2GSGA

Crystal structure of the fv fragment of a monoclonal antibody specific for poly-glutamine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody light chain
publication title The structure of a polyQ-anti-polyQ complex reveals binding according to a linear lattice model.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsgA00
1LDSA 2DQUL 4XPGL 1K5NB 5EWIL 1E4WL 1A2YB 1IAIL 2UVEA 4X9GA 3RGVC 2BNQB 3QPXL 2NXZC 3NACH 3DX6A 5J3HD 5FYJD 5I1JH 4OCYL 1LO4H 5TGBA 3W0WE 4HIJB 1V7ML 3IDYB 3VG0H 1LO3H 1MVFA 3O2VL 1JRHH 1E27A 4HF5H 1A6ZA 1QHOA 3MRMA 3CH1A 2W60B 4HC1A 1V3MA 1OL0A 3HZMA 1WAAE 1A7NH 4N5ED 3MXVL 4XBGA 1RV6X 1ZGLM 1F5WA 4DK3A 5D9SB 1A3QA 2YRZA 3ZKSD 1YNLL 2E9WA 3HUJF 2HJLA 4U1IA 3U9UB 2WIMA 1QNZL 1XGUA 3CSGA 1P4IL 1P69B 1YEFH 3FZUC 3U1SL 2NY0D 1XEDA 2OSLA 1F3JB 2RBLA 4JPVH 1S5IH 1TJGL 5SX5K 4LVNC 3LDBC 3TPUB 2I5YL 1OP5H 4WDIA 4D8PA 3G6JA 2FBJH 3FHQA 2Z92B 3RWJB 4C56B 4WTWA 2BCKB 4PV9B 4PV8A 3EDDA 5D1ZA 3QDAA 4LNRA 3AM8A 4LHUA 1CXIA 1BP3B 1WCBA 4HUWA 2QQLH 3VRIB 4XCEA 2X4RB 4NGHL 3AY4C 2FB4L 2P49B 1NFIB 1JGVL 2X4UA 2BXYA 3M1BB 3DMMD 3ZKNC 4DCQA 3LEYL 3WO3B 1DR9A 1INEL 2A77L 2Q7NA 5CLTA 2O26U 1RZJL 1IZJA 1P2CB 2PR4H 2VLJB 3PJSB 5H35B 3QEGH 2X4NA 3C60C 5E03A 1I4FB 4JY5H 1MEXH 3FT3A 2BVPB 4LCUA 2F53D 1WWBX 3D85D 4XTRC 4DKEL 3WIHA 4W6XB 3REVA 3SGKC 5BRZA 1NBZB 1X4ZA 2MWCA 3QDMD 3IJSB 4AEHH 2V2TB 1R5IA 5EA0H 3QDGD 4R7DB 4Y16A 4N1HB 3F58L 2WNGA 3QUML 3P0YH 3MRNB 4DVBA 2E7LC 1BFVL 1YEHL 4L8DB 4C57C 1J1PH 5E70A 4BQCA 1OSZB 4IM8A 3JZ7A 2W92A 5EUOA 5B38G 1RUMH 1UB6B 3MRKB 5BZWA 2NY2B 5HHMD 4YUEH 3AU1A 5JW4Q 1UH4A 4NQED 3MV9E 5KANI 3G5YA 5K9OB 1ZOXA 4ZUWA 1Q8MA 1J0HA 1HN1A 2G5BA 2N56A 4RDQG 4DGIH 1IL1B 4MXQD 4XPBH 4M1DH 2ZCLL 4FMKA 1FFNA 5C2BL 4M7LH 4GKNB 4N0UA 5CSZA 3NABH 4HWBA 3H9HB 5DYOB 5IT2L 4PTTB 1KCVL 2IBBA 1GGCL 5CEXA 2R9HC 2VOTA 4HGWB 4NYLB 2XQYG 5FOBB 3FT4A 5GRJH 1QR4A 3NFPB 3REWA 3L3OB 3LMJH 1C7SA 1IAKA 3WSQL 4MCZA 4KAQL 5FHBL 1LE5B 2J8UA 2VR5A 3ES6B 4P9HC 4UIMA 4DAGL 2WBKA 1WZMA 3EJZD 1CGSH 1T83C 1P4LB 4JQIL 4KKCC 3LKPA 2OR9L 3HI5H 1JI1A 4NQCA 1EHAA 1EO7A 4EUPG 1D5MB 4OT1H 5IW6A 3MGAA 2I9TA 3HMWH 3TT1L 4OFYA 1TVBA 4CADB 2F8VA 1QYGL 3S37H 2YUVA 2F5BH 2HFEA 2GAZA 2DQDH 3KGRA 3RWEA 4XCNB 2Y7QA 43C9A 4CUCA 2NY5L 2VABA 2DQEH 1J5OH 4XHJC 1P7KA 1FDLL 3IKKA 4OCMC 4MA3B 1UACH 5F9DC 1F6AA 3CFBA 3DIFB 3SOBL 4Z7NF 2J4WL 3D0LB 1RJYA 1SEBA 3CFJA 3WHXA 3SJVB 4LDLB 3BEVB 2BFVL 3IRZA 2NY2C 3VXSD 4GRLB 5K93A 1IC7H 1YYLH 4WI7A 1IC5H 1X7QB 4PJ5A 4U6TA 1M05A 2X05A 4HUXB 3X3FL 3WBDA 1UWGH 5T3ZD 5KSAA 1NUNB 2EYTA 4FA8A 5I15H 1ZSDB 5TH2A 4E41B 3MRGA 5E08L 3IFNL 3QFJD 2ORBL 5CBEB 3VFWA 4NZUH 1T89A 4IMLB 4DOHE 5GRUH 4BZ2H 3RNQA 3JVGA 2X1XR 2R0KH 1T6WA 3V0WH 2AEQL 3QDHA 1J1XL 3ULUH 2JCCE 2H9GB 4OQTL 3T3PE 2VDLL 2GQHA 3LV3A 2H32A 2ESVE 2A73B 3R06B 4OCNC 3R1GH 5IFAH 4JFXB 3H0TB 3UJTL 3EFFA 4G8GB 5GHWL 1XGYH 3P11H 2DQHH 5CGMA 5E0QA 4JKPH 5DQDH 4TOYH 3U0TB 1MWAA 1QFWL 3F12A 1A6AB 3MTRA 2VLKD 3MROB 1CLZH 5LQBL 4IDLA 4KU1A 1CIDA 4G8IA 3MACH 1S7WB 3SKNB 1QO3B 4NOFA 2BY1A 4WEUD 5HVFB 1HYRC 2GUOB 4H20L 5D7IF 3QUXD 4NQDB 5JR1H 1KCLA 4LSPL 2W0FB 1LE9B 1CFVL 4D0DA 4YHKL 2DJ4A 3Q48A 5GGVH 2K3TA 4DUXA 3UTTB 1FYTD 3T4YB 1NH6A 1BWWA 4PJ9B 5FIEA 4AL8L 4JFYA 5J6GB 2LV4A 1EBAA 3N9GH 2F5AL 5DRXA 4OLUH 5EBMB 1CZ8H 3VXOB 1FZJA 1BF2A 4PREA 3O41A 2LE9A 3V0VB 5C0CE 2DTSA 1K4DB 2RQ8A 4L4JA 5DQ9B 5DJ0B 5D72H 1Z3GL 4YBHA 5C3TA 4XP4L 3DUSA 3ZKXB 2WUCL 2X4TA 3D39D 4OFDA 4ZUTB 5FYKH 1RY7B 3ZE0F 4NQVB 3T0EE 2MTPA 3MZGB 2X7LB 3KVQA 4UNVA 5E6ID 1Z9SA 3O6ML 3HNVH 5E2UL 4U1HA 2HRPH 2C1OA 4G6JL 2XWBB 1P84K 1I9JH 5EBGA 3QRFM 5DD1L 3UTSB 4XP1L 1AFVL 4HS6A 1JYNA 1E6OH 2QQKL 1BGXL 1T6VN 4LGPB 3DRTA 3QEQB 5CFHA 2HLFD 3DV6A 2VDQL 3VA2C 3VXQB 3GO1L 4MD5A 1F90H 1K3ZA 2VISB 4RA3A 3BQUD 4TUJB 4XHQA 3EYVB 5D93B 1NBYB 1QEWA 3W9DB 3L95B 2W59A 4A6YA 3HNTH 2LABA 3V0AC 3VI4F 1KJMB 3QDMA 5BS0A 2I60L 4XNXL 5D8JL 1ZT4B 3KYOA 4N5UA 3UMTA 2NX5E 2AEWA 4P9HL 2B1HL 4YR6B 1MCDA 5KTEH 3VWJA 4Y4FB 5CSGA 1GRWA 4ZAKA 1I8KB 1UA6L 2X6MA 2HT4D 2R39A 4P4KA 5D7LB 3LZFH 1P53A 1HKFA 3NIFF 3GJEA 2GTWA 4I4WA 4LQFL 3RI5F 3K8KA 2Y5TB 4CN1A 5C0RH 4Z7OF 1BMGA 4QKXB 5DJ6B 4WI4A 5IBUG 3BUYA 1C5DA 1HH9B 4HCRL 1JNNH 1PX3A 2ICEB 3MRQB 3NIDF 3S5LB 9CGTA 4QRSB 1UADC 2YWZA 1WBZA 5IB3A 5DJ8B 4R4FL 3SDXA 3RVUD 1I1FA 1IBGH 1WC7A 5JIIA 4U1SB 4FXLA 5DDHB 3WHE1 2MQCA 1T2QL 3QDJD 5HYIA 1TJIH 3QIBB 1OCWL 3GBNL 5JW3L 1DVFB 4JDVA 1CGWA 2P47B 1A6TA 1GJIA 3VD5A 5FM4A 3C8KA 5EULV 5DK3A 4JAMA 4P2RB 4YXHL 3KR3H 4IHOB 2X4OA 3WJLA 5DD0H 3MBEA 3C8DA 4OGXL 4KXZI 1HILA 3KPNB 1P1ZA 2VDKL 3MRPA 5EZLA 4KK6C 5ETUA 5BZDA 5AYUL 1KJ2A 1S9VB 4NRYA 1MVUB 1EH9A 1BX2A 4XH2B 5CS7A 1KB9J 3EDFA 2EDHA 2EE3A 1CE6A 3B3IA 1QLFA 2A6DB 4PLKD 4ZS6C 4H0HB 4IS6A 5D93C 1IM9D 4FG6D 1A9BA 4OD3H 5L2KB 4P5TB 4WTZA 2ATPA 3T77A 4UT9H 2XZAL 1MCPL 1U58B 3SKMB 4TVPL 1CIUA 1A8JH 2F54D 1FP5A 3ARED 3MYJA 1QUNA 2YS4A 1TZIA 2VWEC 4ZOEA 3HZKA 4Y4FC 4FQCL 2UZIH 2NMSA 2BNQE 3S35X 5C0GB 1HH6B 2FEEI 4JDTL 4AH2A 2WZPD 4ELMF 4XNUL 3RL1B 2AJUH 4WRLA 4JO3L 2H8PA 3GSUA 