4FZEH

Crystal structure of n26_i1 fab, an adcc mediating anti-hiv-1 antibody.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGSSAKVSCKASRGTLSSYFISWVRQAPGQGLEWLGGITPLLGTANYAQKFQGRVTITADKSTNTAFMQLSSLTSDDTAVYYCAGTVYYDILTGLYTNFHYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords N26_i1 Fab light chain
publication title Crystal structure of N26_i1 Fab, an ADCC mediating anti-HIV-1 antibody.
rcsb
source organism Homo sapiens
total genus 43
structure length 221
sequence length 227
ec nomenclature
pdb deposition date 2012-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fzeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fzeH01
1Q0XL 3NCCB 2JCCE 3BP6B 3QP3A 5AAWA 3CSBA 2V7NA 2FZ3B 5C7XH 3KNBB 1ED3B 4POZD 2NY6D 3LEVL 4L4JA 1WVZA 5CD5C 5FO7B 5FO9B 3K2UH 1Q1JL 3MNWB 2XOTA 3L3IB 3RTQA 1HOCA 4NO2A 4U1NB 1U8QA 4BQBA 5E8PB 1OGAA 3VDAA 4B53A 5CINH 5IK3B 3ZKMC 1NFDB 1CDGA 3QDGB 1S7SA 3NCJL 5AG8A 3DVFA 1U36A 1LHZA 5FHAH 3DXAD 4JO4L 3BT2H 3DV4A 4QOKE 1GPOH 5ESQB 5L7XH 4F7TB 1J1PH 4RDQG 2WUBL 4A2LA 4JFFA 3C60C 3HC0A 4YXKL 4WGVB 3SE3C 4BH7A 3OKDA 4F7MB 5MP6L 3FZUC 4RMUA 3GUTB 4P9ML 2AV7B 4JPIA 4P2QB 3NFSL 1OB1A 2GJ6D 4PD4J 1T5XB 3GI8H 4QF1B 1NBYA 2OJEB 5FGRA 1EGJH 5GSVA 3T4AA 4XBGB 4OCNC 2VH5H 3BPCA 1KIQA 5EB9A 1PQZB 1U92A 1VEMA 2ZP0T 4EOWH 3BZFA 2YXMA 3TA3B 3D3VD 4HCRA 3G6DH 3JV4A 3SJVB 3U4EA 3BGFC 4YHLH 5DQJB 1G7JB 1RZJC 4X7TA 2EDQA 1FCCA 3GBNH 1TTGA 5CBEA 2NW2A 3STZA 3OAYK 5DJZA 5E0QA 4ZUVA 5GRJH 1YEKL 3SO3B 2NXZD 3MV8A 5CKGA 5T1LA 1AFVL 5GQBA 5GS0H 2AEPL 1M71B 4JDTH 2J5LC 3RUGE 1BZ7A 3EOTL 5C0FB 3H42H 1ZVHA 2WINA 2IH3B 3S37X 3EOBB 1T22B 1OT1A 5EORL 3HUJF 3RVUD 4NC0B 3HAEG 1M6OA 1JWUA 3T2NL 4NFDA 1ZANL 1JHTB 1F97A 3B43A 4KKLC 2VLLA 1JRHH 4PRBB 3MRGA 5E2VL 2BNRA 4K2UH 4PY7A 3UZQA 3WHE0 5I6XB 4D3CL 2J8UB 4NJ9L 3IDXL 4FZ8H 3L5IA 2EDYA 2HT4D 3FO9A 1YEIH 3FO2A 5IHZA 1NUFA 2DQDL 4F33B 3IJSA 4EDWL 2VLJD 1EERB 1EK3A 3EYFB 4X8XA 5JHDE 4DN4H 1L9MA 4NZUH 1MVUB 1T20B 5HYIA 4HIIB 1Y18B 5JUEL 3EYSH 3SDCD 1J8HA 4HH8A 4X4XB 2V6HA 4AK1A 3KPNB 1P53A 2I9TB 4U6XA 4HJGB 5T5NF 1G9MC 3HB3C 3T0AA 4OLVL 3TVMB 4ELMA 5HHQA 4AQ1B 4HIEA 3UTTE 4OD3H 3KS0J 5GGRA 2XKNB 4OZIB 1FNHA 4LFHG 4MHHI 4L1HA 3BIKB 3UTSD 2ADGA 2BK8A 4ORGA 3R06A 4JO1H 2YUZA 1DQDL 1WJ3A 5DLMH 4JQIH 3GO1H 5E5UB 1I1AD 1JI1A 1JGUH 4RMVA 4ZFFB 2CDFB 5EH1A 5I1AA 1UM4L 5MHSD 1HSBB 2IQ9H 4YGAB 2CDGA 2JJSA 4R4FH 1K8DB 1A47A 4MNGA 4P46C 1BOGA 2ZUSA 3TJHC 4YDKL 1KT2A 3C9NA 4EIGB 5ICYA 1KJ2H 2BSTB 4R8WH 3UTZA 1MCWM 1MCFA 2EECA 1RMFH 1FNFA 2F8XC 5ISZB 4R2GD 1F13A 4POUB 1KELH 1U8JB 2AJXH 5EBMA 4U6HB 3D25A 5MEPB 4PJCB 3VXRD 3WDJA 1KTLB 1T1XA 1D9KC 1MJ8H 5C92A 2ZG3A 2WANA 1SVZA 3RGVB 3I2CL 3KVQA 5ERWB 3DHJA 4YNYB 4PV9B 5K9JL 3QI9B 3MLPA 2CJUL 1XF2B 3QQ3B 3NA9L 5CGMA 5EZJB 1MY5A 4JY5L 4GRWH 1CFVH 4TUKH 1D5XA 5EU3A 5E2TH 3BUYA 4XRCA 2PTTA 5GGVH 4MNQA 1ZWIB 1YQVL 5HY9A 4Z0BL 5EOTA 5E24E 4JFXB 1A0QL 4AIZB 1RAMA 4ZFOA 4JQVA 1EHLL 1Q9WB 3ZKXB 5KVEL 3GMLB 2YC1B 4HMEA 4NC1E 2PKDA 2XQBL 3MJ9H 2XN9E 3H0TA 3LKRB 3AROA 3H7LA 4LCUA 5IJVA 4Y2DA 4OFYA 1R5WB 4JHBA 2PR4L 5GRVK 3RX5A 2C4XA 3VWKD 3U7WL 3PV6B 2A9NL 3CH1B 4PJGB 4EI6A 1U8KA 3SKUD 1MFCL 4KJYA 1T1YA 1NCBL 3CDCA 2YA2A 4LSSH 4O58L 1TJGH 3C2AL 3MLRL 2H32A 4FFYL 4LEOA 4K7FA 4WY7H 1G6RL 1PX3A 4LPUA 2B5IC 4G8GA 3VXME 3KHOA 4D2NA 2VDLL 4ZNEA 1HXMB 4R6UA 4X8JB 3HZKB 3F12B 2VSCA 5FDYA 1Z2KA 2EXYC 1QYGH 4P4RB 5C0AE 5TDNA 3CMOH 4R3SB 3N1GC 4OM0H 3AU1A 1OM3L 4WO4D 4OCWH 5EOCJ 1FPTH 3MV11 3U0WH 5J9PB 3RWCB 2GAZA 1MIEH 3MBEA 3G6JF 3GM0A 4PJXE 3WO4B 4OCYH 1ERNA 4RGOH 5HGGS 1A6AA 3GMOA 4GRLD 1BQHA 1HWHB 4Q9QL 1CS6A 1U0QA 2DQJH 3FN3A 3I84A 5FAAA 5ILTL 5DD3H 5A3IC 4UQ3B 1BOYA 1AO7E 1FNEB 1I1FB 3GRWH 3PQYE 2D03H 5L8JB 5DMKA 3GJEB 4V1DE 3WKNA 3L95B 4C56B 2F54E 4QRPE 1F5WA 2DQGH 3PG2A 2GK2A 3DIFA 1K3ZA 3V79C 4S2SA 1GAFL 1H3UA 2XWBB 4I18B 1VENA 1QFWM 5KVDL 3QEQE 3C5SA 3QO1B 4OCRH 1T2JA 3NZ8B 4HK3J 5SWSB 3HUJE 3O3AB 1P2CA 2YD2A 3IGAB 3MPCA 3T2OA 2QL1A 3EKCA 1UG9A 4JEGB 3PXHA 4GJTB 4M7LL 5L2JA 5IGXH 1Z5LB 5E6IB 3FTGB 5EDXA 1EXUA 4M6OL 4HKBA 4M5ZH 4NQSB 1NL0L 4RMWA 4KROD 2VR9A 4GMSH 5E4EC 4TVPL 1IM9D 1K8IA 3FB6A 3MJ6A 5HPMB 4NM8H 2VN4A 3OKKB 4WI5A 4PJEE 1OP5H 1AXSA 4NQXB 3UBXA 2HLFC 5DZOA 4GG6E 5GJSH 4F3FA 2ITCB 3T4YB 1EIBA 2XTJB 4HIJB 4LVNC 5E00A 1EAPA 2QR0B 2E7HA 3H3PH 1JGVL 1MF2L 2HJLB 5ENWA 4WVRA 1JL8A 2EEDA 1KG0B 3UTQA 4MD4B 3QEGH 4NQDB 3UPAA 5EFIA 2R1YA 3LY6A 5F1IB 1T89C 3GFUA 5DSCA 2CRMA 1M7DA 3M07A 2FYYB 4HWZB 1UB6B 4KRLB 3OKMA 2IF7A 4XTRC 4I3RH 3HE6B 1MJJA 5GRVL 5DJXA 1WTLA 2JJVA 3QQNA 4U49A 5DK0A 5FUZH 1QFUH 3SGEH 1J87A 4OF7A 1I85C 3O3UN 1VFBB 1JWMB 3U9UA 4Y16D 5JDSA 2BHYA 2XNAB 3SHSA 1BFOA 4QRUB 1TIUA 1RI8A 1H3TA 1MFDL 2ATKB 1B2WL 1FZKB 2VDKH 3QIWB 4B41A 1A4JB 4MD5A 1B0RB 2RCSH 3IDGA 5IWLC 2OMBA 1DQJA 4KZEL 5D6CB 5FOJA 1H8NA 3GSWB 3DBXA 3M17A 1VKXB 4OZFB 1L7TH 3AGVA 5KN5A 4G42A 4PP1C 5DO2C 1DDHB 2HFGL 3LQAC 1U6AL 4UAOB 1A4KA 2O5XH 4ZOAA 4JM4H 1H3PL 4U6YA 5ACLA 5CD3B 3RY6C 1OY3B 1QR4A 5FA4A 3TEUA 4XNMA 4HCRH 1PFCA 4WU7A 3O6ML 3B9DA 5FCUH 2HT3D 4Y4HD 3VD3A 3BVNA 3C5JB 2CLZB 3LS5L 4X83A 