4NKIL

Crystal structure of a fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
b'SALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Epitope characterization of an anti-PD-L1 antibody using orthogonal approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiL02
4XCYA 1YMMB 5C0CE 5I66A 2IQ9L 3UX9B 1IGIH 1SJEA 3QQNA 5I8EA 5I19L 3CFKB 1LO4L 3OQ3B 4M6OL 1OT1A 2Z93B 3FQTA 3SBWA 2BERA 3QUYD 1ZTXH 4PJEF 2P5WE 2YRZA 1BZ7B 3DGGB 3NFSL 4L3ED 5ID0B 3PV6A 1TVDA 1AGEB 4P48A 1I85A 4HJJL 2Y5TB 5HYJD 1DQLL 2DQDH 5D93B 4Y5VB 3AU1A 1HOCB 3DSNA 1DQML 4XVTL 4FQQA 3OWEA 1VFUA 2CUIA 3BRGC 5I1DB 1ZVSB 4NQCA 4DGYL 3UJTH 1CICA 1BJ8A 2D7NA 3OAZK 4R2GD 3BE1H 2I07A 4KFZC 3UO1H 1JGLH 2HA1A 1FE8L 4FZ8H 5CHNA 5IHLB 3O2DH 4GG6F 1I8KA 1YECH 4BK5A 5CEXB 1JNJA 5F7FA 1S9XB 2P8LA 4YWGL 3G6JA 4PJCE 3HR6A 3BGMB 4M93C 2D31B 2X1PA 2AK4B 3QCUL 3UTQA 3GKWH 3MJ9H 4MQ7A 2ZSVA 1CLCA 4XP5H 1CU4L 2DWEB 1J1PH 3PIQB 4JFZH 1DR9A 1OP3K 4XMKH 3DYPA 2AJYL 4AENB 3P4OA 5KSAD 5CP3A 2YHGA 3RZWA 5D7IE 3QG6A 5E00B 4OZIB 4MQTB 2VLJD 1AGBB 1FSKC 1A4JB 3RWIB 4BH8A 2XA8H 3T2NL 4OCYL 2D03H 1V3LA 1S5HA 3D9AH 4KRPD 2YPKA 2V7HA 4KZDH 2FO4B 5DUPL 1IKNC 4L4TD 2EKSA 1CLYH 2B39A 4XVSH 1MNUH 2F5BL 1SY6H 4XNMB 2ICWI 1DBKH 1FFOB 5ADPH 5EUOA 1TQCB 3UPCA 2FHFA 4QRRB 4Z8FL 5M95B 1CXKA 5SWZA 1MLBA 3SDCC 4LLDB 2CMRH 3RVUC 3BPCB 3D18A 1WV7T 3N06B 4KJPC 4RISH 2UUDH 3L9RA 4JGUA 2YZ8A 4KKLC 3QEQB 4Z7WF 1K2DB 4JVPA 1A9EB 3V6ZB 5F7DA 1BVKA 1MHEA 1OWWA 1ZSDB 1I7RB 4QXUL 3JV6A 3ULUH 1WTGT 5I2IA 2AEWA 3IU3B 4U6YA 2FX7L 1KIPA 5C0BD 4I3SL 1N59A 4CVUA 1KCVL 2IPKA 4JFDD 4RBPH 3TEUA 3VFVA 4WFFD 3RNQA 2XPGB 4KPHH 4B7IA 1RJLA 1JFQH 2VWEE 4S1RL 2Q86A 3ARYA 1FFNA 5I1HH 1DN0A 3A6BH 1NGWA 1QBLL 4IEFB 2IAMB 4WUKH 1GH7A 2GSIB 4PR5A 3WJLC 2G5BB 3MBEB 1YNTB 4MAYD 4K8RL 1RUKH 5JLZA 5GGRY 1IAOB 5SV3A 1KYOJ 5FA4A 3BZEB 4KKBD 3MUZ1 4NJAH 5DJ2A 1RJCA 5JR1L 3HG1A 1A64A 4XPHH 3RTQA 2OX5A 5JO5B 1PZUB 4LLQA 1R24A 1DL7H 4NZDA 5IW1A 4XC1H 4PRID 2FATL 3RAJH 3R0MA 5TF1L 1A6UL 3C9NA 1HHKB 3ZHDA 5AZ2L 1QO3B 1A6PA 3L7FA 3L6FB 2UVEA 5D8JL 1TETH 3H3PL 4MDJB 5CD3A 1G9MC 4QWWD 1OSZB 5DA4A 1IKNA 4X6CA 1CDHA 3HRZB 3ARGC 1VFOA 4XP6H 3U0WL 2IPUK 4PRHE 2HTLD 1LEKB 1E28B 4NJ9L 3K0WA 3TH4T 3MLRH 3MV9B 5INCB 5GGTA 5EFIB 1BEYH 1NAKH 3LRGA 1F90L 5C86A 5L6YH 2A77H 4FFWC 5INDA 4LPVA 2N7AA 2P43B 3M17B 2YPVH 1IC4L 2Q6WB 1FCCA 5EWIL 2LU3A 5MI0C 3HPJB 4DKEH 3DHMA 3F7VA 4C54A 5DQJA 4MMZC 5D70H 4PRPD 1QFUH 3H7BA 3LQAC 4NUGH 4YDIH 3UPAA 1WSST 2VLRA 4QHUA 4PGCA 1CDYA 4Y1AA 1OGTA 4M8QB 4R96B 4P2RA 5K9JL 2GITB 4HEME 3FFCE 3O8XD 2NY3B 5E9DD 2OTWB 4JFFA 4OFDA 3WNMA 4DN4L 1DBAL 4DQOL 3LDBC 3RDTB 1MWAL 3ARWA 3GSXB 4ZFGH 3GSUB 3JTTB 3GGWA 5M7QA 3LSOB 5E4IA 3WEXB 4Z0XB 4O9HH 3V6OC 5CKAA 2ADIA 4LSDA 3INUL 3WJJA 4XBEL 3TCXA 1HE7A 3FB5A 5DRWB 2C1PA 2DKUA 3VFMB 3HUJF 5C0DA 4QRPA 5T3ZE 3L3GA 4HXBL 1EUUA 2NNAB 3SKJH 1HHGA 1MFBH 4Q9QL 2BNRD 3F58H 1GAFH 1YEJH 3WNLA 3HC4H 4HJGB 4OKVA 3O6FA 2BVOB 3X3GL 5GZND 2YK1L 4OZGE 4L9DA 3TIEA 3ECBA 1QEWA 2ZKHH 3VWKD 1EGJH 1BD2B 1DLHB 2NYYC 1BQUA 3AREB 4R0LB 4MXWL 5GPRA 4MJIA 3RX5A 3MLYL 4Z7NE 3GJEA 3TT3L 5DT1H 1MIEL 1YYLL 3AFLA 1Q9KA 2WAHA 3IFLL 1IGFH 1KLGA 4OLZL 2W9EL 5D1ZD 3SDXE 3RZCD 5CEZL 5H37G 4M7LL 3VXMD 2GJ6B 2WINA 1DVFD 1PG7X 1XF2B 4U2ZA 5C08D 4DVBA 3MCKA 4M6AA 4TNVF 5BVJB 1YPZB 4U7SA 2MSPA 2Z8WC 5D7LE 1SEQH 4LIQL 2QEJA 4WO4B 1LP9F 5D93C 5KSBE 5ABDE 4OB5H 5IJVA 4TPRL 2ZSWB 1C16A 4PS4L 3HI6L 1S3KL 4WTXA 5B39G 5I0ZA 4KVCL 1QP1A 4OM0H 2OCFD 5E8PB 5IHUL 4YAQB 2JCCF 1MJ8H 4XB7A 5IMOB 2DIAA 2V7NB 1UKTA 2JB5H 5L9DL 3NH7L 1PD6A 5DHXB 5AG9A 5H2BB 2BDNH 3MLUH 2IFFH 4TULH 3O6MH 3ULSB 5L7XL 4YDVA 1JTOA 1EAPB 4UUJA 5SV4A 2P49B 5HI4D 3JWDL 4TVPL 2ATPA 1SJVA 4JM2A 4OZHB 3PL6B 3F8UB 4L5FL 5D1QB 4XP4H 3ZE2E 5HD8C 4C83B 4OLWL 5D7JC 5D2LF 3O3AA 4DAGH 1MRDL 1QA9A 2VMFA 3EKCA 1H8OA 2CIKB 3PGFL 4X6BB 2GK0A 1D5IL 4NQCD 4PJBA 1G6RL 1KIUA 5DZNA 1ZT7A 1CICD 1QLFA 2EDBA 4JO2L 5FDWA 2R1XB 3DBXB 5HI3D 3GMNA 5CJXC 5EPMA 4TVSa 4IRSB 4A6YB 5FEBA 4G6AD 2N1KA 3RGHA 2R0KH 3ZTNH 1M71A 4LLVA 5LQBH 3IJHB 2AEQH 1YMMA 2D7OA 1K3IA 5ILTH 1LK3L 3CFKA 4K3HA 1VFMA 3O6KL 2BY2A 3KXFE 4ZO6A 1I9EA 3LIZH 2Z93A 5HYQB 1CN4A 1BGXH 4EDWL 3GMLB 1E6JH 1RMFL 5KN5B 1XMWA 3FN3A 4GT7A 3QG7L 4Y4FC 5F44A 1BZ7A 5FYJL 3DGGA 1C7TA 1JHLH 5ID0A 1YEIL 1AGEA 2Y5TA 1UM6L 5LGHL 4Y5VA 3IFNH 1HOCA 4LLAA 2WP3T 3JV4B 3P4NB 1OAQL 2APVA 3GB7B 3C6LB 2XI9A 5I1DA 1ZVSA 1I75A 3T0XA 3RWHB 1B3JA 4M5ZH 4WWKB 1WVZA 3G5YB 5B4MD 3ORJA 3RI5F 2EIZB 5EDXA 2XV6B 3MA7B 3QH3B 1LE9B 1P4IL 5CEXA 1S9XA 2H45A 4OCWH 2VXUH 5ESQB 3BGMA 3KWWB 5FECB 4ZOCA 3PF2A 2D31A 3TJEL 4OFIA 3ULVC 2F5AL 3ZSSA 1KPVB 3GMPB 1DQDL 1XGTB 5H37H 4ONFL 4L8SB 2AXHA 3FO9B 4L8DB 4B41A 2DWEA 3MRKB 3PIQA 2O5ZH 5SWZD 1PY9A 4AENA 4JLRB 1FDLH 3PWVB 5E00A 4OZIA 1PYWB 3WFDL 32C2B 1JZ3A 1AGBA 1WT5C 1A4JA 4LSVL 3RWIA 5HVHB 4GRWE 1RURH 4O2FB 2AJSL 4XPAL 5IBUG 3FRPA 5DHVB 3MFFB 4BELD 5C07B 1EO8H 5GHWL 4G80B 2DDQL 5CJXA 5JTWA 4RMWA 1D6EA 2FO4A 4HX1B 4URTB 3D48R 4J8RA 1H3XA 1ZGLM 2YA1A 2FBOJ 1H8NA 2PO6B 1ODAA 5AG8A 3EOYG 4QEGA 