2GSGA

Crystal structure of the fv fragment of a monoclonal antibody specific for poly-glutamine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords monoclonal antibody light chain
publication title The structure of a polyQ-anti-polyQ complex reveals binding according to a linear lattice model.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsgA00
2UZIL 2X9WA 1L4IA 3MJ7A 3BZ4B 1KG0A 1Q38A 2VL5A 4P2YA 5TH2A 1HWHB 4OLEA 5JW3L 1LP9B 2CDFA 5JUEL 1JTOA 6FABH 5D9SA 4P59H 3HR5A 1OTUC 3IETB 3RVTC 3HA0A 3PWVA 4UDUA 3HAEA 4CU7A 1S9VB 4YHKH 4ELMF 1NANH 3U83A 3EGSB 4JFQA 1CIUA 3AGVA 3GSOA 4Z5RB 2ICCA 2A6DA 3WHXA 5E8PB 3HMWH 2ZCHH 2XN9E 3HE6D 4S1RL 3RPKA 2R9HC 5D7IE 1OW0A 1UWEL 4ZXBD 1U8LA 1NANI 1IGIL 5FGCB 4LSTL 2DRUA 4QF1B 2AGJL 2X4NB 5D7LD 4MDIB 3GSWB 1QPXA 1R5IA 3CXDH 1ZA6B 5A16A 4M5ZL 3JWOC 1GGTA 3O2DA 3CCHA 4KVCH 5C0BB 3ARGC 3PWPD 4ELKB 1YNTA 1OTTD 1B4JL 4XXDB 1FGVH 1P4IH 4LCCA 2PTVA 4GW5B 2MCPL 2O93L 3OL2A 4U1HA 2AQ1A 4JQXC 1V7NH 4IBLT 4X83A 2VIRB 1BECA 5DC0A 3TCXA 1LQSR 1NCAL 1IGJB 1SBSL 5K9QI 3GI8H 1A2YA 5KJRL 2Y7QA 1JWSA 1ZXQA 3G6JF 1OP5K 3F7PC 5GHWH 4GG6F 5JOFA 4RRPG 5E1AA 5HHOB 4MJ6B 1T20B 3L3OA 1D5XA 5F1IA 3OHXB 3RA7L 2ZUSA 3NIFF 4U7SA 4WU5A 3IGAB 1OGAE 5DO2D 5T1KD 4NQDD 4DCQB 4YHOL 1TJGL 3TN0D 3WIIL 3HRZB 3O6LL 5TF1L 1JPST 1ETZA 4M9PA 1CK0L 1NAMH 2FECI 4UV4L 3D0LA 3VG0H 3BW9B 4WI8A 5L7XH 1QLRA 3HNTL 1NC4A 3EJZD 3V6OA 2YKLH 3VFGH 1R5WB 3S34L 3DXAA 5AYQA 4KTEL 3GEWB 3U0WH 1TZHB 4RAVA 3TBVA 4NOBA 4MSWB 2VLMD 5EU4A 4HFWB 1JHTA 4KAQL 25C8L 2C1PA 4JRYB 3DJ9A 4J1UA 4A6YH 3DUSB 4NJAL 3KLAB 4Q9QH 4HF5H 1E4WL 4IDJL 4G6KH 3ILPB 1FC1A 1XGYH 5IROA 3QQ4B 4UNUA 5C0CE 1F2QA 3MRMA 3NA9L 1S7SA 2QHLA 1HKFA 2FGWH 3MRLA 3ZYJA 5EPMA 4U3HA 5GRUL 5DFTA 2BRRL 3MNZB 2R15A 4H1LB 1ZLWH 4P2RE 1N0XH 3S4SB 2NXYD 3NABL 2BVOA 5C8JB 1JHKH 4MD5B 1JGUH 4ZD3L 3KYMB 5GGSY 5J12B 3JXAA 1Z5LA 4DZ8B 1ZK9A 2R2CA 4G6JL 4Y2DB 1P5VA 3WHE0 2Z93A 4UOW1 5T1LD 4XH2B 1DLHA 1EV2E 2ARJQ 4UT6L 5JHDA 2X4TB 3BP6B 3ZT7A 5D71H 3WFBL 1K2DA 3WFHB 4OQTL 3EDJA 4XPHH 3TBSA 5IUSA 4IEFB 3DWTA 4Y4HB 1A1NB 4KC3B 3SDCA 5MEOB 2AJ3B 4DKDC 3JTSA 1LEIB 1ORQB 2DD8L 2F54D 3K46A 1GHFL 1JVKA 1MRFH 1CLZH 4IRJC 1MF2H 4WFED 4XVSL 2PW2A 3PE9A 3BN9C 3FFCD 3UPRA 3OR6A 5DHXB 1QSFB 3QISA 5L6YL 3ARDB 5F89A 5DYOA 4PJ9A 5CEZL 1MIEH 3IJHA 1VERA 3TA3B 5IBTH 1CBVH 1NUFA 3QXAA 1LVEA 3ULUC 4WUUD 4F7CB 3O6FA 1WBYB 5HGHB 4H26B 2P45B 4QO1A 1U3HD 4KWUA 1RURH 2H3NA 5ALBL 1BBJB 2W1NA 1KFAH 1IM3A 1FN4B 1KJ2A 5ETUB 1YA5A 4L4TB 5GGTL 2YZ8A 5E2VL 2GAZB 1TVHB 1GSMA 3PWLA 3BKCH 2XA8L 4X4XA 1UVQA 1CTOA 2R0WL 2HKHH 5J7CC 4WEBL 4YZFE 3MFGB 4L4JA 5CZXC 5KBNC 2VAAA 3O2VH 4OJFH 4CADB 4NQEA 3U6RA 2LAAA 8CGTA 5ESVB 1FO0H 4OFYD 1C5BH 2AEIT 2XRAH 4DKAA 3IRPX 1CLYL 3BDXA 4YDIH 5I6XC 3RWGB 3EYVA 1NDGB 4HS3B 2XPGB 5ICYB 1U8PA 1E4XH 2PETA 5F1OB 3NFPB 1CLOL 1WICA 1S78C 5CP3A 1M1SA 4AEIH 3ECBA 4BSWB 2OJEB 2VABB 3QDMB 3DHMA 3PJSA 2C7UB 2DDQH 3QNYA 2NX5B 3S36X 4D9LH 3QJHB 3GI9H 1JZ7A 2NY3D 2N7AA 4QRPB 2DYPA 3IKKA 4DZBA 1A9EA 4KI5F 1EBPA 3OXSB 5F7FA 2RAMA 1CFSA 2QKIA 1UJ3C 43CAA 1TQCC 3MCLH 1QSZA 3EDKA 5GGUB 5IT2H 4XX1E 2PYEB 4EIZC 2VQUA 4YC2B 2BNQD 3IDYC 3NOIA 4YHNB 3BQUC 1CXFA 4JFYA 4QXTB 3L5HA 3QIWB 5IWLA 2P47B 4X5WA 4EI5C 4RWYL 4HWBL 3HG1E 4NHCL 4NQCB 2I9TB 4H8WC 1CF8H 3QEGL 2ERJC 1SEBB 4KI1A 2P48B 1AKJA 2GTWB 3C09C 3HLAA 5I1DA 2P7TB 3EBAA 1DVFB 2PUQT 2ZWLT 3UTSD 3RIAF 2HA1A 1MHHA 3S5LB 3MLUH 6FABL 4PBVC 3QZWG 2OMNA 3N06B 1HHIB 1U93A 3I3EA 4OZ4A 4DFHA 4PJAF 3GMRB 3RHWK 5IFAH 2VN7A 1L9NA 1KCVL 3BZFA 3L95A 3CSGA 4FABH 2D4FA 4ZPTA 2DMCA 3K80A 4ZFFB 2F8XC 3JWNC 5IHUH 3AU1A 1DN2A 5FYLE 4WWKB 2VDLH 4PLJD 5HSFA 4XWGH 1JPSH 3QEQA 5DJCA 2Q8BL 1CFQB 4CNIA 1CGUA 4OCYL 3VFMA 1T6WA 3U0TA 2YA1A 1YEHL 2PYFB 4YHMH 5E2JA 1F8TL 3ZL4L 3CXDL 1YC8A 1TNNA 3RWIA 5I0ZA 4OSUH 3BWUC 5DC4B 1EUTA 5D1QC 4JPWL 5HD8C 5CAYB 2XQBH 5JW4Q 4ZFZA 2Z8WC 4J8RB 4ZSOB 1P4IL 4HKXA 3BGFC 2E5EA 4YHZL 4M7JL 1NL0L 1QR1A 2J3SA 2X44D 3GI8L 3QG6B 3D5OF 2BNUA 4JVPA 3MNWA 2P49B 3OGCB 4PJCA 4XCYB 2OCFD 1REIA 2HJFB 2FECL 1TVBA 3THML 4DKFH 1NGZA 3STLB 2DQDL 1KPRA 1VFBB 4OLVH 5MEND 5D8JL 1S7VA 2GYSA 5DGRA 4ZUWB 3RTQB 1NBVH 4PJHB 2KUTA 3HI6H 1OW0C 2X4UA 4WI5A 4NCC2 4NFBA 2FHFA 4S1QH 5C0NC 5JHLH 4QRUA 3ARQA 3VG0L 4U33A 1LGVA 3VRLE 2GT9A 1MHCB 5EH1A 4X0KB 5CJQH 4LEOA 1H8OA 2WUBH 3BH8A 4EN3A 1IFHH 1RZ8A 4R2GD 3FB6A 3VFGL 2AABL 5FO9B 1IQWL 1FORH 4AY0A 1JZ6A 3U0WL 1I8IA 1OAZH 5KSAA 3IT8D 5L8JB 4NKMB 1VACA 2VDMH 3UP1A 3D3VE 1JK8B 2VLKD 1RUAL 4LCCC 2B39A 1EXUB 3AREA 5H35A 4G6KL 3IU4H 2R1WA 1XGYL 4PJ7E 5CEXB 3DETD 1CQKA 3MBED 5FO7A 4OIBA 1EMTH 1J05B 1NCCL 4JHWL 3DNKA 1TQBC 3PDOA 4G43B 1U8MA 4G3YL 3E2HB 3FT3B 1KTKE 1DEEA 3KS0H 1GC1C 4U6HA 4V1DE 1UZ8A 4L3EA 1N0XL 2DB8A 2DM2A 1Q9OB 4PD4K 4WFHE 2ZSVA 2HG5B 5BO1H 1MFEH 4G8FA 2X89A 3M45A 1BFOB 4FOMA 4WW2B 2YD1A 4OF8A 3U4EA 2R1YA 1MVFA 2IG2H 4JHAH 2M2DA 1JGEB 4NCC1 4U2YA 4FQHA 1AXTH 4X9HA 3UDWA 5BV7B 4DGYL 2FJHA 3V6OC 2DTMH 4XVUD 3JV6A 4JY6B 4JM4H 5D71L 1D5BB 4HUUA 1OQXA 3W39A 2VXQL 2E27H 3QUXB 1AGBA 3ARXA 3ESUF 2Y72A 2VITA 2BJMH 