4HPYH 4ZS7H 4WUUA 4U6VL 2FX8L 4M43H 1DSFL 3FB5B 3RNQB 5K59F 1MWAL 1KULA 3MROA 2BCKA 4M4RA 1RIVH 2EE6A 5E2JA 3LH2L 3QDJA 1NCDH 3CD4A 4LQ1A 1QRNB 4NRXA 3PWPA 3RWIB 2CK0L 4Q6IA 2QQLL 1U9KA 1INQB 1NPUA 4KQ4H 2GK0A 4X9GA 4YHOL 1Z9MA 2ZOKB 3GMRB 2QBWA 3UYRH 3TZVB 2V5MA 4EN3D 4UU9A 3KYNA 4RCAA 4IRSB 1RUQL 3MJ8B 4NP4H 4NHUB 1BLNA 2XTLA 5SWZE 1ZT1B 4OLYH 4Z7NF 3IDIB 3C8KA 5HHVH 2VXTH 2FLRT 3DGGA 4N0YH 1EDQA 3MREB 2FH8A 4UTBH 2XPGA 4XBPB 1YDPB 5T5FL 1TCRA 3PHQB 3QXUA 1X4YA 2DM4A 5GS0D 4AEIH 1AI1H 1LMKA 4UUJA 2Y23A 1PG7H 2WQ8A 5EU4B 4RGNE 2YD8A 1RZ8B 1QRKA 4N0RA 2C3HA 4ZPTA 3PL6D 3Q5OA 5E08H 3MUGB 4K8RD 1I7ZA 5EIQA 2FB4H 3OXRA 1JK8A 2FECL 5D72H 4LPXA 1CXIA 3VH8B 1RVFL 4Y4KD 2DB8A 4W4NA 5J6HA 4GAGL 2FBOJ 4ODSH 3HA0A 5F7YC 3MLTA 4R0LB 4LF3B 4LU5H 3VI3F 4DGIH 5D1XA 1RHHB 4KI5E 4AH2B 3LS4L 4XMLL 3ARQA 4PJ7A 1WZ1L 1RULL 3OXSB 1FN4B 4R96B 1GHFH 5D2LB 5E9DE 3SKJH 4AENA 4U1KB 3M1BA 4U7KA 5MI0C 2OK0L 2JF1A 35C8H 1FL6A 4XXDB 1NCAH 5F7LB 5IBLC 1MIML 5ITBL 2IFFH 1T3FB 1W72L 1SJHA 2APTA 3MODL 4M00A 4WFHE 4U4BA 5EO1B 3I6KA 4G7VH 1WFOA 3FQRA 1GVIA 4PG2A 3WDHA 4L8BB 3UXFA 3MSPA 2FRGP 4HDIB 5EBLB 3IKKA 3IF1A 5DGRA 3DYPA 3SDDD 1EJOL 5FUCE 4MX7A 3RKDD 5CUSH 4I1NB 4OT1L 1U8LB 3QCUL 3IS0X 3P0VH 4LHUG 5ANMA 3L7EB 5BV7H 1I9EA 5E94A 3QXDB 1MLCA 1UJ3B 3LEXB 4FP8L 4OJFL 2DQFB 3UZEA 2ZCKH 3MLZH 2H2PD 1UVQB 3DYOA 4M1GL 3WHXB 3U7YL 1KCKA 2XZAH 3QG7L 4XHQA 1FVDB 3I3BA 4GQ9H 3A0OA 4NKQB 3HMWL 5C0ND 5FECB 4HT1H 4DWHA 5C08E 4PRPD 3RAJL 5DMGC 3S4SA 3BKMH 3JUZA 3QZWG 4OLXL 1QSFA 1FYHB 4M3JA 4PS4L 5I19L 5KZCB 1GZPB 2Z35B 4LHQB 1I8IB 1YC7A 1LK2A 1VCAA 5CCKL 5BVJB 4KK6C 4AQOA 3QI9C 4EBQL 3VFRA 2UWEB 3WSQH 1AP2B 4PV8B 5FFLA 4O2FB 3P77B 2NLJB 1ZXQA 4YHML 4HS6B 4PIRF 2GQHA 4DCQA 1QLEH 3CZFA 1FLTX 3CMGA 4ZSOE 1RK0B 4PG9A 4R26H 5JNYA 3B3IA 3NABL 1CBVH 1BM3L 1KGCD 1OAXL 2ZSWB 5FV2A 3QWOA 2B1HL 5C9KA 4DZ8A 1WC7B 4JZNA 4FHBD 2FO4B 3ZKXC 3ARDA 5D1QD 5I8OH 2DYPB 4QCIA 3WIHA 3PGCA 5CBAB 3UJTH 2YBRB 5JA9A 3S36H 4P57A 4NQEA 2CLRA 4U1HB 4OF8A 4MYWB 1S5IL 3L3DA 5ECJE 3WFDL 2OQJB 1T6WA 2H26B 5C0GB 1X5FA 3K4ZA 1I8KB 5HHOA 5ICZB 4HS8L 3TYGL 1CGVA 2DQUL 2F53D 5GS2H 4ZD3H 3D18B 1MAKA 3T0EB 2IWGA 5T1MA 3T09A 4HZLB 2GITB 3O4LD 1RJLA 4C83A 3G5ZA 4DFHA 5FEBA 3A6OA 1F02I 1WFUA 2E6QA 4OIIL 4QHUB 4LKCB 3ZTJH 3BP4A 1IGML 2FO1A 4OZ4A 3I9GL 3FB7A 2AXHA 2YPLE 3QIBD 4L3ED 5M7QA 2EYSB 4ZTOL 3JV6B 1V7NL 4J6RH 4PJ9D 1GOFA 3SQOL 3WO4C 1BBDH 4X99A 4LSPH 2PTVA 1ZMYA 1YEDB 1DBKH 3VXOA 5DJ0B 1KTDA 4LIQH 1MRFL 3GB7A 5E8DL 3HRZA 1OARL 5GRUH 4FFVC 1KNOA 3T77A 4QT5B 2YRPA 4U1LB 1MLBB 1XR9A 4MHHG 3P4NA 2JCCB 1P4BL 1ZEAH 1E4KC 4OUOA 1V3JA 3AREA 2G60H 5DC4B 2ARJB 4LGRB 2CR3A 5GXBB 4JRYD 4OCXL 1BECA 4XCFL 4I18C 2PUQT 3CH8A 5CHNB 2BFVH 2HLAA 1ONQB 4HUVA 1RZGB 2YA0A 3L5XH 4UT6L 1PSKH 1NLBH 4TSCH 1GGUA 2LU3A 4HG4K 3HE7B 1AGBB 1ZA6B 2DMKA 4XWOC 4BZ1H 3FQTB 1MAMH 1CGYA 4EDXA 1UH3A 4IRJD 1ORSB 3OJDA 3KPRA 1FNSL 3S88H 5HYQB 5D7LA 1HKLH 2EIZA 4FFWD 2KQNA 1MREH 3DX7A 3SCMA 3RIAK 3VI3E 1AGDB 4L4TD 1LDPH 4DUXA 3O45B 1BJ1H 4JREB 1NC2B 3EOYG 43CAA 1F8TL 2H8PB 3WHE1 3ZKND 2XTJC 3D9AH 1DN2A 4X98B 1LE9A 3WFZA 5JW5A 3DVNA 3EO0B 2VNCA 3V6OC 1QR1B 1NGPL 4IOFC 3BH9B 4JCMA 4PJIA 1H15B 3VFOB 4N8VB 4XP5H 5EN2A 3U36A 1IC4H 5L2KA 1GC1L 4HD9A 2NY0B 4L8CB 1C5BH 2LAAA 2B4CC 3GMQA 5ETUB 3FB8B 2GSGA 5JOPD 4Z95H 1B6UA 5KVFL 1JZ7A 5E1HB 3V6ZA 5FO8B 5EU5B 1BP3B 1CD9B 1LO5A 1EEZB 3ARUA 2G5BA 5IB4B 1BIIB 1P4IH 3KXFE 4XHJC 2DDQL 4OV6F 1KPVA 5DWUH 1S9VB 2AGJH 2OBGA 2EC8A 1YN7B 3QH3A 2IG2L 2C1PA 1NC4A 2Q8BH 2FGWL 4JFFD 3RIFK 1YEGH 5IBTH 1LO2H 5JOEA 2KH2B 4V2BA 1HILA 2E27H 4JFDB 2GFBB 4MAUH 3IVKB 3U6RB 4WU5B 4LL9A 2XT1B 5E56A 3FJTA 4P9HL 4APQB 3O6FC 3RL2B 3KYKL 2CLVB 5ID0B 1KV3A 1R3JA 1NUGA 3MV9E 2NR6C 4XP4L 4MJ5A 3T2PA 1WEJH 3BKYH 1J5OH 2DWEA 5JIHA 2ADFH 3OF6D 1A7RL 4K71C 4MLIA 4D0BB 4MSWB 3QR2A 4TSAL 3U2SA 5DZLA 3CFJB 5KSAA 4ZFGL 4PRHD 1NEZA 3DROB 3L3HA 4YQXH 4F2MB 3PHOA 1YEJH 2ICCA 2Y7QB 2IBBA 5F1SA 5IB3B 5FM5O 3MV8D 2IQAA 4U6TA 2FIKB 3QHZL 3LCYA 5T1LD 3WNNA 3I6GA 3QRGL 2NY3B 1T0PB 3BRFA 3WMSA 4HUWA 1NUNB 4URTB 1JZ4A 3BQUD 4DGYL 4WEUD 1IE5A 2OL3A 4MQSB 5HI4C 2DIBA 3UTTB 3MRIA 4JFEE 3RPIB 3BPOB 3K46A 4OGAC 2GSIA 2DI8A 1F6AB 5K9OA 1MQKH 4I5BB 1FAIH 4DGVH 1JGDA 3QPXH 2BNRD 1KOAA 4PJHF 4IEFB 3RU8H 3HNVH 1IBGL 3SE4A 2X4NA 3IRPX 2AJYH 3CUPB 1P6FA 3MR9B 1EJ6A 5K33A 4FQIH 1HYSC 2UZIL 4UT7H 1P7QA 1DBAH 1A6VL 1IGJB 1LEGA 3K7UA 4GLRI 4Y1AD 3QCVL 3PWLB 4J4PC 1OTSD 5DEZA 5F7KC 5DVKA 1J8HD 4OTXL 4QHLB 3U4BL 4ZOEA 4FS0A 3BDYL 5FB8B 5GPRA 2V2XB 1NDGB 3AS2A 3D48R 4WI9A 2VXQL 1AE6L 5B8CA 2NZ9D 4R0LC 4RAVB 2A74A 4OLWH 3MRKA 1WAAE 1XIWA 1CCZA 3KPMB 1CT8A 4WW2C 1PLGH 4LCWE 1W0VB 1FG2A 4JG0L 4TULH 3OGOE 1ZAGA 4XI5D 5A16A 4ZUWA 3QCTH 3S97C 3X3GL 3OMZA 4XCEA 3T1WA 3A67L 5C0CE 3IFNL 3UJJL 3TBSB 4FG6C 3BJLA 1ZLUH 3KG5A 1CWVA 1F4YL 2X10A 3MLUH 1TJIH 2KPNA 2VDNH 5KAQG 4OZGE 5H37G 3ME0A 1U42A 3OR7B 2EH7H 4KJWC 3V6FA 1GZQA 2BSRB 5T1DH 2CKBA 1A14L 4DQOL 1KACB 1P6AB 1QFOA 2GT9A 4JHAH 1OTUD 4G6AD 3ZL4H 3GMNA 1TETH 3Q0HA 4OFKA 1MEXH 1UJ3C 3KNBA 1IQDA 4QWWD 2H41A 3L9RA 3M8OL 3NPZB 2O61B 1CFNA 1WWBX 3BDXA 