4FZEH

Crystal structure of n26_i1 fab, an adcc mediating anti-hiv-1 antibody.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGSSAKVSCKASRGTLSSYFISWVRQAPGQGLEWLGGITPLLGTANYAQKFQGRVTITADKSTNTAFMQLSSLTSDDTAVYYCAGTVYYDILTGLYTNFHYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N26_i1 Fab light chain
publication title Crystal structure of N26_i1 Fab, an ADCC mediating anti-HIV-1 antibody.
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 221
sequence length 227
ec nomenclature
pdb deposition date 2012-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fzeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fzeH01
1FIEA 4ISVA 3TJEL 1GGBH 1ZLSL 2DM4A 1YNTB 3UROR 4MD0B 4D0CB 2YD6A 4Z18A 4N1HB 1NGWB 1T7XA 3DUUA 1NEZA 3QDGD 4JFXA 4K9EL 3T4YA 4Z0BH 4JHAH 3F6IA 4JHZA 4IHOB 3WUWB 4GH7B 4YBLC 1CDCA 5C08B 1JMXA 1NAMH 4FQCH 5K9JL 3KR3H 1N7MH 1MFCH 4HWBL 3W0WD 4JPVL 5D70H 1EH9A 5DSCA 4HS8H 1X3DA 5SX5H 3FT3A 2D0HA 4NBXB 3ZKMC 2A0LD 4YJZL 4DAGH 4LHUG 5FYJU 5D2NC 3ARBA 4D9QE 1F5WA 3BT2H 3ARZA 1U8IA 4Y88A 4RNRA 2DJ4A 3LD8B 3LH2H 2MTPA 3PWUA 1B0RA 2GEEA 3D25B 3B9AA 2A9NL 5E6IA 1YNLL 2QLVB 1LO0L 1U92A 2F8XC 4HLZG 1DBKL 4HS6B 5CJOL 1BAFH 5FYJH 5L9DH 4MD0A 2VC2L 1GHFH 5KSBE 4D0CA 4HK3N 4XPTH 3TGXA 1NGWA 4YHZL 4F8QA 4HD9A 1IM3B 3V4UL 5F6HI 4OZHB 5EG6C 3QCUH 3RIAK 3VXNA 1AQKL 1T1ZB 3LAFA 5D7JC 1HDMB 2O61A 5HI5D 1UH3A 3PGCB 1PY9A 5BZWB 5FGCB 1MRDL 3BZFB 3BP4A 4NT6B 5KZCB 1UJ3A 1YYMH 1FVDA 1A14H 4TNWK 1MHHB 5T5NG 4KTYA 1IKNC 3WDHA 3D25A 3NIGF 5H2BB 3V8OA 1QFWL 3BE1H 4XVTH 3MLZH 5FXCH 3RVVD 1NC2B 4HS6A 4N8VG 3GHBL 4XP6H 3R1GL 1GIGH 3FOLA 3JV6B 4OZFB 1LEGA 1JGDB 5CSGA 4ZTPH 2R0KL 4MD4B 3V9FA 4X4XB 4YHLH 1IM3A 1I7UB 4MNQB 3GSVB 1FAIL 5IMOB 1ZHBA 1ETZB 4OZHA 2WWKO 5MHSE 1OTSC 3WJJC 1HE7A 2XY1A 1T1ZA 4I5BB 1HDMA 4ZFOL 2A6IB 2GIYA 2FB4H 2VO5A 3LEXA 3RP1A 5FGRA 3SCMD 4M9OA 3T0AA 4IEFB 3PGCA 4BH7B 1Z9OA 2YOCA 3BZFA 4ZFOA 4MXVF 5TE4H 5DVOA 4HAGA 5GJTL 5I1JH 4XPHL 2YD5A 3MACH 4PB0L 4ENED 3CVIL 1MHHA 4Q0XH 4YBLB 4K94C 2O5YH 3GIZL 5H2BA 4OFVA 4G8IB 4ZNCD 5HDQL 3X3FH 4FQHB 5D2NB 1RHFA 1NC2A 2H3NB 3RAJH 4UT7L 1KFAL 4LLUB 3JV6A 1CLZL 4OZFA 2RCSH 1JGDA 4MD4A 3UZVB 5GGTL 5JA8B 2ICWI 4MNQA 2BVPB 3QPQC 4KWUA 3UTQA 2QQQA 2JE8A 1ETZA 4UTAH 5C0CB 5GGTA 5GS3A 3IJHB 3GO1H 5IBUB 2A6IA 2ZCLL 5GHWL 3QUYC 4S2SB 4BH7A 3WIHH 4B7LA 3CAFA 5JR1L 4WGVB 2DF3A 3MLYH 3MJ9L 1P7KB 5I1HH 4Y4HD 3ARFD 5KSAD 5D7JB 3TBSB 4Y19A 1I7TB 3MUHL 4O00A 1C16B 4WY7L 1WT5C 4PPTA 3CH1B 4TVPE 4G8IA 5C09D 4FQHA 4JHBA 3IU3B 3WXVH 1R24B 2H3NA 3ZKND 5MEPB 5F96H 1IILE 5FOJA 2GJZB 4L5FH 3P0YH 4GW1A 5D7IE 2NXYD 2AERT 2Z8WC 5C0CA 1NCAL 2YS4A 4P5TD 3DTXA 4HJJL 1PG7W 5EA0H 1S9YB 5EU6B 3GEWB 3IJHA 1IT9H 3SDXA 1NJ9B 3D3VA 3T08A 1B4RA 1DQQB 1DBBL 4EDWL 3BQUC 1DFBH 3QEQE 2IPKB 1TQCC 1JE6A 3KLAB 3JWOH 1P7KA 5D7JA 3TBSA 4AL8H 1C16A 3K2MC 4LDLB 2X9XA 1L4IA 3VE0B 3WNKA 3X17A 5MEPA 4OF8A 3E0GA 5EBWA 4XAKE 3KVQA 1IKNA 4UOJA 2GSGB 1G9MC 3DWTA 3S36X 1WZKA 2APTA 1G9EA 2QQNH 4OM0H 2ZUSA 5C7XH 3S37X 2G9HB 1FGNH 3QIWC 4LP5A 2JELL 2VUOA 1S9YA 5EU6A 1H3TA 4QHUB 1DQQA 4GRWF 4G8EB 4XBGB 3W11D 4XT1C 2ORBL 3AS2A 4BZYA 5IESH 2IQ9H 3P4LA 4NC1E 3LQMA 2IPKA 4TRPL 3RVTC 4PRHE 3SJVE 2O5XL 4F37K 3FZUC 3WJJA 2FATH 2BFVL 3MRHA 3FO0H 3MJ6A 5IJKA 3EJJX 4L8BA 4J3VA 3QUYB 4OCXL 2YN3A 4NQDE 2Y5TB 2CGRL 3Q6GL 4JKPL 3VE0A 1U91A 5AWNL 4QXUL 3RGVC 1U8MB 4OAWA 1WBZB 2ZNXA 2FX7L 1OSPL 4AIXA 5SWQA 2GSGA 3EDDA 2ITCB 4N0YL 4PJ5D 4HT1H 1AXIB 1MQKL 3H0TB 5GZNC 2QQLL 4L9LC 3TBYB 5J6HB 3RVUD 4Q9QL 5E8EB 4QHUA 4BSJA 5ECJE 1RVFL 2VLKE 2DI8A 2XTLA 1YEKL 3N9GH 2VXQH 1T0MA 3MUGB 4Y8AA 3KLHC 4KHXL 3VFTA 5D6CA 4ZUVA 5DGRA 3L7FB 3KPQB 2XZCL 3DHJA 1N64L 3LQZB 3OAUL 3G9VA 4XGZB 3GJFH 5C0GB 5JLZB 1UENA 1MELA 4J6RH 4K23H 3QUYA 4KJPD 6FABL 4ERSL 5JW5A 3THML 2Y5TA 4HPYL 3I9GH 1RIHH 2CJUL 3BQUB 1SYSB 3IFPB 4KKLD 1TQCB 3SPVA 4RQQB 1MCOH 4FMKA 5I1GL 2EECA 2JJSC 2HT3D 1U8MA 4OGYL 1AFVL 1T66C 1WBZA 2H9GB 2ATKB 3C5ZD 4XWGH 1UCBH 1WT5A 2ITCA 3RIFK 2OR9L 3BH8B 1MAKA 5IROC 3H0TA 4J8RA 2HT4C 2V9QA 3TBYA 4PRPD 3R0NA 1NCDH 3V4PH 3QWQB 2NY0D 5IBLD 3SGJC 1FL5B 4JR9L 1I9RL 1PKQB 3MUGA 3NIFF 2IF7A 4HZLB 4D9RE 3IDJB 3L7FA 3QIWB 2F5BH 4IDJL 2NZIA 4P4KD 2IMMA 5JLZA 2BVYA 2H26B 3WE6B 2NY3D 4YPGA 3BQUA 1WAAE 1SYSA 5BVPL 3IFPA 4NFBA 1LQSR 5ACZB 3ULVL 5ISZB 4JCLA 3Q0HA 4KQ3H 4JZJC 4RBPK 1OB1A 2H9GA 2ATKA 2ICWJ 4PJHE 1JF5A 5FM8A 4XHJC 4KKAD 3BH8A 4KFZC 4XC3L 4Z7VE 3S5LG 4RWYL 3PABB 5I18H 4Z6AT 5IHBA 2X09A 4M1GH 4ODVH 1MFAH 3H9SB 1RJZB 1VEOA 4YHIB 2NLJB 3RGVB 1IJ9A 5TQ0H 1F3DJ 5DMJB 3VRIB 3FO2A 2VDQL 1FL5A 1B0WA 4NCC1 1GAFL 3ZE1E 3IDJA 1XMWA 2XTJE 4XRCB 4DZBA 4L9LB 3QIWA 4OV5B 1M7DB 3NFNB 1OAQL 5IHUH 1FCCA 4GKSA 3W5NA 4CW1A 3MYJB 2H26A 2N7BA 1T4KB 5FCSH 2XT1B 3LIZH 4JFDB 4N1CA 4Y4FC 3WE6A 4LRNH 3ZYOA 5J1AA 4HXBL 1BBDH 15C8L 4JJ5A 5ACZA 2DM7A 2FD6H 5HYIA 1UYWH 1OD7A 1YQVL 4LLWB 4Q9RL 3WNMA 4JM2C 1S7RA 1OGAD 1XGPB 1Z3GL 3FB8B 3PABA 3MRRB 5FK9A 3SKJH 3U6RB 1SBBA 4BKLA 4I4WA 3QWRD 3RZCC 4CNIB 5J6GB 3H9SA 3F7YB 1RIUL 3I02A 4LKXA 2DDQL 4YHIA 2NLJA 5DYOB 4J23A 5E2WL 4WO4A 2XNAB 2YPVL 4X7FC 1U3ZA 4NRXB 1EHNA 