4FZEH

Crystal structure of n26_i1 fab, an adcc mediating anti-hiv-1 antibody.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGSSAKVSCKASRGTLSSYFISWVRQAPGQGLEWLGGITPLLGTANYAQKFQGRVTITADKSTNTAFMQLSSLTSDDTAVYYCAGTVYYDILTGLYTNFHYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N26_i1 Fab, an ADCC mediating anti-HIV-1 antibody.
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords N26_i1 Fab light chain
total genus 43
structure length 221
sequence length 227
ec nomenclature
pdb deposition date 2012-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fzeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fzeH01
4FQQB 1WBXB 1AO7D 3K7UA 4ZFOL 5IOPA 5CD5C 2DQEH 3D48R 4WO4D 1TXKA 4I4WB 1F90H 5I1GH 1U6AL 2X2YA 3QDGB 3LDBB 4L5FH 4MQTB 3O8XD 3GSUA 4YHPA 2HFEB 5KS9A 2L7JA 1WVZA 2VN7A 4RAVA 4ZXBD 1LD9A 1U8IA 3PDDA 1Q9LA 3HG1A 3MNVB 3D3VE 4N5EC 1GJIA 4JVUA 4O5LL 1FVCB 2CR6A 2NX5B 1LO0L 3L3DA 2Y23A 4KROD 4UV4L 3BQUB 2DQHL 1GH7A 3HB3C 4IRSB 4X5XA 1CG9B 4JDVB 4XCEA 4ZTOH 1FZOA 1KXVC 4P46A 4LPWA 4U7MA 4FMKA 1J1PH 2ZCHH 3HZVB 3T0EA 2XNAB 4ORZC 4PJXE 2ZSWB 2V2WB 3BZEA 1ZT7B 2O5YH 4U1IB 2Q7YA 1GAFH 1UB5B 3DTXA 5EC1B 2CO6B 4WO4B 2IBBA 4RZCB 3U4AA 5CJXA 1AGDA 1NL0L 4OGAD 5DRWA 4WI8A 3T0AA 3T09A 3THML 4N5UA 5JLZB 2NX5D 3CDCA 1MFAL 2D2OA 5GZND 3FAXA 3DV4A 2Z31C 3NABH 1U95B 3VMNA 5FK9A 4GAJH 4UT7H 4TSBL 2ATKA 3T2QA 3WL9B 1NSNL 4OF0A 3TNNA 1I9RL 2UUDK 4ODWB 3I6LD 4JZNA 4LLMA 3VFWB 1A3RL 3BPLB 1KEML 1WIOA 1CFTA 4O4YH 3N06B 4GG6A 4DOHE 2Z8SA 1QBML 2CLRA 4KK8D 1AD9B 3MRFB 5BRZE 1CBVH 4M8QA 5GZNC 3QHZH 2PYEE 3VFPB 2DICA 1U8PA 3FQTA 5J3HC 5I8OH 4X0KB 1DBBH 5ILTH 5E5MA 2F53D 3S36X 3N50A 1IT9H 5D2NB 2FHCA 2BC4B 4ZFOA 4AEIL 5J1SC 1VFBA 4NM4H 4TRPH 2RFXB 2DMBA 3LQAL 5J11C 5HYQA 4JDZB 4OTXH 3RZCC 4HIXL 4X7DC 3OSKA 4FTVB 5DEGA 2FECI 1CDJA 1RMFL 4JR9H 3EKCA 4DGYH 3S4SA 4U7KA 1D9KD 3MA7A 3BKYH 2VLME 4OCYH 3QIBD 5C0FA 3FT2A 4CNIA 1I3RB 2UV3A 4FRWA 5D7LA 2AW2A 4PJ8A 2R2BB 1TZIA 4HQQH 4Y2DB 3GIVB 1D5BB 1RZ8B 1QLRB 3ARBB 2XI9A 3ILPA 3ARBD 4NQUA 4OF3A 5DYOB 3WJJA 2IFGA 4OZGB 4EOWL 2Q86B 4IIQA 3HCVB 2OMNA 1YNTA 1VFOA 4N0FA 3RUGF 4ODXA 2ARJA 2WSKA 1KB5L 4PBWD 2PXYC 4JFPB 2I27N 4OQ1A 3UTZB 4OIIH 3WLWD 3T4AB 2DF3A 4N9GA 2BCKA 5DK0B 1EJ6A 1S3KL 1B2WH 3H7BB 1HH9A 1YNLL 4XPFL 1J8HE 1F11A 4YDJA 2V2TA 1N6VA 1ZTXH 2DQIL 3IDMB 1AR1C 1HHGB 1WCBB 4R7DA 3V7MA 5JHDA 5ANMB 1CF8L 4H0IA 1ROWA 4XCCH 3L6FA 2EDJA 4MD4B 3O4OC 1FZKB 4G6AC 1RJYA 4FZEH 3QO0A 1DR9A 1XF5B 4ZUTA 3JV6A 3OR7B 5A2JH 3VXOA 1T7YA 2V17H 3F8UB 2DLHA 5LAXB 1C12B 4RQQA 1P7QB 4X5WB 1LK2B 3H8NA 5BO1H 4NCC1 5ITBL 5HHOD 3QXUA 3MV01 3O8XA 3P4NA 4XWGL 1WT5C 1B0WA 5FGRA 1BVKA 2EE2A 5DUML 4ZFOB 4FQHB 4NCDA 4GOSA 3KPSB 1LDPL 2NZ9D 5SWQB 2N1KA 5MEPA 3BMWA 3HNVL 1ZSDA 3MXVL 3EOAB 4PJEB 5EUKB 1G9MH 1K3IA 2XWBB 3GSOA 5JDSB 3DVIA 2ERJC 2LVEA 4I48B 3UDWC 3VGAC 3LEVH 2BDNH 2YKLH 5E2UL 3FOLB 5C9KA 3OJVC 1G7JB 5K9JL 4F7CA 4GS7C 4M61B 5DMGC 4M5YH 5F7EL 3ARDD 1R3HA 4I3SL 1HINH 1H3PH 3ZTJH 5KVGH 3NCFB 4H1LH 1T3FA 3U30C 3G5XA 1CIDA 1YMME 5EO1A 4XMKH 2OBGA 1D5MA 4KVCL 3VW3L 1JPSH 2NY2D 1YEFL 3HFMH 3CX5J 1T20B 1WAAA 3QRFM 2J4WL 1R3IH 5IHUH 3EW3B 3KS0H 3HE7C 4UZGA 4XP4L 2GJZB 3ISWA 5EO9A 5FCSH 5EIIB 4PJ7B 4XPTL 3TZVC 5B38A 3FOMB 4D9LL 5GS1A 5CEZL 1SJEB 1G9MC 4NWUH 5SWSE 1DBKL 4H88L 1YJDC 5CSGA 3R8QA 4IRJD 3BRFA 3VXNA 4HEPG 4LOUD 5DK2A 4PJEE 1PYWA 3O6FB 1E27B 3MRNA 1DDHA 3NIFE 1MCBA 1VESA 3EAKA 1OGAE 5I76B 1UM4H 1AE6L 2VLLA 3EYVB 4YGVA 5CBEA 1F4HA 1ZE3C 5H2BB 3NCYP 4HXBL 5BV7B 4PY7B 3W5MA 3QEHB 1UWXH 4NQDD 1V3KA 4JGJA 2GI7A 4WU7A 5E2TL 1I1YA 4LVNB 3TIEB 2IPKB 4MCYB 4XB8A 4ZOBA 3MRLB 3ROLA 4NRXA 1MFEL 4K7PL 3KHQA 4YXKH 1YY9C 5GSVA 3N85L 3VFOA 4CDHA 2CRIA 4NO2A 3RWEB 4C56E 3UTSD 3EZ8A 1T1XA 4LVOB 3S3SA 1KB5A 4I0KA 3MZGB 1A6VH 4GRLA 3HS0B 2BFVL 2GITA 1H3UA 5D1QB 5I1GL 5TFSH 5JDSA 3BIBX 3UPCA 2ADIA 5DJCA 3IVKA 4I77H 3VMPA 3TN0D 4ZO7A 5CJ8A 4BH8A 2ESVD 3SGDI 1G7JA 4TYUA 2FJHB 4DKEL 4KKBC 2FLBT 1XZ0B 3UJJL 4G42B 3T3MF 5IROA 5JXAL 3RZWA 3CDFA 2ZSVA 4OBSA 5HVWA 1D5MB 1A2YB 2VDPL 1V7NH 4X4ZA 2FBJH 3MLZL 1OPGH 3RFZC 4NJAH 4PY8I 4IRZH 4ZUWB 4PJFA 3DV6A 3B9DA 5IB5A 2HTKD 2XZQH 3OAZK 4FQCL 4NNPL 3FRUB 1I1AC 5CP3A 3IDUA 4R96B 4URTB 4NQCB 2HWZL 3KAAA 1OTTC 5DWUL 1RZGA 1NSNH 3PDOB 4XP6L 4C4KO 2RBLA 3RDTD 4WHTB 3UC0L 4PJGE 4JAMA 1FAIL 1NFDE 4Z7UB 4X6EA 1KJMB 2YD4A 1FP5A 4RZCA 3WFCL 1G7LB 4Y7MA 3B4NA 3PWVA 5SX4I 4AQOA 4L8DB 1T7WA 3HB3D 5HDQH 3RTQB 4PLOB 2OM5A 4EI6A 4K07A 1ZHNB 3NCBB 1JGDB 3VMOA 1K6QH 4E41D 5I66A 1DBBL 4KK9C 5GJTL 1DQQA 1YN6B 4PTUB 2P5EA 3SDXB 1X6NA 4X4YB 3S36H 5GSVB 3PGFL 4LLMB 1MFBL 4ODUB 3NGBB 3IETB 3GUTB 5J9PB 3OGCB 1XCTB 1CFTB 4U1LB 5EB9A 3CC5A 3T0DA 1UQSB 5B8CC 5LQBL 3WIIL 2I24N 4M5ZH 3P11L 2Q6WB 2YPLD 4ZPTA 4PRHB 4DGYL 5HGBA 4CN1A 1J11A 3SKOB 4HKZA 1MCHA 2OL3A 3R1GL 1P7HL 4KKLD 3B5HA 3KJ4B 2AV1A 1SY6H 4LL9A 5GGVY 5FV2A 3LKQB 1EEQA 3MGTB 3WUWA 4EKXA 3L5WA 4P46C 2I26N 5CLTA 3TPUA 1KPRA 1JV5A 1TIUA 1PY4A 1CXHA 1IBGH 1T66C 3OGOE 3T1FB 4QNPE 5DRXA 3EOYG 4ONOA 1NC2B 1HILA 3CK0H 2IH1A 4WW2F 4BFEA 3QRGH 5ESAB 3W0WB 2LU7A 4E42A 5J7CC 5EBMA 4QRSA 2DYPA 