2CMRH

Crystal structure of the hiv-1 neutralizing antibody d5 fab bound to the gp41 inner-core mimetic 5-helix
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
204
Chain Sequence
QLVQSGAEVRKPGASVKVSCKASGDTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQAFQGRVTITANESTSTAYMELSSLRSEDTAIYYCARDNPTLLGSDYWGAGTLVTVSSASTKGPSVFPLAGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTQTYICNVNHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TRANSMEMBRANE GLYCOPROTEIN
publication title Structural Basis for HIV-1 Neutralization by a Gp41 Fusion Intermediate-Directed Antibody
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 204
sequence length 215
ec nomenclature
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cmrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cmrH01
2LTQB 1TZHA 1HZHH 2BNQA 4AJ0A 1XCQA 1U8QB 5DUPH 2FJHA 5FF6A 2EDDA 3KPTA 4XH2A 1BZ9B 2LU3A 4HPOH 4NQXA 1J1XH 2I27N 1NJ9A 3RTQA 4RZCB 3QUYC 5JORB 4JDZB 4BQ8A 1LEKA 5AZ2H 4AENB 2Y6SC 1NLDL 3VD9A 3O45A 5DK3A 4XCFL 4PLJC 4HGKC 1V8HA 3UAJD 2BSRA 4XNMB 3TCXA 3FO9A 4XT1C 5EUOF 5FYLE 4XP4H 1J0JA 2WANA 1E4JA 3MA9H 3OKOB 4PRNB 1JF1B 2CLRB 2DI9A 2X44D 5IROC 3IDGA 3ILQC 3ZE2F 5EIVA 3SKMA 4PV9B 1ZEAL 1RUPL 2AI0H 5ESQB 1YDPA 1X6NA 2XFXA 4EQ2A 1A9EA 2IFGA 2L0DA 5ERWB 1ZSDB 2JB5L 5KANI 2VKWA 3O41B 4P2OB 1CD0A 2C4XA 2NQCA 4DGVH 4MB5A 1IAIM 4RMTA 1NC4A 3QEQE 2VXQH 4JQIH 4NQDB 4X80L 4OLWH 4U1MB 3O6FC 5C92A 2X4TA 2EIBA 3KR3L 3MBXH 5IG7A 2DQUL 4MA1B 4OZFG 3RNQB 2P5WA 4AQ1B 1MFAL 3HMXH 5DD0L 1XR8B 4Z76B 2VXTH 2MCG1 1T0NA 5TE4L 2EYTA 4NBXB 1XGUA 2OSLB 3UTPE 3PUCA 3R1GH 1HXMB 2EKSA 5ISZB 1CR9L 4PB0H 4MWFB 4E41E 5GGUB 3OR7B 1C5CL 4JANB 3CFBB 1KJMA 1MFBH 5I0DA 1JRHH 4LVNC 2F5AH 3VCLA 3HE7B 1SY6H 4JZNB 5E00A 5J0BA 1KCSL 4M5ZL 5D1XC 5E5UB 4Z7OE 1OF2A 3RNKB 3S34H 1A6UL 4PJ7B 5TH2B 5CEXB 3O2DL 1Y6MR 5FYJD 1KLUA 4XVTH 3MV8B 5CWSA 4S1RH 1CGUA 1YY9D 3F12A 4PJGE 4F2MA 1UB5A 4O2EB 1ED3B 1UKTA 1NCDH 1LP9E 4NSKA 3ULUH 3O6LH 3QHZH 3KYKL 2QHRL 4XP9H 1YMHB 1WZKA 3RZCB 4PJAB 1H8OA 2WBJD 4HQQH 1C8PA 5EU4A 4PJHA 4Y5YA 2DQCH 3UTTD 1P5UA 4JFHD 2NXZB 1KXVC 4XWOC 4BSWA 4D8PB 3FB7B 2R0LH 3OAZH 1IEBB 4GRMA 1ZVSA 3QWRA 1UWGL 2C9AA 5HHMD 2GIYA 1AGCB 4K71B 4XTRD 4D2NA 2GT9A 1YN7A 5L9DL 2KQMA 4U1JB 4I0CC 4OCNC 4J8RB 1GIGH 3PL6B 4KVCH 3O3EA 2WUCH 4FQXB 2N7AA 4PGDB 5TF1H 1F4YH 4U6HA 4OLUL 3OKLA 1XGPA 5FHBL 1MJ7L 5AUMA 3H9HB 3LEXA 5FK9A 4FNLH 2BSSA 3BQUA 1MUJA 1TZIB 5HI3C 2VDNL 3WDIA 4Z77B 4HEME 1V7MH 5KVDL 5B4MD 4O02H 2Q8AH 1RZFL 3L6FB 4XC3L 3B9AA 3TCLA 3UBXG 4JFED 3BKJH 4QXTB 5FYKD 3W0WA 4M7JL 1CFQB 3T1FB 4H0HB 4KDTC 1EA9C 3C8KA 4O9HH 3MFGB 1I7UA 2B2XL 1A3QA 5F96H 3MV9B 5H2BA 5B22A 4EI5B 1BBDL 1OSPL 5J12C 2OL3A 5HGHB 3PXJA 1LNUA 5SWZA 3QO0B 1FBIL 5FCUH 1MQ8A 5C07E 4YPJA 2JE8A 3BYYA 5CKGA 4MGXA 1ZTXH 3NCFB 1IC7H 2OI9C 3CCHA 2RAMA 3HB3C 3RWIA 2JLLA 3VG9B 4X6EA 3GBMH 4OF7A 1KPUB 1KGCE 3LKRA 2H26A 5DJCB 4OUUB 3KLSA 3UEZA 3EYVB 4XB8A 2LU7A 5SWSD 4L3CB 4X6BB 1U8JB 1MCOH 5TQ0H 5GRUH 4PRPE 5IWLC 2V2WB 2BSED 4UU9B 5FUOH 3QUYA 4OAWA 3LHPH 5CD5D 1C12A 1AO7E 4X7SL 1SQ2N 1A22B 2R69L 3EO9H 4RISH 5JQ6H 1QLFB 3LVEA 5BS0E 3AAZB 4JRYA 3WNLA 5F1IB 5GHWH 5EBGA 2YUZA 4W68A 5I1CH 1QSZA 3DROA 2FIKA 1XR9B 3K4ZA 3P77B 1AC0A 1PY9A 2XYCA 2DWEB 5IROA 3EJYC 4YNYB 2HRPH 3MXWH 2J88H 4UV4L 4YBQC 4OM1H 3D85B 3KJ6L 4YDKH 1FORL 4RFOL 4QXGH 5DMYA 5ECJE 4DGIH 3SDCC 3K74B 3WNKA 2JCCF 3QIBD 4LQFL 4G43A 3KYAA 2PXYD 4R4ND 4NQED 1NMAL 3ZE1F 3NA4A 4EIZC 3P73A 2HFTA 5B39A 3O6FA 3HNTL 3T2PA 5JW3H 4XGZB 5MEQA 4JO2H 4YHKH 5F3HB 5D1ZD 3CUPB 4LAJH 4RX4A 4JZJA 3VMNA 1OB1A 3H3PH 1YJDH 2GW5A 3TA3D 1HH9B 2QQKL 3BT2H 4J6RH 4JFFE 2X10A 1AP2B 2HT2C 1S8DA 1AGEB 2NYYD 4JZOB 1BF8A 4F37K 1F4WH 2VLLA 3QEGH 1J88A 5JPNB 1J86A 2DICA 3H9SE 3QXAB 3UJTH 1DUZA 3WO3B 3P4OA 1U91A 4PJ9D 5CSBA 2Y06L 1VGEH 2WWKT 5DMGC 3IJYA 1NAMH 3NCCB 2WWKO 2PW1A 1UGNA 3NIDF 1VKXA 2E7BA 5JOEA 1JWMA 2R4RL 4LP5A 3KPLA 5TGBA 4ETQA 2JJTC 1C7SA 5ICYA 2X89A 4LLDA 4ONFL 1I1RA 1QLRB 2IH1A 4DKFH 5KVGL 3DIFA 4PJCB 1CL7H 1DZBA 1FN4A 3MJ7A 2X2YA 2BVUA 4LVEA 1MJUL 4RGMC 5CEYA 1WJ3A 5D2NE 4LRIC 3CVHA 1AQDB 2JB6B 3HPLB 4OD3H 2DJSA 3GMNB 2OTWA 2A6IA 2VH5H 1UEMA 5JNYA 3QDJD 3BPCA 3T4AA 4PV8A 4XWGL 3O4LD 4LFHG 2HAZA 4NQVA 3IFPA 3OXRA 1DEDA 3L5XH 1RJYB 5DQJB 43CAA 4J4PC 1KJ3H 3MODL 5C0JA 3NTCH 3HMWL 1IEAA 5IVOA 3NBNA 25C8H 3QEUB 1EO5A 3V52L 1DBMH 1H5BB 5D2LB 4BH8B 3QDMB 4JB9H 4DTGL 4YHPA 2NY5L 1YEHH 1ZHLB 1CGYA 1B2WL 5C08B 5DJZA 1XF4A 2ZOLB 1T1WB 4N0RA 5DHVH 2XN9A 5BXFB 3PGDB 4WRLA 4KRMB 1ZXQA 1X5JA 43C9B 4PJ7F 3E8UL 2AJVH 4ZFGH 4KMLB 4U2ZA 4E0RB 5IQ7H 3ESUF 1H8SA 3QI9B 5IHZB 3KPSE 2B4CL 1X5YA 2NY3D 5I19H 4CVXA 1JTTA 2IBGA 4KDTA 1ES0B 4UT6H 3MRBA 1O0VA 3LEVH 4F58H 4YE4H 4N5UA 4P46B 1KTDA 3L3HA 5AZEL 1M7DA 1SEQL 2PYEE 4IRZH 3REWA 4DUWA 3BUYB 5IW6A 2CMRL 3MJ8A 3MRIA 4P5MA 4OCSH 1GJIA 1FFQA 4I2XB 3ESVF 2E7CA 2MWCA 3TJHD 1X5KA 1OARH 3ULVH 4HKJA 3MFFA 3THML 2HN7B 2NLJA 4X83A 3SGKA 3U9UB 4L4VE 2FL5B 5H94B 2FZ3A 2YC1A 2CDGB 1N5AA 4N8VG 3WFDL 4HZLA 2NXYB 3N50A 1QKZL 3S36L 2YUVA 1CE1H 4R2GC 4OZIF 3ARFB 5E8DH 1NMCB 2V2TB 1RMFH 1E28A 5ETUB 3HLAA 