4UBDD 3LS4H 4RFOH 2E9IA 3DVIA 2VL5A 4NO5B 3CK0L 4HJGA 1XCQA 1F4HA 5IOPA 3B5GA 2R1XA 3TJEL 1MELA 4YAQA 1W72B 1BD2A 1NBVL 1YEKL 2FHBA 1NMAH 4X9FA 4Q6IB 4EDXA 3QHZL 4P2YA 1U92A 1TQCB 3L3GB 2GK2A 5HDOA 3QIBC 5EFIA 2R4SH 2LU3A 5HTSA 2VR9A 1UG9A 1ROWA 3V5HB 4ODWA 2FX9H 4H1LB 1MFCH 5EO0A 4Z7WF 2P8LB 2GW5A 4AMKL 3DARA 1IAMA 2VXQH 5F9JA 3BVNB 4LGSB 4B5EA 3P40A 3OKKA 4X80H 2DWDB 3IFPA 4O9HH 4LL9A 1K4CB 4MGXA 3CC5A 1K8IB 3BT2H 4MHHI 4LIQL 3RIAK 4ZFGL 1RZ7L 1QP1A 2R2BA 3QO0B 1YN6A 4JJHA 3QULA 4HIHB 1VENA 4JZNB 4NO2B 1X4XA 5DQJB 4GS7B 4KRPB 5LWYH 3DURA 5DZNA 3ZL4L 1PKQB 4HZLB 1PEWA 5C92A 2XZQH 1EEYA 4MA8L 1NDGB 1K6QL 2X42A 1A6UL 1TZGH 5GS2H 4KTDH 4N0CD 3ZE1F 1FYTA 2VLJE 1CYGA 3TO4A 1RSFA 1Q1JH 4ODXB 4OLZL 4MXWH 1RIVH 5D6CB 2NTFB 4DZ8A 3INUL 2H2PC 1J8HA 3H7LA 2ZUUA 2EIZB 4RFNC 2DQTL 1XZ0B 1XF5B 4P23D 3VXRB 1CTOA 1I75A 1X44A 2EXYD 1H15B 1R3HB 2P5WB 1XF4A 4CNIB 5M94B 2JF1A 1II4E 3BKMH 3VFOB 5FO9B 4WHTB 5ADOH 4YXKH 2XYCA 1OF2B 1JUFB 5FKPB 2JIXB 1V5JA 3K8MA 3O0RH 5ERWB 5FDWB 1LEKA 2DYPA 1OM3H 4XPHH 5E6IA 5IG7B 4HWBH 3VXUB 5DMJB 4GO6B 1P5UA 3K2UL 4G8EB 5JXEC 1MH5A 4PJGE 5DMKB 1MJ7L 4M43H 2DWEB 3PDDA 4MD0B 1C5CL 4DQOL 3GI9H 1TIUA 4RMSA 3KG5A 1S7UB 3RUGB 3D2UD 2H2SC 2EEAA 3BWAB 5C0DB 2Q8BL 4JQVA 3BI9X 3VFSA 4JG0L 3TJHC 3T8XB 2F8XC 3CDGA 3V2AR 5D1XB 4MQXC 1EO8H 3FQWA 3BPNB 2EO1A 1FBIH 4M9PA 4GKZA 4JKKA 5J0BA 2ITDB 2VQUA 4IRZL 4OZ4A 3PQYB 1J0ZA 4PPTA 1F4YL 4WNQA 4ZTOH 5TDOA 4Y8AA 4PYGA 1NUGA 1NGXA 1ZHNA 5DWUH 2ZUTA 4QHUA 2LQRA 1JMZA 1ZVSB 4GS7C 4KRPC 4TVPE 5JW4R 3ROOA 2NR6D 3V6OC 2A83A 3GZKA 4Z9KB 4K7PL 1F11B 1FNEB 4AEFA 2A6IA 3B9AA 2YUXA 4RA0C 5HYJD 4GG6A 4M3JA 5FA3A 3IRPX 1Z5LB 4E0RA 4YHML 4P2OB 4X5XB 2NW3B 4I0PC 1LK3H 3O4OB 5BXFB 3ABZA 4UIKH 4WHYG 1LWRA 5FF6A 2O5YL 4FHBD 5KW9H 5D71H 4NIKB 4M7JH 5DJCA 4XVSL 1JPSH 1FPTL 4U6XB 5F7EL 3LEVL 3PXHA 3KJ6H 1S7TA 4CMMA 4D9LL 1OT2A 4QYOA 3VFGL 1K2DA 5ESAA 2YD3A 1E6JL 2FX7L 3V6FA 2FD6L 5FGRA 5ACZB 4L4TB 1AIFB 5KJRL 4MXVE 2VUOA 5F3BA 4LLWB 1WFTA 5I2IA 3MLUH 3O3EA 5E8DH 4LMQE 3UTOA 3FN0H 3UC0H 1IEBA 4KK8C 1FVEB 4BZYA 2ADGB 2H41A 1TDQA 1KACB 3L3KB 1A7PH 3RL2A 4L29B 5BO1L 4U0QB 2AQ3A 1JN6A 4V1DB 1KEGH 2H32H 4E41E 1BF8A 3ARDB 3GSWB 3KPPB 4PRHE 4LIQE 3SKJH 2AKRB 4HZAA 3VRJA 3NVQA 1GGIL 1KULA 3GKWH 3KYNA 1HK6A 4X6FA 1MWAH 3BPNC 3HB3C 3A6BL 2WBJA 4RBPH 1YEEL 3IAQA 2PYEA 2ADFH 3MV8D 4EBQH 1G7PA 3P9MA 2FWOB 4EN3A 2R56H 1JI2A 1YDPA 5BW7C 2E9JA 1SYVB 3LKQB 4Q0XL 1AXTH 3QZWG 1X5AA 5DMYA 2HVJB 4G8GE 5F3HA 2DKUA 5E24E 1VDGA 5IEKB 2OZ4A 3IETA 3TBVA 3HUJB 4QHKI 4M62H 4ONOA 4R7NB 5FM5M 1DN0B 4HWEH 3N1GC 5MEQA 1U8QA 3SDYH 3L5IA 3OKNB 2GCYA 1W0WB 1NCCL 4NQDE 5C0NC 3IDMA 5EU3A 4DW2L 2AK1H 4WEBH 3ARVA 1R5VA 3HAEB 3NPSB 2V7NB 3UTTE 3HCVA 2V2WB 3JV6A 5D7KE 3RTQD 3QQ4B 4OBSA 2R0ZH 5IR1B 1DQJB 3P0VH 3LPGA 4JQXC 4FQQA 1J1OH 4R8WH 4XCYA 2XKUA 5KAQF 1LDPH 4PJEA 5F1NB 4NN7B 4P4RB 4ZUUB 1SVCP 4R2GD 5F96H 2BVQB 5CZVH 1NMCB 4F7PB 5HDLA 4P46A 1Q72L 1UCTA 4M7ZC 4BK4A 2BSTA 4PJDF 1HEZA 1RAMA 1XF1A 5C9KA 1T5XA 2XACC 3O6FC 5BV7H 1VGKB 1LEGA 4MJIB 5SX4I 3KPSD 3ARDC 2CD0A 1G0XA 2IAMC 4N8CH 1W72L 2CO7B 2FRGP 2C3HA 1RIUL 3VFUB 4PRPD 4Y5XA 5IVXF 1DQDL 4NQSB 3CFDA 3V6ZA 1Q94B 1FRGH 5SWZB 5EBWB 2GITA 1NEZA 4A6YH 3K4DA 5MHSE 4FQ1L 2XZCL 1ZHBB 5DRNB 1IKFL 3VFTA 5I1HH 2ZOKB 2VUYA 3QEQE 5KS9B 4PJCF 1GH7A 3X3GH 3EO9H 3MODL 3JTTA 5D7JD 1GYAA 4G43A 4ONFH 3RWGA 4B50A 1XR9B 2Y4SA 4IDJH 1XGQA 3SDDC 3PV6B 5KSBA 4PD4K 3MNZA 4AQ1B 1YPZF 4NHCH 5T5FL 1AGEB 3MLWL 5IB2B 1FIGH 3NFNB 3IKCA 4P23A 3S34L 4DTGH 3TN0C 3QUZA 2VXVH 2B4CC 5IW1A 4U1KB 3NA9H 1OTTC 2VWEE 4X99B 1NL0L 3ILPA 3P4LA 3FO0L 3CXHJ 4L1HA 4KZEH 5D7LE 4K94H 5ICZA 2PN5A 2BX5A 4F9LC 3D0VA 4PRDA 3LKNA 3MRDB 4G9FB 5KVFL 3SDAD 5KSVA 4NJAL 1DJSA 4NNXB 4Z95H 4ZNEA 2HLAB 5HYSB 1JJUA 4XPAH 4F2MA 5A2JH 4DK6A 1CT8B 1Q9KB 1RU9H 1I1YB 3OPZH 4JJ5A 3GMPB 2XNAA 3EHBC 4BSWA 1NEZG 3DVGA 4LLQA 1D9KA 3L7FB 1FZKB 1QKZL 4GG8A 2IQ9L 3GMMB 4MAUL 4HKJA 3TBTA 5CD3B 3RVWC 4JKMA 1GAFH 2CDFB 1BIHA 3DYPA 1KJ2H 3DTXB 5CJ5A 5IBLC 1RZGB 3MFFB 3DXAB 3DYMA 4HPYL 4I0CC 4X8JA 3W9EA 4YDJA 2OMBA 4MCYA 2B2XL 4P2RE 3KXFA 1CK0H 4EEEA 2EDOA 1T0NA 3GMLB 5I1LA 3JV0A 3P0GB 4LHJB 3IU4H 3HPJA 4N8VG 5FYLH 4GMSH 1EEUA 3WFHA 1HQ4A 4CRPA 2OTWA 2OM5A 4QRTA 1OAXH 3IDXL 1A7OL 3GHEH 1ACYH 3QT2A 1BZQK 3CLEH 1AGDB 4J6RL 5JOFA 5I74C 4S2SB 3RNKA 2AJSL 2YN3A 3SGJC 1MHPH 2ILLA 1G84A 2D31B 4J8RB 3QQ3A 2ENYA 4F9PC 4TTDC 4PYHA 4Z0XA 3V5KB 4KY1L 1NUFA 2GKIA 5L88L 2HMID 1RVFL 3OX8B 1RFDH 2DRUA 1CLYH 2FJFB 1VFAB 1KLUB 5HGDB 4K2UL 4O4YH 1NMBH 5GGSY 1KYOJ 3PGFL 4FP8L 5B8CB 1HHHA 4KXZH 5FGSA 2XRAH 4B7LA 4J2XA 4PLNC 1D6EA 1T80A 4YHOH 5GQBA 2MCG1 5FGBA 4FFWC 4QHMB 4NKDB 3AMKA 4JFDA 2C3XA 4PFEA 4PGCB 1NDMB 4S1QL 3DBXA 3CSBA 1G6RA 2ZSVA 3O2DA 1XT5A 3BDYL 1IVLA 1KUMA 1UKTA 3MRRB 2VZOA 3BHBA 1IGJB 3C5SB 5I8KH 5DA4A 2HFGH 3O3BB 5JPMB 1A02N 4Q9BA 3G04A 3OF6A 2QKIA 3QI9A 5DR5L 2C1PB 2EIEA 1VSCA 3S7GA 3V95A 1N0XH 3U36B 4H5SA 5CIPH 4LEXH 2IH3A 1AGBB 3ZDYE 3ZTJH 3WNPA 3HLAB 4PJHF 1AO7A 3HI6H 4FXKB 4I2XA 3MV8A 5I73B 2FZ3B 4POZC 4ETYA 2Q20A 3SE9H 2EDTA 4EI5A 3X11B 