32C2A 4U1HB 4DUXA 1YNLH 2H32H 2Z31A 3MRDB 2VITA 4JJ5B 5DUBB 1P9MC 1MHCB 4DEPB 5GHWL 2KBGA 1CF8H 3VXTA 4KTEH 1F4WL 1MJJA 4HG4K 2IJ0C 3CZFA 4ZUUB 3VXSA 2P5WB 3V8CA 1CL7I 1F3JB 4JE4B 3MBXL 2YR3A 5EA0L 4PP1D 5F6HJ 3RNKA 3BESR 5MERB 5F7LB 1HHIB 1KF9B 1MCWM 1ZWIB 3P9LA 1ZLWK 5CAYB 3S88H 1OP9A 4JFHD 1IM9B 1M1SA 3DMMB 4HSQA 3OPZH 4ONHB 3X11B 3QZWA 2H8PB 5ITBH 5JHDB 1JGDA 4YHZH 5FA3B 2GHWB 1JGUL 5E9DE 1KJVB 4C57C 4PJBB 4JDVA 4XCEB 2H1PH 1B4JL 3MV8D 3T0EB 2XXCB 1MEXH 3SKMA 2PTUA 3BE1L 4OF7A 4UU9A 3RZCA 1BEYL 1LDPH 2Y6SD 3W0WE 4NQSB 3VXSD 3GI8H 3MV9D 1EJOL 3I84A 1PZ5A 4P2OD 2Z93A 2BVOA 5E03A 1JBJA 5HHPB 3UROR 1EZVY 1P7QA 1KJ2H 2NW3A 4U1SA 2FL5A 1JZ8A 3TGXA 1EEUA 4OF8A 4NZRL 4Q6IB 4LLWA 1X5AA 2OI9B 2IFFL 4KDWA 2VWEC 3IDJA 4NQTA 1RSFA 1RK0B 1T0MB 2BDNL 4M6ML 1M05B 4TQEH 3FB7A 1F13A 5DQ9A 3ZHLA 3QQ3B 3PWLB 4WFHE 3QP3A 1MJ8H 2SEBA 3HNSH 3QIUA 2O61A 5D9SB 4MMXC 4L9LB 4HC1A 4WU5B 5E8OA 4Z7VF 2VQ1B 4G9FE 4P9HC 5KSBE 4PV9B 1OOAA 3QUYD 5EUKA 1I3GH 4KTYA 1J0YA 3ES6A 3CLEL 3NOIA 2MQ3A 2B4CL 3QXVA 1NUDA 1FVDA 2J4WH 5IHUL 1CGYA 1IKNA 1KJ2A 3IAQA 4YPGA 1EFXA 1A7NL 5DRNB 4UQ3B 5E6IA 5HHXL 2CIKA 3ORJA 5FF6A 4NC1E 5J6GA 2R15A 4K3HA 5EULV 4G7VH 4PJCE 2CKNA 4PJAB 5CEZH 3GMMB 5MEND 3DVFA 3FAWA 1ODAA 4QCIB 3MNWA 4MA3A 4NCC2 1CXIA 1RZIA 1K5NB 3BUTA 4X8JB 2HYMA 5F1OB 1VGEH 2GQHA 4LSUH 5MERA 3I6GA 5E2WH 4HPOH 1T22A 2NY3D 5L0QC 4LQFH 1JGVL 2HKHH 1YMMA 1D5BA 1TNMA 3HAEG 4YH6A 3O8XC 4NKIH 2VC2H 3RVTC 4Z7WB 4OFKA 1IGJA 4K9EL 1MFCH 1WZMA 1KB9K 1K8IB 3GIZH 5DJAB 3I75A 4OZIF 4QY8A 3FB5A 4XP5L 2AXHA 5CSZA 1WFTA 2Y72A 25C8L 3SKMB 4M3KB 43CAB 1D9KA 2QQQA 2WIIB 1HI6B 1UZ6E 3JWDL 4TPRH 3O3EA 3QSKB 5D7SH 5J1AB 2OL3L 1QSFE 4H1LB 3U7AA 3RWCA 1Q0XL 1T04A 4M93B 1NGYB 5F7WC 5DEFA 4L1HA 3UYPA 5TFSL 1KPUB 3K4ZA 3O2DL 1U3HD 4Z7UF 1CLZH 5GRJL 4I77L 3IFOB 5EU4A 3WLBB 1DEEB 3QQ9C 1P84J 3VXMA 3V79C 3NCCB 4Y4KD 1XGUB 3RWDA 4Y1AD 5HHQB 1U91A 4ACPA 5KSBA 3VRIA 3UPAA 3N1MC 5DQ9B 3ZHKA 3PWLA 4OLUL 2Q8AL 1AGEB 3SJVE 4HIHB 4HKJA 4PP1C 4PGJA 2NY2C 4ODSH 3RWEA 1C5DB 4IJ3C 4OZGE 2IPTL 3VXOB 5CFHA 2VIRB 1HXMB 2HVJA 2DDQH 3K46A 5FGSA 3MRPA 3F5WA 5T3XL 4X5WA 5FM5M 5IG7B 2BMKB 4OCRH 1V7NL 2OQJB 1EAJA 4XCFL 3OAUL 1KNOB 4F37F 1BD2D 4Y4KA 2EIZA 2CDEA 5HYJB 1JPFA 4S1RL 3MOQA 1XGQB 4JO2L 2HT2C 4FQLL 4KUZL 4ZUSB 4PJAA 5T1LB 1QBAA 4PG2A 5MEQA 4WW2C 4YXHL 1DLFH 4FQ1H 4G6KH 5MEPB 2YA2A 1T4KA 3A0OA 3CFDB 3MJ8A 4KI5D 4WY7H 5DWUH 4XP6H 3BP6A 1BVLB 1SBSH 4QHNA 5LKNA 5F1KC 4JN2B 1ZVYA 2NY4C 4GBXD 3KPOA 1U8NB 3BXNA 1L4IA 4TTDD 2VDLH 3F7RA 1LNUA 2H9GB 2OSLA 4LU5H 2W38A 1IQDA 4JPWH 1CTOA 5HDQL 4NRZB 2A6KB 3GMLA 4IMKC 4NQCA 1T1ZB 4MJ4A 5A43C 2N7BA 5EWIL 5EO1B 1IKFL 4UAOB 4PJBE 4JFDA 1FYTB 3S36L 5FYLH 4DZ8B 5JTWA 1TJGH 2ZUTA 8FABA 4JFFD 1BQHG 4RNRB 1DN0A 4GRLC 3LY6A 1A7PL 3I85A 5C0RL 2W9DL 5IMLA 4R8WH 4KQ4H 4PRNA 4PGDB 4DWHA 4NHUA 4M5ZL 4TOYL 3EYSL 4K3DL 1DQLH 2X4SB 2GJ6D 1MY5A 3LV3B 4RBPK 3NBNA 4RSVA 4DCQA 3P3YA 2EZ0C 1X3DA 3FB8B 5DJXA 3MRNB 2CSPA 4C56B 1YMHB 4FG6C 2HJKB 1ETZB 3G6AA 4PRPA 4X9FA 2J8HA 1U8QA 3MLYH 4Z77A 5I1DB 2AQ1A 2E7LA 2BMKA 1AXTH 4CVXA 4MLIA 1T03L 4P4KB 4ZPTB 2W65B 3QDME 4M9PA 3SKOA 2OL3B 2EIZB 1OGAD 1XIWC 3QRGL 4ZTPH 3MRLA 5CGYD 4Y8DC 1QSFA 1Z9LA 3D0LB 5C0AB 2BNRE 4XH2B 4D8PB 4ZD3L 3WS6A 3IDYB 2APWA 5IJVA 1GGIL 2QTEA 2NLJB 1ED3A 4M1GL 2P8PA 5C0NC 4KTEL 5IGXH 2ICWA 1NCTA 1ORQB 5CIPA 3TWCL 3L3OB 2DLEA 4PGEB 3JUYA 5HSFA 3IXTA 5D5MF 1NBQA 1HILB 3MBXH 3D85B 3EYFA 5HHNB 3CDGB 4NQVB 2WIMA 3HR5A 4H20L 1GZPB 5DA0B 5CEXA 5KVEL 5FO7A 3VXPA 1JCKA 4HHAB 4WFFE 4PR5A 4IOFD 2DJSA 4U1NB 5HI4D 3P77B 2CRMA 2F5BL 4ONGL 5M94B 4G43A 1YPZF 5F9WC 4YHZL 1F02I 4M7LT 1ZVSB 5FO8B 4ODTL 3O9WA 1J87A 1QHPA 4DN4L 1KIQA 5FAAA 1B4JH 5HYEA 2NXZB 3CIQA 5IF0B 1I3VA 5D71L 1MEXL 5B39B 1CQYA 2I9TB 1U8HB 2YEZA 4PLKD 4TULH 1JHTB 2P8MB 1PX3A 3GI8L 4X5LA 1Q8MA 4X98B 2R4SL 5HGDB 3I50H 4M62L 3VXUB 3BIKA 5D8JL 1JUFB 3ARDB 1H15A 3BP7B 3ZDYE 2B1AH 2JK5B 2ZOKB 2A9NL 4IDJH 5MHSE 5IW1A 3VWJB 2NY6C 4JHWL 4HS3B 3MRHB 5AG9A 1AHWB 5ISZA 1VADA 4G9FA 4KTDH 4FFWD 2DQFB 2ZKHH 4R9HA 2BY1A 3G5ZB 4AK1A 4OLZL 2JF1A 1ETZA 5E94A 4IS6B 3C9NA 1GPOL 1MRCH 2MJWA 1MI5E 1BWMA 3MA9H 5EU5A 2C3VB 2YMXH 4NQCE 4AEHH 2X9XA 1CFNA 5IMMA 4J6RH 4L8SC 2VLJA 4N8VA 4FQ2L 3D2UB 3QUYC 5KOMC 5C0JA 1I3GL 1MCDA 4LSTH 3QDAA 1BFOA 5SWZD 3SCMB 3VG0H 5J13C 3MYJA 1IC7L 2B4CC 4WEBH 5IP4A 2J6EA 3L95B 3HMXA 1VERA 3ARGB 3P73A 3O45A 3CXDH 1NFKA 1UC6A 4TVPE 3HAEB 1KG0B 2R1WB 2ICWB 3FONA 2IQAB 1I4FB 4JLRB 2YUWA 3VXRB 3B83A 4WGVB 5GRUL 1ZANH 4PRHA 4H5SA 3DRTA 5CJOL 4GJTB 5D7JA 3G08B 3L3KA 2VL5A 3X13A 2MHAB 4LSUL 1DUZB 3ILQC 3NCYS 5D1XD 2H2PD 4JREC 4RMSA 1FNGA 3D0VA 3GBLA 4P4RA 4B41A 4B50A 3KYNA 1JGVH 3M1BA 1L6XA 3RX5A 3MLUH 4XC3H 3D2UD 4NKIL 3PV7A 3ZZ1A 3P77A 1T0PB 3UTSB 4AT6B 4JFZL 5K9QI 4P2QD 4U3HA 2ZUQC 5GGTA 4BZ1H 2H3NA 4XP5H 4YEFA 3NH7L 4LRIC 4PJXF 4BKLA 1D5IL 5E9DD 4XCNA 5I18L 3BGMA 1EHXA 4A2LA 3NIDF 4N0YH 4OKVB 4YHOH 4ETQB 4Q9QL 5HI5C 1SVZA 2R0LL 3QI9C 3MGOB 4TPRL 1DBAL 2P4AB 3CU1A 3AM8A 3RWJB 2HA1A 5ICYA 3VFUB 1NMCB 3KPRA 3P0VL 1MQ8A 2FEDC 5E08L 1VEOA 4PJHA 5IVZA 4FNLH 4OJFL 1ZHBB 1J1XH 3O2DH 4Y5XB 4LLDA 