91 2BVUA 4K3EH 1S8DA 3UXFA 5GHWL 2WLYA 1T5XA 2FEDD 3FOMA 2DQJL 1CD9B 4U6XA 4NZUH 4ZAKA 3BDYH 3UC0H 1X4XA 3L3HA 1V7NL 2F19H 3OKEA 4OLUH 5D2NC 1ND0A 5BW7C 3NPZB 1SBSH 1IAKA 4V1DE 5GSRA 3SDXB 5BS0D 4NO2B 3O3EA 4JM2B 3QCUH 4L3EB 1D5XA 4KVNL 2DMKA 1QSFA 5EORL 1EHLL 3D0VA 4NQED 1HYRC 2NY0C 1I7TA 3GSWA 4U7KA 3T0VA 5IVNA 3X14B 1U58A 1ZVSA 5EA0H 2ICWJ 4UDUA 5CEZH 3VWJB 2X1XR 4XMKH 4LF3B 4OJFL 4RAVA 4ODWB 1NEZB 1H3PL 2ED9A 4M03A 3EJJX 1ETZB 5EU7E 1AXIB 4WV1A 5ETUB 3ZDYF 1DUZA 4G9FE 4KGJA 1J8KA 3FHAA 2VXQL 3LY6A 3OAZH 2JB5H 5KZCD 3DO7A 2IG2L 1YMME 5GGRB 4KQ3L 1NFDE 3Q1SH 3TV3L 3RIAK 1W0YT 1IE5A 1FN4A 4U7SA 3RTQB 4YHYB 1NH6A 4J4PA 1K3ZA 3GJFA 1MJUL 4LCCB 3WDIA 2OK0L 2F74A 3RL2B 5FK9B 1AGFB 4I9WD 4LVHC 4Y1AD 5IVXF 1KTDA 2DWDA 3SDDA 4AM0B 1WFNA 1R3JA 4ZFFB 1PZ5B 5F9OH 5EOQL 4CADA 3R4DA 3X3GL 1R5IB 4M5ZH 1AGDA 5CKAA 1PSKL 3VU2A 3HHRB 2CK0L 3RWEB 1MLCB 4NO0D 2Z93A 1KLUA 3HR5B 1NC2B 4E5XA 1UXSB 4IOFC 4LGPB 4PJAF 3EHBD 3RWCB 3IKKA 4NKIL 2YC1A 3MLZL 3MXVL 4HWZB 3CMGA 3I6KA 4OLVH 5ID1A 4JFXB 3V6FB 4FQXC 3EYQD 2APFA 4WNQA 3DXAB 2UY6A 3RKDC 5ELIA 4ALAL 3V6OE 4XTRD 3FCTA 4BSJA 1TVBB 3QWQB 3T0DA 4UI2A 5ACZB 5I1CH 2OQJA 1ZHKB 1P9MC 2AQ2A 1JWUA 1G9MC 2WBJC 4YAQA 3KYKL 3PJSA 4QYOA 3S7GA 3KR3L 3O2DA 2WWKO 3BEVB 1AXSB 1TJGL 3VGAB 2JK5B 5A16B 2DQCH 4MQTB 4QF1B 1FRGL 5FXCH 3QCTH 2HP4A 1V05A 1EGJA 1I7ZB 2HT2C 4QRRE 2VAJA 3IRZA 3BQUD 5MP6L 5EO0A 2XXMB 4ZS6D 2CUIA 4BQ6A 3ULVD 4AH2B 4G7VL 3BEWB 3HCVA 2I5YL 3L1OL 4HS6A 1Y0LA 1W8NA 2HKFL 4OKVB 4X6DB 4WCYL 2BSSA 3RJQB 5C08A 3BW9B 3QDGA 1A9EB 4YHZL 2M1KA 3WO3B 2XFXA 4KMLB 5EZIH 1AKJD 1INQA 2NY1D 5DD3H 2OTWB 2XKUA 5D2LE 4R4BA 3KPPA 3WJJA 2DYPD 1G7PA 2X4NB 2YD1A 3CXDL 2Z31C 4I0PB 4V1DB 5CGMA 2I25N 1HWGB 1FL6A 2BVPB 1OAXL 4JR9H 5F72S 2DQIH 4R90L 4MAYD 2AJ3B 3UP1A 3W9EA 2J8UA 4HUUB 3W82A 4NO3A 5FIEA 4OCLC 1BLNA 4UIKL 2K7QA 1MH5B 2BMKB 2GK0B 5SX4H 4WRLA 3U9PH 2AEPH 4YHPA 4BM7A 5A2LH 5FECB 4M1CD 4CJ1A 1QFWI 1S9YB 2B0SL 1GAFH 2UUDH 1FZKA 1MCPH 1G7JA 5DS8A 1KSRA 4AL8L 2VH5L 1XF3B 2WINB 3Q5OA 5D5MF 1A3LH 3VRIB 3KPLA 4XC1H 1YYMH 3QFDA 5DUBB 1YMMB 4MXWL 1NFDB 2CMRL 3MRHB 2R69H 4RBPH 3DI3B 5ADPL 4M1GL 5IT2H 3HNSL 5D1QD 3IGAA 4IRZH 2IQ9H 2Q6WA 3U36A 3CC5B 5HYSG 3UAJD 4BK5A 2J2ZA 4HWNA 1FJ1A 2J5LC 4HGKC 4E41E 4OZHA 3DYMA 3PXJA 1FG2A 5BJTA 5E8EB 4R4NC 1V5JA 3GMRB 3ULUC 2OR8A 4MD5B 2G9HA 1NL0H 3ARDA 5E6IA 3QNZB 5F8QC 3RWJB 1ZKAA 1AGEA 3DUUB 2HVJB 4EI6B 1KJ2H 5DC4B 1EFQA 1EUTA 1Q0YL 4U1HB 2OM5A 1WWBX 2GAZA 5JO5A 4YXHL 3DMMD 4AIOA 4DKEL 5MEPB 5I66B 2A83B 5JXAH 4K3DL 2PYED 2VL4A 5DJXB 3QIBC 4GKOA 5DVMA 4P4KC 3S5LA 3VXRD 2IH3A 2IEPA 3X3FL 5IFHH 3IXTA 4AMKL 2D7OA 4YHIB 5DF0A 1I85A 1TZHA 3N85L 1KLGB 2V5YA 3UCRA 3KPNA 3QDHA 4IRSA 1CZ8H 3FQRA 4O5LL 5ANMA 4RGMC 4JFQB 5BZDA 3BJLA 4D9RD 4TSBH 3C5ZD 1FP5A 5DJ6B 4L4VD 4F2MA 3HE7A 4FFYL 4KVCL 3DIFA 4GMSL 1JGVH 1JZ4A 5DQJA 2Z91A 4HPOL 3SCMC 4FQIH 4H5SA 5FUZL 4KMTH 4LP4A 4QRRB 3TN0B 4E0RA 4LDEB 3Q5YA 3QNXB 4QT5B 2V7NA 2YD8A 5FYLD 1L7IH 4UU9B 4UQ3A 4FHBD 4N0FA 4PRID 5D7KE 4WO4D 3KDMB 5AUMB 5GZOD 4M3KB 1U6AH 4HX1A 1EZVY 4QRPA 5C86A 3RX5A 1S7XA 4HV8B 4XP1L 1WBYA 5E2UL 3MPCA 3GJFK 3WSQH 3HMXL 3IVKA 