2GSGA

Crystal structure of the fv fragment of a monoclonal antibody specific for poly-glutamine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody light chain
publication title The structure of a polyQ-anti-polyQ complex reveals binding according to a linear lattice model.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsgA00
3T65B 3B9KC 3GMPB 2Q3AA 1ZV5A 4KRPC 1S7WA 1PVHA 5BOZG 3RNQB 3KPNA 1UVQA 5B38B 4QWWC 5FOBA 3BW9B 5DRNA 1SM3H 4MNHA 4PFEA 5JXED 3GMNB 2E6JA 4HS8L 1J1PL 5GGVY 5IKCB 5J11C 3HI1B 5IQ7L 1EA9C 1J1XL 1I9EA 1MHCA 1MFEL 1T2QL 4EVNA 3T8XB 2A83B 3BKCH 4MHHI 4GQ9L 3OX8B 3DJ9A 3UC0H 3QNYA 5H2BA 2F53A 4AEIL 2W0LA 1CF8H 2YC1B 4K7PH 4PGJA 2ZJSL 3OJ2C 3SE3C 3MREB 3SKNA 1T83A 4KDWA 4HIEA 4QY8B 2WIMA 2E9BA 2G75B 3IDXH 3IAPA 1M6OA 1FBIL 4TOYL 3IDGB 4PP1D 5MHSD 5D2NE 2EO9A 5DJ8B 2YD8A 1KGCD 3TCXA 5DQJA 1G0YR 4ZO7A 4IBLT 2VUOA 2VKWA 5KVGH 1H0DB 3DMMB 3OGOE 3EAKA 4QNPF 5GXBB 3DXAD 2EE2A 4GRMA 2ADIB 3C2AL 3EGSA 3FO0L 5JORA 3LN5B 2H26B 4B0MM 1MHEB 4TTGA 1CGWA 2N7BA 1FGNL 4RGNE 5D7IB 3O2DA 4HF5H 3BX7C 4Z7WE 3T4YA 4F9PA 4OZHF 3ZKMD 3MLVH 5DJ6B 4ISVB 3RY4A 4Z77B 2VDRH 1I1FB 1U8JB 3LH2L 4LAJH 1G84A 4KHTH 3MUZ1 4LCYB 1F6LL 3B2VL 5FYLE 3QNZB 5DQDL 3C60B 5ADOL 5E08H 1QSEB 3PNWA 1RHHA 1J5OL 3LKRA 2W9LA 3MACH 1T89A 4S1SH 3VJ6B 1KJ2A 3VI4E 4TSAL 2GJJA 3NMEA 3VRIA 3QIWD 1CICA 2ARJB 3ZT7A 1JUFB 1CR9H 4XCEB 5IEHB 3GSXA 2XZAH 5GISH 3CPLA 5BJTB 4XZUA 1ZEAH 5KVEH 1XCQA 4JY4A 1DZBA 5DEFB 4X80H 1RUAL 3RWDA 1QO3A 4PRAB 5L9DL 4GS7B 3HN3A 5JA8B 3MR9B 4UV4H 1CBVL 1HZHL 3TLRA 1C5CH 1WV7T 3VCLB 1MCRA 1R3LB 4EI5B 5IVXB 1LEIA 1MCIA 3QR2A 4QTIL 2RFXB 1LGVA 3ARPA 1FPTL 4JVUA 3T0VA 1U8HB 5KW9L 3VMPA 3S5LG 2NZ9C 2EDLA 5HD8D 3HLAB 1ZMYA 2VXSH 1D5BB 4NO0A 2X4QA 3D39A 4P23C 5DJCB 1A47A 4HT1L 1JHTB 4NO3A 3U30B 4CW1A 4YPGA 4Y0GA 2VC2H 5AG8A 1YJDH 5IBLD 1T4KA 1L7TL 4YEFA 1MJ8L 4HDIA 4G43A 3D3VA 4NZUH 3QFJA 2F53D 4OBRA 1E27B 5CBAA 3U36B 4DTGL 4K3JH 4NFCA 4IRJC 1I75A 4LSPH 4L8DA 3ZE1E 5FB8A 2F8VA 1NMBL 2V7NA 3KR3L 3A0OA 3FB5A 1TPXC 4G42B 5ACZB 1NAKH 1QLRB 3BUTA 4P5TB 3O4OB 2KH2B 5ALBH 2IWGA 2H2SD 3CLFH 4FP8H 5I1LA 5J6HA 3ALWA 4NP4H 4P3WA 3QIUC 1DLFL 5C0CE 3OJMB 5IMOB 3HMXL 2EIEA 1J88A 4XI5C 1KXTB 3RIFK 2JKXA 5JMOC 5E0QA 2NMSA 1KN4L 2ZOKB 5F88A 4XC1H 3CH8A 4OZ4A 4U1KB 3GJFB 43CAA 4DEPC 1ODAA 4YDLB 5C08A 1OAUH 3DX9A 3C09C 3RWGA 4JPVL 1FL6A 1SEQL 2GCYB 2AK4A 1LO4L 4BSVB 5KN5B 3MBEB 1T7XA 1YN6A 5FHBH 3TO4B 2KUTA 3DO7A 1RJZB 1H8OA 2ENSA 1CFTB 1T04A 1IM9B 1MNUL 2E5EA 5INDA 2BSSB 1Y6KR 3ARFB 3MXWH 3QULA 5C9JA 4Q58C 2QQNL 3TF7C 4G80B 3DGGB 3ESVF 4I48A 1F6AB 5DRZA 4YLQT 1E4XL 2Y5TB 3MSPA 2VAAB 3MFFB 1VSCA 1GGIH 3MLTA 4JFQA 2KBGA 2OX5A 3CFBA 3DTXA 3REWA 5D5ME 1CD1B 2DM4A 2DI9A 5D93C 5BQ7B 1F3JA 1T22B 3BP6B 3MLUH 4G6KL 1U92A 2JELH 4BUHA 3FB8A 2UUDH 2D0GA 4NKMA 4KKNA 3MA7B 4JFZH 5DS8B 3H42H 1FAKT 1HH6B 1S5HB 1ZT7B 3O4LE 1FNEA 4NUJB 5DQ9A 2VDKH 4L1DA 4ZODA 3RVWD 1JGLH 1NBQA 4XMPH 5H37H 3D3VD 4X7TA 5DT1L 3QFJD 4DZ8A 3BKMH 1WBXB 4F15C 1KLGA 1LO5A 1CU4H 3EDDA 4OZHB 1UWEL 1OGAA 3PABA 4NZTH 5HDOA 4Z8FH 2DDQL 3CNKA 1FL5A 3ARQA 4NQCB 3HNVH 3LEXA 3DNKA 3D1MC 5LGJA 1UM4L 1YQ2A 2PYEB 1N3NB 2MJWA 5AD0A 3O45A 4E9LA 1HCVA 5IK3A 3VGEA 4EEEA 4IDJH 4U3HA 5AUMB 3O4LD 4GRWB 4XPHL 4D0DB 4Y4KC 1N0XL 3W9DB 3X12A 1CFSB 1UB5A 2XQBL 5F7YC 2ZUQB 5JW3L 5A16A 4HFUL 2AS5M 4JHZA 5EO0A 2VNCA 4GG8B 3CZFA 3FN0L 2A9MH 1U93B 4OCSL 2YKLH 4Y2DB 5CGMA 5D8JH 2R4RH 1LE9B 5JQ6H 1INEH 4HV8B 4X9BA 2X4RB 3JTSB 4XCFH 3CFJB 3PWVA 5ERWB 3QO1B 3KJ4C 1BFOB 5E00A 1VFAB 5HHVL 2X1WL 2CH8A 3U0TA 1J1OH 2YSSB 2AK4D 1FRGL 1VA9A 3QDJE 4LNRA 5I9QC 3BWUC 3O9WA 3KPQB 1EHAA 4NNXB 5KS9E 2WW8A 1JGDA 4ONOA 1FYHB 2ZSVB 3PJSA 3TBSA 5DVLA 1FVEB 1ZT1B 1CD8A 4LPYA 1P84K 4LSQH 3FRUA 4FFWD 1K9TA 1UJ3C 3D18A 3SE3A 2QQLL 2YRZA 4LDLB 3BT2L 3TYFA 4PD4K 2WUCL 3U4EB 4HUWA 1T1WA 3O8XD 4IOIB 4QHKI 2Q86B 5DEZA 5FUZL 1OGAE 1WQVT 3MV9B 4RFOH 4NYLB 1M05B 4BQ6A 3LVEA 3GHBL 2W07A 1FJ1A 5JIPA 3F6IA 5DURB 1ZHLB 1YEGH 2IBZY 1ACYL 1PLGL 3OAZH 2GAZA 3WFBL 4NRYB 1WBZB 2IQ9H 2ZG1A 2HJKA 5HYQA 4MCYB 5T1KB 2B5IB 5C3TA 3OG6B 2BSRA 4DKFH 5MEOA 4S1DD 5D1ZB 1B9ZA 5DDHB 4UQ2B 5JW5B 3EJJX 1OGAD 2P5EE 4C54A 1SM3L 1F58H 4M5ZH 1ZVYA 1T1ZA 5ITFA 4X8JA 4WW1B 3NAAH 1FSKB 3BKCL 1C5DA 1HHIB 2CKBB 5EZOH 2GITB 2J12B 4OCLC 3UC0L 1RZJH 3AFLA 2ICWJ 1CF8L 4K7PL 1OP5H 1HSAA 3MLPA 2FSEA 4ZOEA 3S4SB 3CC5B 4WEMB 2AXGB 4HWBH 4ZFZA 3LQAH 3EIFA 3Q0HA 4NZDA 3IDXL 5HHMD 1KCUH 3SKOB 1XF4A 3G6JE 1RQ5A 2P5ED 3B9KD 3D0LB 3PUCA 4KRPD 5GIRB 1GOGA 4BZYA 4I5BB 3KGRA 1YYLH 4UDTA 4XX1G 4NQUA 3MPCA 4QWWD 2J88H 5KVGL 4PRNA 1G1CA 2JLLA 2NTSP 4LF3A 4JFEE 5J3HC 5DJ2A 4P23A 3P4MA 5CSBA 3JWOC 1GZQB 3LV3A 5F8QC 4HF5L 1T0NB 3DXAB 5TQ0H 4Y89A 1WWAX 2AQ1A 4QOKE 4Q2ZA 2CMRH 3MLVL 1PZUB 3MOQA 2BSTA 3HC3H 2J8OA 2HFTA 2VDRL 4OCMC 4OUUA 1JK8B 4KI5C 5IFJB 4KHTL 3BMVA 5E56A 3VGFA 4IRJA 3IVKA 4R0LB 3GSUB 3V6FA 4AH2A 1L0XA 4NHUA 3STLA 5E08L 1UG9A 3I6LE 2M8XA 2W0FA 2R1XB 4I18B 4MJ5A 3MACL 4S1SL 2WBWB 4PLNC 3KJ6H 3OKDB 4LLUA 1B2WH 3GGWB 4JFED 2EDRA 1I1AB 3WV0A 3VXSB 1CR9L 4ENEC 2PR4H 4MB5A 1XGUA 