2YC1B 2R4SL 4XNMA 2VDPH 4PBWD 2CQVA 1FFOA 3LY6A 4O58L 3MV8B 1U36A 3QDMB 2XKUA 3N50A 4QRRA 3OAUL 3ULUC 4FMFA 2EDDA 3CNKA 3W81A 4JHAH 4IOIB 3NCEB 4Y4KB 4TOYH 5JA9A 4K7PL 3BPCA 2K3TA 4A2LA 3HG1D 3RTQD 3QEQA 1K2DA 3G5VB 1A9EA 5E2VL 1S7SB 1NCCL 2D7TH 3V6ZA 3RHWK 3RY5A 1FZJB 1ZSDA 1I7RA 1KJMB 2NY3C 3IU3A 3S3JA 3CVHB 3V8OA 4LU5H 4PJGE 2X4QB 1TENA 1RZFH 1ACYL 5HYSG 2R0WL 2ENYA 5LXGL 2XPGA 5B38G 4LRNH 4K7PY 1UVQB 2QJDA 5IFJB 3QR2A 5HDBE 2IAMA 2ZJSL 3D85B 2WMPA 4G9FE 4APQC 5TFSL 1ZHNB 4OCRH 1MJUH 2GSIA 1TJHH 4FZEL 2G5BA 3MBEA 1YNTA 4EKXA 3QEGL 1IAOA 3L5JA 3BZEA 4X8JB 5AUMB 3KYKH 4KJPD 4H1LB 3C08H 4KKLD 4ZNCD 2VLRD 4F15C 4Y1AD 1T03L 2HRPL 4KK8C 5JO5A 3MGTB 4P2RD 4QHKI 1NANI 5EZOH 4NUJB 1FYTE 1Q72H 5KOMC 1D9KB 3F62A 4R0LC 4JFFD 4X6DB 4AG4L 5DD1H 3TBVB 1NGXB 1HHKA 5BV7C 1PX4A 1OB1B 1ADQL 1I9RL 1QO3A 2R4RL 3L6FA 3SE8L 1RSFA 3THML 2YRPA 4MDJA 3OZ9L 1OSZA 4LNVA 1F3JB 3MACL 3HRZA 3QCTL 3C09B 1FAKT 2ZUVA 4JM4L 4N90D 4JFXB 3IDYB 1LEKA 1E28A 3OAYH 3MV9A 5INCA 4YIQB 3QDHA 1VDGA 5EFIA 5TE7H 1NCNA 1M05B 1RUQL 1BQSA 4QRPD 3M17A 5J3HD 2Q6WA 1HKLH 4EI6B 3HPJA 4BH7B 5I15L 3QFJE 1WBZB 5D5ME 3UROR 3ZZ1A 1CGVA 2H3NB 3O6FD 1OCWH 4ZSOE 3VH8B 1FZOB 1QHPA 1ZLSH 2AW2A 4PB0L 3M07A 1WAAE 2GTZB 4R96A 1N8ZB 1SJHB 2DF3A 1EHLL 4MJID 3QNZB 3N1QC 2OTWA 4M6NL 1J7VR 3RDTA 3GSXA 5JW3L 1T6VN 3GSUA 4Q97A 2GTWB 3JTTA 1CIDA 4TNWK 3S37L 2X09A 3LSOA 3UYRL 1R5IA 4G6FD 2EYSB 3WEXA 4Z0XA 1J87A 4PJ9B 3BGFB 1RUML 4JG1H 1M4KA 2Q76B 4WI2A 2DD8H 4FQXB 5IVOA 5T3XD 1MF2H 4LP5A 1F42A 4ZO9A 5DRWA 4M5YH 1ORSB 4FFWD 1HEZB 3VFMA 2OL3L 2CUHA 5D1QC 3D25B 2NNAA 1FNFA 3GBNL 1HZHH 4AIXA 3MFGB 4HJGA 2BVOA 4R4ND 1U8LA 4IRSC 1BD2A 4M03A 3GK8L 1DLHA 3LD8B 1E4XL 3AREA 4R0LA 1CK0H 3EJZD 2EICA 3ESVF 1QSFB 3T0EE 2VUOA 5F72S 1RUPH 5FYJE 3MV7B 5C9JB 2FBJH 4UTBH 1QLEL 3F65A 5EORL 4QF1B 2GJ6A 5BZWB 4YK4B 2B0SL 1XF2A 5DHYB 4U1NB 1Y18B 4N8VB 3S35H 4NWUH 1LDPH 5BVJA 4JM2D 1YPZA 2EH8H 5C0FB 1IILE 4ZFOB 2YD9A 4NQEE 1UJTA 3MA9L 4G8IB 3C60B 4GFTB 4WO4A 3DX8B 4HFUH 5L2KE 1ZEAL 3V7MA 3OKDB 1BX2B 1W0VB 2ZSWA 2IG2H 1U9KA 4WWKC 2BVPB 3KJ4C 2DQJL 1RIUL 5J6HB 2J1KA 5E8PA 3Q5TA 5F9WB 1A1NB 1YMMD 2CPCA 3CVIH 4YAQA 5IMOA 2VZVA 2V7NA 3RL1B 1N4XH 2VQTA 3SKOB 4G3YH 1ZT4B 4JO4H 4P4RB 3R8QA 1AQKH 1JRHL 2AJ3B 4Q74A 4KKCC 4XNXH 4LSTH 4L8SC 2QSQA 1OHQA 1FFRA 1I3GH 1X5IA 1KJ3H 5H2BA 3CU1A 1TTGA 4QOKE 5BW7A 4PLNC 3HI5H 5EU3B 3ULSA 1XT5A 1EAPA 1KV3A 1F2QA 1AD0B 2EC9T 3C8HA 3KPRE 1RZIB 3BYYA 5DMIL 3UTTE 5DR5H 4OZHA 2H2SC 1XEDA 3PL6A 5D1QA 1D7FA 4C83A 4NNPH 5BMFH 4NRZB 1A6ZB 1L9NA 2P24B 1EK3A 3M8OH 1MCPH 2R69L 4OBSA 5IF0B 2CIKA 4PBVC 4X6BA 5IK3B 1AI1H 3EAKA 2AJVL 2MKWA 1QVOB 1NSNH 1VCAA 4GW5B 4EQ3A 2R1XA 3DBXA 1INEL 4HWEH 5CSGA 2FH8A 5DQDL 4IRSA 4A6YA 4DZ8B 4F7CB 2NY2B 2F54B 4JN2B 4XH2B 3IJHA 5JXAL 3MJ8B 3CLFL 4LSQL 3ARVA 5CUSH 4M48L 3JWOH 3SDXB 4YHKL 1MOEA 4M8VA 1I8IB 3EIFA 1G7QB 5HYQA 3O9WC 5D9SB 3U7WL 3GMLA 4Z7VB 5KN5A 4CKVX 1SYSB 4W6WB 5D7LB 5JXEC 5LVEA 5KSBB 3B5TA 1G1CA 2B2XL 5FUZL 3JV4A 3KNBB 3P4NA 3QJFB 3X12B 3GB7A 3KAAA 3C6LA 4LAJH 3U0TB 2X4NB 5CEYB 3RWHA 3Q1SH 5CINH 4WWKA 3G5YA 4OQTL 1ZT1B 2EIZA 4TYUA 3QH3A 2FL5B 3MA7A 1LE9A 3P0VH 1NH6A 5ESQA 3VD7A 3KWWA 4P2YA 4QXWA 5FECA 5IT2L 3SE4A 4NQVB 2Q20A 4DKAA 3CXHJ 3AB0C 1KPVA 3GMPA 2X4PB 1XGTA 4LVHB 4PG2C 5EC1B 1PLGH 4F9PC 4L8SA 4QRRD 3FO9A 2CKBL 4L8DA 4J12A 3LPGA 5DO2C 3MRKA 1BJMA 2NY5L 1P6AB 1U6AH 5I1IH 4X6FB 4JLRA 1BZQK 2H1PL 3PWVA 4Z76B 5CP7B 5EZIH 1PYWA 4GJTB 3WKML 3K4DA 1GVIA 4PB9L 3QEQD 32C2A 1INDL 5HGHB 5GGVH 4Z7QF 1XF5B 2Y36H 4O2FA 3L5XL 1XGPB 3MPCA 3AMKA 3QHFH 1D9KC 3QIBB 4XWGL 4LLYB 5DHVA 3MFFA 3U30C 5FYLE 4UIKL 5C07A 3DX6B 4G80A 3MQIA 4NT6B 2YUZA 4LSUH 5HSFA 4K7FB 4HX1A 1A7QL 2E6PA 4ISVB 2DQGH 4LCYB 4M02A 2VDRL 2PO6A 3TFKC 1MCLA 2DLEA 2YC1A 2IAMD 5C3LD 1IZKA 1CFVL 3MRQB 4BFEA 3O2WH 2EKJA 5EOTB 3MBED 1T2QH 5GGRB 3H9SB 3MV8A 3QDMA 2XFXB 5IW6B 4IOIA 4L9LB 4Y4KA 5JIIA 4DJMA 1TMCB 1A7OH 1MIML 3WHXB 5E1AB 3NA9H 5JXEA 3E2HB 3G5VA 4NKMB 1F4AA 3ZDXF 1H3PL 1S7SA 3EGSB 5AWNL 1FZJA 3WN5B 4DUXA 5IFAH 3EZ8A 1KJMA 4PJXF 2COQA 2ZPKL 4YDLB 3BN9C 3CVHA 2X4QA 4HC1L 4KC3B 2E7LC 4IIQC 2C9AA 2RCSL 2A6DB 4WEBH 4GSDL 4ZUWB 4HS8L 5J13C 2VWEC 2B1AL 3DURB 3VI4F 5J4MA 3HNTH 5LG1A 1CT8B 1I1FB 2ARJQ 4DUWA 3CFJB 1QHOA 1A6WH 3LKQB 1RHHB 2XKNB 3SKNB 4G6KH 3MV9D 1UVQA 4HPYH 5IFJA 3D85A 4FQXC 3RWEB 4JZOB 3QZWB 5DJ0B 2FX9L 3ZE1E 4NYLB 1FO0H 3MRIB 4ENEC 3IJSB 4S0SD 3OL2A 1NCWH 4X8JA 3E8UL 5AUMA 3BQUB 3NIDE 4MLSA 4H1LA 1NMCC 5I30L 5AD0B 3DI2B 3HPLB 2AJUL 1MFDH 3MGTA 3SOBH 2OJEB 1Z9SA 4NUJA 3VGGA 3RP1A 1D9KA 2NY3D 3LD8C 3MRRA 1ETZB 4X6DA 2EDQA 3EOBB 3MLPA 3TBVA 1NGXA 1OB1A 4XRCB 1J0JA 2VAAB 1RHFA 3DXAB 4Z0BL 2L0DA 1CFBA 3W5NA 1F3JA 2PXYC 4NWTL 3FN0L 1CD9B 1KJ2L 5CGYC 2JB6B 5KBNC 2D9CA 2J8UF 5J1SC 3S88L 1R3HB 1TFHA 4JFXA 1AY1H 5ISZE 1WCQA 4OT1L 2FDBP 4YIQA 5F96H 5JORA 1H5BB 3HFML 3SY0B 1QYGH 1QFWH 4IRZH 4HT1L 1AIFB 1PBYA 4WHYG 1UWEL 5DUMH 1A7NL 5IVNA 1MWAB 3C60C 3ISWA 4EI6A 1OSPL 2YUVA 1QRNE 3TVMC 4BH7A 1BFSA 4RGNE 4W4OA 4ZS6C 4KJWD 4PP1D 1WBZA 3DUSB 5JUEH 2H3NA 4KK8D 3VH8A 1FZOA 