3L3IA 4U1NA 3VFGH 3QDME 4YHNB 2VISA 5I75B 2YN3A 2W0KA 2OZ4L 4U33A 4Q9BA 5IK3A 4HLJA 3CFEB 1QFHA 3THMH 1AR1C 3CX5K 4MNQD 4XAKE 4PGCB 3K8MA 5C0AB 3PWUB 3F7VB 1JIBA 4XC1H 1YPZF 1Y6NR 1N6UA 4PJAA 3V5DA 5H35A 4PJXB 1CGSH 5ESQA 1H5BB 3CFBB 4F7TA 4K23L 4FNLL 4OFVA 4Y2DD 4OFYD 4XGZA 3ZSSA 1BD2E 3HNSH 2F19H 3D85D 2H6PA 4AY0A 4LSDA 2XRAL 1N6QL 4ZAKA 3GUTA 3MA9H 2AV7A 1AO7B 4P2QA 2J1KA 4R4BB 5C2BL 2OMNA 4FMKA 4KK8C 5F6IB 1EFXD 1WZLA 1UB5B 4QF1A 4WFGD 1F4AA 1UCBH 5KANI 4G8GD 4GKZB 4M48H 4QRPB 3GNMH 4UDTB 4HSQA 4DKEL 3RKPA 4ZFZB 4QXTB 3FQXB 4M7JH 1S9WA 4JHWH 4IOIB 5BXFA 5F9OH 3TA3A 3OKEB 3QEQB 1PYWB 1IGCL 4ZTPH 3D39A 3EHBD 4LNVA 4HIHB 3KLAB 5DQJA 5IVZA 3HUJB 1G7JA 1N64H 3MBED 2P7TB 4HC1H 4RFNC 1RUAH 2AXJA 3MV7A 4N68A 4LLVB 5I74B 1LEIB 5GS2D 5IHBA 1J0YA 1OW0A 4LSRH 3T0EC 1YY9D 4M6ML 3NIFE 1SJEA 1CK0L 1N3NB 2XZCL 4CW1A 1M71A 3MRPB 4MA1C 1RZIB 5C0FA 1NKRA 2C1OA 4BK5A 5HD8D 2YPKA 5I30H 2IH3A 2A0LD 1AQDA 1FLRH 5D2NA 1T22A 4MLSA 4IJ3B 1Q0YL 4FQJH 1CD1B 4KDTA 1JPTH 3UC0H 5T3ZH 2Z31D 4NZRL 2W1NA 3B2UD 4GBXB 3D1MC 2OJZL 4PRBA 3BMVA 3UPRB 2XYCA 4OZFG 4JKMA 3TIEB 4BJLA 2E7LA 5DJDB 3SDAA 3NCBB 4GLRH 1RZ7H 3EYQD 2J8UA 4GFTB 4K94C 3K2UL 5DA0B 5DDHB 1GGTA 1N5AB 1PEWA 1Q72H 9CGTA 3RVVC 2WWKT 3PF2A 3PE9A 5C6PB 4F33A 1F11B 3KS0H 3RWFA 1UM5H 4LCIH 4N5EC 4G8FB 1YJDH 1JFQH 2COQA 2EO1A 2DJSA 5DVNA 3MJGX 1Y18A 2WUCH 4XCYB 5EWIL 4GXVH 4PJHE 5H94B 5I8EB 5JXAH 5J13C 5FGSA 2I9TA 2VQ1B 4EUPH 4WIQA 3TVMA 4UTAL 5FHAL 2AQ1A 4ELKB 2XKNA 1GPOL 3EDFA 5L7XL 3TV3H 5B38A 4LCYB 2ZUTA 2CRYA 1H3XA 2OS7A 1J1PL 3CPLB 2ZWLT 1C08B 2ZUXA 4P59H 1IC7H 1QPXA 4ZO6A 4QRRE 4ZFFA 1EEUA 3TPKA 5CIPB 4AIXA 4JB9H 3OR6B 2P5EA 1NKOA 5AWNH 4YC2B 3CSYB 2A6DA 3IXAB 5TDPA 4B7LA 3CFKB 3IFPB 3KLHC 5CLWA 3GI8L 1WBYB 3V5HB 1FNGB 4ENEC 1WZKA 1EGJL 1ZSDB 2VH5L 1JHLL 2I5YH 3C5ZB 2ID5A 4JREC 4EOWL 5ISZA 4LAQH 3FT2A 1WIOA 3RIAF 4X80L 1FVCB 3QHTC 4U6HA 1XF4B 3PWJB 5HGAA 1MRCH 4YHLL 3D6GA 4PJCA 5INDA 1A3QA 2NX5E 1QHPA 4BH8A 4Z7WF 4HXAH 5GRJL 5F3BB 3RGVA 3VRJA 5HVFB 5JZ7C 1PKQB 2AVGA 3BIBX 1MH5B 5IVXF 5J11B 4QRQB 4PV9A 3VCLA 3VH8G 4FQHA 1Q8MA 2NY0C 2EIBA 1RJZB 1XF2A 1QACA 3OWEA 2EDXA 3JTTB 5EZJA 3X14A 2HKFH 1RV6X 2V2TA 3ULUD 5B22A 1IGYA 1L9NA 4MVBD 4ZXBB 5SWZB 3ARYA 4G43A 2GJZB 4XNQB 5HGHB 4NPYB 3ESUF 5FYLH 1ZWIA 3OKNA 4J8RB 2NMSA 1JRHL 4KC3B 1NDMA 3VI4F 5CMAB 2EDJA 4AIZA 3TO2B 4P5KA 4K2UL 1Q9WA 2OCFD 3VD7A 2Q87A 3BD3A 3GMLA 2VZVA 3HS0B 4FZ8L 1ZA3B 3I6LE 4WUUD 1YEIL 3DNKA 5D7IE 5IF0B 4XP1H 4RGNB 4APQC 3BEWB 5FYJU 1YQ2A 3H9SE 3RIFF 3PV6A 43C9A 1H3GA 4N90D 3QDJD 1BREA 4NO0B 2OXGA 1YPZE 2OL3H 3WFCH 4DN4L 2YKLH 3HG1D 3FQUB 3P9MB 3PWPD 4NZUL 3U79A 5DHXB 3EYSL 5EOCH 2MHAB 5F3HA 1D7FA 4LSTH 4XH2A 4PUBH 3QBTB 1KF9B 3NACH 2KQMA 5GS1B 1HXMA 4X8JA 15C8H 3HZKA 3QQ4B 3F12A 1QBAA 3ARVA 4PLJC 4M1DH 5E9DB 4PJDE 2EDFA 2DI7A 4G9DA 3FOLA 1KTRL 4LBEB 3RZCD 4XMPH 5DLML 4OKVB 4JQIL 3GO1L 3WJLC 5J9PA 4QHNB 1JGUL 5I8CA 1OSPH 1A2YA 1JWSA 1ACZA 1Z0MA 3MXVL 2EZ0C 1XGYL 4MJIA 2IQ9L 2VJXA 1BZQK 3KDMA 4B5EA 5I0DA 1L4IA 4NFBA 4R4FL 5E8EB 3CFCH 1RZFH 3SDYH 3Q48A 1RUPH 3GMPA 5DA4A 3K80A 1KJ2L 2PYEE 1HHKB 1IQWH 3VD5A 3GZKA 2RFXA 3N1MC 4G3YL 4MA7H 1S78D 2X7LB 1KN2L 1RMFL 4LSUH 2VDPL 4HLZG 3ZHKA 4A6YL 1I1FA 1PAMA 3ZE1F 2WZPD 2AJXL 3GJEA 3HZMB 2HJFA 3DUUB 3L95A 4RFOH 5I16B 4XVUC 5D1XD 4Q58C 2DIJA 1MJ8L 3DX9B 5CJ5A 4PJ5E 1N2RB 2EKSB 1JHKH 3RRQA 4Z0XA 3VXNB 3DMMB 1FRGL 1UKQA 1QO3B 1OP5K 1CFVL 4EZMA 1Z5LA 4LVEA 5E6IA 3EDKA 2MOVA 1KUMA 1ES0A 5HPOA 2NTFA 1MELA 2CKBH 5HPMA 4G6FB 4LPVA 3B6SB 1HQ4B 3IS1X 4NQXA 1M7XA 2YUXA 3BZDA 1V8HA 4JO3H 3FMGH 5DJ8B 3MJ9L 3UPCA 2A83A 4EQ3A 4X4MA 1LP9F 2IPUG 4HIJA 1FO0A 5CD5D 1KBGL 4ZSOB 2QR0A 3UYPA 4HJJH 2HJLA 2H1PL 4P23B 2Z92A 5D7JA 4HWEH 4FXLA 2VN7A 2X9XA 1JYWA 1KG0A 3SGKC 5IG7A 1CE1H 4NQDA 3P4OB 3ZKMD 4NC1C 4F58L 4OGYH 1A21A 4DTGH 1UB6A 2AQ2A 4WY7L 2D0FA 2KL6A 1MNUH 3HE6A 4QHMB 3V8OA 2V9QA 1QSFD 4YXLH 4PJ8C 4BFIA 1T1ZA 2VWEE 1QYGL 4FQPA 3QA3B 3CMOL 2FR4A 1WBXA 4OM0L 1VFBA 3B9KA 2VR4A 1JWMA 2MCPH 2UUDH 1FPTL 3U0WL 1JN6B 5CZXD 4Z7OF 3MNVB 2AJVH 2XNAA 1MIEL 5CJXA 3T3MF 3GKWH 2BVUA 4L3CB 3F5WA 1U3HB 3GBMH 2ATKA 1FZKA 4OCYL 1YY8B 3QIWA 1GGBL 1A4JA 4RGOL 3VDBA 1B0RA 4R4NC 1G1CA 4S1SH 5F1NA 2LAGB 2X40A 1KCRL 2YSSB 3ULVH 4Y19B 2DQJL 2BVYA 3DTXB 1F58H 7FABH 5DD3L 2F8OA 1O7SA 2AXGB 1JTOA 1DDHA 3TPUB 3CFDB 2YPLB 1KFAL 5CD3A 5MEOB 1A64A 1P4LA 1BQUA 2F8VA 3ARDD 5DEFB 1H5BC 5CJOH 5BJTA 4NQED 5IVXE 1K2DA 1BBJB 1QEWA 4CN1A 2GTWB 4YXHH 2B2XL 3C5JA 4NKDA 1T7YA 5HHOD 5D96C 5I8KH 1LO0H 5F6HI 3L3KB 3WKMH 5IGXL 5CWSB 1A6ZB 3TFKC 2GYSA 5I73C 5E6YA 4GS7C 1XCTB 3BYYA 1QRNA 3UDWA 5IMOA 4GMSL 4P2CG 3ORJA 2BP3A 2WWMC 2HAZA 2ZOKA 3MBXL 3F58H 1AKJB 3QIUB 4NM8L 4OSUH 4ZQKB 4BZ2H 5EUKB 1MHHA 3TZVA 4Y4FC 4IRSA 3MJ8A 3S5LB 3O6KH 4NHUA 5BS0E 1YYLH 5BRZB 1ZT1A 5FGCE 4HV8B 5GJSL 4BSVB 1E28A 3IDIA 4PP2B 1R3LB 2YHGA 3R8QA 5IFJB 3BX7C 4NRYB 4M8QA 4D94A 1W0WA 3MREA 4HF5H 2HFEB 2P43B 3H3PL 4O2CB 1QQDB 3ETBF 4HIXL 3PHQA 1CN4A 3QEGL 1RZ8A 5D7SH 2AXFB 4IJ3C 2P46B 1FFPA 4UIMB 3FRUB 3OKLA 1LEKA 2BY2A 4I8DA 3BW9B 5GGQH 4I3RL 3MUGA 4EUPG 4ODUB 3ULVC 1G6RB 5DYOA 3ARED 3O3EA 2A6IB 