1ZOXA 3OZ9L 5C07E 4G9FB 1MHEA 4OLVL 4U4BA 3FMGL 2K7PA 3B2UC 4WFED 3BKCH 4F7PA 5T1KA 2BHZA 5C0CD 2VZ1A 2WW8A 3LKRB 3BPOB 4UDTA 3TH2T 4PY8J 2X1QA 2GFBB 1NMBH 2HFGL 3KPPA 1CVSC 1MHPH 2DQDH 4ODSL 3GMOA 3ARWA 4DFHA 3B3IA 5TQ0L 2MNUA 3JWDC 1ZKAA 5GS0H 3HPLA 3D18A 2A0LC 2PYFA 3FFCB 1SM3L 5GRVL 1OM3L 1NFDA 1FNHA 3MYJB 1XGTA 2ZUUA 2HP4A 3MX0A 3B9AA 1GC1C 1MJUL 4N8PA 3QIBB 3L9RB 1O7VA 3WUWG 4JO2H 4KUZH 3M07A 1AGBB 1DLFL 4PJ5D 1NDMA 1JHKH 1WZ1L 5GRXG 1KLGB 3U7YL 4I18B 4WY7L 2WNGA 4F7MB 3IDXH 5ID1B 1QFWL 4Z7NE 5EUOA 2Q3ZA 4D9RD 2NW2B 3C8KA 1SJVA 4ZFZB 3TH4T 3BAEH 2BP3A 1YQ2A 1SBSL 1K2DA 2MHAA 1ONQB 4GW4A 5B3NA 4UT6L 2F58L 4Z9KB 5HI3D 1J88A 2JJSC 3KLAA 1BZQK 3PABB 4X80H 5D1XA 3MLPA 1ZA3B 1D5ZB 3W9EB 2C3HA 5F7DB 3SPVB 4G8GE 1ZT4A 2IQ9H 1UACH 3GBNH 1D9KC 1G1CA 2XY1A 3BPNB 4JRXE 3V7AG 4U2YA 4JG1L 4C58B 2ICEB 4MB3A 4ETQA 3DHJA 1MCQA 3CFEA 3ULUF 5TE4H 5KSAB 3CH1B 5BQ7B 5DDHA 1MVUA 3RL2A 3KPRB 2AI0L 5ICXB 1A7PH 3TCXA 2LTQC 1OSPH 1AO7A 4UQ3A 4GKZA 4R8WL 1KCLA 1T5WA 2IAMD 3QZWG 4TOYH 2F5AH 1O0VA 4JM2B 4HWZA 6CGTA 1VACA 4FFWC 4KKCC 2X4RA 1FPTL 2QV2A 4YC2C 5E8NB 1CFVL 2J6EL 3ET9F 4ODXB 4JFDB 4HLZH 3GZKA 4IEFB 5DR5L 1BQHA 2VZ3A 2F8VA 4HD9A 1KFAL 2YD1A 4XXDA 3PP3K 5L2KD 4WWKC 4UTAL 3FQXB 3HC3H 5FYLD 2CH8A 1REIA 5ICZA 3T2OA 1Q38A 3TF7C 1JGEA 1RPQA 3FRPA 3O3AB 2ZUXA 2V5MA 3QIBA 3I6KB 4P23B 4OFYD 1F6LL 1XF5A 1U8MA 3BZEB 2XTLA 1UB5A 5LBSH 3G6JF 4O2CB 4RFNB 5CS7A 1HYRC 3VXUD 2HT4C 5TDPB 5F9AC 3RWCB 3DXAA 5HHME 1WWAX 4S2SA 4ODVL 4OCMC 4UNUA 2VZOA 2APBA 5KSAD 3VFSA 2D31B 4LVHC 1OQXA 4KROC 4UBDC 2DQHH 4LLAA 2CK0L 2X4PA 4OUOA 4PRPE 2EYTB 3IYLW 2NXYD 4G5ZH 2AERT 2HKFH 5GGVH 4F15B 1FDLL 3GRWH 1D5ZA 5AAMA 3W9EA 1CICC 1QSVA 1E4WL 1MCLA 5FHBH 3TBYA 1RI8A 2QLVB 3U46A 3ZT6A 2G2RA 4ELMA 3ZKND 2HVJB 5E8PA 3SQOH 5IFAL 2FJGB 3PGDA 3J7HA 5ALCL 1CFBA 2XTJB 4HX1B 5L8LB 4J8RB 1TQCC 5EBLA 5CJBA 1LO2L 4Y19E 4XZUA 2C26A 2QQLH 3T08A 3NABL 1FO0A 1TETL 2VUYA 3KYMB 3N1FC 2A74B 1I9RH 1MELA 1Z2KA 3CPLB 4KJQC 2VISB 1YQVL 2BC4A 5BRZB 3PQYB 3UMTA 2W59A 2B1AL 1KEMH 5BS0B 1NBYA 1PEWA 4K71B 4YHYB 5FYKE 4PP2A 4LOUC 4M4RA 5HVFB 5DMKB 1WICA 4FTVA 4KTDL 1BQLH 5E99L 2ZKHL 4PRBB 2F54D 4X6BB 3G5VA 1DQJA 3V6FB 2RCSH 4FS0A 1ES0A 2OK0L 4JQVC 3L7EA 4LLYA 5I8OL 2XWTA 2E7LC 2X1PA 3BISA 5DT1L 1DFBL 3CSPA 1L7IL 4PJ7A 1A7RL 5I1AB 3BIKB 4Z95L 3QUZA 1ZEAH 4PJDB 5TGBA 4FQ2H 1H15B 2HMID 4H8WH 2ARWA 1FIGL 5IW1B 4LSTL 3BYYA 4XHQA 3GSRA 4UV7L 3LB6D 4HIXH 1H0DB 3BD4A 5F3HA 4MD5A 4ONFL 2XRAH 4XC1L 3IAPA 5AUMB 1UB6A 2AK1H 2HRPH 2ARJQ 1LP9B 4EJ1C 1T6VN 2NY4D 4GBXC 3FFDB 2VAAB 2OXHA 1A14L 4HQQL 4AG4H 5I1IH 1MWAL 2BJMH 3CUPB 4PY7A 1X5IA 2ATPB 2GT9A 5IMMB 4N8VB 3JV5A 1JNJA 5GISH 4MA1B 5C0JB 5CJOH 5ANMA 3D3VB 5E2VL 3RVVD 3HI6H 2ITCA 4EXKA 5C0AE 2HAZA 5DJ6A 3GHEH 1MJ7H 5DUPL 3FB8A 3MLUL 4JY5L 2VAJA 2Y06H 4OIIL 4GUPB 2ICCA 5BZDA 3OKYA 3DUSA 4F2MB 1C5CH 2VQUA 4LSPL 1I1CA 1KIRA 4N0YL 4Q0XL 1P1ZA 1I9IH 2DTSA 4E0RA 1J5OH 1OF2B 1NGXA 4XCYB 4RISL 2NMSA 4XCCL 1DUZA 5BJTA 4O5LH 3GMPB 3BVNB 4Z5RB 5HDOA 4Y4HB 1UJ3B 5DTFA 2J12B 3VRLE 4C56D 1FYTD 4Z18A 1C16B 4LK4A 4P5TD 1NLDL 1EHAA 5H35B 3O6FD 5JQ6H 2YHGA 5D6CB 2OLDA 1X7QA 2Z91B 2H6PA 5D72H 4OZHF 2QL1A 5J8OA 5I74C 2HFGH 4XWGH 4PJDF 1L0QA 3CH8A 4EIGB 3RWJA 4XVSL 1BZ9A 1KTLA 3FOLA 3QUYA 4KKBD 2Q87A 3GSNL 3KYOA 5DUMH 4EEEA 3FT4B 3E3QC 1I8LA 2GAZB 2WWKO 1W0VA 4UT7L 1IEBB 3ZO0A 1AKJB 4AYFA 5T3ZD 4OI9A 1Q0YL 4LAJH 1A3RH 4I4WA 4HC1L 3LN5A 1RK1A 1I3UA 3MCG1 2NY3C 2YEZB 5E9DA 4Y4FA 3GI9L 1H3WM 2X4NA 1NJ9A 1U8IB 5K9JH 1Z9MA 5D7JC 4AZ8A 1J18A 5F7EH 2CXGA 2GW5A 4DTGL 5HGHA 1HINL 3OX8B 3LZFH 4NZUH 5ILTL 1S9WB 1BJ1J 5FUOH 1A6AB 2GK0A 4TTDC 4PTTA 2DM2A 4JQXA 1PAMA 4NYLA 1FGVH 1YEFH 3B9VA 3HFML 4KPHL 4J4PD 1UM6L 3EOBB 4IS6A 1AGBA 5H2BA 2F53E 4XP4H 1KT2A 3QDJE 5DSCA 3BN9D 1LEIB 2Q1EA 4WO4A 2AXFB 4XPTH 4PJ9B 5L88L 4PJ9D 5F88A 4LCWA 2VXUL 5I0ZA 5KZCD 5LGJB 1OTUC 3KXFE 1IVLA 4X6FA 1KBGL 3ULSA 4JY4A 5JPMA 1YZZA 1PBYA 3CJJA 2PO6A 5CMAB 1F3RB 1LP9F 3STLB 2F5AL 4KK6D 5F7DA 1UM4L 4L3ED 1T1XB 3DARA 4QTIL 1D5XA 5CLWA 4NZJA 4QOKA 1Q72H 5B4MC 3ALXA 1R6VA 1FC2D 5FYKD 5CUSH 3SDAA 4F58L 2EYSB 1CFVH 3AGVA 4TVSa 3V5KA 4X4MA 5MP6L 5EZJB 1EV2E 1JHLL 5EU6A 1S3KH 3ULUC 2IADA 3C5ZC 2P5EE 3SCMD 2P42B 2OZ4L 5KTEL 5KBNC 5EH1A 1JWSB 1MFEH 4K7PH 4UTAH 5FCUL 1QFWI 4YXKL 4YHMH 3G5YB 3QQ9D 3O4LE 1T5WB 5F21B 4M7LL 4LDLB 3CD4A 4AT6A 3MUGA 4PJIE 4I0CC 2ED8A 3CFKA 4R90H 2ZZUT 2BNRB 3FCTA 5HYQB 4X7FC 4K8RD 4KUCD 3S97C 2WBJA 3IXAA 2EIBA 3SO3B 3MXWH 1ZA6B 5GGSY 3ILQD 4HS8L 1H5BA 1ZWIA 1BOGB 3DETC 4ZXBC 3GIVA 3NPZB 4L4VA 2XZAH 3AROA 3VWJD 4PV8A 3DBXA 5FGCB 1W72B 3WKMH 4PB0L 5D1XC 3P0GB 1Q1JH 5K93A 3DNKA 4JZOB 4Z0XA 2ZG1A 3JTSA 2AXGB 3DSFH 1JNLH 1JPGB 1T83A 2FRGP 5H37G 1T89A 3MLVL 4UILH 3EUUA 5CSBA 1J0IA 1EFQA 2E27L 1UEYA 3IDIB 5JUEL 2Z93B 3OF6A 1K8DB 2VDNL 3PL6B 1HH9B 3DHMA 2NW3B 2R29L 1N5YL 4FQIH 2IAMC 3AFLA 2D31A 2MCPL 3ULSB 4I0PB 3AU1B 2QQLL 4E5XB 2HWZH 5JPMB 1BF2A 3V8OA 1P9MA 1R3KB 1AJ7H 2M8XA 5FYJE 1AXSB 2XACC 2Y36L 3G6JB 2CKBB 5IW3A 2VLKD 3L9RA 1QFPA 2R2EB 4LCCB 4UUJB 3UC0H 3WLWC 3TT1H 3TO2B 1KCSH 5IB3A 5D9SA 5DI8B 5L7XL 1OSZB 4J4PC 4BFBD 