5H4YA

Crystal structure of human synaptotagmin 5 c2a domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
ELGQLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-5
publication title Structural analysis of Ca(2+)-binding pocket of synaptotagmin 5 C2A domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5h4yA00
1DJZA 1DQVA 1V27A 2WXLA 4DK5A 3B7YA 4OVVA 2CHDA 2Q3XA 2YRBA 2D8KA 2ZKMX 1E8WA 1DJXA 3APDA 4ICXA 4KZCA 4NS0A 4XZ4A 3IBEA 3PS6A 3S2AA 1E8ZA 1E8YA 3QAQA 1DJWA 2Y3AA 4QJ5B 3QK0A 2K8MA 5G55A 3CSFA 1DJHA 5G2NA 2WXFA 4ANWA 4ICWA 3L13A 4FJYA 4L23A 4URKA 4ANXA 1A25A 1RLWA 2JQZA 3ZIMA 4XX5A 4L2YA 2WXPA 5H4YA 3T8MA 3QJZA 3TJPA 4HLEA 1RSYA 4F91B 3ML9A 4WWNA 4TV3A 1CJYA 2NSQA 3W56A 1E8XA 4LT7A 1RH8A 1GMIA 2CHXA 2WXJA 3APFA 4IHBA 4QJ3B 2K4AA 4J6IA 1WFJA 2R83A 4Y1SA 4TS6A 4F92B 4FA6A 2CM6A 4KITB 4WWPA 3GPEA 1HE8A 2YOAA 1UOVA 2DMHA 2N1TE 3M7FB 4PS3A 3RPBA 3QR1A 1DJIA 3OAWA 3F05A 1WFMA 3F04A 3R7QA 3JZYA 5EDSA 2WXGA 2QZQA 2WXIA 2A4ZA 3PFQA 1UOWA 2CJTA 4V11A 3FBKA 4BFRA 4FULA 2V4LA 3CSTA 3L54A 2Q0ZX 3LJ3A 2K45A 2WXQA 3QARA 4QAMB 4ANUA 4HVBA 4LCVA 4IQHA 3TL5A 1QASA 2BWQA 2ENQA 3NZSA 4AJWA 4GB9A 3TWYA 2WXMA 1YRKA 2RD0A 4FHJA 4OVUA 1W16A 1E90A 1DSYA 2ENPA 2WXHA 4JPSA 4PS8A 5JHAA 5T8IA 2WXOA 5CCHE 3L08A 3P2BA 3HHMA 4AOFA 4FADA 2NQ3A 2CHZA 3PYCA 3QR0A 3L9BA 3RDJA 4F93B 3PREA 4L1BA 4BGDA 1DJGA 1BCIA 3DBSA 3DPDA 4G11A 5H4ZA 4WEEA 4EZLA 3N5AA 4MJJA 4FJZA 3ZVVA 3L4CA 3ML8A 3NZUA 4A55A 3KWUA 4DNLA 4EZJA 2K3HA 4QJ4B 5CCJA 5JHBA 3NSJA 5CCGE 2FK9A 3OHMB 3KWTA 4XE0A 4FHKA 1W15A 2DMGA 2WXKA 4NPKA 4PS7A 1QATA 4Y1TA 2B3RA 3F00A 1BYNA 1E7VA 4L1LA 1TJXA 2CHWA 3PRZA 3HIZA 3F01A 4KZ0A 2WXNA 4NP9A 4TUUA 1E7UA 2Z0UA 3MJWA 4LDCA 4F1SA 2ENJA 2A5UA 2EP6A 3L16A 3IM1A 2FJUB 2KI6A 1DJYA 2UZPA 2NCEA 1TJMA 3APCA 3HN8A 4WAFA 4EZKA 3ENEA 3L17A 3W57A 2QZ5A 4GNKB 2CJSA 2LHAA 2X38A 3FDWA 3R7RA 1UGKA 2WXRA 4FLHA 5KJ7E 4NPJA 3SD5A 3ZW3A 1BDYA 2CM5A 2ISDA 1K5WA 4WWOA 4ANVA
chains in the Genus database with same CATH superfamily