1ORSB 3S7GA 5CWSB 5DZOA 2J8HA 3VMNA 1RZJL 5KSBA 5SX4H 3H42H 4L9LA 3QFJB 4NQEE 4J4PC 3TBWB 3T3PF 3HC3L 4KRNA 3HAEA 3MYJA 4KV5E 4K3EH 4Y89A 3GMRB 2P5ED 4Z7WF 2DJUA 4X6BB 3OMZA 2MCPH 3IDNB 1JNNL 4JJHA 1ZV5A 4PJGB 1HHGA 1V8HA 4LLWA 3ZZ1A 2DBLL 3PWVB 5FDWB 3QEUA 2DQEH 4LASL 1TZGL 1XGPA 2R39A 4L4VD 5I1LB 3FB8A 3D85B 3U6RA 5MEOB 1INDL 3AC0A 4CNIA 4GG8B 7FABL 3F7YA 4JPKH 4DUXA 1HILB 2JJSA 4JZJB 3VXRE 4NOFA 2XZAL 2XNAA 1T1YA 3CMGA 4NRXA 1K8DB 1ORSA 3SGEI 4NSKB 5D5MB 3K2UL 5IROA 2CXKA 4DW2H 2IG2L 1CDHA 3S35H 3P0VH 3T77B 3PGDB 25C8L 5DRNA 3TBWA 1KTKE 5I1IL 3IETA 3GMRA 4LLQA 4PJCB 2FGWH 4X6BA 4Z77A 3IVKB 4X80L 4KXZI 4UIMA 1HSBB 4G6JL 2FBOJ 1AGBB 1T0PB 1KGCD 5KVGH 3CZFB 5EOTB 4PJGA 5IWLC 1BVLA 2I25N 2OBGA 2EKJA 5FDWA 1QNZH 3C87A 3L5WB 1JWUB 5AG9A 1RZKC 2NX5E 3WFEL 4Y4FB 5I1LA 3D85A 3RGHA 5MEOA 3RX7A 4HKJB 1OWWA 1X5LA 3L1OL 3O2VH 4P46D 4FQIL 3T4AA 2J6EL 4YQXH 3CSYB 4KK5D 4KQ4H 2G75B 3FMGL 4TUJA 3I84A 4HIJB 1IGFL 2EDFA 2Q7NA 4JM2B 3B43A 4NSKA 4YO0B 3UZEA 2J6EA 2P24B 3HRZB 2EXYC 4HG4K 3T0DA 4UT6L 3GMNB 3GIVB 3T77A 3RZCB 3PGDA 4DQOH 5B22A 1B2WH 3HE7D 5F7WC 1GYAA 1WICA 3KYKH 4PJCA 5T5NF 4G43B 3D39B 1BIIB 2DQIL 5TJWK 1J1XL 5F9JB 3WBDA 2C4XA 1HSBA 3D0VB 2EE3A 4AZ8A 1FBIL 3SKOA 2DD8L 1T5WB 3UBXG 1RUPL 4IS6B 1RZ7L 5BV7C 3L5WA 2HJLB 5GGVH 3ELAT 2Q7YB 4FQJL 1E4WH 4Y4FA 4TVPL 3QJHB 2DM2A 3R06B 5JHDD 4ZOCA 3C60C 3KPPB 3HNVL 4JFYB 3HR5B 4MB3A 3CSYA 3I6LD 1DCLA 2G75A 5J12C 5E9DE 4JM2A 1EERB 4L4TD 4POZD 3GMNA 3RZCA 3RIAF 3A6BH 1QLEH 2WBJC 4LLAA 5SV3A 1P4IH 5IVXB 1S7WB 1PAMA 5IJVB 2YMXH 3BKYL 4G43A 1BIIA 5F9JA 1I8LA 5T1KB 5B3JF 3D0VA 4OLVL 3VXPB 5HVWA 1X7QA 1RQ5A 1BFVH 1T5WA 4NKMB 4IS6A 1DBAH 3AROA 1MQ8A 5CSZB 4J4PA 4U1GC 3QEQA 4P59H 3EFDH 2X4PA 5C0JA 4IMLB 1YUHB 5IBTH 1E4XH 4IM8A 3R06A 2PKDA 1HHKB 4YK4C 3KPPA 2I60H 4FZEL 4PUBL 1NCCL 4JFYA 4P2RB 4K8RD 5B8CC 1QQDA 4U6HB 5DMIH 5TH2A 1X5XA 5F93C 4HBCL 4WFGD 1DVFD 5DVMA 1YJDH 5I9QC 3PWJA 4UMGA 4ZD3L 1CXIA 5E2VH 1A3LL 1EGJL 4GRWH 4R4ND 5KJRH 1GSMA 4YZFF 4NN5C 3F12B 1S7WA 4LCWE 4M02A 4S0SD 5T1KA 2UZYB 1EGJA 1KXTB 1T89C 1G9NL 3VWJA 1CE1L 4RRPA 5IG7B 2GJ6B 3SQBA 4DGYH 4G7VL 2P1YA 4U6VH 5CSZA 3O4LE 3CXHK 5HHMB 4RDQG 2YPLD 1OP5H 5MP6L 4JFED 1YUHA 2X42A 1AO7E 4QO1A 2ED9A 3V0VB 1HHKA 4RIRB 4WV1C 5T3XH 4XMKL 5C9JB 5HI3D 3WFBL 3O9WC 5IWLA 1CQKA 4HWUA 4NQDA 1BD2D 4U6HA 3TZVD 5BV7B 4KDTC 4Z7QE 4O9HL 1NC4A 1H3WM 1WEJH 3C60B 5GRJH 5LWYL 4P2OD 1CDJA 1UA6L 2P8MB 1NGPH 2PW2A 3QNZB 3OSKA 3IJYB 3LEYL 3F12A 2E3VA 1IGJB 4F80A 5J12B 3GSWB 1CZ8H 4JGMA 4U1HB 4MB4A 4TSAH 5F7DB 5SWSB 3VJ6B 5D72H 5E2TH 5I1DB 1WGOA 2IEPA 4WI2A 5CBEB 5IG7A 4FFVD 1CLCA 2EKSB 2E8ZA 5BRZB 4E0RB 1YY9C 4J7RA 2XG5A 3LZFL 5HDLA 1J0HA 1XGQB 2WP3T 3LKOA 5BV7L 1HHHB 5C0DB 1IFHL 5EOCH 1C7TA 4K7FB 4M6AA 2BZDA 4G6FD 4U1GB 3ROOB 3TVMC 3J7HA 3QH3B 4QHLA 5DA4A 5J3HD 5IMLA 1ITCA 2WV3A 1WWAX 4YK4B 3C60A 3BJ91 3GSRB 2VQUA 2DOCA 2P8MA 3UYPA 4FP8L 2QKIA 3QNZA 2H2PC 3SDXF 1IGJA 3PIQB 1BOGA 1KJ3H 2CUHA 4EJ1C 5D7SH 3WSQL 5F7DA 5SWSA 3VJ6A 4KKCC 5I1DA 1FG9C 5I9QB 2EDKA 4UUJB 2R8SL 4E0RA 1DDHB 2WBJA 5GISL 3NBNA 1PX3A 2E7MA 4NN5B 1CS6A 4FABH 4YEFA 1XGQA 4XZUB 1A7NL 1HHHA 4MJ6B 3GRWL 2LVEA 5C0DA 2VLRB 2BHUA 4IRJD 3O11B 4OZ4A 5DRWB 1U8OB 3GRWA 3O8XC 1ZVYA 2JJWA 5DJXB 1JZ3A 3TPUB 2EEAA 1OPGH 3QH3A 3JWDL 1K5NB 4WV1B 2XICA 3GSNH 4CDHA 3GSRA 1AQDB 3P11H 4UBDD 4ZUWB 1CR9L 3O9WB 5B8CA 4M7JL 1VFAB 3PIQA 5T1DH 1UH2A 4NP4L 1EO5A 3NZHL 3B9DA 4MHHG 1R5IB 5GGSA 5DHVB 2X4UB 4E42A 1DQML 1KJ2L 3IU4L 4UUJA 4F37F 1DDHA 3RUGE 2ZSVB 5ESVA 4I3SH 1KJ2A 1DE4B 1UWEL 5JPNB 3HNSL 2ZPKH 2UV3A 4JDTL 5E8PB 3SDYL 2CK0H 2W92A 5IFJA 3DRTB 2UVFA 5J06A 1CGSH 2UWEE 3O11A 1UVQB 2QHRL 5DRWA 2X89A 4AJ0A 4UT9H 1BJMA 3V5DB 2X4QB 3LKPB 5DJXA 3P9MB 1VEMA 2ENYA 5ICZB 3LMJH 3TPUA 1RHHB 1K5NA 3LHPH 1C7SA 1UM5L 1I1RA 4ZUWA 5GZOD 3KAAA 3O9WA 5ITFB 5ADPH 5IB2A 3DVNB 4KDTA 4TSBH 3TVMB 1TVDA 1R5IA 3VRLE 4QCIB 5DHVA 3C8DA 3QDME 4X7CC 2X4UA 4QRQB 5DD3L 3QXTA 4NKIH 2HFGL 4NKOB 4ZTOL 3NCEB 1PY4A 1N6QL 5EIIB 2YPKA 1DE4A 3NTCL 4H8WH 4JLRB 4XI5D 5BVJA 5JPNA 4NQEA 3FQRB 3U0PB 5E8PA 1D5BA 1I7RB 4UINH 5JOEA 1KC5L 3DRTA 2JCCB 4PJIF 2BDNL 3RY5A 3FRUB 3RWJB 1D6VL 3V5DA 3D69B 3NH7H 4NO3A 5FM5O 1XT5A 3P9MA 3RWDB 5ICZA 4Q2ZA 1JI1A 2BJML 5L2KE 3HMXH 4WEUD 5DJCB 1ZLWK 4MWFB 1Y18B 1ZVHA 1A7RL 1DUZB 2FR4B 4UTBL 4WDIB 3STBA 5ITFA 2DLFH 5LGJB 4NJAL 3BSZH 1FNAA 4FQXD 3D0LB 1ED3B 3MMEB 3TVMA 4RFNB 3K1KC 1YYLH 1T2QL 4QCIA 2YEZB 1L7IL 4QRQA 4F15C 2FRGP 3VXRA 4YHKL 1EX0A 4JCMA 4MYWB 4WI3A 5JHLL 1F42A 4JVPA 3BGMB 1OCWL 3D9AL 4JKLA 5EIIA 3O4OB 1VFBA 3DX7B 4JLRA 4JKWA 3HI5L 3S3JA 3TYFB 1MFEL 1VSCA 3U0PA 3RDTD 2QBWA 1I7RA 4O2CB 1CLYL 4X6DE 3EYVB 2ZP0T 5ETUB 4YDJB 3D69A 4KZDH 4OCSL 2DQJH 1TQBC 3K0WA 4BH8B 1LK3L 1QYGL 3RWDA 5IOPB 3ULVF 3X13A 5IMMB 4KVCL 1H0DA 3L3KB 2VDML 2VDKH 5DD6B 4YXKH 5HYQB 1I1CA 4MWFA 1Y18A 2FR4A 5LGJA 4EKXA 3B4NA 2F53B 4FXGB 3D0LA 3O8XA 1ED3A 3TJEH 3MMEA 4EVNB 2FCBA 2YEZA 3CFKB 5B38G 3H3KA 4JRYD 4KROC 1TZHB 3KJ6L 3BGMA 2W9DL 3TBTB 5ADOL 2CO6B 4NWUL 4GKZB 2A6JA 5E6YA 3UTPD 2OTPA 3DX7A 2GHWB 1BVKA 2Y6SC 3TYFA 5IV2B 5EO0B 4O2CA 3RFZC 2D7PA 2AEIT 3EYVA 3M17B 