1CLOL 2CK2A 4X5XB 2DKMA 3ZO0A 5HHOB 4RGOH 4NHUB 2GTZA 1I9JL 1N8ZA 1BD2D 1SJHA 3V5KB 3ULVF 4RMQA 1ZHBB 3QNZA 4BUHA 4D8PB 4PJGB 5CZVH 1VFBB 4XC3L 1X5KA 2UZYB 2DBLH 2FZ3B 2H32B 2GTWA 2VC2H 1NC2D 2JELH 3DNKA 3EYOB 4AL8H 2GJ6D 4TSBH 2EYSA 5CD5C 5DDHB 1CG9B 4PJ9A 4RRPA 3VFUB 2Q76A 4FQXA 5IW3A 4PJ7F 1EVUA 3FMGL 3RKDC 5SWSD 1ORSA 1HEZA 1ZA3B 5I8KH 1PG7H 4B0MM 3T3MF 3GNMH 3DTXA 3D25A 1MELA 1SMAA 4WO4D 2GT9B 1WGOA 8FABA 1E4XI 3SCMC 4UQ3B 3SDYL 3CZFB 1NDMB 2OTPA 5DRXB 3BDYL 4YHML 4OSUH 1X5YA 3DSFL 2DQHH 4KHXL 3U7AA 2AXFA 2XG5A 1UZ6E 1W2KT 3T3PF 1QSFA 2NY0C 1YJDH 4OF3A 2BVTA 4CNIB 2Q3ZA 1CF8L 5KG9B 3ULUF 1CE1L 1S7RB 3BFOA 3BGAA 5ICYB 3MV7A 5C9JA 3HCVB 4RAHA 1DBJH 5HHPB 4QF1A 4RFOH 5BZWA 4PJDE 1BAFL 4JQVC 3T0WA 5DHYA 4U1NA 3MUJA 2E7CA 1Y18A 2VTFA 2DIJA 4N8VA 3S4SG 4F7MB 3DOSA 3PL6D 5D1QD 5FF6B 5C0FA 3ILPB 4ZFOA 5C70A 5SX5H 1RUAL 2ICCA 3C60A 1I8LC 4GH7B 3DX8A 2N7BA 5D5MB 5GSVB 1KB5H 3MLXH 4CBPA 3OKDA 1S5IL 3HE6B 1W0VA 1X4YA 3EJYC 2BVPA 4IRSD 3GHBH 4KTEH 5EO9B 3O6LL 3GFUA 5J6HA 3VD3A 1A1NA 5FIEA 5DZLA 4IJ3B 3Q5YA 1ZV5A 3RL1A 3TN0C 1KB9K 5CCKH 3SKOA 4BQBA 4LCIH 2LAGB 1ZT4A 1EPFA 4P4RA 2F53B 2AJ3A 1NLBH 2IMMA 3IU4H 2X4SB 3I2CH 1G6RB 1UCTA 3TJHD 5EU3A 4G7VL 5I74C 3ARBB 1AD0A 3R4DA 4QNPE 3WMSA 1E0OB 1RZIA 2B4CC 2R0LH 3IYLW 4LOUC 3WO4C 5TQ2L 1RFDL 4CJ1A 1FPTH 1YEFH 4NRZA 3SQOL 1A6ZA 3SHSA 2P24A 3EFFB 3BKML 5IF0A 2H8PB 2QLVB 3C6LD 3RU8L 3QIBC 3JWOC 4XVUC 5IK3A 1QVOA 1LDSA 4GW5A 4Q0XH 2PYEB 4WWKD 1JPTL 1FG9C 4DZ8A 4F7CA 1IGYB 2D0HA 3RA7L 1OF2B 2F54A 4JN2A 4XH2A 3MJ8A 1X7QB 4KY1H 1UADC 1T7WA 1HH6B 3SDXA 5JOPE 3IAPA 4NQDB 4PLKD 3AS3A 1BBDH 4KROB 3I02B 1I8IA 1G7QA 4QT5B 4QTIH 4J1UB 4M1GH 5D9SA 3L1OH 2XACC 4Z7VA 3CDFA 1KB9J 4FNLH 2BVYA 1SYSA 3OBAA 4PJ8C 2WUCL 4MAUH 5D7LA 3SGJA 3UTZB 3E2HC 4HJ0D 5J06A 5KSBA 2MTPA 5IGXH 2R56L 2NZ9C 3X12A 3KNBA 3QJFA 4YO0B 3U0TA 1VGEH 2XQBL 5C07D 2X4NA 4UNUA 5CEYA 3MNWB 5L8JB 1OQXA 5FB8B 5BOPA 1MFEH 1ZT1A 2DQEL 1ZS8B 5FKAB 1PEZA 1A14H 1GSMA 2FL5A 5LGKA 1OOAA 1ORQB 2PO6D 1GZPB 5AZEH 4NCC1 1A1MB 4NQVA 2OK0H 4KV5E 4JVWA 5JIPA 2WBJC 2X4PA 3CSGA 1WFTA 3MV8D 4LARL 5EC1A 3O81A 4ALAH 1KENL 4QOKB 4NM4H 1DSFL 3U1SL 4QRUA 2AK1L 2BRRH 2ED9A 5I71B 1AC0A 4X6FA 3KPRB 3BQUC 4Z76A 4K55A 3UTTB 5LGJB 5CP7A 5DD6B 1W72H 5IEHB 2N56A 5DD5H 1UYWH 1D3CA 5TE6H 5JXED 5HGHA 5T33H 1XF5A 1J0ZA 1XGPA 4OLVL 2YMXL 3NAAH 1DEDA 3QIBA 4LLYA 4HF5H 3S34H 3HR5B 4DZBB 2DQCH 3DX6A 3U9UB 4JDTH 1DBML 4NT6A 2VNCA 4K7FA 2NX5E 1CDIA 1OP9A 2W0FB 3KPPB 3GSWB 4ISVA 1F13A 4LCYA 5C6PB 3IDMB 4YHNB 1NEZG 3QEUB 4G42B 4OTXL 3N9GL 4LVNB 4FFZH 5TE4H 3D85D 3V4VL 3MRQA 4CDHA 4NO0B 2D2OA 5EOTA 1X9QA 4WU7B 3KLSA 5GGRA 3H9SA 3P9WB 2VLKE 2XFXA 4M61B 3UBXI 1DQJB 4FQPA 3QIWC 4KRLB 3ARPA 5GS0H 5IW6A 4HUVB 4FQ1H 1HKFA 3I3BA 4L9LA 1AKJD 3LN9A 2PCPA 4YGVB 2HLAB 4OFYA 4UQ2B 5DGQA 4P59L 3L3KB 3WHXA 5E1AA 5C0IB 5K9OB 1E27B 4NKMA 4AIZB 3VU2A 4OZFG 3EGSA 2XZQH 4NZTH 3WN5A 1QBML 1D9KD 3KPTA 3X14B 3BZDA 1KCRH 2QL1A 1E4KC 1EJ6A 3CSPA 3IXAB 3O4LE 4ONGL 1ES0B 2A6DA 1T7YA 4ZUWA 1A3RH 3DURA 4GAYB 1CT8A 1I1FA 5F6IC 4AIOA 2O26U 15C8H 3CFJA 3LKQA 4G8FA 4OD3L 3V52H 1RHHA 2XKNA 5F89B 3SKNA 4MLIA 1FP5A 2GJJA 3ZDZF 3RWEA 4JZOA 5LAXB 4ZD3H 2NXZC 3K1KC 3QZWA 5ALBL 4WENB 5DJ0A 1T0PB 4YDJB 3Q48A 4O02L 2FH6A 4DKFH 3PXHA 4NYLA 3MRIA 4Y89A 3IJSA 1MY5A 3BQUA 4GXVL 4ZPTB 1C5CL 3VWJB 2WM0A 1OAXH 5GSRB 4ETQB 5AD0A 3EO1B 3HPLA 2ESVE 4UV7L 4XXCA 2ARWA 2ZCHL 2AXJA 5JZ7C 4G6MH 2ARJB 4M7JH 3BD5A 1PY4A 1ETZA 3EOBA 3BN9D 4DGVL 4F8QA 4LVOC 2K1MA 4XRCA 2ZUYA 2VAAA 4X9BA 5E4EB 1OARH 3DXAA 4NM8H 4A6YH 1O7SA 2VH5L 2X4RB 4YHLL 2EEAA 5FHBL 3BSZL 2VZTA 1I8MB 4UT7H 3T4AA 1EBAA 1R3HA 4NIKB 4PJ9D 4HCRL 2WP3O 4FHBD 4FQXD 1EO7A 4QRTB 1H5BA 1CL7L 3SY0A 1F02I 2QQLL 3B9EA 2OZ4L 1EVTC 1AIFA 5DEFB 4ENED 3HKFA 3LS5H 4MGXA 2VN7A 1MWAA 1VADA 5IESL 4JN1L 3S6CA 1CFQB 4GG6E 2VDNL 3F12B 4M4RA 1U3YA 4PJCF 1S9YB 1VEOA 2VDLH 3DUSA 3HE6C 1MCEA 2EXWD 2VO5A 4M43L 5I75B 1J05B 4X5XA 4XPBL 5HHOA 2WUBL 4AEIH 3V5KA 1QKZL 1IKFH 4D8PA 1NFDE 1QSFD 4PJGA 1J10A 2VQ1B 2GY5A 3NIGE 4ELME 1VFBA 2VB5A 2AABL 3BKCH 4QXGH 2FZ3A 2H32A 3MV7D 1MFCH 1D5ZB 2PXYD 3K81A 4FG6D 4JHWL 3BIKB 1N7ML 3EYOA 5D7IF 1OTTC 3BPNC 4EUPG 5DDHA 1CG9A 3VFUA 4KDTC 3N1GC 3HLAB 3ARBC 4JQIL 5MHSD 3SDDC 2NQCA 1ZA3A 4ODVH 3C60D 4YE4H 2H6PB 1YDPB 2NTSP 2GT9A 3LS4L 4WFED 4UQ3A 3CZFA 3ZKQD 1NDMA 3UTPE 4K23L 3S36H 5DRXA 1A0QH 4MVBC 5F7EH 2JJVA 4Y7MA 1XR9B 3I50L 1A1OB 4NKIL 1P5VA 2APTA 4XCFH 3NTCL 4N1EA 1GC1C 5DHVH 1MAKA 3T0EC 1R3IL 4X7CC 3W2DH 4CNIA 5KG9A 1S7RA 5ICYA 5DI8B 4R8WH 1R0AL 3EUUA 3HCVA 1W8NA 4P2OB 2AI0H 1UJ3C 5HHPA 3UZQA 5CD5D 2X4UB 4JFQB 3MLSH 1MJ7H 2XYCA 4Z7WE 3QA3B 4RRPG 3TYFB 1OPGH 1T1XB 3UJIH 2CH8A 3HI1B 2GEEA 4WI9A 4F7MA 4K3GA 4G6JL 2XZCH 2RR3A 2R2HB 3U4EB 5IVXB 5FF6A 4HIJB 3ILPA 2PNDA 4K71B 1CVSC 1PEWA 1QRNB 3EFDL 4R6UA 3KLHC 5D71L 5TDOB 5D5MA 2XIDA 5GSVA 2QTEA 3HE6A 1D6VH 3SDAB 1T7XA 1T3FB 4BQ8A 1WAAA 3OAZH 3GSNL 1BREA 1MREH 3TO4C 2VQUA 5EO9A 5FYKU 4UINH 1MFNA 2F54D 2HT4D 4K7PX 4HIXH 4AMKL 1BJ1J 2I60H 3T2OA 3HS0B 1I1AC 2IPUG 1BQLH 4M9OA 1RVFL 3MYJB 2FD6L 