3WFDH 3GUTB 1VADA 3SCMA 2ZCKH 2JJTA 1MF2L 4TYUA 5IROC 4CBPA 2OXHA 5DMIL 1UFUA 3MV8B 1QBLH 2E7CA 1MFBL 2ESVB 2IAND 5C07D 3O8XB 3MRRB 4P3DB 4JPKL 4MAYD 4C54A 5B38G 1FL3B 5IEHB 1HDMB 3SDAA 3WDIA 1S9KC 3LMJL 3ARYA 3FFDB 1CXLA 3HI1B 1LEKB 5IVZB 1KFAL 3QDGE 2Z35B 5D2LE 5CSZB 2FX7H 1PLGH 3UO1H 4JCMA 3AAZA 1B0WA 1CDIA 1IVLA 2GHWB 4LIQE 1CDGA 3BKCL 1FFPA 2XQYK 1D5MB 1ZOXA 1FNSL 4LVHB 1NGYB 3SDCC 1OLLA 5HDBE 1IAKA 4APQD 1HOCA 2Q20A 2Z9TA 3PV6B 3AMKA 3O2VL 2GJ6D 3RUGA 2CLRA 1FO0L 2A9MH 1AXIB 1C5BL 1QR4A 3AB0C 3I9GH 1LDPH 5T1MB 2LTQC 4KROC 2VLRE 4FQLL 1ZWIB 4PJ9C 5DQ9B 3T4YB 1YEIH 4HV8B 1P7QB 4XP5H 3OQ3B 5EN2B 5BMFL 3O6FC 4AEIL 2UVEA 4JDZA 2DL2A 2DDQL 5ICXB 4E42B 4D9LL 3QDJE 1J8HA 1IEBA 3OBAA 3GI9L 2WUCL 4LAQH 1T1ZB 3CFBB 1U41A 1D9KD 2VLLA 3BP5A 3K4AA 5I1CH 1QUNA 4FFWD 5DEZA 3B5TA 4NN7C 3FN0H 3UBXG 3CVHA 5KAQF 5GJSL 4FQ2H 4LLYB 4G6ML 5D1ZB 4NRYA 1ZHNB 4W81A 3O6KH 4MA1C 1A6WH 2E7BA 3HUJA 1IBGH 5HYSG 3K81A 3L5WB 3S35H 2V5TA 4PIRF 5CMAB 5GGSB 3VXNB 1HYSD 1MCKA 1IAMA 3LEVL 3V8OA 1J1XH 3KPPA 2BP3A 4J3OC 5ESQA 2C1OA 3D69B 3DGGA 3NFNB 4PLOB 1MCJA 1KJVB 5EC1A 4ZAKA 4G8EA 2CR6A 3AVEA 5INCB 4PJIB 1UJTA 4OCLC 3RY6A 1KIRA 4YEFA 3IVKA 3GSQB 4U7MA 4U1MA 3V4VL 3RX7A 3G5VA 1Q0YH 3KYNB 3GRWA 4RGMC 4Q74A 3G08A 5FKPB 2OBGA 4XBGB 5M95B 2OL3L 1EFQA 5DRWB 1A4KB 3P9WB 3QJFB 1MJUL 4Y88A 4JFFD 2BSTB 2OK0H 2VDLL 3GJFB 4B7IA 1XGRA 2DLGA 3EOTH 1JPSL 1AP2A 1RHHA 5C71A 3N0PB 5HGAB 4NP4H 4AYFA 4JFPB 4LLVA 4F9PA 5ITFA 3MUJA 3P0VH 2CR3A 3TPUA 3V4UH 5IWLC 4HGWA 5EIIB 3UZEA 2Z31D 2VOTA 5E8NA 4PV9A 1P84K 3QPXH 5DJYB 3W11C 1HEZA 5L88L 1U91B 1C08A 4E41A 4FTVE 5JO5B 3C9NB 5CCKL 5KS9F 1F4AA 1LD9A 5I66B 3UTTB 5C0FB 5C0CD 4HT1H 4POZC 5AWNH 3FONA 3VFOA 4M8VA 3DMMA 4YGVB 4ELMB 3SO3C 1IT9H 1KIPA 2FJFA 5I1LB 2MPAH 5ECJE 5CJBA 4X7TA 1KUMA 5KVGH 1XR8A 4JFEE 3VW3L 1MLCA 4QYOB 1TPXC 4P2RD 3LSOA 2ED8A 4DVBA 4PRAB 5TGBA 4OLVL 3D39B 2FBJL 1MELA 5HHMB 2JCCF 3OKDA 4X98A 3HI6L 2P42B 4LBEA 3DSFL 3KPLB 1F02I 4S1QL 2YC1A 2ZUQB 1VFAA 4X6CB 1WIPA 5SV3A 1FH5L 3NGBC 2WUBL 4NN5C 2KPNA 2LFGA 2AJYH 4EXKA 4M5YL 1RULL 1FZJB 3PXJA 1V3LA 3DROA 5IFHH 3GMNA 3BGMB 3VD9A 3PL6A 4E9LA 3ARUA 1LP9A 1R0AH 5I0DA 1IGTB 4R9HA 3BPNC 5IB2A 3IETA 3X11A 2AI0L 3G6JB 1T7YA 4KQ3L 1WJ3A 1CFBA 1VENA 2WIIB 1YPZE 4TNVF 4QTIL 4R26L 5C2BH 1VPOL 1T21B 3AXLB 4LASH 4N9OB 5FUCE 4PFEA 5DK2A 3VFTB 2VJXA 3PQYA 2EDRA 4QRTB 5D2NB 3MRNB 1RSFA 5E8PA 4FQCL 5LQBL 3BUYA 3SDDB 12E8L 4Z8FL 4Z7UA 3ZDZF 4PJBE 3H7BB 4MNQE 1XGQB 4QF1A 5GIRA 2X4NA 4MDIA 3D2UD 4ZO8A 1ZA6A 1CICD 2B5IC 3ALWA 3MJ8B 4PG9B 2B1AH 2IG2L 1YC7A 1FL6B 4MQXD 3HKFA 2EDEA 5EZIL 3CFEA 4K8RC 2BNRA 2DQHL 1JGLH 1AXTL 4ELKA 5ACZB 4JO4H 1INEH 4FN0A 4MQ7B 4EN3C 3S96A 3H3PL 2E7MA 1BQLL 5KSAC 3UYRL 4MNHB 5DD3H 4XNZB 2W65B 3ARVA 4QCIB 2E27L 2VIRA 2X9YA 4OZHF 4Z7NF 3AREC 2BJML 1IGJA 2UY6A 1RIUH 3UJTL 1FGNL 4CVZB 4AG4L 2FJGB 2ZCKL 2VO5A 1FYHB 3AM8C 4MJ6A 5DD0L 1T20A 3FKUS 5GRJL 3FB8B 3QXDB 1DANU 3V95A 1HN1A 5D1XD 1NBZB 3MLYH 1DQTA 3PGDA 2ARJB 5B3JF 1ZGLA 3R0NA 4Y8AA 4XAWH 1FZOB 4EVNA 3HRZA 5KSBA 2XWBB 4XGZA 1UCBL 2AERT 2XKSA 4HJ0C 3BW9A 4PJEF 5K9JL 5TFSL 1TZGL 3FRPG 4LCUB 3UO1L 4XHJD 3U48A 1HXYB 2X7LB 3UX9B 1TZHA 3UDWC 5DXWA 3DX6A 4LPYA 2GUOB 4JRYA 1JNNH 4LOUD 2QHRH 3KLAA 3RJQB 2VDRL 1KLFA 1KNOA 1GRWA 4R6UA 3I75B 4U3XA 3QQ4A 1MY5A 4ZQKB 3HG1D 2QQNL 3MGTA 4ZUTB 3SCMC 5C3LD 2JJTC 5F7DB 5K9QG 2A9ML 2ORBH 3U0PA 4YIQB 2W0FB 3I9GL 1LDPL 5JR1H 5DJXB 1AHWB 4UQ3B 3MNZA 3HPLB 2O5YL 4XP5L 3S4SA 5C8JA 4MD5A 5AAWA 4GG8A 3SDAC 4Y19D 5LCVH 3CFCH 4N1EA 4PRPA 3VE0B 4DZ8A 1EZVX 3EIFA 5C70A 3VMPA 3V6OE 5CZVH 5EBLA 3FOLB 3DX8B 3LB6D 3O3AA 3DXAE 4K3DH 2BVPB 1IC1A 3DUUA 3MOBH 2X4TA 5FYLD 5KVFH 4KJPD 1F42A 3GSRB 3SPVB 5EUOF 4Y4HA 1A1NA 3MOAL 4TQEH 4FQ2L 1I7UB 4MJID 1CGXA 1ORQA 1X9QA 3GSUB 3IFLH 3O6KL 1A6WL 3BSZH 4Y5VB 5ADOH 3TFKD 4KJYA 1ZLVH 4G8GB 4WU7B 1K6QH 2SEBB 5GGQL 3QPQC 3PHQB 1CU4H 2WZPD 4UU9B 5CJ8A 1QSFA 1WTGT 2YPLA 2Z8SA 1HSBB 2YR3A 1KIQA 3H9SB 4IMLA 4N5EC 5EBGA 4WI6A 1J1XL 4KGJA 2R69H 4KU1A 4JDTH 1CDJA 1BIIB 4Y4KB 3T3ME 4NBXB 4NZRH 1XF5A 2DM3A 2QSCL 5IESL 3AC0A 1WBYA 2QSQA 3NBNA 5HGHA 3U30B 1AD9B 5SX5H 1NFIB 4PRIB 2F19L 4LHUG 5F1SA 1QVOB 1BBJA 1N6VA 3B9EA 3WL9B 1FN4A 4L4TA 3WO4C 3GSXA 3P3YA 4RFEB 5BXFB 2BCKB 2I25N 3SKNB 2EC9U 1Q0YL 1TVHA 5JHDE 4XPBH 1OGTB 1MAJA 3N9GH 2EDXA 3QUKB 1SMAA 4ODXB 2HMID 3IDNA 5DQJB 1GGIH 2DWDB 2W9EH 3KYOA 3X14B 3K8LA 3VWJB 1IM9B 5E99H 3GKWH 3HC3H 1CFNB 5FM4A 3EJYC 1T5XB 4I0PA 4NP4L 2VRAA 5E8OA 4X80H 5C08A 1MCBA 4BSVB 1CXKA 1HSAB 1BVKB 1YN6B 3P0VL 4FMKA 4OF5A 7FABH 3DIFA 1ZHBA 3RWGA 3DX9A 1FVDB 3D3VD 3VFNA 3MRDB 1OTUD 2VXSH 4HS3A 3RVTD 2ITCB 2VLJD 5ICYA 3REWB 5DMKB 2AK1L 4PJ5B 4HMEA 5HVFB 1ULVA 1U8HB 3NFPA 3UZVB 4JM2F 4KY1L 3GB7A 1WFNA 2R56H 3HZVA 5E2UH 1IGMH 2VABA 1GIGL 4PRDB 5D72H 4ZAKC 4EIGB 4HT1L 5AWNL 2WBJC 3MRQA 4PP2B 2D9QB 4LKXB 2D7MA 1INQB 2R0LH 1IT9L 1MY7A 2R1XB 4P2OA 3W9EB 1OSPH 3F6IA 2M1KA 2OSLB 5EBMB 3Q5TA 1MFAH 4QRPA 1U9KA 3IDXL 5GS0C 3PNWB 3B6SB 2DBJA 1ZLSH 1WCBA 1MCOH 5KSUA 9CGTA 5HHXH 3MQIA 3TM6A 4CRPA 5GGUA 1XCQB 1J1OH 4NQEE 2PYEA 3RIAK 1H5BB 