1KEML 2AP2A 3V4PL 4JPKL 4G9FE 4CC4A 2XYCA 3D4ZA 1K5NB 1ZDSA 2EC9T 2ED7A 3ARFC 4QEGA 3A21A 4DAGL 3EDKA 2BNQD 3RGVC 1MIML 1ND0B 3X12B 4S1RH 5KS9A 2XWEA 4MZ2A 5KBPA 3X11B 1WS7A 1G7MB 1FVEA 4B41A 5C6PB 2A74C 1PGRB 1YEFH 2PETA 3QJHB 4L23A 3BH8A 3C5ZC 5TFSL 3LD8B 1QYGL 3V5DA 1FQ9C 4PV9B 1RJLB 4KKPA 1EMTH 1E6OL 4GKLA 4Y2DC 3ULVF 4NCC1 1J05A 4H20L 1IGFL 1JD7A 3GINA 3QFJE 1J87A 3CN0A 3U0TB 4APXA 4N0YL 1JF1A 4ZMQA 2NSXA 5IM7A 3A0OA 3UPRA 1UA3A 4ZMWA 1FI8C 3SODB 1LO5A 1KIPB 2GBUA 3MUUA 3OR7A 5IEHA 4LF3A 1OTTC 3QEHA 5TDOA 3B2XA 2DLIA 5A43C 1G94A 1DE4A 2WYIA 2VT0A 3D25A 3FYEB 1TIUA 3S2CA 3FQNA 5IR1A 5FYJE 3FCUB 3SO3B 1OL0A 4NUJB 5J1SC 2WQVA 4O4YL 3L6FB 4AMXA 1CFQA 3CZFA 4N1CA 1HSAB 3I02B 1TZGL 4ODVL 2VW7A 3NG5A 1PX4A 5D1ZA 1CF8H 2W95A 2X12A 3O6LL 4EI5A 5I71B 2DM3A 4J12A 5IB3B 1RZJL 2ADIB 4WK2B 3KL5A 4ZD3L 5KVDL 4C83B 1IAMA 4MJ2A 3OLIA 4K94C 4M00A 3O6ML 4XPAH 5C0AD 5CSZB 1L9MA 4JRYA 2QGBA 2XN9E 2AJYL 5LNDA 5C2UB 4O2CB 3Q8AA 4YHOH 2CG9X 4PJGF 2AEQL 4DP7X 5F1SA 5DEGB 5C07B 1PLGL 5IVXE 5GS2H 2XWBA 4AKQA 1CFNB 5E4IA 3EG9B 3VFTA 4YQXH 1WBYB 1C7TA 1BQ5A 1MLBB 4UT9L 4JVPA 4KUZL 1RIVH 2E5EA 4NC0B 1GZQB 3TVMA 2H2PD 3X1FA 3WKML 2G4GA 4E5XB 2H8PA 2A5UA 4XMKH 4JFQB 3L3OA 1ES0A 3HJ0A 3IPFA 3N1FC 1MHCB 4U7MA 3FDWA 4M5YH 3ZE2B 4R5XA 2R29H 4LHUD 4OF5A 4YN3A 4MB5A 5DHVH 2YO3A 3B3IB 1V55B 3AQYA 4CC4C 4M7LT 2VH5L 3D50A 4AKPA 1E4KA 5CEZL 2EDBA 4V2CB 2ZP8A 3STLB 3M8OL 2FL5A 2I07B 4YSEA 4KI5F 3DVGB 5J9PA 2P45B 1Q9OB 3SQOL 4HBCH 1UA7A 3N1GC 2ITDA 4ZOAA 1GMEA 2DQFA 4FQ2H 1ZVHA 2EIJB 2WHVA 3O6KH 5CLZA 2IAAC 3ILQC 1TZAA 2G3MA 3PF2A 5KW9H 5JXAL 3DBXA 4N9GB 3ZL2A 2K8MA 3FUFA 5KBLA 2OSLA 5FGCE 3LCYA 5LGJB 1DQDH 1FORL 2BSCA 4ANKA 1D5XB 3HI5H 1UG9A 1YECL 2R59A 3CZNA 5HJ3B 1QLEH 4YIQA 1DQQB 3AREB 2Z7WA 2LVEA 1MCDA 2BM3A 1Z5HA 1HINH 3QO0B 3P30L 1UUNA 1B0RB 4X5QA 3WUWA 5IB5A 4FGMA 4A68A 1XMEB 2K4AA 1WFJA 2CBOA 5IW1B 4F8OA 1NLBH 1A47A 3BD3A 4X0KB 5CJOL 1GIGH 4XP5L 3VD7A 2ZG1A 1YNKL 3FO9A 2DQIL 4TTDD 1OP5H 4MA7H 4RAHA 4DO5A 2N1TE 1MRFL 5D1ZC 1YQ2A 4PQXA 3LPOA 1G0DA 1BYOA 4PJHB 3MGTB 3MRLB 4R7DA 2K70A 2XVGA 1RUAL 1BAFH 5C0EB 4K23L 3X14A 4JY4B 2HN7A 1BGXL 4U1KA 2Q7NA 2K45A 1MAML 2XXMB 1DLHA 4NQCA 1FCGA 4NRXA 3ZQWA 2ZAHA 4OGYH 3PDGA 3Q1EA 5B1AB 2ZICA 3PWUB 4RAVA 3NK3A 1P84K 4J2XA 4MS8C 5D1QA 2IEPA 1IGCL 4DWHA 4KGJA 3DURA 4ZFFB 1NFDA 1YEEL 3A6CL 3ULUD 4L8CA 3KLLA 3LQMA 3UAFA 4J4PD 4LQFH 1N5YL 1FGNL 4OTXH 5JIPA 2R0WL 2EH7H 3TVMC 4IOFD 1U58A 4PIBA 5I1LB 1SEBB 3ABZA 4G6FD 4RAUA 