1VACB 1AJ7L 4ISVB 4GBXC 5IEHA 4W6YB 3WN5A 5HDOA 1DUZA 3VD9A 1MHCB 3LQZB 1D6EB 4BQ6A 1JGEA 1QFUL 5F7MC 1UH2A 1G0DA 2NY1C 4AEFA 2YZ1A 4R0LA 4LF3A 3DUSA 3EO1B 5HHME 2R4SH 4HEPG 3QEUA 2WWKO 3OAZH 1FN4A 1WZMA 1KJVA 5IR1B 3E6HB 4X5WB 4KJQC 3QUMA 5ITFB 3ZE1E 3CXDH 3KXFB 1P7KB 1L7TL 3KPRD 4B0MM 5D7LD 3RBSA 3SCMD 4FOMA 3QUZC 5LWYH 5EO1A 3DETC 3ARSA 2Q86B 5IW6A 3G5VB 4L8BA 1CFSB 4D0DB 5EBLA 2XWTB 3VJ6A 1BVKB 5H2BA 1XGUA 2C26A 4PGBB 1KLGA 1UADC 3U0TA 5JW3H 4NFCA 3X17A 1A5FH 4X6DE 2Q3ZA 3ZO0A 3V2AR 1FYTB 3MV9B 4HPYL 3BN3B 3WIFB 4ZS7L 3QXDA 2E7MA 4XMKH 3KJ4C 5L2KD 3S8WA 2XG4A 3RDTB 2Y36L 5DJAA 1B0GA 2YXFA 4YHPB 1RIVL 1B0WA 3PABB 1NCDL 2FX9L 3WHXA 4CVZB 1T5WB 1WFNA 4KMLB 1NGXB 3TIDA 3O8XC 4JFQB 4PTUA 2VUOA 4GO6B 1U8MB 4PGEB 2VDRH 4N9OB 2CH8A 3UYRL 1PY4A 5EOQH 4NP4L 4OLYL 1BVLB 1GZPA 1NC4D 2Z35A 3LD8B 3ESVF 3WFEL 2VXTL 5DFTA 2UY6A 4LSVL 3HMXA 4GRWF 4N0YL 5DI8B 5FYJD 1SEQH 2HRPL 4JRXE 5BVJA 4YK4B 2YMXL 2D7TH 3HPJA 3WS6C 4UTBL 1ZHBA 1AD9A 4JFEB 5KANG 1CXEA 4TUOB 2AABH 4AEIL 4WJ5A 1Z0NA 1A8JH 3GSNA 4O2FA 4JM2A 2QJDA 2NLJA 3EZJB 1PG7L 4HS6A 3HPLB 2JTDA 4IDLA 5C0IA 1HH6B 1A1OB 2DL9A 5F1OB 3AUVA 5E08L 5DT1L 1UZ8B 2FB4L 3B2VH 5B39B 2ZSWA 2E9JA 3RVXD 12E8H 1FSKB 4Z7OE 1U2HA 1WUNT 2I26N 3T3ME 4HJ0D 3OTTA 5GSRB 5CEZH 4ODSL 4KK9D 4CBPA 3G6AB 2DYPA 1NBZB 4DUWA 4FQQB 2BOBB 4DGIL 3X12B 2ZKHH 1XCQB 3KPSE 4U1HA 4Z7UE 2XFXA 1KTKE 1XGQB 3TBVB 2OQJA 1I1YB 3RWGB 1GHFL 2F74B 5ICZA 1I8KA 3SKJL 3IJYB 1DBBL 2VRAA 35C8L 3CC5B 1ITCA 3D18A 3KJ6H 5E1AA 2IFFL 4EXPX 4M6NH 3NBNA 5JW4R 1NANI 3LN5A 1CD8A 4WV1B 5GS1C 3MLSH 4HZLA 3ZT5A 2GITA 1VESA 5DR5H 4UQ2B 5IV2B 4QHUA 4NWTH 4YPJA 1E6OH 4XNYH 2ZSVB 3UAJD 4LKCA 4DVBB 4PY8J 5CUSL 2Y6SC 4I4WA 5JW4Q 2VITA 4J1UA 5IHLB 3CLEH 2IBZX 2X4TB 1T2XA 3F8UB 5C0CB 2EYSA 5BV7L 3I75A 3JV6A 4HQQL 1P7QD 1LQSR 3QT2A 3QFDB 2FL5A 2ZCKL 3QUXC 3RWEB 3QPQD 3TT1H 3MLZL 4K3EL 1EHXA 2YD3A 4UOW0 3CCHA 1J12A 1U93B 2CRIA 2XZAL 2ESVE 4KRPB 3SO5A 1NGQH 5EC1B 1KPUA 2CK2A 2R9HD 4HT1L 1IC5H 2F5AH 1HQRA 5AD0A 1VFAB 1H0DB 3TBWB 2PW1B 1NJ9B 4HWBA 1J9CT 3HC4L 3ZYOA 4ZFOL 4I9WD 3MMEB 2AK4B 1XIWD 3NIGF 4HWNA 1U91B 4KGJA 4Q0XL 5TQ2H 5BCAA 2P42B 2HLFD 3QDMB 5CHNA 5T3XH 1RZGA 1FO0H 4UB0H 5D1ZC 4OZHF 4ZUSB 4JVWA 3JTSA 1IEBB 3HE7A 1AD0A 3V7AG 5ESVA 5EUOF 3WSQL 4JN1L 4P2RA 2V17H 1QLEL 4PR5A 4WWKB 5A2FA 4R26L 1ORSA 3ARGC 2VLKB 1CBVL 3RVTD 3MTRA 4LNRA 4QOKA 5E5MB 2NPLX 3S7GA 4HUXB 5HTSA 5FM4A 1UM6H 3MYJB 1KJMA 3BZ4B 5DD6B 3MA7B 2A73B 5FYKH 3O45A 1NC2A 2M26A 1QVOB 3ARBC 3UJTL 3S36L 3WNKA 2H8PA 4X98A 4PLKC 1A3RH 2APWA 5TGBA 1BQLH 1CL7I 1FDLH 3BH9A 2DIAA 3GK8H 3VFOA 3AM8C 5DTFB 2N7BA 4I0PB 4ZD3L 2XZQH 2VXVH 3OX8A 3D69B 2BJML 1R5VB 4X4ZA 2VQUA 4L8CA 5ETUA 2HKHH 4Q6YA 3QDGD 4CVUA 1W72B 5T1KB 4QYOB 5T5NG 4PP1D 1RUMH 4F7CB 2QEJA 1OAUL 4ZNCD 3TBYB 3LZFL 1I3RB 1TMCB 3MFFB 4F7PA 5TF1L 2CUMA 3O3DB 5IFAH 1J05A 5E8NB 4PRNB 5IMKB 1YN7A 1S7XB 5D93B 1HINL 2X41A 1U3HC 3TN0B 4LSPL 2DF3A 3RUGA 1DBKL 4ZAKD 2P24A 4P2QD 3WEXB 2IAMC 2HVJB 5C0JB 4JG1H 2IALA 2PYFB 1EHAA 3FAWA 2CLVA 3RL2A 2YD6A 5GRUL 3EOAB 4MB5A 4TPRL 3BUTA 4KVNH 2DM7A 4FQLH 4U2ZA 1SMAA 5KOVC 5AZ2H 4XP9H 4D0BA 3TA3D 2PN5A 2G60L 3D39D 1T83C 2HG5A 2YPVH 3BOVA 3KR3H 3PNWA 3MRLA 2A2QT 3CFJA 1FIEA 1MRDH 3OB0H 5I1KH 2BFVL 3MV7D 3P30L 2Z93B 3DROA 4F2MA 2Q3AA 3NH7L 3SKMB 3FO1B 2Y7QA 5IB3A 1PSKL 2VZTA 4TSCL 4F9LA 4F80A 2FIKA 5JHDA 4YJZL 3U1SH 2PCPA 4W4OA 4K3HA 4BZ1L 4PJHB 3HR5A 1MAML 5F71A 2ICES 3K0WA 2G9HB 1KENH 4DN3L 5DRXA 4X6CF 2J8HA 4FXGB 5CJQL 3P4MA 3S88L 3E2HB 2B0SH 2ZUQB 3P11H 3QIUC 1HKLL 4NRZB 1MREL 3G5YB 1F6AA 2EDLA 5DJYB 1K9TA 1LDPL 4I5BA 2FH6A 1R24B 1EEYA 5IW3A 5IMMB 1H3WM 4JR9H 3HC3H 2X42A 3UJIH 4L4VE 4FQCH 3D9AL 2BSSB 3GSQB 5DMJB 5C0BE 3C8DA 4Y88A 5EIVA 3T3PF 5DJ6A 4P5TB 4XP5L 1N8ZA 4YBLB 1IGJA 2BVQB 4ELMF 4R97B 1IC4L 3QUMH 5B4MD 1C5BL 3VFNB 1UXWB 3DXAA 3KYAA 5J4MA 4JY6B 2NXYB 4KXZI 3S34H 1XZ0A 4Z95L 3WDIA 5D9SB 3TVMD 2NX5B 2YS4A 1SBSH 2IH1B 1BF8A 2V2XA 1I7TB 2IPTH 4BFBD 2G75B 2AGJL 2LTQC 2X4PB 4RAVA 1ZLUK 1LILA 2EEBA 5BZWB 1DVFC 3ROOB 4P4KB 3KPMA 1IAMA 4YDVA 4Z7VA 1YEGL 5IBTL 1LO2L 2NY6B 4Q7DA 5EPMB 3G04A 2E27L 3INUH 1VEPA 2VLRE 2P5ED 5IROA 1YEEL 1KXTB 1WICA 5ID1B 4ZUTB 4F7EB 1WEJL 3BKYL 3PWVB 5HGBB 5FGBA 3SBWC 1J5OL 2X4OB 4OBSA 4OUUB 2ADFL 2FSEA 2R4RL 2X09A 3LKPB 5ISZD 2ATPB 3ILQC 3C6LB 4K7PY 2Y9RT 3OR7A 1CDUA 1UFUA 2BSRA 2D4DA 1J1XH 3CIQA 1L6XA 2XN9A 3QFJE 3V4PH 4OZHE 3TESA 3DVGA 4KY1H 1CL7H 5EUOE 3H9SB 3HMXH 4YO0B 5IESH 4J7RA 3W5MA 1YEJL 3RGVD 3C09B 1OT2A 4G8IA 1YPZB 1UZ6E 4Y8DC 1YNTB 3QWRA 4O9HH 3FRPA 3QI9D 5D71H 4FQXC 4YGVB 5KAQF 2Y07H 3GSNH 4HUUA 5DRZB 2UYLA 2XZZA 4YHNA 5J1AA 3VXMA 1S8DB 4U1JB 1RUKL 3DRTA 4P2OC 1J11A 1OGAE 5C0AA 1FE8H 3F7VA 1MQKL 3VMOA 1FAIL 4JDVB 4DGVL 1DEEA 4NIKB 3GEWB 2APXA 4G5ZH 3SJVE 4D9RE 2C9AA 1ZGLB 4NSKB 2L0DA 3JWOC 4HS3B 3RU8L 5J12B 5JOPE 4PJXA 3HNVL 2H3NB 4YK4C 1G0XA 2W92A 3BP7A 3CFBA 4Y5VB 2AJYL 4PREA 3V4UH 1QNZL 3W5NA 2WBKA 4JQXC 5EBWB 5I1JL 5JO5B 2ERJC 3SDCA 3P2TA 1XGRA 2PYEB 5DFVD 1G6VK 3L3GB 5F89A 2C7UA 1A02N 2J2ZA 1AO7A 1S9XB 4XAWL 4H1LG 5I1EH 4I77H 3PQYA 3VRLF 5FDWB 4GAYB 3BPNB 3DO7B 4V1DA 3LIZH 1G1YA 