1A14L 5HI5C 3G6AA 1NMBH 4LLDA 4QXTA 1I4FA 1I1FB 2X05A 4F9PC 5DK3A 3N1QC 3U9UA 5HYQB 2CRIA 2I9TA 3W2DH 1SEBA 4M1DH 3TT3L 1PW3A 4J3UA 4S11A 1BEYH 2AJYL 2GTWA 6CGTA 4PYHA 3VFVB 2EKJA 1CFTB 2YD9A 4KXZH 3H42H 4Z7VF 2P7TA 2DQCH 1P2CB 4Z77A 1RUKH 2D2OA 4DVRL 2XA3A 3ZLQC 3NN8A 2FEDC 1IL1A 2ATPA 4R90H 1HHIA 35C8H 1C5DB 3DMMC 4OCWL 1MFCH 4ZYKB 1LK2A 4XBEH 5C2BL 3BE1H 1OP3H 3KXFA 4G5ZL 3QUMB 3LKNB 3UZQA 4KXZI 3VH8G 2NY6B 4U6YB 5A2LH 4GMSH 1J86A 3QDGD 2YUVA 3BISA 5EB9A 4WI3A 4LSDA 1KGCE 3BKJL 4HWUA 4WO4B 1XF3A 4I3RL 5FYLH 3J8F7 4HGMA 2YEZB 3QZWB 1INEL 4FHBD 1KV3A 4JO4L 4OFDA 5DZLA 3ZKNC 3GBML 5FK9A 5EORH 2N4IA 1WFOA 3C5ZB 4QGTA 4Z18A 4NNPH 3SHSA 1QFUL 3ZSTA 3SGDH 5TQ0H 4WGWB 1KPUB 4G9DA 2VH5L 4NQXA 1RIUL 5JNYB 3QG6A 1UQSA 2YD3A 4LVOC 2VLRD 5CINH 3OGCA 4XCYA 1OP9A 3ZHKA 3IXAB 4JKMA 1S5HA 1ZT1A 3GSNB 2J12B 3A6BL 3CDGA 3CVIL 2DQEH 3RWCA 5FIEA 1VFBA 3MNVA 3QEQE 4JO1L 3MROB 4MCYB 5ITBL 1G6RB 1UA6L 3C87A 4GQPH 4PJHA 4PGDB 5ESAA 4G6AD 5F72S 4YWGH 3TIDB 4P3CH 1EEZA 4I18B 2D3VA 4LPVA 2GI7A 1XMWA 3LKOB 1MHCA 4X0KA 3QIUD 4YBHA 4C56B 1ZKAA 4YNYA 4NHUB 1BAFH 4G6FB 4IOIB 5FO9A 1DZBA 4IRJD 5T5FL 5L2KB 1BGXL 3BN9D 1TNMA 1A64A 1U8NB 3MRBB 1QFWH 3L3DB 4M6NH 2X4OA 1XF2B 4M4PA 2OTPA 5IB3B 4HCRH 4PJCE 5DURD 3OKMB 4GRLB 5DJ0B 4JVWA 4G43A 2VZUA 1LO4L 2BMKB 4X8XA 5F71A 5JR1L 3BP7B 5F7EH 4V2CB 4K7PY 3OTTA 3VGBA 1RUMH 3GIZH 3A0OA 1QLEH 3L7FB 2XG5A 2HG5A 1PEZA 2LU3A 4PRNB 5LCVL 1ZTXH 4WW2A 3OPZH 5SWSB 4MXQC 3FQTB 3CXHK 1JGEA 1LO3L 5KTEL 3EOBA 4L8BB 5CZXD 3JWOH 1KEMH 4JY6A 2ZNWA 1KENH 4UQ2A 2EYSB 3G5YB 2Y36H 3QUXA 4NIKB 4TQEL 3NCFB 4OZIE 1JMXA 1ZT7B 2I5YL 1QOKA 3O3DB 3GUTA 3BEVB 4HWBA 5TQ2L 3O9WB 4Z76B 1K6QL 1UB6B 4NO3B 2WP3T 4KMLB 1S78D 3S6CA 3RZCB 3O8XA 5F93C 4P3DA 5K59F 1FSKC 3SKMB 1FL3A 4JDTL 3CGTA 4L3EE 1R3LB 1RJYB 4WTZA 5AD0B 4BQ8A 2WK2A 3LKPB 1A6TA 3MXWH 4WRLA 1F3JB 1QD0A 5BVJB 2EE2A 5I1GL 3LHPL 1LEKA 3ZYZA 3CMOL 4YXKH 1QYGL 4JFED 2Z35A 3ZSSA 5FKAA 2YS4A 3ULVH 2AV7B 4HG4K 4RGOL 3N9GL 1RU9H 5EZLB 3TESA 5HPOA 2QR0A 3OKOB 4AM0B 5IBLC 1I3RA 4MHHI 2ZUXA 1G9NC 4Y4HC 2W9EL 4D0BB 1NGYA 1U8KA 3JWDC 3VMNA 4EI5D 2HH0H 4H5SB 4GKOA 4LIQH 3NMEA 4YBQD 3OXRB 3QWOB 4X80L 1WK0A 3B2VH 2E9IA 1FIGL 3L9RA 4LLUB 4HAFA 5T1MA 4D94A 5BRZB 2FRGP 2FO4A 4RX4D 1HHHB 2JKXA 1WWCA 1DBBH 1BBDH 1WQVT 3RPIA 2YXMA 1KJMB 4O51A 5DQ9A 4C58B 3RWEA 5LXGH 1A4JB 2PTTA 3LDBB 5EN2A 2J6EH 1DQQA 1HXMA 2ICWI 4P23B 2OTWB 3NPSB 1G0XA 5DUPH 1IGML 4NPYA 1ITCA 2D7TH 1OT1A 2ADIB 5FV2A 2EH7H 5CJXA 1BD2B 3HS0B 4XNYH 4LEXH 4D3CH 1XF1A 1RK0B 4U1JB 3T8XA 1T1ZA 3FO0L 3BVNB 4XAKE 1MFAL 2P8MB 1A3QA 1OCWH 1JYWA 2YD4A 4MNQD 4XPTH 3RRQA 4OB5H 1ZLSL 1IEHA 4B7LA 1MCOL 1ZHNA 2F53B 2YHGA 4XP9L 3REVB 2A6IA 3O3EA 3LQMA 1J1OL 4JHBA 4XNQA 4QOKB 5D1QD 3L5WA 5HD8D 4NYLB 3RUGE 2AS5M 1RZJL 4YE4H 5GGSA 2BVEA 3G04A 2G75B 5GGRB 4NNXB 4TNWF 4IMKA 3LQAH 4B50A 3W2DL 3GM0A 4U1IA 2QBWA 1BEYL 4S0SD 2EDKA 5JW5A 1UC6A 1ZV5A 1H3WM 4UBDC 5F7HA 3QULB 1P4BH 1S9XB 3C6SA 2IFFH 3I6KB 4N0UA 3BPOB 5ALCL 1J8HE 5JIHA 2MHAB 1Z3GH 3KYNA 1R5VB 3UJJL 4XCNB 4X5LA 4D0CA 4YPGB 5HYSB 3BE1L 4K9EL 5FKPA 4XBGA 2JELH 1A7PL 4OQ1A 4RBPH 4MLSA 1UZ6F 3QJFA 3QI9B 2DKMA 1UWGL 1YNLL 5C0ND 1U58B 2BSTA 3L3IB 3HUJE 3GJFA 1R3IH 1OB1A 4TVSa 4IOFC 1UYWL 3F6LA 1G9EA 1K8DB 2YA2A 4P2QE 5DI8A 3U7YH 1N59B 4HDIB 2VMFA 4YC2C 5C0DB 3QIWC 3IDIB 4PGCB 5FYLL 1X5YA 4Q0XL 2OZ4L 3L3HA 2H1PL 5IIEB 5EIIA 3JVGC 3OAYH 2X1XR 1ZE3C 2NY1B 1I8MB 5DJ2B 5BZWB 1I8LC 5DJYA 2L0DA 4OZFH 4U1LB 4WHTB 2EYTB 1SEQH 3MX0A 5JO5A 3C9NA 3UTTA 5C0FA 4XB7A 1T0MA 1U42A 1SJEB 4O2EA 1G7JB 2BC4B 4ELMA 5TQ0L 4ZODA 1I7TB 1J10A 1T89A 4ETQB 3KNBB 4F9LA 3IFNL 3PG2A 3GHEL 2PXYB 1XFPA 3U82B 2BOCA 2AV1B 3Q48A 1B4RA 2DQEL 5A3IC 1YY8B 3LH2H 4PRAA 1Y6NR 2A9NL 3MRIB 4WWKC 15C8H 4ZUVB 3T0EB 4W4OC 3HZYB 4FG6C 3S36H 4WI4A 3V5HB 1NC4D 3KPLA 4ZMAT 3DXAD 4GS7B 4X9FA 2DTSA 4JPIB 3QO1A 5DJDB 2BSED 2DLEA 2E9WA 4RMTA 2NYYC 5D70L 1FZJA 4E41E 4RGNB 4UV7L 4QRRB 5E8DH 4GKZA 5DWUL 4DUVA 1AO7B 4M6NL 3G6JA 4GG6A 3CDYA 1CD0A 3JTTB 2WIIA 3AXLA 3FAWA 5HDQH 3VXRB 3IDJB 1NC2B 2UYLB 5FGBA 4K2UH 5FYJH 4PYGA 3O0RL 4RWHA 3T65B 2OLDA 3SDDA 4TVPE 4ZG1A 4NZTL 5I1KH 5HDOA 4GBXB 5I18L 1XGQA 1BQSA 3HPJA 4PJEB 2Y07H 2Y06H 4WV1B 2PR4H 1TCRB 4XCFL 5JHDD 3MJ8A 4PG9A 4TTDC 4WVRA 1DBMH 1GGCL 5T1KA 4PTUB 2XTJB 3DECA 4DWHA 1A22B 5ACZA 2KBGA 3SDCD 2H2PC 1YDPB 4XVTL 3JWOL 3H0TB 4JHZA 3Q2CA 2VDKL 1LP9E 2W65A 5DLML 2Y36L 1S5IH 4ODWA 4N0CC 4QCIA 1B3JA 2Q8AH 4ZPVB 5EZJB 4KROD 3SDYL 4XHQA 1KB5L 5EUKB 4CVZA 4O4YH 2FJGA 4F58H 4PJ9D 4U1NB 2VERN 4OFIA 4C4KO 4KUZL 1J8KA 3PQYE 1F6AA 4YXLL 4ORZC 2BFVL 4EBQL 3QXDA 2WBWB 3PIQB 2W9DL 4CW1B 3O6FD 4UB0H 5E94B 2AJXH 3HAEH 1MVUA 2IBBA 2XV6B 5I1HL 5EIQA 3E2HC 4Z7UE 5I8EB 2J8HA 4WJ5B 1JBJA 1FZOA 1RZ7H 4K3HA 4YFDB 2D03L 1EFXB 2B2XH 3NPZB 4P9ML 1X5FA 4WW2C 4D0DA 1NQBA 3CK0L 3DVIA 1DUZB 4OGZA 2MSPA 2BNRE 3SKJL 1CR9L 2E7HA 1PFCA 4LSUH 3BIAX 1MRDH 5BV7C 3IJYB 1RU9L 5EUOB 1IAOB 4KKBC 1FNHA 5DSCA 3O2DH 4NC1E 4NQED 1SVZA 5HI4C 3ZDXE 4LSSL 1FG2B 3GMQA 5T1LA 1KJ3L 1A6PA 1XIWB 1YQ2A 1MHPH 3GNMH 1RJCA 3M1BB 3QUXC 4OD1H 5CBEA 1PZ5B 1FNFA 