5D2NE 5I1JH 4M93B 2XQYG 1G0YR 3NABL 5CU5A 4G6ML 1BVNT 4PP2B 1P1ZA 4P99A 4MAYD 3PNWB 4OCNC 5I82A 3FT0A 5IMMB 1CBVH 2FQFA 2JKRM 3UTTD 1J0ZA 1HFUA 3UCQA 3MBED 4AI7A 3KS0J 4NKIH 4GNKB 1KT2B 1HWWA 2HVBA 2BP0B 5JHDA 2VLRB 1M1XA 3TOPA 3F12A 2D7MA 1K6QH 4WTZG 4Z3EA 4PM1A 5D7LA 4CJ1A 4AXWA 1VCAA 3RA7H 2F1AA 1BBJB 2XJLA 4K7PX 3O8XD 4NNPH 2FIRT 2G60L 1RZ8B 2X40A 2Y22A 4I87A 3AWGA 2WXLA 2C1OA 4AH2A 4GMSL 1X5KA 4GQZA 1L3WA 5HBBA 4X5RA 2FO1A 3N1MC 1D5MB 3CXDH 5D9SB 3UTZA 3VA2C 1IAIL 4EEEA 1U8MB 2RFXB 4G6AD 3IKCB 1EUUA 2WCGA 1ZANH 5DJZA 2QHRH 2KQNA 4JAMB 4FCAA 1GJIA 3BAXA 4GBXB 5IQOA 1UVQA 1XZWA 3SDXF 1T2XA 3ORJA 2GYSA 4GINA 3VI3A 1ZTXH 1NH6A 1PNCA 2IQAB 4L4VD 4YHZL 1G87A 3GI9L 1N59B 1KXHA 2R2BA 2NYYD 1C5DB 4GG6E 4FI8A 4AEEA 4I8DA 3F62A 2QJDA 1HDMA 3TJHD 1KYOK 2X2HA 1XBRA 3WTXA 2NXYB 1JMZA 4FFVD 4E5XG 5GJTL 2PYFB 4HG4K 3PY9A 3SZ6A 3WLWC 4DERA 5IUSA 1R0AL 1ZSDB 3VXQB 1S9VA 4J27A 3WHE0 3MCKA 1ACYH 3L2NA 2CWRA 2Y25A 3N55A 4KJYA 2HPOA 5LLIC 4ZQKA 4H8VA 4IKNA 4XT1C 4MQTB 4P0DA 5IK3A 1BYPA 2NY7L 2IANE 4JN1H 5D1QC 4F3FA 2KC0A 5D7IA 4ZFOA 4QHUB 2VXQA 3SYCA 5C08B 4G3YL 4QYOA 4MXQC 2YA1A 1EHAA 4BZ1A 1RMFL 2FR4A 3K46A 4ZMVA 5LBGA 1MFUA 3HMWL 4TSCH 3DRTB 4OLUL 1G7QB 2K9FB 4RGNB 4LU5H 3QFDA 2AC0A 3Q3GB 2Z9TA 3SPHA 3FO0L 1HHIB 2A0LD 3KPRA 2EH8H 2BHFA 4HP5A 4ZBJA 4R96A 4JQIA 3MV7A 1GGIL 2H7WA 2V8MA 3US9A 4MJJA 1F3JB 5DO2D 3NZUA 3SE8H 4ZMZA 4A7GA 3SYPA 1AQDB 2VLMD 2H0EA 1XBDA 3TWCH 3CLEH 3J7HA 4JDVB 5DUBB 1O7VA 4LPTA 4XP9H 1MF2L 3CBRA 4AJ0A 3CZLA 4MMZA 4EO5A 4L1SA 3VXOA 1MCOH 2GAZB 5CIPH 3ZTNH 3EF7A 1QBMH 2R0KL 1OAKL 2MNJB 5I2IA 5KVEH 1RK1A 3HVDA 3MPCA 3MTXA 3VX0A 4JFVA 1CFTA 3GDCA 1R34A 1HEHC 4QT5B 1ERNA 2FATL 1GYVA 1JZ6A 4ORGA 4JPVL 4K2UH 1AGCA 2VL5B 1S2EA 4JQXA 1QBLH 2R8SH 3ZE0E 3LZOA 3MUGA 1JV5A 3IU3A 5A2KH 3C2AL 2CJUH 4KNTA 2YC1A 4YHNB 4CKVX 5DQDH 1MH5B 2MCMA 4NIYE 4AQAA 4ZTPH 3OR6B 1TMCB 2Q76A 4I3GA 1JGDB 1YYMH 4A2EA 3BH4A 2X4RA 4FQXB 4P49A 4PJXE 4XHJD 5EUOA 1WGVA 1DHKA 2YMOA 5K9QI 2FZ3B 1SBBA 2F6AA 3QDJB 1U8NB 4PIRF 3RNQA 4TSBH 4U2ZA 1Q94A 2ARJB 4FJYA 5D6CB 5FM5M 1A25A 3Q8FA 1KXTB 2JQZA 1NFAA 5AKTA 1IAOA 1S9YA 4ELKA 1QHOA 4KKBD 5JW5B 4MSWA 3VFPB 2VLKD 1KELL 3HCVA 3PAYA 2XRAL 2ICWA 3KPSE 5FW6A 4WW1A 5C09E 3T6VA 1KTKE 1NBZB 5FUOH 