1A7PL 5ETUA 3FFDB 4FFWC 4YDJA 1S5IL 2P4AB 1P7HL 4BH8A 1P7QD 2DB8A 3L3KA 1XH3B 2WINB 4TQEL 1A2YA 5F71A 2A9NH 5D7LB 4EBQL 1YNLH 2F53A 1LO0H 4FXGA 4Q9BA 1ZEAL 4BJLA 1TPXC 3QP3A 2VC2H 5M7QA 3CFKA 3ARDC 4YHZH 5KSBF 2AJUL 5E9DA 5CD5C 4P2QB 3V4UH 1KB9J 2WUCL 3TBTA 1F00I 4GKZA 4MDJB 3TO2B 1AQKH 2F5AL 1SJEB 4G9FE 5EO0A 4F15B 2K3TA 1B88A 2FL5B 1D5ZA 3VXTB 1W72B 3UPCA 3OKEB 4LLMB 3HUJE 3SGDI 3HC0A 3VRJB 4QT5B 4U1SB 1MRDH 4XCEB 4NZDA 1F2QA 3LSOB 4PJBE 5CD3B 2WINA 5CBAB 5IK3B 1S3KL 4LSDA 1QFWH 5CJQL 5D7LA 1OT2A 2NY6C 2QADB 3VDAA 3UJTH 4D9LH 4Y5VC 2FECI 5HYEA 1TQBB 2AEPL 2AI0L 1IBGL 1PLGL 1BX2A 4BA8A 3GHBH 2V7NB 4WUUE 5E94B 1IM9A 4XP5L 2MHAB 4FQPA 4AM0B 4U3XA 4NWTL 5FYLE 3ZKXC 4Y19D 2EDDA 1E4KA 4P2QA 1IEBB 2FX9L 4OIAA 4IRSC 3TBVB 2AJVL 5I73C 3IDGB 1GCFA 2F74A 3TO2A 1NUNB 1HQ4B 1WBYB 1SJEA 2Z93A 1UGNA 5D1XC 2BNUB 4W4OC 1SVCP 1IC4H 4NM4L 2FL5A 1KCKA 4LDOB 1W72A 3VXTA 5ABDE 4LLMA 4KROB 2OP4L 3VRJA 4U1SA 3VGEA 4CN6A 4NNPH 4WFEE 5GJTH 4XCEA 5DXWA 3CVIH 3ZE2E 1R3LB 5CD3A 2ICEB 5EN2A 2BOCB 5IK3A 2RHEA 1DQJB 3D3VD 4OZFH 1VGKB 3FQXA 1JF1B 5HDQH 3PL6C 4PJXF 5DMGC 2E7CA 1YY8B 3KPMB 3CZJA 1KFAH 4UT7H 4J3OC 1CLZH 4AM0A 1G0XA 5GGTH 1OARL 4H25B 3I6KA 4LSQL 1IEBA 2Q20A 3M07A 3PDDA 2BERA 2MPAL 1LE5B 3LPFA 3OAZH 5I75B 4OCWL 4HF5L 4FQ1L 1HQ4A 2LU3A 2Y7QB 3BKML 1TPXB 1V7ML 2BNUA 3BESR 1JCKA 2Q8BH 3KYOB 2KPNA 2OS7A 2ZCLH 1QLRA 1YPZB 3DV6B 4ODBD 4TUKL 3ARDB 4P5MB 3KGRA 4LRIA 5C0AD 5TDOA 5JR1H 3MUZ1 3C9NB 4U1LA 2HJKA 1R3LA 3UO1L 5E1AB 2BOCA 4X99B 2CRMA 2I5YL 4QHKI 3N1MC 1DQJA 4G9DB 4PJ8C 3L3DB 3ARED 3EYOA 4KDVA 4XCFL 4M8QA 1YY8A 1MLCB 3U1SL 4L1DA 2RQ8A 2X1OA 1VACB 4H25A 3RWIB 4XBEL 5FECA 2FWOB 1A4KA 5D7IF 4NYLA 2NY6B 3L5JA 1NCAH 4ZUUA 1LE5A 1JN6B 4Y5VB 3WUWG 4HJJH 4H1LB 1A4JB 4KMQA 4CL7A 5F70A 2Y7QA 5AG8A 1IC1A 3L5IA 4M7ZC 4OD3H 1EHAA 1VFMA 3KYOA 1MI5B 1YPZA 3DV6A 3P77B 4HX1B 4P5MA 3EDFA 1WBXB 2J8UE 1DANT 4LSUL 4KGLA 4IRSB 3CVHL 1CGXA 3HNTH 3C9NA 1H3PL 1MWAL 1EBPA 4YHNB 1WC7B 5E1AA 3VG9C 5D1XB 5GGVY 4X99A 4KJYA 1AKJB 2HLFC 4G9DA 3FB5A 1IAIL 1MWAA 4LEOB 3MOBL 5DI8B 4X9BA 1MLCA 5EORL 4FRWA 4KJWC 3MSPA 1VACA 2XRAH 1F97A 1DBJL 1QHOA 1HEZB 2XZQL 2ZUQC 2ZUYA 3PL6B 1JN6A 2D7NA 3PQYB 2JELH 1I1YB 4J12A 4ZAKA 3TH4T 1MCPL 4AK1A 5HDBF 3P77A 3U0WL 4PGJA 4K7PL 1WBXA 2FO4B 3DXAE 3K8KA 3QDMB 4IRSA 4TRPH 3VFSB 2YD1A 1IEHA 1CDGA 2O5XH 5HXMA 4OF6A 1BEYL 5L8KB 4OB5H 4YHNA 1AD0B 2BFVH 3CU7A 1GGUA 4OT1H 5D1XA 4M1CD 4W4OA 1T83C 1LD9A 4MHHI 1AKJA 2GK0B 2CGRH 4XBPB 2IBGA 2OJZL 1D5IL 3F65A 2PNDA 3OJ2C 1CFQB 5AWNH 1ZE3C 4QXUH 2D0FA 3VGFA 1YMMD 2CIIB 2UWEA 1U93A 4BK5A 4OZFG 4URTB 2CR6A 4MDIB 5CZVH 4NUJB 3AXLA 4P23C 3D2UD 1LK2A 4N0YH 4PJ8B 3ES6B 3PL6A 2XWJB 1UQSB 5EB9A 4ZPVB 1I1YA 3EDKA 4Q9QH 1KG0B 5SWZB 3GBNL 3WEXB 1FZOB 3BHBB 3QB7C 3BW9B 4HUMB 3O45B 1QSFE 1RK0B 2FO4A 3NMEA 4KHXH 3ULVD 4WTWA 2B8OT 3UYOD 3G08A 1I3VA 3QDMA 1G6RB 1F2XK 2XZCH 5CKGA 4ZXBC 3MRCB 1N64H 3BAEL 3TNNA 5F1IB 1AD0A 4JFFE 5JW3L 4M7ZB 1A1OB 4FQQB 4NGHL 3MC0A 4ERSH 1Z9MA 4RGNC 1QBMH 4R8WH 4WWKD 2CJUH 3CFCH 1LP9B 4G8GE 5FCUL 1HINL 3MJ8A 1OVZA 1CFQA 3DMMC 4X6DB 2EC8A 2YWYA 4OGYH 1AFVH 2CIIA 1HYRC 2NW2B 1IGIL 1YEFL 3CXDL 3VG9B 4MDIA 1VA9A 3TV3L 1HN1A 3REWA 2PO6D 3T0ED 2OR9H 5GS0C 4LU5H 3X12B 2EZ0C 3ZDZE 3QWOB 4LCUB 1AR1D 3ES6A 4IJ3C 2XWJA 1UQSA 4ZPVA 4JFOB 3MLWH 5AUMA 5SWZA 5IBUG 1FZOA 1G6RL 3QDHA 3BHBA 3BW9A 5EUOE 5MENB 1J11A 3MLUL 3O45A 3F62A 5IB5B 1I9RH 1C5DB 1RK0A 1A6ZB 1A1NB 4D9QD 2IH3B 3L5XL 1G6RA 4NZUL 4PP1D 5GS2D 1A3RH 4YXHL 1F90L 5C0EB 4IDJH 2RFXB 1OL0A 2CRIA 1MAML 4TULH 4Z78B 4FQQA 4IMKC 5HHOE 4WO4D 4PGBB 3C2SA 4WW1B 3ZYZA 4P3CL 1LP9A 4LBEA 3GHEL 3SDCD 1I3GL 3ULVH 1WAAF 5JORB 4X6DA 4H20L 2ADFH 4GLRI 4DN3L 1M7IB 4E41D 1TCRB 2VDOL 3U48A 3KNBB 4RWYH 4XC3H 4PJHF 4B50A 3D1MC 4LCUA 5FKPB 4Z7VF 1G9MH 3BP7A 4X9IA 4JFOA 4MAUL 1X5JA 2E7LC 3I3BA 5E08L 4IOIB 5ICYB 2VDQH 5IB5A 4I77L 1C5DA 1A6ZA 3G5ZB 4P23B 1A1NA 4PJ7F 4PJ9B 2Y25A 4TSCL 3T2QA 3WIFA 1YC8A 4QTHB 3HLAB 2NR6D 4HQQL 3ZE1F 2OI9B 4RCAA 2QHLA 3HI1B 3CX2A 5C0EA 1MHCB 1T2XA 3BRFA 4QHKJ 2RFXA 4YHMH 2BVQB 2X4TB 4Z78A 1MSPA 2C7UB 4CMMB 4PGBA 4HXBH 1RU9L 2A77H 3WFHA 3IGAB 4OTXH 5A43C 5JORA 4ZXBB 1YQVH 1NGQL 1RD6A 5GS2H 3ZDXE 4KHTH 3DUSB 1NMBL 1CU4L 3MCLL 1ZHLB 1M7IA 4YWGL 1TCRA 3KNBA 4NQXA 1LO4L 2J88L 5IB4B 3H9HB 1Z3GH 5MHSD 1XGUA 2H2SC 4NNYB 3B9VA 3Q5TA 4O02L 4RGNB 5K9OB 5FKPA 2ESVD 1J5OL 1OTTD 1RIUH 3DO7A 2BSSA 4F7MA 3DMMB 2V2WB 3MRBA 4Z9KB 2YPVH 4IOIA 4LF3B 1B6DA 4J3TA 5ICXA 1WWWX 2C3GA 3G5ZA 1Q9OB 3HAEH 5GGQH 4WUUB 5JNYB 2PXYD 1PJ9A 2BVEA 3HLAA 4QTHA 4IJ3B 4EI6B 1SQ2N 4JFZL 4I18B 4UOW1 3WJLC 5DJDB 1MHCA 2EDQA 4U1KB 3WIIH 3HC3H 1S7TB 2IBZX 5KN5B 2BVQA 2X4TA 3DSNA 5F7KC 2GTWB 4KV5F 2QSQA 5KS9B 2GI7A 4G9FA 3LOWA 2C3VB 3MO1B 2HTLD 2PYEE 3HRPA 3IGAA 4F3FA 3HZKB 4ZXBA 5I1KL 4NRYA 3OKMB 3FB7B 3DUSA 2K7QA 2OSLB 1HWGB 1MCWM 4QRPE 5I1CL 2EIBA 1TZGH 4J2XA 4PBVC 4WI4A 3OTTA 1T21B 1INDH 2EYRA 3L6FB 4S1DD 5L8JB 2ERJC 5GS0L 3DMMA 2V2WA 2XZAH 5DVLA 4S1RL 4QRRB 5FYLL 3MUJA 1JK8A 3EO9H 2DMKA 4UU9A 4WUUA 5HYJE 3FFCE 2IG2H 1FL3A 1TFHA 4EI6A 3RBGA 3S88L 1A6UL 1UKTA 25C8H 4HKBB 3RJQB 3GFUA 5KN5A 1WFUA 3OGOE 