5FCUL 1CG9B 4LIQL 5EU6B 3MLWH 2Y5EA 4ZQKA 5I76B 1ES0A 4ZUTA 3TVMB 3FQWB 4PBXA 4WI7A 3WJLA 4M7ZB 4XVJH 3B2VL 4W6YB 3RI5F 2VE6A 2W0FA 4BH8A 2CLZB 5IG7A 3WNLA 3HFMH 4UQ3A 3O8XC 5SWZB 3HPLA 1BBDL 4ZTOH 5F7WC 3O41A 1RIHH 1R3KB 4Y16B 5KSBE 3C8KA 4BQCA 2ZCLL 1XEDA 1Y18B 1WSST 1EUUA 3VE0A 1J0ZA 2V7NA 1GC1H 5HY9A 2I9LB 3DLQR 2DYPD 4PV8A 2EH7L 3WMSA 3FOLA 4FQIH 4JFZH 2FLRT 3MA7A 1TJHL 2BVPA 2DJUA 1A0QL 1OAKH 4O00A 2PTUA 3SKUD 4YDVB 5GRVK 3GSRA 2FDBP 3SPVA 4JRYE 4N68A 5GRWA 3PGFH 1I7UA 3SY0B 2HFTA 4MB4A 3GSUA 4LVHC 2QJDA 1KGCD 3VXMA 4JKWA 2SEBA 3W11D 2YD6A 4P4KA 4BJLA 1AKJD 4P5KB 1M7DB 5MHSD 1YEGH 5IP4A 1GGBH 1YQVL 1HSBA 2UUDK 5MEPB 4LGPB 5FM5O 3GIVB 4PUBH 4P4RA 4Y4KA 4GKSB 1DQLL 1JGVH 4JM2B 4JN1H 1MRCH 3MYJB 3WXVL 3WKML 1YECL 2HLAB 5I17B 2XY1A 4PRPE 4Q6IA 3WE6B 4X99B 1QVOA 1T80A 1FHGA 1FAIH 1UM6L 43C9A 3ULUL 1BHGA 2BSSA 5CJXC 2BCKA 1Z3GL 3S97C 3SKNA 3WIFA 4KMQA 3ARFA 1OGTA 1NAMB 3HC0B 4P9HC 1A3RH 2ENYA 3QUKA 4BZ1H 4ODXA 3VMOA 3GM8A 4HUVB 5DEGA 5DQJA 2JELL 5DK0B 2DQIH 1N6QH 2XZQL 2VISA 4BZYA 3X14A 5DT1H 3VWJA 1R3IL 1OM3L 3KJ6L 3LOWA 5DTFA 1CFNA 3VGDA 1LO5A 1XGPB 3ME0A 1RJLB 1T5XA 1K85A 3T08A 4A6YB 1QSFE 4UTBH 3UYOD 2FD6L 2YPLE 4RIRA 4AMKH 1HSAA 1BVKA 2HKFH 4RZCA 5JZ7C 4KTYA 4LHUB 1FVDA 3MRDA 4RA3A 4R4BB 2ITCA 3MLZL 3REWA 3F62A 1VA9A 4PJ5A 4BQ9A 1U8HA 4HH8A 3V4PH 2C3XA 2VAJA 5GZOC 3H2WA 5FA3B 3P0YL 4PRDA 1MCHA 1A6VH 3LEYL 2XG4A 1RFDL 4L4TE 4PP2A 5C1MB 3IAGC 1CD1B 4LKXA 4PJAA 1INQA 4NJ9H 2MCG1 4KUCF 2R1XA 5IB5B 2AXHA 2OSLA 3QCVH 4J23A 3O4OB 3LKSB 3PNWA 3K7UA 5F8RC 3QNXA 5E00B 4LU5H 1FRGL 4X6BB 4MA7H 2R2BA 1FL5B 4DAGL 1CDUA 5H2BB 4L1HA 1XCQA 3UTPE 1CDBA 2B20A 4K8RD 4EN3D 3MOQA 5C08E 3RWDA 1BFTA 4XPFL 2P8PA 5IVNA 5JQ6H 3FB5B 4P5MA 2GK2A 5KSAD 3TZVB 4JG0H 3V0VB 1A6AA 5FYKD 3ARED 1S9WB 2XFXA 4EZMA 2N1KA 3I2CL 5INDA 2HVKA 1CFTA 1P2CA 4H8WL 3G5ZB 5E8DL 3T0WA 1ZT4B 2A77L 1VFMA 4Q6YA 2F5AL 1S8DA 1C5DA 5CP7B 1DN0B 4ZTPH 4ZYKA 1F6LL 5GGVH 3NIGE 2FATH 2ZUVA 2H9GB 3E1F1 1BJ8A 1CE6B 4QRPE 4AQOA 3QUMA 4F9LC 4L3ED 3LKNA 4ONGH 2K9UA 3ETBF 1MUJA 4XCEB 4BFEA 4IHOA 1UACL 1XCTA 4U6YA 4HMDA 1X5LA 4R97B 2X89D 4HJ0D 3I50H 3PV7A 4LP5A 4TUOA 3TYFB 2PYEE 3OJDA 1TLKA 4YGAB 4JFOB 1GAFL 1MPAH 3RWFA 5IBUG 5DRXB 1YEKH 2FNBA 4LCWA 4KDWA 2PR4L 5MENA 5DGQA 2ZUQC 2HT4C 1X4YA 4OGXL 2LVCA 3MFFB 3CLEH 2YEZA 2H26B 1KN4L 4JZJB 4JREC 1FO0B 3ILQC 5MI0B 3PWPB 4KPHH 3C5ZA 3H8NA 1BZ7B 1U92B 3SCMD 5LWYH 4M62H 1S5IL 1PX4A 2CK2A 1NSNH 1KPUA 3P4NB 3D18A 4JFXB 5D7JA 5TPWH 3X12B 4KZEH 4KMTH 3KXFE 3X3GH 3IXAA 1VGEL 4XX1G 3SJVA 5TE6H 5FGBC 3SDAD 4G7VL 4WNQA 4NOFA 4QWWC 1MCCA 2AJXL 5L8KB 3MROA 4MCYA 4PGDA 4NGHL 3SDDC 4NUGH 1XGTA 4NQDB 4I18A 5J6GB 1RZFH 3TN0B 5C6TL 4YK4B 3V52L 2B2XL 2YXFA 3ZO0A 3LKOA 4HUWA 4C56A 4XAKD 4NHUA 3UTQA 5EU5A 1I1YB 4ODVL 4XWOC 4HIEB 3AROA 1ADQA 4LSUL 5T33L 4I48B 3VRIB 5L2KA 3O2DL 5C0GA 3QPQD 3GSVB 3MRBA 4XNZC 4GFTB 4ZDHB 5IR1B 4RMQA 4N5ED 5CIPA 5IB3A 5CEZE 3DYPA 1TTFA 3ES6B 3CJJA 3RY5A 5EWIH 2FX9L 4JKLA 5DJ0A 2NY5C 4GRLA 1WBXB 3N1FC 3UTOA 1CQYA 2BMKA 1YN7B 4X6EB 4ZTOL 4YJZL 2QEJA 3QAZB 4ONFL 3L7FA 5I71B 3BD5A 1TZIB 2X2YA 2IANA 5C07A 1J8HD 5IQ7H 1C7TA 3MLXH 4UIMB 4ONHB 1S7WB 3DV6B 4M7LH 5SWSA 2VSCA 1A6UL 1I7ZB 4NNYB 3I6LE 5C2UB 4FS0A 4M7KH 1T7XA 2AEPL 4JFZL 5A2IH 2ZUUA 3V6ZB 2EE3A 4LVNC 4L8BA 4X6DA 1OAKL 2P24B 4M43L 1T2JA 5MP6L 2EYSA 1R3HA 5CLWA 2CUIA 4KRNA 1ZT7A 3N1GC 4P49A 3O3DA 3P4MB 5JXAH 1PJ9A 5GRYA 4BKLB 4Z7WB 2P1YA 5TE4H 2BDNH 1PKOA 4HS8H 4J4PA 3V7AE 3WJLC 4EUPG 2HAZA 1X7QA 4MB5A 3SDXE 5GSVB 3RZCA 4Y89A 4PJFF 3QWQB 1EHXA 4ZAKD 2K3TA 4GRWF 5GSRB 3SKMA 2WBJD 1AHWC 5I1JL 3K2UL 4OLWH 4M1CC 1I3UA 1RJYA 2Y9RT 3OAZK 4HX1B 3LKPA 3MRGB 4RFNB 3OZ9H 1F3JA 4WUUB 5BVJA 4OAWB 1KELH 2V2WB 1E27B 3DPBA 5I2IB 1NLDL 5GS0D 3P0GB 4EOWH 2OR9L 1JZ5A 2AV7A 2A6JB 2F74B 4QEGA 2Z4QB 2YMXH 1UWXK 5HI5D 4AM0A 4X5XA 2BHUA 1N6QL 1CGSL 4X4MA 4D0BA 4ACPA 4RFOL 1JZ4A 3BMVA 2CKBL 2O61B 2AEQL 3ARBA 3QWOA 1NCWL 3VXTB 2YN5A 4HKZB 4UTBL 4P4KC 4LLUA 4P0DA 4ALAL 5KVEL 4JG1L 4O5LH 1HHHA 3KHQA 4JDVB 1JE6A 1EHLH 4Y5XA 1KJMA 3SE9H 2FEDD 5MEQA 4Y4KC 2UVFA 3DMMD 4JR9H 3V4PL 1I7RB 2VQ1B 2OTWA 1N5YL 4OKDA 5HHNB 5FHAH 1MH5A 3U30C 3RDTB 5IW6B 2R0KH 2ADIA 1UXWB 2ZG2A 5KZCD 4I0CC 3ORJA 3HS0A 1HHKA 5KSVB 4NJ9L 2C3VA 2DQTL 3WS3B 5DA0B 3F7VB 4KV5F 4UIKL 1T2XA 3BVNA 4TVPD 1SHMA 4UNTA 1Y6KR 1U2HA 4KI5C 4F7MA 3BH9B 1WZ1L 2CGRL 5CLTA 1KJ2L 5EOCH 1SYVA 4J3XA 5CSGA 1T4KB 4LU5L 1CD8A 3REVA 1PAMA 4HXAL 5EA0H 4MHHG 1BREA 4HJJL 4QOKA 5E5UB 3VWJC 3VXUB 3ZKND 5C0JB 4ZFOB 4XXCC 5ILTL 2FYYB 2BNQB 4NNXA 3MJ9H 3MCKB 3B43A 4R96B 1JNLH 1JTTA 1MHEA 4LKCB 3PL6D 2B8OT 2FWOA 1FZMB 5KS9A 3QUYB 1J5OL 4CU8A 2Y23A 4LPCA 2MNUA 2CMRL 3FQNB 3I3BA 5AAMA 2JF1A 1GZPA 1ACYH 3VFSA 2L4OA 1S9XA 3TBWA 2ADGB 3PQYD 1Q9WB 2E6QA 1JV5B 3D85A 3BZEB 3I6KA 4PJ7F 2VDNH 3QA3A 5KN5B 4KRPC 1JF5A 1DL7L 4QHNA 1FVEB 1R5VA 3P30H 4HPYL 4UDTA 3HCVA 2AJUH 4YPGA 1KPVA 2VTFA 4N8VA 1N4XL 3P11H 4HWEH 5HHVH 1FFNB 1GZQB 4ONGL 3MV7B 5IMOB 4LSQL 5F9OL 5T3ZL 2R4RL 2YZ1A 1A8JH 2HYMA 5JLZB 5F96L 2JCCA 4EDWL 2G5BA 1AY1H 3DTXB 3BDYH 4H0HB 5FOJA 1A47A 4HDIA 