1MI5B 3CTTA 1G4RA 1AKJD 1ETJA 1D7FA 4FXGA 4M62H 3ZQ9A 3KYOA 5EBWB 2VABA 3GFUA 4PJDB 4X4MA 5SX4H 1JL8A 4KO9A 2AGJH 1SF5A 3P40A 1PKQA 3H7BA 3V7MA 4XX1G 4HWBA 4N86A 5D7SL 1U91A 3ABKB 4AKOA 1BLNB 1D7CA 4U1SB 1VZIA 1XF4A 1UM6L 2DD8H 4OLWL 2W81C 3ARYA 3DVIA 4XXWA 1DVFD 3WEMA 3FRPB 1SYVB 1QR1A 3MLPA 5ACZB 4UNVA 3TN0D 4K5NA 3UO8B 1TQCB 2CBMA 4DESA 2D0FA 2PNDA 4LLDB 2FO4B 1KTLA 1XTMA 4WFGD 3IDNB 5EZJA 4GRWB 4P2RE 3GJFH 1QSFB 4FQJL 4ZFGH 3VE0B 4A7VA 5I0VA 2OMXB 3RWIA 1H0DA 2HRGA 3GT6A 4FFWD 4F24A 4ISVB 1XWVA 3I6LE 4MMZC 4LZKA 3LEXA 4PRIA 4TNGA 1GY1A 2VZ1A 2YEZA 2H41A 4XPGL 1QFWH 3L3HA 1BEYH 1YPZB 2WBXA 4YHML 4OFDA 1JZ4A 3Q9PA 1A6ZA 5GRYA 4FNLH 1N5AB 1UM5H 4GAYA 4ZSOE 1C16B 1TJHH 2BP8A 4A7SA 4WAFA 4P2YA 4J28A 3ARFB 1R3JB 4JFTA 5SWSA 4P59L 3RGVB 1UD2A 1VFBB 4FLHA 5C0BA 1H6EA 2Z1PA 1CICC 2VR7A 1JAEA 1WPCA 2E3VA 4PJBA 1OGAE 3QEUA 1TF4A 2A74B 1OW0A 3Q1SL 3DO7B 4P2AA 3LH8A 4Y2DB 1E8ZA 2ZWNA 2JB5H 3RHWK 1MNUH 3ARXA 1G7LB 2DYPB 3NCFB 4MB4A 3N42F 2B15A 3HZ3A 2OXGB 1IAII 1PS3A 2CO6B 4L3AA 2ZX5A 2W65A 4Z7WF 4HIPA 4J1UB 3EYFB 2OTWB 4DW2L 3T8MA 3JWNG 1BFVL 2O5YH 4FXGC 1L0YA 1T1WB 2XLLA 1T80A 2NUPB 4AV5A 5DQJA 5LGKA 3B83A 4JG0L 3MLRL 1IO4C 1SMAA 3S8WA 5GS2D 2F0CA 4O00A 4WFHD 3DGDA 2PR4H 5L88H 5IG7A 3P9MB 3QJVB 3V6ZB 2NNRA 4N8VB 3LKOB 1SQ2N 1MCNA 1PYWB 4U1NB 4BYHA 1EFXA 1XSIA 3UZVA 3ULUL 2LVCA 4PLJD 1KGJA 2JMRA 2Q3AA 1HYSD 1JXKA 1TDQA 3HFML 2UV3A 4KI5E 1GRWA 1Q72H 3T09A 3PIQA 1A1MA 1P1VA 4GP5B 1L5GA 4ADJA 4QKXB 1JOIA 1VSCA 2IPTH 1OSPH 1BP3B 4HK0A 4OF8A 1N9PA 5DZOA 5I66B 3EUDA 4MJ4A 3G08A 1NGXA 1MEXH 1LNUA 4PJEA 1SYSA 4QLWA 4G8EA 1AGDB 5HHNB 5LUMA 3MRCA 3R06A 3TO4A 1TZOA 2VMCA 3U36A 1NUFA 2XU9A 4GT0A 4PMEA 1H8LA 1OK8A 1SJMA 3V4VH 3BWSA 4XN8A 2AJVL 1Z6JT 3MRKB 2H5UA 2VXTH 5F44A 2A4EA 5EZPA 5CJ8A 3WFDL 5DMIH 4DJMA 3QWOB 5FS5A 4JKNA 3O3DA 1DBAL 5EIIA 5EF1A 2EIZA 1KV7A 3SIKA 4J23A 2VM3A 3RUGB 4Z78A 1C5CL 1JPFA 1TTBA 3NFNA 5K59F 2DMGA 1DBJH 1BF8A 5IOKA 4D7PA 4FQQA 4XTRC 3II1A 4IU3A 5KS9B 4N90D 2J8OA 4BKSC 5FFOA 3RVVD 3MV8D 2JKIS 4UM9D 4OCYH 3B34A 1FVEB 2J8HA 2V3FA 4DZBA 1OW0C 1T7YA 2W9EL 5AW0B 3VXMA 3BH8B 5D7KE 1JG9A 2BOBA 1FFTB 1VF5C 1QR4A 4F8TA 5I0WA 4KPHL 1K4DA 3BYTA 3X1NA 2B08A 4J2QA 2IG2L 4DP8X 2M1KA 1HL4A 1RQ5A 3EYUH 3W9EA 1JF1B 