5F97E 3T2PA 3WFCH 2AK4E 1G7PB 4JPKH 5AEAA 1TENA 3QFDB 4KJPD 1S7TB 2RCSL 2E5EA 5DRZB 4XPGH 2AVGA 3ETBF 1N4XL 3PWNA 5CP7B 2ILLA 4XRCB 1ZT1B 3BGFB 1A7RH 5D7JD 5IBUB 4Z95H 1EK3A 3EJZD 4ELKA 3MV9E 4MJIE 1S7SB 4H8WL 3SDCA 5A3IC 5EZLA 3OKNA 1CICD 2DQUL 4QHUA 4PJEF 2PW2A 4JM4H 4EI5C 1HHKB 3WIIH 5LQBH 1RZIB 4L4VE 2XWJA 3RDTA 4UBDD 3QT2A 2EE3A 1BFVH 1KYOK 1UKSA 1WFOA 4HXBH 3OTTA 2QADB 4OZHA 3DO7B 4LSSL 1A14H 1I9EA 3MREA 1AO7B 4IOFC 4LEOB 4S11A 1S78D 3QUZD 1E6OH 2UYLB 4KMLB 4M00A 3DVNA 2VJXA 3VD5A 3BQUA 2VABA 3VXRE 1CICA 5A2LH 4K3EL 2VUOA 4HUXB 3WHE1 4M1DL 3QIUC 4MA8H 4NN7B 3QDJD 5DF0A 2WIIA 1EVUA 3BO8B 1MUJB 3QFJD 4NNXA 2R8SL 3P9LB 2FX8L 2YUZA 1FL6A 4HCRA 5LGKA 4XVUD 2QSQA 2UUDH 2Y7QB 5E6IC 1BAFL 1I9IL 2FH6A 4PJIF 1J5OL 5ID0A 4KV5F 3VXMB 3SGDH 1M4KA 4P3DB 5IUSA 1U91B 2K1MA 1KPVA 1H8SA 4M1CD 5EN2A 3ARGD 3WXWL 1CT8B 4M02A 2BNQA 3P4MA 3RY4A 3FQNA 3WHE0 1HIML 4BQ8A 1JK8B 5H8DA 1CXFA 1VEMA 3PWPB 2OJZL 1NLDH 2NY0D 1RV6X 2NR6D 3G9AB 1TPXC 7FABH 4O2CA 1W0WA 3UTPE 1AD9A 1Y0LA 2G5BB 5ESQA 2FBJL 4RGMC 4EUPB 4Z8FL 4JRWA 3OPZL 4MXVF 4Z76B 1M7IA 3KG5A 1CLCA 4D9QD 4X0KA 2QSVA 1GGUA 4M7ZC 3DUUA 4XVSH 4HWUA 2H1PL 5INDB 4RRPG 3SJVB 4HF5L 1GCFA 1ZT1A 5HBBA 3GSNH 1E4XL 3KDMB 1NAMB 4ELKB 1NUFA 1BEYH 4RGNB 3F12B 4U05A 4K94L 4KY1H 4ESKA 3OQ3B 4DKFL 1X7QB 1U8KB 3WNOA 5C6WH 2F53B 4WU5A 4M6NL 3MBEB 3KPMA 3QDJB 3UJIL 3FN9A 4OBRA 5JZ7C 1NDGB 3R0NA 5IHBA 5C9JA 1FAIH 5M95B 4GBXA 5CD5D 3WIFB 3EFFB 4CNIB 5T1DL 3BWAB 2X42A 2IFFH 3GGWA 4GRWB 3LSOA 3DX6A 2R2BA 4M6MH 3BXNB 5D5MA 2AK4A 1QKZH 4FQQA 4GQ9H 3SKUD 4ETYA 2DM3A 1NBYB 2HLFC 5F6HI 5D93B 4PPTA 2GSIA 5JW4M 4PP2B 5C09B 3UYRH 4W70A 4JFOB 4PIRF 2FIRT 2AABL 3LH2H 4L8BA 1XF3A 1BD2A 1I7ZA 3WS3A 1RUML 3G5VB 1J86A 1RUKH 3A6OA 1R3LB 3BGAA 4FFZL 3CNKA 1ZHLB 4TNVK 4KJWC 3QCUH 1XGRB 3F7VA 1FVCA 1NCNA 3GM0A 4PRNB 3ZYOA 4XP1L 2EDTA 1IGJB 1MQKL 4NKQB 5TQ2H 3X14B 3CSYB 5BW7A 4Z7NF 4R26L 2FWOA 1SY6L 4HJ0D 4O00A 4QHMA 4R96A 1WZKA 1J0ZA 4PG2C 4P49A 2X4OA 5E1AA 3GJFK 4KAQL 4QTHA 5ACZA 4EDXA 1XMWA 3L3JB 3JV6B 4KXZH 1U92B 2DRUA 2AJZB 1FO0H 4XBPB 1BGXH 5F6IB 5DA4A 1NCAL 3E8UH 1Q72L 3GKWL 1NGYA 2FO4B 2DMKA 1MFCL 5LGJA 2HFTA 4L8DA 1UWEL 3IDNA 4EN3C 3MUZ1 5HDBE 3DYPA 3S96A 2C4FU 5C08E 1ZHNA 2WM0A 5JORA 1QQDA 2O5XL 4HUWA 25C8H 3OKOA 2W9LA 4LIQL 2DLIA 1QUNA 5I6XC 1KB9J 2CJUH 4AEFA 3NMEA 3H42H 5IFHH 2EIDA 5LJYH 1F97A 1RURH 3MRPB 4JKMA 1VKXA 1NEUA 4Y4FC 5I16A 3J8F7 3VA6A 2HJLB 3LSOB 5J12B 4XCYA 5KSVA 3HUJF 4XBGB 4Y5YA 4Y4HA 4ZDHA 4O2EA 5L2JA 5DK3A 4OLUH 4XAWL 1NCCH 4JANB 2XZAL 2B20A 1WBXA 4IRJB 4CMHC 3DYOA 5CEZE 1N8ZB 3V6OC 3MTRA 4G8GD 2VTFA 3BE1H 4GAGH 3UXFA 4X7EC 1JTTA 2VWEE 4MNQE 1KN4H 2EH7H 4W4NA 3PWPE 1G9NH 4EBQH 4DAGH 3MOAL 1R24B 3WO4B 1KJ2L 2EDEA 3KYOB 4S1RH 2Z8VC 3TBVA 3U7WH 1U3HA 1M6OA 1CE1H 2NX5A 4AMKH 4FQIL 5EBWB 3LEXB 3TJEH 1UGNA 1UT9A 4TQEL 4YHLH 1PYWB 4QRTB 5AWNL 2FECL 1CGTA 1AJ7L 4K55A 4EDXB 5I75B 4FHBD 4JHAH 1WUNT 3RJDA 4WI5A 1EH9A 1F2QA 4OZFH 5GGTH 1P6AB 2JCCF 3SBWC 1RZKL 3V6ZB 5C6TH 3P4OB 3QWOB 4WIQA 1S7QB 3RNKB 3QEHA 5CD3B 3MFFB 1E4XI 2JJTC 2ENSA 1T5XA 1UZ8B 2FD6L 4MQ7A 3DPBA 1CFSA 3PGCA 1EERB 1M7DB 2PTTA 2IPKA 1A47A 1UXWB 3FKUS 4P9ML 4NN6C 3ULVC 5C0IB 1BJ8A 5E95B 1FORH 1RHFA 2FLRT 4HUWB 5DMGD 4JZJA 1AXSA 3NPSC 4G7VL 4MNQD 3BHBA 2G5RA 5FYLL 15C8L 3P73B 3O9WC 2FIKA 3D69A 5D1ZC 4OIAA 4FXLA 1KXTB 2CLVA 5JQHC 4DVRH 1A7QL 3VXRD 5DI8A 5K9OB 1CDUA 9CGTA 3TBTB 1A6WL 1XCQA 4JVWA 1VGEL 4JM4L 2GITB 2CKBL 3G04A 3HE6B 5F88B 1QVOA 3RNQB 3QUMH 4HPOL 1BFVL 3GO1H 1EO8L 2XQYG 5HY9B 4I13B 4HGWB 5IFJA 2DM7A 3P9MA 1DEDA 3SE3A 3WFHB 1JYNA 2HTLC 1QRNA 3P40A 4FQHA 2NY7H 4QXTB 5L8JB 3QULA 1UVQB 3VI4E 1N7MH 1VFMA 1T83C 3E2HC 3OG4B 2XYCA 4BSVB 5EG6C 5IV2B 3AMKA 3SDDB 2FR4A 5K9KB 1KLUA 4F8TA 2CDGA 1QA9A 2NZIA 4ZUWA 5CJXC 4XNQB 1OWWA 2HN7A 4LNRB 4Q6YA 4ZTPL 4ZNCD 1DP0A 5D7LB 1G9EA 4PUBL 4WTWA 4F3FA 4QT5B 3VI4F 3W39A 2ZCKL 4LVEA 1KJ2B 1A4KA 4JFHE 5IVZB 4J3SA 2D7MA 1X6LA 4JG0L 4OCSH 3RWIA 2ED7A 4M1GH 5KW9L 5IJKA 1RHHB 5TF1L 5IGXL 3IFPA 5C0CB 1MRFH 2NY1B 2R0KH 5F9JA 4PRAB 5GGRY 5JPNB 3CFKB 3U4EA 2X6MA 1SMAA 2I5YL 1GGBH 3WXWH 1T7ZA 4TUOB 2DQJH 1HIMH 1PFCA 4GLRH 1LILA 4RAUA 1GC1H 4LCIL 3UTZA 4Z7UA 4MNHB 5ISZE 4ISVA 2YPVH 3T4AA 1JZ5A 7FABL 1F6FB 1Q9LB 3HG1B 3QXTA 5B38B 3OKKA 4GW5A 3OAUH 1IAIL 2EO1A 1I8IB 3L3DB 4LBEB 5MI0C 1WFNA 2KQMA 3X3GL 3VXQB 3FB5B 3SDXA 4JZOA 2FGWL 4Z0XB 2P48B 3MRCA 3QIWD 1X5YA 5IVXE 3ARPA 1CDIA 5SX5H 4O02L 3QO0B 3MRBA 5D71H 4GKSA 3OKEA 4Z0BL 3CCHA 2XOTA 2FZ3A 4JRXB 4TSCH 4U1IA 3CC5B 3U36B 1FFNA 4KY1L 1FJ1A 5LVEA 1XCQB 3EYUL 4LDEB 1KLGA 3QXDA 1FNLA 4DW2L 1WAAF 2ZPKH 2E9JA 4L8CA 2PO6D 2NW2A 4ZFZA 1BZ7A 1XR8A 4CRPA 1H3GA 4Z76A 4JHWH 3RX8A 1Z9SA 2VDLL 5F3BB 1J7VR 4GMTH 4P3CL 3Q6FA 4HBQA 1YNKH 4U2ZA 3LKQA 5I71B 2V2XB 2DKSA 5DZOA 3VH8B 1DE4B 2ORBH 2C3WA 2YMXL 4ERSL 4J3TA 4HV8B 3BYTA 3RVUD 3QAZC 3F62A 2NTFB 3UBXA 2CLRB 5D1QA 2X7LB 2YA1A 3M45A 5JIHA 2V7NA 4M6AA 5EIVA 1L7TL 3V4VL 4M8QB 2VR4A 2AV7A 3TV3L 2KZ1B 2OQJA 2EECA 4LSDA 4HWEL 1ND0A 4YIQB 2VITB 3QDGE 5CP7A 3RUGA 5IHZB 3SGJC 2RFXA 2DI9A 5EC2A 1EXUB 4A6YH 1IAOB 4LHUG 4NP4L 3LKNB 3O2DA 3IS1X 3V0VA 5GRUH 4G6JL 