2F53A 3WIHL 2X4SA 1G6RA 1NUNB 2FX8L 4KDTA 4S1SH 1OP3H 3UEZA 4XAKE 3RBSA 4YXHH 4OLXL 3ARBA 4EXPX 5EA0H 1GZQB 5JQHC 3LPFA 2VOTA 5D7LD 2RHEA 1GIGH 5BVPL 1S7TB 3CFCL 3EFFA 4GAJH 2QHLA 2H8PA 2JJTC 2MMXA 4GAGH 2LU4A 1CBVL 3O3DB 1MRCH 2X42A 2PYEA 2CRIA 1LO2H 4H5SB 4H8WC 4PPTA 1IGYA 2BOCA 3BZFB 1OF2A 1HQ4B 2A6IB 1IT9H 3EYSH 1CZ8L 1LO0H 3BKJL 4GW4B 1X7QA 3C5ZB 2EE3A 1FIGH 1HH6A 1KN2L 1U8PB 2E9WA 4NQDA 3QSKB 4PJFF 1SHMA 3I02A 5KS9F 2P48B 4QT5A 4EUPH 4J1UA 1EX0A 1YYML 3DROB 3GRWL 3H42L 2J6EL 2V5RA 4OI8A 3FB8B 3S5LG 3BN3B 5A43C 3UTZA 1F8TH 2AEPH 4J3TA 1N2RB 3QIBD 5FYKH 4P23C 3B2VL 1AJ7L 4I18B 4YO0A 4FA8A 4Z9KB 1GYAA 2CO6B 1MCWM 3D1MC 4GKOA 1A7RL 3MNWA 1NC4B 1FORL 5FB8A 4YHYC 4YPJA 3WFHB 2X6MA 1ZS8A 5EIQA 4JPVH 5FKAA 1ORQA 1GZPA 3HUJE 1QFHA 1A1MA 3GI8H 2FR4B 4WI5A 3WDIA 3J8F7 2XTJE 4CGTA 2OP4L 4HUMB 1N0LA 3H9SD 1AR1C 1OAYH 2Z31C 4JDVB 4H88H 1WFOA 4QOKA 4JFOB 2DLFL 3MUY1 3UTOA 4OZGF 4OFYD 1RY7B 4LSSH 4GKNB 2GI7A 3KPRA 4PJ8D 4P46B 1L7IH 1HYSD 3UTTA 1G9NL 3W82A 5LGJA 5DD6A 3KHQA 3S37X 5IEHA 1BWWA 4Z7NF 2XXMB 3VFOB 3QJHB 3O0RH 3F7PC 2NZ9D 2LQRA 4XMPL 1HIMH 4Y4HC 3DPBA 4JHZA 3HR5A 3MRJB 4DZBA 5F8QC 4MXVE 5HDQL 4YUEH 2XZAH 5E4EC 3U9UA 2M1KA 2NY7H 4YXKH 3O2VL 3WHE0 3CMGA 4BSWA 2W0FA 1X4XA 3KPPA 3GSWA 4HZAA 5ANME 2CRZA 3P4LA 3IDMA 1EXUB 2IEPA 4YHNA 3QEUA 4G42A 1WWWX 4TNVK 4M1CD 4MJ4A 4IDJH 4FQJH 5CZXD 3UBXB 3IAQA 4EI5B 2FGWH 4P5TC 4NO0A 4WU7A 1WWBX 2FECL 4M61A 1DQJA 2EE6A 3QDGE 4KQ3H 4HUVA 3OHXB 3FQXB 3BQUD 4YGVA 2HLAA 5F8RC 4UQ2A 3PABB 4LCWB 3MODH 3L3KA 3T65B 1X6NA 1IBGH 2IPTL 3ZKXB 5C0IA 5K9OA 1E27A 4K9EH 5I75C 4JGMA 4Y5YC 4AIZA 3BEWB 2B1HH 2BVEA 4TQEH 4X9GA 1RI8A 5F7UA 3X14A 3C5SB 5FV1L 3BRFA 3DXAD 3IXAA 4NZRH 1ES0A 5JQ6L 3NFPB 5IEKB 3IJYB 4GAYA 4Q9RL 5HDOA 3ZE2F 4R26L 5EIVA 5F89A 5D2LE 4AEHL 4U3HA 3E3QE 5LAXA 3KPNB 4YGAB 4RZCB 1VENA 4YDJA 1S78D 5F7HA 3QEHB 1YMHB 2CRMA 1ADQA 4MXQC 3DWTA 1KC5H 4ZPTA 3VWJA 5GSRA 3BP4B 4ETQA 1NMBH 2IH3B 3MBXL 3EO1A 2IQ9H 3CDGB 4HK3J 1EA9C 1ITCA 5HHOD 5BRZE 3T4YA 12E8L 2ARJA 1IGJB 3TBYB 1LO4H 3VGHA 4JRXE 2A6KB 4X7TB 2Q7YB 4LDLB 2KBGA 3WNNA 5GGTL 1KTKE 2X4RA 4NBYB 1CL7I 4UV4L 3IFPB 4P2OC 3WNOA 4Z77B 3SO3B 2FJHB 4ESKA 3CZJA 3VFGL 4XHJC 3BT2H 4HJJH 2NXZD 4POUB 3MJGX 1DQLH 4QRTA 2OSLA 1XH3B 4XB8A 4HS6B 1DQMH 5CMAB 3ZYZA 1SVZA 2P5EB 5DEFA 2CLVB 4OF7A 3CX2A 3VA2C 4PLOB 1C12B 1PKOA 4RGNC 1CFQA 1FE8H 4WHDA 4WW2C 1CXFA 2HG5B 3F12A 4UT9L 1S9YA 2Y06L 3F7QA 4YWGH 1FV1B 1J05A 4JB9L 5JZ7D 35C8L 3QCUH 2XICA 4LPUA 3SPVB 2VQ1A 3SO5A 1N64L 3N1PC 3MRDB 4E42B 1CU4H 4U1JB 2FJFB 1P7KB 2YKLL 3LKRB 4KHTL 4NQSB 1D5ZA 2AJYH 3MR9B 3BIKA 2VABB 3MZGB 3FB7B 4POZD 4GRWF 2X9XA 1DLFL 3T2NH 4OCYH 4IOSD 1IAIL 1Z3GL 3QCVL 1JZ2A 3L3IB 2H6PA 1YDPA 3E6HB 3IGAB 4G7YL 5DUPH 3VG0L 4U05A 3HE6D 3MXWH 4LHJB 3IDNB 1PG7W 3ZT6A 1XR9A 1G9ML 4KMLB 1L9MA 5DJ6B 1A1OA 1HCFX 3NFNB 2V2TB 1JPSL 4N0CD 5HHME 2W9LA 4HUWB 4PJEB 4TVPD 3PGDB 3VXNB 1U8IB 5HHQB 2VE6B 4Z8FH 3QDJE 5T3XL 4OV5B 1MCDA 5IJKC 2WWMD 5DI8A 1CFNB 4XVJL 1F4WL 5CJBA 4JG0L 2F53D 4P2OA 2OTUB 2X4UA 4JFQA 2FCBA 2XY1A 2ZCLL 1H3VA 4X4YB 1UKSA 4U1LB 3TYFA 4F7PB 1T1XA 3ARBD 3HI1A 3QIUB 5I73B 5GJTL 3EO0B 2NY1B 3IDGB 3LQAL 4P57B 4QXUH 4ODUB 2QSCL 3TYGL 2R2HA 3U4EA 5IVXA 4HIJA 2FX7H 1ZGLA 3BX7C 4I3SH 1KCVH 3MOAH 2IJ0C 2X44D 1MCHA 1QRNA 5E94B 2VDMH 3NZHL 3P4MB 3CSBA 4FQLH 1FNSL 4J3UA 4MVBD 3BIAX 4S1RH 1JHKL 1T20B 2PYED 3SDAA 3D3VB 1T3FA 1JVKA 1I7ZB 4RMUA 2IGFL 2HMIC 5B22A 3VE0B 3LHPH 1Y6KR 3HS0A 4RX4D 5FYJD 4K8RH 2HRLA 2XQYK 2YPLE 4ODWB 4NQDD 3MYJA 4KROD 3BESR 3VDBA 5MERB 1YA5A 5GRZA 1A3LH 5JR1H 3GM8A 3DECA 1BHGA 1TCRB 4JVUA 4FRWA 3BMWA 4KAQL 4YJZL 2YD4A 1GZQA 1A6UH 3PWLB 3C2AH 1ZHLB 3GI9L 4HK0B 5AZ2H 1S7TA 4GLRI 3KLHD 4D3CH 5D8JH 3H3PH 5HHXL 1Q1JL 5JW5B 4OGAC 2GHWB 3O3DA 5LCVL 1A6TB 3ZT5A 3UDWA 4EN3C 3U0WH 1QUNA 4XNZC 1CD8A 3DHJA 3BZFA 1F90H 1HQ4A 2A6IA 5IB3B 3MJ6A 4GW4A 4PD4K 4MJ6B 2CDGB 2V9TA 1RIVL 2Z92B 1IC4H 4JQXC 3C6SB 1CGSL 1U8PA 5EWIH 2OYPA 3QISA 4Z7WB 3AUVA 3VFNB 4QOKD 1RK1B 1A6VL 4K2UL 4LKCB 3DROA 1GCFA 3KPRD 4EEEA 1VEPA 1ITBB 4OQTA 3UTTD 5K9JH 25C8L 3FB8A 4HWNA 4H0GA 4GAFB 4S1DD 1MHPL 4DN4H 3ZKXC 4DQOH 2UV3A 3L3OB 4I13B 1MWAH 4M7KL 3O45B 1JYNA 5DVMA 1N2RA 4I18A 4FFVC 2C4FU 3D0VB 2O5XH 4PRAB 4JO3L 1NC4A 4KI5D 3INUH 2V17L 5ALCH 3WFHA 3V5HB 1B2WL 1MCBA 2H32H 3WFCH 2FR4A 2YSSA 4NO0D 4XCEB 4HXBH 4UMGA 2EDHA 4Q9QH 4JDVA 3V0WL 1U3HB 4PD4J 4JFOA 4OIAA 1TVBA 1Q9LA 1E4WL 5I8OL 3X3GH 1EUTA 4GKNA 3SGEH 1RULL 4P46A 2YXFA 4U4BA 4MXWH 3CSYB 2FEEI 3MLYH 4UT6L 3VFOA 3QJHA 3UJJL 3TT3H 1LEGB 1MIEH 1YYLH 4BQ9A 1Z9MA 4PJHB 3IFLH 3D39E 4PV8B 2W9EH 5GZOC 2BNQE 3MRJA 5CEZH 1AXTL 4M7LH 2VLJB 2CGRH 2DQDL 3BISA 5DC4B 2FECI 4MNQB 2NY4B 1EXUA 1R3JB 3QUMB 3BE1L 4JPIB 5AAWA 2WNGA 3UBXA 4EI5A 4LIQH 1JGLL 4FZ8L 4JCMA 4K9EC 1YECL 1AR1D 2Z31D 3Q5OA 3FQUB 4J23A 4P4KC 5FYJU 1F6LL 2H26B 4TPRH 4PS4H 3HI6H 1S3KH 4MA3B 4KVCH 3OHXA 3FQXA 2AP2A 2DQTL 1C7SA 2LTQC 2V5TA 1FAIL 3PABA 4LCWA 3VWJD 4MMXC 3T65A 2EDWA 1IEHA 3BDXA 5IHUH 5DVLA 5ITBH 1OD9A 1J1PL 4JFZL 4R90L 4CMMB 3BEWA 4ZTOL 4KU1A 4X80H 5FYLD 5L9DH 1S7QB 3NH7H 