5IWLA 4PGEB 1VPOH 1DQDL 3MV11 4YXKL 3MRKB 3EOBB 1U8KB 5D8JL 4L3EE 4Z0BH 3GRWH 3BOVA 3S5LB 3T3MF 4F7CA 2HP4A 3ARGB 5HHQB 5JIKA 4PS4L 4MXVF 3DRQB 4PJIA 2VSDA 4LVOC 4ZFZB 5D5MF 4JR9H 1QD0A 5F7YC 3OKNA 5TE6L 1J0ZA 1BGXH 3MTRA 2H8PA 5I30L 1WLHA 4RAVB 4YDVA 4IIQC 5TFSL 1G1CA 3EOYG 2BNRB 4KRPC 3VXSE 2EKJA 4ORGB 2GCYB 2X70B 4LNRB 2YXFA 3SDCA 1TTGA 2RFXB 4X98A 2GK0A 1KB9J 2X9XA 3OJDA 1IJ9A 3SDDB 4POYA 5IV2A 1HNGA 4P4KC 2KL6A 1D5MA 2O26U 2MQ3A 3PP4H 4LLWA 3C5ZC 2ZUQB 2W59A 3JXAA 2ARJQ 3AMKA 1MRDH 5E5RB 1CT8A 1EFQA 1U58B 3QUZB 4MQSB 5C3TA 1HQ4A 5LJYH 2AVGA 2IAMC 2CUHA 3LQZB 5FCSH 2UUDK 5C0ND 4FQHA 1IGTB 1JGEB 2IH3A 5CEZH 4M3KB 3DHMA 4I48B 4DW2L 5C2UB 5C0EB 5GGSB 2XZQH 5I1DA 4GBXD 3PWJA 1FYTE 4BKLA 3ME0A 4XBGB 1U95B 4MA7H 2HMID 1F8TL 1QBLL 1Q0XH 4P9HH 1MFDH 3BHBB 3FT2A 3F7YA 3V7MA 1KFAL 5IEHB 1CIDA 2JJTA 1KB5L 3SJVD 3LS5H 5D9SB 4G9DA 1KCUL 3RX7A 1CZ8H 3FFDB 5AYQA 2CH8A 3FOMA 2D7PA 4GAYA 5JPMA 1KIRA 4LL9A 1XGTA 1H3TA 4QWWD 3SE3A 5LGJA 2J7LA 4NQDD 3ARQA 2CO7B 4BFIB 4TVSa 1DE4A 2XY1A 4U1IA 4MS8D 4XNYH 3IDJB 5JTWA 1K8IA 2PO6C 3G6AB 3QEQB 5KAQG 1UYWH 2R56L 3P3YA 1BIHA 4YBHA 5DJ6A 1HHKA 4F37F 2AJXH 4KWUA 3FQWA 3WSQL 2NR6D 4J4PA 3EYOA 1W72B 4OIBA 1G0DA 1JJUA 5ICXA 3G6DL 3FJTA 4P59H 5E5MB 3O2WL 5I76B 1U8PA 4L8SC 3INUL 3ZKXC 4NJ9H 1HOCB 1P2CA 4I0PB 3KYMA 4EEEA 5C2BH 3HRZB 3SE8H 1FPTL 1HHHA 5EO9A 1QP1A 4AEHL 4E41B 4TUKH 1KTLB 4X9BA 4M61B 2QSCH 3OKKB 1F4XH 3BSZL 5JW4M 1L0QA 1RIHH 5HVHC 3MV8D 3B3IB 2VISB 5KSAC 1DDHA 4GW5A 3LH2H 2OZ4A 4HUUB 5BO1L 1YEFH 3TNNB 1PYWA 1KBGH 1A1OB 1CD9B 3JWNC 5HHOD 3WXWL 4D9RE 2C3XA 1CFVL 1D6VL 3KXFE 1EEYA 1EFXB 4UOW0 1NGZB 4JFDE 4HC1L 5F9OH 1HXYB 4HS8H 4MHHG 1P7QB 1IFHL 4PJGB 4OLYL 4X6FB 1EBAA 4XP5L 2VN7A 3PGCB 2AQ3A 3QUMB 1LP9B 1OL0A 3NPSC 1P4BH 4JFEA 4D9LH 4N9OB 2CJUL 2EYRB 3OQ3B 2AW2A 4XI5C 1UQSB 3IJHB 4H26A 4QGYA 3TWCH 2WV3A 2ZUTA 3U2SB 4FQJL 4OCYH 4EI6B 2G5BB 3RWFB 4FQXD 1G7IA 1QRND 1CGWA 3IDYB 3GM8A 4DVRL 2FLBT 2AQ2A 3VXUE 4LCWD 3QP3A 1S5HA 5D2LF 3LN4B 4QXUL 4MAYC 1LK2B 3EFFB 3HNSL 4FQLL 3F7VB 4LF3B 3CH1B 2ADIA 5E8PA 4DWHA 5IB4B 1DJSA 4ZS7H 2HT3C 3PQYA 3PGFL 2ADGA 4Q9CA 1ONQB 2VRAA 3WNOA 3X3FH 2VDKL 4CVZB 4GJTB 4NM4H 4HS3B 4N5EC 4YIQB 4Q0XH 4CAGA 4HIXL 1VFAB 4FQ1H 1B0RB 3D39D 4JPIA 4IIQA 3VGEA 2E7LC 4JFZL 5JHDA 3RJDA 1GPOL 1JNNL 1T03L 1F13A 1SM3L 3LZFH 2M8XA 4JO3H 3V5KA 4M4PA 3VU2A 3MUGA 1I1FA 4XP1H 2NZ9C 2ICEA 1HIMH 5IFAH 1FVDA 2ZUSA 1S7UB 4J3UA 4MJ5A 1URLA 3A6CL 4Q9RL 4P4KA 4PG9B 3U36A 3CFDA 3PNWA 3T2NL 3X14A 1I9EA 1SJEB 3C5ZA 4X4ME 2IF7A 3LAFA 3QA3B 3BE1L 4HWEL 2HTLD 3NN8B 2B5IB 5DRXA 4JM2C 4Z7UF 5C07B 1EXUA 3RWGB 4HJGB 2IAMA 4OZHE 3BYTA 2RCSH 1OWWA 3QIBA 1ZHBB 4U7MA 3GO1H 4JFXB 4YHMH 4FABL 3CDCA 2M2DA 4KQ3L 3ARBD 4R8WL 3A6BL 5DC9B 5EU5A 3VXME 4TUOA 2CUMA 1MCHA 3VFTA 5GGRB 4DFIA 1MHPH 3H7LA 1XT5A 1NBQA 2X4UB 4PRBB 4A6YB 1A0QH 4LU5H 4R97C 2AXFA 3TN0D 1CIUA 4K3JL 4PRPB 3AU1A 3FQRA 1QFHA 3PWUB 4KAQL 3LKPA 3SKUD 1J10A 4ZXBD 4NO0B 4NRZB 1AO7B 4YHZL 1RURL 4HKXA 3VXPB 4QYOA 1C5BH 1NSNH 1YNTB 2CIIA 12E8L 5GGQL 3SCMC 4IDJL 3WXVL 4OT1H 1BQLH 1LO4L 3V79C 3RP1A 1JPTH 4PP2A 3RL2A 3EYQC 5L2JA 3LS4L 4Z8FH 5MI0C 4L5FL 2APFA 1RHFA 2GY5A 2LE9A 2Q7NA 3FO2A 3FQNA 1Z9LA 1T1YB 4PJ9A 4OZFB 2YOCA 3CXDH 3QPQD 1KELH 8FABA 1QG3A 1NGPL 1A7OH 4HJ0D 3U7YH 3F5WB 5FV1L 1V5JA 4R4FH 3VFWB 3NCEB 3TBSB 5CP7A 3OG6B 4KZEL 1NANH 1OGTA 1R5WA 5ENWA 3C08L 3T65B 2X6MA 1HH6B 5DR5H 5ESAA 4G6JL 2VDRH 4QHKJ 4JCLA 3NVQA 3QFDA 2BRRL 3ZT6A 3I2CH 3DURB 1BZQK 4XAWH 5CJXC 4G6KH 1SJXA 3MRQB 4ZO6A 1T2QH 1R6VA 3DUUB 5EU3A 4JFFB 1ZLSL 5EZIL 4MNGE 3OR6A 5JXAH 3B2VL 3O8XD 2YPLE 3O4LA 3BESR 4LSTH 3CPLB 5EOTA 3H9SB 2ESVA 4N8CL 3OJVC 3TYGL 4MSWB 4CW1A 4YX2L 2W38A 3HUJF 3WFCL 5D4QA 5F89B 1T5XA 1JGLH 1WWCA 4HUXB 4AIOA 1WFUA 1NCTA 5EORH 1X4YA 4L8BA 2EE6A 1JP5A 2OR7A 1KC5L 5BJTB 5T3XD 3OJ2C 3B5HA 1ROWA 1SYVB 3MOAL 1Q0YL 1WTGT 5FO7A 2P24A 1UWEH 1ZA3B 2ITDA 1T3FA 4ODXA 1NLBL 1PX3A 3AC0A 3B9DA 4NO5A 5D2NB 2IADA 4P3DA 4GAGH 4GRWH 3ZDXE 4DGYH 4NZTL 2GTWA 4P57A 4U6YA 1X44A 3B9KC 2Z31B 3WL9A 1JF5A 5CJOH 5I1JH 4JFYB 4P2YA 3OHXB 5DXWA 4RMUA 3O2DA 1TJHL 3GSOB 4Q9QH 3QDMD 4MAYA 4P2CG 4FG6C 4JGJA 4ETYA 2VITA 2VN4A 2WMPA 4Y4KB 5DQ9B 5IMLA 1AR1D 3PWPE 1R24B 4YUEH 5JIIA 1BM3H 4L8CB 3BXNB 3IU3A 2DKMA 1YEGL 2MNUA 1JN6A 1T6VN 3Q6FA 2DYPB 1QSFD 2BFVL 3VD7A 3QI9D 1PZ5A 3TYFB 4XAKD 4POZC 2E7LA 1PSKL 3RBSA 3DETD 3G5VB 2PTUA 4P46D 2O5XH 5GSRB 1FVEA 4MD4A 2FGWL 4TVPE 2AEPH 3ULVE 3KPSB 2AXJA 4IM8A 2XRAH 5KOVC 5HDQL 4PJGF 3S4SA 3GKWH 1HEZB 3OWEA 1MCSA 3RU8L 2GSGB 5TDPB 3CIQA 4UQ2A 2KDGA 4JDVB 2PYEB 4RWHA 4WI3A 1S9XB 1YECL 2DQFB 3C2SA 3MX0A 3P0GB 1I7TB 2BK8A 2I60L 3QXDB 4QHUA 5KG9B 2NY5C 3EO1B 3WKML 1E6OL 3JWOL 4LEOB 3C8DA 3WFHA 5HSFA 1FGVL 1JHLH 2JCCA 3R8QA 1MHEB 1UJ3C 2W9EL 2GEEA 1OAKL 4LSUL 2Y36H 5D1QD 1M05B 2XA8L 3VFVB 1CICD 4L4VB 3L7FA 2AV1B 5F3BB 4R96B 4YHOL 3OAYH 5EBWB 2OL3H 4JAMA 2B4CC 5FKPB 1CBVH 5ANME 1KCLA 4EDWH 3MRDA 5LGHH 2R0WL 5KSBF 4S1SL 4O4YL 3X11A 4GS7C 4KQ4L 3N1QC 4YGAB 1NFKA 2PKDA 1R5IA 2VKXA 1F90L 3VRJB 5DSCB 3HC3H 2EDLA 4QHMA 4L1DA 3BKMH 4L3EB 2EDBA 4C83B 1YMME 3HFML 5DT1H 4OGAD 3SCMA 1OP3H 3K2UH 4WNQA 2BNRD 3TVMC 