4FC3E 4BQ8A 4L4TD 2D8KA 2EDNA 2ZKMX 3UPRB 1UM4L 3PS6A 1F00I 1KCVL 3ALWA 1KZQA 3CN3A 3OR7B 5IEHB 3LKRA 4GLRH 4LF3B 3QEHB 4PTTB 3FZUD 5TDOB 1ZD6A 4YO0A 3RJDA 1JXDA 3D25B 5DI8A 3ASNB 5IESL 3VW3H 2B77A 2XNAA 4NJAH 1FFNA 1NDGA 4HPHA 4AMKL 1M7IA 1GXEA 4JHAH 4LCWD 1CFQB 3CZFB 2Y36H 4JCWA 3KAAA 3AU1A 3T6QC 2VR4A 4WWKC 5D1ZB 4Y1AD 1E43A 2JKSA 3K5RA 3KPQA 3FMGH 1Q0EA 1RK0A 1D5BA 5JQ6L 3RTQA 1A2YA 1UB6A 5DHXB 5HTSA 1MFNA 4Y5VA 4MRBA 5I19H 4HJGA 4JRXA 4JRYB 4XI5C 2X9YA 5JW4M 3TO2B 2YEVB 2OMNA 3ULVC 1ZXQA 4Z9KB 2DLFL 1RZFL 1T0NA 1NAMA 1QP1A 2XWBB 3BJ91 5A6LA 3VFTB 3TZVB 2FLMA 3TO4C 3V0WH 2QSVA 1NBQA 5GGSA 5DR5L 2WD0A 2WYTA 3M1BB 4DQAA 3TVMB 1WTGT 4M6OH 3TCLB 4GSUA 2H8PB 3RX9A 3QXVA 2OXHA 4X4XA 5C0GA 4NO0B 4OCLC 3LQZA 3IGAA 5KUMA 1JYXA 3NDZE 4GAGH 3LKNB 4YBLC 5K9JH 3MLWH 3BGFC 2FBOJ 2XV0A 3K7UA 1DLFL 2BNUA 2FL5B 3W0WA 1SOSA 3QZWA 3S8GB 5IEKB 5IMOB 1YJDC 1OCWH 3O4LD 1Q9LA 3LDBC 4TKWA 1XGYH 1XGRB 2YARA 3N5AA 1UB5A 1UOKA 4HIXH 2BNRE 3NSJA 2NY4C 1UZGA 4M6ML 2B4CH 3N50A 4HJ0C 3VH8G 5MEPA 2Y6TE 3E6HB 5EF3A 4RWHA 3QFJB 1RJCA 1RUKL 1TO5A 3GHEL 5ICZB 4N8VG 3QEQD 1BA9A 4KMTH 4AQ1B 1JHTB 2OSLB 3Q8CA 3CVHH 4FG4A 2B9BA 4HQQL 4OD3H 4DCQB 1F2QA 4U4IA 3UYRH 1KBBA 4ALAC 1NMBL 4N0UA 3RX7A 1A8JH 3NEOA 2EDFA 2A6IB 5FW8A 3K0YA 4OLZL 2YD0A 1G6VK 4BFNA 1UD8A 2BIOA 4C8XA 1KYOJ 4JKMA 1LEIB 1AIFA 4JANA 5F3HA 3NCYS 3APDA 3GSVA 3S2AA 3TBVA 1SHMA 1PF3A 3FN3A 3FO9B 2W60A 4CSZA 4YSRA 2WLLA 4XVUC 5DJAA 3DPBA 1KB5L 4PJ5A 5KWYC 3HAEH 1SUHA 5I30H 2VMDA 5DUML 1Q9KB 3ATBA 2UX7A 5G4OA 4R7DB 5GRVL 3RTQC 5GGRA 3X14B 4XCCL 1F0LA 1PX3A 1R1CA 4Y5VC 2HN7B 3MODL 2G3XA 3FSAA 1DLHB 4NRXB 4NQCB 3FFCD 4PGBB 2PYED 1MJ8H 4F7CA 2QR0B 3NEEA 3G5YA 4RAVB 1RPUA 1JZGA 4UTAL 2J8UA 1F11A 3RRQA 4LSRH 1Y18A 5DMYA 1U8PA 4JFHD 4L05A 4W6WB 4YAQA 1GGCL 1DR9A 4PGCA 3DURB 3GYRA 3ZR5A 3QVAA 1NFDB 4L8CB 2EJ1A 3S98A 3U4AA 1VENA 3KE0A 4R9HA 4IK6A 3KNBA 3C6LD 4JE0A 3UBGA 3P3TA 3VACA 5I1DA 5JMRA 1U58B 1ZOXA 2FD6H 4ZYKA 2A9MH 2JELH 4RAUB 2IJ0C 3JWOL 3GXPA 1U21A 1A64A 3SKUD 3WJJA 2XIDA 1AZUA 1P1ZB 2AQ1A 3EGDA 4BCZA 1YEFL 4X4YA 1G7PA 3GSXB 3KPTA 5DD0H 3ZK0A 1G0XA 5I0YA 4P5KA 4DK6A 3EFFA 3QQ4A 4GQ9H 2Y2TA 3E3QC 3MOBH 4KU1A 3F12B 5ISZE 4HGKC 3P2BA 4AXWB 3WEXB 1BFOA 3SBQA 1C1EH 3FB6B 3LIZH 4PW4A 