3RWFB 1WFNA 4PJFA 4ZFFB 3FT2A 5K9KB 2D03L 3MLSL 1IFHH 1OAUH 1RUPH 4OZFA 1T04B 4YLQT 4LASH 1TVHB 2NXYB 2KPNA 4RMVA 4NNYA 2QADD 4GW1A 4JRYB 1P6AB 5JMOC 3ARFD 1U8NA 3RAJH 5FO8A 2VIRB 4I18B 1UH2A 2KQNA 3DROB 3QIWA 5HPMA 3F7PC 1YN7B 1G0YR 3V6OE 2N7BA 1PKQE 5CEZH 1LP9F 3KLHD 1ED3B 1JHLL 3NH7H 2DMBA 1I1AB 1JNLL 5E2TL 1DUZB 4MNQD 5EO9A 3RTQA 5B8CC 2VLRB 3CXHK 2AK4B 3FKUS 2BC4B 3RPIB 5MEOA 5E7BA 5J6HA 4XMPL 3FB5A 3VXRE 2YA0A 1IAOB 1RHFA 4O2FB 2FHFA 2P44B 3RP1A 1NGWA 4LP4A 3VXTB 1RQ5A 2P5WE 3C5ZB 2MKLC 1I3GL 1BVLB 2APFA 4NRZA 2KZWA 1CICA 1NGYA 3VRLE 1G7LA 2DBLH 2CKNA 1EMTL 4X6CE 3ESUF 2YD5A 3OJVC 1JL8A 1J0IA 5IHUL 3FTGB 5GRVL 1QSED 5DVOA 2V5SA 5C09A 3VXUE 2OJZL 1PG7L 4TTGA 1NC2D 3ZT6A 4WVRA 1G7IB 1QSZA 3F7YA 1BFOA 4ZXBB 3QQ9C 3L3JB 4TUKH 1M7DA 2FCBA 3BEWA 4OD2A 2OR8A 5I73C 2P42B 1AC6A 4JFFB 2HFFB 2WQRA 3O6KH 3MJ7A 2YD7A 2VH5H 2BHZA 2P5EA 5C0AB 2OQJB 3R0NA 1EO5A 2L7JA 2ZKHL 1PZ5B 5EUKB 1ZANL 3OXSB 4BUHA 1CDIA 4OFVA 3ULVC 1IGFL 1FLRL 5CZXC 1SBSH 4L1DA 3N1MC 1EFXD 3H9YA 2IADA 4I18C 3EYOB 4CVXB 4GW4A 1A7RL 4YHZL 1DBBH 3QCVL 2R23B 4HX1B 5C08B 1UZ6E 4WW2A 2X70A 3OR7B 1HXMA 3T3MF 4PRAA 1EV2E 4P3CL 2ESVD 2MHAA 5GSRB 1Q0XL 4KJQC 4EUPB 3TNNB 1KYOK 1I85A 5I8OH 3KWWA 3G5VB 4YGVA 1I8IA 4M6NH 3GFUA 1KLGA 1JGLH 4H25B 5HJ3B 3E2HB 1RK0B 3GIVB 2BNRA 4NRXB 3ULUF 5DXWA 1WIUA 3QCTL 1ZVHA 5JOPD 1DUYA 2MFNA 2WM0A 2KKQA 2R2HB 4XXDA 4WO4D 4NKIL 1BEYH 4PG2C 3ZSSA 4XI5C 1SJXA 3UZVB 4P9MH 4GAJH 3CX2A 4YFLI 4MMZC 5DD6B 5L7XH 3W0WA 5C0BD 4JPIA 4K8RC 3AXLA 4LCCB 4D3CL 1HI6B 3MA9H 5T1LB 2PO6D 1DDHB 1OAKH 2D7QA 5D1ZC 3AM8C 2MCPH 2AXHA 3KPOA 2VL4A 3DUHA 2UY6A 4FNLL 4QRUB 4ZXBC 3OHXA 1KLFA 3O8XA 2AJVH 4F57H 5C2UB 3MC0A 3LN4B 1J05A 5ESVA 5C0CD 1I9IL 4GBXA 2BJML 3TV3H 3GMRB 4X6DE 3TA3B 4QOKD 2CIIA 4OKVB 5EU5B 3TF7C 3IXTA 3WE6B 2R69L 4ELMB 1S7RB 5DJ2B 1HQRA 4LRIA 1KN4H 3C6LD 3IT8D 5EBLB 5ECJE 4PS4H 3I6KA 4OSUH 3RVVC 3W2DL 3OGCB 3MLTB 1UB5A 2NLJA 2OZ4H 4JB9H 5K9QI 1N3NA 3VD4A 1P5VA 4X6BB 1AKJA 1I9EA 2X4PB 3HR5A 3LS5H 5LAXB 1AQKL 3O4LE 2XTJB 4JM2B 1KC5L 5FECB 3FB7B 1U93A 4Y16C 3HUJE 2DICA 1V05A 5E8PB 4Y89A 3VXME 5J13B 3RHWF 5FYLD 2C7UB 3ZTNH 5IKCA 5ID1B 3RPKA 3D69B 1KJ3H 1R5WA 2J3SA 1R3IL 4DN4H 2YXFA 3HRZA 1EZVX 4RMUA 1QFOA 3QXTA 3P4MA 4ZPTA 4MS8D 4M8VA 3U82B 2YMXH 3FN3A 4HUUB 1MF2H 5JA9A 5GGUA 3S4SG 4XP5H 1QQDB 4LCCC 4K23L 4EDWL 4H8WL 3HC4H 4G6FD 1MRDH 4K7PY 2YC1A 1A3LL 3PDOA 4PUBH 4L8CB 5EZIH 1S9WB 2EO9A 4MNGE 5E5RB 1MFAL 3OMZA 5GJTL 1T5WA 1IAII 4GXUN 1WTLA 2A9ML 3GMOB 4MJ6A 1D3CA 4ONGH 4GSDL 3TA3C 3HS0B 3VI3F 3QXDA 3BH8B 4WUUB 2CDEA 4M93B 2IC2A 5L2JB 1DQML 3O2WL 3S88H 1U8JA 2R8SL 4N9GA 3EO0B 3MNVB 4RZCB 3AROA 1EHLH 3L3DA 4ZS7L 1QSFB 3ARFA 4HMCA 3QHFH 3VFPA 1LO2L 3G5XB 3UPRA 1U8OB 1A1OA 3FMGL 4Y0GA 4JO1L 4N0FA 1KT2A 1T0PB 5JHLL 5DJXA 4KC3B 4KZDH 4QT5B 3VWKA 4JM2C 5KS9E 3PWLB 2NY1D 4LVOB 1U2CA 4QHKJ 4RQQA 5SX4H 1MHEB 5C71A 1WVZA 3GGWA 3IJYA 1A64A 4OM1H 2HRLA 4P5MB 4XPFL 4OJFH 4F33B 2OTUA 4KRNA 2HJFB 4G6KH 2PYFA 3V5DB 1MIEL 2FO1A 1JPTH 3MV01 1P7QB 4MA7H 3VMOA 5TDNA 1I3RB 3TZVD 4YDVA 2ZZUT 3AUVA 2NY0B 1EK3A 3IFLH 2DKMA 2Q76A 4G42B 1X5ZA 3ZKND 2XWJA 3ZKMD 5KSAC 1EVTC 4PGDA 1U6AH 3JBG7 4P5KA 3LN5B 5CEZD 4BSVA 1DFBL 1I3VA 2YZ1A 3S6CA 3I6LE 1U36A 1T89C 1NGZA 3HPLA 3BGMA 3P73A 4BZ1L 4Y5VA 1NC2A 7FABH 2DQCH 2OXHA 4GRWE 5I1IH 1DQQB 1A6VL 5EG6C 1DBAL 5IHLB 5F7DA 3HZYA 2BNQD 1PBYA 1JGDA 4HFUH 3LIZH 35C8L 5J1AB 2N7AA 1VESA 1JV5B 2ICWA 2FJGA 3DMMB 4UB0H 4OZHB 4BFIB 2GSIB 2DF3A 4FZ8H 4JHWH 4RGOL 1NBQA 4X7CC 5D70L 4M93C 5KOVC 4UAOB 4K7PX 5CINL 3Q3GB 4WY7H 1GSMA 5F7NC 3SCMA 1UM5H 3DXAE 3TVMA 4HBQA 3D85B 1MJUH 3GSOB 5I30H 1EFXA 5J3HC 4P99A 5B21A 1MCLA 3MGOB 2P24A 4R0LA 3U4EB 1CD1B 5IBTL 4F3FA 1KGCD 3B6SB 2E8ZA 1HHGA 3QDGB 4LLVA 1OSPH 4XMLH 5LCVH 2JCCA 2WINB 5IK3B 5JHDD 3GRWL 2AV1A 2ESVA 5ID0B 3QYCA 1FO0B 3BKCL 2VC2H 1ZLVH 3QWQB 2CDGB 1GIGH 1A0QH 3G6JF 3EOBB 4G80A 2CLVB 4N5EC 4CN4A 4NN6B 4C56D 1C08A 4HG4J 3SHSA 5MERA 2A38A 1GZQA 4NQEB 4C4KT 1BBJB 5MEPA 4JY4A 1VEMA 2J5LC 1JZ4A 3STZA 4YWGH 1CDUA 1G6RH 3O2DH 3SBWA 4JE4B 3L1OH 4RAUA 4Q9QL 2Q6WB 1OAQH 3UO1L 2NY0C 4FQHA 2DQGH 3QUMA 1ZLSL 1MREL 5I1GL 1R3LA 5L9DH 4JR9H 4X7TB 3B5TA 1KCSH 1FL6B 1AP2A 1ZA3A 4OB5L 3U0PB 5T3XH 2HWZL 3P9LA 1DEDA 4U49A 5FB8A 4O2EB 4WI2A 4U3HA 4HUVA 3SQBA 3QJFB 2XG4A 1D6VL 2C4FU 4LSRH 1LO0H 1MAJA 3D87B 5EORH 5C0CA 2IBZY 1B0GB 3CX5J 4U05A 3ARTA 4NHUA 3DMMC 5BMFH 5TE4L 5H2BA 1MCFA 3C6LA 1IGYB 5KVDH 1JCKA 1KIQB 5DEGB 3D3VE 4X4ZA 3VFMB 5IHBA 1NLDH 2ITCB 3PL6D 4OZFH 1FCCA 1S5HB 3K4AA 5IESL 5EUOF 4WFEE 2RJMA 5GS0D 5KVEH 4KPHL 4HWUA 1S8DA 5HHOE 2ZUQB 3KPRD 2VQTA 4R3SA 2NNAB 2GI7A 1CVRA 1J7VR 1ZHLA 1FGNH 1DLFH 1SEQH 4UT6H 1R3KB 4ORGB 3KYKL 1NGPL 1U8LA 3FL7A 2YRLA 2C9AA 1MFDL 1WLHA 5I17A 4GKSB 4NDMA 1KF9B 3MNWA 3L7EA 4PJDB 2H6PA 3NIGE 4YHLL 4WI5A 2GJZB 3MPCA 5C0FA 5J7CC 2OCFD 4NN6C 3UBXB 1MJ8L 1ZHKA 2YKLH 4KRLB 3VXSB 1A4KA 4LSSH 5AG8A 3P4NA 1AI1H 2XKNB 3RY6C 3BGAA 4LSVH 2DQIH 3EOAB 1ND0A 4LPUA 2Y07H 2AERT 2R2CA 5CGYD 1ZXQA 4MXQC 1JZ5A 1JZ3A 2HG5A 1JWUB 1MPAL 1NAMB 2VLRE 2J8UF 3LKOA 4RIRA 4KVCH 5HHPA 5IMLB 5D1QA 