5I1AA 2BNRD 1C5CL 5ISZE 2VUYA 5J0BA 3CVHH 5C0DA 1YEEH 4FP8H 3P77A 1ITBB 1S9YB 2BY0A 4F15B 1QQDB 5DJ2A 3CLEL 1F4YH 3C08L 5DHYB 2EECA 2EYTA 4WEUD 4KPHL 2AAVA 4NKIH 3MA9H 5C0EB 2C3GA 5LWYL 4M62L 4J7RA 5KVDH 4Q9RH 1NSNL 3IFPB 1G7JA 1MJ7H 4N0UE 1I7TA 4MNGB 3KPRB 4ETQA 3KNBA 4R0LA 3TV3H 4WW1A 4KMTL 2EIZB 2B4CH 3C5SB 5DQDH 4B5EA 1QSEA 2XZCL 3MBXH 5ENWB 2AJVH 4GW1A 5T5NF 4AH2B 4KJWD 3GHBH 1BIHA 2AV1A 5TE6L 3QFDB 1YY8A 2NY6C 4HKJB 4MXQD 5IM7B 2Q86B 3ULVF 4ZUVA 4K3GA 2WSKA 3L5XL 2PNDA 3C6LA 3HZYA 4XCCH 5TDNA 5GS0H 4NUGL 1N26A 3V5HA 2P4AB 1NGWB 3FT4B 4JJ5B 3QH3B 4PY8J 5BZDB 2ZOKB 3MRFB 1N7MH 4JQVA 4JPIA 4JRYD 4KKAC 4QHKI 4R2GB 5MERB 2FR4A 1CICA 3MRHA 3UTTE 4OZHA 3CX2A 3U46B 3C5ZC 2EH8L 2DM4A 1AO7A 4WTWA 4UT7L 2CIKB 3TO4B 4GAYA 1MAMH 3NZ8B 5IQ9B 2DMKA 2CO6B 2VXTH 4HS6A 5D7JC 1YYMH 3GJEB 2IJ0C 1DR9A 1AGDB 3VXRA 3IDJA 3MBEB 2OMBA 4OZFG 3P9MB 2I26N 3T65A 1ROWA 1JN6B 4UAOB 1F4HA 4PRPD 2CUMA 4TSAH 5CD3A 1LO2H 3EDFA 4HK0B 3RU8H 4ZS7L 3OG4B 1B0GB 1X5GA 2H32B 4I18C 4WV1A 1TCRA 2B1HL 5ABDE 1F5WA 5F7UA 5IBLD 3MRPB 4TVPH 3KPMB 4Y4HD 3WNMA 5IFJA 5I15L 4YR6B 1VGKB 3QEUB 3L1OH 3BT2H 1KF9B 2P8LB 4K8RL 3F12B 4L8CA 1JWUB 3G6JE 4GG6E 5E5MB 4ZPVA 3SE8L 2BOBB 1QSFD 4KK5C 3S3PA 2YPLD 1MCIA 5JXAL 2WLZA 1KACB 3HHRB 3CPLB 3PF2A 2G60H 1D6VL 5TE4L 4ISVA 4HFUH 3W82A 2ZSWA 3NIFE 5FYKL 4NSKA 2LVEA 4HH9A 3PIQA 4HLJA 4GRLC 1WWWX 2Z91A 4CW1A 4HUNB 4PY7A 5E94A 4LF3B 2J8UF 4WJ5A 1QRNB 4L4TD 3CLFL 3H7LA 2YUXA 1CGWA 3QO0B 5IKCB 1EFXA 2A2QT 5J13B 1KELL 3CH8A 1DLFH 1DUZA 3L6FA 3A67H 3W0WB 2XXCB 1UADC 2OYPA 4YHLL 2JJVA 3LRSB 4MAUH 5F21B 4Y19A 4ORGA 4FFYL 3TJEH 3GBNL 5EUOA 1IAOA 3UTPD 2BHZA 1HHJB 3UTZB 4PGEB 1FG2A 1XIWA 4H20H 5C08D 2RJMA 4KHTH 5H37G 3CC5B 4EJ1C 3WLBB 5EU6A 1FLRH 5E8EA 3T77B 3WUWB 5I76A 1AC6A 3O9WC 4PLKC 3FQWA 3MUHL 3TVMA 3RP1A 3ZKMC 2GJ6B 4GAJH 5F3BA 2VQTA 4J4PC 1MREL 4MJIA 4UBDD 3TNMB 2CLZA 5JA9A 4CJ0A 4JKKA 4O5LL 4R7DB 3RZCC 3SOBH 1EHLL 3QDMD 2X1PA 2E9JA 2GKIA 4Q97A 4M6MH 2W9LA 4JR9L 1R3KA 1X5KA 4AENB 3D0VB 2E3VA 1Y18A 4P2OD 4HBCH 4I3GA 2X1OA 1URLA 2R0KL 4HC1A 4QRPD 5I19L 1EHNA 2IQ9H 3FMGL 4IOFD 5F88B 2G2RA 1HI6B 2NY4C 4YDVA 5DD1L 3HAEG 4OD2A 1DQDL 2PYED 4BH7B 2XN9B 2VR5A 4NWTL 1D9KB 2I07B 3DO3A 1DSFH 3QIWD 4NN6B 5D4QA 1MNUH 5EA0L 1T04A 1T3FB 4QHLB 1CVRA 3MO1B 4BA8A 2QADB 4XMKH 1N2RB 1A5FH 3ARBC 5KW9H 3SE4A 5MEPA 2R0ZH 2DN7A 3VD4A 3GIVA 2NMSA 3P9LB 4GKSA 1OF2B 4Y5XC 4JM2A 2P43B 1RJZB 2GJZB 3LN9A 2HLAA 4M03A 5I17A 1MFDL 1ACYL 1M7XA 4X99A 5C09B 3NPSC 3KXFD 3S98A 3R8BB 4DN3H 3QHFL 5A3ID 5D93B 4A2LA 1MLBA 2YBRB 1BLNA 3P30L 5IEKB 1UM4H 4WWKD 5A2FA 1NAMA 3HC0A 4FG6D 4HUVA 4ODHH 1QFHA 4LSPL 1OGAB 2HTLC 3EW3B 5J11C 2A1WL 1LDSA 3VXME 3WFCH 1Q0XL 1ZGLM 1AJ7H 4FNLH 4TPRL 1RJLA 1RVFH 3FN3A 2NYYD 4LCIL 1G9NH 4LLWB 4A6YA 3CVHL 4GW4B 2OI9C 2DICA 1BX2B 4IRZH 3ARGA 4O58H 1O7VA 3FZUC 1VEPA 3SE3A 2Z31B 4Z7VA 5HBBA 2UZIH 4KFZC 1KB5A 4X7FC 4K94L 5CEZD 1FIEA 1PVHA 5FA3A 4JQXA 5DMJB 5JW3H 3MSPA 3NCEB 4Q9RL 5JUEH 4PTTB 5C0CB 1CD1A 4X8JB 4PJGF 5IB5A 3BPOC 2FX8L 3TV3L 1H3XA 4D2NA 1NAKL 5J57B 1HE7A 4TRPL 3VXPA 3LKSA 3SKOB 4YO0A 5E00A 4XNMB 4NM8L 4P2RB 4WIQA 4AJ0A 3BFOA 1FL5A 4TTDD 4S1RH 2VWEC 1MIMH 1J0IA 3GRWL 3LN5A 4OUOA 3I6LD 4X7EC 4XCCL 5GS0L 4LDLB 3FQRB 4LSTH 2CUHA 2AGJH 2H2PD 2OTUA 5HYEA 3FB5A 3TZVA 2V2TA 4M5ZH 2YSSB 3MLSH 4ZOCA 3K0WA 4NDMA 4G42A 1S9WA 3OJMB 4PJ5E 2J88L 2XWJB 5F7YC 5L8LB 3MLTB 2V7HA 1WBZB 2AQ2A 3IFOB 4UILH 1VB9A 3G5ZA 5E6IB 1ZT4A 4C55A 5DZOA 2A74B 4K71B 5FB8B 2PO6A 4PJAE 3QNZA 3H3BC 1NCAH 4O02L 1Q94A 1SBSH 1G7PA 1EEQA 2VXTL 3MLVL 3FOMB 5J56B 1RPQA 1YUHA 1CE6A 3CXHJ 5JW4R 2GY7B 1K9TA 3DVFA 4FXLA 4Q9CA 1TIUA 2PXYC 1G9MC 3RA7H 1G84A 5GZNC 1JWMA 1D5IL 1N64L 2C3WA 3TYFA 3DOSA 4JFOA 4YHOH 5FHBL 3C6LC 1TJGH 4MZ3A 5JORB 1U3YA 4YHPB 4HSQA 5DRXA 3O6LH 5TF1H 1CK0H 4KKBD 4UV4H 5DFVC 1JRHH 4KKLC 5HI4D 3LEXB 1JI2A 4YFLI 1ND0B 3MR9B 3QUXD 2RBLA 3HNTH 4JQVC 4Q2ZA 4X4ZA 3O45B 4JZJA 4O2CB 3KPNA 3S34H 5HVHB 4KTEH 1U92A 1DANT 4TN9A 1M6OA 5HYJA 3BT2L 4KAQH 25C8H 5HYFA 1J11A 2DJSA 4AL8L 3MGOB 4URTB 1JRHI 1KC5H 4IDJH 4JFXA 5DJ8B 3X12A 3O8XD 3ZE1F 4DK6A 4XBPA 1SY6L 3NA9H 4N0RA 1MJJA 1V8HA 5FF6A 1T7WA 2DS4A 2DQFB 4RAHA 5CJOH 5BCAA 3QT2A 4X4YB 4Z78B 2BRRH 5E9DA 2DQJL 4GBXC 4AIOA 5J6GA 4LCWE 1PG7W 5FAAA 4ZD3H 3FTGA 5MENE 3QUZB 1EK3A 1MAKA 1T22B 4KQ4L 4WV1C 4G6JH 1PGRB 3A67L 1T1XA 1ZVHA 4OGAC 1I1YA 2XTJC 2HT3C 3JUZA 3LVEA 4I48A 1S7XB 3IXTB 3VRIA 1R24B 3RVUC 1HQRB 2P5WB 3ISWA 1EO7A 3GSVA 5D96B 2EXWC 3FJTA 4ZDHA 5IR1A 4H20L 4KHTL 4G9FA 4JFDB 2DD8H 2R4SH 2VLKE 2B0SL 4XVSH 2EE6A 5SX4H 3SJVE 3HG1B 4PJFB 1WBXA 3EFFB 3OKEB 4GRWB 3LRGA 2MQ0A 4R3SB 1YN7A 3WDHA 3DI2B 5CEZH 4X6EA 1CYGA 3OJ2C 3PABB 4R8WH 4L4VB 1N0LA 4YHIB 1U8JB 4L8DB 4UIMA 3DV6A 5SX4I 4JGJA 4HBCL 4NNYA 5ALBH 4C56E 2R2EB 2XY2A 4BFGA 4E0RB 4OV5B 1KT2A 2DI9A 5GGTH 1OAQH 1UB5B 1A7BA 5E2VH 4DTGH 2DL9A 2APBA 3DVNB 5L2KE 1UG9A 2XWTB 3E8UL 5ID1B 2A73B 2R0WH 1UJ3A 4ZNEA 2W0PA 4WEBH 5K9KB 4AQ1B 1GOHA 1DSFL 1XIWC 2FL5B 4R7NB 3GFUA 1MNUL 1IQDA 5JZ7D 4LMQE 4P5TA 3BQUA 3TVMC 4WDIA 5AG8A 3OR7A 5J1AB 3VFRB 3CAFA 4NO0B 5GZOD 3TCLA 