3MRHB 3GZKA 2A74B 2FX8L 4Y4FB 5GRZA 4PRHD 2VXVL 4GBXA 4MD5B 4PJXF 1KIQB 2Y5TB 5GGVL 1J1OH 1G9NH 3F7RA 4ZPVA 1RZ7H 5E2TH 2Q7YB 4AZ8A 1BWWA 3VXSB 3QPXH 3TPUA 1SJVA 3GNML 4R26L 5EU6A 4S1QL 3FOLB 2AXGA 3C5SA 4P9ML 4M9OA 1NCWH 4KK5C 3TBVB 2BERA 5J1AA 1S7RA 3MGOA 4WFFE 5DMKA 3ZTNL 1T89C 3MNVA 5CEZE 3P11L 4ZO9A 3KLAB 1WK0A 1RJLA 1RZ8B 4LLQB 5DA4A 3T8XB 3P9LA 2Y4SA 2DRUA 5TDOA 3MNWA 4M43L 3GMRB 3T04D 1R5VA 1FL5B 3FCTB 1A1NB 3MLSH 5LBSH 5CUSL 1TJIL 1RIUH 5FGSA 4NFCA 2VXUL 4IOFC 4PGCA 4XCEA 3S8WA 2YD9A 4GLRH 3LCYA 1QSEE 1P4LA 1KN2H 4IRSD 1HYSC 4EQ3A 4Y1AE 1N64L 1T5WB 4OZ4A 1BFOB 1J8HE 2OTUB 4Z5RB 5T1MA 1FYTB 2IFFL 3LIZL 2VO5A 3U0TB 3BGMB 1R3KA 1JNLH 4Z95H 5F7WC 5EWIH 5D71L 3SHSA 1RIVH 4RMQA 1AR2A 5CLWA 3SY0A 4KKLC 2YA1A 4X6CF 5GS0H 3O6ML 3RY5A 4CNIB 5I66B 2V5MA 4NHUB 1A7NL 3WS3B 3AUVA 3GSQA 2DMKA 3O2VL 4LHQB 4HK3N 3UTQA 3QEQD 2A6JA 3KYNB 4WDIA 4ONGH 3DBXB 3NFPB 3QR2A 1IGFH 4AL8L 2EXYC 5C9JA 5BQ7A 4BZ1L 2Q76A 3QIWB 3QIUB 5D7IE 2ZG3A 3D25B 1AXTL 3P4LA 3DV4A 1A21A 1XIWC 1D5BA 4I0PD 5EOCJ 2R2HA 4Z7WA 4MJ2A 4M6AA 3UTPD 1FC1A 3D2UB 2WM0A 4E41D 3QQ4B 1FLRH 3D87B 3DYMA 4K94H 4RFNC 2XWTA 2MCPH 1MAMH 4NCC1 2YMXL 3WUWB 4CDHA 4EBQL 1MELA 1QRNA 1P7HL 4OZIA 1W0WB 5HYQA 5HHXH 1DLHB 4YAQA 1EFXD 3HPJB 4I9WE 5T1LD 3B6SA 4PP1C 1JPSH 1QA9B 1S7WA 1DBBL 5DJ2A 2E8YA 4K7FB 2V5RA 3D18B 1BOGA 1F58L 1AE6L 4O2FA 4Q6IC 2H2PC 1G9ML 5DS8B 5JW4Q 1Q1JL 4QOKE 5D5MA 3KXFB 4MQXC 3CFJA 2J6EL 4JFDB 2GTZB 5IB2B 3BH9A 2LABA 1G7PB 4S1DC 4BUGA 1Q38A 1MI5E 4N8VB 3D39A 1J1PH 2NY0C 4C54A 3EYUL 1D9KB 3IDUA 5L2KE 2Q86B 4JY4A 3B9EA 1GGYA 2H32H 3PJSB 4OLZH 1AGFB 1FIEA 3HZMB 3FB6B 1F4HA 3O3AB 3IAGC 1GAFH 3MLWL 4PJBE 1FCCA 1HDMB 2FATL 3O6KH 2DQEL 1VGKB 5I73C 4ELKA 4GG6E 4DN3L 4IMLB 4JDTL 3CMOL 3SKOB 3L7EB 4NKDB 3VXUB 5GZOD 4XVSL 1QBBA 1IRAY 3O3BB 4U31A 4YDJB 4UIMB 4X8XA 3TFKC 4HF5H 1MSPA 2VZOA 4XPGH 2FBJH 1N59A 5D6CB 3CFCH 3RGVB 5CBEA 1T21B 3ARBA 4V1DB 4MD0A 1IQDA 5C9KA 2D7TH 4FFZL 3QFJD 4P23B 2F58L 2QSVA 4RBPH 4JREC 3H9YA 4GXUM 1J0KA 3ZT7A 1S3KL 3ZL4L 3TEUA 3CFIC 2PW2A 4NPYB 5ID1A 3QXTA 1KCVL 3AB0C 1UZ6F 1A6ZA 1EPFA 1INQA 4WI6A 2AJSL 3TN0A 1IL1B 5F93C 2Z91A 5K9JH 4K3EL 3AFLA 5E8OA 2HYMA 1FGNL 4O00A 1AI1H 4LVHC 4KGJA 3VFGL 5AWNL 1K4DA 3RPIB 3MYJB 1A7QL 1I8LA 3TZVB 4CVWA 1PD6A 3D5OF 4HIIA 5F1KC 1MIEH 1NBVL 4K8RL 4QTHA 5I1LA 5DRZB 5JOFB 1IGYA 2ZSVA 2MPAH 4C56E 1KGCD 4MMXC 1QEWB 2O5YL 3LKSA 1KIPA 2CLVB 5I16B 3IDXL 3BN9C 3S9DB 1JFQL 1P1ZA 3GGWA 4OZHB 3EJZD 2VJXA 1VENA 4HWZA 3SBWC 4CL7A 1CD1A 1FFNA 1MY7A 5D72H 1S9WA 2CDFA 4ZODA 1K2DB 4PREB 5INCB 4KY1H 3WN5A 2AK1H 5KOMC 3VXMB 1J0IA 1T80A 4PRPD 3QJHA 1BVKA 1F45A 2BNQE 1OM3L 1RSFA 1P5VA 2EEBA 4NO0D 1S78D 4R7NB 4RGOH 1AO7D 2V7NB 3DOSA 2YPKA 3G04A 4H88H 3BD3A 5DJYB 2ARWA 2NY1C 3QXUA 2Z92A 3BMVA 5BS0D 2AABH 3MRJB 2PN5A 1J5OH 3DMMC 2EZ0C 4KH2A 2XTJC 5BRZD 2A0LC 1GYAA 2I9LA 1MHHB 3O8XA 3L5WA 3UDWC 4KHXL 1DBAH 4E5XA 3W2DL 2VB5A 4HIEA 3VFMB 3KWWB 2VDPH 4G7VL 4LCYA 3EGSA 4P5TC 3FB8B 4KI5C 3GIVA 4MQTB 1F3JB 4MNHA 4V2BA 1BJMA 3QDGD 1AJ7H 4UMGA 4WW2F 2CO6B 1YY8A 3BKCH 5DMIL 1VEMA 4HUVB 5CINH 5D96B 4KJYB 1F6AB 4XC1L 4XBEL 5DRWB 2IG2H 2XT1B 1I7ZB 4KGLA 4KHTL 1XIWA 2UZYB 4OTXH 2UVFA 1K8DA 1KB5A 3DX9A 4UV7H 2YK1H 1RVFH 1JGDA 5E9DE 2P5WE 5CP3A 1X9QA 3O3DA 3HI1A 5FYJH 3H9SD 3ILPB 3RDTB 4JM4L 3I02B 3HC4L 1EH9A 3W11D 2VXSH 3UYRH 4H1LA 3MMEA 4XP6H 5HDBF 2YPLB 5A16B 4AT6A 4MDIA 1A6AA 2D31A 3ZKND 5DZOA 2P44B 4NWUL 1FSKC 1R3JA 1AKJA 1T1ZB 2IPUG 3ZDYE 5F1SA 5JW4R 3V0VA 3ARDB 1IARB 5T33L 1G84A 1NGWB 1ZS8A 1LEIB 3D0VA 1UM6H 2IQAA 1N6UA 3UTSA 5I9QC 4X8JA 2I9TB 4U0RC 3ROOB 3IVKB 4Q6IA 3PV6B 4QRPD 2W1NA 1QFWH 2YZ1A 6FABL 1QSFA 1FO0L 3CFEA 1R0AH 3VRIB 4RQQA 3REVB 3S88L 4HS6B 2VSCA 4LNVA 1LO5B 5CGYC 2YR3A 5DLMH 3WD5L 5EPMB 1LDPH 1E4XH 1MIML 4QT5B 1KSRA 4ZNCD 2OZ4H 2I07A 4MJ6B 5ID0A 4HHAA 3RKDC 5IGXL 2P7TA 1ZHNA 3RWDA 1Y18A 1E6JH 4PJHE 3VGHA 3FB5A 4OCRL 4Y4KD 3OPZH 4KFZC 4I77L 3C5JA 3GDBA 4NQSB 1XGRA 2VDML 1NGQL 1YEKL 1JHKL 2O5ZL 1EJOL 1V7NH 2HFEB 2OQJB 4HC1A 2YRZA 1TXKA 1FL3B 2HVJA 4RA3A 5EOCH 1CFNB 2DYPD 1BPVA 5FYKH 3BZEB 5DI8B 3PWLA 3PWPB 3N1FC 2Q3ZA 3MNZB 3RUGF 4R0LB 5AAWA 2FEEI 4B5EA 1DUYA 5D1QA 1IT9H 2MHAA 4MJID 3X3GH 1CICA 1ZHKA 4ZQKA 4ZOEA 3DSFL 4JRXA 3DX7B 3D9AL 1MCFA 3KPSD 2GFBB 4Y5VC 4QY8B 2QKIA 4X5XA 3GBLA 4K3DH 2BVQA 1UH2A 2VIRB 1BVLB 4YHYC 5LXGL 5BCAA 1I8KA 2PYED 1N5YH 3W0WE 3VXNA 5D7JC 2W9DH 1P84K 4OI8A 4M7LL 5CSZB 4RWYL 1T1XB 1EHNA 1CYGA 5DVMA 5DD3L 4PRHA 5SWZE 1X4ZA 1BAFL 1XGQA 2G75A 5F6HI 3ZSTA 4GUPB 5DTFA 3M1BA 1UWXK 3TP4A 4BZYA 5F7EL 4G6ML 3SBWA 2VQ1B 4S11A 3S98A 4JO4H 4DEPB 1IKFH 2YA2A 1JWUA 4APQC 3H42H 4M8QB 2QADB 3DI3B 1FZOA 1T83C 1TQCB 2BOBA 3BP4A 4L3ED 5ANMB 3TT3L 5L7XH 5DEFA 4OF8A 5IB1A 4LGSB 3TGXA 1T04A 2EDRA 4Y4FD 4U1LA 3WIHL 4FFVC 4X5WA 2OK0H 4GRLC 2W91A 3JWOC 1T22B 3HI6H 4YXHL 1YMMB 2DIBA 5EFIA 2DD8L 2OXHA 3BWUC 3UDWA 1N6QL 4JRYE 5DO2C 3MRMA 4M02A 4F57L 3QG7L 4U1NA 1U3HC 1U8HA 4M1CC 3SGJC 1ZGLA 3L3GA 3HUJA 5DJAB 1YNKL 1RJCA 2BHYA 1A6VH 3VD4A 3I9GL 2Z93B 4I4WB 3HE6B 2WIMA 4XMKH 1L4IA 4WV1C 1U8LA 1RD6A 3RA7L 2E27L 5KW9L 3LKOB 2GSIB 1HNFA 3C09B 5A3IC 5IF0B 1TPXB 1BLNA 1WSST 3NPZB 