5L6YH 4I77H 2AK4E 3OKEB 4JN2B 4U6YA 1FH5H 5DMIH 2I9LB 1FFRA 4NCC2 3CMGA 3QH3A 2NX5A 1MCKA 5CJOH 5HI5D 4ETQB 5DFVD 3M07A 1RZFL 1CXEA 3RDTD 4GFTB 4S11A 3RGVA 4FFYH 4UOJA 1FORH 4QRRB 4WHDA 1BQUA 4WFGD 1MQKH 2CLZB 1JHKH 3RWCA 5MP6H 4JRWA 3WJLC 2I24N 3C87A 1KENH 1YPZB 3ZYJA 5HHVH 5J11B 1BVKB 5D4QA 3NTCH 4WENB 3CUPB 4ZOCA 4HK3J 1S9XB 2VLKB 2P8MA 3F8UB 5GIRA 3EJZC 2CKBH 1JGUH 3TYFB 1P4BH 1IQDA 1DEEA 1JZ6A 1E28A 5DTFA 2P8PA 1Q9LA 4NUGH 5IF0B 3SJVD 4XAKD 3QUXB 4JFFE 5FKAA 3D9AH 5EZOH 3LHPH 1KCRH 3P4OB 3T0BA 3ZDXE 4GRLD 1OQOA 5ALBH 3FN9A 2X4QA 4AIOA 4GKOA 4OLVH 3QBTB 1NCDL 5DLML 2OK0H 1R0AL 4PR5A 3EYSL 1C7TA 4E41D 3RIFF 4F7EB 5BOZG 5DRWA 3MA7A 1DE4B 3BOVA 3QRGH 3FRUB 4YNYA 1JPFA 3AS0A 3EGSB 3GIZL 1AQDA 4RAVB 4LU5L 2EE2A 3SGEI 3KPQA 4JFOA 3AY4A 4OCXL 4ZQKB 4PJ7E 2F74B 2Z35A 4LPVA 3LQAC 1XGTA 3D39B 2YD9A 5M95B 4PP2A 2JB5L 3U6RA 1Q0YH 1CGXA 4LKCB 1KTLB 1BBDH 3NFSH 4ZFOB 1QBBA 1BQSA 3C60A 4D2NA 5C07D 2IGFH 2EH8L 3F7VA 3CVHH 1K5NA 1A2YA 5DF0A 5C0JB 3SE8H 5LXGH 1U3YA 3THMH 2BNQA 1C5BL 3S36L 4PRIB 3P30L 2ZUXA 4F7TA 3U7WL 3SGKA 1T0MB 5E1AB 5F9OL 3WJJC 2BHUA 4HIJA 2ATKB 2AGJL 3NCMA 4HUMB 3ZTJG 3BUTA 5I16B 2AEIT 1YQVL 2V9TA 3S96B 4QXUH 4XBEL 3PE9A 4PJ9D 1A7BA 2J88L 3BQUB 1I7RB 1YEIH 1INDL 1HDMA 2DLEA 1QLRB 2ZCHL 5GPRA 3VGBA 3PWJB 5D9SA 1PFCA 1G7MA 3QUXC 4UMGA 1TETL 3U9UA 2B0SH 2RIKA 2ED9A 3PDGA 4ELME 4JO4L 3R4DA 4JRXD 1F3JA 5SWSB 3X12B 4MLSA 5TF0A 3TPUA 1RIHH 1A7QL 1MCSA 2DIAA 1WQVT 1CD0A 5DHYB 3EZ8A 5IJVB 3RWJA 3QZWB 1U41A 3DECA 2DJSA 2BCKA 2BRRL 2CK0L 3CMOH 4C56A 8FABB 4PV9A 3QIUD 1QBML 1FNAA 3T2PA 1YECH 3SDCD 4KJYB 4KTEH 3VRIA 3UTSD 1S3KL 2X4RA 3UYOD 4PJHB 3NCJL 3GDBA 1N64L 1NFIA 5JQ6L 4M7KH 6FABH 4K3GA 1T3FB 4HLJA 3TYGH 1FO0L 1GGTA 3QDJB 4WCYH 1T83A 3BIAX 5E6IC 2B39A 4M5ZH 2VLJA 1P2CA 5H35A 1H5BC 4G5ZL 4TRPH 4Z7VE 1CWVA 5TQ2H 1I4FA 1JNHB 3B43A 2AJYL 1N7MH 2BVPA 2W9LA 1SY6H 2Q7YB 1BREA 4RISH 5IVNA 3MV7B 3K74B 4HCRA 5ITFB 3IJSA 4OZGB 3UTPE 4R7DA 3MRNA 5DVNA 2HLFC 4M5YH 1TPXB 2JK5B 5GS3A 4L8DA 4YXLL 1YMME 2V2XA 4YJZL 3BQUC 1TTFA 4WV1B 4YDIH 4M1GL 1UB6A 1IM9B 3MRKA 1L7IH 3DSFL 4I5BB 2Y06L 1EGJL 3EOTH 2CK2A 1DL7H 3O3DB 5AG9A 5K9OA 4EQ3A 4WUUE 2F54B 3AREB 2EEBA 3UXFA 4MSWB 3RKDD 1IL1A 4FTVB 4XZUB 1CD9B 1WFOA 2SEBB 3SDXF 1IM3B 3DLQR 2ZSWB 1UYWH 4KI5D 1Y0LB 5DD5L 5E8OB 4D0CB 2Z0BA 4GKNA 3UJJL 3GMQA 3DO7A 1JK8B 3H9HA 2HT4C 2EIBA 3B9VA 4NKOB 3I6GB 3L9RB 5TQ0H 2XA8L 4PTTA 1DVFD 4XPGH 4H88L 1X5XA 1IAIH 3LCYA 4NYLA 3GB7A 4I3RL 3BRFA 5JIHA 5FOBA 2RHEA 4CW1B 5KZCB 1OLLA 5I1CL 3NFPA 1FZOB 5DK0B 4P2RD 4LMQI 5FO7A 4OLXL 1V3LA 5IHZB 1LE5A 1HYSD 4UILL 12E8L 3RVUC 1U8MB 1M4KA 3ES6A 3N50A 3HMXL 3SE4C 3CSYB 3N1FC 1LD9B 2BSSB 2OX5A 4O58L 4Z8FL 1P4LA 1XFPA 1JIBA 4EJ1C 5DJZB 1I7UB 3VGFA 1PG7X 4EIGB 4ALAL 3MXVH 5CP3A 1D5MA 1J10A 1UFUA 3WN5B 3B8YA 1MSPA 1YNLH 4CADA 5L2KD 4P5TD 3EKCA 3LQAL 4I3GA 1I9RL 4CAGA 3QO1B 4U7MA 5DHVH 5T3ZL 1V7NL 4XCNA 1C8PA 5L0QB 1NAML 3G6DL 3G5ZB 1KPUB 3QWRD 5CUSL 4TQEL 4XC1L 3AB0B 4MA3A 2I5YH 5ENWB 3PWUB 4LRNL 3DRQB 3DIFA 3RQ3A 3D0LA 2EYRB 3V8CA 1P9MC 1CGUA 4PLKC 4WV1C 4G3YL 4IRJB 4NQXA 5IGXH 4FG6C 1L6XA 2QV2A 3K81A 3RJDA 4GRLA 1MFBL 4OZHE 4XCFL 1FC2D 1UJ3B 5E5UB 1X7QA 2PW2B 3BH9B 1D5BB 4NGHH 2XN9B 4HUXA 3RZCB 3AREC 3X14B 1CLCA 3RWIB 1RI8A 4JFEB 1ZSDA 3LEYH 4TSAL 4E41A 1J88A 1S78D 2F53E 4PRHA 1KPVA 5CHNA 1KCKA 5E7FA 5CBEA 1INEH 4EZMA 1H8OA 2BOCB 4IMLA 1WICA 3DV4B 3QDME 1MLBA 2MJWA 4UBDC 1GHFL 4MAYB 3QDGE 4J1UB 2H9GA 4OLWL 1XCTB 4OM0H 3R06A 2I25N 4JFXA 4XVJH 5ADPH 5J89A 3H0TA 4GXVH 4O51A 3JWDC 4G8GA 2F19L 1B4JL 1EX0A 5DRZB 3U0TA 1A6AA 5T1DH 5HHME 4YK4B 4NQEE 3W82A 1JMXA 3QXUA 1JFQH 4JG1H 5CBAB 1IEHA 3VCLA 2HYMA 2ZPKH 3J7HA 3ZDZF 3G08B 4X7SL 1S7WA 3SKNA 1QO3A 2YD1A 4KUCD 1JYVA 4NQDA 5INCB 3D2UB 2W0FA 3BP4B 3NACL 5LG1A 2XTLA 1LE9A 4X5WB 5IMKB 3FHAA 5I1JL 1NFDF 1LO4L 3UTTA 3FB6B 2QQNH 3T65B 2OP4H 3JTSB 1LO3L 1JRHL 2ZCLH 5F7UA 4HF5L 5J6GA 1IT9H 2D7TL 2YEZB 3V4PH 5C2BH 4ZFOL 2IPUK 2EDEA 1AY1L 1JTOA 5FK9B 3MUGB 1M7IB 4S1SH 1CN4A 5EBMA 3VXOA 2GJ6B 3MRHB 3FO2A 3V0VA 4NT6B 5IT2H 4FQIH 1K4DA 1A7NL 2G9HB 4JLRB 3HTLX 1CL7I 2DLGA 1XR8B 2F15A 4ZO8A 3O3AB 3E6FA 1A1MB 5DJ0A 5F1IB 4BFGA 1X4YA 3ARBB 3I75B 1QPPA 4N0CC 3WSQH 4Y19D 4KAQH 5FHBH 2JIXD 3H9ZA 4NQVA 3PP4H 2L0DA 3OKOB 2X7LA 3KHQA 4P23C 4G6MH 2FBJL 3QEUB 2EXYC 2XWBA 3TBWB 2ZUYA 2CIKB 1BQLH 5F9WC 3UTSA 1WBYB 1QYGH 3GBML 2E7BA 4KDWA 2A6JB 2P45B 2QQLL 3P3YA 4YC2B 4PJDE 4TSCH 2G60H 3QEQA 2NY5H 5D1XD 3FB8B 2DLFL 3CFEB 3VXSE 1GC1C 4YK4C 2AXFA 2VISA 3VG9C 3MLPA 3PQYD 4EKXA 2J4WH 2NY3D 3CDFA 4TUJA 3EYVA 1NBYA 3W9DA 3ORJA 1X5HA 3QEGL 1TCMA 5T3ZE 4JY5L 2BFVH 1MEXL 1KJMA 3EUUA 3QFJE 2X1OA 4X7FC 1ZT4A 3MLYL 5JUEL 2EDFA 1YEGL 4WFFD 1LVEA 1QLEH 4YR6A 4GG6F 5EU6D 5CP7B 4L3AA 5EA0L 4Y4FA 4Z0BH 4NO0B 4TVSa 4P2OD 4AEEA 5E08H 1CE1H 3IFNH 5F6IB 4IBLT 2ORBH 4S0TD 4WI9A 5D7LA 3GSNH 3H3PH 5TDPB 1J1PL 3QA3B 2ED7A 3GKZA 1MCCA 1WWCA 3ME0A 1RUML 1YPZE 2NR6C 4L8BB 4HWNA 4ACPA 4Y4HB 1HH9A 1PGRB 4YUEL 4JN1L 2VLKE 1UC6A 4Z6AT 3C09B 3MRQA 3S5LA 4PY8J 4QRSA 5C7XL 5DJ8A 1UCBL 3T08A 4L4TD 3CFKB 4DGIL 4P3WA 3TM6A 