1EAPB 2XZAL 5E7BA 3LIZH 1AE6H 5GISL 4C57C 3QIUA 3HNTH 1ZEAL 5KVEL 2HTLC 5I15H 3R8QA 3QIWB 3RY5A 4ZS6C 4X80L 4NIKB 1JZ5A 1XZ0A 2Q8AH 3BPOB 4LVNB 3SJVE 4EQ2A 5HGHB 3QG6A 3TBTA 2WBKA 3ARGC 4UV4L 4ELME 1C5CL 2O5ZH 3WJJC 3X14B 2ICEB 4HG4J 4M62H 3MA9H 1KNOA 5CIPA 3SO3C 1NFKA 3L3HA 4A6YA 1WICA 2FECL 2VR4A 5HGDA 4ZFOA 2VXSL 5J6GA 4F9LC 1S7WB 2VQUA 3GKWH 2VC2L 1UVQB 3KPNB 1NPUA 5FOBB 3AU1A 2AKRB 1YJDL 3Q5OA 5DRNB 4IRSC 4MNHB 1CGSH 2X9WA 4NZUL 3HPLA 3L5XH 2XKSA 3H9SA 1MHCB 4HUMB 1QPXA 4K3JL 2RIKA 3SJVD 4EVNB 4LSPL 3MBXH 4NC1C 3DRQA 3QNYB 5H2BB 4ODVH 2F53B 3DI2B 4YO0A 3B9EA 1NAKL 2YWZA 1RZGA 3SKNB 4HIEB 1I8LC 1KULA 4PV9A 4FZ8H 3WJLC 5ALBL 3CLFL 4FP8L 1M6OB 2VL5A 2CRZA 1NANI 4ODSH 4U4BA 2NZ9D 1BECA 4XVSH 1T5XA 2D7TH 1X5GA 3ROOA 4P23D 1D5IH 5DQJB 1MH5A 1NSNH 3WUWA 2CK2A 2E7CA 5HI4C 1S9XA 2R2BA 1G7JA 4U1LA 3ZO0A 4MA8H 1OY3B 4XC1L 5LWYH 5CJQH 4GRMB 3EGSB 4XBGA 2HAZA 2GSIA 5JORB 1AGBA 1OAUL 3GHEH 4IRJD 5FO7A 3N1PC 3T4YB 2X1PA 2LTQB 3K8KA 3L7EB 4N0CC 3SDDC 3AVEA 5I75B 1I9RH 2EDJA 5CJOH 3V0AC 5LXGH 4QYOB 1OGTB 3AMLA 3CDYA 5FHBL 2DYPA 5HHXH 1DSFH 3PNWB 1RHHB 3LKRB 4FQ2H 3QIUD 4YHNA 1K5NA 1KJ2B 3MXWL 4XTRC 5JPMA 1VEOA 4XI5D 2X4TA 2E8ZA 2AJVH 2HTKC 2R0WH 2HH0H 2BOBA 3U0PA 4D8PA 4Y5YC 3GSXB 1JNLH 3CPLB 1YPZA 1GGIL 3EOBB 2W0PA 4PR5B 1XCQB 4JY4B 2WV3A 2NW2A 4PJAA 4MJIE 3RWDB 3MLUL 1ZHNA 1QO3B 1RURH 2JELL 2FCBA 3C6SA 4JHAH 1K2DA 5GHWH 4JFZL 3VMOA 1LEIB 3O3UN 3SE4C 3H42L 1ZLWH 3ZKSD 2Q20A 2I9TB 5EZJB 5SV3A 1BF8A 2OZ4H 1WAAE 5C1MB 4ZMAT 2VDKL 1JGLL 4NO0B 4R4BA 2X4QB 4XMPL 5EBMA 1G7PA 4NO3B 4CW1B 4MA1C 3B2UC 4YPGB 3H9SD 4U1IA 3BKML 4OGAC 1CU4L 1R3JA 3MV7A 2BZDA 4WW2C 5E8DH 1A1MA 3L3IA 4HDIB 4NZTL 3D3VB 2PUQT 2E9JA 3QFJB 5CBAB 4MJID 5D7KD 4OKDA 4Z8FL 4ODWA 4S0SD 1F5WA 3HNVL 3RX8A 4JAMA 4L8DB 5FB8B 4NZRH 3C5ZC 1DBMH 1OW0A 3ARBC 5D5MB 2V7NB 3FB5B 1ZSDB 4IDJL 5BVJA 1X5IA 4PJGA 4U0RB 1WZ1H 3HNSH 1EEZA 3ARSA 3EYUH 3K8LA 5KANI 5I1LB 2BRRH 1T1XA 4WUUA 3ZL4H 5J6HB 3O4LB 2A9ML 3NPSC 2ICCA 2YKLL 4I3GA 3MRGA 3B5TA 3PP4H 4QRRE 5D8JL 2R4RL 4L8CA 5C0GB 5JQ6L 1INEL 1HWHB 5F88B 4XCFL 5IHUH 3QDGA 1TXKA 4OZ4B 4U1JB 4PJAE 43CAB 4CDGC 3TJHC 4KUCD 2N56A 2CRMA 1KCVH 4YJZL 1J1OL 5C08B 3TM6A 3DX9B 1IQWH 5DWUH 3RWGB 5ESVA 4P5KA 1FL6B 3T0EC 1V7NH 1GJIA 1T7WA 2AK4B 4JPIA 3FO9B 4LSQL 5L2KE 4JM2C 4Y4KD 4ZUTA 3TNNA 3VD5A 2FBOJ 3NIGE 3DO7B 4N8VG 2AXHA 1T04B 2C3HA 2DI8A 1FQ9C 3MV7E 1EEQA 3QULB 3QIBA 3B3IA 1FC1A 5C9JB 2I60H 1BJ1H 3IETA 4LFHG 5ICZA 4RFOL 2WBJC 2H41A 3DUSB 3QFDB 1T3FA 5DRZB 3MLTB 4JFQB 5B3JF 3NCBB 1CGYA 3CFBB 3DTXB 1YEGL 4APQC 3AS1A 4HD9A 2R2CA 2VIRA 2CR6A 2CD0A 2BCKA 1A0QH 1F3JB 2IQ9L 1U92B 4NQSB 4FQIH 5KTEH 4QEGA 4NKMB 5GS3A 1I1YA 1N4XH 4KC3B 5I8EA 3O3EA 3G5VA 1UFUA 2VN7A 4DKFL 1FNEB 2LVCA 5DQ9B 3MV7D 1BLNA 5I74B 5C3LD 5E4IA 3BIAX 4X7TB 2WK2A 1F58L 3REVA 3KS0H 1Z9MA 4M5ZL 1WEJH 4DZ8B 4Y19A 4PG2A 1F45A 3QI9C 1LO5B 1R3KB 5EOQH 3NAAL 2VABA 4UI2A 1VGEH 4PJ9C 3TEUA 1OGAB 3PABB 4GKOA 2PF6A 5EZOL 3ZKQD 2X70B 1RZJL 5HYJA 3LEXB 3T0XA 1FZJA 1KPRA 1WZMA 3MRPB 5AD0B 1MCBA 4HWBL 4WUUD 5IK3B 3T2NH 3LQAL 2OR9H 3G08A 4LSRH 1AHWC 1KCUL 5JXAH 3V2AR 2J2ZA 1JZ6A 3BEVB 3MYZA 4Y4FC 3X12B 1UB5B 15C8H 3WJJA 1S7SB 2XN9A 5A16B 5HHMB 5J4MA 1HE7A 1V3MA 5EO0B 3RZWA 1YYLL 4POUB 2QSTA 3CZFB 3HC4H 4JQVC 2J88L 4Q97A 2A6JA 2IANA 3B9KB 4JY6B 3DX8A 3FJTA 4F9LA 4KRPB 2APTA 4X7CC 2EYSA 1S7VA 5F9WC 3QWQB 5E00B 4IRSA 3EUUA 4C56A 4OZFA 3U0TB 5TQ0L 2VSDA 4LNRB 3WIIH 5IROA 2CMRL 5J11B 4FTVA 3HC3L 4KY1H 5I19H 1P6FA 3ZTNH 4S10A 3F7VA 4KKBC 3PJSB 3TBSB 5JW4Q 4QKXB 3DRTA 3FRUB 2ERJC 2NYYC 2B1AH 2UY6A 3D18B 2OMNA 5DGRA 3L95A 3U7YH 3KJ6L 4PP2A 1B2WL 2WAHA 3TYFB 4Y19E 4HUWB 1TJHH 1BQHG 1T1WB 3OF6A 3KPRA 2PR4L 4JG1H 5E8PA 2AI0H 3S8WA 1JF6A 2OJEA 1WCBA 3LIZL 5FA4B 1AE6L 4XGZA 1TQCC 4OI9A 3HNTL 3IFOA 5J0BA 4V1DA 5I15L 3R0MA 4YDJA 5J3HD 4HW6A 1FJ1B 1P5UA 4JDTH 2C3VA 2Q8AL 2K7QA 1CG9A 4YX2H 2GAZB 3VGDA 2HJKB 4M62L 3MA9L 5HYQB 4C4KO 2ED9A 3QZWA 5KSAA 4KI5D 3VFUA 3O2WH 4Z7NE 5E5MA 2CPCA 4Y19D 3RWHA 5MEOB 1X5YA 3GKWL 3LQZA 3SDDA 1PGRB 4KUCF 2FO1A 1CGSL 1DBKH 1FFNA 1T1ZB 4ENED 1BJ1J 4L4JA 4X8JB 5ITFB 3L5XL 1JHKH 1CT8A 5JDSA 2HVKA 2HTLD 5FA3A 1C5DB 2XV6B 4ZS6D 3MBXL 2BP3A 1U3JA 4ODVL 1OPGH 1HSAB 2CGRH 1S9KC 2FSEB 3U7AA 3ARGD 3UBXI 5KSVA 1YPZF 3OQ3B 1K8IA 4NC1E 5TQ2H 4FZ8L 1CTNA 5D2LA 3DUUA 1HQRA 3GSVA 3UX9B 4ODSL 1NFDE 2MPAH 2IAND 4XVSL 2D7TL 5K59F 3SE4A 4I13B 1NSNL 1QA9A 3C9NA 3QUYC 4JFYB 3KS0J 4XAKE 4UDTB 2DM2A 1JYXA 4LPXA 4MA8L 4JQXC 4PRNB 4IRSD 4LF3B 1YZZA 5LWYL 5DJ2B 4P23B 5CJQL 3P4MB 5DRWA 1P6AB 4GAGH 2FATH 4FTVD 4UDUB 1HQ4A 5CP7B 4KK5C 2VXVH 3GHEL 3LV3B 3M45A 4WW2A 1DEEA 1BJMA 4JQIH 4M7KH 3T3PF 4Q2ZB 1SYSA 2BSTB 3IJYA 4OUUB 5DZLA 3O6KH 1I9RL 4IRJB 1YNLH 5CJOL 5DC4B 3VFWA 5LXGL 3C5ZA 1G0DA 3V6FB 3ARBA 3OF6D 4NHUB 3STLB 3UTPD 4AH2B 5C9KA 4RCAA 2SEBA 5HHXL 1DSFL 1TPXB 3T2OA 4FQ2L 2W0FB 1B6UA 4MJ5B 1IC7H 4V1DD 5EG6C 1U91A 2EH8H 4PJGF 4HSQA 2AJVL 2R0WL 2HH0L 4PLOB 4OD3H 2OR8A 5HI4D 1XGUB 5IB4A 1JNLL 4LKXA 3QIUB 5DVMA 3D25B 5CEZE 4PJ8C 1LP9A 1EPFA 5FO8A 2APWA 1XZ0B 1EUTA 1A64A 2GJ6A 1RURL 1CDCA 4JHAL 