4OLYL 5F6IB 2X9XA 4OF7A 3CFJA 3I9GL 4U6VH 1OAQH 1DN2A 1IT9H 3WO4C 4AQ1B 4OGAC 1MFAH 1UB5B 4OZFH 3U82B 2R8SL 1DUYB 1CD1B 4LCYA 1DVFC 3PQYD 2XTJE 3BP5B 1AO7B 5SWSE 3BPNB 4HAGA 4L9LC 2Q86A 2Q76B 4RDQF 4YNYA 4NZJA 1UJTA 4WTZG 2VLJD 4GSDL 3ZZ1A 1DDHA 4LSQH 1ZLSL 3S96A 1TETH 4KJYA 4HIIB 4LU5H 4JZNA 4GOSA 4PJGF 5FHAH 2NTFB 5GJTH 3RP1A 1EH9A 4KDTA 5DMJB 3WLWD 1BMGA 3DYOA 1A02N 1AC0A 1YN7B 3QCVH 4PG2C 1LMKA 3EJZC 2A0LD 3SJVD 4Q9BA 4PRAA 1ZTXL 1OGAE 4C4KT 1BQHA 1NGYA 5CZVH 4E41B 5H2BA 5CSBA 2MSPA 1I3RB 3GSOA 1LP9A 1XIWA 3QZWG 1JE6A 1ZWIB 4XX1E 5E5MB 1QBAA 5IMKA 5BS0E 1FFPA 3BH9B 4LARL 3LS5H 1JRHH 5F1SA 2NXZB 2VMFA 1FZOA 3L3DA 5TDOA 2YZ1A 5IK3A 1VSCA 5I19H 5DRZA 5F1KC 1UYWL 1X4YA 2UWEA 4NJ9H 2VUYA 4PJCA 4B53A 3WDJA 1EEUA 2M26A 4X9HA 4OV6F 4A2MA 4NDMA 3QEUB 4CU8A 3NCJL 1CGXA 1W72A 4ZFOL 3WFBH 3KVQA 5IB3A 1CICB 4XAWH 5J12B 2N4IA 3NCBB 4JY6B 4JQIH 4YIQA 2X41A 5I6XC 3W11D 1UKSA 1JPGB 5KN5B 3LRSA 4K7PH 4XWGH 4POZC 1T04A 3ZKXC 4GRLB 3M8OL 1YEIL 1T6WA 1U3ZA 1XGYH 2FGWH 3VFSA 3VFNA 2WAHA 2ZSWB 5TH2A 3VXMB 5JW4Q 3HRPA 4OD2B 3WBDA 5ERWA 3L5WA 1A1NB 4Z77B 3TYGL 2Y6SD 4MA3B 2E7LA 1BREA 5GJSL 1YEGL 2X4QB 5DD5H 5E8NB 4PJ7E 2GJ6D 4RMWA 5JIKA 2F5AL 3GSUA 4JFFA 2AEQH 3BWAA 3DX7A 3O45B 3HTLX 5C0CB 4XPAL 4MXQD 1TJIH 2ZCKH 1J11A 4W4OC 2BRRH 4MS8D 4DQOL 1ROWA 4G6MH 2BFVL 2J8OA 1MCDA 4DW2H 4HIEA 1Q9KB 4MNHB 2HVKB 2EYSA 3ET9F 3QB7C 3L7FB 1F58L 4LDOB 4N0UA 3VRJB 2AJUH 5IW6A 1YPZE 4WI8A 4Y16C 5B4MD 4F33B 1KULA 5B38A 1XZ0A 4JFYA 2YD7A 4JRXD 3VDBA 3G08B 4BFIA 3BIBX 2QLVB 2HTKD 2XTJB 5D1ZC 4WHCA 4HG4K 5CZXD 5IJKA 1DQLH 2YPKB 3KPQA 4WU7B 1NUGA 1BM3L 2FECL 5F7MC 3ECBB 1XCQA 5EUOA 5E4EC 4Q9RH 5HHVH 1DQMH 3V5KA 3V6BR 1BD2A 3TP4A 3NPSC 3Q6FA 1UXWB 2E6QA 3CU7A 3FRUA 3QI9A 4KTEH 1XR8A 1F02I 2XNAB 4FTVE 1N5YL 4HT1L 3UTQB 3N0PB 4OFKA 1F6LL 1OTSC 3V6ZB 2B2XH 2J1KA 1I7UA 4X5XB 1S5IH 1Z9LA 1LEKB 4P9ML 3K1DA 3VWKD 4LAJH 2CLRB 2R1WA 3ULSA 1JGLL 5HJ3A 2G2RA 1F2QA 3V0VB 1OGAB 4ORGB 1G84A 4MSWA 3LEXA 5HGBA 5EU3B 2V2WA 4EI5B 4AQOA 1PZUB 3C60C 4JFDD 1B9ZA 2A74B 1VB9A 2AK4D 2IPKA 1ZANH 1UB6A 1WJ3A 3AM8A 4XCFL 2NY2B 4L1HA 1T1ZA 2ITCA 5CP7A 3TZVA 4AG4H 3VXTB 3RWGA 3RPIB 5IBUG 2NX5B 5HDQL 3QUXA 5KSAD 4P5TC 2A6JA 3STLB 2ZOKB 1MWAA 2DQDL 3C5SB 8FABB 5T3XE 1ZLWK 3CXHK 4DVBA 5I1IL 4M61B 5DUML 3ARXA 1UZ6E 5IIEB 1QYGH 1MRCH 4GG8B 4ZUVB 5DHVB 3OL2A 3T0ED 3VH8G 5IFJA 4DGVL 4OKDA 1RULL 4P2RE 4L29A 3VXNB 1YYLL 4G8GD 5D2NA 1R5VA 3Q3GA 4HKJA 1F4YL 2PO6B 3RAJL 1IBGH 2D7TH 2C1OA 3INUH 3QEHA 5DRNA 3B43A 4J3SA 3LN5B 3D25B 3Q2CA 4BUHA 2D3VA 3SGEH 1KNOB 4JO1L 4ZAKD 3GSVB 1QSZA 2BK8A 1S7QA 1O7VA 4PJ7B 4M6AA 4EUPA 3PDOB 4NM4H 2APWA 4PGBB 4XHJD 1QSFD 3OZ9H 4WDIB 4CRPA 5JHDA 5FO9B 4GW1B 1AP2A 4I0CC 4JG0L 4RFEA 4NZRH 5CD3A 2P5WA 4WUKH 4KFZC 3V52H 2PYEE 1F90H 1TZGL 5LXGH 4K3EL 3QJHA 1YPZB 3SO3B 3KYMA 4QWWC 3K1KC 4HK3J 5DJZA 2H3NA 4NZUL 5FM5M 1R6VA 3VXRE 1SHMA 1IAIH 3BDYL 4MB4A 4NNXB 3EO0B 4WU5A 3UC0L 1EEZB 1FZJB 1PG7X 2F19L 4OLUL 3U4BL 3JXAA 1SBSL 3U4EA 4OLEA 5GISH 1U8NA 4TQEH 3EGSA 3QCUL 4DKFH 1A6VH 4X4ZA 4D9RE 1HN1A 3I02A 4S0TD 1YQ2A 4L4VE 1WZMA 1IM3A 4NN7B 1N0XH 1GIGH 3HS0B 3G5YB 3G5XA 3HC4H 1R24A 1AHWB 