1OOAA 4O9HL 4F33B 1CLYH 3CDCA 2APVA 1Z0MA 3SGEH 1Q9LB 5D5MA 1TXKA 4LHJB 3CZFA 2EC9T 3TP4A 1AGEB 2XKNA 3BEWA 1WAAA 2IANE 3NTCL 5C07E 3G6DL 4HX1A 5F1NB 4Y16C 4XP6L 3MUGB 4UUJB 5SWSE 4OAWA 1EAPB 5E4IA 1E27A 4DN3L 1I85C 5BS0A 1ACZA 5CUSL 4U1KB 5FYKU 2IAMA 2J5LB 2A6JA 3SGEI 4X6DE 4LQ1A 3KG5A 4QKXB 1K5NB 2KH2B 3EOAB 1CXEA 1P4LB 2B7DT 5BV7H 1QKZL 3FQUB 3AS0A 1AJ7L 2O61A 2RGSA 4OD3L 3MZGB 3VXTA 3JWDL 4HKZA 3EUUA 1ZS8A 3L7EA 3FO9B 3SE4C 2AXJA 1RIVH 4RWYH 4HWBH 4NHCH 4JDVA 3UTTD 4O58L 1HINH 2Q7NA 4OBSA 2V2XA 1J9CT 5JIIA 1ZSDB 4JM2C 4Z7QF 2QSVA 1BJ1J 5TJWK 3V9FA 1H15B 3EO0A 3F8UB 1X5XA 3RDTA 3DGCR 5IW6A 1FZKA 4PJ7B 1UXWA 1NJ9A 1UM5H 1A1OB 5KSVA 2D9CA 2AJZB 4EDXB 3BRDA 3KPOB 4RQQA 1JL8A 3WS3A 4DGVL 4QHUB 2YK1L 5HHMD 1WC7B 3CD4A 1KCVH 2A83A 1OWRM 1IC7H 2LE9A 1T4KA 4X4ME 4V1DB 3S37L 1E28B 1ZANL 5ID0B 1MIML 1JIBA 1YMMB 2Q8BH 1A7OL 3VXUA 5C9JB 5FUOL 4OCYH 5FDWB 2VZ3A 3ILQD 5TDPB 4ZFOA 4MCZB 3I6GB 1YEHH 2VKWA 2VKXA 1F8TH 2IADB 3ZL4H 1FYTB 3MLSL 2I24N 4R96A 4WTXA 2R39A 4JPWH 4X6CF 1A21A 2MJWA 3MLRL 1FZMA 3QB7C 3QUYA 3RNQB 2FIKB 3SE3C 3U4BL 5JPNB 3QCUL 3FQNA 1CDCA 4UILL 1MQKL 4MJ4A 3PWUB 1DDHA 2IF7A 5IMLB 4JZNB 3W81A 4YHZH 4G8IB 1JV5A 4M7JH 1NL0H 3VXOA 3BZEA 4QWWD 3V6FB 3LZFH 1AQKH 1OAXL 1FVEA 5DMGC 4JRXA 1H0DA 1BMGA 3SDDD 5DHVA 3KAAA 5IMOA 3O4OC 1V7ML 3THMH 3ZE0F 3N50A 4OI7A 2EIDA 3B9AA 3K1KC 2DQDH 2NZ9C 3TPKA 1ZHLB 2WIMA 5D8JH 4PRHA 4XTRC 4HUXA 2L7UA 4XWOD 3IS0X 1H3TA 4ZUUA 1C16A 4JFFE 5D2LB 5EO9B 1F58L 5EC2B 5HPMA 2CK0H 3TZVC 1JRHL 2HJKB 1QQDA 2W59A 1K8IB 2OJZH 4XC3H 2ICWB 5KS9E 5DHYA 3BD4A 5GRXG 2AABH 4YX2L 1IQWH 4LPXA 3KYAA 4GSDL 2XZAH 1RUAH 1QNZH 4OZIF 3IFPA 1RZKL 2WM0A 2PO6C 1IKNA 1KC5L 4Z0XA 4WUKL 3KPRA 1JFQL 2JB5H 4L8SB 4JGUA 3VA2C 3UAJC 2EIZA 5E7BA 1KXVC 1YNKL 4OCRL 3HNSL 5ENWA 5C0AB 3V7MA 4AH2A 1FNGA 1NCCH 4JHWH 1DCLA 3QFDA 1BP3B 2JCCE 4U7KA 4G3YH 2VWEE 4HKJA 5CJOL 3ULSA 4OTXH 4R97C 5IM7A 2Q86A 1WWBX 1X5JA 2WANA 3DRTB 3FCTB 1NGWA 1QBBA 4IJ3C 4F7PA 3L3KA 4JJ5A 3QH3A 4JKPL 2ZOKA 2X1WL 3MRFA 3C5JA 3QDJB 1K4DB 4MDJA 2GW5A 4V2BA 4NBYB 1GGYA 1NMCC 3QIUB 2KQMA 3EO9H 4DGYH 4JZJC 4JO3L 2BSRB 2CKBA 1T1YA 2CXGA 3CMGA 1WF5A 2EZ0C 4IRJB 3U46A 4DFIA 3ROLB 2VXQH 4CN4A 5J9PB 2CIKA 3TO4A 2V17H 1FAKT 3EZ8A 2R4SL 3R06B 3GJEA 1QSEE 3QXWA 3IDMB 1AGDA 4M1CD 4W6XB 5CILL 4L29A 1A1MB 3C8DA 5DURB 5DMIH 4F8TA 1X6LA 1MFBH 4RMUA 3C60A 2J8UB 1SYSB 3ZDZE 4Q9BA 1JN6A 3HZKA 4JPKH 4R8WL 1UGNA 4HWZA 1JGDB 4Y4FB 3K4ZA 2GSIB 5C0RL 1MSPA 2H32A 1UKTA 1A3LL 3LMJH 2CJUL 3ZTNL 4MQSB 4JN2A 1NGQL 3MRPA 4PREB 3KPMA 3QDAA 1OAQL 1V5JA 2EYRB 4DTGL 3L3GB 4L1DA 4DQOL 4OZHE 3VXMD 3N1MC 4Z7NE 3PWNB 4IRSA 4JAMB 3F12A 1M4KA 1TVDA 1JWUA 4P4KD 1PBYA 5E5MA 1FNSH 2BOBA 5GS1B 4NZUL 4FXGA 3CPLA 3UROR 1GPOL 3QIBB 1X5IA 3VXRE 4Y4KD 3OJVC 4FQPA 4DJMA 5HJ3B 2JB6A 3MPCA 4CU6A 5B3JE 1F13A 1NCDL 5GISH 4I2XB 3FRUA 5F3HB 4FQLH 4LF3A 2V6HA 4QHMB 3SO5A 4HIIB 1HHGB 4HKBA 4FTVB 3D25B 1QRNA 3QXUA 3T4AB 1QBMH 1XZ0B 2D0HA 5DVLA 5BMFH 5I71C 5I16B 4LCYB 1VKXA 1QO3B 3QO0A 3ARFD 3O2WL 5IKCA 4KI5D 1DBKH 5DC9B 4ZOAA 3W0WA 4XZUA 4JFEB 5I8KH 4GMTL 2WUCH 3VWJD 3WFEH 2ARWA 3HN3A 1HHJA 1ZEAL 3UTZA 4ZO9A 2XICA 3PP4H 5ACLA 5GJSH 3HUJF 4G6MH 5BV7L 3OF6A 1EH9A 4YAQB 3WLBA 5B39B 5AZEL 4P5TC 3G5XA 4JEGB 3OMZA 1CTNA 1CI5A 3GGWB 4PJ5D 2CD0A 4HQQL 1B6UA 3C09B 3WD5H 3QSKB 4R7DA 1ZVSB 1RIVL 2J1KA 3LEVH 3V6BR 5I73B 5L2JB 1B9ZA 1HINL 4OBRA 2ENSA 4KRLB 2HTKC 4KRPD 1QG3A 4OIIL 4RFNC 2VUOA 4CVXB 1YPZB 3WBDA 1A9BB 3B3IA 1UM5L 4OM1L 2P5EA 4M61B 4U6XA 4Y19E 5IVXF 3V4VH 2IAMC 2Y1VA 4FQXB 4HUMB 4HIHB 5EUOE 1ZLUK 4XPAL 3CSYB 1MCLA 4XI5C 3MMEA 4BH7A 2XN9A 1G7IB 2OL3H 1G7QB 1IC7L 2I07A 4QY8B 3TO2B 4KZDH 1W8OA 3MV9B 1MJUH 4PJBB 3JV5A 3KPQB 1IZKA 4MNQB 4RA0C 1T3FA 4QHLA 2FIRT 5EU6E 1NGXA 1N2RA 1KCRL 3MREB 1KTDA 4PY8I 3H6JA 4RAUA 5ANMA 4XB8A 4HPOL 4MJIE 5JPMB 4F57H 1ZHKB 3ZDYE 3D6GA 4NBZB 1EO5A 5IB4B 5FM8A 1MEXL 3BGFB 3P9LA 5CHNA 3QXVA 1OF2A 2JE8A 2W60B 4NKDB 4O2FB 3H9ZA 2K1MA 2GJZA 5L88H 1O5DT 3UMTA 5CCKH 3LD8B 4UDUB 3HAEB 1NGPL 5C09A 3U7WL 4GKNA 2JIXA 3RDTC 4PJGB 4BZ2H 1INDL 3KPSB 2FB4L 2NY6D 3LZFL 1AQKL 2YBRA 3GSOB 3EYUH 4OV6F 1LE5A 2A6DB 3WHXB 5JA8B 3VW3H 1CL7L 3VGGA 4NKOB 4PG2A 1OGAA 2NNAA 4LCWD 1M05B 2VZ1A 4N90E 2FBJH 4P9HL 2GTZA 1R5IB 4DW2H 4P99A 3V8CA 5CKAA 5I74C 1IGYA 4KKAD 3DSFH 4LLWA 3VCLA 3CCHB 3E6FB 4MA8L 4L9DA 4DK3A 2CK0L 5EOQL 3C5ZD 1BX2A 4NQUA 1FH5H 2Q87A 2OJZL 1HNFA 4XC3L 2VZVA 4U1HB 4M5YH 1RULH 2DIBA 3QUYC 5L0QB 5D7JD 3BXNB 1HQ4B 5IGXL 1PQZB 2XZAL 1FFQA 4I9WD 1UH4A 2EDHA 2V5MA 2Y7QB 1JWSB 2VLJE 3IU3B 1FCGA 1QNZL 5JOFB 4PTTA 3SJVD 1QLFA 2AI0H 4IDLA 3N85H 3NCBB 5E4EB 5KOMC 4KQ3H 4X8JA 5DR5L 2JB5L 3NCMA 4QTHB 1U8QB 3AM8A 4QTIH 4R26H 1VPOH 1DQJA 1FNEB 1S7RA 1ZMYA 4WU5B 4YDLB 3FQXA 4FQCH 4KVNL 5LQBH 2YRZA 4OTXL 2J2ZA 1EX0A 12E8H 3BHBB 4UINH 2VXVH 1L9MA 4QNPF 4Z8FH 4C56D 2H41A 3D0LB 1F4XL 3Q6GH 4G6FD 1QLRB 3FB7A 3S4SG 1NC4B 2YSSA 1UT9A 5L2KD 1Q1JL 4RAVB 3TBVB 2G9HA 5EZIH 4F15C 2DQHH 4M6AA 4Z7VE 1JHTB 2C1PB 2XWJA 3I02A 4KK5D 3EO9L 3MLTA 4J1UB 1NFKA 3IFOA 4C4KT 2Y5TA 1OAYL 3H3PH 2IBZY 3LS5H 4FZ8L 1BQLH 3UYRH 3GMOB 