3OKMA 1REIA 1P7KA 1WWAX 3MREB 2NY4B 4O58L 5F8QC 3VH8G 3MJ9L 4J3TA 5JO5B 1AGDB 5KBNC 1RK1A 1ZT4B 4LCCC 2UYLB 4FP8L 3L9RB 5E2UL 2EDJA 3HR5B 4HIJB 1SBSL 2IALA 1MREL 5EC2B 3GMOA 5TE7L 1XGYL 1NLDH 1B4JL 1QSEB 5DGRA 4XCFH 4C57C 4RDQF 3FRPA 1O7VA 4Y1AB 5BOZG 1FYHB 1A6TB 3VA6A 4WU5B 1J8HB 2DS4A 2UVEA 1M6OB 3LSOA 1MPAL 3LN5A 3P0VL 3PWVB 4ZDHA 1EVUA 4OLVH 1JYNA 35C8L 3UZQA 4KKBC 1CK0L 1NFIB 5DQDH 3IFOB 3WNNA 1Q72H 4J7RA 1SVZA 5EN2A 5A43C 3BP5A 4ZUUB 4LQ1A 5T1LA 3QIUD 1Q9KB 3FQTB 5KSUA 2PXYC 4WWKB 3KR3H 4OZGA 2P49B 1RUAL 4U2YA 5K9OA 1QQDB 3C6SA 4X7EC 3NABH 5FO9A 5I15L 5IM7B 4FRWA 5D7IB 3V7AG 4KZDL 1UXSB 1A3LH 1DSFL 1I3GH 3MGTB 3Q5TA 3CX5K 3MRCA 1QTYT 4EOWL 5K59E 3I84A 4DKEH 5SWQA 1RZKL 1M71A 1Q9LA 1RZGA 2IANA 3L3DB 1KCSH 4M5ZH 1JGVH 1OW0C 1H0DB 1EK3A 3RX5A 2DM2A 4D94A 2X1QA 1CTOA 2D0FA 4EUPB 4C59B 4LEXH 1S5IL 4UBDC 4NN6B 4M62L 1ACYH 2XN9E 5HYEA 5KSBA 3TO4D 1DQJB 1JTPA 1RUKL 4D9RD 3LD8B 1X7QB 3MZGB 3P0YL 4JG0H 2HFFA 3KXFD 4JRWA 4QRTA 1MCDA 2JIXB 4JFQB 3KYKH 5JXED 4Y2DB 5HD8C 4WI2A 3JV0A 5IVZB 3QFJA 3U46A 4QOKB 3IFNL 5DMJB 2DIJA 5I75C 2C3WA 3IYLW 4JQXC 4PJXA 3KPOB 3U9PL 3G5XA 3GIZL 4JPKL 3ZDXF 4R9HA 1JPFB 5L9DH 2CKBL 5L2KB 2C3VB 1O5DT 2HLAB 4BQBA 3DLQR 5I17B 4NQCA 5IHUH 2F74A 4M48L 1QNZH 3G6JA 2CDEB 1Y0LB 2UWEF 3GHBL 1UVQA 4U3XA 1PKQA 4APQA 4OI7A 1A64A 1WBZA 4UTAH 4PJBB 1MJ7H 1AFVL 1T83A 4OCWL 3T3PE 2J8HA 2CQVA 3RGVD 4GG6B 1G9MC 2BNUB 4J3SA 1IAOA 1WTLA 4JFOB 4ALAH 1EGJH 5KVDH 2DTML 4LSPL 5GS2D 3VG0H 1UH3A 4XC3H 1DEEA 5I71B 5JDSA 2FX7H 3C60B 4PJ8C 4ODVH 4I3RL 5EA0L 4CADA 2AK4A 3I6GA 5IFJA 1ETZB 2A6KB 4I5BA 1U3HA 2B2XH 1QR1B 1NGYB 5CKAA 1F11A 2X4NA 1BBDH 1OSPH 2DLFL 3WIFA 3FN0L 2JK5B 4NBZB 3JV6B 1PDKA 2VC2L 4RGNC 3LPWA 3TZVD 4NRXB 3KPMA 5KN5B 5FA3B 1P6AB 4WJ5A 5DHYA 1XAUA 1F3RB 4XCYA 3UBXI 1YEDA 4XRCA 5BRZA 4OGZA 1AHWB 5IR1A 2VWEC 3H8NA 2HTKD 3S35L 3X13A 1INEH 4X99B 3TJHC 5BOPA 1VADB 4X6CA 3JV4B 1JIBA 5IB5A 3P2TA 1B6UA 3FAXA 3V6OE 3GMQB 1K5NB 1GZPB 3DX8A 4C56B 4LSQL 4AYFA 3QDGA 4LCCA 3VXMD 1WEJH 2KKQA 5I2IA 3UTOA 4WO4C 1U8IB 4R4BA 5I6XC 2Q8BH 3SOBL 4WGVB 3MLPA 1W2KT 4X7SH 1HCFX 4Z0XB 3WFEL 4ZFFB 1KEML 5IBLD 1MEXL 3SDYL 4JQVC 5AYUL 1CDIA 1TZHB 2BNQB 1XCQB 1YYML 2WAHA 1EEZA 4S0TD 3FT4A 1P6FA 3FZUC 2F53A 5H8DA 3MACH 4XH2B 3HS0A 4K8RC 3BPOB 3RVUC 2WNGA 4NQXB 4UV4H 3CD4A 3ARVA 1IAIL 4K23L 1IEHA 4F7TA 1MCBA 1LEKB 4RFOH 2J2ZA 2ZKHH 1U3JA 3O45B 1LO2H 3SQOL 4PY8I 5EZLA 4GSDH 3MJ6A 2FJGA 4CN6A 4IS6A 3V7AE 1EMTL 1I9RH 2BSRB 3FO9B 1MCCA 4MDJB 2FBOJ 2NTFB 5C6WH 3F62A 5A2IH 4WCYL 3DGGA 1IC5L 2CRMA 3W9DA 2BVTA 1E4WH 3IDGB 2XWJA 1YDPB 2XFXB 1A9EB 5J3HD 3AXLA 3HRPA 4WTZG 5FYJE 3H2WA 4OB5L 1JNHB 4HV8A 5JUEL 1NC4B 4YDLB 3E2HC 2DN7A 4EN3D 2HWZL 4MXQD 4PJ5A 2BSTA 2DBJA 2ED9A 2X4TB 3HCVA 5FIEA 2FEEL 3WHXB 3MLXL 5E9DB 5IG7B 1OW0A 2P5WB 5ALBH 5F7NC 4Y89A 5F9WC 1L7IL 1T0NB 5ELIA 3RWCA 2EYTB 3ARDD 4U6TA 1XGUB 2H1PL 1S9YA 5DD1H 3RPKA 1ACZA 4KKNA 2QR0A 2EKSB 2WUBH 4LHUA 3F7QA 5F97E 2B7DT 3CVIH 4XPFH 1OTUD 1P53A 1TZGH 1MLBA 3VCLB 2DKUA 3BWAA 3V5HA 5KVGH 3E6FA 2R2EA 5E00B 2N1KA 2DDQL 1C5DA 1NL0L 5FO8A 1OF2B 3SDAB 4MJIA 3IFLL 4UTBL 4P2OC 4TSCL 4GRWB 1FHGA 1KLUB 2UY7A 5CWSB 3BIAX 1KNOA 4JQXA 1N0XL 5J9PA 3F12B 3U0PA 4F2MB 5IJKC 1UB5B 1QFUL 4HWUA 1TTUA 4UDTA 3RIFK 1X5HA 2PCPA 4ZTPL 2A77L 5M94B 4G7YL 4JFEE 4NC1C 3TLRA 5D7IF 5E56A 3HMWH 5CSGA 4PJHB 4Y5YB 2R1XA 3V52H 1QFWM 4DTGH 2R1WA 3NOIA 2NY5H 3QUML 1EZVX 4GRMB 1ZVSB 4ZUSA 1CXFA 2YKLL 3CXHK 5JZ7D 2GKIA 2J6EA 3O4OC 1FFOA 4HCRH 2GT9B 1YN7B 3ZKMD 2D0GA 2F19H 3HE7C 4LCUA 5JW4N 2VR5A 2AJUH 5HYIA 4NUGH 3PQYE 3Q2CA 4U6HB 1WBXB 3EDFA 3OKLB 1XGPB 2BVOA 1YNLH 5D93B 4GMSH 5AUMB 3LEXB 5EBLA 5FK9B 2VQTA 4TVPD 5SWSE 1NBYA 2E7MA 1SMOA 2BSSB 3BQUB 3N1PC 1MUJB 3O9WB 4XVUD 5JHDE 4KUZL 1DN0A 1JRHI 3QCVH 3IETB 2CIKA 1PVHA 4PR5A 5HDOA 3ET9F 1N7ML 1ZLVK 4QCIB 5J6HA 2Q1EA 3THMH 3W0WB 3RZCC 5BMFH 4PYGA 3BIKA 5EZOL 3C8KB 2NXZC 4F80A 3GMLA 1I7UB 3LRHA 4KTDH 1ITCA 5EUOE 5DEGA 5HYSA 3DVGB 4XPTL 5H2BB 3BN3B 2OL3B 1H3UA 1QKZH 1KULA 4K71C 5SWZB 5I1AA 5GRVK 5DJ0A 5FECA 4ZUWA 4WW2A 3PL6C 2HA1A 3OAYK 5T1KD 3NZHH 5J1TC 3CCHB 3S4SG 3RWIB 3KPQA 1DQDH 4YXKH 5I1EH 5K9QG 5ILTH 3LKRB 2DLEA 4EXKA 1BP3B 4YR6A 3OAUL 3FN3A 4PS4H 1WF5A 1FNEA 1OTTC 4OGXH 3O0RL 3NACL 1YMMD 5CLTA 3LQAH 2NW3B 4FTVD 3QUYB 2GYSA 4OAWB 1K9TA 3CC5A 5IKCA 3T0XA 4UB0L 1BVZA 4RMVA 4JRYB 4EI5C 2KUTA 3EAKA 1FLTX 3DROB 4G5ZL 4G80A 4GQ9L 2FIKB 1JUFA 4JHBA 2PR4L 4YFLI 5L6YL 3ECBA 3QRFM 4WFFD 3NA9L 4FXKA 3HG1A 1UACL 4TULH 2NY4D 1QBML 5C0CD 4F9PC 1F42A 4G43B 2YSSA 1N4XH 2KZWA 4R90H 1JZ8A 4KU1A 3P73B 4DW2H 4QRUA 4Y4HB 5B39B 5ESVA 1U8QA 2A1WL 1A6WL 4ZUVA 5HI4D 3IT8D 1QSED 3H9ZA 4B50A 2FRGP 1YC8A 4JZJB 5FUCC 1F8TH 3GSRA 5BZWA 2DF3A 2E7HA 5T3XH 1J8HD 2VDOH 4M1GL 1S8DB 3RVWD 1UM5L 1KFAH 2FECI 3O4LE 2VLLB 4ZTOH 3T4YA 2OR8A 3BKYL 5I8KL 2ESVE 3CLEH 1DUZB 2WSKA 3ARED 2YPVL 1OCWH 4GKZA 2P8LA 3RUGA 3P4OB 3UP1A 3UC0L 2ORBL 4N68A 1L9MA 4NJAL 1HWHB 1U91B 3W9EA 3K81A 3IJYB 2FH8A 1SYSA 4C55A 2PW1B 3I3BA 1GOHA 2R8SL 3K8KA 4W70A 1JWMB 3MXVL 4HKBA 1YEIL 4WWKD 3KPLB 5TGBB 5KJRL 5JIPA 4U1SA 5TDNA 3FO1A 4LLDB 2O61A 1G0YR 3TO4A 3W39A 1I1YA 4M6NH 2IH1B 4KI1A 