1U95A 5EA0L 1FFOB 1KPUB 4GKNB 1MAMH 1EFXA 5DI8B 5CEZL 1FGVH 4J4PD 4Q9QH 1UWXH 2P44B 2VLRB 1VADA 4XMKL 1DBBH 1WITA 5C0EB 2X1WL 4M4PA 3P9WB 4WJ5B 5FYLE 5E56A 3VFUB 4FTVB 1AR1C 4XH2B 4PRIE 3BUYB 3SDDD 2X4UA 4TPRH 4FQXA 4E42B 1RJLB 1WBZB 2JB5L 5E9DB 1JGUH 4LSUH 2H6PB 5HSFA 3U48A 1MCCA 3VDAA 3KYNA 4YFLF 2NY0B 5CBEA 1FZMB 1KYOK 2BSRB 2ZSVB 5CHNA 1OGTA 3T4AA 3LKQA 3Q1SL 3CVHB 2VDOH 1JF6A 3RGVB 1CIUA 1LK3H 5FB8B 3FTGB 3OB8A 4KAQL 4PRHA 4YXKH 3WN5B 4I48B 1OCWH 1I1AC 4KK6C 3F58L 4HGMA 4WHYG 1I9RH 1MHEB 4D0BA 4PJXA 1T20B 1MCWW 1WVZA 3V0AC 1I1YA 1F13A 4ZOBA 5HGDA 3PQYE 5E0QA 5D70L 2GJZB 1QSEB 4JHAH 3VXSB 5F9OL 5BXFA 5CMAB 2C7UA 4M5ZL 1FCCA 3IAPA 4U6HA 3IJSB 4OV5A 2VLJE 1A1MA 4L8SC 4YFDB 4JN1H 1CGTA 1TTUA 4OLVL 2ADGB 1ES0B 5I8OH 3O81A 3FQTA 4HUKB 4LVHB 2RGSA 4X5WA 2E7CA 4OCMC 4P2RB 2AV7A 2P48B 1I8IB 3MGTA 2Z31A 3H9HB 2RR3A 5I1CL 3P77A 5EBLA 4KI5D 3TH2T 5IM7B 4ONGH 3CUPA 1RUAH 5C08D 5B39A 3QDGD 5K9QG 1MHCB 1M05A 2E8YA 2BZDA 2R2HA 3ROLB 3TT1H 2DQCL 3MRBA 5DZOA 3QCTL 5TDPA 1XGQB 4G8IA 2ATPA 2APXA 5E1AB 3MLYH 2XV6B 5SWZA 1UADC 1UQSA 4QXTB 5C6PB 2YD2A 3SPVA 3W9DB 4OIIH 4XZUB 1DBJH 2WBJB 3MSPA 5EIVA 1N5AA 1Y6MR 3IXAB 2D2OA 1A4KA 2P7TA 3NZHH 4KGLA 1TZIB 4M5YH 3RBSA 3I50H 4Y4HC 2PYEB 2H32B 3PWNA 1SY6H 4YBLC 1JZ2A 4FXGA 4PR5A 2XY1A 5E95B 5DD3L 5KS9F 4NKDB 5DWUH 5H37G 4OUUB 3L3KA 4WEBH 4YDVB 2NW2B 4PLJC 1BP3B 1EO7A 2B39A 5IFAH 4GAJH 1FAIL 4JR9L 3OXSA 2DQIL 5T1LB 1YC8A 3O3UN 5AZEH 3GSXB 1LO0H 2Y72A 2YBRB 1E28B 1DBAH 4KKLC 1SEBB 2V2XB 2O5XH 1T0MA 3U9PL 2AEPL 1XR9A 5SV3A 4X7SH 1KN4H 2GJ6E 4OF0A 3ARDD 5E6ID 3K0WA 5IP4A 3IKCA 4JFED 1ZAGA 5T1MA 1GAFL 5CJXA 4XBGA 1MCPL 1CIDA 3QIBA 3RPKA 3TPUA 1HILB 1A3LL 3CSYB 2VAAB 4XC1L 1YYML 4P4KA 4XNZC 3QUKA 4XCNB 1U92B 2LFGA 2CIIA 2R69L 4HS8H 2EZ0D 3B9AA 4ZO6A 5IT2L 1DE4A 4IRZL 2IQ9L 2CLVA 3ZKND 3CJJA 5DVNA 3GZKA 1MCOH 4BK4A 4P48A 1JTPA 3BAEH 3TA3C 3ALWA 5D9SB 5GS1B 1NL0L 4FN0A 2GKIA 4XXDB 5H94B 1FO0A 3SCMA 2DIAA 1TVHB 2YPLA 1C16A 5B3JE 1YMHB 5IEHA 4IRSD 4PY7B 1U2HA 1LNUA 4JY4A 4KRPD 3F7VB 4F37K 3SKNA 3TCLB 3HE7D 5DMKA 1KJ2L 5EU5A 3BZ4A 5EBMB 1T66C 4M7LT 1KJVB 3KHOA 1VEOA 5JXAL 2EXWD 3ABZA 3P4NA 3ILQC 3QDME 3WFEH 1JGEB 5C7XH 1JFQH 4FQCH 1NFIB 4WW2C 5IFHL 3QISA 1C1EH 1VPOL 1I7RB 2EDDA 2YD4A 4QRPD 1HKLH 1CZ8L 1Q94B 3FFCA 3VFPB 4QRUB 5CFHA 1DVFA 3M17B 4TSBL 3RZCA 1BZ9B 3RUGE 4PTTA 4L9LA 1JGVL 2PTUA 2JCCB 1ITCA 2VQ1B 3H7BA 4HMCA 5KSBB 3G9VA 4HXAH 5IQ9A 2VWEE 4LNRA 3BZEA 1YNTB 4FQIL 1T7VA 1TIUA 4KMTL 3BN3B 3G5ZA 2DDQH 5JLZB 4Z78B 5DK2A 5TQ2H 2GTWA 1L7IL 4HG4J 3WDHA 2JF1A 2LU4A 2NY3C 5F21B 3G6JF 1U6AL 2CIKB 1D6EB 1G7IA 3LH2H 4RIRB 3HC0B 2EDYA 3GFUA 4MD0A 1D9KC 1MHPH 1G7HB 4G6AD 1X6NA 3WSQL 3ZE1E 4U6VL 5IW1B 3OXRB 1OAQL 4PJDF 1IT9L 1J18A 3GMMB 4CMHB 3JV4A 3ZE0E 1Q0XH 4QHUA 1MFAL 2EE6A 2HT4D 5E00A 3AAZA 25C8H 3FQXA 5FA4A 5TDNB 4KUCF 3BI9X 2ED8A 4C56B 5JIPA 1HHHB 5HI4C 4PJBA 1T1WA 2HJFA 2ICWI 3ZTNH 4NN5B 4F15C 5K59F 1H3UA 1CXIA 2VISB 4I4WA 4WI7A 3V7AE 4S1DD 4PJEF 1NANH 3ZDZF 5EIIB 5ENWA 1XIWD 4LSQL 4ZUWB 2X44D 1XGUA 1TETL 2GJ6B 1I8KB 4WW2F 5ISZE 4LU5L 2YUVA 2FEEI 5FHAL 2BJMH 3RNKB 5GJTL 1OB1B 3IYLW 4NKQB 5E5UB 2HN7A 4BZYA 