1NFDE 4X6FB 4PJXF 2A74A 5FB8A 1O7SA 4PRBB 1HWGB 4GRLD 2V17L 3WJJA 5JTWA 1EHAA 1XH3B 3VI4E 1IILE 3MRLB 4RDQG 1IKNC 3UJTH 1FGNH 4CMMB 4AG4H 1BFSA 3E6HB 5DD0H 1PG7X 5GRJH 4N1CA 1F90L 3OGOE 4BQ6A 3JV4A 4RMSA 3VI3F 1TETL 5FDYA 2X4QA 2BVOB 3CH1B 5SWSD 4J6RL 1CN4A 5JORA 5KSBF 1T0PB 1CVSC 4YHPA 4OM0L 3BWAA 1M7IB 2Z93B 1UCBH 1B2WH 2WW8A 3LEXA 5K9JH 5TFSH 3Q1SH 1TZGH 4XMPL 3MR9A 5CBAA 5H8DA 2UWEF 3ZE2F 1S7QA 4PLKD 8FABA 3ZKMD 1NPUA 3TH2T 3ARTA 4J4PD 3IYLW 2HVJA 3MGOA 2VDRH 2PW2B 5E1HB 2NCMA 5C0IB 3TO4C 4XMLL 1A7RL 5DJ8A 1L7IL 3UPRB 2FZ3A 3RZCD 3IKCA 3OR6B 4KROB 3H3KA 4GAGH 2QQNH 5DYOB 4PJ9B 1TTGA 1KLGA 1CLCA 4N9GB 4X9IA 4MVBC 1IE5A 3QDHA 5GISL 4X4YA 1BZ9B 1U3JA 2NY7H 3C60C 4I4WB 4DGIL 3O6FB 1BQHA 4UAOC 2O5YH 3VFPA 3LCYA 1CT8A 3VD3A 1QBML 4HD9A 4GRMB 5BJTB 1IM3B 3WUZA 2NY4D 4UI2A 4F2MB 3QUZA 2X4SA 5FYJU 1MOEA 1DBKL 1KTLA 1X5ZA 1RMFH 4X4XB 1UVQB 4NN7B 5I8KL 5JOEA 3I84A 4MD4B 5F7NC 1ZA3A 3WHE1 3CDFA 4TUKH 1NUDA 5DFWH 3KHOA 1FV1B 3IXTA 4I3SL 5HYJE 3WFEL 1HQRA 2P5WA 3ARBD 3OSKA 1SJHB 4IRSC 2VAAB 3PP4L 3U6RB 3AY4A 3MOAH 3NH7L 1WWAX 4JFDA 4S1SL 4GXUM 4LSVH 5GGQH 3TF7C 1AFVL 4PJFA 3EFFA 3EYVB 3WD5L 4R3SA 2WAHA 2GQHA 3ZKXB 2AK4B 5DUML 1NBYA 3DVGA 4NZDA 3ULUE 3P40A 3PABA 3ECBB 4L4VA 2NY5L 4MYWB 5E9DE 2QSCH 5IESH 1B0RA 3Q6FA 2QTEA 4YHIA 1U8JA 5LAXA 3DRQB 2QQKL 2F19H 4KH2A 2WBJA 2AXGA 2R2EA 5J13C 2HTLD 3IJSA 3NAAL 1UB5A 3OKLB 5H94A 2MKLC 2DYPB 4MA3A 4TULH 4W6WB 4DZBB 1SM3L 2Q3ZA 4OLUL 4Y1AA 1A9EB 2UV3A 1CFSB 2XTLA 2RQ8A 4QOKD 1F4WL 4FRWA 3TBTA 2A73A 4KZDL 1NEZA 3BKMH 5K9KA 1ADQH 2FL5A 4G9FE 4R7NA 3UJIH 1HKLH 1BPVA 4LFHD 2IFGA 3FZUD 2EDQA 3ARRA 3RY4A 1FFOB 5K59E 5J1AA 4F57L 1PZUB 3VFRA 4NO0A 5HHPA 4F33A 3PHSA 1AKJB 5CIPH 2IALA 1DQMH 1Q9LA 3G9VA 5I1DB 2NTFB 3P4LA 5J8OA 4QXUH 5EOTB 2ADFH 3MUY1 3RKDC 2AK1H 3D85D 3U2SB 2LAGB 3BMWA 1MHHB 3SO3B 2O26U 4OLXL 1LO0L 4KY1H 3MUGA 4UUJA 5I30H 4OZ4B 1U93B 5F9JA 1EAPA 2XNAA 1J0YA 5EO0B 4OLZL 2MQCA 1GIGH 2DLTA 1XGUA 3GJFK 4BZ2L 1CD9B 4OIAA 1TPXB 5EU7C 3BZFB 3L95B 3MUZ1 3NIGF 4LMQI 2EEAA 4ZPTB 2C3HA 4OKVB 3EYUL 1PSKL 3AU1B 4I8DA 3RX8A 3IDXH 3QEQB 5DJCB 4ZNEE 3FO2A 1F11A 4CNIB 1P4LA 3VFMB 3MXVL 3U0TB 4NN6C 3ABZA 4DW2L 3RHWF 1EEYB 1QP1A 2QADC 3Q3GB 3RWIB 1W72B 1A14H 3QRGL 4CDHA 1TJIH 3JV0A 4L3AA 2ED7A 4ZFZB 3UC0H 3GMPB 5D5ME 2HFGL 4KDVA 3TT3H 4HKXB 1WAAE 3BPNB 3ZTJH 3JSSA 3ZYIA 1QR1B 1H15A 3SQOL 3BZ4A 1GXEA 1SY6A 5E2TL 2BNUB 1QSED 4DVRH 3MTRA 3MNWB 5BS0E 3QXTA 3V0WH 3N85L 5GZND 2AJZA 3KPOA 3MRJB 1S9VA 4OCWH 3EGSA 2OM5A 4JO2H 2NW3B 1KPRB 4G5ZH 3C6LD 4XP4L 4Z5RA 1WGOA 3M17B 4NRXB 4PG2C 3DUHA 3V7AG 5DFVD 2X4UB 4KKLD 1BVZA 1OARL 4YEEA 4UINL 4D9QD 1YMMA 5JMRA 2IBGA 2VXVL 4MMZC 3Q6GL 1AH1A 2GT9B 1HCFX 1P7KB 3STZB 5FDWA 4GXUN 3I6GA 1H3PL 1RZ8B 2DIJA 3GSWA 1GOFA 3BKJH 1FYTA 4I3RH 4QRRD 1E6JH 5KSAB 2VZSA 1X4XA 5F9DC 1E6OL 5C0BA 3QFJB 3A6CL 3UPCA 1AO7D 2GSGB 5BVPH 3GBMH 5JPNA 4LRNL 4XXDA 3LS5L 4QT5B 3WXWL 4OZIB 4GW5A 3PWUA 2R1WB 5DRZB 3BIKB 3VXRD 1QFUH 1NC2D 4G8IA 2RR3A 3DI3B 3BJ91 1AI1L 4K55A 3V6FA 2VH5H 4FFVC 3BAEL 2WWMC 4TTGA 1I1AB 1U8MB 5HHOA 1UZ6E 3RQ3A 2H2SC 4EI6B 1MJ8L 1LEGB 3OHXA 4U6HB 3A6BH 3CVIH 3E0GA 4L3EB 2FHCA 3LS4H 2ZSVB 4EKXA 5BQ7B 1ODAA 3KLSA 1ZHLA 2XQYG 3VGAB 3IGAA 1QA9B 4G8FB 5ITBH 4JO1H 4OGAD 3VXUE 4DCQA 1UA6H 4FZEL 2R1YB 2HT3D 2VDQL 4WI2A 1C1EH 4UOW0 1KCKA 1F97A 2VSDA 4WTZG 3TT1L 5CD5D 5EC2A 3RVUD 2FGZA 1B2WL 2EXWD 4PBWD 5F9AC 2IPTL 2HJKA 3Q1SL 1K8IA 4Z6AT 1R5WA 1QFPA 1WZKA 3W39B 1G7LB 1IC5L 4MSWA 1DFBH 5T5FH 1J0KA 2P44B 3ARWA 4HFWA 1BGXH 4Z0BL 4N8CH 2NY0D 1VADB 5SWQB 5E6IC 3SCMB 3WS6A 3DUSA 4K71C 1H3GA 1MWAB 3WJJC 3ILPA 4JRXE 2J6EA 4GAGL 2CLVB 3OKNB 5C0AA 2HRPL 5F7MC 3SDXF 1AR2A 1I9RL 1KCLA 4NKQB 4PJ8B 3EYSL 1LO4H 2NY7L 4I0KA 1EFXD 4U4BA 5J4MA 4PRHE 1AGCB 4H1LA 3NCYP 2MMXA 3D9AL 3DRTA 3QUML 1Q9KB 3H9YA 4PJDF 4TSBL 3KYMA 4JY5H 3QDJA 3TH3T 5GGRY 4Y2DA 3RIFF 1LO3H 1RV6X 2GK0B 1RMFL 5KTEH 1XIWD 4XH2A 3IDUA 4TUKL 1BF8A 5LBSL 2BSRA 3RVXC 1H8NA 3BP6A 5EU6D 3WFHA 1IAKB 3TVMD 3QR2A 5MEOA 1BJ1H 2AJ3A 4JVUA 1IC4L 3RUGB 5C9KA 3KPRE 5CZKA 1LEIA 2I5YH 2MWCA 5TQ2H 3R06A 3BUTA 4LSVL 3TNNB 3HB3D 4Y16D 2F8OA 3HI5L 4CN6A 2J8UA 1SYSA 5FM5M 3ARDA 1F6FB 3O4LB 5E56A 1DE4B 3U1SL 3TA3A 3RBGA 1JGDA 3LIZL 4Y4FA 4Z7OF 4F7CA 1HK6A 3GSNL 2VC2H 4H26A 1KB9J 3S88H 1J8HB 1IEBB 5I1GH 3QUZC 3LHPH 4TSCL 3T3PF 4PGBB 3CMOH 5ETUA 1QYGH 1G6RL 1KBGH 2VLLB 3BP5B 2EYRA 3C2SA 4TULL 2YRPA 3TYGL 4RGOH 2GAZA 3L3GA 1JUFB 3CVHB 5IJVB 1NUNB 4N90D 4NRYB 3HUJB 1NCNA 1X5AA 4A2MA 1MCPL 5D96C 1IZJA 1EGJA 3B9KB 3BKML 4P2QB 5GS1A 1ADQL 3AY4C 3RBSA 3UJIL 2HN7B 1HKLL 4MQTB 3I3DA 5AG9A 4CADA 3QIBA 4HW6A 4PGJA 1BFVL 4ZO7A 1B88A 2IMNA 5ESVA 1FBIL 4JM2D 1OAUH 3KPPB 5HJ3A 5DVOA 1KCSL 5F70A 1OL0A 1FIGH 5ESQB 4P46B 3DGGB 4K94C 4I2XA 1DQML 5F3HA 4QHMA 3C2AH 2EO1A 5E03A 4FTVA 3D25A 4ZAKB 1NDGA 4H25B 4P57B 2XPGA 4QXUL 2ADFL 1KCUL 5I16A 4WHYG 5I30L 4BSWA 2OJEA 4DKEL 3QDMA 4KRMB 1C7SA 5IVXB 2C7UA 3G08B 1EVTC 2NX5A 2QQQA 3QJHA 2R9HD 5AZ2L 3FO0H 3INUL 3RFZC 3OXSA 4HIXH 2X5PA 4RSVA 5HTSA 1PKQB 4LLVB 4XNUL 1U3ZA 4XP9H 5B39A 5ITFB 4QXGL 4TOYL 4OFKA 3ARGD 1SJXA 