2K1MA 3QDME 3QG6B 4I8DA 3TBTB 1BBJB 4NRZA 4DKEH 5GHWL 3E3QE 1MY7A 4LVEA 4N0CD 3RWFA 1KNOB 5CIPB 3T08A 3SDDD 5ICXA 2OZ4L 3L3HB 1DDHA 3C09B 4A6YB 2Y1VA 5HGDB 4ZFOB 2BFVH 1A7RH 5J6GB 5IV2A 3T0EA 3EW3B 1FFPB 1MCWM 2NY4B 4LHUD 1XGYH 2CO6B 3AU1B 3VDCA 1JZ4A 1N26A 4JM2A 5CSZA 5FECA 4XTRD 5E8DL 2HTKD 3IKCB 3HPLB 1DBJH 4KMTH 3H9SB 4JO1H 4RWYH 1RUKH 1MHPH 3CSYA 5EC2A 4NZRL 1DBML 5EO1A 3DRQB 4YO0B 3L3DA 1RZGB 1WZ1L 3HNSL 4XXCC 4PV9B 3WBDA 4OLWH 1MREH 1SYVA 5D93B 3EYUL 1G6RH 2BRRL 3SKUD 3ZL4L 2ARWA 2FJGA 5IM7B 3S36L 3ZE0F 1YN7A 3LKOA 4LLVA 4XCCH 5MI0C 1T5XB 3GSOA 3ROOB 3VH8G 1UKQA 1MH5B 3FRPA 3WUWB 1CXFA 3PP4L 3S3JA 3B2UD 2R2BB 1G7JB 4OGAD 3QXVA 3TFKC 4Z5RA 4M3KB 1MCEA 5IHUL 1OCWH 1LP9E 5DJXA 2XFXA 5F93C 1KCVL 2KZ1B 4XBGB 1NMCC 4KI5F 3CFIC 3O3BA 2GSIB 3VXNB 1IGYA 1AGBB 4F15B 2A0LC 1BIIA 3QI9A 1H3GA 3GBMH 1QP1A 5FO7B 1IQWL 4N1HB 2UYLB 5DWUL 4PJ9A 2OLDA 2DRUA 1OQOA 3C5ZD 4K8RH 3ARBD 1V7NL 1M7IA 1DEDA 4NN7B 3WE6A 2M26A 5FKAA 3NIFE 1J87A 1BD2E 1LK2B 4HS6A 4YHNB 1K5NB 4Y4KB 1AHWA 5JPMB 5IFHH 2I60L 2X4TB 4WFEE 4WHYG 1GGUA 2BOBB 3U0PB 4D8PB 2GJ6D 4KTYA 4LCUA 4ZNEA 1YPZB 5K9QI 5JIKA 1ES0A 2NW2B 4PJAB 3TJHD 1A0QL 5FYKH 1ZHNB 2QTEA 3C6SB 4FQIL 5KTEL 1OOAA 3RNKA 3PL6C 1VERA 4BH8A 1K2DB 3TVMC 3MRNA 2OTPA 1BAFH 2NX5E 3KJ4B 3T0ED 1N4XL 3SDXE 4PJCA 1G6VK 2XNAA 3JUYA 2EKSA 5F6HI 3Q6GH 4JM2D 4PGDA 2NXYC 4BFEA 4R4BB 1FIEA 5SWZA 4MAYC 5EBMB 3RWEA 1G7PB 1OT2A 2XXMB 5GGSA 1WEJL 2C3GA 3B5GA 4U1IB 2P45B 3N85H 3PP3K 1R3JB 3MRLA 3MV7B 4PJHA 5EOQL 1A1MB 3OKOA 1UJ3B 1VGEL 3TBWA 5CHNA 4ZAKA 2WBJD 1AD9A 1HDMB 4MS8C 3BEWA 1A6PA 4ODWB 5HPMA 2VLRA 4I2XA 1MCDA 4JAMB 4APQD 1I9IH 4NQEA 2VAJA 3T2NL 3U6RB 2OR9L 1ZVSA 4LSTH 4PJGB 1FL3A 3B5HA 3ZHLA 4LSRL 3RUGA 5F7DA 1YEIH 4BSJA 4PRPA 5JXAL 5M95B 2VRAA 3PDOA 15C8L 1QRKA 1T1XB 4WUUB 1JGUH 2IPUK 1FFOA 5E2JA 1NEZG 3DI3B 5I0DA 1NLBH 4NQXA 2ZSWA 4FOMA 3HC4L 1PEWA 5BRZA 3MRGB 3FT3A 4ZNEE 1XCTA 1WCQA 3QI9D 4N5EC 4X6CE 3RJQB 3T0AA 3BH9A 4PJ9D 3ARVA 4M6NL 3VRJA 1U6AH 1AQDA 2GSGA 1J8KA 5INCA 1CDIA 3PG2A 1INDH 3WIIL 1JZ8A 4KY1L 1QLEH 5I19L 1U8PA 5ESVB 3ZTNL 4P5KB 3EOAA 1PYWA 3G5YA 3SN6N 1GOHA 4JPIB 4PUBH 1I7RA 4Z7QE 4ZUTB 2B1AL 2GYSA 4H1LG 5TDPA 4XPGH 3RY6A 4JFDA 1BZQK 4Y4FD 3U7YL 3VD4A 4QT5A 1TJHL 3C6LA 4G7VH 4JG1L 4BZ1H 2AI0L 3CGTA 3QIBB 1ULVA 3B3IB 4Q7DA 5D2LF 1P1ZA 5F21B 4OCRH 5ICZB 1UEYA 2ICWA 3F12A 2BJMH 4C4KT 2J5LC 2ITDA 3VRLF 4JDTL 1EVTC 3RDTA 4G8EA 1Y18B 4YX2L 2VIRB 3VFMA 5E5UB 2JF1A 2BCKB 3MCLH 4NQEE 2B4CH 4YFEA 5J12C 1OAQH 4X5LA 1A3LH 4ZXBC 4LCWA 3LKPA 4J23A 1BVKA 5SWZD 4JGUA 1I1YB 3O2WL 4LPCA 1CLCA 4KKBD 5I8EB 3O3EB 5CZVH 3G5VB 3P0YH 3BYYA 1BF2A 5ILTH 4WW2F 1ZLVK 4I0KA 1RZ8B 1A1OA 1BLNB 2HP4A 5IB3A 2E7LA 2GUOA 2NYYD 1NGQH 4OTXH 3ETBF 4GUPA 3REVB 2Z91A 1DBKL 2YXMA 4Y19B 3QJFA 2FL5A 2B2XH 2VABB 4JVWA 1JHKL 4ZUVA 4LGRB 4NQED 5DRXA 2JTDA 2YXFA 2MQ3A 5JIIA 5CJ5A 1OPGL 4X0KA 3VWJA 1UQSA 4PRPD 2CGRL 1FZJB 1KPRB 2HLAA 4TTDC 1MCCA 5JW4N 4GAFB 4JFHE 4PJ8A 3QO0B 1UADC 5TQ2L 3QH3A 3G08B 2VE6A 5KSBA 1SEBA 4OAWA 3EO9H 1CD9B 5BRZD 4NBZB 2MPAL 1G9MH 2EC8A 2W65A 1QHOA 4WFFE 2ADFH 4NQDA 3SO3B 4JGMA 4YDKH 2A6JB 5HVGB 4Q6IC 3JBG7 2IANB 3DX8B 1J0ZA 2EDXA 4GAGL 2FATL 3ARTA 4HAGA 4JY5H 3G5XB 4F8TA 2VXVL 3GJFH 4IRSB 4C56B 4OZFB 4JFHD 2EC9T 3B83A 4JM2F 4JQIL 4MNQA 4M7KL 4WTWA 4FTVB 2YD1A 3GUTA 3O6KL 1HIMH 3F7VB 3NZHH 1YNLL 2OM5A 4JFDD 1CWVA 5TGBA 1BREA 4WFFD 3KYKH 3TPKA 1IC7L 4IHOA 2ZWLT 4PP2B 4XXCA 3OL2A 3KPRB 5E8PB 4OD3L 3IFPA 3QUYD 5KVMC 2OJEB 3ZDZF 2XPGA 3IFOB 5IR1A 4QHKJ 4V1DB 3VE0A 4YDJB 4R7NB 2MFNA 5D9SA 1X6NA 3IGAA 4LCWD 2C3VB 1D3CA 1CG9B 4KK5D 4YDIH 5I0ZA 4DKEL 2VISA 4YHMH 3EO1A 1T03H 3HB3C 3P11H 3RWJA 3QZWB 5KSAB 3VFUB 1BM3H 3AREC 5E5MB 2BFVL 5HGAA 3RWHB 1A7RL 3LQZB 1NANH 3SDDB 4AEFA 1XGYL 4MLIA 4PJ7A 1VGKA 4KHXH 1FFNB 1B0GA 3S9DB 2CUHA 1DBJL 4KMTL 4JO1L 4RWYL 5T3XE 1RUKL 1MHPL 1CT8B 4HWBA 2H32H 4PJ8D 2WWKO 3DVIA 5FA3B 3FB6A 1EX0A 4EIGB 4M1DH 3KYMA 1J12A 5D7SH 2Y25A 2DI7A 1MQ8A 5KSVB 4OLWL 1MREL 3UP1A 1K8IB 1D9KC 1OARH 4WEBH 4Y88A 5D2LB 4YHIA 3DUUB 1HQRB 3GSVB 2VITA 1G6RL 4GRWH 4DOHB 4NQDD 3LPWA 4GLRI 1A6TA 3TESA 3PL6A 1YEJH 1TCMA 4L3EE 4XCCL 1OP3H 2XZZA 3LKNA 1QA9B 1KEGH 3HUJA 2DLHA 4NBXB 4PJCF 1P7QA 3ZE2F 1K4DA 1A4KA 3M17A 2VO5A 4EUPH 3OV6A 1OCWL 5JR1H 4MAYA 2V2XA 4MNQD 4MA1B 5AZ2H 1HQ4B 5C0BA 2DJSA 1QFHA 1IEHA 2VZUA 5MENE 3GBML 2LE9A 4WW2B 1DEEB 1NKRA 4K8RL 4P9HH 4PJHF 1X5LA 3W0WA 2IJ0C 1SYSB 1MF2H 4JO4H 4G8FA 4NKIH 3IJYB 3WKMH 2BVQA 1FV1A 1MRDH 5F1KC 1VADA 4OGZA 3I75A 3VFWB 3RBSA 3C5ZB 1V8HA 3ARBB 4RA3A 2SEBB 4HAFA 3GMQB 4HIHA 2VLJA 2RHEA 5IFHL 1U91B 1CGXA 3KPSA 1NGPH 5EO9A 3BZFB 1TNNA 3RUGF 5IB4B 2HT3C 3TFKD 5E95B 5LJYH 1W72H 1LP9B 1NBVH 4D3CH 4GAJH 1L9NA 5FO8B 5FYKL 3TH4T 4U2YA 2GJ6B 3A6BH 2A0LD 4HGKC 2XWTA 1S9WA 1BAFL 1WK0A 3VU2A 3RWFB 5IJVA 1TJIH 4Y4HC 1T2XA 5ICXB 5ECJE 5BV7C 4MSWA 3Q6GL 4QCIA 1ZANH 2W38A 1OAYH 3MJ9A 3K7UA 3QXWA 1L7IH 3T0EB 5CP3H 1WZLA 2CDFA 2P8PA 3GDBA 3FCTA 1VEPA 3N85L 5FECB 2IFFH 4JM2B 5CSZB 4C83B 4HUVA 5D1QC 3SPVB 5ANMA 5EU6E 4RRPG 2BXZA 2DB8A 4K55A 3THMH 2AV1A 5C0BE 3VDBA 4WUKH 3CSYB 3PHOA 