2CRMA 1JI2A 2B8OT 2OX5A 4KY1H 4X98A 4NKOA 2J8HA 5TFSH 3QCVL 4GKZA 2YXFA 3CXHJ 4HXBL 1A9BB 3IS1X 2HMIC 1S7TA 3BP6A 4YE4H 1A7QH 3BKCH 2AK1H 4NRXB 5T1KD 5CZVL 5INCA 3VFGH 2HFGH 5GRUH 1T21B 5HDOA 2VZ1A 1E0OB 3LS5L 1RV6X 1JRHL 4ERSL 3ZT6A 3TVMC 2EYRB 2Y5TA 5I19L 4NJ9L 2XYCA 4K9EH 3EFFA 4I2XA 5FYJH 3KPMA 7CGTA 4PGZA 4G6JH 1SVZA 3DBXA 4YH6A 2FJFB 5DD6A 4TSCH 3LKOB 5JA8B 3TBSB 2XKNA 3B9EA 3QDMB 3WFBL 5D8JH 4XAWL 4JFFD 3PG2A 4JQIL 1WFUA 3B2VH 2IGFH 1SYSA 5D1XB 4NT6B 4K7PL 3T8XB 4U4BA 4XWGL 2XPGA 1VGKB 5FYKE 4U0RC 4K7FA 1HHGA 1XGYL 2FGWL 4UUJB 4K23H 5K9QI 3FO1A 5DJAB 5DR5H 1C5DB 2IJ0C 3CFEA 3QO0A 1K5NB 4OZGE 2E8ZA 1GH7A 2AJYH 1U8MA 4OGYH 2ARJA 4CVXB 2I60H 1BVLA 1DQDH 3C6SA 2HTLD 3LN9A 2CKBA 5F1OB 4IMLA 3QAZB 3MRKB 5DD5L 1K8DB 3GSQA 4NC2B 2R2BA 2AEQL 4Y0GA 3VD4A 2QR0A 1H3VA 1OSZB 4Y89A 5KSAB 1TJIL 2ZCKL 1GGBH 5A2IH 2BRRL 5D71L 2FJGB 4IM8A 5F1IB 5DA0B 2HLAA 4G6ML 1NCDH 1RJYA 3CNKA 1DSFL 3CX2A 4PRPA 3WUWB 4DW2L 3IRPX 3PGCA 1BD2D 2ZJSH 4LNVA 1GGTA 1MFCH 4O02H 5D7LA 1Z9MA 2AJUL 3QI9D 3GK8H 4P3DB 2BVOB 2P5EE 5EBWA 1NLBH 1QVOB 5I1DB 1VHPA 4Y5VC 3C60A 1U8PB 2HYMA 2GCYA 5J13C 1KYOJ 2ARJQ 4HEPG 1OP5H 3PL6B 3SDAB 3TNMA 3BGMB 3RWFA 3SN6N 1DQLL 3HMWH 4PJHF 4X7CC 2QADC 1PY9A 4MJ4A 1U8JB 3BP4A 5L2KA 2CSPA 4ZAKB 4P5TA 2BY0A 5IVZB 4Q9RL 5HHVL 1DQML 4C57C 4I3RH 1T7YA 5ISZB 3MJ8B 1IAKB 3TGXA 4KTEL 2XT1B 2FO4A 2ZNWA 4LHUB 4FQJH 1IEAA 1D5XB 1WQVT 3D39E 5HVHB 2J8UE 3D0VB 3FL7A 3RNQA 3TZVD 1HH9B 1I7TB 3WJLC 1AXTH 3U83A 3QUXD 1S5IL 5C0BE 1F3DH 5IVOA 4WWKA 3QXDA 1QLRA 3X12A 1RMFH 3MLVH 4ZO8A 4PJIE 3QG7H 5AAWA 3HC3H 3UZEA 4HJ0C 3FN3A 4RQQA 3DECA 3SDCC 1ZANL 3MCLH 3JVGA 1PGRB 2QEJA 2R0KH 1UCTA 4U1GC 3H3PH 1JWSB 3H9SE 4X0KA 3LS4H 4AG4L 3GB7B 2Z0BA 4MCZA 4XXCC 5JORA 3VCLA 1U91B 3GJEA 4OZHE 1MIEH 1LE9B 1QRNE 2IMMA 4M62H 3ES6A 5C0AA 4M1DH 1RZJH 4HWBH 4JQVA 4WGVB 3KPSD 1K4CB 4JFEE 3OR7B 2NXYC 3E3QE 3O4LB 1Q9OB 2OMBA 3LZFH 1QYGL 1MRCL 3S3PA 1EZVX 4H1LG 2HJKA 5KVDH 1IM9B 4FQ2H 4O2FA 2OTUB 4RAHA 3WIHH 1GPOH 5JHDD 4PV9B 4LP5A 1IBGL 2D7TL 3INUL 2GT9B 2EDHA 3DRQB 5E8OB 2IQAA 2P5WD 4OZGB 3OKMB 5ID1B 5IHZB 3VFWA 4J3XA 1KBGH 3X11A 4JB9H 3MNVA 3MUGA 1T5WA 4X4YA 2EXYC 3MRFB 4NM4L 5MEQA 5FO7A 3MRCB 4QYOB 3AS2A 4LMQE 3OZ9L 2IH1A 1NEZG 4KZDH 5HVGB 2BDNH 4GG6A 1JK8B 5CIPA 2VABA 3L3GB 1EFXD 5MI0C 4NZRL 3QUMH 4ZPVB 3V52L 4WFHD 4PGDB 5HYJB 1F90L 5LXGL 2FZ3B 1G7LB 4P57B 3KYOB 2H1PH 2P5EB 4U3HA 3CAFA 4KRMB 1JYXA 5T3ZD 1IAIL 1QLFA 2BCKB 1I1AA 4DZBA 4FQXD 4GRWE 4WEUD 1HDMB 3EW3B 4JKKA 1WZKA 4ODXB 3RX8A 4HS6B 3BN9D 3UTSB 1MJJB 5GISL 4IOIB 4TQEL 2H9GB 2P8MA 4LLUA 5KS9A 1EJ6A 4DKFL 1A6VL 1JV5A 1P4BH 1YN6A 1R3IH 2ORBH 2X10A 1T83C 1VA9A 2XFXB 3B6SA 5DRWA 4HK3N 5D96B 3RVUC 1A0QH 1GIGL 1N0XL 3CSBA 1PKQA 4GS7C 3TJEH 4AEEA 2KBGA 1LILA 3HC4L 5IJVA 4PRHD 1MAML 1HQRA 1FGVL 4Q9QL 1G7PB 1LD9A 1DBBL 1U8LB 4XHQA 5M7QA 1UEMA 1T1YB 4B50A 2XACC 1WEJH 4F80A 3K46A 4IS6B 1RK0A 3D39B 2HT2D 1JZ8A 3SDYH 4TPRL 3OWEA 3QUZC 1A7NH 5ACLA 3UPCA 4TUJA 1JGUL 3CIQA 2OP4H 4LSUL 5HY9A 5C0BB 2FH6A 3ZDXE 1T4KA 2CR6A 2NY4B 3IDMA 1LEIA 3ARGC 4P46A 2VZ3A 4PJIB 2VDOL 1ZLVK 4HSQA 1HYSD 1LK3L 1CT8A 1D5IH 4KKCC 1QFWM 4YXKL 5E8PA 1OCWL 