3CK0H 1J0HA 1X4YA 2OQJA 4EN3B 5LAXA 4ODXA 2C1OB 4Q97A 4L9DA 1KULA 2K6ZA 3KGUA 3MJ9A 3HG0A 5J1TC 4H1LH 2XKUA 3U1QA 5DJZB 1QO3A 2BXZA 1UVQB 3ENEA 4XO9A 3KW7A 5E5MA 5GSRA 1EWHA 4I48B 2XT1B 2Z3FA 3TEXA 2DS4A 2GJ6D 1E6JL 2GHWB 2R2BB 3X1BA 2ZP9A 1CXKA 1NEUA 2CR0A 2IV9A 1FVCA 4XX1E 3STBA 1FUNA 3VX1A 2YUWA 1FGVH 4YHOL 1U0QA 3IPBA 4E9TA 4ZUTA 1YCSA 4C55A 5MEOB 1B3JA 5ICYB 3GRGA 4UQDA 2UYLA 4YQXL 2HKAA 3VFRA 1P4BH 1S9VB 3I75A 4TSAL 1DJWA 2I60H 2OPCA 4QTHA 1CDJA 4P05A 1ZGLA 1AGBA 4KJYB 4IBSA 1DCLA 1XD0A 3OKMA 4NT6A 4ZQKB 5J56B 3QP3A 2J25A 3ARQA 4HUMB 1R4XA 3MMEA 1EO8H 2FCBA 4PRHD 2E7BA 4U05A 4XMKL 4YSPA 4HUNB 5D7IB 4F3FB 3BUQA 1QFWM 5L8JB 2B14A 1NBYA 2Y1AA 1MLCA 3MLZH 5DK3A 4DPRA 1YN6A 2Q2LA 4M5YL 3T6XA 2R29L 1OQXA 3RVUC 2FR4B 2WKOF 3KHOA 3T0ED 1DSWA 4G82A 5LAPA 3KLHC 3CVCA 5DEFA 3ERXA 4HBCL 3ZE1F 4EI6B 3BRDA 2XYBA 4JZJA 3GSNA 2UX6A 3PNRB 4PP1C 5MEND 5D1XD 3UYPB 3WJJC 4FQ2L 5CBEA 4MZIA 4RH4A 3RPBA 4B5ZA 5DVKA 3HR5B 3OWRA 3CD4A 4HFUH 3G6DH 3MV7B 4TLTA 5GS1A 4U7KA 3HLKA 1NDMB 1QTSA 2YPVH 5KW9L 4DKDC 1ZSHA 2ED6A 3RWJA 3WUWG 3S3JA 2JJWA 3PXHA 3CG8A 4MJHA 1NOAA 1AZNA 1DQDL 1TZHA 4MMZB 1MJJA 4MDIA 4Z7NF 1VGKA 3N06B 3IJSB 1QLEL 2VUOA 5I2IB 2BSEA 2UVFA 1XQ4A 1MCPH 1RK1B 4NRYB 1CFTB 3MRMA 3TH2T 3TPUB 1ZA6A 4Z7WE 3ZHNA 2ESVA 2HT4D 4PJCF 3A4DA 5DK0A 4JGUA 3TEYA 4ORGB 4FADA 1AGCB 3PYCA 4XCNB 1GIGL 2XTSA 5HDOA 3PU7A 1JV5B 3IU3B 4MA7L 2J6EH 4HHAB 2WZ6A 2ICEA 5KAQF 1GZPA 1NCNA 4AQAB 1WC7B 2Y6SC 1CICB 3S9DB 3Q05A 2EVIA 1INQA 2R2EA 5F1NA 3V0JA 2Q76B 4HXAH 2X4RB 1KJVA 1BAFL 2CMRH 5EUOB 1L9PA 1CZ8L 2UY7A 1UXSB 1ZLUH 1X3DA 3OB8A 2IFFL 4PJ8D 2PWHA 1T1XA 5DLMH 3PWPE 4RMBA 3RNQB 2AAVA 4UANA 4AVKA 3FPXA 5G4NA 3H8NA 3D9AL 4EQ3A 3KL0A 5IGXH 2KZWA 1SHWA 1KJ2L 1IAOB 1S9YB 2GJRA 1N26A 4YFLI 4U33A 5JOEA 4QCIA 4MSWB 1I9EA 5A1AA 2NQCA 1MCLA 3MTRA 3HCVB 4UNUA 5DUPH 2ICWB 3LZFH 4PS4H 4YFDB 4WW1B 3G5ZA 4LQFL 2ZIDA 4FTVA 4E9LA 4FXGB 2EH7L 3BVWA 4BWTA 5L0QC 4TNEA 2DF3A 5FYJH 1BM3H 1A1OA 3KYOB 4FLRA 2VABB 1GW0A 2WK2A 3UTOA 1G5GA 2F5AL 3EJZD 1PKQB 2OMBA 2R0ZH 3C75A 3H7BB 5KBMA 3HZYA 5CWSB 3ETBF 3IPEA 1CGYA 4NQUA 1U91B 1OKEA 3NQIA 1XF4B 4AJYV 4OCSH 1KFGA 3UG4A 1CBVL 3V9EA 3QJXA 5K59E 1QR1B 2XIIA 3VRIA 4V2BA 4HFWA 1D7BA 3QBTB 4JZJC 5DD6A 4XRCB 3SQRA 3AADB 