3AS3A 4MQ7B 2DQUH 1T66C 5JDJA 4I3SH 5EIIA 4ZQKA 1I9IL 5EO1B 2C4FT 1MVUA 5B3JE 4UT7H 4GAYB 4M8QA 4Y8AA 3T2QA 4HMEA 4LSTL 3PL6D 1KUMA 1YEIL 1NAMH 3TVMD 2R2EA 1SYVB 3UBXG 1FO0H 1MLCA 3QWRA 1JGUL 2FJGB 1CLYH 1BVLA 1P7QD 1NLBL 3FQRA 4GBXC 4E0RA 2NXYD 5EU6D 4XRCB 1WT5C 3GSOB 4Z7VA 2D2OA 4MAYD 5ESAB 2G9HB 1Q0XH 4HFWA 5C0BD 1EMTH 4Z5RB 4MVBC 3EYQC 1JPSH 1UT9A 5DJXB 2XFXB 5C86A 4LGSB 1U6AL 2ZOLA 3W0WD 1UXWA 3O3BB 1VFBA 5TF0A 4MS8D 3FL7A 5I8CA 3QI9B 1INDL 1BIIB 2B39A 4OZIA 1KTLA 4S11A 1QLEL 5I1CH 4PJ9B 4HUXA 4RSVA 3H3PH 1D5ZA 5IQ9A 1M7IB 5GRVL 3U48A 5JHDE 2Y7QA 1C5BH 3P9MA 4PUBL 2HYMA 5CMAA 2HT4C 5FKAB 4XPGL 4HS6B 4TSBH 1ITCA 1FAIH 4YWGH 4G7VL 4BZ1L 1AHWB 1I1CA 3EJYC 3H2WA 4OCRL 4XNQA 5KSBF 4Y4FB 2BJML 4JJ5A 4H26A 4LCUB 4N5ED 1Q9WA 1ES0B 3FFCA 43C9A 2ATKA 1NC2A 3MCLL 2B4CL 1XT5A 2OZ4A 1OAQL 5CZXC 1OP9A 1A3LL 1AJ7H 1Z6JT 4FQHA 4MXQC 3RNKB 4BH8B 2AXFA 3MRNB 5F9WB 1Q9LA 5JMRA 4PJCB 5TDOA 5CZVL 3P0YL 4ZO9A 2EKSB 1O5DT 5ILTL 3UO1H 5LQBH 4PGDB 4O5LH 5FYLH 1NGQL 4OTXL 5SWZB 3O11A 3RWEB 4J12A 3BPNC 5GGSB 4YK4C 4AIZA 1GC1H 2VLKE 4DGYH 3MRLB 4PJHB 3CX5J 2B2XL 5C07A 2ERJB 3VI3F 3TBWB 5CHNB 3FO1A 4ZAKB 1JHLH 1BFTA 4QXTA 3X11B 1AD9B 4I1NB 4LARH 4OZIE 3BEWB 4MD4A 5C0AE 5HPMB 3H6JA 3WDIA 1TQCB 4NNYA 1UKSA 4NQEB 3AS2A 5F7EH 2CK0H 5EUOE 4ZXBD 5AYUH 1ZVSB 2BK8A 1FL3B 3RUGB 3C5SA 1WIPA 5F7DB 5LGHH 4PRPB 2BDNH 3EO9L 5ACMA 2BXYA 4FXKA 3PDOB 1G9ML 3BZEA 1FFOB 2P8MA 4KJQC 4BA8A 2ADFL 1JI2A 3MZGB 3KNBA 1NBYA 3BIBX 1PKQE 5ADPH 4NQXB 4U3CA 2ZSWB 1DBBH 4YDKL 5BRZB 3AREA 1QFWM 1FDLH 3FT3B 1XCTB 3L3GA 5A3IC 1Q8MA 3BH9B 1JMXA 4JY5L 1CXKA 5HHOA 3VRJB 3FQTA 4KUZH 2GSGB 3GMMA 5INCB 4MJ4A 4PJ7F 1U8LA 5DGQA 4KTEH 4PRIE 3QB7C 4S1RH 2FEEL 3U46A 4TTDD 1HIML 3EOAB 4P2OC 3NZHL 1PYWB 3G5YB 4GMSH 4OLYH 4XX1E 1QSFA 4M93C 5IEKA 1I7RB 1MJUH 1DQTA 4LLWA 5BS0A 3KYKL 5TDPB 3MLWH 4JFDB 2P5WA 5E99H 2Q1EA 4XPFH 1ZA6A 2YPLA 2GI7A 4H20H 1EVUA 1CL7I 4QT5B 3BZDA 3V6ZA 2AW2A 3C6LB 1E4KC 2CO7B 1J7VR 1P1ZB 5J56B 3RP1A 2ICWB 3F12B 2ITDB 3ARUA 4RZCA 2EEDA 3N1GC 3DYOA 5E1AA 4G8EB 4H0GA 3UTTA 1C7TA 5K9QG 3TIDA 3QPXH 4R8WH 4YE4H 4YDIL 4YHML 2A74A 1T03L 4J4PC 4LCWB 3P11L 4U31A 3LKPB 4PY7A 3AROA 2X4SB 1BM3L 4F7MA 3MX0A 1KT2A 3MV8E 5IB3B 2WWKT 2YWYA 2GUOB 2Q6WB 4JZJC 4X7DC 3QUKA 4L8SA 4ZOAA 1YEDA 4GUPB 5FYJU 5KSUB 4X6DA 5FIEA 3R06A 4KHXL 1NBZA 2NY0C 3QJFB 2EC9U 4I3RH 1RSFA 3DX6A 4ZUVB 5GGVH 5D7LA 3D0VA 1PQZA 3DARA 3DURA 5DRXB 1MEXH 2ADJA 4NN6C 4X5WA 4M1DL 4X0KB 1UQSB 3MRMA 1RIVH 2HLAB 5D7SL 3AS0A 2EDTA 5J7CC 2NY2C 4PJ8B 2V5YA 4CDHA 3QH3B 1OARL 2BY0A 3QXDA 4WEBL 3HB3D 1QEWA 3MV8D 2VE6B 1JF5A 1SEBB 1G7IA 4OAWB 4O4YH 1YEJL 3ARED 5FDWA 4EN3C 2W65B 4N8PA 1DQQA 1BZ9A 4JFFA 1KEGL 4NQDB 4Y4HA 4M4PA 5HHOD 3UPAA 3WN5C 4P49A 5JR1L 3VXTA 3UTTE 5AZ2L 4D2NA 1NGZA 3HRZA 4GRLC 5DVOA 5D1QA 3WLWC 4U6HA 4FQQA 4P9HL 3BWAA 4MNQB 3S5LB 1CLZH 1MF2L 4YBHA 4JO4L 4NKIL 3WSQH 3WKML 4XWOC 4KQ4H 1MRDL 2P5WD 4ZS7H 5IESH 4MJ2A 1D9KD 1BQLH 5GS2H 1NCNA 3QRFM 3Q3GA 2HN7A 4NFDA 3O6FA 1T20A 4IHOB 4O2FA 1NGPL 4KQ3H 5E6ZA 3PHQA 3UTTD 2CLRA 4HX1A 4UNVA 4X4XA 1ADQH 4P2RA 2AGJH 5IR1B 2HJLA 4FXLA 5MI0B 1NGWA 3U79A 3VE0B 1W72L 1WT5A 3VG0H 5D9SB 4D3CL 1LO0H 1NBVL 4GAJL 4MXVF 1XR9A 1JPST 4Z7VF 1SMAA 3A6BL 5JW4R 3D2UD 2VISB 4P0DA 2ENYA 4YHPB 3EO1B 1MJ7L 5FUOH 4JKPH 4ETYA 1TJIL 3RWJB 3MXVH 3VA6A 2GQHA 5E6IC 1ZANL 4BSWA 5DD0H 5HGAB 2FR4B 1TITA 4OI7A 1L7IL 2N4IA 1MCPH 3GSWA 1Z5LA 5IBUB 1X4XA 5D7LD 1KFAH 4PJ7B 2IFFL 3MLRH 4PRHE 4GG6E 4MWFA 4UBDC 2EYRA 1B0GB 1A7QH 4LLDB 3THML 4HKJA 2HT3D 3QA3A 4WUKL 3BDBA 2DQUL 4I3SL 3FB6B 3W9EA 2XY1A 5FM4A 5BZDA 1FN4A 4UT7L 5CBEA 3KYMB 1D7FA 1G9NH 4N8VA 1NAML 3S88H 4YHYB 5C70A 3MODH 4TUKH 4BZ2H 1FO0L 4JFFD 4M43H 2VITB 5EOTB 4Y4HD 3T09A 2GKIA 1A6TB 2OXGA 1CLYL 3PL6B 3HI6H 5IMMB 3TVMB 2VMFA 2APFA 5F96H 5B21A 3WHXA 4B50A 2NY3C 3LKNB 4HWUA 1Q0XL 4OLXH 1EO5A 3HUJB 3QNXA 1EMTL 3ECBA 1YEFH 1P7QB 5D1QD 1A4KB 3M17B 5LKNA 1JPSL 1CIDA 2NXYB 5EU6B 4MAYB 4RMQA 2V2XB 1KYOJ 2AEQH 5C0BB 3MCKB 3TN0C 3LS5H 1T66D 5B3NA 5I1CL 3H3PL 3HAEG 4N9GA 1O7VA 2X4PA 3W0WB 4M48H 4G8FB 1N64H 1IKNA 2BVQB 1C5BL 1FV1B 5DFVC 3VXOA 3CAFA 3CVHA 1VADB 3R8BB 3I75B 3TIEA 2Z8VC 5B38G 4LP5A 2QBWA 3QEQE 2HWZH 4TSBL 1FAIL 1WF5A 1QG3A 4YWGL 3SCMC 5HI5C 3ZDXF 4BQ8A 4GBXD 4Q9RH 5EO9B 3I3BA 1CGUA 4E41E 1QFPA 3F58H 1EJOH 4PLKC 2C4FU 1J0KA 4G3YH 4NKOA 4LNVA 1G9MC 4XNYH 4MVBD 2YUWA 3EYQD 3M8OH 1TZGH 2KKQA 5FM5O 4XT1C 2PXYC 3M07A 5FK9A 3WIHH 2DQDH 1F3DH 1AJ7L 3RAJH 3IFLH 1AGEA 1S9WB 4ODBD 4Y2OA 3QXUA 3OKKA 4HQQH 3V6OC 5IJVB 3MGOA 2JJWA 4MSWB 3UO1L 5LQBL 4QCIB 4FQPA 3P73A 2HT4D 4MA3A 1M1SA 4O5LL 3SKJH 3TT3H 5FYLL 1KCKA 2VH5L 3KPLA 4E41D 1N0LA 2CDFB 2P8PB 3LSOA 3FCTB 4PJXE 5IP4A 1GC1L 4DGYL 4F7CA 4HUVB 3EJYD 5E9DE 3RPKA 4RX4D 5ANMB 3KYAA 1JHLL 4B41A 4RMVA 5K9OA 1Q94A 2AV1B 4LARL 1KELH 5B8CC 3PHOB 3GMLA 1E4KA 2P43B 2BERA 3RGVC 1HNFA 1A6AA 5EIIB 3WUZA 4ZQKB 1IEAA 1G6RA 3I6GA 4K94C 1MVUB 2J5LB 8FABA 4L1HA 3S37X 5F7EL 2CK0L 2R29H 5CZXD 5AYUL 1CDGA 4MXQD 4LFHD 1FG2A 2AV7A 2UWEF 5LGHL 2R2EB 2BDNL 4BM7A 4PJ5A 3RKPA 1IMHC 3BZ4A 3TBYA 3EBAA 5J13C 3WO3B 