2NTSP 3LD8C 4A6YH 1H8SA 4MB3A 5C8JA 2NR6D 3FB7B 4ZFOB 3WMSA 1I9RL 4AENB 2BP3A 3V8CA 1KB9K 4G8FA 2EC9U 2EKJA 3NZ8A 4PY8J 1BF8A 2Z31D 2EC8A 3B83A 3H9SB 2Q6WB 4QHMA 4JHAL 1E4JA 3FT4A 2FDBP 1G0YR 4UAOC 1J0JA 2ZUQC 1RUPH 3VJ6B 1QRNB 1F42A 4V2BA 5D2LF 1MEXH 5GGVH 4JRYE 3QO1B 4FG6D 4JN1L 4OIBA 4JFEB 4XNXH 4Y4HA 4D9LH 3PHQA 5CJQL 2K1MA 2VE6A 5I8OL 5SWZD 1BJ1H 4ZUTA 1QSVA 5HGHA 1P5UA 2RCSH 4TSAH 5HDLA 5DHYB 5J06A 3KJ4B 5F71A 4Z18A 5K33A 2HFEA 5ILTH 4HIHB 4LEOB 4LSRH 4ONGL 3TBTA 1RUAL 2PW1A 3GKZA 3MLSH 1UKQA 1DBKH 4L4TB 3DV4B 3O3AB 3TT1L 5KANG 4LPUA 3OX8B 5HVWA 3MLYL 1QACA 4IRSB 1UZ8B 4MYWB 4JANA 1DFBH 3JBG7 3BDXA 2IANE 5EOCH 3R1GH 5EC2A 3FHQA 3JWDH 4OIIL 3MYZA 1RJZA 4PG9B 5F6HI 1DBJL 2NNAA 3VFTA 5EPMA 1IVLA 1KIQA 1OF2A 3NZHL 4U1NB 1C08B 2Y23A 4M5YL 2CD0A 3I50L 4HJJH 1D5MB 5IROC 1SY6L 4Z0BH 4Q2ZA 1A6ZB 5CEZE 3EYOA 1CE6B 4X6FB 4HGWA 5BZWB 1C7TA 4N9GA 4LSTH 4I5BA 1WIPA 5DWUL 3JWOH 3QIBD 3CFKA 4GRWB 4WEBL 3TA3A 4W6YB 1GCFA 4P4KD 5DA4A 3QNYB 1SJEA 2WIMA 2W0KA 5IFAL 3D85B 4GAJL 3IVKB 3UROR 4M9OA 4PJ5A 4KKBC 5AZEL 1LO0L 3D0LB 1DBAL 3HR6A 4B7LA 4MCYA 1DL7H 5FAAA 3NCEB 2O5XL 4D0CA 2XWJA 5HI5D 5MERB 5C92A 3IDIA 3JTTB 1VEPA 2BNRD 3NBNA 1MHHB 4X7SL 3T2NH 1KELH 1QO3B 4JHZA 3SCMD 3P40A 1MNUH 2YPLD 4NQDA 5J6GA 4HDIB 3OMZA 4ZQKB 3RWIB 4YNYB 4HFWB 4OCYH 4WW2A 1KT2A 1FORH 5ESVA 4J8RB 1A8JH 3OHXA 4HS8L 5K9KA 1BD2E 4Q6IC 4U1SB 4NQSA 4YEFA 2HT3C 2UZXB 4OI9A 1N8ZB 1MCOL 1U3HC 3NFPA 3BAEL 4ODSH 3JV5A 4LBEA 1JF1A 3DV6B 5HHXH 4ZXBC 4YPGA 3BHBA 3ZDYE 3EOBB 4JEGB 2D7QA 2VR5A 3FFDB 3NA9H 1A7BA 3FFCD 1Q72H 1FNFA 1DVFD 1BQHB 5ECJE 3U30C 3RZCD 1CQYA 4PP2B 3GMQA 3QXTA 3H7LA 1BOGA 4JRYB 4L5FH 3BPLB 5JR1H 2X9WA 4YR6B 1D9KA 5IMKB 1C12A 1RZIA 4GAYB 2P43B 1T80A 1G6RA 1M1SA 1TNNA 4AEHH 1A4JB 5DMGD 3FONA 2DQFB 5CWSA 5M95B 3WFEL 2XICA 5C7XL 5MENA 2BHZA 1JFQL 1MFDH 1Q9LB 4FQCL 4HIJB 2FX9H 3ZTJH 1BECA 3U0PB 3IFOB 1ITBB 1C1EL 2R4SH 5IVXE 2EEAA 4QOKE 3RWHB 2Y36H 3TBYB 4HFUH 1HKLL 1NDGB 1ZXQA 4PJ8B 5T1KB 3SKJH 3EJZD 3DVNB 4Y5XC 1YJDH 5I71C 4I18B 3FAXA 1S7SB 4Z7UF 4PJAE 4HXAL 3C6LB 3LKNB 2DDQL 3C8KA 5D2NE 3MXWH 4NKMB 3AC0A 4LL9A 5TQ2L 2V17H 5HYSA 2C3WA 3VFNB 2IANB 2X4TB 2NMSA 3U46A 5E8DH 1K4DA 3HZYB 2OSLB 2DLFH 3LH2L 5F9AC 2V2TA 1MHPL 1SYVA 4UBDD 4NQUA 3KPSE 4KC3B 4MD4A 1OTUD 1INDH 2BVTA 3L7EA 1I3GH 3LQAH 4JE4B 43CAA 2LQRA 3J7HA 1J8HE 2LTQB 5LKNA 5MEOA 1ZT1B 3E1F1 1Q0XL 2BRQA 3NIGF 5ITFA 1L9MA 4PRDA 5ICXB 25C8L 2WM0A 3WHE1 1KCRH 4ZUSB 3ZSSA 5IB2A 2V9RA 1JPSH 5EU4A 1U8KA 2P5WE 3O8XB 3ZTNL 1NAMH 2C9AA 3TVMA 3WXWH 1GZQA 3KXFA 1JUFA 3NFNB 3CZFA 2R2EA 2DKUA 4ETYA 4IJ3B 4OD1H 2ESVE 1J5OH 5BOZG 3QHTC 1G0DA 3VFOB 2WV3A 4PJHA 3CFBB 3P73B 2BJML 1U8OB 3BX7C 1A6AA 1L7TH 1NMBH 3ME0A 2NZIA 3HZKB 4KY1L 1E27A 5TFSL 1TCMA 1NMCB 4F7PA 4BA8A 1AC6A 4WFHE 3Q6FB 1HHJA 4YE4L 1A7QL 4WI3A 3BKCL 2AK1L 5F88A 1XR8B 2JIXB 2RIKA 1CDJA 3VFGL 1A6WH 4JFOB 2HFGL 1MPAH 5T3ZE 3U1SH 1IC5H 5GRUL 2VZTA 1ODAA 5TQ0H 4ZPTB 1I7UB 4O9HH 1B6DA 1KPRA 3P4OA 1BBJA 3GBLA 3P9LA 3VXQA 4UQ2B 4JKPH 4NBYB 1J1XH 3D9AH 3QG6A 35C8H 5F7DB 4DCQA 2V5MA 1NCUA 5D5ME 4ODUA 3SGDH 3QHZH 4N0RA 3O9WC 3DJ9A 4K9EL 5FYJL 3CSPA 4LFHD 1RHFA 3QUYC 