1ETZA 4JO2H 1K6QL 2UZYA 1KTLB 4Q7DA 3N1PC 5E56A 5EZJB 3RA7L 2NYZA 4EQ2A 1S7RA 2GC4C 4NNPL 3B7SA 4LL9A 5GS1C 3V4UH 5ES4B 4LLMA 1H0DB 4OFPA 1TR7A 3RJOA 1RULH 4NYLB 4Z77A 4NUGH 3EOBA 3NVQA 4BIKA 3IE9A 1OAZH 2BZDA 3N6YA 2ZAGA 1SHSA 4X98B 3P2DA 4NXKA 3LEXB 3I74A 1FC2D 2DDQH 4GKNA 4PRIB 2YEZB 2QHRL 1UH4A 5CGMA 5I5RA 3L3HB 1IBHA 1U93B 2CDEA 3ZE0B 2DY2A 1A6ZB 2W0KA 4H25A 4GAYB 4BHUI 1NLDH 1P7HL 2CA4A 4Z5RA 3MNWA 3KHQA 1FHGA 5CKGA 4PYHA 1OM3H 2CLZA 5DT1L 5DXWA 1ZMYA 2ICEC 4GO6B 2A9DA 1CGTA 5H35B 4UZGA 5EPMA 5H37A 4PVMA 1S4IA 3RDJA 4WQOA 3NA4A 2P5PA 4N0CC 4RDBA 3RZWA 2DTSA 1O7DE 4KK6D 2ZX7A 4ZUVB 1W2KT 2DKUA 1X7TA 5B7MA 3ETTA 1LK3H 3S7GA 2OR9H 2J73A 1PG7H 5C09B 5DWUH 4JN1L 4X6DF 4MLIA 2O5ZH 2ZX9A 4UF7C 2FJUB 3EYVA 3HN8A 1JP5A 2W65B 1SRDA 3MJ8A 2K8QA 5H94A 5T5FA 3DA0A 2LHAA 3EAKA 3UP6A 5IFHH 3KH4A 1WV7T 3SPGA 2ZKHH 1QFOA 3OKNB 2WUBH 3MCLH 2Y9RT 4LU5L 2FT6A 4FS0A 2C7UA 4LKXA 1G4MA 1OE2A 3KDPB 3TFBA 5DQJB 3TIEB 4OFYD 4MJ6B 4F5CE 2A9BA 5DJ2A 2EH8L 5DJDA 2VRKA 4RDQG 4A2LA 1YAZA 2YZ8A 5IB1A 3IDIB 2YKLH 5EEVA 4WWKB 2ARJQ 1CGXA 4IRSA 3SE8L 3ZR6A 4LASH 1YYLH 3RFZC 3UZVB 2NX5E 4NAQA 1OWRM 4BFEA 4UV4H 4L3FA 5FHAH 2CJ3A 3TWCL 4CKQA 4P5RA 3WU1A 1UWFA 3O6FC 3MRGA 4XP9L 2C9QA 3V9CA 3WIAA 3PIQB 1A1MB 1MCOL 1L5GB 2OZ4A 3TCXA 2O61A 1FWXA 1GC1H 1MREL 5B8CA 1T89C 2COQA 3NT0A 4HK0B 4XOEA 5T3ZE 2ITFA 3UC2A 5JOPE 1LNUB 2A4CA 1SYSB 2D7TH 4PJEB 4G8EB 4I2XE 4MHHG 1QA9A 2H1PL 5K5YA 1CJYA 2QLVB 3R06B 3TO4B 2FGWH 3SGDH 1TYEB 2XTJE 1H15B 1KGCE 4MDJB 5CFAA 1QBLL 2R8SL 4FA6A 3PWNA 1DO5A 1WA2X 1XH1A 2CJUL 2QHLA 2Y24A 1THCA 3MOAH 4Y4FD 4Y5XC 2YD1A 1NCOA 4NKOA 3RPKA 1DQJB 4ZTPL 4QRTB 1YYML 3OX8A 4JFZH 2BY0A 3B6SA 2EIZB 2K4WA 2PXYD 4Z78B 3SO5A 3FS9A 4YBLB 1JPFB 3D06A 3BDBA 3NFNB 1OGAB 3EBHA 4WFEE 4MCYA 2VDRB 4TSBL 3SCMD 2KS0A 4QRSA 2BSRA 3CZSA 3KCPA 5E9NA 4FQQB 3LDBB 4IU3B 4NNXA 1C8PA 1P9MA 3FB5A 3RHWF 2NY4B 2WQAA 2X6AA 3QNXA 4JJ5A 4E0RB 5T1DL 4DZBB 4L3EE 1L7TH 1IGJB 3MVSA 3L3DA 2BOBB 1EA9C 4YXKH 4PJGB 3RWFA 3ZT6A 3BPNC 4OUOA 3T2LA 4DN3L 5FUOL 1UTDA 3FUNA 4MJ5B 4OBSA 3B2MA 4LRNH 4M02A 2B59B 3W9EB 4A55A 3CJJA 4HWNA 4ABQA 2X0VA 2AGJL 2VITA 4YSQA 2AQNA 3EJQA 1E2WA 3OXRA 3F00A 3BZFA 4N2FA 4UBDC 1NC2B 2DD8L 3ARBD 4KQ3H 3BIAX 3BESR 4ZJ9A 4AQOA 1BSIA 2D3LA 