3U0WH 3LN4A 5J12B 1LE5B 5EN2A 4JDVA 5I18H 5EFIB 3JTTA 1H3TA 1BVLB 1XGRA 3F8UB 3FQRB 5ADPL 3H3BC 4RNRA 3VG9B 1KACB 1DBBL 3OKLB 1FDLL 4HFWB 1JYWA 1RULH 4ZSOE 2VZSA 3Q5YA 3TZVC 1U3HA 3TO2B 1VEMA 5FGRA 5GS0C 2ZOLB 2XG4A 4KUZL 4WFGE 4XXDA 1UXWB 4X6EA 1VFBB 5I8CB 2DJUA 4OZIB 4X6DF 4KTEL 1V3LA 4DKAA 1KTLB 4S1RL 3ZDYF 1R3HA 4HUXB 5ISZA 1D5ZB 4G6MH 5IQ9B 4GMSL 4OLYL 4DVBA 2Y7QB 5JHLH 1RU9H 4JVPA 3P9MB 5EUOB 4D0BA 1MJUL 5KVFH 4HIJA 5CMAB 3STBA 2VXTH 3V5KA 3MLWL 4PBVC 5E99L 4JLRA 4H20L 2UVEA 3CDGA 1U0QA 4U1NA 4XPFL 3PDDA 1NGYA 4L4VA 1T5WA 2VN4A 4KJQD 1CXLA 1P53A 3U4BH 4XP5H 4XNQB 5KG9A 2BNQA 4JJ5B 4EN3A 2A6KA 4H26B 2E27H 3VXME 3OB0H 3SE8H 5A3ID 1RMFH 1X5AA 4X7SH 4G9FA 1Q9WB 1Y6NR 2X1OA 3QPXL 1ERNA 43C9B 2XQYK 5IB1A 4KRMB 1NC2B 3WN5A 3AMKA 4LSVH 4IMLA 4R8WL 4YE4L 4FQHB 1A2YA 2AXFB 4JDZB 5E5RB 1CQYA 4OIAA 5LG1A 4AZ8A 4PJ5E 3UTZA 1Z3GH 4P2OD 4XVTH 3ULUE 5TDOB 2CUIA 1JP5A 4RGMC 2PTUA 4I9WE 3BW9A 5I16A 4YZFF 4MNGE 1A6ZA 2IADA 5F6HJ 3O11B 5FXCH 1ROWA 3SOBH 4AIZB 3BFOA 1YC8A 3NBNA 1AKJA 2ZKHH 4I3RL 2YD5A 5GGVL 3OX8A 3FO1B 2JJSA 2Y06H 4QXTB 5KZCD 1MEXL 1MOEA 3WO4C 2DKUA 3DUHA 1RIVL 1ZOXA 1F3DJ 4PJ5D 5EUKA 2BNRA 1PG7H 4FQJH 5F7LB 4J4PD 5DJ8A 3C5SB 1SHMA 1CFNA 3UDWA 4KI1A 4NBYB 2BOCA 4O4YL 3KYOB 5DFTA 4FFZH 2QJDA 4L4VE 3BZEB 4KZDH 1IILE 2P8MB 1H0DA 1NBYB 1OAXH 1AY1H 2DM3A 4JZOA 2ZPKH 2ADIA 3AREB 2MWCA 1QFWI 4J3UA 4PB9H 4OLVH 2JCCA 3SGDI 4R97C 3LDBC 2FBJH 1MHEA 5DR5H 3L3GB 3ROLA 2NY0D 4G9FE 5I1KH 3GM0A 5HHOB 4XC3H 3FQTB 4PLJC 1RPQA 1BHGA 3C8DA 2V9RA 4Z77A 3GMMB 1U8LB 4PJEA 5HBBA 1CLZL 3WSQL 3U46B 4KQ4L 4RDQF 2NY2D 4ZS7L 3MQIA 1QSEA 2VB5A 5IESL 2VDMH 2YZ8A 5IEKB 4L4VD 1BQLL 4LLWB 4U1MA 5BS0B 1AR1C 3O2VH 1EEYA 5FYKD 4Y8DC 4XCEA 2DTSA 2P5WB 5IEHA 2A6IA 1ZA6B 2YPLB 4EN3D 2HMIC 5ENWB 4KQ3L 4M7LH 5BJTA 1HKFA 4EKXA 1IGTA 3BI9X 4PV8B 4G9FD 5CS7A 3RZCC 1WTLA 2DMBA 4FABH 1ADQL 2AGJL 3LRSA 1BZ7A 4KDVA 4NO2B 4O58H 4RZCB 1LO0L 1W0VA 3MR9A 4OZGE 2PW1B 5E1AB 3QUZC 4R9HA 3UTTB 3VCLA 4OV5B 2C7UA 4EI5A 5IVXA 4GRLD 2RFXA 3WLWD 3A6OA 1U8HA 5DHVA 5ACLA 1LO3H 2I07A 1WISA 5FUOL 2P44B 4JKPL 2MMXA 3MV11 3WXWH 4XWOD 2H6PA 3MXVL 3TN0A 4BH7A 1KEMH 5HY9A 5DD0L 4OSUH 1MY5A 1MCPL 4F7MB 2P46B 1KT2B 1NKOA 1AKJD 2X42A 3BOVA 3EKCA 1NCTA 2XYCA 1KFAL 1RIHH 1ZWIA 2OTWA 3G04A 3MLRL 1YEDB 3QUKB 4L8SB 4X6DB 2JCCE 3R06B 1OSZA 3TBVA 1A6WH 1A7QL 3DX6B 5BW7C 5D7LB 4BYHA 3D0VB 4HIXH 1PQZB 2BNRD 3DURB 1R0AH 2ADJB 4FXGA 3U9UA 1EK3A 3OKEB 4X5WB 4Z0XA 4NCDA 1S9YA 5D2NC 1AO7A 1HH9A 3MRMB 4LLQA 1G9NL 3D9AH 1ORQA 1HHHB 3S88L 2PXYA 4KJYA 2WLZA 3MODL 3QXDB 4TUKL 4BZ2L 2IMMA 3HZMA 4XNZC 1F6FB 4M43L 3RU8H 3S7GA 3UJTH 1T6WA 1PY9A 1R5IA 5CWSA 3HI6L 5E6ID 5ABDE 1DR9A 5FDWB 3CU7A 3L5JA 5F96L 3SDYH 1UC6A 1DQQB 1DN0A 3V6OA 4OLXL 4JFFB 4RGNC 4Y4HB 4PJFF 3GJFA 5HDBE 5BV7B 1YEFL 1MFCH 4JFOA 5DD5H 1PKOA 1XGQA 3VGBA 4ZFGH 3PWPA 3H7BA 2Z92B 4UBDD 3VXTB 3IXTA 1NUNB 1C8PA 1GPOH 5DMJB 3VFSA 1NGZB 2GCYA 2I9LA 3LS5L 4NWUH 5D1QB 4BK4A 4U6HB 3WLBA 3BWAB 2O5YH 4MLSA 4M48L 1MCLA 1N64L 2DQTH 3K80A 4QRPA 5B8CA 1H3UA 1F8TH 5C0FA 1IAIM 2H9GA 5EU4A 2HA1A 1QFUH 2D7QA 2YPKB 3ARFA 4M9PA 1X5KA 1EHXA 2HWZL 2HN7B 4G80A 1T20B 4YXKH 4MGXA 4Q9RL 3NIDF 2VAAA 2NY3D 2FEDC 4AMKH 3PHQB 3IJSA 3F58L 1EJOL 2CLRB 1AGDA 4G3YL 4HX1B 2K7PA 4X4XB 2UUDK 4P2RB 1S7TA 4XNYL 4GBXB 3M8OL 4NOBA 1NGWB 1TZGL 4UNTA 1XR9B 3S4SG 3WIHL 2QLVB 2DQDL 3MA7A 1PSKH 3RAJL 2WWMC 3TN0D 2M1KA 1JNHA 3IFLL 1EIBA 4HQQL 2FB4H 2FJFA 1I8MA 3LD8C 3JWOH 5DFVD 3D85D 5HDQH 4BSWB 5I2IA 5JIHA 3SKJL 3TT3L 1VHPA 4PIRF 3GSWB 4IS6B 1UWXH 4HPYH 1GGTA 1Z5LB 2X9XA 3B4NA 5JPNA 1W8NA 5HI5D 3SCMD 5FAAA 2H32A 3SE9H 2X09A 4KDTA 3PWPE 1QVOA 4MWFB 1HNGA 3WDHA 2EYRB 1B6DA 1MI5A 4PLKD 1KELL 4HKJB 1B0WA 2NXZC 3TJEH 2PXYD 3W9EB 1N8ZA 4X9HA 1FC2D 1FN4B 1BJ8A 3LY6A 4DW2H 1J9CT 2R29L 3ARWA 3W9DA 4KVNH 1T7YA 2BNUA 4WO4C 4N8VB 3U0WL 3U9PH 4ODHH 2DKSA 5I18L 3IDJA 3VD3A 5C2BH 2PTVA 4Y2DA 1NCDH 4EUPA 1E6JH 2IC2A 3O81A 3PWPD 4J3OC 4R2GC 5BOPA 2X4RA 2X89A 3JTSA 3OKNB 3BJLA 1RULL 3QNXB 3QO1A 3ECBB 4NM8H 1QACA 3EHBC 5IVZB 4HG4K 3B6SA 3KPQA 3BPNB 4YK4B 2D4DA 4QRPD 4MD5A 1TJGH 2LQRA 1J05A 3RGVD 1QUNA 4OZFH 1DCLA 1ZT1A 4G6ML 4N9GB 5CGYC 1IEBA 4QXWA 1T2JA 2X4PB 3RA7H 4UINH 5JHLL 1RU9L 1QR4A 3VXOB 2YR3A 4RBPH 5F70A 5KVFL 3CVHB 2BVTA 1H8NA 2VXTL 4K9EH 2IH1A 5EU5A 4IOIA 5I1AA 4JKWA 4LLYA 4CVZB 1MCWW 4U33A 1M05A 1H5BC 1W72A 4Y1AE 3U4BL 1GSMA 3OAZK 4XP5L 2DL9A 4HIIA 2E27L 1GHFH 3SE8L 1QYGH 2XT1B 1RMFL 3TZVD 1WBZA 1P7KA 4X7SL 1AR2A 4IJ3B 4N90E 3VWKA 3BESR 1X6LA 4U05A 5FK9B 2A77H 2DIBA 4PJBA 4LSVL 5GS0D 5IFAH 2ADGA 1M7DA 2R4SH 7FABH 4P2QA 2R9HC 2ZCLH 1AGEB 5D7IF 5CP3A 4XVTL 3OKKB 1E6OH 2LV4A 1EAJA 3MGOB 2NY7H 4UQ2A 5DMYA 2ZUXA 2IPUG 4JRXE 3AAZA 1AXIB 1WJ3A 1E28A 1J0IA 1DUZA 3P73B 4PJEF 3UPRA 4Y1AD 3UROR 3KPLB 2AP2A 2KQNA 3SOBL 1A02N 4ZFFA 1O7SA 3E2HB 2W9DH 4F7CB 2NR6C 4M7LT 4NKQB 2ZKHL 4GSDH 1OP5K 1HHIA 1KPVA 5JXEA 4N90D 2Y06L 1PBYA 4PGEB 1NCCH 2IBZX 3FQXB 5K9OB 1KENH 1Q94B 2D0HA 4YDVA 4PG9A 3K4ZA 1NAMA 5GGRY 3GMLB 4PJDA 4AYFA 2OL3A 3RZCA 1A6AB 4XH2A 1IEAB 5CEZH 1FO0A 1G6RB 2LU3A 3I6GB 5KZCB 1PG7L 2VZVA 