1K6QH 3RL1B 2GTWA 4X80H 2WIIB 4G6JH 2C3VA 3MO1A 2FEDC 3HZKA 4XAWL 4G3YH 1RFDL 2R15A 1TETL 4H26A 2L4OA 3OKMA 1MCJA 2OSLA 4IOFD 4NCDA 1BBJA 5EU4B 4IMKA 2UZIL 3M8OH 3U4BL 1T21A 2ZZUT 1RZ8B 3P30H 4FQIH 3IFOB 3QJFB 2J6EH 4XX1G 1MVUB 3DPBA 4RX4A 3CU1A 4MAYC 4QRRA 1IGFH 4KKBC 4MCZB 5H35B 1INQB 2FIRT 3QO0B 4HH9A 4UT6H 3WMSA 2HRPL 4BSWA 4QXTB 2E7LA 4XNMA 5C86A 2YD8A 1RMFL 2NY2C 3LY6A 4FOMA 3RRQA 3RL1A 4LOUD 2DQIH 3DRQA 1UXSB 2VLJE 1XAUA 4F58L 3OXRA 3MLVH 2DD8H 4BFEA 1JJUA 4XAKD 4HIXL 1RUPH 1ZHNB 1RZ7H 2KKQA 2J8UB 4HUVA 4XMPL 4KTDL 4PS4H 3C09C 4TVPH 3QXAA 5C0BB 2BMKB 1CFVL 3OXSB 3GKWH 1JP5A 4OZGB 3O3DB 1AGCA 1LO2L 3HNVH 3QJFA 4L1HA 4ZS6D 5T1LB 3VWJD 3S36L 1MVUA 2DWEB 4HUXB 3EO1A 5EOCJ 3O6KL 4X98B 3S37L 3O3BB 3QZWB 5H35A 1JNHB 1INQA 4PRHD 3SJVD 3QO0A 5ERWB 1NCWH 3N1QC 3SDAD 4QXTA 4PLOB 4JDZB 1JGEB 2PR4L 2XWTB 4AENB 2YD3A 1WFTA 4MQXD 3MZGB 3GSUB 2QSVA 3BKYH 1WSST 3LKRB 1UXSA 5I6XC 4UV7L 4BZ1L 4DK3A 1KN2L 3BDYL 4GAYB 4QOKE 2AJ3A 2EICA 3RA7L 1S8DA 1TIUA 3ARGC 3WJLA 3K4DA 2J8UA 5K9KB 1TJHL 4CAGA 5KANI 2X1XR 2OR8A 3QCTH 5E00B 1BQHA 3VGGA 4OZGA 2LVCA 5HGDB 3QPXL 1H15B 2VLKD 3LN4A 4HUXA 4J1UB 3W9EB 4HBCH 4DVRL 4JFPB 4KY1L 3QZWA 5F89A 2AKRB 2HG5B 3OR7B 5HGBB 1S9WB 5ERWA 1NCBL 4N9GB 4JDZA 1JGEA 2XWTA 4ZD3H 1EGJH 5GRXG 3GSUA 4Q9CA 3CDGB 2YUVA 4MAYB 3LKRA 2Y07L 3UX9B 3DYMA 1S5HB 2D31A 2HH0L 1G9NH 3FQTB 4JREC 3O3UN 1SEQL 3ZSSA 1CE1H 4LSRL 1EEYB 4GAYA 4G7YL 1QFHA 3OKKB 5BS0E 3OPZH 4G7VH 1QSFB 4KZEL 3DXAA 2NY2B 3RNKB 1QOKA 5MP6H 4ZUSA 4RFEB 5DO2D 4XVSL 2HKHH 1J8HD 4EQ2A 5FM5M 1I7ZB 4XMKH 1HXYA 3KPOB 1B0GB 3WFBH 2IBZY 5HGDA 3U9PL 4BFIB 1H15A 3T3ME 4J1UA 3K1DA 3AY4C 4M8VA 4JFPA 3VFUA 3C09B 3G5VB 3TN0C 2HG5A 1QFWM 2DKMA 4HV8B 4Z7QF 3OR7A 3KXFE 1S9WA 5HGBA 2UY6A 3KG5A 4D94A 5AD0A 1NAMB 2XOTA 3SOBL 2EH7L 4R7DB 1UA6H 5DVKA 3WFCH 1S7VA 3LEYH 4ELKA 5HI5C 4MAYA 2YRLA 4CMHC 4JQIL 4N5UA 3HC4L 1AY1L 3FRPA 3VFRA 3FQTA 3MUY1 4AIZB 2KUTA 2Y72A 1EEYA 1QP1A 2V5MA 4TOYH 3R4DA 3OKKA 1IZJA 1X5KA 3V5KB 1QSFA 1DQDL 3BRGC 1MFDL 3RNKA 2AXJA 3SBWC 1I9JL 5I6XB 5CINL 5BV7H 1BGXL 3RVVC 1B0GA 2MFNA 4XPAL 2EXWD 5IF0A 2Z31A 5J56B 1T7VA 3ARGB 3ZYJA 1YQ2A 4WTXA 3N1GC 4G8GA 4XVJH 4PRPE 2WMPA 3CSPA 3G5VA 1NBVH 1J1PL 4HV8A 3BGFC 1HQRB 1QSZA 2XTJD 3VXUE 2EDYA 3MV9E 1ZT7B 4HMCA 4R7DA 4FP8H 4PP2B 1E6JL 4ZNEE 2EDNA 4M3JA 3SCMC 1HWHB 4R4BA 1D7FA 3KS0H 2FJHB 3WSQH 3QDGB 1RK1B 2WW8A 5DJ8A 1T0NB 1KYOJ 5HBBA 2LE9A 4Z7UB 2ZKHL 4AIZA 2R8SH 1W2KT 5EUOA 3I75A 3TT1L 4ENEC 3PGFL 2XQBL 5GISH 1GPOL 3W0WB 4NQSB 1HKLL 1T1XB 1UWXK 4GAJL 4DWHA 3VWKD 1A7NH 1NDGB 3QI9D 3GRWH 4LIQE 2QSCL 2YC1B 4N0UB 1OM3H 2MMXA 2Z91B 4G42B 3ARGA 3X3GL 4OFYA 2YD7A 4OQ1A 5HHNB 4MJIE 4XXDB 1OP9A 1J18A 1HQRA 3JWOC 4ETYA 2N1KA 1ZT7A 5I66B 4NQED 5DC0A 5C3LD 2PW1B 4FA8A 5DZLA 5DD0L 4NP4H 2FJHA 1IQDB 1RK1A 1RZGB 3QDGA 3CLFL 1BFOB 3TN0B 2IH1B 3QAZC 5JZ7C 1KJ2H 3IU4H 3EDJA 3C6LC 4X0KB 3S96B 4Y4HC 1QLFB 3ARFC 5KSAC 2W65B 4HHAA 5FO9B 4JN2B 5FA3A 4X6FA 4ODUB 4JO2H 1BQSA 5IGXL 4BUGA 1PEWA 4CMHB 3RUGF 1EUTA 1I75A 1HHIB 4Y2DA 2A73B 1UWEH 1NDGA 4OLYH 3GI8H 5KG9A 3QCVL 4XNXL 1MCHA 3SDYH 35C8H 12E8L 4OF7A 1NLBL 3ZKNC 3VFOB 3VXRD 1CXKA 4N0UA 4BM7A 4G42A 5DJAB 2QHRH 5EZLB 2OCFD 2UWEF 3HI6H 1U8PA 2NXYC 3FQWB 3KPSD 4XXDA 5D71L 4R2GD 2DLHA 3LS5L 1MCFA 4P5TC 1U6AL 1AGEB 1L9MA 2PW1A 2BCKB 5DHVH 3WLWD 3MFGB 4MQSB 1X6NA 4ORGA 2VAAB 3AY4A 5EC2B 1CF8L 1MCQA 3CFDB 4E5XB 1MCKA 2NQCA 3EGSB 1XF2B 2IH1A 5D9SB 1EK3A 3MGOB 5DD3H 3MLPA 4HWEL 2HFGH 3AS1A 4X0KA 3S96A 3MGAA 1QLFA 2DQTH 2W65A 4HW6A 1IAKA 1WTGT 2NX5D 4JN2A 5FO9A 3ULUD 1N6QH 5D1QD 3SCMB 3K3QA 3V95A 2OMNA 3EIFA 3NTCH 3AM8C 2A73A 2BY2A 3VFOA 3F6LA 5DJAA 2BDNH 5EZLA 1D6VH 4C4KT 3IF1B 1AGFB 5DD1H 2HWZL 3BD4A 3FQWA 3SBWA 5DUMH 2BJMH 3N85H 3EJYD 4M9PA 2FZ3A 1OAUL 3VI4E 1Z0NA 2G5BB 7CGTA 1A7RH 4UTBH 4PRNB 1AGEA 3IS1X 4NJAH 1KPUB 3L3GB 2VAAA 5EC2A 3W11C 3CFDA 4E5XA 4EN3B 3DVGB 4JPIB 1L7IH 2E9BA 1XF2A 3OKLB 1CK0H 4HDIA 3BN9D 3MGOA 5D9SA 3V6ZA 4I9WE 4YHKH 1SM3L 4JRWA 2EH8L 2J3SA 5EBGA 5KVEH 5JHLH 1XFPA 2B1AL 3EHBD 2P7TA 1FYTE 4KJQD 2DIJA 3D9AH 5FB8B 3SCMA 4OBRA 5HPMB 3FFCA 3DSFL 5HYJA 4V1DE 4U7SA 2IGFL 5T3ZE 1WIUA 1MFEH 4PJAE 3QAZB 1CLYH 5KTEH 4PYHA 1Q0XH 3C6LB 4Y4HB 3AAZB 3ARFB 1J0YA 5KSAB 5E9DD 1AGFA 1UM6H 1LK3H 3MCKB 4HWNA 3SE3C 2VDMH 4LGSB 5C09B 1J88A 3LKQB 5MERB 2G5BA 4BK4A 3RVUC 3G6JF 4LLVB 5EOQL 5I76B 4P2CG 3L3GA 1TCMA 4G80B 3WHE1 1XGTB 3IYLW 1XEDA 3DVGA 1QFUH 3OKLA 1V3MA 1ZTXH 1KCSL 3BRDA 2DIAA 2GK2A 4P5TB 3QNYB 2EDBA 3KJ6H 4W70A 3U4EB 5ADOH 1ITBB 2ID5A 5HPMA 4DUVA 4KJPC 3QRGL 5FHAL 1MRCL 5TF0A 1EFXD 4KKLC 4LQFL 4QXGL 5DJ2A 3NABL 2HT3C 4Y4HA 3AAZA 3ARFA 5KSAA 2VLJA 1S5IH 4WHTB 3C5ZC 4KTEH 4QTIL 1CBVH 2GY5A 3MCKA 1IQWH 2J8OA 3I6LE 4C56D 1XCTB 4POYA 3QDJB 1DN2A 4OGXH 3TA3A 4TQEH 4XP1L 1ZOXA 4WTZA 1YEGH 4L4TE 4EBQH 4I48B 3MRPB 4UI2A 1F4WL 4F7CA 2NY0C 4LCWD 4CUCA 5I76A 5IBLC 5L7XL 3L9RB 4PJDB 1NCTA 1ZEAH 2XA3A 1C5BL 4G80A 1XGTA 1ZGLP 1IRAY 1XIWD 3RKDD 1GOGA 3QNYA 1Q0YH 5B39B 2AJUH 4M61B 4NKDA 3O4LD 2KBGA 4P4KC 3P3YA 5GGUB 1U58B 2CDGB 2APBA 1AO7D 3RVWD 2F5AH 2NY3C 4G5ZL 4RMQA 2DLEA 1AGDB 2OZ4L 2CDFB 1U8QB 5C08D 3RY4A 1DLFL 