2F54A 1EEQA 1TPXB 4GKZA 2J6EL 1A6TB 2BNQE 4ZPVA 2F5BH 2F58L 3BAEH 4PJ5B 4M3KB 4FXKB 1ORQB 2VKWA 3OKEA 3QEQA 1PYWA 3KLAA 3QG6A 5DRNA 1UACH 1PLGL 3SQBA 1JGLH 1X5ZA 1IL1B 3EYVB 1UQSA 4LARH 4PJFE 4TULL 1LNUB 4MJID 2R2BB 4LLVA 1HHJA 1IGIH 1GXEA 3QCTL 5LAXA 4LEXH 2HTKD 1JPSL 1WBZA 1N3NA 4E42A 1BZ9B 3V9FA 4WV1C 3SEPA 5TH2B 3T65B 4U3CA 1A7BA 1HKFA 1RZIA 1TJIL 3ARFA 3CZJA 2VDNL 4HW6A 4PJEA 2IJ0C 4OZIE 3HAEB 1DBJH 4GG6A 1PGRB 4HWBH 5T1DL 3QJFA 4C59B 2DKMA 4HKJA 1AXIB 4ODVL 3FO0H 1YN6B 2DTML 3TCLA 1CG9B 2UZXB 1Z6JT 1MSPA 1P9MC 3AC0A 1DZBA 1WWCA 4BUGA 2ZG2A 1I1AB 5DDHA 4X6CE 4XBEH 3DI2B 3VFGL 3VFTB 2B8OT 1SYVA 2J7LA 1F11A 5F9AC 5JW4M 4KRPC 5E6ID 2YA1A 3O2DA 1D5ZA 2KUTA 3THML 2Z8WC 3P0YL 1G7LA 4F57H 4XCYA 1JF1B 4EI5C 2DS4A 3O4OB 4IHOA 5H94A 4TUJA 2VQ1A 5GRWA 4D9QD 4YIQB 4OI9A 5F9JB 3KYMB 3RQ3A 1CGSL 1E4WL 3BXNA 2ARWA 2XV6B 3L7FA 3HZVB 4QRTA 5T3XD 4LCYA 3T0VA 3AAZB 2EXWD 4NUGL 3C87A 4MAYA 3CPLA 3EGSA 1C08A 1T2QL 1WT5A 2QQQA 1DEDA 3HNSL 2F19L 4GKNB 1JNLL 4NYLB 4XVSL 1DP0A 5D7JD 1AQKH 3HNTH 2Q1EA 3FONB 4HX1A 3OR6A 3MRJB 4WWKC 3VWJC 2CQVA 4NQDD 3CSYA 3IXAA 3CFKA 3IFPA 5FUOL 4Z7WB 1BEYL 3BIAX 1VFMA 2HN7A 3HE6D 5GJTH 5IVXB 3GNML 5I1HL 1KB5A 3C5ZA 4MNGE 3HCVB 4JAMB 5FYKD 4JJ5B 4JHWL 4X6EB 2WBWB 4B50A 4LCCC 4ZTPL 4XHJD 5EZOH 1FVCA 2W59A 2PTUA 1XF4A 5I1IH 4G6MH 1N64L 2QHLA 2X1XR 1F2XK 4HC1L 3ZE0F 1RUAL 4CUCA 2P5WE 2LU7A 1M05B 3QIWD 4BM7A 4PJGE 4I0PC 1Q9KA 4M1CD 3VE0B 2XA3A 3W9DA 1EMTH 4M7KH 2N4IA 4LSRL 5A1AA 4YUEH 2AJ3B 2BC4A 3VWKB 3OGCB 4XB7A 1DJSA 2R0LH 2NR6D 4E41E 5SWQB 1TNNA 4QTHB 3KPQB 5I30L 1FLRL 1R3HB 2C3VA 4ZXBA 5BS0B 1SY6L 5FGCB 1JPTL 5HGHA 2XY1A 3UC0L 4NPYA 5T3ZL 5CS7A 2V5RA 4K3DH 4LLUA 1G7MA 3VG9C 3R0MA 2MQCA 1FVEA 3IDUA 1N7MH 5ICXB 2Z4QB 1RZ7L 4X6FA 1FBIH 2NY2C 3HS0A 1ZA3A 4HKZB 4CGTA 1K6QH 3KPLB 5IF0A 4FTVA 1Q72L 5CEXB 3TP4A 2GJJA 4PRAA 1EO8H 4YDLB 5CZKA 1UM5L 4DW2L 4LCIL 1EBAA 1S3KH 3F7YB 3BEVB 4Z9KB 1QRND 1YJDL 2VDQH 1JFQL 1INDH 4LLWA 4XNXL 2EE3A 5I1DA 3ES6B 4XNUH 3MRMA 4RAUB 4GKSA 1FJ1B 1A7PH 3TZVD 4C56E 4IRSD 2R2HB 5HHMB 4H25B 3ZDYF 2EC9U 3QQ4A 4X7SH 2NY7H 4LLDA 4G8GE 5DVMA 25C8H 2WSKA 4LBEA 1BX2B 4PYGA 5F7NC 4X9BA 3BO8B 5SWSE 2H2SD 5FKPB 2DBJA 2EYRA 1LK3L 3L3OA 1J88A 1WCBB 1U8PA 2GI7A 4Z7QF 4L8DB 2RAMA 2ZUQC 1N59B 4CVWA 4X5XA 1WCQA 2YRZA 1MJUH 5EZLB 4S1DC 2I5YL 4HWUA 3KHQA 4KROB 2X7LA 1FZJB 4F8QA 4LLMA 4LAQL 4PJ7F 1Y0LB 1EZVX 1K85A 1V5JA 3V0WH 3GSVA 5M95B 4MMXC 2G2RB 3HZMA 1AGCB 3DUUA 3C60B 1MRCL 4HZAA 4BQ9A 3MNZA 5HYSA 1HCVA 1UYWL 5LCVH 3MGOB 2XTJE 4JVPA 4ZYKA 1G7PB 3DX9A 4P5TC 3ZKSD 2AKRB 5ELIA 3U30B 5J1SC 3GI9H 4P2YA 1MCEA 1N2RA 4HXAL 3V6OE 1CGXA 4YBLC 5JXEA 4NO5B 3LPFA 1OAKH 4R97C 4TN9A 1INEH 4KTDH 2DD8H 2V5SA 4QRSA 5IW1B 2Z9TA 3DMMA 1UEYA 1OWWA 1I7RA 4XXCC 1QO3A 2NXYC 5C08A 2HKFL 1FFRA 5DEGA 4XPGH 1LP9B 4HMCA 3G5XB 3F65A 5FYLL 5BQ7B 2X4SB 2I9LB 4KDWA 2D7MA 4OD1H 2JB6A 1HQ4A 4P4KC 4RRPG 3AY4C 4Z6AT 1MI5E 4RSVA 2NY6C 1FV1B 3OKOB 4Y16B 3MCKB 5DJ8A 1GL4B 5I1CH 2KDGA 3MCLH 1FIGH 4XP1L 4OD2A 1FCGA 4ODWB 4UINH 5MEQB 5E6ZA 3FQWB 5DXWA 4ZSOA 2BY3A 1HEZB 4L9LC 2DQHH 2X9WA 1JV5B 4N9GB 4UOW1 4KKBD 4P23A 3WFCL 3U48A 4KMTH 3ISWA 3CSPA 3OZ9H 1XMWA 3W11D 4MB4A 1WISA 1ZHNB 3LKOB 1YEFH 2KKQA 2UUDK 3DI3B 1KC5H 1MCSA 1ZHLA 3T1FB 1GCFA 3D87B 2ZNXA 1MY7A 3QXAA 3QYCA 4LSTL 1X4ZA 4PUBL 2H9GB 2DQTH 3BSZL 3NACL 4UIKH 3KPSB 1EUUA 3WFHA 4Z77A 1DANT 5KZCD 2X89A 4Q9RH 3OAUH 4PJBF 5IHUH 3QA3A 4M1DL 3C09C 4ESKA 3BZEA 4JFYB 3Q3GB 2ZG1A 3TNMA 1SEBB 1RJYB 4I3GA 3NGBB 1JN6A 4Y4HB 4N0UE 5TFSH 1ACYL 1CLOH 1OSPL 4J23A 4QY8B 4L3CA 5ALBH 2R1WB 5HGDA 1FH5H 4JM2D 3UMTA 1JE6A 5GIRB 3LRSB 3CFCL 5EC2B 1RZFL 2YSSA 4KV5F 3SDYL 3BHBB 1JPFA 4Y5YC 3WLBA 4MMZC 5A40E 2MWCA 4BELD 5I1LA 5KS9A 4MA7L 3TPUA 4LSUL 5C9JB 3CFDA 4PB9H 5LGJA 2YPLA 3S37H 5MEOA 1OAZH 2HVKB 3BWUC 5J12C 1HHHB 4E5XB 2DYPD 3DVIA 3GMMB 5DEFA 4RFOL 4Y5VC 4WI3A 3RP1A 4YBQD 2W0FB 4CJ1A 1BBJA 3QNXB 2GTWA 2FJGB 3ZDXF 3NMEA 4Y8AA 2NXZC 1AGEA 5CLTA 4XPBH 2ESVB 2YEZB 3AXLA 3BWAB 3IYLW 3MYZA 1U58A 3LV3A 1LVEA 2JK5B 5DQ9A 1N26A 3T0ED 1F3JA 5I2IA 1IC1A 1RJCA 2XIDA 4BUHA 5I15L 1O5DT 1TPXC 3MRRB 4EIZC 3P4LA 2E6JA 1XCTA 3RVUC 4OF5A 5I76B 1NMAH 1U95A 3X11A 4LOUD 1PKOA 2CKBL 2QSCH 2W60A 2YD9A 3B8YA 4WI8A 3FQNB 5DGQA 5JQ6H 1AKJA 4ZQKA 4LK4A 2NW3B 5EUKA 4Y4KB 3S5LA 1HDMA 3LHPH 2PXYA 2GTZB 3LPGA 1AHWA 2V2WB 4JO3L 1CFQB 2HT4C 4ETQB 3FMGL 3QUYA 2W65A 4IBLT 5D2LE 1R3LA 3F6LA 3QJHA 4NRYA 4RNRA 3FOMA 4P9HC 2HFEA 4MDIA 4W70A 4HJJL 4N0FA 4O2CA 1NGYA 1QQDA 4NKMA 4PGZA 3O2DH 1J8KA 1CE1L 5DUMH 4OCSH 2BVTA 1MUJA 5DUBB 3ZDYE 4BFGA 3NZHH 2AXFA 2FEEI 3BW9A 1MNUL 3OAZK 1G6RA 2IMMA 4YXLL 1VACA 5DK2A 4ISVA 2E9BA 1D6EA 1UKSA 2WM0A 1S7TB 5FA3B 4TQEH 3K3QA 3TT3H 4U1GB 1I1AC 2EIDA 3D0LB 1B4JH 3EO1A 3GKWL 4HMDA 3TBTB 3HE7D 3JV0A 4CAGA 2OX5A 4FRWA 3U9PH 1T4KA 1I4FB 1OLLA 1KXVC 2XI9A 4P2RD 5IR1A 3MRQB 3E6HA 4X5WA 3WXVH 3QWQB 3ULVL 1I8LC 1IGTA 3RL1B 4YBHA 4NNXB 3ULSA 1S9YA 1F58L 4U2YA 4RISH 3KXFA 7FABL 1CU4H 1JCKA 1P7KA 3O4OC 1VFOA 4QOKD 3IAPA 1S7VA 1KJ2B 1KB5H 4A6YB 3HI5H 3G5VA 3OSKA 1P69B 4PRPB 4PJIF 1NC2D 3PP4L 4D0DA 1RIUH 1BVKA 5EO9B 3RA7H 4PGBA 4BQCA 4CKVX 3GIZH 1TZHB 