1TTFA 3DIFB 5I8EA 3DO7A 3WSQH 4PB9L 1MWAL 1FN4B 3MJ7B 4YBLC 5CEYB 3G6DH 4JHAL 5LWYH 1DQMH 3O2WH 3CVHB 1SHMA 2OTWB 5JIHA 4UINL 5EB9A 5KZCB 2HKHL 3LB6D 5JNYB 1HXMA 3T08A 3BPCB 4DZBA 1WZMA 4GG8A 2NY2B 1LEGA 4B7IA 3OR7A 1FO0A 2X7LA 4NQVB 3IFPB 5ACZA 3OXRB 4OD1L 3U4EA 1NCNA 5C0JB 2H45A 1IEAB 2DQGL 4DAGH 1F00I 3QZWA 4PRAB 4YHPB 3ZDYF 4I9WD 5ITBL 5KTEH 5DJZB 2YD6A 3WLWD 1OOAA 1XF4B 2DAVA 4U6VH 2XN9B 1ED3A 3FFCA 1IFHH 4K55A 1I1AC 4FFYL 5GZNC 4QOKD 3FMGL 4FQ2L 3RIFF 1X5LA 1JYXA 1EAPA 1D5IH 1INDH 3RZCA 3OV6A 1MI5D 1KPRA 4UILL 4CVXB 2WP3O 3MRBB 4QRQA 5LQBL 2ZNWA 1RZKC 4HX1A 4K9EH 1F3DJ 3MLUL 1A3RL 3JWDL 3RWHA 1KTDB 3L3HB 4PGBA 1M7DB 5JR1L 3I75B 3QNXA 3MJ8B 1DVFC 3MRIB 4FQJH 4P5MB 4MHHI 5IHLB 4WIQA 3SE4A 1GRWA 1X6LA 5INDA 5IT2H 4XCNA 4ODSH 2DQDL 1H15B 3ZYIA 2OI9B 3KNBB 4HKJB 3MFFB 4XNUH 2JCCE 1OAXH 2D03H 5IMKA 3ZE1E 2L4OA 3MLZL 1BQHA 1RZJH 3H9HA 1NCAH 4X9FA 2P4AB 2FZ3B 2YC1B 1KLGA 4ZUTA 1I9IL 1N5AB 4HZLB 3GI8H 2VDKH 1IM9B 4NGHL 2CK2A 1T03H 2R9HC 3HLAB 4OUOA 2VLJA 3O11B 3M45A 2UUDH 4ODWA 1M7XA 1RK0A 3UJJL 1FRGL 3OXSA 4ZNEA 4WFEE 4K3HA 4BZ2H 3MCLH 2CR6A 4FMKA 4FZEH 4PLKC 3BI9X 5HGHA 2ZCHL 5CZVH 4PBVC 3C8HA 1OPGL 1BEYH 2H8PB 2V5SA 4U1GC 5FA4A 3VH8B 4YDVB 4BQCA 4QEGA 4KPHL 2BC4A 5C0FA 1C16A 1A7PL 4IRJD 4GO6B 3NIDE 2UY6A 1GC1C 4OF3A 5EU6E 4GKNA 3SDCB 4C56D 1HK6A 5D7KD 2HKFL 5LG1A 3OJDB 3V0WL 3WIHA 4FABH 4X0KA 5IV2B 3BAEL 1D5MB 2NXYC 4LLWB 4OM0H 3V4UL 5CJ5A 3ARFC 4UNUA 2WLZA 5HYJA 1EO7A 1IQWL 1IC1A 5BVPL 1CT8B 3FO0H 3JTTA 4KJPD 4ZAKD 1LK3H 1GGCL 2BNQD 4ENEC 2AJYH 1RUML 4KAQH 4FQHB 2IH3B 2IPTL 2IMNA 3ARGC 1HZHL 1LVEA 3AAZA 4EN3A 3VWKC 1RURH 2DIAA 3ARUA 5GPRA 1MRFL 3RTQD 3LPGA 4N90D 3A67H 4QRSA 3PWJB 4CVUA 4BKLB 1J1XL 3LS4H 3S36X 3MJ9A 4OV5A 3S3PA 5KANG 4TOYH 3NCMA 3FT2B 3F7YB 5L0QB 1RHHA 3SDDC 1ND0A 4G9DB 2BXZA 3WHE1 3MA9L 5HPMA 4YZFF 1MCNA 2IGFH 4P5KA 2ZUQC 4ZYKA 4KZEH 3FOMB 4GW1A 1BOYA 4GAYB 3C08H 5JPMB 4UT9H 1IGJA 1KIRB 5MERA 4RGMB 2AI0L 1XGTB 5LGJB 4U7SA 2XXCB 4HPYL 1NC4D 1A1MA 3QUZC 4WHTB 5HHOE 5HXMA 2B1AH 2BRRH 1DE4B 5T5FL 5K9KA 4JQIL 2CLZA 2VXQL 4OLWL 1K8IB 4OFKA 1ZLSH 3GMMA 1P69B 2W0KA 2P5WD 3RVXC 5EZIH 5FXCH 1BMGA 3BD5A 2VMFA 4MCYA 4L1HA 1HHKB 3HI5H 3FQWB 5GS1C 4JY6B 4Z7WE 4WI7A 4WEMB 2ADJA 3EYOB 5SX5K 3TT1L 4HDIA 2ATPA 2N56A 5ICXB 3TYGH 5BZDA 2UWEA 1EUUA 2VXTL 5M7QA 1U8PB 4JO1L 3WFCH 4JGMA 2WBJB 1U41A 1FG2A 3UROR 1P2CB 4F15B 3UTTB 4YHIB 3KYMB 2Q87A 3FHAA 5F1OB 1T2JA 5DJDA 1QRNE 4OZIE 1HHHB 1MFBL 4N9GA 5EO9B 1JRHL 4LAQH 4WI8A 1MCWM 2BX5A 3CSYA 1XF5A 1I1AA 5FKAA 3UPRB 1Q0YH 4M7ZC 1QFPA 3ZKQD 1CLYL 3RX8A 3S34L 2YD8A 1DDHB 4GW5B 2IWGA 4CMHC 2F8VA 2FR4A 1PYWB 4QGTA 1MFEL 3QQNA 4HT1L 1IAKA 2B20A 4MXVE 4XVTL 4PJDF 5EUKA 1I9JH 5D5ME 4QNPF 1EEYB 4WENB 5EZJA 4NZTH 1DVFA 2VAAB 2CRZA 4KK8C 1YQVH 3D39E 2C4FT 1NCDL 3DYPA 3ULUL 3IS1X 1VACB 3RJQB 3QHZL 3TIEA 3IKKA 5F72S 1BIIA 4HQQL 4JFEB 3QWRD 2VL5A 2DQCL 3RVVD 5HI5D 3IDIA 1I8MA 4H26B 5F71A 4Y7MA 2R0LL 3VJ6A 5E6IC 1YEGH 1JHTA 5GGSY 2BFVH 1G7IB 4R2GB 3UCRA 1PZUB 3PGDA 2X5PA 4OQTH 1CS6A 2V7HA 2RB8A 5CZXD 5T1KA 5T3ZL 5IHZA 1F4YL 2FX9H 4G6AC 2FGWH 3EOTH 4HLZH 2ADIB 5E8PB 3BQUD 1ES0A 2NMSA 3TBYA 1WUNT 2CKBA 3PQYB 4J1UA 5HDQH 1DBJH 2ADGB 4FNLL 1MCKA 3RU8H 3V5DA 2YZ8A 4ELMF 4X7TA 5SWSB 3W0WD 4UAOC 1UM4H 4KKAD 4U3CA 1FFPA 4JPIB 1YECH 2E9BA 3MOBH 4IIQB 4O02L 5E08H 2I60H 4N1HB 1VB9A 4KRPB 1E6OH 3BKJL 4KDVA 2C4FU 3JWOH 4FHBD 4FTVA 3V5KB 1OAZH 1I1FB 1FGVH 3MUGB 2ICEB 3QH3B 2R1YB 1N2RA 1FVDB 2ARJA 4O9HL 5SWZD 4KJQD 4MJ5B 1BJ8A 1F3DH 4LSUH 1JI1A 2NY6D 2XA8H 4DKDC 4P4KB 3U36B 3PNWB 3BJ91 3X14B 3C5ZB 5EUOB 3QUXD 5T5NF 3IDYC 5FCUL 1VA9A 2V2TA 2VERN 2X1OA 2EDTA 4BFGA 4D3CH 1ZTXL 5DRXB 4HMDA 5F6IC 2R0WH 3MA7B 1EXUB 5F9JA 2IAMB 4S1SH 3LY6A 3EOBA 1U8KA 2FECL 4O4YH 5LCVL 5C0CA 3GMPB 3QIBB 3T3PF 2VAJA 1F90H 3U83A 2XQBH 5EU5B 2AQ1A 4JY5H 4YXLH 3VWKA 2H41A 3HFMH 2IQ9L 3JVGC 4TUOB 2XZAH 1I7RA 1Z9OA 2DL9A 2OJZL 1H3XA 4NOBA 1CFTA 3QUYD 4I1NB 3K8LA 1BD2A 1MCOL 1VEPA 5I0ZA 2Y6SD 5GRUL 2VXVH 4IBLT 1YN6A 4PLJD 4Q9BA 4WVRA 5B38A 5FUOL 3LHPL 3S7GA 4PJIF 2GCYA 4K2UH 1L9NA 4JRYD 1NAKL 2K9UA 3N1GC 3AU1B 3FQRB 4EVNA 1QYGL 3TA3B 2DQTH 3LKPB 4RISL 3OGCB 4R26H 3EJJX 3NAAL 4HXAL 1Z6JT 3ILQD 4HKXB 4LHJB 5HHNA 4QYOB 5CS7A 3ZTNH 5I1CL 5F9AC 3CK0L 3OX8B 2V5YA 1A7RL 3P11H 4LCIL 4PP2B 3AREA 3RL2B 5FFLA 1TQBC 2HRPL 3MXWL 2EH8H 2J88L 5L2JB 1V05A 1K85A 3GBNH 5IW1A 2DI7A 3QUZA 3L3IA 4CJ1A 4OM1L 4YFLF 3FQNB 4YDKL 4XMPH 5BVJB 4PJ9B 3O6FD 4S2SA 3AVEA 3SO3B 2EDNA 8FABB 4JN1H 1H3PL 4TYUA 4PY7A 3WS6A 4RX4D 5T3XE 1T7YA 5KSVA 5JW3L 5CP7B 4JO2L 1KOAA 5GS1A 1OGTB 1R5WB 5ENWB 5FGBA 1RJZA 4ZOAA 3T2OA 5ESAB 4NIKB 1N64H 1BJ1J 2X42A 5DDHA 2D7QA 4P2QA 3TM6A 4V2CB 3VXTA 3MGAA 1YJDL 3K8MA 4IMKC 2EEAA 4J6RL 5D6DC 3AM8C 1W0YT 5IEHA 5EU3B 3ULSB 5D71H 4O51A 2HH0L 5D1XD 3OR6B 3EDJA 3O4LB 4N1CA 2XKNA 4M6OH 5EOTB 2XA3A 2ESVB 5HVHB 4HBCH 1IC4L 2I5YL 2WINA 4G9FA 4CW1B 3UPAA 2X89D 3UTSE 1NAML 1T5XB 2E3VA 2X1WL 3V9FA 1WCBA 2D9QB 1C7TA 1GSMA 1QSFE 2EE2A 4L8BB 2GAZB 3EBAA 4XVJH 4M9PA 4NRYA 1K6QH 4U1KA 1B4RA 1AXTH 2ICCA 3VXOA 1BF2A 1CL7L 4IDLA 2EDYA 4ONHA 3MROA 4OIIH 4XWOD 2ZUYA 1WWBX 1PW3A 5FO7B 2P24B 4XMLH 