4LPTA 3T04D 2D7NA 1I3GL 4YHNA 4HGWB 1RZJH 5E8NB 1TJIL 4PV9B 3QIWA 1MFNA 2C4FU 3MODL 3UC0L 1ZVSA 3JVGA 4NQCA 5L2JA 1C08B 4E41B 2ICES 1I8LA 4KK8C 1LD9B 1T6VN 3CU1A 1S7UB 5DMGD 2VDOH 3VFOB 3DMMB 4UTAH 1S7TB 1DVFA 2FJFB 4CVXA 4U31A 1TFHA 4C57C 3W0WE 3S5LA 5T3ZE 4X7TB 4Q58C 3V0WL 2E8ZA 1MLCB 4FQJH 5ALCH 5KZCB 2J5LC 2NZ9D 4FQXA 3LSOB 4HIHA 3UJJH 3GMRA 3CSYA 3OB0H 1IMHC 4JO2L 4KGLA 4XTRD 4K9EH 1AE6L 5TGBB 1L7TL 1G7IA 4RISH 1BOGB 1G7QA 3MYZA 4QY8A 1A7PH 4ZFFA 2ZG3A 3R0MA 3MV9A 1NDMB 3KPQA 1UWGH 1YNLH 4WWKA 1U8OB 3TZVD 3DO7B 4W4OA 1UYWH 2DBLL 3MREA 4Y2OA 1VFAB 1CFQA 3VFUB 1YEFL 2XYCA 4LSRL 3VU2A 5JPMA 1JF1B 2PYFA 1ZHKA 5T3XL 5IB4A 1T03L 3HE7B 4Q0XH 2OZ4H 2H1PH 1E6JL 3DROB 3GKZA 5K9OB 3GMNB 5JOPE 1Z6JT 2W60A 2PO6D 3PL6B 5BVPL 4NKDA 1P1ZB 4O2FA 5MHSE 3VXSB 3M07A 3ARZA 4J8RA 3IS1X 5J1TC 5IB2B 4ZSOA 3UAJD 3X11B 4LVOB 2MQ3A 2YPVH 5EU7E 4PJGA 2JJUA 4W4NA 3KPSA 2P5EE 5DK2B 3PQYB 4YH6A 4BSJA 5EO1B 3NACL 3IFNH 3GHEH 3BUYB 2HJFA 4NKOA 4HC1H 2UUDH 4Z7UB 3LS4L 3STLA 4WFFE 1M05A 3EDEA 4WY7L 5GIRB 4GLRH 2A9NH 3RTQA 4ZUWA 1FQ9C 5ANME 1C1EL 3E6FA 3CFEB 2BNRB 4K7PH 1KYOJ 4YDJB 2EZ0D 1N8ZB 3S96B 5HYJD 2X09A 4MZ2A 4GLRI 4EUPH 5D70H 4B0MM 2CQVA 1JMZA 3BXNA 1HQ4A 2WQRA 1PQZA 1DFBL 1ERNA 4NKMA 4PJXB 2EDBA 4UV7H 5C09E 1JK8A 4N8CL 5DWUH 4L9LB 1EXUA 3IU3A 1X4ZA 3WKNA 3ZT5A 4LPUA 3SN6N 5CEXA 4QTHA 1U8QA 3WFZA 3OKKB 3WSQH 1FNEA 2F15A 4F37F 3PGDB 3ULUD 1J05A 5E9DD 1ZGLB 2NXZB 2V9TA 2VZTA 5IHZB 3O0RH 4EVNB 3ULVC 3FT3A 1ONQB 5KSBB 3BHBA 4XGZB 3ZT6A 4NZTH 1Q9OA 2DQUH 2V5RA 5I18H 4H88L 1KXQE 1YYLH 3BKYH 3B83A 1BFOA 4JY5L 4FMFA 4XCFH 1LILA 4NC2B 1GGCH 3ELAT 2UWEB 3DX6B 3X17A 1IRAY 3DBXB 5GJTL 4G9FD 4XVTH 1KNOB 1CFVL 1D5BA 2VDKH 2E6JA 3GMOA 4X6FA 5FYKE 5DLMH 3FT2B 4PRBA 1W2KT 3MGTB 2CPCA 3WS6C 1XH3A 2FLBT 3SDYH 2R23B 3U0PB 4CMMA 1KB5H 2YD5A 4LVEA 4L8SC 1CZ8H 2APWA 3E6HA 2E9BA 3UXFA 1FSKB 4XNXL 1WIOA 4KUZH 5GXBB 2RB8A 2CRYA 4YXLH 2BFVH 4EBQH 3MV8A 3L5JA 1J87A 2W92A 2ESVA 2W9DH 5L9DL 3MRRA 3CH1A 1OD7A 5I1HH 1CXIA 4GG8B 3DX7B 5IEHA 2GIYA 4PRPB 3TGXA 2DF3A 1G9ML 1HDMA 5FGRA 1E4JA 1D7FA 3MRKB 4PB0H 2JK5B 1YJDC 1M7IA 3FFDA 2VC2L 4G6AC 5EBLB 2AXFB 1U6AL 2D03H 3O3AB 3S88L 4P9MH 3VXQB 3HI1A 5IVZA 5J12C 3DUUB 3CK0H 1T7ZA 2QLVB 1KBGL 1CR9H 3SKJH 4Y2DC 5CSZA 2C5DC 2C26A 2CO7B 3QIUC 5IMMB 4M9OA 1Z9LA 2DAVA 4P5TD 5CGYC 4YDKL 1RUPH 4KJYB 3BQUD 4LSSH 3LQAC 1D5MA 4F80A 1KJ3H 5C0IA 1XF4B 5FCUH 3WNNA 3PV6A 2YPLB 5B38B 1KIQB 4IMLB 5GRZA 2HTKD 4Z7WF 4EQ3A 3NZHL 1OAUL 4N9GA 1XF5B 3W5NA 3MACL 1G1CA 1BZ9A 4I4WA 1JYXA 3ARDC 3C2AL 4N0YL 3EFDL 1ZWIA 3T4YA 5FO8B 4HV8A 1P7QA 5BS0D 4GRMA 1DEDA 3TA3C 5BJTA 2IAMD 4KK9C 1BJMA 2E6PA 4Y4FC 4RNRB 2ZCLH 2VR9A 3GSXB 4F2MA 4OUUB 3J7HA 4XI5D 3S37X 4XRCB 5ICXA 3IDNB 4J12A 4MD4A 4E42A 3HMXL 3I85A 1TJHH 1QHPA 1A0QH 1CS6A 1FE8L 1FV1A 3CFBA 1CGTA 3KYOB 1SJHA 4LP4A 4HIXL 4LLYA 5D1ZA 4I0PB 2HRLA 4Y8DC 4I5BB 1KTRL 5E8OB 2D7OA 5GS1C 5C08B 5SV4A 4M48L 2HJLB 3Q5OA 1BWWA 1GVIA 3F65A 3QIBC 3DIFB 1ZHBB 3DX9B 5CMAA 3PP3K 3VFNB 3VXNA 3BIBX 1JNHB 2GFBB 1YQVH 1IGFL 1JNJA 3AS1A 2AK4A 3GB7B 4NQSB 1WVZA 3OWEA 5HGGS 3RDTD 1JPTL 3HZVB 3NFSL 3NA4A 3D69A 1DQLH 3NFNA 1G0DA 2HLFC 1KJVA 2VDOL 3MRQB 1R3JB 4M1GH 5EFIB 3WKMH 3WXVH 4UTAL 1YECH 3DRQA 4JPVH 3V5KB 5LGJB 2YD7A 5INCA 4PJIA 4PPTA 1RZIB 4P2OB 1E4XI 1UM6H 3GSQA 3ULUH 3OKLA 3UBXB 1Q72L 4FQJL 3HC4H 2FH8A 2NY2B 4KKNA 1WCBB 2P5WE 5KSUB 1OQOA 1JTPA 4RISL 3VXUD 1LHZA 5AEAA 5DRWA 4HXBL 1A4KA 1X3DA 2XZQH 3GBLA 1T5WB 4JFDE 3G6AB 4LLDB 1OM3H 1I4FB 3KJ6H 1H9VA 1HNGA 3U9UB 1FLTX 5HGAA 4PJFE 4JFPA 1FFOA 2YWZA 5E24E 3QUYD 1JI1A 4GRWE 3BJLA 4YQXH 2FD6H 4FFZL 1T66C 4YBQC 4ENEC 2VN4A 5I73C 4L4VE 2NTFA 4Z77B 5EOTA 3MLZH 1RZKC 3U2SA 1MI5B 4MJ5B 1U91A 3NN8B 4P59L 5GRVL 1IL1B 2ATPB 4JRXD 3QYCA 4JANB 4BFIB 4F7TB 2YPVL 3P0YH 5EO0A 5I66A 2IH3B 1DVFC 1LK2B 2W0LA 4YHKL 3S8WA 3LEYH 1RFDH 5CGTA 3MV7D 4YGVA 3KXFB 5I1LA 3ARSA 3CFIC 4Y1AE 4OKVA 5FUCC 4JGMA 4FQXC 4PRHD 1QRKA 3HMWL 2ZCHL 2BY1A 4QYOA 3TJHC 2Z8RA 4HC1L 4M00A 4FQQB 1TITA 1FRGH 4GAFB 4DAGH 2H6PB 3D39A 5EU3B 5HDLA 4MX7B 3PUCA 2LU4A 4MXWH 1EEYA 3KDMB 1XF3B 1V3JA 3OAZH 1W72A 3Q3GA 3T0VA 2DKSA 2FH6A 4KVCL 4XPFH 4B41A 3D48R 4K7PL 5E70A 4X6CA 4TNVK 5FK9B 3TBYB 3GMPA 5C86A 1FGVL 3SGJA 3I2CH 1G7MB 1V7NL 3KPRD 2ICWJ 1J7VR 1UWXH 4BM7A 3BGMA 4G9DB 4NQXB 4H8WH 1W8NA 1UQSB 3LD8C 2A77H 5GHWL 1MCWM 1IGTA 4R4FH 4KV5E 2F5AH 1S5HB 3MRJA 1ZT1B 2Q3AA 3SEPA 3CDGB 1T21A 3WSQL 2NW3A 3RWCB 5CSBA 3VFTA 2LU7A 3MNVB 3RAJH 4DUWA 4QRTA 5D2NA 3MRNA 5IB1B 5ESAB 3M17A 4NRXA 1UACH 1EEZB 3P4OB 4KTDH 1NAML 3RTQC 1GAFH 3H7BA 3STZA 2DQUL 1P7KA 5F9WB 1YYLL 4OF3A 5H37H 4YNYB 5L7XL 3BKYL 4ZO6A 2YKLL 1HH6B 1TMCB 2D7QA 1FL6A 2D31B 4NC0B 4LPWA 4OGXH 3QFJA 2GSGA 3M8OH 4MQ7A 1KN4H 3TO4D 1UKSA 4A6YL 1GH7A 4Q9QL 4HF5L 4QT5A 2X4OB 5L0QC 5F44A 1KULA 4OZIA 2H8PB 4MNHA 1AC0A 3AFLA 5DRZA 3BIKA 3O3BB 4MVBD 5D6CB 4DN4H 2FGWL 1X6NA 3C60D 5E4EC 1SBBA 2IH1B 2JJSA 1I1AA 3SDXB 1CZ8L 4EI6A 1LEGA 3FB8A 1VGEH 4S1DC 1NBZA 5DJAB 4G7VH 4YDLC 5BQ7A 3ZTJG 1JHKL 4GH7B 2ARJA 4ZOBA 1QA9A 1JGUL 1YMME 4OCNC 5EIVA 2QL1A 2AW2A 4CVUA 4NGHH 4WEMB 4PJDB