2VZ1A 1JGLL 5IB3B 2A9ML 3HUJF 3PNWB 4WHTA 2YRPA 4WCYH 3LKSB 2JJUA 4OQTL 4KKAC 3O2DL 1I8MB 5INDA 4QOKA 3VXME 2RR3A 4GG6B 1J0ZA 4TNVK 1CGVA 2PF6A 4PJBF 4OQTA 3FOMA 1S3KH 4I48A 1T3FB 3IDXL 4RWHA 3L9RA 5I15H 2AEPH 2AI0H 2VZ3A 1IBGH 2NZ9D 4WW2A 4PJ5B 4NC2B 1KIRA 1VADB 4XP5H 1F11B 5HGAB 1N2RB 4NWTH 4UZGA 5HDOA 4M61A 4JFHE 1JZ7A 1LWRA 2FX9H 3QIUD 3EOYG 1CGTA 2P46B 3NCJL 5BQ7B 2CDGA 3F58H 5IP4A 1R3JA 3QHZL 4XH2A 2R0LL 3CC5A 4NM4H 4MZ3A 1HHJA 2YPLE 1U8QA 5B4MD 5DFVD 5IB3A 5J11C 2PTUA 3PNWA 3LKSA 3KPRE 4FHBD 2GAZB 4X8XA 3T04D 4FXLA 2AP2A 2AGJL 3ZE2F 5D1ZD 5E8DH 2VZVA 1T3FA 4BELD 5KVMC 3NPSC 4P48A 3GSOB 3C5ZB 4FTVE 5HHPB 4NCC2 1CDYA 2RB8A 4PJ5A 4U6YA 3SE3A 1VADA 4LNRB 5L2JB 5HGAA 1OARH 3FO1B 2FIKA 4PRPB 5DMKA 4RFOL 3I50L 1FNSL 2NY0B 3KLSA 2MPAH 5BQ7A 1IAMA 1NANH 4OCWH 4R9HA 3OKYA 2ZCKL 1V5JA 3BKMH 3E3QC 1V7MH 2R0WL 1JHKH 3HMWH 4TUKH 2XN9E 1GZPB 2YXFA 5J89A 4P4KB 3ZYIA 4I8DA 1E28A 4MJ4A 1F13A 2GAZA 2NY3B 1RIVL 3TT3H 2V17L 2X40A 4ZAKD 4PRBA 2P8PA 1JZ4A 4QRSB 3MZTA 1TZIA 2AXHA 4LQ1A 4NO2A 3GSOA 2A1WL 3DX8A 1AE6H 1T7YA 5HHPA 5L2JA 4N8CL 3FO1A 4M6NL 4PRPA 3SE4C 1KACB 3MLRL 2X9YA 4HFUL 4LAQL 4NQCD 3BOVA 3JWNC 1MJ8L 3CFJB 1CDIA 4ZNEA 5FM4A 1QHPA 4GSDH 1DJSA 1OAXH 4MMXC 1M71B 2W60A 3RJDA 1MWAH 1FIGL 4WU5B 1FG2B 1NBZB 1WF5A 3BEVB 4P46C 3UAJD 3WN5C 4LIQL 5D5MF 3G5YA 5AAMA 1NMAH 3MNZB 4GKOA 1IAIH 4KK5C 1KTRL 1UB6B 1BREA 4QRSA 4H0IA 5J11B 1JHLH 5BJTB 3SKNA 5I1EL 4ZFGL 2V5TA 1OGAB 5EIQA 4C55A 3TO4D 3NA4A 4YHPA 5IT2L 3U36B 2GW5A 1DBJH 3MRNB 4MJIA 3HE7C 2XZQH 5BO1H 4NBYB 4EOWL 3NPSB 3W5MA 1CL7I 2ZSWA 4XCNB 2ZCHH 3TNMB 2EE6A 1EV2E 4N68A 3CFJA 1EJOL 1IL1B 4I13B 2WP3O 4YAQB 3U0WH 4U1IA 1F3JB 4EI5C 2VN4A 1FLTX 4OIBA 5CCKL 3M1BB 1M71A 1YJDC 2P5EB 5L2KD 2OTUB 4PRIE 4U7MA 4G6KL 3LQAC 3BEVA 2C3WA 4LLYB 3MR9B 3H3PL 3NCFB 3U7WL 1NFKA 3MNZA 2C3HA 1LO5B 1TTGA 5E6ZA 4XC1L 2OJZH 1R0AL 3FHQA 1OGAA 4L4VB 4CU6A 4POZC 4KI5E 5ID1B 5KVFL 1PD6A 3QWRA 5IEKA 3U4AA 1PEZA 2RBLA 3MRNA 4NZTL 1D5XA 3RWHA 4HKZA 2J4WH 2R1XB 5HYSA 2P8LB 1UB5B 4XCNA 5EZJB 1YEDB 4U1NB 3GBNH 2K1MA 1FE8L 5I16A 1Q72L 4ONFL 4YAQA 1SMOA 4LLDB 4DKEH 2IAMD 3CDCA 4EDXB 4OCRL 1ES0B 5I0DA 1YC7A 5C71A 1NGXB 2P5EA 4OFDA 2OTUA 3Q2CA 3BAEH 5DRZA 3U2SB 1CFNB 2VUYA 2Y4SA 4DJMA 3QA3B 1U8KA 1CWVA 4HFWA 1ZHKB 2IBBA 4HJ0D 4LLYA 4NGHH 1FV1A 4LPXA 4K8RC 5FCUH 4U49A 1HINH 3STLB 4L4VA 1DVFC 3V5HB 1IGIH 2NPLX 4EIZC 2VDLL 3CXDH 1HCFX 4GQPH 2EEDA 4P46B 3TV3H 3VGDA 3WN5B 5FUZH 4M4RA 5FHBL 4N5ED 2CXGA 2R1XA 2B39A 2F58L 3ZDZF 1N6VA 3V4VH 3HB3D 5EZJA 5F7UA 43CAB 4U1NA 3RPIB 1QVOB 2E8YA 1G6RH 1FN4B 1GGIL 2VDPL 4KH2A 4LLDA 3AS3A 5E8NB 5EUOF 4EDXA 1ZANL 5IEHB 4J3SA 3HE7B 1ES0A 1MFBL 4NZUH 3PP4L 4P9ML 4YXHH 4LCCC 3MV7E 5T3ZL 3EOBB 3N1FC 1CFNA 1OSZB 4U0QB 5CEZD 3ZO0A 2VXUL 1T04A 1CXEA 2Y23A 5HI3C 3L3IA 5CJ5A 2VIRB 4EI5B 3TZVC 4P3CH 3ULSB 1TTUA 3GK8L 5SV4A 1I3GH 3STLA 3VG0H 3D87B 1MIEL 4HIEB 3V5HA 4DN3H 5JHDB 4PG9A 4P46A 2VDOH 3WN5A 1Q8MA 4P2OC 4GRWB 2ICWA 5F7LB 1JNLL 4U3HA 5E2UL 3V79C 4GUPB 3O81A 4JRYE 1QBBA 3U7AA 4H1LG 2Z4QA 3NN8B 3RPIA 2C9AA 4H5SB 1FN4A 1ADQL 4UILH 3UTPE 4FFVC 5A3ID 4I77H 5C0IA 5E8NA 5ACMA 4PY7A 2IPUG 2I07B 3FN0L 4TSCH 1ADQA 4HQQH 5C07D 4O58L 1F4XL 3EOBA 4FZ8H 1KJMB 1OSZA 5FUOL 1A6WH 4O5LH 2VIRA 5FF6B 3ULSA 3LQAL 4OLEA 1ZLVH 2Q76B 4HIEA 2AV7A 1NGQH 5FYLD 1CU4H 3MCLH 5J3HC 5JHDA 5TE6L 4YWGH 2ZWLT 1HK6A 5IFHL 1LO4H 1J5OH 4GUPA 1KLGA 5GQBA 3NN8A 5GGSY 4L4TA 5IW1B 3X11A 1DVFB 3IAGC 1IC5L 2Z8SA 4WHCA 5FYJE 2YKLH 4X6CE 4Y16A 2NY1D 1RUAL 1QR1A 3IXTB 4HK3J 1S7XB 1Z5LB 3DYOA 1KJMA 3AS0A 5FOBA 2DL9A 3SDDD 2VZSA 1PGRB 1HZHL 1J86A 4IRJC 1RUML 2J5LC 2VABB 4JFDD 4JG1L 3ILQD 3UTTB 1ZMYA 2YPLB 3OAYH 4JFEB 5I1KH 4HCRL 4LCCB 3VFPA 1AIFB 5I1CH 4X4MA 4CADB 1G7JB 1MNUL 1BWWA 3WXWL 4UBDC 5FYKU 4HCRA 4MA1C 4X4YB 2IALB 1BD2B 4ZOBA 3TZVB 4H8WC 4WEBL 1DUYB 1D5MB 2IFFL 4ELME 1ACZA 5GS0H 5IW1A 2AQ2A 1DVFA 1YNKL 2L0DA 3BZ4B 4PGDB 2V2XA 3QG6B 3T8XB 4P2OB 2HT2D 4QGTA 3IXTA 2SEBB 1S7XA 1B4JL 3S88H 1A6UH 3QUXB 5H94B 4LDEB 3HPLA 1OGTB 4MCYA 5F7HA 4HS3B 4DUWA 3QFJD 4TTDD 3OV6A 5F7YC 1OTUD 5IW3A 2VABA 1FO0L 1H5BB 2J1KA 2IADB 2YPLA 1TETH 4JFEA 3EJZD 5F1KC 2ARWA 3VXSB 2DQFB 1JIBA 4LCCA 1AIFA 4OM1L 5TFSL 4KUZH 1FO0A 1Y0LB 3KPRA 5GZOC 4X4YA 3U4BH 1UKQA 1P4LA 2IALA 3TZVA 1EXUB 2YZ8A 2FYYB 2BXZA 3V8CA 1IARB 4YDIH 3ISWA 1U3YA 4DGVL 5KAQG 4YDLC 4PGDA 1F6AA 2C1PA 5EFIB 5C0FB 1JRHI 4P2OA 2JB6A 4FTVA 1FVEB 2VR4A 3I6GA 2BK8A 1TENA 2YRZA 2HRPH 4XI5C 2EDJA 4S10A 2DQCL 2WK2A 1OGTA 1RMFH 1KLFA 3BWAB 1N3NB 5F88B 4HS3A 5CKAA 5TDNA 5LXGL 3ZT7A 2EYTA 2DI9A 1J0KA 4F58H 1QBLL 1LE9B 1T80A 1NFIB 2IADA 1ZT4B 1DBML 1S7QB 4RGMB 1KLUB 2XN9A 4K9EC 4NPYB 4XMPH 4KTDH 2I9LB 4NRZB 5LGKA 4M62H 4DCQB 2VOTA 2WBWB 3FONB 5JW4M 1NGZA 1Q38A 4IRJB 4ZG1A 1N4XL 4FQXC 4FXKA 2J5LB 2W1NA 2GSIB 3KHQA 1FPTL 5DJ0B 1BP3B 2QR0B 5DFTA 1GC1L 3S36H 4KVNL 1T22A 3SE8H 5IHZB 5JDSB 2R69L 2X7LB 4M48L 3O6KH 4LP4A 5EFIA 3S37H 5C0FA 1NBQA 2XY2A 3B2VL 4WGWB 4AEHL 3DXAD 1FVEA 4MA1B 4Z7WB 2G2RB 3ZTJH 3BGAA 2PR4H 2ZJSH 1FNHA 1QRNE 2BOBB 5JOFB 4WI7A 1C5CL 1MJUL 3BWAA 5F88A 3PWNB 1HXMB 5CZXC 3G6DL 5I17B 2DRUA 5TGBB 1WCBB 3IB4A 3CH8A 