3QNXB 2E6JA 4DWHA 2PTTB 4Q7DA 4U1SA 5DDHA 5IVZB 3WXVH 2LVCA 2ZUWA 5LQBH 3IDIB 4M7LL 4XCCH 3KDMB 2VDRH 2HT3D 3QIBA 3NABL 2NZIA 1DVFA 5B3JE 1H3UA 4TSBH 1SJEB 5GRVK 1FYTE 4MB4A 3MREA 4ZYKA 1PZUB 4P2RA 2FR4B 4IHOA 4V1DD 2A9NL 3FAWA 15C8H 4YHKH 5H37H 3C2SA 4XGZB 3VDBA 1E0OB 1A6WH 5FGBC 3KPNA 5I1EH 4PG9B 4MNHB 1HCVA 4WUKH 3ALPA 4AL8H 1S9VA 1MVUA 2F5AH 3MRMB 1K8DB 4NZDA 4XH2A 4AJ0A 3L6FA 3BXNB 5J57B 2BSRA 4ODVL 4CJ0A 2MNUA 2A6DA 3AGVA 3AAZB 3HI5L 3LRSB 4PRNA 1VEPA 3ULSB 3BESR 1NSNH 3D39E 4X8XA 5L2KA 3A6CH 4P5TA 3HMWL 4RMTA 3W11D 1U58A 3JWDL 3SKMA 3S37L 4D9RD 2NY7H 3I84A 3EDJA 4HKXB 2F5BL 2WUCH 2DQDL 1H3TA 1XGUB 4PRPB 3OXRB 4H26B 4X0KB 3OZ9H 2DQEL 1J5OL 2EICA 1DANT 5C0GA 1HH6A 1UACL 2UYLB 1UM6L 1QZ1A 5E2UH 3SGEH 4WDIB 3G6JB 1QSVA 4B7IA 5EIQA 4NO5A 5DD1H 4XP1H 5DEZA 4BQ9A 3LRHA 4U31A 1IC7L 4PIRF 1YYLL 2QQKH 3E6HB 4LEOB 4MYWB 1SBBA 4MB5A 2EDNA 4KFZC 1UWGL 1W72A 4PJEF 2VERN 4XWGL 4DCQB 2VDQH 4ZFZA 3WUWG 5JXEA 3L3GA 1BZ9A 1MRCH 3V79C 2K7PA 3BP6A 1F4XL 4NZUL 1F4AA 1CFSB 5GRUL 1FAKT 3PWNA 4BZ2L 3ILQD 1DP0A 3O45A 4H1LA 4EXKA 4U1LB 3RVXD 2R0KL 2NY6B 3EYFB 1T1ZB 2P8LA 1B0RB 1JGEA 1D5IL 3V0WL 3ULUL 1GOHA 2CXKA 3RTQC 1YMHA 1R24B 3BVNA 4MJID 3DJ9A 2ENSA 2DWDA 5IFAL 1K4CA 2B1HH 2UY7A 3O3UN 3SDAB 1XGYL 3P11L 2DQHL 4RMQA 5DQDL 1UA6H 4TOYL 3QO0A 1CLZL 4HIHA 5CMAB 4AG4H 5SWZD 4JZNA 5DQJA 2VKXA 1X5JA 5EUOB 3MACL 2HP4A 1PKQA 3OAUL 1B2WH 1SMAA 3UX9B 5JR1L 1BIIB 4HCRH 1LNUB 1NDGA 3QDJE 4QTIL 5GGVL 2UUDH 3VGAB 4R4FH 4UQ2B 4ODXA 5HHXH 5D6CA 3MO1B 2NTFA 4APQD 1FFNB 2EIZA 3N9GL 3S4SB 1XZ0A 4M3KB 2QBWA 1XF5A 2FJHB 3VXRA 5JMRA 5JW3H 1HSBB 4LLMB 3ZHDA 4HJJH 5F8QC 3IXAB 1H15A 5IEHB 3CPLB 4OZGE 5C6TH 4DZBB 5JLZB 3IS0X 2P5WA 4CNIA 4JDZB 1AR1D 5ACMA 3VFOA 4YXHH 4UT7H 3MLVH 3FT4B 5D7JC 5F72S 4WHTA 5FO9A 5ITBH 5I71B 4F37F 1OF2A 1JUFA 5FKPA 4URTB 2JIXA 1EJOL 2IG2H 4X6CA 5ERWA 4OIAA 4UV4H 2YN5A 4XRCB 5FDWA 4DFHA 3I6LD 2FECI 5IG7A 2VTFA 4Q97A 2J8UB 3VXUA 4G9FD 4UIMB 4XVUD 1FFQA 5KVGL 3O9WB 2FEDD 5DMKA 2F54E 4FZEH 4IJ3B 3HNVL 2EDYA 1FE8H 2DWEA 4MD0A 4NQCB 2HRPL 1OP3H 4FTVE 1S7UA 1KIPB 5C0DA 3BWAA 4G7YH 2I9TB 2XZAH 3QUYB 1MCPH 4R26L 3ARPA 4BH7B 5JIPA 4TVPH 3T8XA 1E6OL 2EC8A 4Y4KB 5D1XA 2E9BA 2ARJQ 2HFEB 3H9SD 2WP3O 2Y7QB 2COQA 3SDAC 3VW3H 4FQCH 2ITDA 4LF3B 3C6SA 5B3NA 3H7BB 4JDTH 4XNUH 1F90L 5BW7A 1G0DA 2KH2B 2HTLD 4JO3H 3OWEA 2YSSB 3GSQA 1ZVSA 3JSSA 1RHHA 2CO6B 3ARZA 3HNTL 2E27H 3DETD 3MRCA 2QSCL 1CDCA 1EERB 2K7QA 1KFAH 2R0LH 1FNEA 5JPNB 1OOAA 4DJMA 1SJVA 3M45A 3VXNB 4LAJH 1N6UA 1Z5LA 3TJEH 1SM3L 2FYYB 4P2OA 3VGAC 2NW3A 3B5HA 1YEKH 3IVKB 3QHZH 5F7YC 3V8OA 2VSCA 4AEIH 3ESVF 3LZFL 1S7XB 4U6XA 1CQYA 1T20B 4LRIC 2A1WH 2V5TA 1HHIB 4NKQB 5C0RL 3BKYH 3PP3H 2AQ2A 3WIFB 2QADB 3PWVA 2GIYA 4JQXA 1FFOA 2H32B 3SKUD 3T3ME 5ACZA 1AIFA 4G9DB 2NW2B 2VZTA 3OJDB 4Q6YA 1UKQA 3BPLB 4LLWA 5CILL 5HDBE 1KOAA 4HXBH 4X4ME 4KH2A 1IBGL 4ZFGH 4TULH 1XF3B 4MVBD 2HMIC 5JXAH 4PTUB 1FVEA 3F65A 2ADGA 3AVEA 3UYPA 4IJ3C 4R97C 3BJLA 4ZO7A 1KPRB 4MNQB 4L29A 4X6EA 5CJQH 4UOW1 5KSBE 5LKNA 3ZL4H 4V1DA 5LBSL 4HK0B 4HDIB 3ARDA 2IPUG 5D6DA 1VEOA 1H8NA 1DLHB 2IAMA 3KR3L 2AKRA 5ANME 5DD0L 4PJIF 4QRPB 2QHLA 1OW0C 2WIIB 1JZ2A 4OLZH 5EIIB 3QFDB 5I8CA 1VKXB 5E8NB 3S36X 3UCRA 1SYVA 5E8EA 3LKQA 1P7HL 1EHXA 3O41B 5LGJB 3BKJH 5HPOA 2VZSA 3O4LA 5EDXA 2DI7A 1X6LA 2QJDA 3PGCA 3LKRB 4OD3L 5IEKA 4Y5YB 1BLNB 3WFEH 3HUJA 1BFSA 2NXYD 1U3HD 2X41A 3QNZA 4R7NA 2NZ9D 3I50H 4JRYD 3VXMA 3ZE2E 2LU7A 4K3DH 4LKXB 3RI5K 3OKNA 4UUJB 4NWTH 4OIIH 1DANU 1W0WA 4QCIB 2Z8WC 2WLYA 1BHGA 3HAEA 2AJUL 4RFEB 2V7NA 4U1HB 1GPOL 1I1AD 1T1YB 3ARRA 4RFOL 2V2WA 2K9UA 3VFNB 1QFUH 3QQ4A 5KOMC 2QADC 2VLRD 5BV7B 5IR1A 4D0BB 4JG0H 2AK4D 2C3WA 3ARFC 5GGRB 2GJ6E 3CAFA 4F9LA 4XNYH 2HA1A 1VFOA 4WEMB 5F1NA 2MQ0A 5EU7C 4P4RA 1FV1A 4ZUUA 3T1FB 1DTUA 2C3GA 3DV6B 2BVQA 4WWKB 4LBEB 4AT6B 3FFDB 3U9PH 2XY1A 5FM8A 5F21B 4MNGA 3C5ZD 3KLHC 4LPWA 3MJ8A 5HYJE 2R4SL 1VGEL 5I1DB 2FX9L 3LB6D 4NSKA 4A6YB 4MJIA 3QNYB 3KLAA 4LLDB 4K7PH 5I19H 3WIIH 4WW1B 1J9CT 2VDOL 1BQHB 1KIRB 2VXQL 5BS0B 4PGBA 4X80L 4D9QD 4O9HL 2VRAA 4YHMH 4ZXBD 1YEJH 4Z5RB 1QA9B 5E99H 5IUSA 2EDLA 4WO4B 3VWJB 4NQSA 3I3DA 4OZIF 3WFCH 1Q94A 1CL7H 5SWZA 5EBWA 4FN0A 3WO4C 4QRQB 5C0BB 5F6HJ 1BJ8A 4CU8A 3NAAL 1JPGA 3F6IA 4HUNB 5C0AD 3EJJX 2ZOKA 5LWYL 5KS9A 5DUPH 2PO6B 4U7KA 4MD4B 4JGUA 1UWEH 2ZP0T 4OF6A 5HXMA 2BOBA 1YY8B 4JCMA 1TZGL 5J06A 3SGJA 2FD6H 5KJRH 1SQ2N 1M6OA 4F9PA 1AGEA 3W11C 1FVDB 5IB2A 1HSAB 2W1NA 3NFNA 4MXWL 4MDIB 4JGMA 3DGGB 4HH9B 2X4SB 3KYAA 4WW2F 5E94B 5C08D 4U1KA 3CCHA 4Z7QF 2EH7H 5HI4D 3S97C 2CPCA 1EIBA 4HHAB 2CRIA 1OVZA 4X99A 1A6TB 1R3JB 4JFZH 3C8KB 3L5WB 1C16B 4DUVA 2M1KA 1CXKA 3MV8E 4JAMB 4OFPA 5C1MB 3GSXB 4KV5E 3MBEB 2OI9B 1CR9H 3MRDA 1MCWW 3A6BH 2C5DC 3MRPB 2UWEB 1OM3L 2AI0H 3NMEA 4XPHL 1KJ2B 4NNXA 5HYSA 5C0IB 5DFTA 2H3NB 1CT8A 5BJTB 1Q9KA 1A4JB 1F42A 3N1QC 1I1YA 1CE6B 1QLFB 4JVUA 3TPKA 1ZWIA 4OF7A 2WAHA 1WT5A 3L7FA 1UEYA 4GAGL 5T1LD 1CXLA 3GMMA 4ONHB 5CD3A 1WAAF 3S9DB 4P3DB 5HSFA 2AAVA 2CDFA 4U6VH 1MLCB 4HQQL 3H3KA 1RZIB 3SKOA 3MFFA 1TZIB 3DXAA 1FBIL 3HC3H 5IB1A 4WO4C 2N1KA 3UTQB 