1WZ1L 5E2UH 3C5SA 3ULVL 1UH3A 3UYOD 2AXGB 3JVGC 1NKRA 1UH2A 5E6ZA 1OW0A 3VFPB 3WO3B 3NFPA 3FT3B 4S1QL 1GL4B 1RZKC 3HUJB 3IJYA 2D03L 1KTLB 3QFDB 3G04B 4GMTL 4JFDB 4L5FH 5DJAB 4OLWH 3Q6FA 3KPNA 4GO6B 4MD0B 1MRDH 3MYZA 4RZCA 2NXYB 5DLML 1EO5A 1D5IH 2NW3B 1I7TB 4MCYB 4PJIE 1G6RH 1YNLL 3I75B 3QEHA 1YMHA 4JO2H 4Q2ZB 5H35B 1SY6L 4L29B 4ZQKB 4HPOL 4WGVB 4CVZB 3R1GL 3BP4A 4Y2OA 2IH3A 1RZ8B 4I77L 3WDJA 3CDGA 3KS0H 4OUOA 1X5XA 1LK3H 1TTUA 1IGJA 3TBYA 2CMRL 2A6KA 4X7TA 2Q7YA 1F58L 3P77B 4HQQL 4PJ5E 4EDWH 3VFTB 1RMFH 1UEMA 3IFPA 3ULUL 3X13B 4Z77A 1CCZA 1YNKH 1YEIH 1LP9B 4D0CB 4HH8A 3H6JA 2N4IA 5I73C 1UM6H 1XH3A 2HYMA 4HS6A 4UNTA 5EB9A 4HHAB 5IBLD 5CMAA 1OAQH 1JFQL 3QDGB 2I9TB 2ZUTA 1QZ1A 1T2XA 2P5EA 4N0UE 2CLVA 3QUKB 1SVCP 4PIRF 1UQSB 2VUYA 1C12A 1GRWA 2HG5A 2JCCB 1P4IH 3VGAC 5I1LB 4P2QB 2DI9A 4TSAH 1FV1A 4OD1H 2F5AH 3TPKA 3I9GL 2ORBL 3QP3A 3GBML 4JFHE 4NJAL 3SPVA 3MRDA 4E42A 5AEAA 4U1JA 2FJFA 1P7KA 2GIYA 3LKRA 4ODTL 2WANA 4NQSA 4OUUB 3SGKA 3MR9A 4P2OD 3MXVL 2EDXA 4XC1L 2VABA 3RAJL 3FB7A 4QYOB 3O4OB 4PY7B 4E5XB 5D2LB 1TZIB 3BIBX 4XHJD 1X5LA 4Z5RB 3B9KC 4Z7QE 3U4BL 4LSVH 4X83A 4I4WB 2AJSH 3BWAB 1JIBA 2JJSA 1AGFB 4WDIB 3JWNC 2DM4A 2QQQA 4XPAH 1U91B 3L3IA 5GHWH 1QRND 3LKSB 2DDQH 3MLRL 1AHWC 3E6HA 3IGAA 1TZHB 1EJOL 5BV7L 2X41A 1CWVA 5L6YL 4F3FB 1P6FA 5GGQL 5FOBB 3SDAD 2RIKA 2R29H 3IDNA 2E5EA 4YBLB 1VHPA 3T77B 5DJ6A 2R4SH 4UOJA 2YPVL 2X2YA 3NFNA 2V2TA 3DVNB 6FABL 5ADOH 2W9DL 2A1WL 2LAAA 2FSEB 4LK4A 4X5LA 2BOBB 3PP3H 4HUWA 4PJEA 4O58H 3PGDA 3VXNA 1QFUL 1U8IA 3QI9B 4OM1L 2VE6A 5HHQA 5EU7E 3OAUH 2ENSA 4OV5A 4JZJC 1CFNA 4K7PH 1KEMH 1U2HA 1QPXA 2OTUA 4AH2B 4RQQB 3VXUE 4KTDH 2VDKH 4X4YA 3MZTA 4U1LA 3ZDXE 1MPAH 1RZJC 4F7PA 3GSNB 3QIUA 3EO0A 2DN7A 3IDGA 5D1ZB 4P57A 4NQUA 2NMSA 4ODUA 3ZHKA 2NY6B 5J12B 1WCBB 4O9HL 4XP1L 3ZKMD 5FK9B 5E94A 1ACYH 2R0WH 3P4MA 3KG5A 5DJYB 3VI4E 5LXGH 1OY3B 3GO1L 4GMSL 5LJYH 4MA7H 1T20A 4Y19E 2J88H 3D3VA 1I7ZA 4JKKA 5IROC 5D1XC 3RVTD 5IB1B 2ZJSH 1AD9B 3DV6B 5TFSH 3VE0A 5DK2B 4X4MA 3CK0H 4LHUG 1T80A 4FZEH 5DC0A 1YEJL 3ZE1F 1K85A 4LFHG 1JPST 3QEGH 4ODWA 5F70A 3NIDF 4U1KB 5MERA 3TCLB 4BQCA 7FABH 4Y8DC 2ZOLB 4K07A 4E41E 2YUXA 1A9BB 2Z4QB 1T03H 2HRPH 1TCRA 4D9RE 1AGCB 1KCUL 4R4FL 4AG4H 1DFBL 3PWLA 5E7BA 1ZHLA 1ADQH 4HK0A 1I9RH 2J4WL 2R4RH 3SE8H 1AHWA 3SEPA 1UT9A 3PE9A 3OZ9H 3MACH 5JW5A 2EDNA 3STZB 3QCTH 6CGTA 2J8UE 2HT3C 1A6TA 3NGBB 2BK8A 1NC4D 4JM4H 1QR1B 1MCSA 4WRLA 4KJQC 2HMID 4BM7A 5CBEB 4OB5L 3RKPA 5IB3A 2NY4C 4MJ6A 2CDGA 2VYRE 3QHZH 2Z92A 1MCIA 3C6SA 4OM0L 5I15H 1Q9WB 4Z7WA 4WW2F 3VFNA 4G8GE 1MJ8L 1RK1A 1S9KC 1RQ5A 4LKCA 1FL3B 4PB0H 4HUUB 4P46D 2OJZH 1LVEA 2J7LA 2JB5L 4OCXL 1S7XB 4M6NH 1JBJA 2FRGP 5T1MB 3L3OA 2BDNL 2G75B 4U1SB 3O45A 1AP2B 2AV7B 2IF7A 4OGAD 5IB4B 4XNYH 2CXKA 3CGTA 4EN3D 3D0VA 1A3QA 4PRAA 5HPOA 2DBJA 4PRNB 1RUMH 4PJ7E 1BP3B 3QPQD 3CFIC 4KK6C 3V5HA 3U7YL 3CPLB 1V5JA 4ZPVB 2OL3H 3T3ME 2D0GA 4EI5D 2XTJC 4F7TB 4XCEA 2W65B 4TSCH 4RWHA 4KDWA 1U3HA 4KUCF 5ILTL 3ZYOA 4LCWD 2L4OA 2IADB 3GK8H 5KVEL 5HI5D 2UUDK 3CFBB 3CSYA 4JPKL 4PJAF 3ULUE 3D69A 1LEGA 5F97E 1CGTA 1KBGL 2ZCKL 3PDDA 4PV8A 5E5MB 3D18B 2BFVH 1QLEH 4R9HA 1T7ZA 3GSVB 4OGXL 3FN9A 4JRWA 5EORH 2V9RA 4PJDF 2VLJA 3MUGB 4FABL 2B0SH 1GGYA 2VJXA 3QQ9C 4GQPH 2EZ0C 2JIXB 5IQ9B 3OJ2C 4YC2B 3AS0A 4MNQA 5K93A 4U6YB 4Y5XC 1BIHA 1JN6B 1R3JA 4P3DB 4DOHE 4WV1C 3QUMA 1FC2D 3MA9H 3MRLB 3W11D 5F71A 3HB3D 1JHTB 4PTUB 5C0JA 2QADB 4PTTB 4EZMA 1QPPA 3FQUA 1ZEAH 4OCWL 2H26A 4M93B 3TZVC 1QSEE 1CGUA 3KVQA 3CIQA 4MA3A 1LWRA 4O2CB 1TJIL 2HTKD 5CSBA 1XF3B 3HMWL 3M45A 3JZ7A 3ALWA 2DQJH 1RIUH 3CVHL 3IDUA 3QHTC 2DTML 3MV01 1AXSB 4LRIC 1OL0A 3GZKA 4CMMA 1FDLL 5GZOD 3KPSE 4D9LL 4RFNC 2E6QA 1JRHH 1S7QA 5C7XH 5GGUB 1NLDL 2IMNA 2OLDA 1JI1A 2NX5D 2AXGA 5DEZA 4HKXB 4LLQB 5DEGB 5L8LB 1P7HL 1ZK9A 1J11A 4I3RL 4HFWB 4NHCL 1P69B 5BO1L 2QSVA 3VFPA 1QACA 3MLVL 3FT3A 4WUUB 3IETB 3HUJA 2W91A 5DMIH 3GIVB 1KTLA 3QFDA 3G04A 5DJAA 5TPWL 3PGCB 3E3QC 4HUNB 2YEZB 5CILH 2A0LD 5T5NG 4MD0A 4MCZB 2R69H 2VLKD 3JV5A 5DFWH 1R5WB 1I7TA 2P5ED 4HZLB 3I75A 4P0DA 3MV11 4Q2ZA 5H35A 2DI7A 4L29A 5HTSA 1INEH 4ZQKA 5DQDH 4ELKB 5KZCB 3EDJA 5DK0B 4CVZA 1QD0A 4U3CA 3OKOB 3IFOB 3QB7C 1RZ8A 5JXAH 4KDVA 2AGJL 3CLFH 1KLUB 4LSQH 4JHAL 1J1OH 4M48H 1GGCL 3SDCB 5EU6E 1YZZA 3HZVB 3P77A 3BP5B 5J7CC 3U9PL 1U8MB 3U7WH 3VFTA 5BS0E 1KUMA 2CIIB 5ANMA 1D5XB 4KRMB 4ZTPL 3X13A 1A22B 3DMMC 3EW3B 1LO5B 1XR8B 1V3JA 3SJVE 4KVNL 4LU5L 4HSQA 4JPWH 4LSPL 1LP9A 2I26N 3GSQB 3WV0A 4D0CA 4X7DC 2B2XH 4HAFA 4HHAA 3QDGA 2I9TA 3QNXB 5F9AC 3QUKA 4OQTH 2XWTB 5FOJA 1KGCE 4L3EE 4OCRL 2JCCA 1AH1A 5HYJE 5I1LA 4P2QA 4QRPB 5EG6C 5IT2H 1UACL 4G8EB 3KYKL 1T1ZB 3ARRA 3VD4A 5I1EH 4P2CG 4M6ML 1UWGL 3KYMB 1YEKL 2CKBH 3HZYB 4OI9A 2NY5H 4OUUA 3WLWC 3LQMA 4Z18A 5F3BB 3DGCR 4OF6A 4PY7A 4E5XA 1H15B 3WKMH 3U36B 4MWFB 4PB9H 5D2LA 4MD5B 1TZIA 2HH0L 4Z5RA 1INDH 3QIUD 2VSDA 4XMLL 5EO0B 4GBXC 4I4WA 3L5XH 1KCSL 3BWAA 2PW2B 1AGFA 1EAJA 1T0NB 3ARGB 4X4XB 4ZNEA 4WDIA 1LO3L 2J2ZA 4XHQA 1G6VK 2IQAB 4XWGH 1U91A 3TBWB 2VLMD 4UIKH 4HGKC 1DUZB 3LKSA 4N9GB 2MJWA 1TZHA 