8FABB 4FQJL 5BXFA 4NN5C 2DLTA 4JM4H 1FG2B 1H3PH 1EDQA 1JI1A 1BQHB 4PJ5B 2JIXA 2DIJA 3BZ4B 3TBYB 4I5BA 2X89D 5IVXF 3LN4B 4UOW1 5EN2B 4FFZL 3JTTB 4KZDL 1XGRB 5DK3A 1OAXL 5DUBA 3BE1H 1AY1L 4O9HH 4RNRB 1EGJH 3IDUA 2ZPKL 5E24E 1CL7H 2BVPA 1ZVHA 4PB9L 1DQJA 2FBJL 5DR5L 1AP2B 2VYRE 1TTFA 1T0NA 5I1KL 4JZJB 5EPMA 4PTTA 2Y72A 4XC3L 1HXMA 4XXDB 1CE6A 1PY4A 2YZ1A 2MKLC 3ZSSA 3P2TA 2NY0B 3ZHDA 1R3HB 5BW7A 5ISZB 4D9QD 4XB8A 3HG1E 4IMKA 4Q9CA 2VDML 4NN6B 2RCSH 1IC4H 1KIPA 2EE3A 5D2NA 3RWCA 5BMFH 4HIJB 3O2VL 3V5KB 2YRPA 3MRBA 2NY2B 2W0KA 3PXHA 4JLRB 4LEOA 3CDGB 1EAPA 3QBTB 4M7LL 2EE9A 1MRFH 1J10A 1G9NC 1NGYB 3MGAA 2OJZH 4L4VB 1T5WB 1F4WH 3T2PA 4FABL 2YRLA 3VA2C 5FGBC 2BX5A 5KG9B 2BNQB 1CDUA 3ULVC 1IARB 4EN3B 4O58L 2A6KB 4LPVA 3MNVA 1XIWC 4P2QD 3S3PA 1L4IA 4F7EB 5DD3H 3LN9A 3IF1A 4G9FB 4Z7WA 1CFVH 2ICEA 1U8IA 3WN5B 4PLJD 3G6DH 1LDPH 1LO3L 2GK0A 2ID5A 4LQ1A 1A2YB 1GGBH 1BOGA 4KROC 2CSPA 3WXWL 2JJTA 3UTZB 4AL8H 4GRLB 1XMWA 1KEML 1M7XA 1RJLA 2J8UE 3NCMA 4WI2A 4OSUL 1QFOA 2AKRA 5I16B 1A6ZB 2IADB 4EI6B 4QXGH 1AR1D 1RIHL 2HMID 4H0HB 1JN6A 1XF1A 4WHDA 1A6WL 1AKJB 3RZCD 1TZHA 4HIXL 3WNPA 2IEPA 1SBBA 3PWLB 1R0AL 2IAMC 3EYFB 4WU5A 3OAUH 3QUZD 4DFIA 1U42A 2JIXD 3P40A 5EUKB 3D9AL 4UMGA 2BNRB 4Z7UE 5KOVC 3HZKA 2GTZA 3RU8L 2R0ZH 1JZ7A 3RBGA 3UJTL 1CFNB 1AC0A 2BOCB 1ZGLP 3SDYL 3AM8C 1I7ZB 3MJ8B 4UUJA 3V8OA 4JZOB 4YGAB 5E6IB 1MFCL 2I5YH 5DD5L 2DM7A 5HTSA 5CD5C 2JCCB 4ZFGL 3VXRE 1J11A 1UENA 1OAZH 3ROLB 1HYSC 4XP4H 1GPOL 3CFCH 4LRNH 4XHQA 4KK8C 1K85A 3L7EA 4G6AC 4NWUL 3IU3A 3RL2A 1F4HA 5EIVA 5SV4A 2O5YL 4PJEB 5DUPH 1HSBA 1DQLH 1GAFH 1ZT4A 3DV6A 4QYOA 2DQTL 1OGTA 1F8TL 3L6FB 4WY7H 1MCNA 4MX7A 1U9KA 1QFUL 3VGHA 4D9RE 4PGCA 3JV4B 5C0CA 4U1MB 1UWGH 4GRWF 3MUGA 1EEYB 4WO4A 4YXKL 2A6IB 2FRGP 1XF3A 1VACA 3CMGA 3L3OA 3EOBA 4AMKL 2IH3B 4RGND 2C1PA 1IGTB 4DGIH 4HLJA 4PR5A 2NY1B 4N0UE 1R5VA 3LRSB 1BZ7B 2PCPA 1TTUA 4X5XA 3OKYA 1W0VB 4KZEH 1ZLWK 3JV0A 5BVPH 5FYLD 2C7UB 4J8RA 1CD0A 1PSKL 1U95A 5GPRA 3BD5A 3UBXA 3H0TA 4X4ME 1OF2B 3MROA 1YMME 2I9TA 5DHVB 5EZJA 1VCAA 2I07B 2FB4L 5HVFB 5HYFA 4D9RD 1S78C 3JWOL 2H6PB 3CMOH 3TN0B 4BH7B 5I1IH 5HDQL 5HY9B 4U6TA 5T33H 2YHGA 4HPYL 3DYMA 4MQSB 3VXUE 1ZWIB 1I7UB 2OTWB 3D85B 3G04B 3SE9L 5HJ3A 1OSZB 1L0QA 3TBVB 3LQMA 2FEDD 1MWAH 3QDHA 4BQCA 3BRGC 3NCJH 3ZKNC 8CGTA 3SCMB 5D5MA 4N9OB 6CGTA 1QBAA 1H5BA 4V2CB 1ZSDA 3TJEL 1P4LA 4FXGB 1YMMD 3U9UB 4Z0XB 1IAOA 1S9YB 2QQQA 1AO7B 1MCHA 4L29A 4DW2L 1HH9B 4LLQB 5HYSG 4HKXA 4KVNL 2WWMD 1ORQB 2PXYB 5L0QC 4KJYB 1QR1A 3O4LA 1G0XA 4CUCA 3HZMB 5CD3A 2H3NB 5IWLC 2VLME 3U9PL 4ODHL 1Z2KA 1R5IB 2OMBA 5CWSB 4PJBF 5C2BL 1ZS8A 1NLDH 3AGVA 1NCDL 2FNBA 2HFGH 3UTSE 4CRPA 1E6JL 5C0GA 1DN0B 3BIKA 1FHGA 5EIQA 5KAQF 4U1JA 4NM8L 1EERB 4DK3A 4W81A 4JFOB 1XGQB 3BPLB 3BDXA 4PS4H 3PWPB 3H7BB 1TVHA 1J0HA 3IXTB 4M61A 2COQA 2OBGA 3VFSB 5FOJA 2V5TA 1PX3A 1TJGL 4F33A 2I9LB 2NXZD 1S9VA 3CIQA 3FO9A 3WLBB 5IIEB 1IE5A 3RA7L 4UINL 5C0CD 1J0YA 4QRPB 5B8CB 4WO4D 3WMSA 3T3ME 2EDHA 5C0FB 3RGVB 2GY5A 5LGKA 3UTSD 1W0YT 2H9GB 5EU4B 5I8KH 1IAII 4PJDF 4K9EL 2APXA 3RX5A 1K8DA 2UWEE 1ADQA 1JPFA 2QHLA 3MUY1 1TQBC 1FNGA 5TH2A 3DUSA 3QFDA 3IDNB 2V7HB 5F7MC 1UH2A 4WV1C 4YXHH 4R2GD 3IJSB 3O8XA 5J13B 1AGDB 4P3CH 1GHFL 4RQQA 2VERN 1QYGL 1S7TB 1CFBA 3EHBD 1OQXA 4NQSA 1A1NA 3I6KA 4MMXC 3H9YA 2A77L 3QDJA 5DVNA 5IFAL 5DI8A 5FO9A 2R4SL 7FABL 4OI8A 2NZIA 5KS9A 2ZCLL 4I4WA 1JNHB 3TZVB 4RGOH 2C3WA 1MCFA 1P7HL 3K2UH 1UZ8A 5CGYD 3TYGH 1E6OL 2FJFB 1I8MB 4UTBH 1IRAY 2NY7L 3CFEA 3H7LA 5DD6B 2FIRT 3GI8H 5I2IB 2D03H 4KTDH 1R3KA 5GRUH 4EOWH 5JPNB 4YC2C 5GGTH 4HCRH 2W9DL 1VPOH 4OCYH 2X7LB 2H32B 4HJJH 2H45A 5EBLA 3BKYH 1CXIA 1JMZA 4GSDL 1QVOB 2X70A 2IG2H 1U8NA 1NCCL 3JV6A 1A6VH 1MI5B 1KENL 3MRCA 4M5YH 32C2A 1WSST 3MRPA 5DK0A 2QQKL 1P4BH 5EZLA 5CEZL 5FGBA 1N8ZB 1RFDH 5CKAA 1XIWA 1I3VA 1KPUA 2R9HD 4H1LB 4CNIA 4JM4L 3BEVA 1H15A 1H3PL 2BNUB 5ELIA 1BFVH 4TNWF 1G7MA 1S7SA 4M6AA 5DJYA 4TSCH 4JRYE 2FGZA 3EYSH 3IDJB 4G6JH 1URLA 2P5EA 3B9KA 4EUPB 4JY6A 2ESVE 1D6VH 5CEXA 3BE1L 4O9HL 1EGJL 5DMKA 4UT9H 1CL7L 4K71C 3C60C 3DROA 3OAYH 4WDIA 2FH8A 4MJ6A 4NKDA 4RGMB 3V8CA 2F19H 3IU4H 2NR6D 4ZUWA 2ZUYA 3JSSA 4TVPE 3LRHA 5GS2D 3VI4F 3MRJA 3B6SB 5K9JH 3QT2A 1YQVH 1A7BA 4MD5B 5T3XH 1KV3A 1J05B 1IEBB 1K3ZA 4H8WC 2A38A 2W91A 2IAMA 4YEEA 3P0GB 2RCSL 4JRYD 1IC4L 3RHWF 3G6JA 4YUEH 4GS7C 5BMFL 1RY7B 2ESVD 4P57B 4RMTA 5FFLA 2IH1B 1RJCA 5EU5B 1XF5A 1T21A 2G2RA 5FA4A 1I9JH 5I1AB 1MRFL 3EZJB 5D4QA 4LLYB 2OJZL 1F4WL 3IDIA 1W72B 1TTGA 4JFEA 2PO6C 3KLSA 2Z4QB 4HIIB 3QDJD 3WIHA 3LHPH 3U30C 3O41A 5DD3L 3PWUA 5HVHC 3AM8A 1P7KB 3VWKB 5ITBH 1CFVL 3LEYH 3L9RB 3ULVE 4KV5E 4PJBB 4QOKA 2ADGB 1HEZA 1M7DB 4XPAH 4UTAH 3G6DL 1LDPL 3LDBB 4P2QB 4R97B 1GGBL 3V4PH 1JYNA 4OLZH 2DQEH 4U6XA 4AL8L 2OR7A 3BJ91 3SDCC 3ZE1F 1VENA 1EBPA 2QADB 3OXSB 4YFDB 3AAZB 5DHXB 2D7OA 4N0FA 5IB5A 1R5WA 3IS0X 3WUWG 1E28B 1DUZB 1IGFH 4QXGL 4PJIE 4P4KC 3UPRB 1BFSA 1UZ6E 3WKNA 3ZKXB 4ZO6A 1LDSA 1M4KA 4ZFFB 1FYTE 2FIKA 1NUDA 1KPVB 3U83A 1VDGA 1T7VA 3ES6A 4R90H 3ULVD 3RVUC 2AEPH 3SGDH 3SGKC 1HXYA 1XIWD 4LK4A 4YDVB 4PG9B 