1DBJH 5FYJU 5ILTH 1X3DA 4ERSL 2D0FA 5DWUL 32C2B 1IJ9A 2PO6C 5KG9A 1UM4H 3N85L 2PTVA 4M1CD 1I7ZB 5LGHH 4HJGB 5DT1H 1DN2A 4FQLH 5J9PB 4O02H 4S2SA 4PJ8B 4YO0B 5C70A 2NY4D 4J8RA 2RGSA 4P59H 1BD2B 3ZZ1A 4YFLF 5E4EB 1LK3L 3V5KA 4PJAB 4UIKL 2XTJD 3ZT5A 3KPSE 5KW9L 5F1SA 4NUJB 1NCAL 3C9NB 3F7RA 1Q72H 1RULH 2FJFA 5D71L 1VFAA 3Q1SL 4M7JL 4PP1D 1HWGB 1KLUA 1JPSL 3WYRA 4U3XA 5HGDA 4E5XB 2R29H 2VLLB 2BHYA 5B8CA 4PRPE 5SV4A 4HIXH 3WFDH 2MPAL 5EO0B 4ZODA 3WNKA 4NKDA 2VMFA 3BIKB 5E56A 5CIPB 2FATL 2ADIB 4PGCA 1W72H 1NDMA 1RIUH 1CQKA 2OI9C 5B39G 3QG7H 1DQDH 3HNSH 3BP7B 2IQAA 3CZFA 3BYTA 3MLUL 5E8DL 3MRRA 4RMWA 3FN0L 5EB9A 1IGJA 4H1LH 5TF1H 1HKLL 3UC0L 4LNVA 3W39B 3O3BA 3T0XA 1IKFH 5JPMA 3NCFB 2C1PA 3DURB 3MODH 4KDVA 1CF8H 1MIMH 3K0WA 4X9IA 4B53A 4PRBB 3D3VA 3ZMRA 2VR4A 3A6OA 3HLAA 2IPTL 3TZVB 1MI5D 1NFDB 4FXKA 4KJWD 3TO4B 3GKWL 4BYHA 2V7HB 2BMKB 2FZ3A 2CUMA 5HHOA 3HZVB 3X11A 1BJMA 4MS8C 1U8PB 3RWFA 3C2AH 2ADFL 4EBQL 3ARGD 5C86A 5K9KA 4OCWH 5EOTB 1FJ1B 2R56L 4L5FH 5FEBA 2OS7A 1T04A 1CDGA 1NL0H 1TVHA 1XF4B 3VDCA 4IIQB 3K3QA 1MNUL 4M4PA 4L3CB 1QSFD 7CGTA 5IVOA 1YNKH 4IRSD 1KG0B 4I18A 4XNQB 4PBWD 2P1YA 1GL4B 4HWEL 3DROA 1LEKB 1YN7A 4ZD3H 5ICXB 4NJAH 4KK5D 3F62A 2JJTC 4DKDC 1ED3A 4XP6L 2AK1L 1DUZA 5MEND 4J3OC 1EXUB 2ARWA 4Q74A 1QBLH 2VLRA 1QKZH 2OR7A 2IQ9H 3GMNA 2AK4A 2LTQB 1XIWD 1NC4D 3RPIA 4GMTH 2YRPA 2NQCA 3P0VL 1IAOA 3CDGB 3T2OA 1P7QD 1NEUA 4O2FA 1J1OL 5DI8B 4R8WL 1AD0B 1TFHA 1LDPL 3VXTA 4LCIL 4NM4L 3C5ZA 4PG2A 1BVLA 5JHDB 4ODBD 3QHTC 2VNCA 2B2XH 2NY1C 1KBGH 2ARJB 5F96L 5CZVL 3V4UH 1RJLB 3VA6A 5B38A 3OKYA 2O5ZL 3MR9A 4NC1C 5KBNC 4KMQA 3HG1B 4QHUB 5BV7L 4FXGB 5E5MB 1T66D 1G7IA 1F4WH 4YHIB 4ZXBA 4B0MM 3L3JA 3TZVC 5CEYB 3PXJA 4WI8A 3VH8G 4UINL 4GG6B 1IAIM 4LDOB 1PD6A 4JFFA 2HFFA 2VITB 5L88H 3FAXA 3ZKMC 4QXGH 3GRWA 1FRGL 2OQJA 4UTBL 3TWCL 4E9LA 2VAAB 1PZ5A 4UV7H 4A6YL 1OWRM 4K2UH 1H3GA 2A74B 3OXSA 4FP8H 2XQBL 4N68A 5EUKA 1T7WA 5I1HL 4U2YA 3X3GL 1S7TB 4CMMB 1LK2B 3EO9L 5FGCB 1GOGA 4IIQC 2OTPA 2EE6A 4ONFL 3V9FA 4L3ED 3N1PC 4Z7UB 3WS6C 1F8TH 3EYOA 4CVXA 2I07B 2DJUA 2DTML 5FAAA 5F3BB 1GGYA 3IDYC 2R23A 2JCCF 4HX1A 5C08A 3O3EB 1FIGL 3I2CH 3OR7A 2OL3B 4DTGL 2IALB 4PJ7A 2VXVL 5HVWA 5GSRA 4NP4H 3PL6B 1MRFH 4KHXH 4EUPA 3TNNA 1ZLWK 5DMGD 3G5VA 1DQLH 3SPVB 2LFGA 5IWLC 4H25A 3BAEH 4RGND 5HJ3A 3MRBA 4HIEB 3GIVA 3KPRB 4NZJA 4KZEL 2Z93B 4DVRH 3VRJB 5GISH 2X44D 3UAJD 2R2HA 1IC1A 4OGZA 5CJBA 4LDEB 4Z95L 5E2VH 3MLSH 1G7PB 2FO4B 3KNBB 4EN3B 4BA8A 1FQ9C 4LCCA 4A2LA 4XBPB 3GK8L 2BVTA 1RU9L 1HI6A 3OPZL 1AD9A 2D0GA 3OB0K 5GGTH 1QRND 5EU7E 4NQUA 5F88B 1DDHA 1RUQH 3RX5A 3B2VH 1F2XK 2H45A 1YUHB 3TBVB 5FUOH 3Q6FB 4QRUA 2WUBH 3MOBL 5F89B 4MNQE 1KJ2L 3IDJB 3GMRA 3TA3A 1CXFA 4OKVA 5EU5A 4ELMA 1JHLH 1S7RA 5DJ2A 3RZWA 3IDMB 1VFBB 2B7DT 5EU3B 4PJBB 5E2TH 5EBLA 5IV2B 3IU4L 5FYLL 3OGCA 4GMSL 1IC4H 3S37X 3MLTA 3RDTB 4N1EA 3QXVA 3JV6B 4S1RH 43CAB 3GHEL 2Y6SD 5JDSB 1H0DA 2X4PA 1PY9A 1FGVH 4XMPH 1UT9A 5JO5B 3RWHB 5LAXA 1MHPL 4U1GB 2RCSL 2DQFB 4JM2A 4PJEB 5FECA 1I3GH 2B4CH 1QSEE 1OB1B 1ZA6B 5IM7B 1RFDL 2F58H 3MRFA 1CLYL 3P77B 5FXCH 5E8PA 3PL6C 1S7VB 4CBPA 5FV1L 3GJFK 5GS0C 5IHUH 1NGQH 2ED8A 2XRAL 2C7UA 3U46B 4K7FB 1ZEAH 5ID1A 1EA9C 3PWPD 4KMTH 4FMFA 4Z7VA 4C55A 2EXWD 4ODHH 3PIQA 2VQ1B 2V5MA 3QCUL 4Y5XB 2B1AH 1SHMA 2P46B 2KZ1B 1OD7A 3F5WB 3CFDB 1BJ1H 1OT1A 1QQDA 1O7SA 2YK1H 4OFKA 1ODAA 4YQXH 1OPGH 5I8KL 5CKAA 1ZANH 3KJ4B 4YH6A 4NO3B 1N0XL 4L8CA 1KCUH 1FLRH 1IILE 2PNDA 1YMMA 5EO1B 4G43B 4QRRD 4P2CG 4GQ9H 3ECBB 3HI6L 2FEEL 5CGYC 5HGGS 3GMOA 4ZTPH 3L5XH 5GGQH 3HS0A 3QCVH 3SE9L 5E9DD 1XGRB 1FN4B 1CGTA 3FFCB 1KXTB 3IKCB 4WUUA 2FH6A 5L2JA 1NKOA 1L0QA 5J1SC 4P3CH 2IFFH 4HLZG 1IFHL 1Q0XH 3IB4A 5JOPE 5HI5C 5C07B 1OAUL 4U6HB 5DFVC 4ELKB 3MNVA 1RUPL 1ZS8A 1VFMA 4LCWB 4RZCA 5AWNL 3RDTC 5JNYB 5GRYA 1L7TH 3MRIA 4LASL 2ZCKH 1MHCB 3G5XA 5K59F 1U8OA 4XNZB 3BPCB 3N0PB 5C0BE 3BGFB 3HC0B 1WCQA 1WTGT 3OAYH 4J3XA 4U1GC 3D0VB 4PRDB 1IARB 4QT5A 3MJ9L 1BJ1J 4NKIH 1OP5K 3I9GL 3RVTD 5CEZL 1U2HA 2Z91B 1T1WB 4RX4D 1MHEA 3W5NA 4F2MB 3IDGB 3NH7L 1CFBA 4P5MA 4M48H 2X9WA 4F33A 1YYML 2XNAB 2VE6B 3P2TA 2HJFA 4QOKE 2AJ3A 3V5DA 1U8HB 1P7QA 5HYFA 4PB9H 1L0XA 4GRLC 5F1OB 4HKJB 4JRXB 5IQ9B 4GRWH 1TCRB 4QNPE 2D3VA 3J8F7 2BJMH 3WS3B 4KROB 1QG3A 4G42A 4F7MA 4YEEA 2HFTA 4OUOA 3R0MA 2R69H 4LARL 3KXFB 4QHLB 2ZG1A 3LN5A 4YDLB 5IQ7H 5AYQA 3W2DH 3QIUB 3L3HA 4IOSD 1VACB 5INDB 3KJ4C 2UWEE 2R1YB 4PB0L 3SDCB 4X4YB 2IANB 1UGNA 1RURH 1WBXB 2DM2A 4PRID 3VMPA 4QF1B 2IPKB 1N5YH 1ORQB 4TUKL 1DQTA 1JV5A 3DMMA 1KC5H 1B0WA 3QQ3B 5FYLE 4OZHA 4BFIA 2GSIA 3O6KL 2VH5L 1SYSB 4P2QB 3Q3GA 3GNMH 1BAFL 5JORB 2BVUA 2F53A 4NJ9H 4MA1B 3D85A 5I75B 3GSOA 3STLA 3I02B 2WV3A 1CG9B 3MGOA 5MI0B 5JW5B 3BGFC 1R3IH 1IQWH 3IJHB 1CD1A 3QDGA 3UYRH 4JPKH 4OGYH 1G6RB 2WINA 5I1KH 1DBBL 5SWSD 5F8RC 1BECA 2QSQA 4PJ9C 4ZOAA 3T4AB 1FO0A 4XVTH 2PETA 2CDGA 3BPOB 3MYZA 3EOBA 3JV4B 2XPGA 2CLVA 1TJHH 3G04B 4R90L 4NQEA 1BBJA 4PJAE 1JGLL 4KHTH 3BZ4B 1BM3L 1YJDC 3RY6A 4PJIB 4KI1A 4CVUA 1QVOB 3UEZA 1AO7B 1T22B 3DX7B 2Q6WA 2OXGA 4I2XB 2EKSB 1A21A 2ZNWA 3TH3T 3ZKXC 