1JMZA 2WQRA 1N5YL 4GAFB 1KN2H 3D39D 1NFIA 5DHYB 3BDYH 3VFMB 1LE9A 1S7QA 3RA7H 3IRPX 4AT6B 1TJHH 3KPNB 4TNVF 4NPYA 3JZ7A 2E9IA 3IFNL 2I9LA 4NRZA 3RU8H 4DCQA 2BNRE 4MA3B 2HLAB 3FONA 3LS4L 2CLRB 2PTVA 2VWEE 2ZOKB 1O7VA 3JTSB 5ITBL 2QR0A 3QPXH 4PYGA 4WW2F 4K7PX 2OTWB 3UEZA 4DVRH 2AW2A 2AK1L 2GT9B 5E5MB 2G2RA 3P4MB 1KPVB 1MHEB 1B6UA 4JFFD 1L6XA 3MRGB 2BOBA 1IMHC 3O3AA 5HVHC 5T1MB 3TP4A 4L3AA 2Z31D 4YDLB 1HXMA 2FEEI 1WZ1L 4D0DB 5I17A 2Y07H 4NZRL 1XGRB 2HH0H 1ZA6A 5HI4D 4IRZH 1X6LA 5D96C 5DHYA 3A67L 2XKUA 5FUCE 4AT6A 4XP9L 2MKWA 2X9WA 4KZEH 2QQKL 4MA3A 2HLAA 1MRFL 4PRIA 3BZDA 2CO7B 3DUUB 1NEZB 3AVEA 3T4YB 3JTSA 2BRRL 1O5DT 2VRAA 1TJIL 3GJEB 2OTWA 3T3MF 2D9QB 5DSCB 1CVSC 1VHPA 4G8FA 4CDGC 2NTSP 3FT3B 1EMTH 3P4MA 1KPVA 4FQXB 2KQNA 1RULL 2EDLA 3M45A 2EH7H 3MLTB 4OJFH 4JZNB 3VMPA 3QG7L 1U8IB 1NUFA 4Y2OA 5T1MA 5HHOD 5EU7E 5ACLA 2JB5L 4JQIH 1TLKA 1XGRA 3HC4H 2L7UA 4M7KH 5BMFL 3L7EA 2R29H 2EXYD 1DQDH 4L3EE 4AEIH 1MFDH 5E5UB 2GJ6D 4JO1L 1QSEE 1I9JH 5CINH 2NXZD 4HLJA 3T0EE 4XPAH 3GJEA 2AEQL 3VXNB 1ACYL 2O61B 5DRXB 1J1PH 2DWDB 4I3RH 2X10A 4Y2DD 4K2UL 4FQXA 2YA1A 3MLTA 4F2MA 1AXSB 4HWBA 1KF9B 1MVFA 4JZNA 3BP4B 1E6JH 2G60H 3DECA 3FKUS 4R26L 1UJ3B 1IKFH 1FVDB 4DFIA 2B0SL 3FAWA 3ZTJG 2WZPD 4TPRL 1I9IL 3OKNB 2HN7B 3NIDF 1UWXH 2B20A 2ZKHH 2D0GA 4ZMAT 3TT1H 3PGFH 2XQBH 1GPOH 1LDPL 2XKNB 4JRXD 4QRTB 5HVHB 3RDTA 4WNQA 4RISH 1F02I 3BYYA 5BRZD 2W0PA 3FOLB 4GAJH 1LEGB 1F8TH 3VH8B 2QSTA 2QL1A 4E41E 5C1MB 1JPGB 1NKOA 1P7QB 4K3JH 5D96B 1QO3A 1ZHBB 3HZMB 3X3GH 2DYPD 2WWMD 5DRXA 2DWDA 3LEXB 2IWGA 5FO7A 2BNQE 3TWCL 1J8KA 1AXSA 1MJ7L 1NSNL 4WI5A 4ZFOB 5E7FA 4X5XB 5DD0H 4S1SH 1JPFA 4JRYA 3CLFH 3OKNA 4TTGA 2HN7A 2PYED 4X6EA 1GGCL 3GMPA 1KT2A 4Z0BL 1U2HA 4QRPD 2XKNA 3V2AR 1G1CA 4QRTA 1BZ7B 4HMDA 2AV1B 2XIDA 1YN6B 4FQCL 3LB6D 3HKFA 3VH8A 1N7ML 1MFCL 2Z0BA 3QCVH 3AREC 4XNXH 5D70L 5C2BL 1JPGA 4HS8L 4XCCH 1BLNB 12E8H 1NLBH 4JY5H 2KZWA 1P7QA 5FAAA 3UTQB 1KXQE 4NO5A 3F7RA 3UYRH 1ZA3A 3HZMA 1R3HB 4DAGL 1MCDA 1BFTA 2ESVE 4UB0H 5D71H 5IJKC 4XVUD 3FFCD 2JLLA 5HYJD 1XF3B 1IAIM 5F1NA 3LS5H 4NBZB 4NN7C 1U6AH 5CGYD 3CIQA 4HUUB 4PV9B 1ZSDA 4X5XA 3Q6FA 2OXHA 1CF8H 2GUOB 4Y19B 5FYJL 1KCVL 4ODWB 1V7NL 3FRPG 4WRLA 4MQ7B 5DUBA 2Q86B 4HWEH 4PJXE 3EKCA 4K7PY 4X6CA 1BZ7A 2AV1A 5DTFB 3NCCB 1U8JB 1YN6A 1OQXA 3B5HA 4GW1B 4DOHE 1INEL 1WJ3A 2BVTA 1PVHA 3PP3K 4PTUA 1BLNA 1ODAA 4C57C 4NKQB 3WS6C 3G04B 4ACPA 3Q3GB 3VXOA 1R3HA 1A7QH 4GAGL 1P53A 1Q94A 3DTXB 2VWEC 3QQ4B 5CEXB 1YYML 3SDXB 3WL9A 3D3VB 1XF3A 3ILPB 4JN1L 1OAUH 1IZKA 8FABA 2F15A 1KN4H 3P4OB 4HUUA 4PV9A 4XVTL 3VI4F 5H37H 1JFQH 4OI7A 1KTLB 3MLZL 2R9HD 2GUOA 2VLJD 4H0HB 4ELMA 4ODWA 1VFUA 3T65A 4XP6L 1IC7H 3MJ9A 4MQ7A 1SM3H 2Q86A 3MV8E 2B1AH 3TA3D 2BY3A 4M1CC 2XPGB 1PQZA 5DTFA 5EBWB 4WI6A 2MKLC 1U8JA 4GS7C 3NCYP 2IGFH 1DLHB 4XXCC 2X6MA 5C0AB 3SO3C 3VCLA 2AK4E 5DDHB 4HC1L 3QQ3B 4BYHA 4GW5B 4JGUA 4PJAF 3G04A 4ZFFA 2XWBB 3BIKB 3Q3GA 3O6ML 4F7TA 3QQ4A 5TE4L 4HC1A 1BF8A 3CPLB 4PJEE 5CEXA 1PBYA 3MACL 3OZ9L 5A16B 5DVNA 3T09A 3AREB 1HOCB 3ILPA 2O5YL 1JPST 3UJIH 3P4OA 4KK9D 1EIBA 5E1HB 3EFFB 3JBG7 5EOQH 4LFHD 1KTLA 5E0QA 3QHFL 2L7JA 1RUQH 4UV4L 3RAJL 4UAOC 2JJTC 3MRHB 5IR1B 1IGCH 3ULVC 4QNPE 5EBMB 4L8BB 1N6UA 1DQLL 1KCSH 3F7VB 1YEEL 4NN7B 4QOKD 1HI6B 4CKVX 1U91B 4BFBD 3IDMB 2XPGA 1JTTA 5JXAH 4OAWB 1TJGH 5SWQB 1DLHA 1MRCH 2MJWA 5FHAH 4WWKC 3GO1L 5C0AA 3V6OE 5E7BA 2Q87A 4LQFH 1XGYH 5DDHA 3QQ3A 4QXGH 1C1EH 4GW5A 3NABH 2XWBA 3BIKA 3DURA 1G7PB 4PR5B 2DKSA 4QXWA 4QTIH 3MLYL 5FKAA 3CPLA 3RWFA 2PO6C 5I1HL 2IANE 5HDBE 1OLLA 2E6JA 5A16A 3BO8A 1AR1C 1T0MB 3AREA 1HOCA 4PJFF 5DGQA 3VFTB 5D6CB 5J13C 2OLDA 4ZUVB 2BVOA 1QFPA 3EFFA 2A83B 3IDUA 3ET9F 2O5ZH 1AC6A 4AEEA 3ME0A 1C5BH 3WFZA 5IR1A 1U9KA 5EBMA 3F7VA 3QO1A 5JW5B 3P0YL 4PP1C 2EE2A 1OW0C 5BS0D 1HI6A 3EAKA 4JO3H 1MFNA 4M5YL 2VN7A 3IKCA 1I8IA 3IDMA 3SPVB 3QUMB 1IEAB 4PJIB 2VKWA 3NZ8A 1QEWB 3NGBC 1A7OL 4JZOA 1KB9K 1LEIB 4WO4C 2YUZA 5CUSH 1IT9L 1QRNA 1RZFL 3SDCC 2EIEA 4IDLA 1FRGL 4NNXA 1DLFH 2Y1VA 1DFBL 1G7PA 4J8RB 1JGLH 4PR5A 2MSPA 4AG4H 3OX8A 4OQTH 5ANME 2ZG1A 3O2DH 5GJSH 1RZJC 3KXFD 3QR2A 5C6PB 4KUCF 2I27N 5JQ6H 1WCQA 1EAPB 2DN7A 3WS6A 2A2QT 1YMMB 2WQ8A 2A83A 5TPWH 4DFHA 2FO1A 3FT4B 2XG4A 4MNGE 4MSWB 3D2UB 3QUML 2B1HL 4WFHE 4APQD 4GO6B 2NR6C 4YPGB 3GMMB 4LCIL 1SVZA 2CH8A 1CGYA 1GJIA 4OM0L 3QUMA 1IEAA 4PJIA 3WS3B 1QEWA 1FGNL 1LEIA 1OB1B 4Z7OE 4JKKA 4UAOB 1BMGA 2R0LH 3B2UD 3PDGA 5DQDL 3U9UB 3GNML 1EO7A 3B6SB 5ESAB 1UZ6E 5IESL 2IQ9L 3CGTA 3QUZD 1J8HE 3C2AL 1KEML 2X4SB 4ODHL 3E6FB 3FO2B 3VXUD 4UDUA 4XXCA 3MV9D 2BSTB 3BKJL 3FO0L 1HNFA 4OCNC 1EAPA 5MEQB 1OTTC 1Y6KR 4M6MH 1YMMA 4DZBB 3NPZB 4OCYL 1NAKL 3FT4A 4GKSB 2PO6B 1A22B 4CW1B 4MSWA 3D2UA 2QADD 3K8LA 4Y8DC 4PLJD 1ZT1A 1N59A 5J1AB 5DA0B 3GMMA 1FH5L 4JJ5B 2F54D 5J13B 2FBJL 3BDXA 3I50H 1FNSH 3WS3A 5JW4N 2LU4A 1O0VA 1S78D 5D6DA 2ZCKH 2JJTA 1E27B 4PB9L 1S7RB 3U9UA 2HTLC 3N9GL 2VXQL 3B6SA 5ESAA 4FQ2H 3MRFA 2XQYG 3FL7A 5FK9B 2AABL 4I4WB 1OQOA 4BKLB 5F3HA 1HIMH 4NUGH 3I02B 4LKXB 3MA9L 4MJID 2X4SA 1A6TA 1XR9B 5D2LE 3E6FA 4WO4B 3CLEH 2W0FB 3B3IA 2E6QA 3RQ3A 4WWKA 4PJ7E 2BSTA 1RIVH 