2EIZA 2EIDA 4ZDHA 2CDGA 3SJVA 1NAMB 4WENB 4PJDB 3OAUL 3TP4A 4ELMA 2OL3B 3RZCB 4XH2B 3BAEH 1FO0B 1EO7A 5BXFB 1A21A 3N1FC 1Z0MA 2R0ZL 1JGEA 1VFUA 4KROD 2ITCA 4CMMA 5DF0A 2JIXB 1EV2E 4JFYA 2XTJC 1GGYA 3W82A 3LPFA 5DUBB 3UTOA 3QUMA 4M3JA 3LKQA 2I5YL 2BVPB 4UDUA 2Q76A 3L1OH 5CP7A 1NFIA 1DQJB 1OAZL 4XP4L 3CFCL 4KKLC 4LRNL 3P4NB 5EPMB 4PTTB 4QHLA 5CJXC 1HXMB 4JPKH 3JUZA 2PYFA 1CE6B 2IAMD 3O3DA 5DUPL 3T04D 1DQLL 1GAFL 1AI1H 1UKTA 3ZTJG 1KJ3H 4WY7L 1RZKH 3DHJA 4Z7UB 1ED3A 1RV6X 2CXKA 4WWKC 5D5MF 5B22A 3UJIH 3U2SA 4D94A 1KIPB 5D2NB 1BIHA 5EC1A 3RWCB 1XAUA 1YNTA 1UWGL 1UYWH 3VFRB 3MRBB 4LEOB 2EDOA 3WS6C 3CXHJ 4LSUH 3D25A 2UV3A 4QOKD 4WRLA 5CD5D 3MNVB 2DQJH 1HYSD 4PJFE 4KZEL 1BBJA 3IF1B 5M94B 4RGNB 1YDPA 4DCQA 4CVXA 5BVPL 4Z7WB 4KK8D 1TZIA 1LMKA 1U8IB 3MRKA 4G6AD 4TNVF 2Z93B 4OD1H 4QTHA 5FYJE 2GK0B 3FZUC 3I6LD 3P9LA 5C0IA 4OUOA 1BOGB 2DBJA 2ZCHH 5C0EB 3CMOL 3AB0C 1FFPA 5I1IL 1RJLB 5T33L 1UACH 5BO1H 2GY7B 3F7RA 1TNMA 3MJ9H 3PQYE 4JRWA 3IKCA 1JN6B 2M2DA 4I0PC 4OBSA 2FJHA 1MWAL 1U36A 5HHPB 3CJJA 1TZHB 3HAEA 4K9EC 2YMXH 4BK5A 2VOTA 4P2CG 3QCTH 1L9MA 4MJIA 4HGWA 4WU5B 4M9OA 1FCGA 1TETH 3C5JB 1RIUH 2AJ3A 4NP4L 5HHQA 1YMMB 3HZKB 2GTZB 5IM7A 1WAAA 1S78D 4LSSH 5JA9A 3PQYD 1NLDL 2HFGL 1CIUA 5KS9F 1XGPA 3LD8B 1YMHA 4UUJB 4C55A 5E4EC 1Y0LB 3L5WA 4LASH 4PS4L 3UJJH 3VXNA 2IPTH 4CKVX 2QHRH 4OIIH 5C0NC 4J3WA 2UYLA 2QSQA 2DAVA 3ZKND 4FG6C 1QNZH 4HXAH 3L5IA 3IU3B 3RL2B 4M4RA 2O93L 5I73C 5J57B 5DK2A 4JO2H 1HSBB 1ZT4B 3DV6B 3BH8B 1MFDH 4PBWD 4LRIC 5L8KB 1LK2A 4MX7B 3WNKA 5I8KL 4Y4KA 1QRNA 4PGCB 4OFPA 5C0CB 3MUGB 4UB0H 4UNUA 1PFCA 4WO4B 4HH9B 1XF3B 1VACB 3L3OB 4QRRA 1QOKA 1ZK9A 4YXHL 4G8GE 1EZVY 2C1PB 1I3GH 4NWTH 1XFPA 4P3CL 1W0WA 5L8LB 3E3QC 1R5VB 2GFBB 3J8F7 3DLQR 2PCPB 4X5XB 4R2GB 3T0BA 4LSDA 3WNOA 4J8RB 1U95B 3UBXB 3H0TB 4RGOL 3MROB 4J6RH 3K2UL 5CUSH 3TYGL 2OS7A 4U1HB 5L2KA 4UTBL 5JOFB 2FX7H 4HXBH 3GI8L 2YA0A 2D03L 4KTDL 3NCCB 2QKIA 4LHQB 4OIBA 4P9MH 4Z7OE 1NCUA 5GRUL 3HE6C 1UJ3A 4QRSA 1DUYA 5GGTL 4HCRL 1VPOL 4OCYL 4HJJL 3OR6B 3V7AG 3WDJA 2NLJB 3BKYL 1X7QA 5HJ3B 3GSNH 4NQTA 1HDMA 3NA4A 3VFVA 2IG2L 4W70A 5EA0H 2CIKB 2OP4H 1A6VL 4FN0A 4M5YL 2QR0A 3TGXA 4DZBA 5SX4I 1H5BB 1FLTX 5I17A 2MQCA 3U6RA 1P4LB 1P4BL 1IAOB 1U41A 4L29B 3SKMA 1S5IH 3LKSA 1A22B 4HKXB 1JNJA 1BFVL 3D6GA 2V5RA 4QRQA 1T7ZA 3RTQC 1QR1B 1F3RB 1QRNE 4TSCL 5CD3B 3OWEA 4HLZG 3EYSL 4GW5A 4G6JL 1ZS8B 4XVUC 5D7IE 4GKSA 4CBPA 1D6VL 2ZNXA 3GZKA 1QLFA 4UT9L 3RWIA 3BIKB 4QHMA 3SDCA 1A14H 3OJDA 3UZVB 2F19L 2BVUA 1ZLUH 3IU4L 3RVTC 4P4KA 1BEYH 2Z8SA 4WTZG 1JIBA 1TVHB 1I1AC 2YPVH 5I71B 2KDGA 4M61B 5GRVK 2OSLA 5K9JL 2OTUA 4CN4A 1YQVL 1WFTA 1MAMH 3OMZA 3MNZA 3ARDC 4ZO8A 5D6CA 5T3XL 4F33B 3VFTA 1CK0H 3FFDA 4ZPTA 5J89A 1S9VB 3QISA 4WCYH 1IBGH 3QZWG 2E9WA 1QRND 4OM1H 4N68A 4YUEL 2YUXA 4FNLH 3E1F1 4QRRD 3MUHL 4ELMF 4JZNA 1K8DB 1I9JL 1JPFB 1Q9KA 4NN5B 2BHZA 1FNGB 5TH2B 4EZMA 4Z78A 5C7XH 2RQ8A 3O8XB 3C60D 3LHPL 1Y18A 1CDBA 1FVCA 5FCUH 4RQQB 1I8KA 1NMAH 3HMWH 4Y16C 3P0VH 5D6DC 1Z0NA 1A1NB 5ITBL 3I6KB 3LEYL 1MVFA 3QDJB 2C5DC 2BVYA 2F54E 5DI8B 3V7MA 2VZTA 5FO9B 5L2KD 1EHLH 4XPAL 1P4IH 4UTAL 4HWNA 2AQ3A 2P42B 2X1XR 5KS9B 4OM0H 4I4WB 3V4PL 4OLZL 5C8JA 2YA1A 2DQEL 5DHYA 5IHZB 3S35H 5HPOA 1UZ8B 1PAMA 5DTFA 1RZ8A 5F72S 5JTWA 3CFEB 4MMZC 3FOMA 5JUEH 5AAWA 2DF3A 3L7FA 5I8OH 1MUJA 1T83C 1IGFL 1Z9SA 4F2MA 2BY1A 3OGCA 4WWKA 4XCYA 5IGXH 3UYRH 1FNAA 5EBLB 1X4ZA 1JWSA 5C71A 4Q0XH 2PO6D 1U8NB 4R90L 3JV6B 2RR3A 2AEPL 2F54D 1GVIA 3MRCB 32C2B 2VTFA 2VWEE 1ORSA 5DK0B 3QO0A 1GGCH 2EXWC 5FM8A 5EZLB 3CSGA 3IDYC 1V5JA 5IF0B 1C08A 1FZOA 1XIWB 4CNIB 1KPUB 3ARGA 1H15B 1XF2B 3MYJB 4UQ3A 4EXPX 3PWJA 1G7MB 5DJYB 2J3SA 1KCRH 3SDCD 3F6LA 5F44A 3GSRA 4XP9H 2IALA 2P5EB 3KDMA 1LWRA 5CEXB 4P4KD 4PJIB 5DMKB 3GJFK 4TVSa 2XTJE 3DROB 3I3EA 4WDIB 4MJ6B 3L1OL 3ZT5A 3G5XA 4NKDB 4XNMB 1Q0YH 4U6YA 4EBQH 5BV7H 1T89C 2F58H 4ZUWB 1CICC 3ZLQC 1ETZB 2XQYG 3MRJB 4JPKL 3RVUD 2I27N 4XNUH 4I0PA 5TDNA 4K3GA 1AI1L 2DQCH 4J3SA 1KJ3L 2DWDA 1RZKL 3KWWA 4YIQA 2IAMB 4ZUSA 3UJIL 3G6JB 1NFDA 3DVGB 3MGTA 1I8LA 1S3KH 1UYWL 3WJLA 3V5HB 2MQ0A 1SVZA 1VFOA 1XF5B 1T21B 2G2RB 2XTJD 1UCTA 1PJ9A 4LSUL 4YHKH 4HH8A 3IDIB 3QDAA 4R7NA 4JFEB 1WAAF 3L3KA 1CXEA 2ZG2A 2HRLA 2CUMA 2DQJL 5A1AA 3O41B 4QNPE 1CZ8H 2I24N 3PWUB 5TF1H 2O5ZL 4KKLD 1WFNA 3NN8A 1Q1JH 3KLHC 1FNFA 4QOKB 4OD1L 1HEZB 1JZ3A 2APVA 4OZHE 2ZCHL 4U6XB 1CLOH 2W59A 1HOCB 4WWKD 4Z6AT 5SX5H 1B0RA 1UACL 5BO1L 1PW3A 4NQCE 4N0FB 5IB5B 1R5WB 3FRPG 3ALXA 4U0RC 4LRIA 3MJ9L 2MKWA 4JREC 4X8XA 1A5FH 2APBA 1SJEA 4LHUA 1A8JH 5D96C 4GRWE 3HE7C 1MPAH 4G7YH 4MCZA 2FIKB 5I76A 3FAXA 1KXQE 2XICA 1C16A 5LCVH 2B0SH 2YMXL 3ES6B 5GRYA 4Y5YA 1ZHKA 2DQIH 3QCTL 4HC1H 1YY8A 1HXYB 2EIZB 1IKFH 1JVKA 2CDGB 4ZDHB 3I2CH 3QDMA 2GJZA 3SJVB 3NGBC 4ELMB 5J9PB 1TETL 4BFGA 1OP3K 1RIUL 3TV3H 4PJAF 3X3FH 3FZUD 1JGEB 4NQCD 3N1MC 3SBWC 4LSSL 4PREA 2ITCB 1EGJA 4Y5VC 5D72H 2DN7A 4CMMB 3DIFA 3F7PC 3WFDH 1D5IL 2OCFD 1GIGH 4HWZA 3BGAA 4F3FB 4NT6A 3KPMB 1ZAGA 3IAGC 3QUMB 4OQTH 1IGCH 5I1DB 3LKQB 2YUVA 1SVCP 5T1MB 3DVNA 3NIGF 2Q76B 4LASL 3UJJL 1JE6A 2IPTL 