3NPSB 1T3FB 3KPNA 4ODXB 3VFNA 4NO5B 4OD3L 4GXVL 2IADB 4P3DB 1FNGA 2VH5L 5EOQH 4WY7H 5E6IA 2E9WA 2GTWB 5E8EA 4P57B 4U6YB 4OQ1A 3WL9B 5I1KH 4OJFH 4CN4A 3L5XL 4EBQH 3OKKA 2Y7QA 1JK8A 2KZ1B 1KJ3L 1NANI 4YK4B 3NTCL 3B3IA 1WC7A 2VITB 2XQYK 2NY7H 5FGCE 5IMLB 4JLRA 4F9LA 5DJ8B 5HBBA 25C8L 1DBML 5HI3D 2XN9D 5F7HA 5IVXF 3IU3B 4PBWD 1JN6B 3Q6FB 1F58H 5E2JA 1P7QA 1PZ5B 4Q2ZA 3RY6C 4JHWH 1CU4H 5FM4A 4PBXA 3PGCA 3V6ZB 4XB7A 3UX9B 3QUMA 4LLYA 5IQ7L 2XWBA 3J7HA 1FVEB 4F3FB 4MD4B 4K7PH 3TESA 4KMTH 1VFMA 3LEVL 4F58L 4YDIL 4YE4L 3S4SB 1A7BA 2R23A 4IRZL 5C3LD 2Y9RT 2Z4QB 2G5BA 4X4ZA 4UQ2B 2BMKA 2Z31C 3HB3D 3L5HA 5IVNA 4PRHE 3GSWA 3T0VA 5IP4A 4NZRH 4X4XA 2YXMA 4DN3H 3VFSA 4JDTH 4QHUB 1OARL 1LK2A 3CMOH 2C7UA 3MLVH 1NEZA 4XVSH 3V6BR 3WFHB 4IRJA 4JPVL 2DQJH 5IB4A 3BO8A 2JCCB 1UB6A 4BELD 3HNVH 4HFWA 1MCQA 3GKZA 3RL1B 4XHJC 1MCEA 3L7FB 1HHGA 4MA3A 1CE1L 4JAMB 4HS3A 5E8DL 3GHEH 3GEWB 1CDGA 3GK8H 1B0RA 1CXHA 3MRDB 4NO2A 3JWDC 2LVEA 2X41A 1VPOL 3UZEA 1KCVH 3OL2A 4ZAKA 4MNQA 1AXSA 4Z0BL 3X11B 3GRWL 1QHOA 1R5IB 1R3HA 1S7UA 4MB3A 4HLZG 1PG7L 1S7VA 4QHMB 3QISA 4K3EH 3EJYD 1FGNH 1E0OB 3I3EA 4WNQB 4YBQD 3NFNA 1A7QH 2P43B 4TSAH 2GJJA 2WBWB 3SDCD 4Z78A 4KDWA 4KI5E 3QA3A 3QAZB 4GBXB 5MI0B 3HUJE 3NN8A 5DK0A 4OGYL 4HJGA 4HGWA 4ZPVB 3VGBA 5JHLH 3TPUB 4D0BA 1D3CA 4JFXA 2AXGB 3C5SB 3TNMA 5J13C 1TENA 4D0DA 4AMKH 5J1AB 1S7RB 2VR9A 3EIFA 2VDLH 3MGOB 4Z18A 3SJVB 3PP4L 5DMKB 1TIUA 3PP3K 4X5LA 1HSBB 1MCIA 1RJLB 1MRDL 2HT2D 1EX0A 1OM3H 4FXGA 5HY9B 3KG5A 5TDOB 4IMKA 3MNWB 5D6DA 3AM8A 1GGTA 2WWMC 4U4BA 1R5VB 3BGAA 1DBKH 3IKCA 5GSVB 4HEPG 4TN9A 5A40E 4XCEB 4PGCB 3LKQA 3RVTC 4G8GD 3F6LA 1LD9A 3CSGA 5DMGD 4HH8A 1GCFA 4OZ4B 4QO1A 4MA7L 1G7HA 5T1MB 4DZ8A 4P9HL 1MFDL 5DVLA 5JMOC 1R3KB 1EHLL 4KK9C 3PWNA 1OD9A 2FHBA 3WO4B 2BY1A 3LS5L 1VFOA 4XC1H 1CZ8L 5GIRA 3E6HA 3SY0B 4WEBL 4OF5A 2B0SL 1YEJH 5E95B 2IJ0C 4PJEA 1ORSA 3GSQB 4OKVA 4OZGE 1U42A 3UTQB 5CMAA 1P84J 1IKNC 4NN5C 4XNYL 4PYHA 4WDIB 5HHOB 1HSAA 4D9QE 4J4PD 4E42A 5C9JB 4N0YL 2Q76B 1T7WA 1UYWL 2AJXL 3DV4B 1DCLA 3PHOA 4K7PY 2P8PA 2H9GB 1D5BB 1LILA 3G9AB 2GUOB 1BJ1H 4P59L 3KLDA 1SJHA 2WQRA 2R2HB 4Z7WB 2IANE 1YA5A 5T33H 4NJ9L 1CDYA 4HUXA 5DVKA 1MWAA 3GSXA 5C2BL 3SE8L 4FOMA 1PKOA 1LGVA 2XWTB 1M7IA 4TUKL 1FO0H 3RY6A 1QRNB 2QSCL 3VI3F 4OZIB 1IVLA 1F4XL 2EDFA 3BDYH 4LCWB 5KSBE 5HYQB 1BFTA 1RIHL 5EU7E 2WZPD 4YAQB 5F7FA 1F2XK 4MZ2A 1G7MA 5A2FA 3B6SB 5EO0A 4TPRH 1QOKA 4OBRA 1S7WB 3AS1A 4X9HA 3SQBA 32C2A 4YC2C 5DJ2B 4CJ0A 3D1MC 1BOGB 1OVZA 3IXTA 1MJJA 4NCC2 4O2FB 5DZNA 3QFJE 5HHPA 5F9OL 4NKIH 5D5MB 4HS8L 3QIWC 3CFJB 3E3QE 3R4DA 1WICA 4OIAA 4JKPH 3WLBA 3BH9B 4PJXE 1A02N 3RFZC 1L7TH 1YEKH 5B3JE 3DRTA 1JHKH 3D39B 1QSVA 4HFUH 2O5ZH 4NOFA 5GS2H 2YN3A 3FQXA 3CDFA 5CIPA 1P4BL 3TH3T 4ZG1A 4ZD3H 1D5XA 5CJQL 1KEGH 4NQCE 4R2GD 4BM7A 3UBXA 3TWCL 5ADPH 1PKQE 4OCYL 2X05A 3KLHC 2F54A 5C7XH 3QUXA 4ELKB 4QRRA 1T66C 2DQIH 3DSFH 3NIFE 2X09A 1T4KA 3CU7A 3PQYD 1GGBL 2D2OA 2X9WA 4GS7B 4ZS7L 3PDGA 4LPXA 2AJZA 3NIGE 3S97C 2A9ML 3G5ZA 3ULUC 5IBUG 1QHPA 3P9MB 1N59B 5CBEB 3MUZ1 3CLFL 3ARBB 5JHDD 3X3FL 4MD0B 1IQDB 4KRPD 2AK4E 4M7LH 4JDVA 2EICA 1F2QA 4FQ1L 5SX4H 3KHQA 4M93B 5DD3H 5KG9A 5DK2B 1AY1L 2XTLA 2PW2B 3LZFL 2J1KA 3LMJL 1D9KC 2ENYA 4P4KD 3EYSL 1A6ZB 1U8NA 2AKRA 1INQB 1HIML 5IFAL 3TN0B 3C5ZD 2Z91B 1VESA 2VLKA 5BRZE 5E8OB 2A2QT 3RHWK 4G6MH 1A8JH 4ZXBB 2BHUA 5E7FA 2AV1A 4JM2F 3OZ9H 2J4WL 1K4DB 4X6CE 3IGAA 2IAMD 4HIIB 4QTHB 4ZS6C 1EDQA 1IGYB 2ZSVB 3QDGE 1HWGB 4UZGA 1EERB 2BVPA 1LO3L 1KIPB 3GO1L 4HUMB 4YHML 1P1ZB 3GGWB 1OAQL 4HG4K 5E1AB 2EXWC 4HWZB 2RBLA 1FFNB 4K7PX 2J8UA 1S9WB 1WV7T 5HYSG 1DQLH 3Q5YA 3WN5B 4YXHH 4P23C 1SBBA 1MHPL 1MHCA 2DD8H 3CX5J 3QJHB 4IJ3C 1BVKB 3FRUB 4L8DB 3QJFA 3UYOD 3IU4L 1RUQH 2Y5TA 3QG7H 1A0QL 2HVKA 2F53E 2GJZA 4U1HA 2YPKB 3G04B 4RAUB 1YNKH 1KN4H 2Z92B 2ZUXA 2ZPKH 1ZMYA 3STZA 3FOLA 1UG9A 1OTSC 4PIRF 3TBVA 3RA7H 1C5BL 1NSNL 5D1XA 5KW9H 2I9LB 3C6LC 3O8XB 1BQLL 2APVA 3L5WB 2EDHA 4KROC 2DI8A 4HIEB 4Z8FL 4LCYB 3EGSB 3L1OH 3QUKA 3BEWA 3GIVB 3RBGA 1KJVA 2PO6D 3CXDL 4MNHB 1KCRH 1IKNA 1MLCB 3FCTA 2W0PA 4PJDA 4QRPE 3MZTA 4S10A 4PUBL 1A7OL 3U7YL 5C8JA 1S7TA 3L95A 4JJ5A 4R4FL 5E2UH 1SBSH 2X4PA 1OAUL 2WIIA 5TE7H 4WI9A 4IOIA 1X3DA 1XIWB 1TJGH 4WFHE 5DR5L 4PJ5E 1B4JH 1T5WA 2IMMA 3F8UB 2VDRL 1EO8L 2OTUA 1K8DB 3DX9B 4DKAA 3T0DA 1JGDB 3I2CL 4Y8DC 4XXCC 2EO9A 3V4PL 4G6KL 2W0FA 5IBLC 3TBWA 3V6FA 2MKWA 3O3DB 4ZFOL 3HI1B 4PTUA 4UQ3A 3KDMA 2ESVD 2VDQH 4RFNB 5HVFB 5DF0A 4LSTL 5KSAD 4GKSA 5F1NA 4DFHA 4G8FA 4H1LB 4GAFB 1OD7A 3WNPA 1NBZA 2D31B 4R7DA 4X7DC 5F6HJ 1R3JB 1AKJB 3Q3GA 1D5ZB 3C87A 3V0VB 4G3YH 4M1DH 1JGLL 3DVIA 1MJ8H 1ZS8B 4JHZA 3KYNA 3D0VB 1CLZH 3PABA 2IQAB 3UTSB 5EORL 4MJIE 5CFHA 4Q6IB 2MOVA 1RUAH 5D96C 2FWOA 1GHFL 1QSFB 1YPZA 1YJDC 5DC4B 4ELMA 3D25A 3QQ3A 5EIIA 3BVNA 3ZKSD 2JELL 4XI5D 5I15H 4OD2A 1UZ6E 1DSFH 3WUWG 5E2WH 2I07B 3STLA 5ID0B 5GRXG 4HHAB 4NKQB 1QO3A 4U7KA 2P7TB 4DJMA 1ZHNB 3RWDB 2EDKA 4DGYL 1Y18B 1U6AL 4MAYD 4TVPH 3RDTC 3FB5B 5CJOL 5IBTH 2AV7A 3VFUB 3WMSA 3C5JB 4WHDA 4Z7WF 1XGRB 1W0WA 2HT3D 3Q6GH 2VZ3A 1VDGA 3BDBA 3ES6B 1IILE 3PV7A 4M62H 3QWQB 3ZHLA 4OCMC 4Z7UB 2HVJB 4KKCC 1UWXH 