3S4SB 5DD1H 3SE9H 3AREC 4ISVB 4Q2ZA 3K4DA 4KMTH 4MYWB 3WYRA 3VD4A 4OZHB 1NANI 5I30H 3DO7A 3C09B 1S7WB 3ARTA 4NKDB 1OAZH 3ZTNL 4YAQA 4ONHA 3X11A 5I1LB 3KPNA 4G80A 3LKOA 2WZPD 2AJUH 2PNDA 4IIQB 4EI5D 4MAUH 4HCRH 4K2UH 4APQA 3EOTL 3PDOA 3FJTA 3PIQA 3QUXC 5ETUA 1KCVH 1XGPA 4PJDE 4LIQH 3CCHB 1YEKH 2W07A 3BX7C 2EC9U 4WWKD 3FT3B 5ADPL 3HZYB 4Y16B 2VR5A 4G6FB 3P0VH 4CU8A 2Z8RA 4NO5A 1INEL 4FNLL 4DKDC 5T3ZE 4XNZB 2BVEA 3VG9B 4AJ0A 3PDGA 4Z7QF 4AM0A 4RWHA 1T0NB 5IEHB 5KS9F 3FMGH 1E6JH 5FIEA 4RGNE 1ZS8A 4JCMA 4YHKL 5GGRB 3H3PL 4XAWH 3VH8A 3RGVC 4WJ5A 1SEBA 3PWPA 2DQDL 2APFA 2VKWA 3LAFA 4DN4H 2GIYA 2BNUB 5C0BD 3VCLA 2UZYB 4FN0A 1FNAA 5C1MB 2QQNL 5B3JF 4JFQB 1MI5B 4H1LG 3SY0B 5FB8A 1KN4L 3BP4B 2EH7L 4WWKA 5C71A 3IVKB 4U1KB 1FO0B 2NYYD 1YEEH 5I0DA 1QHOA 3TZVA 5D8JH 3IJSA 2DBJA 5GS1C 2DI8A 1W8OA 1RVFH 2ZUWA 4P5MA 4KZDL 2A9NH 2CPCA 4YK4B 4FQXD 4MAYD 4O2EB 4FP8L 4NT6B 2WV3A 2X4UB 3RIAK 3REVA 4OLEA 1EXUA 4WW1B 1EHNA 2FX9L 1ADQH 4PJHF 4YHLL 5AWNH 3VFVB 4P2RA 3MBEA 2J8UE 3K1KC 4JHAL 1I7UB 1NDGA 3V9FA 1IAII 3K8MA 2GCYA 1XR9A 4S0TD 1HHJA 2QSTA 2Q8BH 5ESVA 3MRKB 2I60L 4J6RL 4PJAE 5EBMB 1UJTA 3RAJH 3FN3A 4JJ5A 5I1LA 3O6LH 5EORL 3QUZB 4PJDA 1QR1A 4OV6F 4PD4K 1U3HB 1G84A 3L7FB 2DKUA 4YJZL 4IRSA 3ARYA 4RGOL 5EBWA 4WEBL 3U9UB 1K4DB 1BQUA 3CDYA 3KGRA 4JQIH 3P9WB 3UTPD 4ZMAT 1MFDH 4JG1H 4AEEA 2I9LA 3AB0B 2PR4L 4OT1L 5I8EB 3C6LB 2NY0C 2NY5C 1T20A 4NNYA 4E41E 2BXZA 4NGHL 4X6EB 5AZ2L 4MD0A 5E4EB 1HH6A 3D6GA 3PL6D 3VXUA 5DURD 2CO7B 1T5XB 1UZ8A 1R3JA 1S9KC 1CD1B 2JK5A 2ATKB 2ZOKA 1EFXD 5E6ID 1J12A 3GO1L 3VGFA 2FO1A 5KN5B 3LOWA 4HS3A 3RA7H 2A77H 1MSPA 3W82A 1LEGA 3VFWA 4LPYA 4KK6C 4Z7QE 3U1SL 5EPMA 3MUHL 4HIHA 4HKJB 4QKXB 3QDMB 1N3NA 5C0GA 3RVWD 3IETA 2MKLC 3NH7H 2WINB 5I15L 3MR9A 4YGVB 1KFAH 2AP2A 2OZ4A 5JOPE 3DXAB 5HDLA 4Q9QH 1UH3A 5HHPA 4I5BB 1RIHH 3G04B 5L2KA 5FB8B 3VFSB 2R9HC 1TQBB 3RNQA 3IDNB 4PG9B 3WNLA 1TITA 5E08H 1URLA 4P2RE 1AQDB 4HPYL 2NCMA 4KHTH 3HPJB 4OJFH 1J1XL 2ZCKH 5D1ZD 5DMYA 3B9KC 3HNTH 2SEBB 2C7UA 3DIFB 5J1TC 4PGCB 4R4ND 4K7FB 4PBVC 3NFPA 2EDXA 1HQRA 2I07A 4PV9A 1NQBA 4L3CB 2IBZX 1KLUB 2V9TA 1MCEA 4OFPA 4PS4L 4YDIH 5IB1B 5TQ0H 5GS0L 1TZHB 3GRWL 1E4KC 4Y5YB 3N1GC 2FSEA 4XX1E 4EVNA 5CILH 3P2TA 3H9HB 4QRSB 4U1HA 3DO3A 5L2JB 4X6CE 4G8EB 1JWMA 4JZJC 1MHCA 1YEGH 1KIPA 4LP5A 3LQZB 4HDIA 4PJXB 3Q3GA 1IQWH 2CLZB 3WN5B 1MJJB 4XBEH 4D0CA 1NGZB 5D1ZA 5ALCH 3S5LG 4OFIA 1AI1H 1FCGA 1CS6A 2WQ8A 4PRBA 5DQDL 1P4LA 5F7NC 3C6LA 4OSUH 1MLBA 4WEMB 1P7KA 5J4MA 3MLRL 5IW6A 2PYEA 3HAEH 1Z3GL 4N9GB 1OAKH 1D6VL 5E6ZA 3D39E 4Z0BH 3OXSB 2E7BA 4JFXB 1FFPA 3LKPA 2VLRB 2IGFH 5TH2B 4NHUB 3H7LA 4DW2H 1YQVH 2JJVA 4NQDE 1K8IA 5DJAA 3QPXH 4OLYH 3ZTJG 5IBLD 2C1OB 1QFOA 4LLVA 5E4IA 2VLMD 5I8KH 4OB5L 4PTTB 4GKNA 2LAGB 3V6BR 3MRCB 1E0OB 1IGIH 4P5TC 3QDMA 4KRPB 4KK8C 4MSWA 4D0BB 2CUIA 2QHLA 2V6HA 1CI5A 1CN4A 4ZAKB 5LAXA 1DTUA 5DT1H 1U8JA 5JW4N 4RQQB 3QXAA 4U1GB 2EXYD 5F7YC 1L7IH 3GNMH 4NRYB 4QXUH 2JELH 3PWUA 1L7TH 3V4VH 1DEEA 3C2SA 4BQ9A 5IBLC 5SWZB 1KXQE 4WHYG 4JY4B 3L3HB 1EO5A 5FO9B 1FBIH 3D25B 3KPQA 3FO9B 4XNMB 3I9GL 4LKCB 4XAKE 4RWYL 3NCEB 4MXWL 1DE4A 2LQRA 4K7FA 5DJ0A 3IF1A 1U0QA 3DRQA 5EU3A 3TBTA 5CWSA 4MJ5B 5DGQA 3FL7A 1OP5K 1RY7B 6FABH 5DD1L 2NY5L 5AZEH 5GIRB 4HKZB 4WHYH 5FYJH 43C9B 2IH3B 3R06A 2UZIL 3ZLQC 3T77A 2ADJA 4KMQA 2ED9A 1QLFB 1MRDL 1RJCA 4MVBD 1PSKH 4JFEB 3PV6B 2Y06L 4G9DA 2A6DB 3LQZA 4HDIB 4I3GA 3UBXG 1UVQA 3U82B 1OB1A 4MAUL 2VL4A 2P45B 2EDOA 4HCRL 3WUZA 3GBMH 5IV2A 4OZIA 5D2NE 4GG6F 2BSSA 1MCWW 3SDDA 4I1NB 5E00B 3QDGA 2X89A 3OJDB 4KRPD 1I7TA 4Q0XH 1GXEA 1KJ3H 4WO4C 1GL4B 4MLSA 1HOCA 1ZA6A 4RISH 1GHFL 1H5BB 5ADPH 3HI1B 3EGSA 4M43H 4R2GB 5JOFA 2VLRA 4UOW0 2AEPL 5CJQH 2DYPB 1INEH 5DUBA 3HZMA 5JQ6L 3CX5K 3UO1L 4JM2A 4G5ZL 2HKFL 5GGVL 3EFDH 3O6FA 1CE6B 1OWRM 3I3BA 5IVXF 5F9JB 5GS0D 5D72L 3TCLA 3UX9B 1V3MA 1T66D 4RNRA 2VZSA 3G6DL 5B39G 3SEPA 3VWKC 5EU5B 3SQOL 2DM4A 3RWFA 4QRPB 1KYOJ 4NRYA 5IB4B 3BUYB 4NDMB 1S5HB 4H0GA 4ZSOE 2A38A 5FOJA 3PL6A 1TETH 3ULUH 1G7QB 4KKAD 3MJ6A 5ICZB 4PJCF 3CFJB 3MCKB 3EO1B 4S0SD 3SGJA 3BZFB 3QG7L 4MDIA 1CD0A 4A6YA 1I8KB 4JZNB 1CGUA 4FP8H 4KK9D 4BFIA 1WAAE 2WP3O 1EIBA 3MJ9H 1VB9A 5LXGH 4PLKC 4NFBA 2IQAA 4ZS6D 2WBJC 1FVEA 3S3JA 1JZ2A 4QRPD 4D94A 4L4VD 3QO1B 5MENE 1V3LA 4OGZA 1R5WB 4LASL 2ESVA 4NQEA 2OK0H 1GOFA 2AEIT 5GIRA 2IH3A 3R06B 5JW3H 4HJGA 1DFBH 2I60H 4O9HL 1UH4A 5DHVA 3IGAA 4AQ1B 1ZK9A 2P47B 2QHRH 5K9QG 2D7TL 4NZTH 5C07B 1FGVL 2FB4L 3O9WD 1UEMA 2VDMH 4APQC 4UV7H 3QNZA 5TF0A 4P2QB 5IMOB 3QUXA 2MCG1 3RWGB 4LCUB 2ICES 2XKNA 3W2DH 3ULVD 1YA5A 2EYSA 1HHKA 1C1EH 1F4YL 2AK1L 2HRPL 1MFDL 2JB5H 2VXUH 3RY6A 1XR9B 4LCWD 5FDYA 5E8DL 1JYVA 3C6SB 4AG4L 5ESVB 5I1IL 1RU9H 1P84K 4POUB 4PJ8B 3NIDE 4MAYC 4GO6B 5GISL 5CCKH 1IGFL 1BD2E 3WE6A 1OD7A 2VABB 3GMMA 4BH7A 4GXVL 3O4OB 4ZPVA 1MJ7L 5DUPH 1L9MA 4GAYA 4K8RL 5CUSL 5FOBB 1QPXA 4F58H 4JRYA 5DVOA 3VA2C 2OP4L 4KKCD 2FX7H 1K5NA 2W9EL 5ANME 1J1OH 1HSAB 3RWFB 4U3CA 1K4CA 2Z4QB 3NTCH 4PB9H 5I15H 4LSPH 4XMLL 5FCUH 5JNYB 1G1YA 3HPLB 3RVXC 5FKAB 5A2KH 1CG9A 1LE5A 4R90L 4MDIB 4P57A 1QFHA 4HPYH 4WW2A 4P23D 4M7KL 1OL0A 1KUMA 4PRID 