4EN3C 2MHAB 5IB4A 2N7AA 4G6JL 4OLZH 4PJXE 1S9KC 2CPCA 4K3JH 4TSCL 3P0YH 3LDBC 5DHVH 4U1IA 1B4JH 2HH0H 3RVTC 1S9WB 2BNQA 4NC1E 2ITCB 5D8JL 1HI6A 2DF3A 3RWGB 3VXOA 3QIWD 5LBSH 3B2VL 2IGFL 3C08H 4KJPC 5DZLA 1BFOA 4U05A 3HZMB 5IVXB 4QOKB 5FV1L 1MWAB 3QDJA 3SHSA 1WLHA 4G80A 4K23L 4PRPD 5DR5L 1CLYH 1OM3H 3MV9A 1Z5LB 5D7LD 2AJYL 1I9EA 2D7MA 4OGYL 4PJAB 2YKLH 5KANI 3ULVF 1NBZB 5CEYB 2I60L 1DQDL 4KRNA 4XB8A 1KJ2A 2R1XB 3C60D 1EAPA 2VQUA 3RVXD 2DQUH 4Y8DC 3RIFF 2C1OB 5FUOH 2WWMC 3PV7A 4QXWA 3LPGA 2FHFA 4HLZG 5JMOC 1ZHLB 1AD0B 1GGBL 1JZ5A 3QZWA 3P11H 4F7EA 1NCDL 1FLTX 1MCJA 2VDNH 1XGTA 4P5TD 4N5EC 4ONHA 3KPSB 3S35H 5ITBH 2ZJSL 1HQ4A 2WWKT 4MWFA 3DX9B 1MFCL 4O02L 1J8HB 5SWZE 3GK8L 2D7PA 4TYUA 1NLBL 2OL3B 3MROB 2VKXA 5DRXB 1HNFA 4OFYA 3SDCA 3HI1B 1UJ3B 3PWUB 3FQNA 4X8JB 1AP2B 3OAZK 5KG9A 4XPBH 1YY8A 4WWKD 3QRFM 3GEWB 3QJHB 1TITA 3HMWL 4XX1G 4XXCA 1RUKH 4GXVH 1OLZA 2YZ8A 1KB9J 1EHNA 1YUHA 1J05B 1TQCB 4I3RL 2ESVB 3RJDA 1ZT4A 4UT6H 3MRGA 2R56H 4Y5VB 1QEWB 4J3OC 4Y5YA 1M71A 4Y19A 5HVFB 3VD5A 5JPMB 4PGJA 2E27H 3IDNA 3NTCH 1YEJL 4AJ0A 2D4FA 3G5XB 1AXTL 3OR6B 4ISVB 5GRZA 3DUHA 1JNJA 1CG9A 1MVUB 2E5EA 2QADB 4P4RB 1GYAA 1A5FH 4OD3H 1RMFL 3MLVL 5C0AD 4JAMA 2NW3A 1XCTA 2X1OA 3HC3L 4C55A 4F3FB 4PGCA 1ZK9A 1MAJA 3MCLL 1AD9B 1FV1B 2AV1B 3WEXB 2JLLA 3GO1H 2R0KL 2HAZA 4PJGE 5IHUH 2WMPA 3B9KB 3H3PL 4R8WH 4R7DB 4R7NB 3LS4L 3GSNH 5D5MB 3UTZB 2CGRH 2AXFA 2ADFH 4KROD 2W60B 4GRMA 3P0VH 5T3XH 1MIEL 3MRPB 4HIXH 1BX2A 3D2UB 2BNRE 3QWOB 4M62L 5M94B 4UB0H 5DO2D 5DVLA 5BVJA 4M1DL 1RZJL 4HWBL 3PF2A 1M7IB 4G42A 5HGDB 3S98A 3RDTC 2NY6C 3OBAA 1CFVL 4QTIH 3TF7C 5I1HH 3LZFL 1PQZB 2AI0H 2A73B 2X4PB 2C7UB 4Y4FC 1YC7A 3D3VA 3T77A 4JM4H 4U6HB 1AR1D 5KVDL 4X5LA 4FQ2L 3WIHL 4Z0XA 2GY7B 1GPOL 2Z92B 3VE0A 1G9NC 5BRZD 4QRSA 2E7BA 4JG1H 1JZ6A 5AG8A 4PREA 5FA3B 4IIQC 5E6YA 4EXKA 5BQ7A 2R23A 2NXYB 1HXYA 2O5YH 1KBGL 1NGXB 1G7QA 1I1AD 4JB9L 1A7RH 1P6AB 1MI5E 1IC1A 2H8PB 4D8PA 5IR1A 4OZFB 3UO1H 3TBVA 3FFCE 1JIBA 4LRIA 2FWOA 1V8HA 2VN7A 2W0FA 3NCYS 3QFJB 3QUZA 1T7XA 1FLRH 4KZDL 1A6TB 5J1AA 2BDNL 1MSPA 4DWHA 3PWVB 3FO2B 2W0PA 3QUML 3HLAA 5TDPB 4G8IB 3ARGA 3LMJH 2OLDA 2ZUUA 1PEZA 3ARBC 2H1PL 4H26B 5A43C 5C07A 4HPYH 1RZKH 3TO4B 3GUTB 2R1YA 4APQC 2XWTA 2UUDK 2OXGA 3REWB 3HG1A 4DZ8A 1L4IA 4TTDD 1IGCH 4BZ2H 5KBNC 4WWID 1P4BL 1R3IL 2ORBL 4YO0A 4LHQB 1DEEA 4XAKD 4P46D 5DYOA 1IILE 2R0WH 1WK0A 4RBPK 1A0QL 1F6AB 1Y18A 4K9EC 2HFFA 3TJEL 1S9VA 5FYLH 5F1NB 3THMH 1GZPB 3MNZA 3O6LH 1G1YA 1FBIH 4FFZH 5L0QB 1GGCH 5F9JA 3MJ7B 1KTRL 1NCAH 1WEJL 2Q87A 3F7QA 3QXAA 4PJBE 3SDYL 4M7ZC 3FZUD 2DB8A 1NUNB 4X6CA 1A7NL 2AGJH 2H26B 4JPVH 1XEDA 2OP4L 1WWWX 1V3KA 4MJ6B 1I8LA 4CVZB 3MBEC 4HK0A 4CDGC 3UZQA 4GBXC 4J3VA 3WUZA 1ZHBB 4ZUUA 1RZ8B 4LCUB 4NFDA 1D5IL 3IKCB 4Y4HD 4XBGB 3HE6C 5I1JH 3AS3A 3SGJC 1M6OA 3UPRA 4A6YL 1PX3A 4ODBD 1PKOA 1HH6A 5K9OA 3IDYB 4PJGB 4TNVF 4WI2A 5LCVH 3V4UH 4L8BA 1BVKB 1IGYB 2X7LB 3RIAF 1KV3A 3PGDA 2ZOLA 1XF5A 4W4NA 2KZWA 1PG7W 4CN1A 4PBWD 1LWRA 2ED7A 1RZ7H 4X80H 2COQA 3G5VA 1RUPL 2WUBH 5ESQB 4KKLD 2CDGA 2BOCB 2EKSA 4HKXB 2BNRB 3MRMB 5GGVL 4TN9A 3LD8B 5HHQA 3ARFC 1P4IH 5IROA 3P2TA 4XNXL 1QOKA 