2X9WA 4LKXB 5JPMB 3QUZC 1A7QH 4F3FA 5FOBA 2D4DA 3D3VD 1MEXL 2VDRH 3TBSB 4NRYB 5EOQL 3FCTB 3T77A 5E2TL 2IALB 2APWA 3G9VA 3OX8B 3DVNA 3BPOC 3T0DA 1CFVH 4OGZA 2FSEA 4U33A 5DF0A 5TH2B 3WS6A 2BOBA 4PJ5B 3RIFF 3QI9A 4L4TE 2ITCB 1ZLSL 1GPOL 1I3VA 4W81A 5J1AB 1MIMH 4AH2A 4ODHL 4RQQA 3LDBB 3ILQC 2VL4A 2R2CA 3GHEL 3GSNA 5F3HB 1IGCL 2C5DC 5AWNH 5D1ZA 4MZ3A 1NUGA 3RL2B 5CIPB 4N0UB 3BEVB 4O2EB 2ZPKH 1WCBA 4HC1H 2DL2A 3EOTL 5FK9A 4LPTA 2YD2A 3LEXB 2RCSH 1J1XL 5DJYA 4GSDH 4HS8H 2FEDD 2B1AH 4J4PC 4EDXB 1FLTX 1QFPA 2ZG3A 5CBAB 3WIHA 1BQHB 3B6SB 1Z0NA 1U8QB 2PN5A 2BMKB 4Z7UE 1QA9B 5IB1A 1AD9A 3DV6A 2AKRB 3OPZL 3U82B 5DK2A 4WFFE 1V3KA 4F7EB 1RIHL 2MQ0A 2DL9A 2MPAL 3DARA 4GRLC 4BKLB 1U0QA 3D2UB 3E8UH 4U1KA 3T0BA 1UC6A 1LD9B 5T3ZL 3TCLA 3VXTB 5I30H 3CMOH 2JK5B 2ZOLA 1T66C 3F6IA 2AJUH 1A9BA 2Z4QA 1RUPL 1SQ2N 1KCKA 5HPMA 5DXWA 2EECA 1Y6NR 1AGCA 5E6IC 4CRPA 1JJUA 4GG8B 5F21B 3DVGB 3BOVA 3AY4A 4Z0BH 4MDIB 2EYRB 2Y25A 3NCJL 4NWUL 5FCSH 2HKHH 3STZA 3FN0H 1QSZA 1KJ2H 2EH8L 5DRNB 4PRIE 3S88H 3S3SA 1QR1A 4X5WB 4UILL 4OT1H 2FYYB 3VRIB 2GUOB 2P8PB 4YC2C 4JREC 5CBEA 3OSKA 3GRWA 3HFMH 3EYUL 2J6EA 7CGTA 4HT1H 2VZUA 5HBBA 1PGRB 3EHBD 4DTGL 1UWEH 5I9QB 2J5LB 1A7NH 5IG7B 1IFHL 1OSPH 1P9MC 2QADC 3VXUB 1Q9WA 4JGJA 1N26A 3CVIL 4YFLF 1U3HD 1QRKA 4XAKD 4YBQD 1CLOH 1FL3A 1J5OL 4HUUA 4X6EB 1I9JH 3BD4A 4G3YL 5HGBB 4PJXB 1CS6A 3CDYA 1NFDF 2CUMA 2KL6A 1KTRL 1YQVL 4XNXL 1EEZB 1S7XA 3NIGF 4ELMF 3AXLB 5T1MA 1KJ3L 4F2MB 2G75A 4XC3H 4U1SA 5T1DL 4MQSB 3HI5L 1AP2A 4LAQL 3MSPA 2AV7A 1BMGA 4PRPE 2ICWJ 5ITFB 5T1LD 5IB4A 1TZGH 1V7NL 2C7UB 2HJLB 1QFWM 1HSAB 4KGJA 3V6BR 1YEEH 2HT3D 3WYRA 5DR5L 2UZXB 1U3ZA 5GS1C 4KJQD 4PRNA 5D7JB 3FONB 4LSRL 4MNQD 1WIUA 3FMGH 2NY4D 1WEJH 3CPLA 4ZPVA 3BRDA 4KQ4L 5IFHH 3AM8A 2MNUA 1D6EB 1BBJB 4HWEL 2E8YA 2B4CL 4J8RB 4F7TA 3EYQC 2W65A 1CXEA 1NCDL 4K3EL 3PWPB 3SDYH 4E41B 1KYOK 3BDYH 4YHMH 4PLJC 1VKXA 3IXTB 1DEEB 1B0GB 4X4ZA 5GJSL 3QAZC 4FS0A 3DSFH 3TM6A 1QTYT 3JWOL 1BIIB 2IADA 4KHXH 3LVEA 1X5ZA 3BKYL 3BJLA 4ZAKC 3FAWA 3CFBA 2VN4A 2BNRE 1CF8H 1CE1H 1MJJB 3ZKNC 3RNKB 4IOFD 4Y4FB 3OXRB 5E5MA 3JBG7 4MQXC 2J8UB 5L0QB 3GSVA 3KR3L 1JWMA 1L7TH 2FHBA 1UWXK 1ZKAA 3MUGA 2C3XA 1F11B 1BAFH 2APXA 3FL7A 1V8HA 4AEFA 1GHFL 2JIXA 4V1DB 5IQ9A 2Q8BL 4RFEB 4MS8C 3WUWB 4PY8J 3WXWL 3DETD 2WW8A 1UEYA 1JN6A 1WTLA 1AO7B 5KSVB 4P3DA 4KK5C 3BO8B 3EO9L 1H3WM 1N6VA 3MRLA 4K94H 2WWKO 1RUAH 1JHTA 4PTUA 4PTTA 2NXYD 5C08E 1JNHB 3MRNB 4GXUN 5J1TC 2BX5A 2LVCA 1T89C 4O2CA 2NPLX 1XF3A 5FGCE 2DQIH 4EVNB 2GQHA 1ZVHA 3PQYB 1MAJA 4Y2DC 1PLGL 1AXSA 1BFOB 1DBBL 1E6OL 4PY8I 3HC3L 5I1IL 4LCCC 1I9IL 1N0XL 5DRZB 4LGPB 5E2WL 4MJ2A 5GGUA 2X89A 3U6RB 4HKXA 2EZ0D 5DEGA 4PJ7B 1FVEB 3RWGB 4JKPL 1S9WB 4HFWA 4ZUTB 4M3KB 4F9LC 4G7VH 2OXHA 4WUUA 3IETA 1JGDB 4Q6IC 1NGZB 2PUQT 2Y9RT 3GIVA 5TQ2H 1RFDH 3PGCA 1DCLA 5ERWB 5LBSL 1WIOA 2YOCA 2Y5EA 4LSUL 3SQOH 2YEZA 4Z6AT 4KGLA 4L3CB 4MCZA 3BKMH 3QDGD 3RU8H 2DQGL 1AE6L 1R5WA 3DRTB 4HZLA 3L3JB 4MB5A 2VXVL 3GUTB 1JPTH 4ELKA 1VPOL 4J3WA 2BHYA 5DK0A 4YQXL 2A9NL 3OKOA 4P2QD 4RGMC 3IFOA 1U8JB 4IRJC 4NSKB 2G2RB 1KLUA 4NQCE 1V7ML 3CCHB 3SDCA 4PJFE 5GRYA 3WKNA 1A7OL 5I1JL 4U31A 5KS9E 3HZVA 3NA9L 3BP5A 4RSVA 3TBTB 3G6JE 1U8MA 4ZXBC 2CIIA 4UOW1 1D5XA 1LO5A 1XR8A 2WUCH 4C4KO 4NOFA 4MNHB 3GSQA 1XGUB 5C8JB 4WEBL 2R56H 2KKQA 1R5IB 3HZMB 2CK0L 3QNXA 1K9TA 3RVVC 2LFGA 4OIBA 2XG4A 4APQB 4BFIB 2XWTA 4WCYL 4WY7L 3MCG1 4XNQB 2DQEH 5D6DC 3WJLA 5F9OH 3ZL4L 4FQIL 1XF1A 2VXSL 3BUYB 3K8LA 1FO0L 1IEAB 3BUTA 4G8EA 1EIBA 1T1ZA 3G08B 3HTLX 3TT1L 3QI9D 4MA8L 1ONQB 5F9JB 3KYMA 4F15B 3GKZA 1KENH 4LQFL 2Z91B 4RA0C 3HZYA 1DUYB 1DSFH 1P84J 5FM4A 3U1SH 1U8LB 1JZ7A 3ZKSD 5C1MB 5F3BA 3P0YH 4KUZL 1KELL 3MX0A 5BV7B 1B4JH 1H15A 3U36A 4MWFA 4MD5A 1WZLA 5EUOE 1YY9D 4P9HH 5EO0A 5CSZB 1NC2B 2A9ML 4I2XE 2PW2A 2E3VA 2GSGB 4POYA 4OLVH 1T0NA 2YMXH 3ARGA 4X4XA 5SWZE 2NY6D 2IQAA 4MXVF 3TBWA 2A2QT 2YRLA 4LDOB 1DUZA 3V2AR 4ZOAA 1DBMH 4N9GA 4LKXA 5JPMA 5SWSB 4JDZB 4KKAD 5MEPB 5DFVC 1MLCB 3TBSA 5E99L 4NRYA 3FCTA 5MEQB 2IALA 3NA4A 5D7SH 3I3EA 1J8KA 3V4VH 5KW9L 2Y1VA 3OX8A 5JIHA 3RFZC 5TH2A 3ZYIA 4PJ5A 5EU7C 3LEYL 5JUEL 2ITCA 4NC1E 5BS0B 5I9QC 5JOFB 2J5LC 5J1AA 4R7DB 4P59H 3CXDL 4N5UA 3SJVB 4J7RA 1A7PL 5CZVL 1CIUA 3QPXL 4TNWF 5GQBA 4LF3B 4PGEB 5F3HA 2VC2L 1OP5K 4UU9B 3QO0B 3U4AA 1B0RB 1QBMH 4HS3B 5IOPB 3RL2A 5IHBA 3HNVL 5CIPA 1X5JA 4N0UA 3BEVA 1XIWC 4O2EA 5J57B 3V6OA 1E4JA 2D9QB 1HILB 4ONGH 1U92B 3LEXA 4ZO8A 4FTVE 4EDXA 5GRJL 3LZFL 4IHOB 4ERSL 4A2MA 2UVFA 3WSQL 4OD3H 5CBAA 5EOCL 1BQHA 3B6SA 5HHMD 1XF4B 1U8QA 2BMKA 2AKRA 1GOHA 2UWEF 2X1XR 2P8MB 3VXSB 5TGBB 2ZUUA 3QDJD 1P4BL 4F7EA 5MENB 4O02H 5D6CB 4BKLA 1LMKA 3D2UA 1VERA 4GXVH 1C5CH 1LD9A 3ILQD 3VXTA 3K2UH 3TNNB 2JK5A 5HXMA 5E1HB 4X9IA 2YZ1A 2ZCHH 4KXZH 2I27N 5DS8B 1UKQA 4DGVH 3GSOA 3CH8A 4GG8A 1BVZA 1H8SA 4L1HA 3ZSTA 3DVGA 2DM7A 1GC1L 2VH5H 3B2UD 4MDIA 2ID5A 2EYRA 4YHLH 2VLRE 5L0QC 1JZ4A 5FHBH 4WI7A 5KVGH 4QHLB 5GRUL 5DRNA 1XAUA 4HCRH 4JFFE 3DLQR 4X5WA 4EIZC 2FYYA 3VRIA 2GUOA 2P8PA 3QULB 1BZ9B 4U1IB 4Q6YA 3MLXL 1VB9A 2QQLH 3RIAK 2OZ4H 3MRBB 4HWBH 