1NFIB 1VFMA 4I0PD 2QHRL 4OIIL 1GOFA 4I0CC 1AC6A 3HE6A 3K1DA 4U1SA 1QNZL 4HXAL 4QHLB 4PGZA 5IBTH 3K81A 3QEGH 2PYFB 1OT1A 3O3DB 4JO2L 4EJ1C 1MJJA 1FVDA 2DMKA 1MFDL 3MV9E 2D31A 3IRPX 1D6EB 3ZYZA 3GMQA 1ED3B 4XAKD 4F57H 3U2SB 5EC1B 3CX5K 1YNTB 1QHPA 4OCWH 3CVHH 3KPOA 3FQUA 3BZFA 4HZLA 4UB0L 2NTFA 2CIIA 5F8RC 3ILQC 2E8YA 1IGJA 5L0QB 2A73A 3RTQA 4NWTL 1I3GL 1TLKA 4AJ0A 5I74C 3EYVA 1HKLH 3B8SA 2DQFA 3GJEA 5C0ND 1YDPB 4DCQB 4CVXB 1TZIB 4FG6D 4KJPC 5IMKB 3Q2CA 4JN1H 3NFNA 4DEPB 3MRKB 1G1YA 2EDEA 4QTHB 4J6RL 5DEGA 5CUSL 3GK8H 4NC0B 3P9LB 5C0IB 4XHJC 1ZTXH 5DURD 2P1YA 4MZ3A 5SWSE 2FX7L 4HXBL 3V4UH 5LVEA 3ARDA 1BD2A 3QEUB 2DWEA 1CN4A 3OKMA 4IDLA 2UVFA 1KLFA 4P9ML 4PRBA 4C83A 2X4NB 4MXWH 3SPVA 2RB8A 5CEZD 5EZIH 5C6PB 3G6AA 3V4VH 3GSNL 5GJTH 3PWNB 5EA0L 2FJHB 2OQJA 1WLHA 2OP4L 3QDMD 4MQ7A 3C8KA 3ELAT 3WYRA 5C6WH 1B3JA 3HAEB 5I1GH 1TQBB 2WBJA 12E8H 4GAYA 4B7IA 4MJIB 1QBLH 4WI3A 4WV1B 4HGWB 3HZVA 1S5IL 4APQA 5MHSE 5SWSD 2NX5A 4DFHA 4GMTH 4KGLA 3P9WB 3DGCR 4Y16A 1UJTA 5F1OB 3SDXA 3N50A 1KGCE 2AJ3B 5D6DA 5HHQB 5F7UA 1LD9A 3S96B 3MRDA 3O9WC 5DUMH 4XRCA 5ESAA 2G9HA 3RFZC 4H25A 3ULUH 1IAIH 3DXAE 1XGPB 1JTOA 2WIIA 4PRDA 3P77B 4WIQA 2XWBB 4ERSH 4WNQB 4YHZH 1A14L 3HE6D 1YMHB 4K3EH 1CFQA 4LIQE 3OSKA 3L5WB 1BEYL 1IGMH 3HA0A 2YPVL 4QGTA 4L9DA 4YC2B 1MAML 2AJXH 4LCIH 2DQGH 4HEPG 1BBDH 1CK0L 2HVJA 4WCYL 3VXSE 1IBGL 2HFEB 5H37G 5DK2B 4LQFH 4OM1L 2IGFH 4NPYA 4R4FH 3UTQA 1JYVA 4FNLL 3IJHA 3RTQD 2I26N 3QHZH 1JWUA 1QRNB 4D0CA 3QAZC 5F7HA 4XVUD 3CFDA 4Y4FA 5CEYA 1PZ5A 4K3DH 4QRRB 5C7XL 2X10A 4Z7NF 3JWNC 3VW3H 4X6CA 3DPBA 4B53A 5FCUL 4ODUA 4JQVA 1W0WB 3QHFH 4TNWK 1NMAL 3HMWL 3RVTD 3P0VL 4LBEA 5CAYB 4GT7A 2O61A 4NM4H 2EZ0C 1I1AD 3VXSD 5AG9A 3GMOB 3W39A 4K71B 3GBLA 1EHLL 1P4IL 3INUH 4JB9H 4OM0L 2W92A 1BD2D 3ARDD 5T1LD 3IXAA 3BQUC 3S35L 2FH6A 2JB6A 5I9QB 1A9EA 1F90H 5MEQB 5L2KB 4DQOH 5JUEL 3VD7A 4WFED 5I8OL 2YD3A 5HI3C 3F7YA 3W81A 1MWAA 3IKKA 2QKIB 2FGWH 2F53E 4QRSB 1DUYB 5IGXL 3FHAA 3UYRL 3X11A 1RZKC 1CXHA 4JN2A 1X7QB 3PXJA 4Q0XL 1NFDF 35C8H 3VFVB 3ARZA 5GRZA 2QR0B 3RHWK 4DZBB 2NX5D 4WEUD 1EFXA 4Y16D 3AY4C 1SY6A 3HI5H 1GGCL 5I17B 2PO6B 4L8BA 3S35X 1NEUA 1YEHH 2KQMA 3HZYA 2F54B 2DS4A 3SKMB 3LKSB 3HKFA 4RISH 5HVHB 1MCQA 4QRQB 4BKLA 2J1KA 1KCRL 1YNKH 2XWJA 4NZJA 4GW5B 1FCCA 5K93A 4XP9L 1I7TB 4GKSB 5MEPA 4HUNB 5JZ7C 1UCBH 3ILPA 4ZOBA 5IW6A 3D48R 1QLFB 4ZUUA 3RWIB 4QHMB 3SDCB 3OJDB 5TE7H 2A1WH 2XG5A 1Q0YL 4EBQL 5BV7L 2F58L 4P4KB 1I8IA 2ORBH 1MCOH 2OSLB 2OTUB 4XNUL 4M7ZC 4CVWA 3MNZB 5TPWH 2X4OA 3HE7A 5D6CB 1MIEH 5T5NF 3VFTB 3FFDB 4TULH 2F15A 4ZPTB 2DQCL 2EXWD 3T77A 4F37F 4LOUC 2NQCA 1HWGB 1N6QH 3KAAA 4KKAC 1S3KL 5IBUG 4U6VH 1X3DA 4E5XA 4JZNB 1IM3A 2MSPA 5IVOA 1Q9KB 4YHKL 3IRZA 3SBWA 4Y5VA 4Z78B 3R4DA 1A4JA 5IOPB 1DN2A 2R1YB 3QUYA 2XTJB 1FVCB 2MOVA 2XKNA 2UY7A 1F2XK 1CZ8L 2NY4C 1I8KB 4TUJA 4JQXA 1WBYB 5TF1L 2JE8A 2V5SA 1CICD 3NA9H 3D39E 1Q1JL 4X99A 1V3JA 2FWOB 4NDMB 1MCSA 2XZQH 2X4SA 3BP7A 4GFTB 5C8JB 4KVCH 5DHYB 4CJ0A 5FF6A 4JKMA 1CLOL 5DHVH 1BWMA 2L4OA 3D3VE 5DTFB 3QFJE 3CLEH 3KXFA 4QRTA 4HCRA 5GGTA 2Q6WA 3FOMB 5F7FA 3L7FB 4NQVA 5KSUA 1MUJB 2K9UA 1FFQA 1KYOK 1OL0A 3CDCA 1A5FL 4F2MB 1REIA 3OGCB 4WWKB 4XCYB 1MIMH 4NRXA 2BSED 2HG5A 4GKNA 1MPAL 1DP0A 2VDNH 1JWSB 1EFXD 3G5ZA 4G7YL 4GQPH 5EH1A 3HS0A 5LCVL 2B0SL 4NO0D 4KGJA 4YFLI 5EU7E 3D39D 2DQIL 4HC1L 1HYRC 1ZLSH 1IKFL 3I2CL 1ORSB 3BD4A 3KLHD 3EDEA 5F7NC 2JJVA 2BVEA 1C08B 4P5MA 3TV3L 4O02H 1FZOB 1LP9F 3X3FL 2VDOH 1BOYA 2AJYH 3ARGB 4UQ3B 3PWJB 5D72L 3BUYA 5J06A 4OF6A 3WFDL 2R39A 1GIGL 3V0VA 5C08E 4LVHC 4NN7C 3GSRB 2IALB 4WHYH 3KDMB 4TNVK 4OQTL 4YR6A 1EUUA 1IGCL 1ONQA 3AB0B 5T3ZE 3NIFF 4CN6A 1KC5H 3E0GA 1YUHA 2AK4E 1OTTC 2Z31C 3MRFA 4U6YB 3HE7D 2RJMA 2B8OT 3OJVC 1N2RB 2Z35A 2DLFH 3EFDH 5IBTL 2JB5H 3S5LA 4LVOC 5HVWA 3QEGL 4I0PB 5TDNB 2H1PH 4UIKH 4XMKH 1TCRA 3KXFE 2DWDB 2VJXA 3IDMA 3KWWB 4GH7B 4YIQB 2ILLA 2VDPH 4ZUSB 5C08D 4F57L 1NFDB 3MGTB 1TVBA 4OCWL 2EH8L 4L3EA 3CVHL 4N0RA 1T1YA 4AY0A 4EDXB 3IB4A 4QLRA 1GCFA 5T3ZD 4K94H 3SDXF 1OLZA 2H8PA 1HKLL 3L3KB 5J1AB 1AXSA 1RZ7H 2WSKA 3HRPA 1KB9J 4RAUA 5HYSA 5J8OA 3ALPA 1MLBB 5MENA 2LAGB 4JN1L 4YHPA 3NN8B 5E4EB 3I02A 3KXFD 4R26H 4CU7A 3GK8L 1FG9C 4M1GH 3LMJH 1J8HA 4WTXA 1ZTXL 1KN2H 1VESA 5I6XC 2FR4A 3V4UL 1OW0C 3NCEB 3WFEH 4MDIA 5AWNH 5GS0H 1CVRA 5I73B 1B0RB 2YD6A 4DVRH 4MXWL 5EZIL 4I77H 4RFEA 4S2SA 4LLDA 5IW3A 3QEHA 3MO1A 3V4VL 3ILQD 3WHE0 5GJTL 1SJEB 1U8OA 2OXHA 4LHUB 5DA4A 1YEEH 1RUMH 4MCZB 5I76B 3ZMRA 2HKFH 1C16B 4U2ZA 5FUCE 5I1GL 4LPWA 4Y5YB 1ZHKB 12E8L 1YY8B 1QBLL 1KF9B 5DC0A 5F9DC 3QDMB 5HHME 2GJZB 5IB2A 4KJPD 5FEBA 4X6CF 4HHAA 4GMTL 5EOTA 1FZMA 1YY9C 2KPNA 4XHJD 1KIRA 4H1LH 1RD6A 5IMMA 1LO2H 4IRZH 5DUML 4PREB 3TVMA 1DL7H 3DIFB 5SWSB 3KPPB 4OFYA 3ULUL 1IAIL 4HWZB 5BCAA 3BQUA 3F65A 1TDQA 3BP5A 5T3XD 3LEVH 4ERSL 4YHZL 4NT6B 2NY6C 4K3EL 2VLLA 5EU6A 1U58A 1KIUA 1MCKA 4Z7QF 1MSPA 1A9BB 3DVNB 1IGML 4JGJA 3MCKA 3PE9A 1V05A 3HE6B 3QIBC 1KTRL 2AJXL 2ZZUT 4LCIL 4U1SB 2DQGL 5EORH 1BBDL 1JF1A 1J8HE 3BP4A 2GK2A 1MJJB 4LQFL 1AH1A 2IGFL 1JV5A 4L3ED 1FVDB 4R4FL 5C6TH 4AG4H