3MRJB 4D9LL 4X9IA 1J12A 2GSIA 3WNKA 4K07A 4OFIA 3S6CA 3EO1A 2RCSL 5FKPB 4JM2C 4OLXH 1EEYB 1TNMA 3T04D 5ILTL 4UAOB 3DGGB 4LSRL 4L9DA 1W0WA 3DTXA 3MC0A 1R3KA 1AY1H 4NNYB 2YWYA 4U1MB 3MLSL 1LDPH 3VWJC 3V8OA 1U2CA 5F3HA 1DBKL 3GMLA 1JBJA 2XTLA 3G9AB 1YDPB 3BE1H 1JWMA 3MCG1 1MI5B 4GW4B 3LQZA 4UTBH 3TA3D 4JVPA 4OF3A 2GUOB 4P9HH 4HKBB 2XY2A 5DJCB 4U1JB 4NQXA 1CFSB 1DFBL 4LAQH 4PYGA 1KCSH 5A40E 3EJYC 1IL1B 3R1GL 5IV2B 3T4YB 4PJ5D 2VLMD 2A6KA 3MMEA 4NOFA 4GQ9H 3ROOB 5ICYB 4PV8B 4NHUB 4F9LA 2QQQA 3FOLA 3BO8B 2I07B 4XB7A 3LB6D 3SE8H 1S9XB 2IPTL 4HJJL 3RTQC 4XRCA 4YHYC 4C83A 5LWYH 4NGHH 4Z0BL 1T66D 3IDJB 1LK2B 1AGCB 1KB5A 2APBA 2YN3A 4LCCC 4LSTL 4ELMF 2KKQA 4KTDH 4NQDD 3X13B 5D7IF 4BSVA 3L3IA 1SVCP 1HHIA 4BH8B 1G7IB 2RFXB 3R0MA 4BZ1H 1U8QA 1D5ZB 2EDRA 4P5KA 4DN4H 4QLRA 4PRPE 5F70A 4ZXBA 3BYTA 1DP0A 1OP3H 3AB0B 1XH3B 4Z7NF 1DL7L 3CPLB 5E2WH 4XGZB 1TQBB 1X7QA 3ZYOA 5FO8B 3F7YA 3IU4H 1KENH 2BSTB 3HUJA 5I1AB 4ODTH 1ZEAH 1RZJC 1ZLUH 1KELL 3T2NL 1FH5H 4WI6A 1EK3A 3L3OA 1MNUL 4LKCB 1R3HB 3PNWB 4N5UA 3KGRA 3GIVA 3CSGA 5JPNB 1B4RA 3E2HB 3NH7H 1T6VN 3CZJA 4BELD 2NY3D 3RUGF 4OCYL 1FORL 2VUOA 3W0WA 4JFPA 5AD0B 1FFRA 4R3SA 4OGZA 1D9KD 1PYWA 3FB5A 1ZT7A 4HH9A 3VGAC 3PABB 3WE6A 4Y5XA 1YEEH 5CD5D 2Y9RT 5SV4A 5MEND 4ODSL 1R5WB 4NKOB 4DEPB 2DMCA 1V3MA 3G6AA 5FF6B 5HHXL 1T7ZA 4BQ8A 1NBYA 3JZ7A 4HC1H 5TGBB 1OTTD 1QKZH 3NA9L 4RMVA 3VD9A 2AKRA 3ZE1F 1Q72L 4TVPD 2VLLB 2J4WH 4Q6IB 5HI4D 5C0DA 3KPRE 1P1ZA 1FL5A 4NYLA 5CGTA 4BUGA 3U4AA 4HUVB 1DQTA 4XBPB 3MLTA 5CEXA 3LKSB 1F4HA 5C09B 4L5FL 5JR1L 1VKXB 1U3HB 2ZCHH 2DLHA 2F58H 2DWEB 2P8LB 3GMOA 4AEHL 3OJDB 4I0PC 4NSKB 1U8IA 1WTLA 1MFDL 1VACA 4NN6B 3RVVC 4EVNB 4Z7WA 2FX9L 3MRLA 3DRTA 3DNKA 2R4SL 1N59A 4ZYKA 5HHPA 5DSCA 2Y36L 1S7WB 3HAEH 4HFUL 3VGDA 4UDTB 3LSOA 1EX0A 2XKNB 3SKJL 5IBLC 5FGSA 2HMID 1WBXA 1YJDL 2G75A 5DLMH 2PXYA 4DVRH 1NCBH 2B7DT 5EBGA 4DOHE 3MA7A 5EU7C 3V5HA 4IHOA 4DTGH 2X40A 3EKCA 1OLLA 3MXWL 2VXVH 2DTMH 2DQEH 2V17L 5DDHA 3W39B 2EIBA 3QT2A 5I30H 2GY5A 5E8DL 4LLWB 1EBPA 2F53A 3O0RH 2DLFL 3ILPB 4MDIA 1IAIM 3LV3A 3WFCH 3MR9A 4K8RD 2WIIA 2HKHH 3OF6A 1DN0A 3WS6A 1INDL 2LAAA 4M48H 1I3GL 3LQAL 1KG0B 3VRLF 1S7VA 3GNMH 3QIWB 2I9TB 1URLA 3U0TA 1QBLL 5EN2A 3C9NA 1F6FB 4D9QD 5IHBA 1KCRL 2I27N 4MJ5A 5BRZE 1MUJB 3D18B 4YDIH 1JPSL 3NGBB 4XNYH 5J1SC 1MCBA 1NAML 1EV2E 1FVCA 3WXWL 3QR2A 4YGVA 3QQ4B 2C3GA 4NPYA 3O9WA 4PB0H 3O3DB 1NAKH 3QUYA 3BMWA 1X5YA 4OCWH 4EN3A 4FQQA 1J5OL 5AWNH 4O2EB 4XCYB 3B3IB 3DVGB 3V6OC 5KS9E 4CW1B 2X4SB 5GGSA 1Q1JH 4RCAA 32C2B 1L7TL 1NMBL 3DROA 3B9VA 2C3VA 4XP5H 1PKQE 3LCYA 4K7PY 1CFQA 3FT3A 4MQ7B 5I17B 3PHOB 3VXPA 2AJSH 4R2GC 4RMUA 1ZS8B 4GO6B 3ELAT 1A6WL 4GUPB 1MPAL 1JPFA 5J56B 3U1SL 4Y2OA 1IC5L 2BNQD 3TN0C 4PY8I 5TQ0L 5EG6C 1ZA3B 3ZE2F 5FOBB 4O9HL 2LV4A 3ARYA 5IB1B 2ZWLT 4HZLA 4MLIA 4JKPL 1J1XL 3D9AL 3JV6B 3QDJD 35C8L 3RZWA 1RHHA 2D7NA 4XAKE 2V5SA 4JPWH 3KS0H 3QHZL 4NUJB 3N1MC 1NGZB 4N0YH 3KPRB 3WFHA 3WXVH 4MNQD 4ZS7H 3BZFA 4JDVA 3BD3A 3CLEH 5F6IC 5KSUA 3WL9A 4OLZL 4K3JL 3P0YL 4NBZB 3B8SA 1JGDA 1K3IA 1B4JL 4KI5F 1LE5B 2HH0L 4HS3A 4X0KB 3SE3C 1MLBA 1UH3A 3UYRH 5LBSL 4Q0XH 5FYKH 3C08L 2R0ZH 1T1XA 