3WFDH 4S1DC 3W2DL 3MODL 4IOSD 5MEQA 1YDPB 4HWZB 2W9LA 3H8NA 3I9GL 5IB1A 1QACA 1QSEA 4TUOA 5KSBB 2IMNA 3T2NH 1FC2D 1A7BA 3GJFK 4E41B 1U3JA 1MCOL 2X44D 2PO6A 4KPHL 4P2YA 3HAEB 3T0EA 3OKOB 3PE9A 1EEZA 3IT8D 1A47A 3BD3A 4XWGL 1UCBL 4N8CH 1HH9A 2BY1A 4PREB 3IJSA 4ZODA 4QRUB 3HZYB 4JHWL 1VGEH 1H3VA 1MJJA 3DUHA 1HHGB 4HFUH 4LAQH 3QEUB 3V4PL 4OLWL 1J7VR 1IVLA 1E27A 1MJ8H 4ODSL 3MNWB 3DI2B 1I3UA 1IGYA 1OW0A 1G1YA 1I9EA 2D9CA 3GM8A 1XR9A 2CMRL 3ARDD 3ZDYE 5CD5D 2W0FA 1T1YB 1FIGH 1I8LC 1YEHL 4I3GA 3SDCA 1YDPA 4HWZA 4LIQH 3MXWL 3ZTNL 4Z95L 3LEVL 1KIPA 5E70A 2B4CC 4E41A 5DRNB 4ZFGH 1AHWC 5GIRA 3OKOA 3OGCB 3IETB 4LLQB 4HUNB 2ESVB 5DR5H 5IT2H 4Z77B 4QKXB 4UIMB 2HVJB 4PREA 5B39G 5D4QA 4QRUA 4YHOL 3HZYA 5L88L 2W38A 3QNXA 1BVLB 1VEPA 4EOWH 5JOPE 4LOUC 4CJ1A 2R2CA 5TQ0L 4X83A 3MNWA 4P57A 1SEBA 5IHLB 3T4AB 1Z9SA 5CCKH 5DZNA 2P5WD 4PJXB 1FDLL 4TUJB 4Y1AE 3PUCA 5K33A 1AJ7L 2KQMA 3KPSE 1URLA 3FT2B 4JQXC 4LRNL 4ZS6C 3H3PH 1XF5A 3VWJC 1BBDL 4XPGL 2CUMA 4XC1H 2V7HA 1BZ9A 4NC1C 4YIQA 1SBSH 3AMKA 1G9NC 3OGCA 4I9WD 1VFOA 2ESVA 3SDAC 5KVFH 4M7LH 2HVJA 4KI5F 1FYTD 4NZTH 1I1FB 4MJ2A 3SKOB 3SKJL 2BC4B 3DO3A 3WD5L 4V1DD 1JPTH 2H1PH 5T3ZD 3B9KD 2HJFB 4I1NB 3ULUE 4O4YH 1FE8H 1KNOA 3PQYD 4ODXA 2PXYA 1Q72H 1NFDE 4KRLB 1T03L 4U0RC 3EZ8A 5E5RB 3K4ZA 3C5SA 4PJXA 4I0PA 3MJ7A 4X7SH 5KSUA 2FECL 3FT2A 2MCPL 3VW3L 5D7IB 2MCG1 3V0WH 2COQA 2E5EA 3PHOB 5DK2B 3MOQA 2ATPA 3IDIB 5JQHC 3ARRA 4Y0GA 2W9EL 1A9BA 1SY6L 5T33L 5FHBH 1I1FA 1X7QB 2BC4A 3EOTH 1L7TH 3K81A 2F58H 4HAFA 3WKNA 1AHWB 1SY6A 3QEQB 2HJFA 2X4PB 5C0JB 1C8PA 2VDPH 2DTML 3B5TA 5BZDA 5CMAA 4KAQL 1ZANH 1MFBH 4DW2L 3VXQB 3MRJB 1G7MB 2Q8AH 2ADJB 1K8IB 1M1SA 1QQDB 1NBYB 3PP4H 5DO2C 4P9MH 5TH2B 4YFEA 4MA8L 4M3KB 1QG3A 2VXUH 3PWJB 4YDKL 1FL6A 3BDBA 3GDBA 4Y16D 3GK8H 4PGCB 5D7IA 1S7SA 5DK2A 3PHOA 1UH4A 3KPTA 1MIEH 3MXVL 3IDIA 2R2HA 2B4CL 3DETD 3VWJB 4HKXB 4JDVA 1JNLH 3O2VL 2OL3B 5I1AA 2EC9U 1AHWA 4YQXL 2DLGA 2FJFB 4PRHB 3SJVB 1ADQH 3SDAB 4LMQE 4X4ZA 4I0KA 3FN0H 4UOW0 3VXQA 3MRJA 1G7MA 4KUCD 5ENWB 3B8YA 2ADJA 1K8IA 5MEND 1VKXB 3W81A 4NQDB 3VXMD 4DQOL 1U41A 4XNYH 1NBYA 3JWDC 4ZO7A 1Q1JL 1T5XB 4C4KO 5TF1L 5FUOH 1NC4B 2EXWC 1CIDA 4O51B 4C56E 5JXED 3F5WB 2FGZA 1U8HB 4U0RB 2VXTL 2H6PA 5ALCL 3LQAH 1R5VA 4PGCA 4GOSA 2AJYH 2PW2B 1YZZA 4IIQC 4X9GA 4F57L 2XTJC 2OL3L 5TE6H 3QIBD 5IFHH 4JQXA 4U7KA 5LQBL 2IANA 4JFHD 4KKNA 2VLKB 4HKXA 2OL3A 1CIUA 4Y4KD 2FJFA 5I71C 2Q6WB 4PRHA 3SJVA 4J3WA 3SDAA 3VA2C 3LKOB 2DI7A 3HG1D 3MRLA 1JHTB 1RUAH 4X6CF 5GGRB 3KPRD 3J8F7 5ENWA 1UADC 4ZPTB 1VKXA 5C08E 3A6BL 4P23D 2X2YA 4PJ9D 1T5XA 3VWKC 3QI9C 2UYLB 4KRPD 5TE7H 2R2EA 4O51A 4QHLB 3F5WA 2EDHA 5IMLB 1U8HA 2BHZA 4W81A 4EQ3A 2HFEA 1RUMH 4FTVD 2QKIB 4RA3A 4HCRH 4K8RH 3N50A 2D4DA 1BOGB 1J8HB 3HFMH 3B9EA 3WXWH 5ANMA 1E4XL 4R90L 3PV6B 2A6KB 2VLKA 3W82A 2I60L 2WBJB 1CXFA 3DV4A 4ELMF 2Q6WA 5DMIL 6CGTA 5EBLB 5AZ2L 2XN9D 3D48R 3LRGA 5F9DC 4GRMB 4OGAD 1JHTA 4OZHE 4MNGA 3BISA 5GGRA 4ZPTA 4GMTH 4YNYA 1B4JH 4OZ4B 4OLUL 1XR8B 5KJRL 2UYLA 2ZUVA 3EYSH 4HIHB 5FGCE 4YXLL 4PJHB 5FYKD 1FO0H 1A5FL 4Z7VB 1OP3K 5B8CB 1VERA 4OGZA 4R2GC 4U6VL 1DEEA 1J8HA 1EVTC 3W9DA 4OM1H 5TFSH 5GGSB 3KJ4C 4E42B 3PV6A 5F7FA 2A6KA 3WLWC 4OI9A 4PJ7B 3B83A 5ESVB 4IIQB 1KJ2B 4DGVH 5EBLA 2XTJB 3SY0A 1H8SA 1I1AA 2OQJA 4GRMA 2RJMA 3ULUC 4Q6YA 1NL0H 5IFJB 5D1QC 5GPRA 4ZO9A 1BJ1H 4KGJA 4PGEB 4N0CD 1WAAA 1XR8A 5DEGA 2DQCH 4C59B 3W39A 1EJ6A 5I71B 4HIHA 5LXGH 5D72L 4PRDB 4PJHA 2F19L 1FORL 4NQUA 4Z7VA 1DBMH 3MYZA 5IB2B 3QI9B 5IMKA 3EJYC 5I8EA 5I30L 1R5WB 1MPAL 3BEWA 3PXJA 4RMRA 5D2LA 1CQYA 5DQJB 5D2NE 1YEJL 4PJ7A 1FAKT 1N4XH 4L8CB 5EOCL 5EZIH 1FQ9C 4DN4L 2YPKB 4IIQA 2UUDH 3BN9C 2R69H 4M48H 5BVJB 1MY5A 4NQCE 3EHBC 4NQEB 4AEHH 1ZGLM 1D5BB 4KJQC 3JV5A 4OCMC 1J12A 2AEWA 4PRID 4YUEH 4PGEA 1KCRL 4NO3B 4OKVB 3DVFA 1MCSA 4Q2ZB 1C5CH 4LHUD 1E6OL 4OSUH 4PRAB 1JPSL 4PRDA 3HCVA 5LJYH 3TFKD 1KB5B 4S11A 2YSSB 4B53A 4KI5D 3VWKA 2JIXD 3QI9A 1Z9LA 5EZOH 1MHPL 1R5WA 1L0XA 1FNGB 3IFNH 3QFDB 2APWA 2R1WB 1U36A 3VXRB 1AI1L 3LS4H 2ICCA 5DQJA 3ECBB 3ARTA 2R56L 4L8CA 2DBJA 5GRYA 4RAUB 4GBXA 3DLQR 5CLTA 4R2GB 4ONGL 1VFBB 2NW3A 3ZKSD 1EVUA 1FFPA 4YFDB 4ETQB 5T1LD 2AK1H 1SJHA 3H3BC 3ALWA 3ABZA 3LN9A 3GSNL 1P69B 4OUUA 2VH5L 5TDPA 1X5YA 4OKVA 5EWIH 3X13B 2YD4A 2BRQA 1H0DB 1KB5L 4EXKA 1WZ1H 5IQ9B 4PRAA 5GRZA 4NZRH 2NX5B 2FSEA 1E4KC 5D1QB 5HHVL 1RURL 3HE6D 1KB5A 2YSSA 2Y06L 4XP9H 3P73B 3O8XB 4MD5A 1PW3A 1FNGA 3QFDA 1CN4A 5CSBA 1TTFA 2R1WA 4I2XE 2QQKH 1JWMA 4HXAL 1MRFH 1GOHA 2C1OB 4BQ9A 3ECBA 2J2ZA 4Y1AA 4BZ2H 3ESUF 2BRRH 4RAUA 3KPSA 3TIDA 4UT9L 2A6JB 1XIWC 2LV4A 4ETQA 1U2CA 2Y36L 1BVKB 4ZOEA 5F9AC 1RAMA 4HLZH 1U42A 1RULH 3MV7D 3RVWC 5A2IH 3ULUL 3QG7H 2APVA 4LVNC 3U79A 1KBGL 5IQ9A 4FFYH 3PF2A 3G6JE 4JAMB 1W0VB 2NX5A 3BMVA 3PWLB 5D1QA 1A2YB 4R4FH 5BMFH 4KKBD 1NFDA 3IXAA 4LEXL 4Z5RA 2VDRL 3P73A 4L3CA 4LCYB 1UKSA 1ZLSH 1KENL 4JO1H 3RWEB 4HIIA 4HEPG 3RZWA 4A6YL 1L0YA 4CRPA 2C1OA 2Z92B 2CRYA 4OF3A 5E9DB 4K9EH 3E2HC 4LRIC 3SGEH 3V7AG 3RVXD 2EYSB 3TESA 4ZUTB 1LNUA 4Z7NE 1VCAA 3EOAA 4A6YA 3OKDA 2Z8VC 2AEQH 2QTEA 3NH7L 5K9JH 1ACYH 4HWBH 5DFWH 5EPMB 4S1QL 4JPVH 2J7LA 