1UCBL 2ZNXA 1PQZA 4N5ED 5FGCB 3TO2A 3PWLB 4KTEH 4K7FA 3EKCA 4P3CL 3D18A 1DUYB 1T20A 5D1QB 2MHAB 1CICB 1ZHKB 4PPTA 4ZQKB 1NMBL 1IGIH 4JREB 2NZ9D 1G7PA 3IFNH 1QZ1A 4RGNE 5E6ZA 3EDDA 1GGUA 2QKIB 4X5XB 3DVFA 2BVQB 4LLUA 3VWJC 4JPKH 4NO3A 3ISWA 2XRAL 1ADQH 1I8KB 1CDBA 1CG9A 1P9MC 4LDOB 2OLDA 3WJLC 3VXNB 2ICWI 3QZWG 3ZMRA 5B8CC 4JM2D 4LVHB 1I3VA 5ACMA 1TMCB 4UDUA 2A73A 3R0MA 4PRHB 1AFVH 2G9HA 3L7EA 1OGAD 1Q9OA 3UXFA 3EHBC 4GW4A 3ZTJH 5IEKA 1NPUA 4ACPA 3E0GA 5DTFB 2ZSWB 4XBPA 1IMHC 3M1BB 4J12A 4H8WH 2DTMH 1PGRB 4LSPH 4R0LC 4V1DA 4LIQL 4P23A 4AM0A 3U79A 1CVRA 1JWUB 1CBVL 3MLRL 3X12A 3P9WB 3MBEC 5LGHL 2EDXA 4LGRB 3Q1SH 3BMWA 4NPYA 4WFED 3BP4B 5DEFB 3D6GA 2NY1B 3SCMD 3NGBC 5LGKA 2DJ4A 1CF8L 3HC3L 3MR9A 4U1LB 3EYQD 5DT1L 3ULVC 4BSVB 1ZLWK 4X5WB 1GXEA 3C6LA 5IIEA 2R0ZH 5HDBE 3RHWF 4G8GA 2Z9TA 5EFIB 4HIHA 3FAWA 4IRSB 1C1EH 1JV5A 1NUGA 1PFCA 2VZ1A 3MRMB 5EU6D 1J1OL 4U1NB 4YO0A 1UZ8B 1U8HB 1G9NL 4O5LH 5AD0A 1ZGLB 3L3GB 3HUJB 4YWGH 2P5ED 3HG1E 2BCKA 4OZHA 5ICZA 4UIKH 3RZWA 1U8LB 3QWOA 1U2HA 2HG5A 2Z0BA 4TNVK 4PREA 4DEPC 5E1HB 4X7CC 4RDQG 1HI6A 4LRIA 5E6YA 3DXAD 3BISA 3OKMB 4AQOA 3BD4A 4GKOA 3WFEH 3VGFA 2QADC 3UPCA 1P7KB 2IBZX 4U05A 5DUMH 2DWDA 1TQCC 1IBGL 1PLGL 4XXCA 3U1SH 1RK1B 3SPVA 1CDJA 3IF1A 4QHNA 3NCJH 4OSUH 1KN2L 3GMOB 5HJ3A 4UNVA 2X4QB 3EO0B 1CE6A 3CXHJ 3SQOH 3QSKB 2G5RA 4HLJA 1KENL 2AEIT 3I6KA 5IQ9A 1EMTH 1GZQB 2HJKB 1CQKA 5DJXA 3QXWA 3RUGE 3LSOB 2DQHL 2QBWA 3LN5B 3BGFC 4ZDHB 4WCYH 5IVXA 3HE6C 5EWIL 1IC5H 5I9QB 2PYFA 3L3KA 4WU7A 3C09C 1IE5A 1EBPA 2HLFC 4KTYA 1AIFA 4C4KO 3MV7A 2J5LC 5EN2B 4EUPH 5JUEH 3GSVA 1ZANL 2W92A 1XZ0A 2HWZH 4PJFA 5EULV 1K4CA 3BP5B 4LSVL 4MA8H 3B9KD 5T1LB 1Z9SA 3N9GL 4W4OC 5E94A 5I1HL 3WFBL 4OZGB 5J8OA 3MLXH 5TJWK 3BZFA 1IGFL 4CBPA 3C2AH 4O2CA 1S7QA 4FG6D 4NN7C 3RDTA 2QSTA 2X1PA 3QYCA 1L6XA 3C6SB 1QLEH 4P9HC 1NAMA 3K2MC 2MQCA 5FO9B 4Z7NF 2A83A 3CX2A 1KV3A 4GOSA 3MRCB 4CGTA 2Q3AA 2YRLA 1ZT1A 1XF2A 4NBYB 5CAYB 1NGWA 3GJEA 3KYOA 3TIDB 4BK5A 1M71B 1Q9LB 5MEPA 4NNYA 1G7LA 4POZD 2I9TA 4AEIH 2EDQA 2MCPL 1MAML 3VXRA 3U4BH 1XF3A 4XNXH 3HAEA 4JPWH 1NDGA 3REVA 1OT2A 2DKSA 3FFCE 1N0XH 4LDLB 3ALXA 5KSBB 3EYFA 4MJ6A 4XNQB 1QFUH 3VWJA 2HFFB 2NZIA 1BZ7A 1K3ZA 1OSZA 4QRTB 1P9MA 1YYLL 1QPPA 1KXTB 1N8ZB 4AH2A 5B8CA 1JPST 3V2AR 3T0EC 3FONA 2ZUVA 1MQKH 3QFJB 2C26A 4W6XB 4I13B 2ZWLT 5IFHL 4FA8A 5HVGB 3EFDH 4PJXB 3SDXF 4I8DA 3BEVA 1HINH 4PRDA 1FL3A 1CFNA 5DHVA 3G5XB 1JNJA 3FT3A 4A2MA 1CGSL 4OLZL 4ISVA 1OQOA 2IBBA 4NQCB 2F74B 1GAFL 1CFSB 1HILA 3OF6A 3NFSH 2G2RA 1ZKAA 4HUWA 2FD6L 1PKQB 1WBZB 3G08B 4Y19A 3MBEA 2W65A 1CN4A 1B88A 5HGBA 2BJMH 1IM3A 4L3AA 4KUZH 2VLJE 4HF5L 1WAAF 2FBJL 3CFCL 4ZNEE 1DEEB 4Y2DC 3FQUA 1KUMA 2D7TL 4WWID 5E2VL 2CXGA 2BDNH 3L3OA 4CADB 1C08A 3I6GB 5IFJB 3GJFK 1A14H 4I5BB 1U3HB 1CLOH 1TVBA 5C0IA 4XPTH 4LSRH 5JA9A 1F11B 2X4NB 4KK5D 1MH5A 1WIPA 3LRSA 3WIFB 4NP4H 3SE9H 3B4NA 3HZKA 4M8VA 3KPMB 5T1DL 3VFPA 5BS0B 4WJ5B 5DHYB 2VQ1A 4QHLA 2UZIH 1AI1L 4GT7A 1YEDB 3MRRA 5BRZB 5F7DA 5GGTL 3IJSA 3QO1A 3X13B 5L8JB 3GRWA 1MIEL 3BRDA 4X6CB 2FJFA 2FO1A 5IB5B 5C0DB 4PTTA 1R3IL 4HXBH 4IOFD 4OLXL 3WYRA 3DTXA 1VSCA 5HYJE 3O0RH 1JPGA 4G6FB 3ZTJG 2PO6A 3NCBB 4MQ7A 3NACH 3QDGB 4LCCB 1HYSD 5KVFH 5BV7H 15C8L 5A2LH 4R4BB 5D72L 1RFDH 5I71C 4JGUA 1TETL 4KY1L 3BPNB 5ITFA 1FNSH 2GHWB 3C60C 1MAJA 4P49A 4L8SA 5HGAA 4P99A 4U3HA 1CGVA 1QR4A 2V2XA 4RGOL 5C71A 3MRPA 5JOPD 2NX5A 2ZCKH 3FT4B 4G5ZH 4RFEA 3UJIH 2F53B 2AABL 5DFVC 2AGJL 1J5OL 2E5EA 3HE6A 3HS0B 4KKLD 3VA2C 1KTKE 3NA9H 3WDHA 1UACH 5CJBA 2GSIA 2AJ3A 4F7TB 3QQ9C 4KI5F 5C0AA 5KSAA 5FB8A 1DQQA 4U33A 2L7UA 1DBAL 4TNVF 5EZLB 2V17H 2FJGB 4IS6B 5JO5A 2EXYD 2HJLA 1EV2E 5DD6A 3HC0A 1T2XA 5B38G 2JJUA 4B0MM 1A6WH 4P2RA 4AIZB 3DGGB 1A5FH 1XIWD 2H6PB 2UYLA 3MC0A 4TQEL 2XWJB 4QRPB 3AXLB 1BX2B 3AS3A 3CJJA 4HWNA 5H35A 3L3JA 4M1GH 4HV8B 3MLYH 4OTXL 2EC9T 1QBAA 5IJVB 1S7XA 3S35X 3P30L 2RQ8A 2YK1L 4PJ5B 2BSTB 4U49A 2COQA 1M6OA 3HCVB 2KQNA 4Z7QF 2FO4A 4F7MA 2UWEE 5FYJL 4XPBH 3TBTA 1FH5H 2Z35A 3UC0H 1AKJD 4OFYA 2VXSL 1FC2D 2NNAA 4NJAH 1KT2B 4OLEA 4PP1D 3RWCB 1B0GA 4XP6L 1FFRA 3IFOA 1S9YB 2MFNA 2QR0B 2R8SH 1F97A 3TV3L 3DX6A 3MXVH 1YEIH 5IHBA 4UI2A 3UTSD 3D48R 4MZ3A 5KJRH 4NHCL 4PD4K 2D7MA 4ZUUA 5AG8A 1MLBB 4MQXD 1Q9KA 1UADC 3ROLA 4LMQI 3UZVB 3BWAB 3DGCR 3V5HB 1UM6L 3E6FB 2R2EB 4S1DD 5KVEL 4PB9H 1MWAH 1C5DB 5FO8B 3MRNB 1QFWL 3T0EA 2NY0D 2LQRA 4JHAH 4MJIB 1QVOA 1AQKH 4N0CC 5DWUH 5I75B 4OCXL 2HKHH 2ADFH 5DLML 4YDLC 1Z3GL 4OZGF 2APTA 1NGXA 4NYLB 3U0PB 5J9PB 1JWSB 2FGZA 4EUPG 2JTDA 3C9NA 4JKMA 4LOUC 4UDTB 1I75A 2VLMD 2PCPB 2EC9U 2ZG1A 4TTDC 1ZLVH 1UA6H 4OD1H 5DRNA 1L0XA 3F7PC 3OPZL 4JM2A 5IBUB 4Y5XB 4YH6A 2R1XB 4Y0GA 1MNUH 3DARA 2R1WB 1V7NL 3TFKD 1FZJA 4LLVA 1OGAA 2X4RA 4AEFA 4WHYH 4ZUSB 5CIPH 3RAJL 5FYKL 5FYJU 4LARL 3MYZA 1S7SA 3NCYP 4LCUB 2JIXA 4JRXD 4FFYH 3BDXA 4CU8A 1XFPA 2K1MA 1WBYA 5CGMA 5FOBB 3FMGH 1IT9L 1D7FA 2NPLX 1KJ2L 3X3GL 3SDAC 4LBEA 5DC0A 4UILH 1OHQA 5F88A 4BH7A 2BVOB 4Q6YA 5LQBH 1A3RH 3ZLQC 5EBLB 1NBYB 4K3DL 4KVNH 3Q0HA 4MXWH 4RGNB 2C1OB 1DN0B 3DYOA 1MFCL 1N5YL 2C3VA 2HLAA 2UV3A 2CIKB 5I17A 3U0WH 4PR5B 4FTVE 2R2BA 2W9DL 1E27A 5B3JF 4Y5YC 