4WTXA 3WUWG 3FT2B 2CO7B 3DPBA 1PJ9A 4N1HB 3OGCA 2GSGA 2VDPH 2AJVH 3ES6B 4K94H 4TRPH 4OFVA 2AJZA 5TPWH 3S37X 1CLYL 1ZSDB 4HUWB 2ICCA 2BC4B 1T0NB 4K3GA 1FNAA 1QTYT 2YKLL 2J8UF 1ZGLB 2HJKB 3KLHC 5C70A 5F7LB 4HJ0D 4YUEH 4OFYD 1P7QA 3SDCD 3D87B 2DQUL 3SE4A 4TULH 4PRBA 5FUOL 1UGNA 1OAUH 3TWCH 2W9LA 3O2DH 4YHLH 4KROB 4Z7OF 3C09B 4JJ5B 2JE8A 2MCPH 5D7JA 1REIA 2GTZA 3CCHB 1ZGLM 1EA9C 4LLMB 3S97C 3BKJH 3O41B 1KOAA 3P11L 5ADOL 3BH8B 2VDNL 3VFWB 5I76B 1RZGA 2VB5A 1P7KA 4LHUG 3P4MB 2EE3A 3S35L 2RAMA 5ITBL 5LQBH 3HZVB 1UWXK 1KCVH 2F54E 4GW5A 4NZTH 1S78C 2IFGA 4Y19D 3HNVL 2NXZC 5BRZB 2FIKA 4GH7B 1NC4A 3VGEA 2DI9A 4JLRB 1E4XI 3DURA 4XPBL 5IB5A 4KTYA 1WIUA 3G6JE 3EYVA 1RUKL 3IJHA 5DFVC 4GXVL 1CS6A 3KNBB 4PD4K 3A67H 1QLFB 2PCPB 1P2CA 1Y6NR 2YD5A 2Z9TA 4RFOH 4UT6L 4EJ1C 1CICC 2R56L 2JKXA 4WEMB 5J12C 1EO5A 2HJLA 4PJDE 4LLDB 4YC2B 4HJGA 4L8CA 3RDTA 4LPYA 4ENEC 3WS3B 3MACH 1HWHB 4PJ5E 2EXYD 2E27L 3NTCL 4Y4FA 4GRLC 2MCG1 4YDJB 1EVTC 3MYJB 2ARWA 3AREB 1A5FL 2W65B 4OD3L 4OT1H 5K59E 4EIZC 5ICZA 4GFTB 2V9TA 1YJDC 4KK8D 1DQJB 4NQCA 9CGTA 1RK0B 1C5BH 2KPNA 3VXUA 3ZDZE 4F7TA 5KVGH 3MO1B 4TUJB 3OKOB 3D3VD 1KTLB 5HY9B 4XPFH 1HEZA 4X6BA 3GO1L 3U9UB 2FL5A 1GOFA 3PWPA 5J8OA 2QSTA 5IHUL 1KJMB 4R8WL 1LEIB 5DXWA 3IETA 4Z7VA 1FL3A 3GSNL 3GBNH 2CGRL 1R3LB 2ADFL 2FD6H 1HSBB 1KN2H 3P0VL 5T3XL 5HGGS 3U6RB 4HIXL 1Z3GH 2VERN 3RVUD 1PD6A 3M1BB 5L6YL 4UB0L 4B5EA 3LQAC 5JNYA 3R8BB 4QTIL 3PWJA 4JDZA 3ARBA 4CMMB 2AI0L 5I1HL 3OG6B 4ZTOH 1VENA 3MRNB 3AU1B 4JM4L 4XC3H 3DHMA 4JO4H 2XTJC 4APQA 4BH7A 3QUZD 2C1PB 4QHNB 3MLWH 1FSKB 1P69B 4NWTH 3U2SA 4XVTH 1F3JA 3MFFB 4JG1L 1ACYH 3O11A 1YNKH 3ARGD 2VE6B 1BJMA 1KFAH 3WKMH 5C07D 2J88H 2E9JA 5HGHB 5MENE 4KKCD 2O5YL 4GXUM 2UYLA 4GLRI 3VGFA 4NHCH 1A7RL 2VLKA 5EO9A 3C5JA 2OS7A 3PV6B 3UO1L 1AIFB 3HG1D 3PIQB 1TCRA 4TVPE 5TE4H 5IEKA 1K9TA 1I4FA 4GMTH 1BFTA 1FLRL 2DL2A 2EH8H 4G5ZH 3CFDA 4IIQB 3L9RB 4EI5C 5C0RH 3QEQA 3DVFA 2GEEA 3LMJL 1S7RB 2F54B 4Z5RB 5HPMA 4GRWH 4JANB 1HIMH 5J9PB 4P0DA 3EUUA 1NGWB 2L7UA 3JTSB 5FOJA 4HPYL 1DCLA 1RZKL 3HE6A 3SGJA 1JHTB 3DARA 5GIRB 2KQNA 1IFHH 2NNAB 5EPMB 1WCBA 3LIZH 4YGAB 4U2ZA 4W70A 4G8EA 1LP9F 4KQ4L 4N90D 4OCRH 1IGCL 4BZ2L 3S3SA 1CBVH 2AVGA 2ZUWA 4Q2ZB 5D7IA 3G6JB 3QYCA 4LKXA 2R0WL 3MUJA 2P49B 6CGTA 1MFBH 4NRYA 5FYLL 2KDGA 5I8CB 3TNNA 3CFKB 3THML 3SO5A 2FBJH 3O6LL 2UWEF 4PJCF 1I9IH 1FBIL 4FFZL 5JHLH 5DT1H 1GGCL 1IEHA 2W9EH 4PJDB 2EIEA 3T1FB 1NCAL 2VXSH 3UBXB 3KYAA 4HUXB 2W1NA 1RK1B 1KGCD 4MCYB 5FCSH 2AGJL 4JPVL 1GGIH 4IDLA 3SDXA 4NO2A 2FYYB 4JM2A 3T2OA 1AQKH 4YDLB 5GS2D 2VTFA 1ED3A 4ZDHB 2A1WH 5FGBC 4PJHE 3X14A 4PJEB 5D6CB 2XZQH 5AAMA 1TXKA 3IU3B 3VFVB 3VWJA 4D9QE 4LF3A 4ODWA 1NEZA 4Q97A 1ETZA 5JZ7C 4RMRA 5ETUA 4FQHB 1SMOA 4PYHA 3HI6H 5LCVL 3SKMA 3V4UL 1EXUB 2O26U 2H2PD 5ABDE 4BFEA 4KKAD 4ONFH 4JO3H 3MBEB 1MF2H 1RZ7L 1EJOH 4X80L 1T2QH 3HA0A 2IAMB 2WUBL 5GGRA 4O2CB 5FM4A 1CFNA 1TFHA 3ESUF 3MGOA 4HAFA 4ETQA 4YWGH 3SO3C 1QLEH 4LBEB 1JF1B 4JFHD 5HHNB 1P4IL 4IOSD 4YPGB 1JTOA 5GGSY 4K71B 3HRZB 1UH2A 4KWUA 4XTRC 3STZB 2ZCLH 4QHKJ 1NBQA 4J6RH 4LCCA 1LO5B 5DEGA 5FGCE 3RL2A 5MHSD 5FK9A 1AGFA 1PLGH 1Y6KR 4OLXL 3GMQB 3