4LHUB 3V5KA 3MV9A 3H9HB 2ICWI 1XGPB 2IMNA 5I8KL 1MJ7L 1A1MA 5ANME 3ALPA 3RDTA 3WKML 2K9UA 1T03L 4YHPA 4GRWB 3PABA 1UENA 5E5RB 1FZOA 2GUOB 4CVZA 1KCUH 3TCXA 1NGXA 4WCYH 5D6DC 3F58L 4OSUL 4BZ2L 3O6KL 3QZWB 1YYLL 4ACPA 3L1OL 1RD6A 3FFCE 2O26U 3BP5A 3GIVB 2C4FU 5TDOA 3DURA 3LEVH 5IJKA 2DM2A 2GW5A 4G6KH 3VWKC 2X1QA 3MLVH 4XWGH 4APQD 5D5MF 1CE6B 4GUPA 4U1MB 4YAQB 2E7CA 3RNKA 1V7MH 5E4EB 2W9DL 3MC0A 1IZJA 2I24N 5E8OA 4UDUB 4ZG1A 5D7SL 2OTWB 4PJBE 2X70A 1ZHKB 5GGQL 3CVHH 3CU1A 4WHTB 2R29H 4L4VB 2PO6B 4JANA 4H5SB 5B39A 4RZCB 5C0BB 5MERB 2Q8AL 5INCB 1OLZA 2P8LA 4KVCH 4YZFE 1TFHA 2HTLD 1NUDA 5GSRA 2XWJA 4PLJD 4Y5XB 1NBZA 4WO4C 5IB2B 5I18H 2PW2A 3X12A 2VXSH 1XCQA 2R4SL 5HI3D 5JHDD 1CDBA 4U1SB 4YDLC 2WUBH 4OLUL 3JWDC 2NY3D 4LVHB 3NA4A 5DHYB 3TO4A 4GRLC 3GJFA 5HHXH 1RK1B 2FHCA 4QXGH 4F9PC 3IJYA 2DOCA 3CC5A 1CFTB 4H20H 3UTTD 3CXDL 4LLYA 5J8OA 3VFMB 3U7AA 1IFHH 3S96B 4XCCL 5HVGB 4YFEA 5ABDE 1E4XH 3IRZA 1WAAA 3KWWB 4UQ2A 1VEOA 1MCDA 4QNPF 3DRQB 1CLYL 3ZDXE 4EKXA 4LCWA 5J56B 4DVBA 1ZGLM 2VLRB 5FCSH 5JW3L 2EIEA 3LKSB 2CXKA 4XVUD 1A5FL 3BH8A 1TVHA 2X4TA 3WXWH 5C0CA 4GSDL 4ZOCA 5TE6H 3VFUB 5SX5H 4IS6B 1RSFA 1YEKH 1YZZA 5DQDL 4XMKL 3QFDA 5BO1H 2MQ0A 4FQ2H 4OAWA 1R3KA 4OZGA 1MWAA 2HJKA 1U93A 4JY4B 4KROC 1Q9LA 3QFJB 4IRJB 4OZHB 3E6FB 3EZ8A 5EORH 2VAAB 3K1KC 2AJSL 5EUOB 2VDRL 3FKUS 5EOQL 4AYFA 2PW1A 2UVFA 4L4TB 1KCSH 5EU7E 2P1YA 2D0GA 3MMEA 4PFEA 3U30C 4L8SA 2A38A 4MQ7A 3WL9B 3EJYD 3QDMA 5T3ZE 4NJ9H 1A7NH 2D7TL 4LMQI 1ZT4A 2CSPA 3RTQB 3DX6A 1U8QB 3OF6A 1I3UA 2AABL 1OGAB 3P73A 2XKSA 4K9EH 5A43C 3MOAL 4XVTL 3WUWG 4UV4L 1KIUA 3DV6B 3QAZB 5ACZB 1S7SB 4GXUM 3VGHA 3B2VL 4Y89A 5E5MA 4PRHA 2YD7A 2EC9T 12E8L 2XN9D 4YDJA 5DD6A 2E6PA 1BD2A 5CJ8A 5CEZL 3JVGC 4Y16C 4IMLB 3SGJC 4RA0C 3BQUA 3QWRD 4LRIA 5DJ2A 4JFDE 3HKFA 5I1GL 2APBA 4JDZA 3HC0B 4BH7B 1CR9L 3OKDB 4WTZA 4K8RH 2EH8L 2BVOA 3IFLH 4G6JH 1OB1B 5TQ0H 3VXMD 2BNQB 4PJAF 4M6NL 1NBYB 4PJIE 2CUHA 2C3WA 3MACH 2DQCL 3ALWA 5C0AD 3T4AB 4KZDH 3CX5J 5B3JF 1KIQB 4RQQA 4PRIE 5DR5L 1LO3H 1AXTH 4U0QB 3O9WA 5J1TC 2MFNA 3TBYA 3LDBC 4XNYL 1I3RA 4JN2B 4PJFB 3JV4B 1AR2A 1JTPA 4PRNA 4XP6H 5DJCB 2HT3C 3NGBC 4CRPA 4Y4HC 3ULVF 2BDNH 4Y1AA 1IAII 1S7XA 5MI0B 1ODAA 2NW2B 3STZB 3WYRA 5DJZB 4JCLA 2ENSA 4ZUVB 3TN0A 3LPWA 3MV8B 1AO7D 5T1LB 3WLWD 1HXYA 4TTGA 2HVJA 1D5BA 2CJUH 5C0JA 3PQYD 1Z3GH 3HLAB 4DZBA 5KSBF 1YECH 2GY5A 4HFWB 1BZ7B 3OB0K 4V1DD 3TFKD 3EOAA 2WINB 2F54D 1SHMA 4DJMA 1KYOK 1NGQL 3GGWB 4QRPD 3Q6GH 1ITBB 4RBPH 1M6OB 1IC5L 2X4RA 3BKJH 3HI1B 4EN3C 1YQVH 2WWMD 5CGYD 2P8MA 3QEQD 2VLLB 2FBJH 1A0QH 1WIUA 4WNQB 3REVA 3EFFA 4KPHH 3AFLA 4X6CB 5D5ME 2NY5H 3MRGB 5TQ2L 4ZUUB 1G9NH 5FYLE 5T3XL 5I0ZA 2Z93A 3FO9B 2AP2A 3FO2B 1FO0L 3FO1A 3SKMA 4UB0L 3O3BA 1VFUA 5GS0C 2A9NH 3IJSB 1WGOA 2V17L 3EFDH 3E1F1 1R0AH 1TTFA 1X5YA 5HHPA 3ARFD 2A1WH 4PPTA 2G9HA 4J3SA 3PL6C 3HRPA 5GRXG 4FXGA 3P9LA 2AK1H 1ZGLP 4U6XB 2J8UF 3SGEI 3G5YA 4Y4KC 5DJYA 4HIEB 3MOBH 5FYKL 1UCTA 2E3VA 2DI9A 1E27B 1AY1H 5BW7A 2GHWB 4QRRA 3GSQA 4K7PL 4KUZH 1QSEE 1OM3H 4LSQH 3BRGC 1A3RL 3MXWH 1FDLL 2EDEA 5I1AB 4WW1B 2XZQL 2VXVL 4MGXA 4MNGB 4WGWB 4Q9QH 1UXWA 2HKHL 3V0VA 5BZDA 4JY6A 2X9YA 3UTZB 1KIRA 1RUML 5FM8A 2NX5A 1EO7A 3SDDC 2P5WB 3RKDC 5EBMB 3S35L 1L0XA 1I7TA 3D25B 5DUPH 5IFAL 2G75A 3D85A 4U1GC 3WNLA 3NAAH 5HYJE 1T1XB 3AVEA 4MAYD 3KPOB 5BZWA 4XPFH 1WTGT 4P4KA 1GAFH 5BV7B 3RVWC 5LGHL 1EFXA 4E41B 3LQMA 2WQRA 3PP3H 2H2PC 4JG1L 1G9NC 4JZJA 2OTUA 4OCMC 5ID1A 2P44B 4ZUTA 4F7EA 1G7IA 5HGBA 1D5XB 4WDIA 4M6OH 4KVNL 4PJCF 4FQLL 1ZKAA 1CDHA 5C0NC 4XRCB 3C5ZD 1NL0H 4MNQB 1ZVSA 5AZ2L 2ATPA 5HY9B 1MFAH 1WV7T 3C6LA 4HUNB 1A3LH 5EOTB 3ALXA 3V4VL 3PDOA 2YPVL 3KR3L 1BGXH 5D7IA 4ZFOB 1MRDL 4RWYH 2M2DA 1C16B 3I85A 5I1KL 1MCHA 4QHKI 5JW4N 1VGKA 3H0TB 3DSFH 1DR9A 4WFFE 4Y2DB 4YLQT 1YNTA 3U1SL 3IDYC 4EI6B 4XVJH 1U8KB 2FEDD 1AH1A 5F9DC 3WJJC 4KJYB 2WBJB 4TTDD 5C09A 4HGWA 2Z31A 1KENL 1MCLA 4U1JA 4ZXBD 5K9KA 4G7YL 2AV1A 1RU9L 4AIOA 2B0SL 4K7FB 2VXUH 3P11L 4KTEH 1IAKB 1Q9OB 3V7AE 3QNYB 4G8GB 4PJDA 2FWOA 2JJTA 2LVEA 1IAIH 1NFIB 4JDVA 5F97E 3DUHA 2ICEA 4BSWA 5D1QC 4H0HB 2J4WH 1XAUA 5TDNB 3HC3L 5EZIL 1ZGLA 4NSKA 1BHGA 3AU1B 1IM3B 4MA3B 2H3NA 1HN1A 4OF3A 4FTVD 1FFOB 2GAZB 4RGND 2N1KA 1UWGH 3N9GL 5EBWA 4C54A 1B2WH 3GJFH 5JO5A 3ZKQD 2OTPA 1A6AB 2PYEA 3GMOB 3PHSA 4KZEH 1BQHB 5E03A 2KBGA 3QUML 3HFMH 1IKNA 1OAQL 2OM5A 1S9XA 3VMPA 4ZO8A 1MPAH 3S34L 2PO6C 5FDWA 3B4NA 3H3BC 2XACC 2HFGH 1QG3A 3JWOL 5CP3A 5HI5C 2OR9L 3ULVE 1SBSL 1A6TA 1HHGA 1YA5A 4KI5D 5DMKB 4FXKA 1ORQA 5HYSG 4Y5XC 3CAFA 5CFHA 5E9DD 1D5IH 5EULV 3DIFB 2VL5A 3SOBH 1S5HB 4S2SB 1VADB 5AYUH 4LVHC 5KSBE 3TLRA 3LS5H 4M9OA 1AGFA 3C5SB 4IIQA 2GY7B 1LNUA 2R2BA 1TZIA 4EQ2A 2OXHA 5L2JB 4WUKL 1MWAH 3SDXA 1EXUB 5GGUA 4HKBB 5SX4I 5TH2A 5C0RH 3T65A 1ZT7B 4J3XA 1K8IB 3L3JA 1MI5B 3FB6B 3IDJB 4XCNA 4YHOH 3MLWH 1KLFA 2Z91A 1JUFB 3HAEA 3K81A 5KSVA 4H8WH 1KJ3H 1J1XL 3BGMB 3VD4A 5GGVY 3V4PL 5D7KE 5D2NE 2C4FT 1I3VA 1A9EB 4KY1L 3S9DB 1CL7L 4X0KA 2VDOH 2WLZA 4UBDD 1YN6A 3HMXL 5IESL 4M93B 3O6FB 3BYTA 5JXED 4LLQB 2HWZH 3BD4A 5E00B 2R1XB 3D2UB 4O9HL 4YX2H 3DMMD 3RWHA 1I8MA 4GW1A 3GSNL 4MCZA 5C08D 