1WBZB 3HNTL 4EI5A 4PLJD 4PLJC 3HLAA 4G8FB 5T33H 1N3NB 4S1SH 1V3JA 4NKMA 1LP9A 4LHQB 1JI1A 1B3JA 4WWID 2Q6WA 1Z0NA 5ID1A 4HMEA 1FE8H 3NA9H 3VXME 2QADD 3IJYA 1X5LA 1EX0A 4OD2B 4Y4FD 4TTGA 4GW4B 3DV4B 1ZLSL 1A5FH 4PS4H 3ALWA 5FK9B 1Q1JL 1Q9KA 3BWUC 1NMAH 3JWOC 5EOQH 2X9YA 3MRJA 2CKBA 3WEXA 1G0DA 3VRIB 3ARGA 4UILL 2AJ3B 1RZFH 3B9KD 4UNVA 4YFLF 1RJLA 3Q2CA 3X3FH 1MF2H 5SWQA 1KPRB 3TO2A 5IB3B 1YUHB 1X5XA 1Q0YH 4R7NA 4X7TA 3EBAA 3PWJA 1OGAA 2VDNH 1N5YH 3PQYE 3DGGB 1Z3GH 5IMKA 5EU7E 1I85A 3GGWB 3MNZA 4V2CB 1JWUB 4XVTH 3EO0A 3PWNB 4XPAH 5DGRA 5JA9A 4NZUL 4D9QE 4NQEE 4D3CH 3VXTB 3SDCB 4P2YA 1KCSL 4Z7WF 3T1WA 3CZFB 4ZUUA 2DB8A 5SV3A 4D9RE 3B2UD 5D6CA 4WUKH 4HBCH 1J8KA 5LG1A 1JN6A 1N0XL 4Y5VB 3MA7B 3H0TB 1MH5B 4YBLC 1EA9C 3MV7D 1ADQA 1Z6JT 5BV7C 1HNFA 5HYSA 4U7SA 3LD8C 4P2OC 4HUKB 2GSGB 5DVKA 3U4BL 4CJ1A 1GOHA 5I1KH 1NBZB 1U8NA 3LKPB 3JSSA 5I73B 4QRUB 1WC7B 3GNML 4QXUL 1SJXA 3DX9B 3L7FA 1NGQH 2GY5A 4BSJA 3KYAA 3LRGA 1NC4D 3FZUD 2WANA 3T65A 3QIWB 5DJZA 4GSDH 3W81A 1P4IH 1F00I 2ARJB 4QTIH 4WCYL 2WQRA 4YBHA 1U8OA 3MV9B 4IDLA 4RWYH 4MXWH 4AH2B 3SE8L 5CKAA 3QNXA 2C3VA 4XI5C 4NQDB 3QXAB 1F6AB 1FL6B 3UDWA 3MODH 3IJYB 1JHLH 4MGXA 2EDLA 4YR6A 2OTPA 2OZ4H 4LCYB 2NY5H 3O3BB 2J8UA 2P7TB 3EDDA 3KYKL 1LO3L 3RVTD 5HJ3A 1DBJH 4MA8L 1T7XA 1RJYB 4AIOA 4WI4A 4U6TA 1MRDH 3TBYB 3OV6A 4OCNC 1NDMB 2Y07H 3HAEA 2R8SH 2R2HA 1U6AH 5DZLA 4OZFA 5CWSB 4RMWA 5DSCB 5BVJB 4Y8AA 1LEIA 2F8XC 3BEWB 4DQOL 3HE7A 1S9VA 1A6UL 1X44A 3MNZB 1YEDA 3MLTA 4PG9A 2WBWB 4M43L 1AQDA 1I1AB 1KELL 1LO0H 5SV4A 3KPSA 4EXPX 2OJZH 4G9FD 2Q76B 1ZT4B 4N8VG 4ZOEA 4ZTOL 1S7VB 1WIUA 3UO1H 4LP4A 1U2HA 3RP1A 3ALPA 1WWCA 2A83A 3DSFL 1JNLL 3SE4C 2AK4D 4I2XA 1LDSA 2X70A 1ORQA 5CIPB 5E2JA 2M2DA 5A40E 1RUAL 3CFEB 2O5YL 2E27H 4PJIB 3C60C 4TVPD 4WHDA 5JUEH 2YWZA 1P7QD 1FLRH 3MRRA 4JEGB 1VGKA 3RKPA 4ZUVA 1MOEA 1RJZA 2R29H 1E4XH 4F7CB 1NGPH 1MAML 1L9NA 2MCPH 2HT3C 3FRUA 1CD8A 4HK0B 1N59B 4K94H 3IU4L 4Y2OA 4QRTA 3PNWA 4ODHH 3UJIH 3TCLB 1G7HA 1H3TA 3BH9B 4OAWA 2BSED 5J6HB 2D03H 1MCJA 2EEBA 5L7XH 2E9WA 2VZUA 1QSED 5LCVL 4F9PA 1QBMH 4AL8L 3BDYL 3KNBA 5DJDB 2W0LA 4PRHD 4Z7VB 1PKQA 4OFDA 5F7UA 1QKZL 1V7ML 5HVHC 3EJYC 4ZYKB 4XPGL 4LAQL 3D3VA 1X9QA 3RIAF 3VDCA 5JW3L 4O9HH 4U1MB 4AEIH 4PGBB 2BVQA 4XPHH 3EJZC 2FB4H 2YRLA 4FFZH 4R3SB 4OTXL 3SDXF 4LLUB 2X4TA 4OZ4B 1P4BL 3JWNC 1RMFH 4R4BA 3LDBC 1UQSA 2I25N 3F5WB 3BKYL 5IEKB 4CN6A 3MLSL 3KPSE 1CGWA 3AM8C 2R23A 4E0RB 3TIEA 12E8H 3VFRB 2DN7A 3W11D 3UYOD 1LEKA 3P9MB 1RU9L 5HYJD 2ADFL 1MREH 4V1DB 3KPTA 4FOMA 5TDNA 3S7GA 3T0VA 4L3AA 2JJUA 4QRQB 1Y18B 1PEZA 1PZUB 4EUPG 4FTVD 4E41B 4LKCA 3B6SB 4ALAH 5IMOA 5E7FA 5F9DC 4M1DH 4O58H 4GXVH 4HKBA 4FXKA 1NCAH 3E8UL 4Q97A 3GKWH 4QYOB 3HS0A 3RUGE 4ORGA 1I8MA 2CDGB 3GMNA 4XZUB 1QBLH 1UWEH 4NBZB 4MQXC 5BXFB 3G08A 3CH1A 3KYMA 4N1CA 3AXLA 5BQ7A 1OP5H 4V1DD 1FNGB 4JO1H 1VCAA 2O5XH 4GT7A 2E6QA 4HFWA 1BIHA 3TT3H 4RMTA 2GUOA 3RHWK 2YC1B 1ZXQA 4MS8D 4ZNEA 2VDRH 3WXVL 1WISA 2CJUL 3NCJH 2OMBA 5HHMD 2ZSVB 3BPLC 1GGCL 1UFUA 2D4FA 3QJHB 3V6FA 3ARSA 5DD5L 1YN7B 1PKOA 3SGEH 3DETD 1FV1B 4LLQA 1CDHA 3OKKB 4Y1AE 4R0LC 2OR8A 4Q6IC 3NA9L 3SE3C 2JJSA 3S5LB 4HUMB 3K2UH 4HF5H 1CE6A 1ZVHA 1RZGB 2C9AA 5SX4H 4C56A 3GB7A 3TESA 1C7SA 4N0FB 4P23A 3LRSB 5J11B 2A2QT 1U8MB 1LQSR 3X3FL 3OKEB 1WIPA 3TO4B 1A9EA 1MPAL 1NCUA 1UA6L 3QEGL 3PHQB 4DAGL 3MOAH 1A1MB 2VLRD 2GT9B 5CD3A 3L3IA 5FYKH 5T1DH 2XXMB 1VEPA 2A9MH 4IHOA 2CK2A 1G7QA 4OD2A 4BJLA 3PUCA 2YKLL 5E2UH 3BT2H 3CFJA 4M5YL 2EYTA 1SY6A 5IJVB 2KL6A 2PO6B 4A6YB 4X9HA 1KV3A 4PBXA 4G3YH 2VKXA 2X05A 1A3LL 3HUJA 2BHUA 4XX1G 3ZYIA 5J9PA 4TUKH 2E6PA 4NM8H 4P2QE 5EUOE 5T3XD 2AABH 4R7NB 3S6CA 1QRNE 2VSDA 2X44D 3VD9A 1W0WB 2LABA 4KVCH 4G8GB 1EEZA 4F7MA 3GJFA 5IR1B 2X4QA 3DGGA 1CR9L 1H9VA 1EEYA 4TUJA 3GK8L 3QG6B 1WJ3A 4AENB 4YPGB 3FFCE 3GSNB 2CIKB 5GS3A 3GKZA 3ZDXF 3G5YA 4NWUL 2HJFB 1TCMA 1FYHB 3C2AH 5DD3H 5H35A 4M3JA 1M71A 1NGQL 3PQYA 2ZNWA 4OGXH 1OAQH 4PJBF 4KAQH 4BSVA 2PKDA 3GSVA 1CXLA 4GSDL 1ORSA 3QJHA 4Y89A 4J1UB 1Y6KR 2COQA 1SYVB 4RFEB 5C0ND 1BGXL 2HFEA 5KANI 5KS9B 4CADA 4XNQA 1ZGLA 3I6GB 2BNRD 3M17B 3MNVA 4M93C 4EUPH 4MJIA 1JUFA 1RZ7L 1YECL 1LO5B 3GJEA 4PV8B 2HRLA 2ICWI 3TJHD 3FTGA 3JUZA 5I2IB 5IVXB 1YY8A 4ZO6A 1NAKL 3VJ6B 2XNAA 1DBJL 4NC1C 2AXJA 1GRWA 1OW0C 2V2WA 3TO4D 4L8BB 3C9NB 2NR6C 3LIZL 4YWGL 1CFQB 5EC1A 5GZOD 1ZHLA 1RURL 1AGCA 1AGFB 1VFAA 4P48A 5GZOC 4QO1A 1PG7L 2ATPA 2R9HD 5C3LD 3MACL 2GJZA 5DC9B 5DEFB 3VGAB 3OX8A 1IKNC 2IALB 3TJHC 1AFVL 4LKXA 3V95A 4AM0B 4WUUA 5TF1H 4C83A 2OR9L 2KDGA 4PJFF 3U0PA 2VN4A 1IGML 1NLBL 4LDOB 5IT2L 3U30B 1HXYA 5JXAH 3ZHDA 1XFPA 4MWFA 5LWYL 5C86A 3QCTH 2BZDA 4LPVA 3QUXD 5HXMA 1HNGA 2W0PA 3TBSB 3DUSB 1I9JL 4JPVL 4M48H 1YYML 3MLZH 1OPGL 1RUAH 1IAIH 4BSWA 3SY0A 2NY4B 4EBQL 1EZVX 1KLFA 4WU7B 4WTZA 1FLRL 4Q9RL 3EDJA 3X3GH 1UYWL 2PTVA 4XTRC 3Q6FB 3U7WL 4G8IB 3GMRB 5B3JE 4V2BA 2JTDA 4NO3A 4NC0B 4ELME 5C92A 4X7SL 7CGTA 2H3NB 4L4TB 4AIZB 4LRNL 4UAOC 4X7TB 1HSBA 2C1PA 1T4KB 3CFDA 4XCNB 2XN9D 2Z91A 3AY4A 2H6PB 2ZG2A 1NCWH 3BKMH 3EDKA 2R69H 1YC8A 3SKNB 4P5KA 3BDYH 1JWSA 4MJIB 1YNKL 1NCBH 4PRPD 4XBGA 5IK3A 3BJ91 