2OL3L 5I76B 1PG7W 4EI5B 3OQ3B 4X7TA 4P9ML 4HULB 1DQMH 1VFUA 1FL6A 3K1KC 5L7XL 5GS0L 2R8SH 3U0PA 3KHOA 3QIUC 5AAWA 4OZFB 5HGAB 3GBLA 3QJHB 5ABDE 3RWDB 4O2EA 3SDCC 5DEFB 1OAKL 1T7YA 4QEGA 2MCPL 3QJFA 1U8NB 4XC3H 3MV7D 5JHLH 1B0GA 4NC1E 4RRPG 2AJVL 4F57L 3VMNA 3WUWB 1XF2A 2E7MA 3BIBX 4HK3N 5IMMB 2Q8AH 1IGYA 1KIQA 3VFMA 2ITCA 1S5HA 1W0VB 1KN4L 1TQBB 1NFDE 3QG6A 3ULVH 4ZSOB 2VZVA 5F9AC 4OSUL 4JB9L 2QR0B 1L0YA 1MIEH 2DB8A 4GJTB 2NNAA 5IB5A 4HPOH 5MEOB 4PJGF 2APWA 5CEZE 5ICYA 2J6EA 1R3KA 4ORGA 2JJUA 1CDYA 1AXIB 4FTVD 3HMXA 4HC1H 1OARL 4GKSA 3U30B 4LLYB 4I1NB 1NGYB 3BPOC 4PJDA 4OCRH 4XMKH 5CJXC 1M71A 1N59B 1VB9A 3VXSA 1A6VH 3X13B 1DBAH 2E8YA 2QTEA 2XKNA 5KZCD 5IB4B 3DYOA 1BFOB 3EOAA 2OMNA 2D7NA 2HH0L 5EPMA 3RKDC 1M7DB 5AD0B 1JWUA 3BEWB 1NAMA 4JZJB 4GLRI 5IMLA 1FG2B 1JWSB 4KI5C 3BZEB 4K8RH 3LAFA 1KTDB 4OZIB 3QFJA 2YMXL 3OKEA 4JN2A 4RGOH 2I9LA 4OD1H 1MF2L 2P5EB 5CINH 3MCKB 4ETQA 4FFZH 2CKBB 1DVFC 1KGCE 4TPRH 3HC4L 4Q2ZB 1MRDL 1XGPB 5JHDE 3FOMB 1OGAD 4K55A 4K9EH 4PUBL 3ARQA 3HE7B 2W65B 3VGGA 1T21A 4LQ1A 5EZIL 3CVIH 3WJJA 4L8SB 4TN9A 1TXKA 2ERJB 1YPZA 1MAKA 3BMWA 1HYSC 2W0PA 4C56E 1BVKA 1IGCH 4ONGL 3CUPA 1MHHB 5I1AA 5KAQG 1S9XA 4YDKL 2VLKA 4J4PD 3ARWA 3D18B 3TYFA 4JFHE 1NJ9B 1EAPA 4L9LB 4XT1C 1IEAB 1I1CA 4MXVF 4KKNA 3FQTB 2E6QA 2KUTA 3NZ8B 4W6YB 3UJIH 4IRJD 5IF0A 3D6GA 3QUXA 4KRMB 3WIHH 4NN5B 5JW4N 1MAMH 4P5TC 3P4OA 3IS1X 3UBXG 2BNRB 2Z31B 3FO1A 2XN9D 3ULUD 5E1HB 4Q9QH 1DUYB 4JREB 3RZCD 3UO1H 2D9QB 4XXDB 4JFED 1YEDB 4LVHB 3L5HA 5FGCE 2PXYB 5I1GH 4WJ5B 3RHWK 4F7EA 4EUPH 1UWXH 3K7UA 4OB5H 4Z7UE 4OM1L 2OBGA 3FRUA 1O7VA 4OJFL 3EGSA 4MAYD 4RAVA 3CVHB 2H1PL 4G6KL 1FZMB 1JPTL 5HGHA 2X1PA 4NCDA 1QOKA 1HWHB 1D6VH 4ZQKA 1X5IA 4MA7L 2F74A 4XXCC 3OHXB 3D39A 4Y19B 2ZJSL 1EFQA 1MCWM 3MLZH 2X89D 4GBXB 3IFLL 1S78C 1QPXA 2GFBB 2NTSP 2E7CA 4LKCA 4LLUB 2W0LA 4Q6IC 1KTLA 3KPRE 4YX2H 4ZFOA 1FNLA 1H5BA 4ISVB 5IESH 2CUIA 1TQCC 2NYYD 5C0JA 3QSKB 4HWZB 4KPHH 2NLJB 2CRMA 2W9DH 3NCBB 1YJDL 4LHQB 4PRIA 4U1JB 7FABL 3MUJA 5B4MD 5IFHH 5I1IL 1AH1A 5D2NB 1KEMH 1T0MA 5E1AA 5I6XB 2R4RL 5BVPH 4HFUL 3T0AA 3TO2B 3LIZL 3DX8B 2ATKA 3BE1L 5D7SH 3ZYZA 2ERJC 3EZJB 3IU3A 3WXWL 2WP3T 5I16A 3S96A 4UB0L 5FA4B 3D5OF 5HVHB 5FYKD 2KL6A 1KB9K 1N4XH 2NY3B 1I7RA 3BQUA 4L9LC 3SO3B 4W81A 3RY5A 2GJ6D 1QLRA 3U7YL 4WY7L 3RRQA 3PWJA 1MJ8H 2D7OA 3GI8L 3HE6B 1MJUL 3CDYA 5I30L 1ETZB 4PJBE 2BNUB 3ARBD 4HH8A 3BWUC 4KKLD 5EU6B 3X12A 4PGEB 4XMLL 2EECA 4NM8L 4D94A 4K3EH 2MOVA 2YPVH 2DDQH 5DHYA 5GGUB 5GS1B 4WFGE 5IJVA 2VC2L 3QZWA 4ESKA 3GSVB 8FABA 1GIGL 1A0QL 1GGBH 3TCLB 1RZFH 5E00B 2Q87A 3MLRH 5GGRY 4KJYA 3SQOL 1YNTA 2CH8A 3MUY1 2CSPA 3PDOB 2WMPA 1ES0B 3IF1B 1CGVA 4PJHA 4DKFL 1NCBL 3SY0B 3O2DL 3L1OL 1T3FA 4ZNCD 1RUAL 1OAQL 3SE4A 1Z2KA 4MJ6B 3SJVE 4QHNB 4XAKE 3QDJA 3MV9B 4K71B 5L9DL 4JR9L 1ZGLB 5A2KH 4OF3A 1JNHA 3DPBA 1KTRL 4X4XB 5HGBA 4LLAA 1UH3A 2Q7YA 1OTUD 3MV7A 4I48B 5D2NC 5I6XC 2APXA 4WI3A 1LMKA 4CN6A 1N6QH 2JB6B 2EDQA 4LSRL 1LO0L 2FLRT 3NGBB 4OZGA 1KT2B 1VA9A 4ODTL 3LD8B 5D1XC 3ALXA 2H26B 4EOWH 5DUBB 1R0AH 2JK5A 5BMFL 4EI6B 4NO0D 2RFXA 5T33L 1ORSB 1P9MA 1IGML 4XB8A 2NY3C 4WV1A 1NLDL 4M6ML 5EC1B 3SO3C 1IM9A 4I5BA 5H94A 3O3DA 3GIZH 5FYJH 1H3PH 3Q6GH 3LVEA 3FFCE 2PYFB 4OCXH 2F54A 5C0EB 1F6LL 1I8LC 4Y2DD 4Y4HD 3AREA 1A47A 1NFKA 3GM0A 1C1EH 1FGNL 4AENB 4F7CA 1DLFL 5C07E 1ZTXH 4FTVA 4UT6L 4XZUA 5FUCC 2SEBA 4LCWE 1IM3A 2ZSWA 4D0CA 1ZT1B 2XOTA 5E8OA 5ESQA 4P2OC 4GH7B 1JK8A 2YBRA 3O4OC 2XWJB 4PGDB 4NKOA 4WFHD 3I6GA 4YBLB 1YQ2A 3L9RA 2IJ0C 4F15B 3NCCB 3LPWA 2Y23A 4UU9A 2PW1A 1C5BH 2MSPA 3OAZH 3S36H 4LSSL 1FZOA 5DK0A 1UQSB 3OKLB 3HZYB 5HHQB 1AI1L 3GUTB 5J56B 2ZG2A 3NOIA 4QXTB 4LSVL 1CS6A 2DQIL 2VSDA 2Y07L 1G7HB 3CXDL 4ZUSB 5DHVB 1U8MA 1K85A 3CSYA 4XBEH 1LD9A 5JTWA 2BSSA 4KVCL 5L6YL 1TTUA 1NQBA 4I77L 3JWOC 4K71C 2HT3C 4N8PA 5DMIL 1I7UA 3TIEB 1O0VA 3OJ2C 4JRXE 1YC7A 5CJOL 2ZCHH 4FFYL 1FORL 3TVMB 3MBXH 3WCYA 4R96B 3QO1A 5D6DC 1JHKL 1BFTA 5EU4B 3NGBC 4R0LB 2IEPA 1KPUA 4W6WB 3FQXA 1HHJA 1CFTB 2J8HA 5HHVL 4Q9CA 1A7QH 2JCCB 3NZHH 4LSQH 3PWUA 5ENWA 3NTCL 1E4XI 3DRQA 1G9NC 2AV1B 2IANE 3PHSA 3UTSE 1CFNB 2CKBL 1P4BL 3VU2A 4HS3A 2BRRH 5ACLA 2YPKB 1QBMH 4X4MA 1IGIH 4GW5B 4NUGL 1U8KB 2VB5A 2Z8VC 1NCWL 1MFEH 2PW2A 3D9AL 3BH9A 3FQNB 1D5BA 3LHPL 2XN9A 3B9KB 4LHUD 4MWFA 5EZOL 3VJ6B 4Y7MA 3NCJH 1EEZB 1T1XB 4J12A 1PDKA 3BSZL 1N64H 5ALBL 3RWIA 1MCEA 4JFEA 4TUOB 2WWKO 4ZUVA 3H6JA 4APQB 2OK0L 4FQJH 2AXJA 1KB5B 5ANMA 4N8VA 3ZDYF 4BQ8A 4XAWL 3DV4A 4G5ZH 5SX5H 4F15C 3MJGX 4MAYA 3NPSC 3A67L 4J1UA 1FL3B 4RCAA 5AZ2H 2NY6D 1RUKL 3BMVA 4I8DA 1OAYH 1WEJL 1VPOL 1MUJB 2D7MA 1X5FA 2X89A 5BRZD 3M17A 5DRZA 5GS2D 5IROC 4C83B 4Z78B 3T1WA 4NN7C 3F7QA 1Q0YL 5CBAA 4X7DC 1BBDL 4ZDHB 1NMCC 4PJIE 4M1GH 3G08A 3ILQC 2IGFL 4NKMB 3CVHL 3RVXC 2Y06H 4CVWA 3SE8L 3T0EB 5INCA 3D2UA 5HDQL 5LXGL 4KI5E 3THML 3BP4A 3QQNA 4X5WA 3HI1B 3V7AG 4HJ0D 1PW3A 2QSVA 5IMKA 2X1QA 3BD4A 3FONB 5B39B 1TITA 3FB6A 3H9SB 3T65A 4TNWF 1TZHB 4EIZC 1G7JB 4FQXB 2YEZA 3UJJH 2M2DA 4FQPA 5FK9A 1M7IA 4POUB 1XAUA 3MRHA 2GJ6A 4NDMB 4NT6A 2XA8H 3MNWB 5CD5D 2G9HA 4H88H 