1NBZB 3KJ4B 4QHNB 5IG7A 3GHBL 1JYXA 5IESH 1TPXB 4JN1H 1Z6JT 4E0RB 2XN9B 3VXUA 2VDNH 3K2MC 2OXGA 4BZ1H 2CO7B 4YXLL 3T1WA 1L6XA 2VDQL 4JEGB 4M43H 4XAWH 5CCKL 1G0YR 1MVUB 4XPBH 4X6EA 5HGBA 1P53A 2WUBH 3QUXB 1BFTA 4PJXA 5BCAA 2WV3A 1EEZA 1IGML 2M8XA 2X70B 4JRYB 3AXLA 4K3JH 4CMHC 3I2CL 3CX5K 4F2MA 2FB4L 4M1DL 2P46B 2AABH 5F9DC 5KAQG 5ITFA 2EDOA 2C7UA 4JHWH 2HJLA 4NN6C 1HSAA 1N7MH 3U2SB 1OTUC 2B5IC 4Z95L 1V3MA 3QNYB 1ZLUK 2ERJC 5D7JA 2DOCA 4MJIE 2JIXD 3F6LA 3T8XB 3FONA 4BYHA 3TIDB 1RK0B 2P7TB 3SGDH 4JE4B 1P7QD 1KCLA 4NN7C 4LASL 1BBJA 3E6FB 5CLWA 2QADD 4HV8B 2ICWB 1EFXD 5C0CB 3PWPA 4JY4B 1NMAH 2BHZA 3QWRA 4E41A 4KZEH 4NKDB 4K23H 1JYWA 4KY1L 3UC0H 3KPLB 3IXTA 1DEEA 1B0GA 2Y6SC 3I50H 3S3PA 2MCG1 1BIIA 1AC6A 4NKIH 1FCGA 1BBDL 3NTCH 2FLBT 3RY4A 4H8WL 2E7MA 3O9WB 2I5YL 4QTIL 3RVXC 1R3IH 4OGYL 3B3IB 3NVQA 3NOIA 1MJJA 2NLJB 4QO1A 3RNKA 1Y6MR 2P5WB 2C3VB 4WHCA 3GIZL 4Y4FA 3OXRA 1R0AH 1II4E 2J8UA 4K94C 2X89D 1F11A 3CX5J 1SEBB 4V1DA 2XQYG 3CAFA 4RFEA 4UBDC 4WUUD 3WUWA 5IGXL 2DRUA 4LEXL 5KSVA 1AO7A 2XXCB 3BO8A 5ACMA 5D72L 4HIEB 2CJUH 3EFDH 5D71H 4PJCB 4QHKJ 3V6FA 1DANU 1A14L 2ADJB 1JNHA 1KLFA 3MRNA 5AZEL 3GSNH 2IANE 4I0KA 5KZCD 3AB0B 2ICEB 4EVNA 4G43B 1F2XK 3PQYA 4AMKH 1ULVA 4YPGB 2NTFB 2NZIA 4ODXB 1BFOA 4PJBE 5B39B 3IKCB 3SDCD 1AKJB 1BF8A 3OKEB 5D7IB 3RVUD 1RVFH 5DRZA 2PF6A 2FD6H 1Q9OB 3U6RA 1UYWL 3WIHH 1WT5A 2EH7L 4NDMB 1JF5A 3SKUD 4F37F 3NCBB 4LGSB 4PJ7A 1FVEA 3RWGA 4KMTL 1S9WA 4ZUTA 4MS8D 1SY6A 3ZE0E 4OLXH 3MRRB 4WFGD 3DUUB 1JGDA 5EU4B 1KULA 3U30B 1N5YL 1NGZA 5F93C 5IBTH 5BVPH 5ERWA 4MD4B 2IH1B 3DYOA 2DAVA 4PUBL 3CFCH 4L3CA 2LV4A 3DRTA 2E9JA 1CBVH 5EZJB 2DJ4A 3HA0A 3L3JA 1MRFL 3H3KA 4FFZL 4U1GB 2D0FA 4YZFF 3GUTA 1OAUL 4K3DL 5FYLL 5JORB 3LKNB 1U8JA 4WW1B 1CZ8H 3BKJH 4NSKA 1ED3B 5I1AA 2G2RA 5H8DA 2E6JA 3CCHA 1FNGB 1KN2H 2BC4B 4X8XA 3NCMA 4JY5H 3C8KB 2XKSA 3NABL 1NBVL 4RMTA 3TBTA 3TWCL 2DJUA 3QXTA 3QWQB 3GRWH 5FGRA 5ECJE 3H42H 2AK4E 4WJ5B 1MH5B 2J6EH 5C92A 1KCRL 1DTUA 4IIQB 4MNHA 1XGUA 3EJJX 3QUYC 3WFEL 5C8JA 5J13B 1IM3B 3ARGD 5C6TL 3S7GA 1SM3L 1JNNL 1AJ7H 2VIRB 15C8L 3B2VH 3HZMA 5E2JA 3Q6GL 4W6YB 1MSPA 1A7RH 4OZIE 4APQA 1FORH 4BFIA 4KRNA 1PDKA 5KOVC 5JNYB 3MC0A 4XNQA 1X44A 2BSTB 2QQNL 3BUYA 4DKFL 3DTXB 3BWUC 3NIFE 2ADFH 3V0AC 1IEAA 4BSVB 5CP3H 4R2GC 5F7LB 4B53A 8FABB 5J11C 4RIRB 2CLRB 4P9HC 1NMCB 2IC2A 2OP4H 5C71A 3G08A 4PJ5D 1OAXL 1ONQA 2YD1A 4WWID 5F9JA 3TPUB 1HSBB 2VDOH 2A83B 2Z91A 4MZ2A 3O3BB 1DUYA 2MCPL 2YXMA 3S98A 2AXFB 3LH2L 4TUKL 4M7JL 4LPWA 2OBGA 3UZEA 3MLWH 1MCOH 1BOGB 4QRRE 3KYOB 5CSZA 2PXYB 2PTUA 3MUHL 3W9DB 1I4FB 1NC2A 2GSGA 3VRLE 4PRHB 1QFWI 5KSAC 4HMCA 5FUOL 5HDQH 2OR8A 3O2VH 3QEQE 3ZTJH 5SWSA 3MO1B 4JDZA 5MEPA 4LNRB 3FO0L 2YN5A 1MLCA 4QY8B 5IBUB 4KRPC 5MEQA 1G7JB 4PJFB 3TVMB 5EOCJ 5M94B 4JFHD 5KS9B 1G7HB 4FXKB 5C2BL 2EE9A 5E8DL 2VR9A 3K74B 5BS0A 3FFCB 1MQKL 5JOFA 2NYYD 3D2UD 4R7DA 2ZOKB 1TPXC 2B7DT 5CWSB 4GS7C 3SJVA 5GRWA 5HGGS 5CFHA 2IPTH 3QBTB 1INQB 3ARTA 1SBBA 4XPTH 2WBKA 4LF3A 1TITA 1MFCL 4R97C 4PGEA 4UU9A 3IDIB 3MMEB 3QO0A 1B0RA 3QUXC 4CU7A 4HS3A 5IOPA 1IL1B 2V6HA 4RWYL 4UTAL 4M7ZC 3EZJB 1HILA 1U92A 5J0BA 5B8CC 5JQ6H 1SBSL 4IHOA 1EGJA 4Q9RH 1T1WB 1T7VA 2ZG1A 4R26H 1O5DT 2C26A 3ROLB 1XF4A 4AEHH 3P30L 1WK0A 3SCMB 5HYSB 4X0KB 3VXSA 2P8MA 3W5MA 4PJIF 5TGBA 5MENA 1A0QL 5B38B 4OZGB 5D6CA 3CXHK 3UTSE 1IMHC 1YY8B 3HMXL 5FO8B 1FNHA 3VXUD 2VERN 3MV9E 1N6QL 1IQWH 4WNQB 2NY0B 4XT1C 3TNNA 1Y0LB 3KYAA 3MBXH 3H2WA 3W2DL 4MAYC 3UPRB 4I2XB 5SX4H 1IQDB 12E8H 3RWFB 2Y72A 4LGRB 2XNAB 5DS8A 5LWYL 2DLTA 1FH5L 2I25N 4KKBC 2L7JA 2LE9A 1KN4L 5GGTH 3T08A 4OCSL 4YDKL 3ZYJA 3VD9A 4UV4H 2XZCL 5HD8D 4QHLA 4FXGB 1HINL 5D7JD 2EIBA 3JUYA 3VFGH 4NO2B 3QULA 2WSKA 1BZ9A 4U1IA 4W70A 4QWWC 4NN5B 1CDGA 1J88A 1D6VL 3MRBA 4IMLB 1NBZA 4RDQG 1MREL 1BPVA 1NEUA 4QHNA 3A6CL 2PR4H 1DN2A 3T04D 3PWPD 5C0RH 5JIKA 4E0RA 3QWRD 2XN9A 4PP2B 4E41D 4OLUL 4HIXL 3BPLC 4UT9H 3ZT7A 5FO7B 1XCTB 3W39B 1T4KB 8CGTA 3TC9A 3TN0B 1BQLL 3GDBA 3V5DB 1MVUA 4JB9H 1KEGL 4D9RD 35C8H 4NO3B 3QUXA 2B8OT 3MNVB 1KG0B 5K9QG 2V2WB 2CD0A 2HFEB 3FRUA 4JRYA 2X70A 2AJXL 4QRUB 1IVLA 3RGVB 5FA3B 4S1SL 5I74B 2YKLH 1DQTA 4KHTH 4Y4FD 5CJOL 4YXHL 1Q94B 5CJQL 4YHOH 2CR6A 3U2SA 3OGOE 5EA0L 3WO4B 3O8XC 1BD2E 3QNYA 3VXOB 5IB2B 1GIGL 2WLYA 3PWNA 3NPSB 4V1DD 1MCJA 3JV0A 3T8XA 3TIDA 1RK0A 2P7TA 2WBWB 1IAIH 1FNEB 3TO2B 1AO7D 1Z3GH 1MRCL 1IAMA 1LO2L 1S8DB 3E6FA 4G7YH 4HV8A 1LQSR 3UXFA 2ICWA 5C0CA 3VG0H 1AXIB 2ZP0T 3IS0X 4JY4A 4NKDA 1YEHL 2BY3A 3ULVD 3KPLA 1G9MH 3VGEA 2KZWA 1YPZE 4U1GC 3KXFB 4JFPB 3IF1B 3PQYD 4F80A 3MTRA 1LGVA 1KOAA 3O9WA 5T5NF 4I48B 3B3IA 2PCPB 5T3XH 4ONHB 4ORGB 1MI5E 1RJZB 2NLJA 5DJ8B 1ZLVK 2P5WA 1M6OB 2C3VA 5GZNC 4PJ8B 1F4WH 9CGTA 4JG0H 1MFAL 5MEOB 3FZUC 3VWKC 1XGYH 1U3JA 1L6ZA 2W0LA 1UM5L 4OFVA 1SEBA 1YEGH 3U0PA 5GJTH 3FRPG 3LQAH 2QSCH 4PREB 3IAGC 3RZCC 5J9PB 4HIEA 1DVFC 3NZHH 4PJCA 3O3EB 1OM3L 4JPVL 2ADJA 4G8FB 1FNSH 3WFZA 4NCC2 5J56B 1JHKH 1VGKB 5HYEA 3GI8L 2WBJB 2IGFH 2ICEA 4G43A 4KJYB 4PG2A 5CIPH 4F9PA 3ULUD 4YPGA 2V9QA 2NTFA 4ODXA 4W68A 5B39A 3IKCA 1AKJA 3MOBL 