4ODHH 5KTEL 4OI7A 1ZE3C 4K71B 3UTQB 4KJPD 4IRJC 1TDQA 3ZZ1A 2Y4SA 2R1YB 3BDBA 6CGTA 1RFDL 1ZVYA 4FFWC 4AL8H 1FE8L 2VLME 1KEGH 4NQTA 4YE4H 1OVZA 4JFHE 4K3GA 1X5XA 4G5ZL 2L7JA 5DK0B 4N0UB 3UTPE 4O5LL 3LKQB 2W91A 4OF0A 4GAGH 3KYMA 5F9JA 5IB1A 3UZVB 5GGSY 3TWCH 3ZKNC 3U9UB 2CMRL 5TE7H 5JDSB 3I02A 3Q1SH 3HZVA 1PKQE 3AAZA 3V4UL 1A6WH 1BFOB 4M8VA 3MRHB 3RTQC 2BHUA 3HG1A 4XMLH 5IT2H 1MCCA 1F4XH 1XF3A 3IU3B 4NYLA 2QLVB 3IDGB 1L0QA 4P23D 4DKFH 1DQJB 1WFTA 1S7WB 2I07A 3DBXB 3M17B 2X05A 1LGVA 3MRJA 4HBCH 3QAZC 1FFNB 4JGUA 4I77L 4IMKA 3DOSA 5KN5B 4G42B 1EO5A 5L0QB 3LIZL 4MDJA 5GISL 4MJ6A 1A4KB 1FNLA 1MVFA 3GSOA 4PBVC 5IVXA 3RZCA 2X89D 3QUKB 1C1EH 2Q76B 4ODXA 4X6EA 4WU7B 4OV5B 1VPOH 3OL2A 2VDMH 1F4HA 1JGLL 1FL3A 1JVKA 3BVNB 4TRPL 3CSGA 4HK0A 3S3SA 3GSXA 3BGAA 1U3HD 1MHEA 5CAYB 3SKNA 1I1CA 1U8IB 1IGIL 4O2EA 4KRNA 1X6NA 4GW5A 2Q20A 3L6FB 5C0DA 3ARTA 4CMHC 1F3DJ 1UXSA 2NNAB 5DC0A 5ESAA 3G6JE 4NRXB 3QG7H 3PWPB 5SWQA 4Q6IB 5J6GA 3DX8B 3KPQA 4NGHL 1NLDH 2YPLD 4QKXB 1XR8B 2WK2A 5BS0A 5KG9A 3H9YA 3U83A 1DBJL 3UBXI 4HWBL 4WW2B 1VERA 2NQCA 1BLNB 5C1MB 4PS4H 1FC2D 1N0XH 4NQVB 4L9DA 3G9VA 3C8KB 3DGGB 1XH3A 3EYOA 5K93A 2KZ1B 4CNIB 4HKZA 4PLOB 3REWB 1UJTA 3WV0A 2XPGB 3KPLA 1LD9B 4Q2ZA 3FCTA 4EBQH 1TCRB 5CEXA 5AG9A 4J3UA 4YHKL 2VQTA 3L5WA 2CIIB 3FL7A 1K5NA 5F8QC 4UUJB 1CICA 3F7YA 5MENA 4YHMH 2Q6WA 4ERSH 1NEUA 4F57L 4DVRH 4RAUA 1I7ZB 1NAMA 4QHKJ 3QIUD 1AKJD 1R6VA 3PWNA 3DSNA 5J6HB 2PXYD 1EX0A 3MLTB 2DTSA 5I17A 3QUYD 3STLB 5DD0L 5IP4A 4NN7C 4NN5C 4P3DA 1BX2A 3WFDH 4OB5L 3BO8A 1VDGA 5CEZE 5GZOD 4K55A 5SX4H 4AENB 3M1BB 5FKPA 4RA3A 1O7VA 2DAVA 3CLFH 1FNAA 1OTSC 5TE4L 4GRMA 1R5IA 4J3OC 2QV2A 1T21A 2HMID 5IMLB 2BSED 1N59A 4MJIE 5F96L 4D8PA 1DQLH 3OG4B 3ROLA 3QQ9D 3X3FL 3FQRB 5C07E 2CD0A 4Z8FH 3WFBH 3CXHK 2DLTA 3NOIA 3MRNA 4WI2A 4E0RB 3U82B 4X6DA 3IDMB 3IF1B 4MX7B 5EZOL 1Q38A 3KPPA 3PUCA 1AGCA 4M5YL 3C60A 3SE3A 3ZDZF 4LQFL 4L29B 5ANMB 3MZGB 4JKWA 4N5UA 1RZKH 1G7PA 1V7NH 4KUCF 4ZDHA 4Z5RB 2AKRA 1BFVL 2H32H 4XI5C 5E94B 2X1PA 2JJSC 1EMTL 4M7KL 5IUSA 1CGWA 2BVEA 4PB0H 2H45A 3PGDB 4YUEL 4S11A 4MS8D 5IW1A 4DAGH 4TVSa 3ZE2F 3F7PC 3KXFD 5E8DH 2R0LL 2HA1A 5CSZA 2F15A 4LASH 4JZOB 1WITA 3MUHL 5BMFH 5EU6E 1DLFL 2P8PA 1TJHH 1II4E 3G5XA 2YN5A 1WF5A 3FFCB 2DM3A 3S4SB 5BQ7A 4K3DL 4RFNB 4DFIA 2I9LA 4JRXA 1OTUC 4G6AC 5BV7C 1FORH 1LK2B 3LKNB 1N7ML 1OF2A 5DS8B 3MV9D 4QWWC 2ZOLA 3OKOA 4M4PA 2JELH 4MA1B 4ODWA 5MEQA 3RDTD 1DUYA 4PJBB 4Y19E 1HEZA 8FABB 4ODBD 4N9GA 1JV5A 1EAJA 1S3KL 1J0HA 1U41A 1JZ3A 1ETZA 2OSLB 4X4ME 4WFEE 3WCYA 3WS3A 1INDL 1ZHNA 3LKOA 4PG9B 5GZND 5JNYB 4XNUL 3B3IB 3QSKB 4ZODA 5K59E 1A7PL 2HT2D 1KPRB 3P9WB 1GGCH 1SQ2N 2GIYA 4DZ8B 4JQVC 5IOPB 4D0CA 2NY4D 4OIBA 4WHCA 4Z7UA 3ARDB 5LQBH 3B5HA 2YWYA 3PGCB 2WLYA 5CILL 4JM2F 4P57B 4NQEB 2CLRB 4WI7A 4Y2DC 25C8L 5GGRY 4JFYA 3Q3GA 3ZYZA 3OQ3B 1U8OA 2WMPA 1NGPH 4JFED 3E8UL 1TVBA 4G8EA 5HHOB 4QY8A 4NQUA 3EAKA 4Z7NE 2R1WA 2WBJC 4K07A 4J3TA 4TYUA 5J0BA 3LRSA 5J13B 2IANE 1HNFA 5EC2A 4ZS6C 1GC1H 4OBRA 2KZWA 3BHBA 5T1MB 3SY0A 1MJUL 5CP3H 3VGEA 4C83B 4K3JH 1RJLB 5KVFH 1YNLH 4NDMA 4DOHB 5AAMA 3IFOA 5FF6A 4NM4L 3V0WL 2WW8A 2HVKA 3BP4B 5BRZE 3EHBC 4OZ4B 5GGTA 3TYFB 5ADPL 3H3KA 1NAKH 1OD9A 1XEDA 3O0RH 4YDIH 3MO1A 4X5LA 4N0CD 2HH0H 3MBEC 2R23B 4NT6B 3GI9L 3MRFA 4X99B 3TO4D 4P46A 3C6SA 1OPGL 1OAKL 3VXOB 1CXHA 4NZTH 1YY9C 3RY4A 2ESVA 3BWAA 3CK0L 2DD8L 3RPKA 3IETB 5JMOC 1CF8L 3GB7B 3AS1A 2AQ3A 3HRZB 4HAFA 2O5ZL 4OKDA 1DN0A 1DQML 4NQCE 4KQ3H 5HD8C 2DLEA 2A0LC 4XPGL 3AS0A 1XR9B 1U8NA 5B3NA 4MWFA 5I76A 4AG4H 1ZLSH 5CZVH 3HAEH 4LCWD 1DQQB 4O51B 1D9KA 3EJJX 5CKAA 3FQNA 3B2UC 4OD1L 2DL2A 3LB6D 2Z8SA 2QQNH 4G9FE 1NBVH 1RHFA 4MQXC 4NN6C 5C0CD 4U1IA 3OV6A 3EYQC 3IKCA 4PRDB 4RAHA 5A2LH 2VE6A 5I1CL 3ULUH 3MCLL 1JMXA 1D5MA 2DKUA 4UINL 5IM7A 4OLZH 5AZEH 5I9QC 4M7LT 2YR3A 4Z78B 3OZ9L 4DGYH 4EDXB 3K8KA 4HHAB 1J18A 4NOFA 1KC5L 3QULB 2AJZA 3OJDB 3KPRB 5SV3A 5D7LB 5HVHC 3DX7B 2DQTL 4EUPB 4KRMB 4N1EA 4M93C 3OAUL 3FT4A 5IHUL 1QFWI 5L6YL 5DFWH 1FYTE 3QDMD 3OB8A 5AUMA 1S7TA 1IBGH 3DVNB 5TFSL 1CLOL 3D0LA 3TBTA 4P49A 4PJIB 4XAKD 1G7QB 1NMCB 3VXSE 5EN2B 5E4IA 1A6VH 1BJ1J 4PRIB 1CTOA 1Q94B 1F4WL 3SE9H 4WWKD 3GMQB 4FFZH 4NNXA 4OTXH 4P0DA 2V5YA 2GSGB 4NWUH 1P84J 1JNHA 4TVPE 3V6ZB 5I66B 2CRZA 2Y5TB 1TLKA 4PB9L 2G5BB 3S37L 4A6YA 1HYRC 1OAZL 1L6ZA 1BD2D 2XA8H 1QPPA 3QH3B 4KKAD 3CDYA 2MCG1 5E2WH 3P40A 3BN9C 1QBMH 5JMRA 2JB5H 5F70A 1TZHA 2P4AB 4LHUA 1HILB 3Q6FA 2D9QB 1W8OA 1I75A 1IILE 4TSBL 1BWWA 3A67H 3IFNH 5JOFA 5L0QC 2BY1A 4MJ5B 2A6KA 1LE5B 1MCQA 2GCYA 4GW4A 3HI6H 1ZV5A 4UT9H 5JLZB 1NMAL 1A9BA 3MGAA 4BKLA 2W0LA 3O9WD 4N8PA 5D5MB 1G7HA 2FATH 3U2SB 3RUGF 3VDCA 5JQ6L 3VXUE 1BAFH 1MFEL 4DQOH 2IC2A 5KSAB 2CDEB 3LHPL 1UC6A 3L3HB 3QNZA 1F90L 4WEBL 3PHOB 3TN0D 3GIVA 5GHWH 2IQAB 2BNUA 1CVSC 1ZTXH 3MX0A 3I6GB 1NGWA 4ALAH 3A6BH 2RR3A 4U1MA 1DL7L 3O2DL 4Q6IC 2OL3B 3VXQB 4UDUA 2YOCA 5EIIA 4NHCH 1MCIA 1QA9A 2OTWA 2DKSA 1NAMH 2PETA 4X4YB 3W0WE 3AMKA 5K9QI 3MLYH 4H5SA 1QSEB 4ONGH 5C0BA 1JGDB 4ONHB 3OHXB 4UV7H 3VRIA 4WWID 5KOMC 4TQEL 2X4NB 4Y5XA 2ARJQ 1V3MA 1B4JL 1C12A 4U1SA 1P7QB 2QTEA 32C2A 4FQ1H 3S6CA 