5E24E 1BFVL 5C6PB 3BIKB 4PJBA 3GMLB 1FAIL 3KAAA 3BN9D 4WW1B 4DQOH 5C09A 1Q94A 5DEGB 5HYSB 1CQYA 3G6JF 3UYPA 5I1AB 2R4SH 5DJ0B 2P5EA 5C6TH 1NFDF 4QXWA 5FECB 4ZUWB 4WW2B 1U93B 4H5SA 3BH8A 5C0CE 4NQTA 4JO4L 2Q6WA 3KPQB 1IKFL 3OB0K 5HDLA 3NIFF 3UJJH 1FRGH 4I3SH 2NY1D 3H42L 1B9ZA 3DXAA 5D93C 5FYKU 5CJXA 3DMMD 2EZ0D 1AH1A 1FNEB 2XICA 2XTJD 5L7XL 1BD2E 3NIGF 2A0LD 5B21A 5F44A 1NC2A 3O9WC 1NEZG 1IGMH 1OPGH 3BZ4A 1B0WA 2FIRT 2EE3A 1AGBA 5KS9A 5MEND 2OK0L 1A7PH 4UNTA 5FDWA 3HI6L 4P5TD 3TJEH 4KI5D 4NZJA 4KKAC 3CC5B 5IKCB 4X99A 3WIIH 1DL7L 3D0LA 4FQCH 3DNKA 3LKNB 5C0BD 4L9DA 2IC2A 3JV4A 2HKFH 3QB7C 2C3GA 3VRLE 4G80B 1GZPA 4HW6A 1A6VL 3V4UH 1JUFB 5DYOA 3ECBB 1CXLA 3B2UC 4MVBC 5GQBA 4FXKB 3HG1B 3QCTH 4OFVA 5AAMA 4Z0XA 1RUMH 5F7MC 2YSSB 3VFRB 2IPTH 3E2HB 5J6GA 5ADOH 4TNWK 3X17A 2RR3A 4QRUB 5ESVB 3QCUH 3B9KA 1MRFH 3NZ8A 4P2QE 4ZUVB 2OMNA 1G6RL 3QG6A 4M6MH 1G9NC 5F9WB 3GSRB 3W82A 5FM5O 5BZWB 2G60L 3IB4A 2BHZA 3CVHH 3GFUA 4U6XA 3T4YB 2EIDA 2OJEA 4PRIA 4YHLH 2A6DB 4MDJA 3GSUA 4CMMA 1MF2H 2NTFA 1KG0A 5CILH 3KPPA 4G9FE 4OLVL 4AG4L 4GKZB 1EJ6A 3MCKA 2P8LB 3RUGB 1L0YA 5CGYD 4WUUD 5I8OL 4HPYH 1FDLH 3T0BA 3W9EB 4HKZA 4G8EB 5DQDL 4KJWC 1SYSB 4UT7L 3RKDD 1Q72L 5E8NB 1JNHA 4ZFOA 5T5FH 4HKBB 4S0SD 4DN4L 1A9BA 5CBAA 4NNXB 4U1SB 5TDNB 3FO1B 2O61B 3B83A 1JZ4A 4Y4HC 3TO4B 3W39B 1I1YB 4D9QD 2R0KH 5I8EB 3WHXA 3DO7B 5E9DA 2FB4L 3TT1H 5JQHC 1YUHA 4HGMA 3GB7A 4RMRA 3UO1H 4JZJC 3S37L 5CJ8A 5MP6H 4JO1H 5C0RH 3NABL 3K1DA 4GAJH 4H25B 1A3LL 1I3GL 2IAND 1UJ3A 5CHNA 4DZBB 4GG8B 1LEGB 1MRCH 4LRNH 1EAJA 5IMOB 1FO0B 2X7LB 4DKEL 3O4OB 5ACZB 3MUHL 3AMLA 1DLFH 2YBRB 5GS0C 3U4EB 4XPAH 3T77A 1JGVL 1CLYH 3SDAA 1ZVHA 5IB3A 4N0FA 4MLIA 4LEXL 2YEZB 3WHE0 1MFEH 4NNPH 3QZWB 4HT1H 4GH7B 3U82B 1EHAA 2ZUUA 1ACYL 5EO1A 2F5BH 5L8KB 4LLAA 5D7JD 1OP5K 4RA0C 2E9IA 5IOPA 4JG0L 3OTTA 3FFCB 4FQQA 3TVMA 1Y6KR 2NW2A 5HGDA 2LFGA 4FQIH 1EAPB 2XKSA 3R0NA 4CUCA 3H3KA 2APBA 1KPRB 4M5YH 3AS0A 1F4AA 1F6FB 4QRQB 4HX1B 1RY7B 4JG1H 2ID5A 4KXZI 3KPRA 3RWHB 4PGBB 4MAUH 1HHIA 1ZVYA 2ZCLL 2LV4A 3QNXB 4NQCD 2NY2C 4K94C 4F33A 4HAGA 5LKNA 1FNFA 2GJ6D 5L88L 4BK4A 1T89A 5INDB 4APQD 2DLIA 4XCNB 5H37H 3MUY1 5IHUL 4KV5E 1QNZL 3PHSA 2DBLH 4FZ8H 5T3ZH 4Y16C 1OWRM 1WBXA 5D7KE 5FHAH 4UTAL 5IMKB 5CGTA 1BQHB 4L4JA 1UFUA 1KLGB 4ZUTB 4FFVD 2HT4C 5ALCH 7CGTA 1FZKA 5HHVH 4GRLD 4KK6C 3O9WA 4WHYG 4FFWC 3GSNL 4ALAL 3IETA 1EGJL 5DO2D 3VG0L 2AK4D 4MNQE 4QCIA 2VLJB 2FX7L 1MCPL 1U3HD 4P4RA 3K4AA 4XXDB 4M1CD 5SV3A 4ODWB 1A47A 1RK0B 3OXSB 4ODVL 5TPWH 1AD0A 1IGCL 1MVUA 2QQNL 3DVGA 2B39A 5J56B 5E70A 5IK3A 4N90E 3M17A 3NH7H 5A3ID 3OKDA 2MQ0A 2P8MA 5FA4B 1HQRA 1X5AA 2BC4B 5C0FB 1C16B 3B9VA 1TFHA 4Z7VA 1GGIH 2MJWA 2FEDC 4GKNB 3SGKC 1INEL 5LCVH 4G6FD 4ODBD 1NUNB 1FE8L 3ARZA 4N0UA 3U4AA 4X0KB 1A2YA 2IQ9H 2OJZH 4QF1A 5HPOA 1WEJL 5HYJB 2ERJC 1OLZA 2Q8BL 3JTTB 2Z8SA 3V4VL 2NW3A 3DVNA 2VLRD 5JDJA 1NAKH 1QYGH 2H2SC 2YD4A 2F53D 3I85A 3QHFH 3R06A 3FTGA 5TQ2L 3NAAH 4HXAH 1FL6A 4EN3B 1U8MA 2ILLA 1UJTA 4KKBD 5SX5H 2APWA 3MACL 4QRSB 3CK0H 1K3IA 1A7RH 4LCIH 2Y07H 4MCZB 4MNGB 5B39G 5FV2A 4L9LC 1PEZA 4OV5B 4FMFA 2ZKHL 3ZE0F 1LO2L 4GSDL 1RHHB 1H3PH 4LPUA 1I9RL 1ND0B 2DB8A 4Y4HA 3UAJC 1JCKA 5HPMB 4P5KB 5GRJH 4ZYKB 4TNWF 4GW1B 3V6OC 3CSBA 1E4WL 4PJEE 1IGJB 1IAII 5MERB 4NWTH 4YBLB 1VFBA 4PLNC 1A1MB 2KPNA 4WTWA 3BIBX 4WFHD 4PJ5D 3D3VA 2PTTA 3LDBB 3MRGA 5MHSE 5IESH 5K9KB 1ZAGA 3H0TA 2CLZB 3HZYA 1TVHA 1HHJA 1FIGH 3SDXA 4LKCA 3GMMB 2HH0H 3MRFA 3GI9L 4MCYB 3ELAT 4NKOA 3IDMA 1LE5A 2CGRH 2CRYA 1T0PB 2ADJB 3GUTA 2EDWA 4UBDD 2IPKA 4HDIB 2P46B 2ATPB 1IC4H 4LHUD 1XCTA 2I5YH 5ALBL 5BZDB 2UWEB 1SEBA 4WI5A 4HZAA 1FG2B 5DD1L 3P4MA 5L0QC 2WUBL 4OV6F 3CDGA 5J11B 4R6UA 3CVIL 5DJDB 4XPFL 3BP6A 5HD8D 4N9GB 1TZGL 3SKNA 2AEQH 3CSYB 1XF5B 1I1AB 5FKAB 1WAAA 1NDMA 3O3UN 3SE3C 1I8IA 2FR4B 4ODUA 4GMTL 4GXVH 3SGDI 1IAKB 3HAEH 5JLZA 4TRPL 5EUKB 1TNMA 5FUZH 3DWTA 2QLVB 4ERSL 4M7KL 4L4TA 1FP5A 1DVFB 5EZJB 5GJTH 1YY9C 2ZOKA 2WW8A 4IOSD 3VDCA 4X6DA 5I18L 4LGPB 3TIEB 4CDGC 1BIIB 4Y16A 5I1IH 2VL5B 1AD9A 2WBJC 4ODHL 1D6EA 1NKRA 2CK0H 3RRQA 4F15C 3IDIB 4QTIL 1I8MB 4PRAA 1J7VR 1VCAA 4X9IA 1HN1A 3VJ6B 2AS5M 2F54E 3TH2T 1JHTB 3OKEA 3BRFA 4QRRE 4HCRL 4TUJA 3HZVA 4PJ8D 2F19L 4XTRC 2LVCA 2FCBA 4WUKH 1NCCH 3CFKA 2V7HB 2AJUL 3PDOA 4H0GA 4LPTA 7FABH 2K7QA 5ACLA 4NUGL 5T1KB 2OR9L 2H32A 3KS0J 3UTZA 5GRWA 3TBYB 4J2XA 1YNLL 2W9LA 4RGND 4GMSL 2CKBB 5FDYA 1G7QA 1LO0H 4J1UB 4YDIH 5T5NG 3I75A 3DMMA 1VEOA 3V5DB 1UCTA 1RZIA 4NT6A 4X7TB 3QEHB 1TCRA 3DUSA 4XPHH 3VDAA 4E9LA 4U1GB 4PJAF 1FFPB 3QCVL 4UOJA 1MFNA 4LASL 3H7BA 4XNZB 2XZCH 1H15A 4TSBH 5B4MC 3RWEA 3KNBA 5MENA 2VLKE 4FTVB 1I1CA 4P5TA 4PFEA 1WISA 1OP9A 5BMFL 4JPVH 1N2RB 2ARJB 1BECA 4RNRA 2SEBA 4KTDL 3WBDA 5C0BA 1ZT7A 4YZFE 4WO4D 5J89A 1WZLA 4I18C 1FG9C 3JBG7 1IM9A 1RU9L 3NZHL 1JZ3A 3U7AA 4G42A 3O11A 5H37G 5F9JB 5I1EL 1YQ2A 3IXAA 5ILTL 1UXWA 5C0CB 1HKFA 3FZUD 2J8UE 3LEYL 4RMSA 5D7LD 1PG7H 4K8RD 2X4OA 3RVUD 3VWKB 3MO1A 5GGTA 4OGXL 1I7RB 2D3VA 1CFTB 5I1GL 1BD2B 2F8OA 3VH8A 3MLTA 1DFBL 3ALPA 4WFGE 1YN6B 2BZDA 5B38B 3LQAL 4L9LA 1ZLUK 4HWBL 3IDNB 4OGYH 4WI4A 1T6WA 4EVNB 5CD5C 1V3LA 5HTSA 1GOGA 4UUJA