4LSSL 3OKEA 5D7IA 1IGTB 3OG6B 2F15A 4NRXB 1Q9OA 4U49A 4NFBA 4GRWB 1UA6H 2LVEA 4NDMA 3DVIA 3NACH 3O0RL 4UBDD 2V2XB 4J6RL 3DUUA 4F57L 5EU4A 4AM0B 4KAQH 4CVWA 2YN3A 1FBIL 1JF1A 3QQ4B 3NCYS 4EQ2A 2XZAL 3VMOA 4ETYA 3GI9H 4YXKL 4MD4A 2IH1A 2EDTA 2M26A 1F4HA 5HHXH 4I9WE 1Q1JH 3T4AB 3T0AA 5HI4C 4JR9H 5EZJA 1NL0L 4APQD 4QRSB 1I85C 5EBLB 3LKNA 3DJ9A 1U42A 4PYGA 4WW1A 3S8WA 3QIWB 4N5EC 1ED3A 3AROA 4B7LA 1CICC 1VADB 3KPSD 1FNGA 1OQOA 5T1KA 5HI3C 1CGSH 1HK6A 2BC4A 3ARDB 4H20L 3C8KA 1IBGL 2X7LB 1ERNA 5DMGC 3A67L 3GJFK 4X7SL 5DVKA 4K9EL 4K2UH 1FGNL 1ZLWK 3SE3C 1KSRA 4UAOC 4WJ5A 1MH5A 3V7AG 1MHPH 2E7LA 4IIQA 1NFIB 4M7KH 2DLHA 1FO0B 1F4YH 3O41B 1IM3A 2QQKL 4XCNB 4N9OB 1NUDA 5F6IB 1FRGH 1QFOA 2VIRA 3WFBL 4G9FB 1NGPL 5HY9B 5KVFH 2WQRA 5JNYA 4P49A 2NXZB 4DN3L 5F7YC 2BSTA 3UYPA 1WZKA 3MCLL 5FGSA 4BSVA 1RZKL 2HWZL 5TQ0H 5A2JH 5HDLA 5KTEL 4RIRA 2CLRA 2VXQL 3FB6B 3V4PL 5ESVB 2J8OA 4I1NB 4X9FA 3TPUA 1HSBA 5BS0D 2A83A 3V0WH 1FYTB 5I1KH 3O3BA 5I8OH 3W9EB 1E4WH 4DUVA 5GS3A 4U6VH 3SJVD 1RULH 4HUKB 4LVOB 1SYVB 4PJAE 4UT6H 3WUZA 2FHCA 3UJJH 3MV8E 3QDME 1BOGA 3KYOA 4OAWB 2PXYA 5C09E 3W9DA 2C3WA 1I4FA 4FP8H 3S97C 5C3TA 4PRHA 2F8VA 2F19L 1AXTH 3VXPB 1KGCD 4PGBB 4ZMAT 3STLB 3BT2L 1UFUA 3VGBA 1NAML 3MO1A 3K4ZA 4LNRA 3VXRE 2G9HB 4QY8A 4AJ0A 1G7JA 5D7KD 4PJFA 3TVMA 2HT2C 3QFJB 2J12B 5GIRB 5DWUL 4PFEA 5KS9A 1G7HA 3VXSD 4FXKA 4C56E 5B3NA 5MEND 4ZSOB 4NN5C 4NC1C 1PSKH 4HWZB 5E8OB 3MJ7B 4WFHE 3FFCA 3VG9B 2DQTH 1ZOXA 4J2XA 2ZOKA 3SE3A 4TTDC 1FAIH 5CWSA 2JLLA 1IJ9A 3WD5L 5IUSA 1OAKL 5B3JF 1INQA 2KDGA 1NCBL 4OIIL 4PG9B 4I8DA 2WIIA 4R90H 1F3DJ 3IDIA 3MMEA 3U79A 4ZTOH 5JMRA 1IL1A 2K7QA 3BPNB 1WZ1H 3SE9H 4P9ML 3ULVH 3IB4A 4Q58C 3RGVC 3RTQC 2AJZB 5DURD 3SDDB 3OGCB 5DJCB 4XTRC 5ID1B 4S1QH 3K3QA 4OZ4B 3MLTB 1T1WA 1OAZL 4X6DE 4GMTH 5IWLC 3AVEA 3ROLA 3NPSC 3SCMA 3JXAA 5HYSA 4X0KA 3MXWL 5DLMH 4XP9L 2MWCA 4OZGA 5D96C 5B38A 1YNLH 2YD3A 4DW2H 1YY8A 5FO8A 2BOCB 1ZAGA 2XN9D 4HPOH 1JZ8A 4CL7A 3TV3L 4WNQA 3R1GH 3T0EB 1Y0LA 2DTSA 4I77H 1F00I 3UPRA 4I2XA 5JPNB 1MCCA 5DVOA 1IQDA 5I6XC 3QUXD 1WICA 4QKXB 1JK8B 4KKCD 3TGXA 2ED7A 1C8PA 1UJ3B 3RWFA 5DTFB 2XNAA 1G7PB 4JRYD 1I3UA 3PJSB 1KB5B 4JQVA 1F58H 4D2NA 4HQQH 5FYKE 2W59A 2DLIA 2ZUSA 4HBQA 5FCUL 2H2SD 4HD9A 4NQEB 4O5LL 4FXGA 2W0KA 5CZKA 5IQ7L 2OMNA 3MOAL 1I8LA 1C5DB 5L2KB 4NO2A 2VDML 5FM5M 5DMYA 2UY7A 1WFUA 2BJML 2MQCA 4FQLL 4BZ2L 3BAEH 1RZJL 4JFEE 1X5AA 4GW1B 4IMLA 4DEPC 3TO4B 3K8KA 1CQYA 2HFTA 5C0CD 3WJJC 2WQ8A 3LHPL 2H9GB 4PP2A 4UI2A 1I1AB 5FO7A 1XCTA 3W39A 1T4KA 1T6WA 1JMZA 3TN0A 3V5DA 5I1CL 5J3HC 2UZIL 4NO3A 3MNVA 1KG0A 3IDXL 4XPFH 2V2WA 3K46A 3O9WD 2WLZA 2HFEA 2ORBH 3I9GH 3GBMH 1A3LL 4U0RC 3RGVA 4FTVA 5I0DA 5FA3A 1IC1A 2P5WD 3O6FC 4ODTH 1Q94A 4U0QB 4LHQB 3HAEB 3MXVH 3LV3B 3SKMB 4NNXB 3VXOA 5IB2A 3C2AL 5IWLA 5D4QA 1HXYB 1QSFE 3U4BH 4D3CL 2MOVA 1A21A 3T1FA 5B21A 1KPRB 1FJ1B 5I8CB 3MV7E 1FNEA 4PJHF 3TO2A 3UTSB 4XBPB 2ZZUT 1A5FH 4W4NA 1S8DA 4BSWB 1EJOH 5BV7H 4G5ZH 2BNUB 2DM2A 5GGQH 2CSPA 5MHSE 2BP3A 4YFEA 3KXFA 1RJYB 4JFPA 3IF1A 1KFAL 6FABH 2W9DH 1UGNA 2A1WH 1FLRL 5DO2D 4I48A 4WFEE 4OM1H 3IDJB 3MRFB 3HNSL 4ONHA 4ORGA 1RJZA 5DJ8A 3AC0A 1M6OA 3RIFK 3PP4H 4R4NC 4PJ8A 1NGYB 3ARDC 5MEOA 5C2UB 1J0YA 4HBCL 3QUML 4FOMA 4TN9A 2H2PC 3H3BC 3H9YA 5KVMC 1U8OB 3EJZC 2V5YA 3NZ8B 1VA9A 1NCAL 5BJTB 4P23B 4RNRB 1TVHB 2KZ1B 5C9KA 4PREA 5F7WC 2KUTA 5FUCC 2O5XL 5J9PA 4YHYB 3WXVL 4XP1H 4NZUH 5ALCL 3ARSA 5JHLL 3O3EA 1MQ8A 1FL6B 3GO1H 4GMSH 3TFKD 3S4SB 4UB0L 43CAB 1VGKA 5C0AE 3NCCB 1W72B 4JM2C 4H25B 4YHZH 5A2IH 2F58L 4Z7UF 3NN8B 3WFCL 1CR9L 2WBJA 1QBBA 2FLRT 4KJYA 2Z31B 4FQCL 1I7UB 4ZYKB 2YA0A 4FFYL 1VEMA 3X3FL 5T1KD 1IGTA 4N0RA 3FZUD 4N1HB 4NRXA 1U58B 4OF8A 2F54E 4CAGA 3T4YB 4J3XA 2V2XA 4Y4HB 4AM0A 2VAJA 1KCUH 4R4FH 1DFBH 3QQ4A 2CGRL 4XCCL 2J4WH 4NBZB 1LE5B 1FIEA 3VW3H 3N85L 1UH4A 4Z7VE 3FTGB 4BFBD 3FO1B 4CVXB 1RV6X 2OI9B 2AQ2A 3GMMB 4QRSA 2IBZY 4P5TB 2OSLB 5D2NE 5EBLA 1CDJA 4Y5VC 4JJ5B 3QIWA 4ODSL 1MI5B 2RJMA 2C1OB 2H41A 1B90A 1JYVA 4H1LG 3ARDA 3V4UL 1JTTA 3ME0A 5HVGB 4HGMA 2X7LA 4YH6A 1W8OA 5TDPB 5ITBL 4Y5YB 3DX7B 1UCBH 3VG9C 3HC0B 4BA8A 4X80L 5CLTA 5KVDL 5E2UL 4NGHL 1U8HB 1E4KA 4OCXH 1QSVA 2IWGA 1NFIA 3LMJH 5C0EB 1I3RB 3DX9B 1FO0A 3O41A 1ZANL 4XCNA 5CGYD 1LHZA 4PRHD 2DM3A 4CW1B 3P11L 2QHRL 4G9FA 2IANA 1IC7L 4Z78B 2HVJB 5HY9A 3NCYP 1BF2A 3U7YH 5KJRL 3B5GA 4N5ED 1DQQB 3EYFB 2GK2A 3RUGF 1L0QA 3PDGA 3TVMD 1YJDC 3OR6B 4ZS6D 1JE6A 1JUFB 3FB6A 3MLZL 5DMGD 5ESVA 3VH8G 4AT6B 1WLHA 4OD2B 1FYTA 3FFCD 3W9EA 3V79C 5E8NB 3K1DA 2Q1EA 3LKPB 4CN1A 4ZS7L 5KVEH 1SYVA 1TQCC 1ZXQA 4JPKH 3H9SE 4DFHA 4OAWA 3B9VA 5I1GL 1KBGH 2ZCKH 5IMMB 5ISZB 2F74B 1YNKL 4OGXH 4D9QE 5KSUB 3FT4B 3VXPA 2ICES 4PGBA 4EBQL 3STLA 4FABH 3RKDD 1GGIL 4AEEA 4C59B 4NFCA 4O4YL 5T3ZD 2G9HA 3BP7B 3LOWA 4LEOB 1ZGLB 1HHHB 1RZ7L 2Y7QB 3I85A 3GJFB 4RGNB 3SCMD 3QFJA 2XY2A 1FGVL 5GIRA 4WW2B 2GW5A 1HN1A 1TJGL 2VR5A 3WNKA 4HXAL 4ZSOA 1EZVY 2A73B 5E5UB 4HWZA 5E8OA 1NEZB 3MJ7A 4TSAL 4YFLI 1WJ3A 1TJIH 2AK4A 4OD1L 2IAMC 2CDEB 3HMWH 4ZO7A 1IC5L 2NY0D 2D4FA 3CVHH 1RU9H 5F7MC 2DTMH 3DIFB 3MBEC