1CU4L 1RZ8A 3ILPB 1FRGH 4OZGA 1EDQA 3OAYH 4U0RC 5I1JH 4NRZA 1MHEB 2F9BT 4OF6A 3REWA 1F8TL 1WBYA 4Y2DD 1F2XK 5BRZD 3RGVA 5IQ7L 2FEEL 2VLKA 3MNWB 3MUJA 4MA3B 1DJSA 3MGAA 4LVOC 1AH1A 4F7EA 4WEUD 1QBBA 3KWWA 2D7QA 3VWKD 1A7QH 3BO8A 2EDNA 4DVRL 3QHTC 2VXQL 5CHNA 4O51B 1MUJA 2B5IB 1VFAB 4R97C 1S8DA 4HWEH 2VB5A 3I2CH 5EU6D 3P11H 4P4KC 1S7WA 1JRHH 2WUBL 3CMOH 5HI5D 4QGTA 5A2FA 3MLSH 1HHHA 3IDMA 5I1AA 4LKXB 4Y4KC 1EO8H 3R1GH 4YGAB 5ABDE 4WUUB 4NQXA 3LV3A 4A6YL 4GRWF 1NEZG 1D6EB 2ADFH 1B4RA 2JB6B 4DVBA 2BNQB 3P4MB 5D96B 1HI6A 5C0DA 2HFFB 5AUMA 2QSCL 3JTTB 2WINA 5JR1L 2J88H 1W0YT 3EYQC 1JMXA 2FBOJ 3QYCA 1F4XH 2DMCA 2F8OA 3V2AR 1FSKB 1S7QA 4LF3A 2MMXA 2XQYK 3C5SB 5EBGA 1CXEA 2Y9RT 1RIUH 3EO9L 4YR6B 2A6IB 1IAMA 1BM3L 3CAFA 4MVBC 3AAZA 5INDA 3BZDA 5KSBB 3IFNH 1ZA3A 4OCSL 3L3GA 4HIIB 4JGUA 4JO1L 3D3VD 3DVGA 2VSCA 3VGGA 4PTUA 1Z0MA 4TVPL 5KW9H 4LQ1A 3V52L 5CMAA 2VH5L 4KI5E 1MRFL 1F4WH 4GG8A 2VDRL 1C5DA 2I5YH 1D5XB 1EUUA 2NXYC 1CDYA 1G7PA 5K59E 2DQJL 1OHQA 4F2MA 4F9PC 2R4RL 5EA0H 1GC1L 5C7XL 4XHJD 4LSRH 2YPVL 3GMNB 4J12A 1AO7E 1QOKA 1QVOB 5DD5H 4CVZA 5HHNA 3AC0A 1YEDB 1JF1B 2BSTB 4OLXL 5D2NA 2NY6B 3SDAD 4G8EA 1JGUH 1C16A 4MX7B 4M1CC 1DANU 2G9HA 3QEQA 4F7TA 4HUVA 4LPTA 3VFVA 4J23A 3UAJC 2XWJB 4X4XA 1NEZA 4QF1A 3W11C 2VE6B 1QZ1A 1HCVA 1I3RA 1BJ1H 2X9WA 3QNYA 3EYUH 1EJOH 1MPAH 1OVZA 1CZ8H 5C09D 4XXDB 4L8SB 1TZIB 4JB9H 2DQCH 4BELD 1EO7A 5E5UB 3L1OH 5E8EB 1FG2B 2JCCE 1QLRA 3ARBA 3BJLA 2OSLB 5INCA 4WUUD 5HTSA 4C4KT 2E6JA 4BA8A 4OZFG 3DX7B 4GMTL 1ADQL 4MNQA 4HH9A 5DVLA 3ZE0E 4TSAH 3IFPB 5C0CA 1FZOB 1C7TA 4FFVD 2I9LB 3U0TA 3WHXA 3BFOA 5KJRL 3SDAC 3DXAE 3TO4A 4NN5C 3T0EE 5IB2B 4LSVH 4YNYB 5FDWB 1J8HA 1MCPL 2KH2B 2R1YA 1S9YA 5IMLB 3CLFH 3MZTA 4S2SB 1UXSB 5D7KE 1F11B 2FO4A 1PKQB 4YDJB 4PGDA 2VLJB 3CLEH 3FO2B 4L29A 3TN0C 3ZE0F 2R0WL 2Y7QA 3C5ZA 3E6HA 1IM9A 2YN3A 1JPTH 3LPFA 4RGOH 1UH2A 5FA4B 5HHXH 2J7LA 2OTUB 3GSQA 1KPVB 4GFTB 4NRXB 3H9ZA 3D25A 4DEPC 3FO1A 2PR4H 4ODWA 2ZUQB 3SHSA 3C2AL 3LS5H 4R3SA 2AGJH 1PD6A 1AQKH 2G2RB 2J5LB 4ELMB 2DWEA 3QQ4B 4NP4H 1Y6MR 4LLUA 4OGXL 4RIRB 5CGYC 5E8PB 4W6XB 4G6JH 4KFZC 1AP2B 1TTUA 5E70A 3WDJA 3DOSA 2HG5A 2BVOB 4KMTL 1NFIB 4J3OC 5I30L 2FL5B 4ZXBA 5MEOA 5DRZA 4UIMA 3CVHA 3ZTNH 1OAZL 2HKHL 3E6FB 4WHCA 2EKSA 4JVPA 3IU3A 4MNGE 4Y5XC 1KCUH 5HD8D 2R2CA 5L6YH 4S10A 4X6DB 4C59B 4K2UL 1M71B 5EZOL 4YFEA 3QCVH 4P5TA 4OLWL 3MJ7B 2IBGA 2N4IA 5EU6E 4PGEA 3BGMB 1MWAB 1JP5A 5FYKU 3QH3A 3Q5OA 3BWAA 3LIZH 4YWGH 4OI8A 3IT8D 3VGEA 3ES6B 2Y5EA 3EZJB 4HZLA 1G6RB 3GHBH 3V5HA 2VXVH 1PG7H 3ZKXC 1LO5A 1C5BL 1A6ZA 1P5UA 2DD8L 3RUGB 1WF5A 3A67L 3LN9A 4HUUB 5TE6H 5HYSG 5F93C 1H0DA 4OI7A 3G5XB 1QYGH 4F9LA 1KN2H 4OD1L 3WCYA 4V1DE 1HEZB 5AYUH 4OCWL 4WI3A 4L9LC 1R3LA 4DFIA 4NHCH 3CVIL 3OXSA 4JDTH 4XMPL 2VO5A 3QCTL 4X99A 1BOGA 2XN9E 4ZOAA 1HCFX 4KH2A 4W68A 4XCFH 2V2TB 2W0KA 2YK1L 1HHGA 4Z7OE 1RVFL 4Q9RH 1LK3L 4RA3A 5DQDH 3QJFB 1CQKA 4WI2A 4GKOA 4ZODA 4CDGC 5AD0B 4LRIA 1DL7L 4L4JA 4NPYB 2CLVB 2ZJSL 3S37H 1J0JA 3RDTC 5J1AA 4PJHE 4Y16A 3VGDA 1HN1A 1N2RB 2WWMC 1OTTD 1OF2A 3BSZL 2O93L 1LK2A 2IWGA 1K2DB 1UENA 2IG2H 2LTQB 4QRRD 3RAJL 4YDLB 1I1AD 3O8XB 3P4NB 5TJWK 3HRPA 3O6LL 5EORH 1DZBA 2BSRB 1U8LA 3TA3B 4JM2C 4JRYD 1CU4H 5J06A 1IGTB 3KDMA 4OFYA 3QULB 1AKJD 4X9IA 1IGYB 2CIIB 4LCCA 1RIVL 5I1JL 1AGEA 1OW0A 1WCQA 1IKFH 4JJHA 3CFIC 3A6BH 3BMVA 1MWAA 4MJ5A 3BP5B 1NC2A 2N56A 5M7QA 3QWRD 2UWEF 1U36A 5F9OH 2OTWB 5EOTB 5GSRA 3W39B 4OZIE 1XZ0A 4GKZB 2B2XH 3MLXL 3EDEA 3A6CH 3AS1A 4BH7B 3O6MH 4YZFF 5EZLB 3AS0A 5I1CL 1OP3H 4NWTL 5DJYB 3WFEH 4JRYB 2YD5A 2Q7NA 3MRMA 1XF4B 2PETA 4TNVF 4RRPA 1I7TB 5E0QA 1SYVA 4PJ8D 2V7HB 4RFEA 5E9DB 4PJFB 2G60H 2BVYA 3K2MC 5JXED 2J88L 4RBPH 1VDGA 3TVMC 1RIHL 5JW4Q 4ZS7H 4J3WA 5IB5B 3LKSA 3MROA 4WV1C 5CINL 4FQXB 1ZHBA 3CVHL 4G6MH 3FQRA 3X14A 4QHLA 2F15A 4MQXD 1BM3H 1CICB 3CMGA 5DXWA 4PRIA 1IM3A 2J3SA 1C08B 2W60A 1TDQA 2JB6A 2E9IA 4U6XB 1DDHB 3GDBA 5KAQG 3V52H 4JAMB 3ARED 3IB4A 1F4AA 1ZLVK 4LEXL 5I8EA 3S35H 5KAQF 3ULVF 2XTJC 2IPUG 3QXDB 1AGCB 1TQCB 3RY6C 4EN3D 5CJQL 3V4UH 3ARFB 2R39A 5C8JA 3PQYD 1C8PA 3QPQD 3QWQB 4YDIL 4LHJB 4LSRL 2DAVA 2PYFB 1R5VA 2F54A 5FHAH 1W8NA 3MCKA 5KVEH 3BZFA 3MRJB 3ROLB 3FB7B 5EN2B 3BHBB 1IEAB 3FQUB 3S35X 4B5EA 4K71C 4W81A 4R4FH 4KZEH 3H2WA 3G6DH 1IQWL 4K3GA 2NNAA 1FN4B 4LSQH 5I8CB 4OSUL 5T5FL 3U9PL 3DWTA 2MQ0A 5HPOA 1OAXL 1OAKL 3KPRD 3NIGF 2EE9A 1SJHB 3C8KB 3ULUL 3ECBA 4OGAC 1I1FB 2R4SH 1ACYL 4F80A 4JPIA 4JB9L 1MIEH 5J6GB 3SJVA 1HYSC 4IDJL 3QPXL 4OLYL 3HPJA 2P44B 3QNZB 2Q3AA 3MOBH 3FB6A 1CGXA 4NKOB 2BNRA 3FCTB 5FV1L 4CJ0A 2EICA 1CTNA 2P49B 1GPOH 1MRCL 4IOIA 1RD6A 2QBWA 4AEHL 2EC9T 2D0FA 2GSGA 1MCPH 4GQPH 1J0KA 3CLFL 2D7TH 4NZTL 5E8EA 3HHRB 2EDDA 2R0WH 3AS3A 5INCB 1AXIB 1PX4A 3QHFH 3I75B 4WFGE 3STZA 2ENYA 3LB6C 1FBIL 3JTSB 3IDYC 3W2DL 3PIQB 5D70H 4WVRA 1H8NA 3I9GH 4BQ6A 2JB5L 2R0ZH 1X5KA 3CZJA 1BD2B 1I7ZB 3RU8H 5IF0A 3G9VA 2BOCA 3LS5L 3KLHC 2D3VA 4QWWD 1AGDB 2FJFB 1KIUA 2VLJD 4JFXA 1F6AA 3BD5A 1BIIB 1RFDL 3HC4H 2JKXA 5C0EB 2UZIH 3IJHA 1DQMH 1SJEA 3MPCA 4FTVE 4UIKL 4Y4HC 5D2NC 2Y1VA 1UJ3C 4PJBA 4K8RH 4JKKA 4XC3L 3VXNB 1QLEL 4KJYB 2OP4H 