1D5ZB 3QIUC 4MVBD 4NFDA 4K2UH 4JANB 3GKZA 3HC0B 5D8JL 5MI0C 4LNVA 2DLFL 4KXZH 5DUPL 3Q1SL 3QEHB 4R26H 4KC3B 3L3HB 2B0SH 4TPRH 5B4MC 2X5PA 1I9IH 5DFVC 4JAMA 1W0VA 5CEZE 4K71C 3PWLA 4AY0A 2IFGA 1KYOK 3MQIA 3RPKA 1LDPH 4LCYA 3UBXI 1DBKH 3UZQA 5CJOH 1BX2B 4RAVB 3RWEA 5D1ZC 3JV4B 1IM9B 2FX8L 1S9XA 3WYRA 2AXFB 2Z92A 1G7HB 4OKDA 4V2BA 3H7BA 2EYSA 4ZUTA 4MS8D 4YBQD 2F74B 4P5KA 5FYJD 2Z93B 3AUVA 5EPMA 1BOYA 3L5HA 4LCWB 3VGBA 3TWCH 1JYNA 4JANA 4G6ML 2HKFL 5J0BA 4XX1E 2HRLA 3DIFB 4MMZC 3QEHA 3QYCA 1XIWB 1ORQA 3L3HA 1PKQE 5C07E 4L29B 5J1SC 5EN2B 3O4LB 2LFGA 4R0LC 5SX4I 5F6IC 5J9PB 1GGCH 3LDBC 2WUBL 3FQXB 1AO7B 1X4XA 4NO0D 1EFXA 4RA0C 3HHRB 4RAVA 2V2TA 4ZAKC 3R1GH 3BFOA 3JV4A 4LVNB 3FO9B 2R0KH 2AXFA 5ISZE 3OJVC 3QISA 1G7HA 5C2BH 3I6KB 1FAIH 1QBAA 4KMTL 4C56A 3OQ3B 1P84J 5JUEL 2FH8A 4F7PB 3CUPA 1QLRB 4LCWA 4OLZL 3H9SE 1GGTA 3E2HB 3MGTB 4F33B 1JBJA 5TDOB 1PYWB 3DIFA 3QSKB 3VDBA 1XIWA 4XPHH 4PB0H 5GRVL 3QEGL 4L29A 4U1LB 2HJKB 1KCVH 3O4LA 1V7NH 1YNTA 3VDCA 4B41A 5J9PA 3GIZH 4C83B 3QIUB 3FQNB 1MCWW 2CUIA 5DEZA 5GRVK 1AO7A 1LO3L 3EYOB 3TN0D 5MI0B 3PP3H 2X05A 4M8QB 1EO8L 2ARJB 1LMKA 3KLDA 4JFDE 3UAJC 4IHOA 5KVDL 3WUWA 5C08A 3FO9A 1AXTL 3QXVA 3GBML 1INEH 2PETA 4K71B 1NEZG 4NJ9L 5FECB 1A4KB 5EIVA 5E56A 2EIZB 4NYLB 5C3TA 4ZUUB 1WV7T 4JEGB 4FS0A 4GAGH 3TO4C 1P6FA 1FLRL 5D1ZB 4F7PA 5GHWH 1WLHA 2EO1A 3S9DB 2CK2A 4JN1H 3MGTA 4F33A 5C0RL 3VFWB 1PYWA 3WHE0 1LHZA 4QLRA 3MJ9H 3UJTL 4D9LL 4ONOA 4WY7H 2D7TL 4OD1L 4C83A 3CVHB 4KJYB 3QIUA 3FQNA 4K3DL 3FB5B 5B3NA 3QFJE 1MWAB 1EHXA 3HPJB 3Q5OA 5JIPA 4N8PA 3O0RL 2GJJA 2ARJA 4MXQD 2DQUL 4RMUA 3QULB 4R0LB 5F6IB 1IC4L 4PJGE 4HC1H 3LDBB 4YGVB 2EIZA 5BZWA 3O6MH 1MAJA 2VB5A 4F9LC 4RDQF 4NNPL 2YZ1A 4PLNC 1JWSB 4NT6A 4ZAKB 5D1ZA 2E7HA 4LPYA 3TH2T 3OZ9H 4PJEF 1DBBH 2H32B 4EDWH 1MF2L 3ZKXB 2GFBB 1UG9A 3EYQD 4ZS7L 1QRND 1NUDA 3VFWA 3SEPA 5I73B 4DTGL 2CLZB 3QHFH 3F7QA 1BZQK 4UV4H 5D5ME 2IAMC 5CFHA 4OCLC 1LD9B 3RUGB 3CVHA 1DQLH 2QEJA 4X7EC 3S4SB 1YEEH 4X4XA 4QNPF 1X4ZA 2NYYC 1UWGL 4EN3D 1I7UA 3HPJA 1OAKL 2R2BB 3GSVA 4NQCB 4OD2B 5IMOA 1A6AB 4PJCE 2BNRD 3BH9B 2UWEB 4HJ0C 1U93B 3QULA 4I5BA 4R96B 3VH8G 4R0LA 5IVZB 1WTLA 2Q8BL 4M6OL 3SGKC 3O6LL 1U8LB 5ILTL 3AXLB 2BY0A 4YGVA 1LK2B 3T1WA 3OAZK 3UPRB 1CI5A 3CX5J 5JZ7D 4UQ3B 1JWSA 3GM0A 1E4XI 3C6LD 4N5EC 2H32A 3A6OA 2ORBH 2GFBA 3HB3C 3WDIA 5LGHL 2VERN 3G08B 2EO9A 2WNGA 1CT8B 1X5HA 2CLZA 5D2NA 4RMSA 3TO4B 1DR9A 1JGUL 3SQOL 3TNNB 4ZDHB 3PWPD 4LLUA 5C0ND 3RUGA 4OCXH 3S4SA 4BUHA 3Q6GH 4M5YH 2R2BA 2YUWA 4NQCA 4OD2A 2BVPA 4JKPH 1LILA 1A6AA 2Y9RT 3TF7C 3MJ8B 3D39E 3BH9A 1A7OH 2FX7H 1OSPH 4R96A 5IVZA 3REWB 4OD3L 1RZFH 1U8LA 4S2SA 1FRGH 3UCRA 3UTSD 1MQKH 3TM6A 5L2KB 2QV2A 3UPRA 1BF2A 2QQLH 3OWEA 2OXGA 4UQ3A 2X4OB 4WI8A 5AUMB 3HNTL 1RVFH 1YEKH 1I7TA 3KWWB 2AVGA 3BYTA 3NACL 4NN6C 4D0BB 3CH1A 1QPXA 1OAZL 4I2XB 3QDJD 4MQTB 1CT8A 3TO4A 3IU3A 4AH2B 1R24A 4TVSa 5A3IC 3OAUH 4ZDHA 2GJZA 3QUMH 4X9FA 1P4BL 2B1HH 2XRAL 6FABH 3THMH 4HPYH 2VLLB 4LBEB 4LCIH 4L3ED 5ALBL 5IVXE 3BUYB 4XPBL 4QY8B 4WI9A 5I1GH 1QSED 2H45A 3OF6D 2D03L 2BSRB 2IAMB 4LSVL 1NJ9A 5HPOA 1K4DB 5I8CB 4Z7OF 5DQDH 4Q58C 1FCGA 3GNMH 3VI3E 2HTKD 4OIIL 5L2KA 1UZ6F 3BP7B 3C2AH 4OUOA 3G6JB 2IC2A 4LARL 3KLAA 1KEMH 2X4OA 4ODHH 4OB5L 1T1WB 1KEGL 4OT1L 4BFGA 3BKJH 4JR9H 3KWWA 4P2RE 4D0BA 1RPQA 3WIFB 2ZUQB 4I2XA 4R3SB 3O41B 4K94L 3H6JA 4OCYH 4F9LA 4AH2A 1NAKH 4YH6A 2NY1C 5GSVB 4RBPH 1QR4A 5CZVL 1FH5H 2VLLA 1FGVL 2VLME 3WFHB 1U3HD 5BVPH 2FBJH 5F6HJ 3BUYA 4QY8A 3SDDC 2G9HA 3OB0K 5C2UB 1OWRM 2BSRA 2IAMA 1V05A 1K4DA 4PB9H 1KCUL 4NQXB 5I8CA 1NQBA 4G8EA 2GJ6E 5JPMB 2B7DT 4XBGA 3MFFB 1XGUB 3ILQC 2DMBA 2AABH 5HHME 3KDMB 1HYSD 1RJYB 2D7OA 3G6JA 1KUMA 3DO7B 2BSSB 3MA9H 4F7MB 4F9PC 2ZUWA 3MRBB 4FMFA 3FCTB 2DQDL 1T1WA 2BNQD 5D2LF 2MOVA 3E1F1 4W68A 5I19L 5ICXB 3SGKA 3W2DH 3MODH 1PG7X 5C70A 1GAFH 2DIBA 4CU7A 4R3SA 3O41A 1QBML 4R8WL 3CFCL 4OZIF 3C5JB 3UMTA 1OAQH 4KPHH 5GSVA 1ND0B 2HT2C 5AYQA 1CD9B 1L9NA 3FHAA 3S8WA 15C8H 4NN6B 1MH5B 4PV8B 4G9FB 4LU5L 4F3FB 3V0AC 4JHWH 1X44A 1JGVL 2YD2A 3PDOB 3TJHC 4NRYB 3HUJB 5SWSE 3U7YL 4QHNB 3MLWL 5J6HA 4TTDC 4Q9RH 3CD4A 4OLWH 5E8EA 1UM4L 4JRXE 1OTUC 2OMBA 4ODSH 5CEZL 5JPMA 3MFFA 5BRZE 4HUWB 5HD8D 5JTWA 2EYRB 5C07B 4LGRB 3EJZC 3KDMA 4PJBB 1RJYA 4XP4L 5E99L 2P45B 3KPQA 2DDQH 1VB9A 1HSAB 2CMRH 1A3RL 3FCTA 4P9HC 5E2WH 1N0LA 3LQZA 5CIPB 5DD5L 3ZDYF 5C0GA 4XGZA 1SMAA 2HMIC 5JMOC 1YEHH 1X5FA 1JK8B 4TULL 3QQ9D 3BPCB 3MXWH 1Z2KA 4UU9B 3ZTNH 4Z95H 1RZJH 1FL3B 3LEVH 1ZVSB 3C5JA 1T7WA 3NCMA 2ADIB 4RQQA 4X9HA 3MNVB 2ADFL 1ND0A 4OLXL 4DVBB 4I0PD 1JNNH 1MH5A 4PV8A 4YHOH 1QSVA 5L88H 3PDOA 1G9ML 4H26B 3HUJA 2DBLH 4QHNA 4LSSL 4DZ8B 2NY1B 1BBJB 4LASH 4HUWA 1PKQA 4HH8A 5C07A 2O93L 4KDWA 4PJBA 4HZLA 4G6AD 7FABH 1GL4B 4WHYH 4B0MM 4UDTB 4YE4L 5FGBC 3SDDB 1HSAA 3IRZA 2X41A 4Q97A 1FDLH 2VQTA 5CIPA 2VLRE 3KYNB 4YHML 1AJ7H 3AB0C 1WITA 3NCYS 3WUZA 1GH7A 3K2UH 2IPTL 3BPCA 4XTRD 2FJGB 3B5GA 4AQ1B 4EUPB 4HH9B 3IAQA 4XPGH 2A77L 1ZVSA 1U0QA 5ISZA 2XKSA 4BSWB 4HGKC 2ADIA 4OTXL 1YEIL 1MIML 4XNMB 5I1IH 3MNVA 4KHTL 3UJJL 4PLKD 3MV8D 2LTQC 4YLQT 3DRQB 3MLSL 1FFRA 4DVBA 3QRFM 3EZJB