4OF5A 4DKAA 4MMXC 1XR8A 3IFOB 3PUCA 5KSUB 1FVCB 1ZHKB 1A1MA 2XV6B 5F1IA 3ARBA 4GAFB 2J6EH 3I75A 3P4NB 5DVKA 3VRLF 5HYJA 4Z77A 5SWQB 2VDMH 4J3TA 4OLXH 1T2XA 4X6CF 4XP9H 4IOIB 2MKWA 3QXWA 3RIFK 4ZSOE 3OKOA 1PSKL 4RIRB 4APQC 4HXAH 1RIHL 5I8EB 5L2KE 2V9QA 5HY9B 4U6YB 2AEPL 5GSVB 3U4BH 3QH3B 3O9WD 3CMOL 1WZ1H 3TBWA 2CIKA 3OKMB 1YECL 4NQCD 1AR1C 1WBYA 4MQSB 2NXZB 3KS0H 4KTEL 4R4BB 2A6JA 1OQXA 3QUYD 5T3ZH 4OFYD 4XPTL 4ZMAT 1NAMH 1UJTA 3DO3A 4Y4KD 5A16B 4RBPK 1UVQB 1WJ3A 3FB8A 4TQEH 4S0SD 1ZVYA 3CFEA 3TYGL 1L9NA 4KK9D 4DGYH 4JO2H 4OI7A 4XVUC 5ALCH 4W70A 3HFMH 4M5ZL 2FEDC 4YEFA 4I13B 4TRPL 2DD8H 3GSNB 5D5MF 5TQ2L 3NCYP 4F58L 1LGVA 4MJ5B 1URLA 3EO1B 1N7ML 1MFBH 1SY6L 5FCUH 1UZ6F 1WT5C 2FX8L 5D7IB 2PF6A 2V17H 3KPLA 1N8ZA 1HZHL 3DX9B 4PJ5D 5FV2A 5CP7A 4NO0A 2AJXH 3JWOL 4LVNB 3AC0A 1OAZL 3UROR 4GRMB 4TNVF 5TDPA 3QA3A 2HTLC 1YA5A 1JTPA 4YPGB 4UNTA 4UZGA 4YDIL 3KS0J 1VCAA 1L7IL 2CGRH 4L8BA 3S8WA 3EOTL 3DETC 1DL7L 4Y4HA 1YZZA 4GLRH 3UZQA 1U3HB 3KPQB 2I26N 4U1MB 3VH8B 1BPVA 2EYSB 2ADJB 2R0WL 1X9QA 1KJVB 2Z8SA 2F19H 2Z35B 3CFKA 1B4JH 4TYUA 3QNXA 1G9NL 2PTTA 5IVZA 4HFWB 1UYWL 3U6RB 3IDIA 1U8IB 2W91A 1RK1B 4HT1H 1FFPB 1SJEA 4M6OH 5TQ0L 4X7SH 3C60B 3VD9A 2W0KA 3F7VB 5KVMC 4X6DF 2HN7B 5TE6H 2FR4A 3MCG1 1G6VK 1AE6L 4XGZA 4F7TB 4H8WC 3TT3H 4WHYH 1W2KT 3CLFL 1HOCB 1J0KA 2AJZB 3TIDB 5TE7L 4QRPD 2BP3A 4MNHA 5AAMA 2D7TH 1K8DA 1AY1H 3BXNA 4MVBC 4PBXA 4Z76B 3VD7A 4WWID 3AAZA 3BZDA 3LRSA 3ULSA 4Y19E 1HDMB 4LCYB 3ZHKA 1F13A 1H3VA 3WD5L 3KPSA 4ODUB 1A3RL 3WL9A 1E4KC 1G7MB 5GGSB 3QWOA 1JHTA 2GTZB 3MXWL 1BOGB 4HKXA 2W38A 4PRPA 3OXRA 4H26A 4X0KA 3NN8B 2ICCA 1U9KA 2Y72A 2XXCB 4WHCA 5F7MC 2UYLA 3RUGE 5D2NE 1Y18B 3KPMB 3BW9A 1DCLA 3WEXB 1AGCB 5IGXL 1JWMB 5D7JA 4WI6A 3GBMH 3IDNB 3AMLA 2NXYC 2V6HA 1WFUA 3E6HA 4O2CB 3WV0A 1U3HC 4LEOA 2NZ9C 3PQYE 1QACA 4NZRH 2B20A 1TLKA 2XWTB 4ODSH 2ZOLB 3WHE0 1T2JA 2DLFH 3IGAA 5DJAB 4JY6B 4WWKD 2BDNL 1CFSA 1TNMA 1EZVY 4WFFE 4U1LA 5DC0A 1I1AC 5FUCE 5EU6E 3EYFA 5DC9B 1T1ZA 1B0RA 3V7MA 3CD4A 3K80A 1R24A 3EYQD 3MLYH 3ROLB 5JUEH 4OM0L 3SEPA 1YEGH 4XVJL 5ADPL 1NAKH 4GXVL 3T0VA 2ZWLT 5BS0D 4I9WD 3SDAA 1KB5L 25C8L 1BZ7A 4HV8B 2CLRA 5T1DL 4HEME 3VDAA 3C5ZC 3VWJD 1U95B 3B9DA 5ELIA 5CMAA 2LVEA 1JFQL 4JG1L 4ZAKD 3FQRB 2V2XB 4P4KD 2ZPKL 2GEEA 2AABH 3LB6C 4L4TE 2PCPB 5KS9F 5GRWA 1BIIA 1LNUA 4JN1H 2YXMA 5DJDB 2FBOJ 4LHUG 4PJGB 3VFVA 2E6PA 5C7XH 2C4FT 1UCBH 2FSEB 4UQ2A 2QQNL 1J8KA 2OP4L 3MO1A 4IOFD 3SGDI 5AEAA 2BZDA 1IT9L 3V4PL 3S4SA 3GMQB 4V1DE 2FJHA 3DO7B 1HSBA 4LLMA 4S1SL 2UZXB 4QLRA 3IXAA 3LEXB 5IEHA 3CPLA 4FQIL 4DZBA 2B8OT 5JLZA 1CDHA 2DL2A 4JDZA 5CKGA 3T2NH 3RGHA 3GB7B 3LKSB 1P84J 4MQ7B 5IW3A 1ZGLP 2A9NH 3F6LA 5GZND 2JELL 1G9MH 1PVHA 3FOLA 2X2YA 1RMFH 4BUGA 4XRCA 5FO7B 3MBED 2NY4B 3WNLA 5C6PB 1PQZB 1JYXA 3MMEB 3PP4L 4GRWF 1INQB 3MX0A 2HTKD 1KELL 2L7UA 4KGJA 4ODVH 3O9WA 1HIMH 4D9RE 3PABB 4FFVD 4OLYH 4G6ML 5HI4C 5I18H 1Y6KR 3GM8A 3U79A 3Q5OA 1BQLL 1F6FB 1KIPA 2XA3A 1IKNC 3QUYA 4OTXH 4BH7A 4Z7WB 3JWDH 5EOQH 1ADQL 4Y4KA 3E2HC 1GGUA 1OW0A 4ZPVB 4OUUB 4LPCA 2YR3A 2VKWA 4TSCL 2G60L 5AZEH 3BZFB 4I3SH 4LF3A 3EJYD 3H7BA 1QRKA 4RWYH 1UM6H 3PHOB 2YSSA 2GK0B 4NQXB 1I1RA 2DQJL 1PLGH 3BO8A 5JPNA 1T03L 1B88A 1MI5B 3VXNA 4UDTB 2FYYA 2WQ8A 4JM4H 1QLEL 4PJ8D 3UPAA 4XWGH 4CMHB 3O6LL 3IVKA 4Z0BL 2FGWH 4PRHB 1BD2D 1CE1L 1KPVB 3ARGB 4MJIE 5CHNB 1S7XA 4Z18A 4NNPL 2KBGA 1F4XH 3GSNL 3H3PL 4GOSA 4AK1A 1T20A 1DBML 1S9KC 1MLBB 1HHIA 4LK4A 2YPLB 4M8QB 3WIFA 4NFBA 1D5IH 4YHPB 4M1CC 4HMDA 5KANG 1FHGA 4IRSB 4NQTA 4G9DA 5GZOD 2NW2A 3OJDA 5SWZE 1D5ZB 1S7QB 4O51B 4CGTA 3RA7H 2NY4C 5D2LF 2Q3AA 3WXVL 2M26A 1XF3A 2XTJC 4PTUA 1LO5A 4RNRB 4XCCL 2VDRL 1UENA 2W9EH 4PP1C 4JVPA 2ICWI 4U1NB 3H42H 5MENB 3VCLB 1KPRA 4MNQA 4OQ1A 5BOPA 4TSBL 3LN9A 2QLVB 5J4MA 1ZLUH 1T7XA 3OAUH 1J86A 1JE6A 4HK0A 5IFJB 4HDIA 1DSFH 1DLHA 5J13C 1XIWB 4UQ3A 1NC4B 4PJXF 4QTIH 3C8HA 15C8L 1PYWB 3ZYOA 4QRPA 1E4XH 4GUPB 2CR6A 2WIIA 1A6WL 1GC1H 5I1EL 5EIIA 3TO4D 3QFDA 4WUKL 2DAVA 5DS8B 1VKXA 5E8NA 2NPLX 3WNMA 1J8HD 1S9YB 3FO2B 4GAYB 5LGJA 1NSNL 1LEIB 3LKRA 4KUZH 4Y5YA 5T1MB 3A6CL 1QSEA 1BLNA 5EH1A 3ULVF 4G9FE 3E6FB 3U83A 2UVFA 2E7HA 1R6VA 1EJOH 2NY7L 4RWHA 2KDGA 4KJWC 3NIGF 1BWMA 2O5XH 3HHRB 5K33A 2BVYA 4LKXA 4K3JH 4KQ4H 2Y36H 4UUJA 5FM5O 3ISWA 4CMHC 3O11B 3OZ9L 4QCIA 2DYPD 5BVJA 2D4FA 3CJJA 3ARGC 3DHJA 5KVGH 6CGTA 4JKLA 1YY9D 4RFEA 2V5RA 4YZFF 1HXYB 1T1YA 3H9SE 2QHRH 3VFNA 4RGMB 4R26H 4WGVB 4D0BA 1WGOA 2UV3A 4NCC1 4L3EB 5GGRA 4IRSC 1WV7T 1HNFA 3WFBH 4Z7NE 2C26A 3T1FA 3SE3C 4KK5C 4WWKA 4LBEA 4AT6A 3FFDA 2AXFB 1MRCL 4LVOC 3KAAA 1DBKL 3BDXA 5I1DA 4NWUH 3MRLB 4Y2OA 3QNYA 3HG1D 4LLDA 4OAWB 4HS8L 4V2CB 4RGNB 2QSCH 5DVLA 4WW1A 1JBJA 1XIWC 1NLBH 3EDKA 1BQHA 1KIRA 5T1KB 4JPWL 1HINH 4JFHD 4RDQF 1SM3H 1CVSC 5DZOA 4Z5RA 1QA9A 2FIKB 4WO4A 4YIQB 3R8BB 1XH3A 3ZDXF 2IMNA 4QRQA 5C0BA 4MB3A 3VXPA 1T4KB 1W0YT 4KVNH 4AG4L 4AZ8A 1CTNA 1WUNT 2J7LA 4EVNB 4J3SA 3U0WL 3X17A 2PO6A 1QRNB 4OCSH 4C4KO 4MD4A 1QTYT 3M8OL 2VXTH 1B2WL 3BD5A 1YY8A 3LH2H 1T66C 2AP2A 1UKSA 4G8FB 3FO9B 1JF1B 3DVFA 2N4IA 3PV7A 5CILH 1RZKC 1FVDA 2VDPH