3WJLC 1YEIH 3RHWF 1TVBB 5F9WB 1KCUL 4S1DD 5DJ2B 4GKSB 4WJ5B 1YC7A 3H9SE 4CAGA 3G6JE 5D1QD 5ADOL 4X83A 3PJSB 5EZOH 4CGTA 3FN0L 4HEME 2PXYD 5SWSB 3T0XA 5I18H 1R5IB 4XMLH 4P9HL 3CFBA 1A0QH 3MV8E 2WLYA 4IBLT 4P2OA 1BBJA 4Y2DC 4J7RA 1HK6A 4GXUM 5TPWL 3PWUB 3ARBC 5BJTB 1M05A 1MCSA 3GHBL 3MMEA 2HTLD 3H3KA 3OJ2C 3L3GB 2XFXB 4HIIA 3WFHA 1GIGH 3OKDA 1H8OA 1FL3B 1TZGH 5DMIH 2WUCL 2DJUA 3REVB 3LQAC 1FNEA 1KOAA 3A67H 5TE6L 3U46B 5FKPB 4HV8A 3BKCL 2PXYB 4K8RC 1GAFL 3PWJB 1KN2L 1FFRA 4OD1H 4UB0L 1FE8L 3S4SG 3SBWA 5DRXB 1BVLA 2NY3B 4IOIB 4OZHE 5E6YA 4P99A 5AYUL 5IMKB 4DKAA 1A5FL 5FGBA 2P24B 2Y5TA 2IH1B 1P6FA 1KACB 1BZ9B 1KTLB 4KRNA 5EOQL 4BH8B 3DXAD 3K4AA 1DBMH 2V5YA 3L5HA 4JO3L 3C5ZD 3SCMC 4KRMB 1OM3H 4JANA 1N59A 2H26B 3KPLB 1II4E 3QG7H 2EEAA 2YXMA 3UTSA 3VE0B 1G7IA 5A3ID 1LK3H 3SKJH 2P5WA 1LHZA 2CDFA 3JXAA 4OZIB 3NAAL 2MSPA 4Y5VA 5CEYA 2VE6A 5SX5K 2FDBP 4BFGA 4H25B 4KDVA 2ZJSH 5C09E 1HH6B 4UI2A 2X4NB 2ADGB 3INUL 3VH8G 1EAPB 4KJPC 3BAEL 4OD3H 1IC4L 4N8CH 4W4OC 5EOCH 1TVHB 4UT6H 1NANH 2E9BA 2IG2L 1A7BA 3LEXA 5HHVH 3T65B 4X80L 1G6RH 4HBCL 1SMOA 2DLTA 1G9NC 3QJFA 1A7OL 3SE4A 1WWWX 4JFEE 5FXCH 4JR9L 3G6AB 1DLHA 4K9EC 4OCYL 4YNYA 1YPZB 3C60A 5DD6A 5GRVK 3SN6N 3RGVD 3L5IA 1A6TB 4PJ9A 5E8DH 4HZAA 4QXWA 2AI0H 3O6KH 2PTTB 4PRDA 1BVKB 1OSPL 1LEKB 4OM0L 3RI5F 3HA0A 4O2FA 1DVFC 1U8LB 1U58B 4WCYH 1FNEB 4YZFE 3MLXH 1KB5H 1U8KA 2XN9B 4JKPL 3A6CL 3OGCA 2O61B 1FQ9C 3ZSTA 1TLKA 2NTFA 3UBXB 4ORGB 4OUUB 5JIPA 2DIAA 4FFYL 3NTCL 4HAGA 1UZ6F 1MNUH 4K7PY 2YA0A 3DURA 1LE9B 4ZO8A 1ZTXL 3AXLB 3TYFA 2G60L 3TZVB 2D0GA 4HGWA 5GSRB 5IFJB 1ZLVH 4M61A 1LO3H 3WSQH 5CEXB 1MHHA 1WLHA 4HHAA 3IKKA 3LEYL 5CINH 5C07A 4U6VL 3MGTA 4FZEL 2YPLE 3MUGB 4OQTA 5C09A 2YSSA 2MKWA 3RI5K 3T1FA 2GCYB 3RVWC 5T33L 2D4DA 1A6UH 1A9BA 1VPOL 2K9UA 4RAVB 3HE7D 5D4QA 5LGHL 1S7XA 1BHGA 3OF6D 2ADGA 4LVNC 2HVKB 5JHLL 1BVZA 1KCRL 1NC4A 1ZLSH 2BOBA 4JGMA 1PQZB 1JZ7A 1Q94A 4HJ0C 2FWOB 1B0RB 3F7QA 1NMAL 2CK0H 4PJ7F 1MLCB 5I19H 3ABZA 4XXCA 2X4OB 5FHAL 1T1ZA 5HVGB 1K3ZA 2AKRB 3GSXA 4LCCC 3RX7A 2AXGA 4HFUL 1SVCP 2XG5A 4Q7DA 1FYTA 4DZ8A 3LRSA 4RA0C 3HNVH 5I76A 3UPRB 3BPNC 1AY1H 1CL7H 4XPBL 3ZE2F 4IM8A 4PJ5E 5D1QC 3DTXB 3KNBB 5DJDA 3QI9D 3LEVL 2YWYA 4KJWD 5D7IF 2GK2A 2X4SA 4KKNA 2PW1B 4WTZG 1KPUA 1MCRA 1BFOB 1T80A 4HMCA 4I0PA 4XVTL 4WI6A 2AQ3A 3U83A 1QQDB 1ACYH 4DCQB 3BGFC 4F33A 4WDIA 5ITFA 4J2XA 4MCZA 4P46D 1ZS8B 5EPMB 5HGAB 3I6KA 2HLFD 3UTQA 1OAUL 5CZVH 3BZ4A 4AL8H 3VW3H 1JPSL 2FZ3B 4JRXA 5FYJU 3UZVB 5JZ7D 4JLRA 1FJ1B 3AREA 3LCYA 2Z35B 4LAQH 4XT1C 1RUQH 2PF6A 3ECBB 2QADC 3TVMA 3DECA 2MOVA 5KSVB 4R0LA 4D9LH 4Q6IA 1ZMYA 2W92A 2WAHA 4MS8C 5J57B 1ZEAL 2X4PB 5FECB 4Z7OF 2AEWA 1IAIM 4G9DB 3S34L 4DOHB 3DIFA 1IM9D 2RB8A 4P23C 1P4IL 4HKBB 4LGSB 2KQNA 4JDZA 2B0SH 2EDYA 3VFTA 5D70L 4L3CA 5D6DA 5DEGB 1A2YA 2FYYA 1FNFA 2JE8A 5EFIA 1YYLL 5EIQA 3BP6B 5KVFL 1YMMD 4FA8A 4CVUA 1T1YB 5ENWA 3JV0A 5C08A 5EOTA 4BYHA 2YZ8A 1UWGL 3I6LE 5F71A 4DZBA 1FVDB 1AC6A 3MODL 1FYTE 2EDWA 4LVHB 4KROB 5ELIA 5I9QC 5HPMA 3VFMA 4NJ9H 5E2VH 1QR1B 1PLGL 2AJYH 5DYOA 4ALAL 1B0GB 5F1IB 4F15C 3B9EA 1DQML 1E28B 3QA3B 4O58L 4JHBA 1YNTB 2A1WL 2BY3A 2IMNA 3N1PC 3NGBC 4OZGF 3LKNA 4JY5H 3H9SB 3I3EA 4HJJH 3UPRA 1JN6B 3QWRA 2F74A 3R0MA 2I9TA 1QBLL 2GFBA 3KPPB 4GAFB 3WO3B 1RQ5A 5C2BL 5C0BB 2EO9A 4QNPF 5ADOH 2OR7A 2YPLA 2XA3A 1C5CL 3VDBA 3FN0H 1X4ZA 1XH3A 3FQWA 4LHUD 4IRSD 4NNXB 3UEZA 1S5HA 4Q9BA 1OQOA 4DQOH 2A6JB 2BRRH 4NUGL 3PHSA 1YMMB 3IFLL 3KJ4C 1A0QL 3RTQA 1WCBA 2XTJE 3LKOB 3WXVH 5EO0B 1YN6A 3W9DA 3NA4A 4GKNB 3L5XL 4P46B 4MD4A 3QIWA 5ITFB 1WITA 4RGNC 3HZVA 3KXFD 1YEHH 2AJSL 2AQ2A 3FFCD 1EPFA 2VDPH 1CDCA 3MBEC 3RWHA 4QRRE 3QO1A 4NJAL 2RAMA 3U2SA 1EUTA 3OAYK 4ZFFB 4TNWK 1K8DA 1Y0LB 2G5BA 5ESQB 4X6CA 3HZKA 4EUPA 4UB0H 4N0RA 2V5TA 4QXGL 3K2UL 2XZQL 4FQCH 4NNPH 3AU1A 1FC1A 4KRLB 1NAML 3JWOH 5C0CE 2H2SD 4PJ5A 1I7RA 1T0NA 3OB0H 2BNQD 3O0RL 4G8IA 2HT3D 35C8L 3H3BC 2YBRA 3BQUC 3MMEB 2P7TA 4IRSC 1DBML 3BEVA 3RTQD 3OKDB 1U42A 2GJ6E 3IU4H 3ESUF 4NUJB 2P1YA 3D5OF 4JKLA 4PLNC 5E1HB 1N64H 2NNAB 2DTML 1G7MB 3ZT5A 3PWPD 5K9KA 4HC1H 1HQRB 1SBBA 1NCDL 3SKJL 5BZDB 5HGGS 5LCVH 5DQJB 3NAAH 1BQSA 4KKAC 4JFQA 5DC0A 2XWBA 3GSOB 4PFEA 1S7TA 5HHOA 2XKUA 4UDUB 2EKJA 4E42B 5JDJA 4NQVA 3MRQB 4F37K 1QLFA 3O81A 1V7MH 2YOCA 3LRHA 2Z31B 3GSNA 3INUH 1BFTA 1K6QL 3RWIB 2HJFA 3LZFL 3RKDC 1IC4H 1A3LH 4PR5B 1VACB 5IVOA 3I02A 1Z5LB 3NFSL 4TUKL 3DJ9A 3FB6B 3PGFH 5F44A 2R1XA 4L3EA 4PJXA 5HHVL 4BKLB 1CK0L 3C8DA 3OJDA 2VMFA 4KPHH 4ZOCA 4Y1AB 4F7EB 1P4LB 3TNMA 2VRAA 1P4BH 5IW6B 1CR9H 5D2LE 2FATH 1OAYL 2DKMA 3MRKA 4H25A 3HI1A 1XH3B 4AIXA 5IIEA 2C3GA 5L88H 4XB7A 3WFDL 4LMQI 5EO9B 4ZNEE 1WT5A 4EN3B 5IQ9A 4HAFA 3FTGB 4CMMB 3O6KL 2CR3A 4M6OL 1LE5B 4QEGA 4JFDD 4LLVB 2W1NA 4OM0H 4HUXA 2BX5A 4YFDB 3WNNA 3BW9B 1IBGL 4NQED 2GEEA 3KHOA 1UKQA 3RZCB 3EYQD 2MQCA 4X6DE 2VLLB 1KEGL 4HLJA 3Q6GH 3VXUE 2VZVA 5TDPA 5DD6B 5MP6H 3WNPA 1YECH 1CVRA 4Z7VA 1XR8B 3D39B 5J12C 1IJ9A 2IALA 1GSMA 4R7DB 5KTEH 4ZYKA 5F3BA 1Q9OB 5DD0H 3FZUC 4BK5A 3TT3L 2KKQA 5FYLE 5GHWH 3WKNA 3L3HA 3H9YA 3WEXB 4YHML 4B0MM 3WSQL 3B5GA 2AJ3A 2GK0B 1KTDA 4M7LH 4YPJA 3FO9A