1T89A 1LEGB 3IU4L 2NYYD 3MUZ1 3HTLX 3WXVL 1ZS8A 3MRDB 4CVXA 4RISL 1CU4L 4PJ8B 1OCWL 3BP6A 1S78C 5SX5K 1KB5L 2FZ3A 2R0ZH 5HYJB 2E8ZA 1ED3A 2YRLA 2MKWA 4S1DD 1I85A 3HI5L 2E7BA 5FO7A 5FO9A 1I9JL 1CD0A 2AK4E 5CEYB 5B8CB 1N5YH 3MZTA 3DRQA 4QRRD 3MNWA 3JWDL 3RA7L 2ENYA 3GHEH 2VLRA 3R1GH 2R0KH 5E8PA 3FN0H 3RY5A 5IWLA 3C08H 1A7QL 1NFDA 4CN4A 3QDGA 4ZUWB 4JJHA 3NFNB 4XCEB 3GSRB 2J88H 1B3JA 4XNZB 2QQKH 1CK0H 3RY6A 3WIHH 2EEAA 2VLKE 2XZCH 2NXYD 2V7HB 4PG2C 1KCUL 4WCYL 3QFJA 1C7SA 2NX5D 1H8OA 1QFWH 4Z7VF 3RHWK 1RZJH 3DO3A 5IVOA 1GZQB 2X6MA 2CKBB 4RMTA 2BXYA 1BQHG 4F7MA 3U46B 2GT9B 1CIDA 5D96B 2OJZH 5EA0L 4P4KD 3GMNB 1T5XA 3WL9A 1YC8A 1CLZH 1IQDB 3L9RB 1O0VA 1CFNB 4G6KL 2ORBH 4WI4A 2OJEA 3VGAB 5I73B 4XBGA 3MLVL 4XWGL 4GS7B 1PQZA 1UH4A 4WHYH 3ZTJG 1V7ML 2VISB 1V3KA 1VGEL 3TNNB 2AEQL 3BRDA 2DQIH 1A7OH 5D8JL 1NBQA 1NGZB 3B83A 4Y4FB 3SJVA 4BQ8A 3DV6A 5ACZA 4QTIH 2DLGA 3CVHL 4HPOL 5EWIH 3C6LD 2R29L 1HK6A 3EJZD 1IRAY 4P2RE 4U05A 1OD7A 3I6LD 4UTAH 4PJAB 4KVCL 5C0EB 5F7EL 3V5DB 5H35B 3H9SD 3BFOA 4NJAH 2W9EL 2FX7L 4OQTA 1GGYA 4FABH 3C8HA 5I18L 5CZXC 3MV01 2VXSL 4XGZB 4IMLA 3EOBA 1T04B 3N50A 2H6PB 5HHXL 4ZAKB 4QXGL 5C09D 4JPVH 2D7OA 1JHTA 2BNQA 1N4XH 4H20L 2HP4A 3UBXG 1G9MH 3V0AC 4LPCA 1X44A 1IFHL 4NKIH 4LPTA 4PJXF 4CW1B 5C7XL 1E4XL 1JHLH 2NY1B 3C2SA 4H0GA 3ARDC 1S9WB 5KSBB 5BXFB 5GGTH 4JN2A 5E7BA 4PJFA 3D39B 4X80H 1X5KA 3MJ7B 5DJCA 5IVZB 5CINL 3WXWL 4XPAH 3RWDB 4RBPK 3EYFA 5TE6L 3MV7B 1MVUA 1T20A 4HIIA 2JJWA 1MCNA 2PYED 3TC9A 4X4XA 4JKPH 4GH7B 2EE9A 3KPNA 5BO1L 5KVGH 3QUZB 4HJGA 1SJEB 4FQ2L 2FEEL 2X4UB 4YFDB 3HLAA 3BT2L 4R7DB 4OZIA 2DN7A 4HFWA 2C1OB 3AMLA 3LSOB 5A2IH 3BIKA 2YPKB 1AQDB 1QHOA 3GGWA 5D2NB 2ZCHH 3V6BR 5C8JB 4PJ5D 3HI1A 4C4KT 1KCSL 3X13B 2CDFA 4KH2A 5LBSH 3IT8D 5F7DB 1J0JA 3TF7C 1HSBA 2RGSA 3FHAA 4WNQA 5SV4A 4X6CA 1K8DA 1OGTB 3KJ4B 3SDAB 2RHEA 4ZUUA 1PD6A 1JZ8A 5KBNC 1YEHH 1A7NL 2FDBP 4I3SH 2VABB 3QDAA 4PJEF 2BSTA 3N1FC 3LN9A 1YMME 4NO3B 3RWFB 3O8XB 5B21A 4K9EL 4GG6F 2C3GA 1TVDA 3F6IA 1U8JA 3ZLQC 3LAFA 3G6DL 5J89A 5EU7C 5MEPA 1OOAA 3NPSB 1K4CB 3GBNL 1KTLA 3AREC 4QXUH 5DHVB 5FXCH 3RJDA 5FYJH 2BHZA 5JPNB 5ERWA 4YNYA 3WIIH 4I2XE 1BMGA 3QI9A 1E27A 5GS0L 5B38B 3QQ3A 4JDTL 4NKOB 3QEHB 3MGTB 5TPWH 4ZO7A 3H42L 3RX7A 1U2CA 2LFGA 4CN6A 1GGIH 4K8RL 3MXVH 3IFLL 1IVLA 4G6JL 5E99H 1XGYH 4JPWH 4WW1A 5TQ0L 2P5EB 2A6DB 1YJDC 5TDPB 4JFXA 2YUVA 3MACL 3SCMC 2EDRA 4KZDL 1EV2E 2P47B 2YC1A 5ADOH 4G3YH 1LO3L 2MNUA 1IJ9A 1KN2H 4A6YH 2VDPH 1AXTL 4KK5D 3LKRA 3CVIH 1JP5A 3DXAE 3PP3K 1R5WA 3FT2B 2P5WA 5A2JH 5C3LD 5HVWA 3CH1A 5HGAB 4LFHD 4PJGA 4XP6L 5INDB 5DMIH 2BDNL 1KB9K 3KPOA 1OTTD 4BH8B 1NMCC 5HJ3B 3VRJB 3G6JB 4ODTH 3VCLB 4FQHB 4LVOC 4E41A 2D7PA 4Y2OA 1NFKA 2GJ6E 1FRGH 4HKXB 1Z3GL 4Z7VE 4OD3L 1YECL 3X14B 2V2TB 5HDQH 2QHRH 4P4RA 1IGYB 1KEMH 4R3SA 4JO1L 3Q6GL 4G43B 3BKJL 3RWCA 5F7WC 3OKNB 2CO7B 4R7NB 5E70A 3D3VE 1NDMB 5D70H 2FBJL 2VIRB 5FHBH 3VGDA 4KPHL 2NY5L 4P5KB 3UEZA 3QUXB 2LVCA 1C16A 1G9NL 3MQIA 4BYHA 3ELAT 5JHLH 4R8WL 1KBGH 4UQ3A 1FNEA 3KYOB 43C9B 4NNPH 4HUMB 1KELL 4HH9B 3STBA 2H1PH 3EFDL 2D7QA 1R0AL 1E4KA 2WBJA 2A1WL 5IFHH 1TTUA 4C56A 1XGTB 5BS0D 5F3HB 2AK1L 4F58H 1YYMH 3RVXC 4XH2B 1IAKA 1Q9OA 2XWBA 3QNYA 1X7QB 4I18A 3FAXA 3GJFK 2RIKA 2D31B 3MOBL 5KSAC 4HJ0C 1NFIA 3QO1A 4KK9C 1AY1L 3NZ8A 1KLUB 5D1ZB 5SWSA 3O3AA 3IGAA 1DTUA 4G9DB 3FOLB 1IM3A 4KUZL 3H6JA 5H8DA 4MA3A 4LSQL 3FTGA 4TUKL 3EDEA 5E2TL 1PBYA 5I8CB 1FFOA 2HFFB 1A2YB 1JWSB 3MXWL 4NQSA 5GGVL 4MJIB 3S4SG 5FIEA 4AT6B 5TF0A 4J3VA 3ARGB 3KDMB 1GGBH 1CICD 3MFGB 4KKCD 5C07B 5MEND 3I50H 1IEAB 2VLJE 4I13B 4KI5F 1KCRH 1F00I 3OKKA 2IBGA 3ZT7A 3GMPB 4H1LB 2XKUA 2RFXB 1AC6A 1JF5A 1C8PA 3ARBB 4BSJA 1IEHA 2ITCA 2OR8A 3T4YA 1KFAH 2WIMA 5HHMD 2FCBA 3UAJC 5DUPL 2HJFB 4GG8B 3UTSE 3SE4C 3V6OA 5IKCB 3NAAL 4TNWK 2EKJA 4XPFL 4AEHH 4LSSL 4MD4A 2ZCLH 1GIGH 1S5HA 1VADA 1TJGL 3VFSB 2B2XH 3MUJA 5F1IA 4MNHB 5KVMC 4Z0XB 4HWZA 2FYYA 4E9LA 3LVEA 3QPQC 1C5DB 5MHSE 3EYUH 5EU6B 3LQAH 1TQBC 1UWXH 3AS3A 1HH9B 1NH6A 2LQRA 1ES0B 4Z76B 2R9HC 1ZT7A 4XPHH 4OCWL 4WTXA 5KW9H 2NTFB 2R39A 5B8CC 1MFAL 1MI5A 3OJ2C 3IDJA 1A3LL 1MFBH 4QRUA 1PZUB 4ZMAT 1JUFA 3MBXH 3ILPB 2AJUH 1XIWC 3C60D 1BGXL 1RPQA 3BGMA 3W2DH 2Y72A 3FZUD 4PYHA 3VXRE 5D6CA 4RWYL 1A9EA 3GSWA 2IAMB 4MCYB 1IAOB 4N1HB 1VKXA 2D2OA 5BOZG 3DSFL 4OZFA 2A83B 3O6FA 4JO2H 4LLQA 1FO0B 3RWJB 2R1XA 3D2UA 4WHYG 3UP1A 1U8HB 2BERA 3GRWL 4XNZC 4XVJL 1NCCH 2Z92B 5D7JB 4HIXH 2D03L 5F7HA 3MOQA 4Z7WE 5IG7B 2QSTA 2QADB 1SM3H 5L88H 5F1KC 4CMMB 3RVTC 2DQGL 1JI2A 1I3GH 2VXUL 3VFVB 4KTEL 1HE7A 5DRWB 1JTTA 3CDGB 2CLZA 2R8SH 4JRXD 1IAIL 1AJ7H 4BFIB 4OCRL 2B7DT 2J4WL 1T1ZB 3RHWF 4N0UA 3LKQA 3FB5A 2FR4B 1I7UB 1WBXB 4OQTH 3RNQA 4HULB 3B9KB 5CJBA 3VGAC 4HK3N 2IANB 5F44A 4M5ZL 3MRHA 3VI4E 3F5WB 3MCG1 1UWGL 3RWIA 1INQA 3IU3A 3CX2A 3N85H 5F1NB 1S7WA 2AEIT 3HFML 5IQ9B 2VKXA 3GMRA 4CU8A 4MJ4A 1RURH 1FFNA 5IBUG 4KKLD 1MPAL 3I3EA 3E0GA 3KPSD 2NTSP 3ECBB 1P4LB 3EW3B 3K74B 3QUKA 2Q76A 1F3DH 4UILH 1YDPA 4XBPA 5BJTB 1X5GA 4OV5A 1K2DB 1D5IL 1QEWB 5HBBA 3SOBL 1T1WB 3WE6B 5AYUL 4NKDB 5EU4A 4POYA 4J4PA 4ZAKC 4NQCB 5KS9F 3K1DA 1WLHA 1U8IA 4AJ0A</