2D7OA 3JT2A 5DI8B 1YVLA 2XNAB 1DZ0A 1M7IB 4YE0A 3FK3A 3FH5A 1FC1A 5FKPA 2V2WB 3AU1B 5TDPB 1NOFA 2FT8A 4ZFGL 2NT0A 4IRSC 2R15A 5HYEA 12E8H 1D5BB 1Z9NA 3KPMA 2X88A 3RTQB 1T2QL 2P7TA 3QSKB 5AW1B 4Y5VB 4H4NA 3JWDH 5ALBH 5GRVK 6FABH 2MQ3A 2WBJA 2DKSA 1UUSA 4JRXB 3ZKMD 1Q0YH 3LN4B 5F0PB 2QKIA 3RIKA 1OY3B 4Q74A 5B8CC 1MQKH 1MDTA 1QFWL 1BEYL 1IBZA 3DROA 4TTGA 4FNLL 1UM5L 7FABH 1NJ9A 1TJHL 3GGWB 1N8ZA 4QR7A 3V10A 2XETA 4MS6A 4LOUD 3RU8H 1QWNA 4JNXA 1S7UB 2MPVA 4J3OF 4ODUB 3UABA 1LWHA 4S11A 2KUTA 5AW2B 4JDEB 1LILA 5GQBA 2OXHB 2R1WA 2G9HA 2ZPKH 4X4XB 4ABWA 5C0GB 4JE4B 4NXSA 4QRRA 3IGAB 4C4BA 2OL3A 4PRPA 1J0IA 3B9VA 1UACL 1JRHL 1UGNA 4FG6C 5GPRA 3D51A 3AG4B 1WAAA 5EBGA 4HGWA 5A2LH 3I9GH 5BVPH 4N3TA 2IMNA 4BV1A 3W0WB 3UAEA 3QZWB 2ZYIA 4EKJA 5B38A 5IY5B 3DMMC 1MNUL 5CP3A 3T1FA 3M1OA 4CC0A 4WUUD 1UB5B 4S1QL 3W11C 4MYWB 1P9MC 4Y5YC 5I5IA 4P07A 2PTTB 5MEPB 4P9HC 1BD2D 3R19A 3L2MA 4M7JH 1CLOH 4LAJH 5AB2A 1WVZA 4ZO6A 5JIIA 1YEDB 1N10A 3V6OA 2F9BT 3RPIB 5LDSA 2VLJD 4OIIH 2A7BA 3CHSA 4TN9A 2XWTA 2D4DA 3RX5A 5PCYA 5JZ7D 4N0UB 2BVUA 3CUPA 2HH0H 2PR4L 4N22A 4U1MB 5L88L 4JFFB 2DWEA 3PQYD 3FQTB 2E4TA 1U2CA 3LEVH 4ZAKD 4JANB 1J86A 3VGEA 5A2FA 3GSVB 3TBVB 1VACA 2VSDA 3W1ZA 3DXAE 2Y7MA 4LOEA 3W5NA 3G9AB 3GSWA 3BIKB 1AH1A 2W60B 2WLLB 3ZE1E 5DJAB 1JNJA 3PRZA 1SMOA 2IPTL 3ZL4L 1OSPL 3U7YH 4HEPG 2PN5A 4JUSA 2Z0BA 5GGRB 1JCVA 4DVRH 5EIIG 4KK8C 3IS0X 1F3DH 2WBJC 1Z66A 2WSKA 3T0WA 4OZFH 3V4VL 4UYQA 2XACC 1DVXA 2QKIC 3LS5H 3G5YB 2J8UB 2LFEA 1F11B 4Z7NE 4OCXH 3O9WA 3ZXAC 5HI5D 3VGFA 4HUUA 4DPCX 3EFOA 4G8GD 4YAQB 1A4KA 2EEDA 5EDXA 5D7JA 3DUUA 2CK2A 3EJYC 1FFPB 3DHPA 5I1DB 3KNBB 1WZLA 2X2IA 2ZD0A 3HC3H 3HVNA 4PJCE 5DVPA 3L5WB 1DBJL 3SDXB 5C3LD 5JPNA 4KRNA 3MCYA 3KLAB 1EBAA 1QTPA 5JXEA 4G83A 1KJ3H 5FX3A 3X3GH 4K9EH 2UUDH 2PO6D 4M5SA 1LE5A 5LKNA 1A3QA 3EGDB 4G9FD 3HZMA 4X4YB 1G7PB 5FR3A 3C5SB 3DARA 4L0PB 2BNRB 5LGHL 4MJIB 1G7IA 1VFOA 2X09A 5I1KL 3EFFB 1GMIA 3QQ4B 1U8LA 4U0RB 1HWGB 5EU7C 3EYUL 2F7RA 4JFPB 1R5IA 5J6GA 3FT1A 4OB5H 5AZUA 4JKPH 3U9WA 2F7PA 3SGKA 1BFOB 1ML0A 4DTGH 1CXIA 4CDGC 3H9SA 3BIBX 3NIDF 4L1DA 2APTA 4MXWL 2OQJB 2F54A 5DTFA 5LAXB 3V6OC 2E6JA 5EDSA 1OE1A 3QCUL 3MZTA 1I7UA 4DGIL 2I26N 2TSAA 2WQRA 2B39A 3VW3L 3VG0L 3ARGA 4LLWA 4UQ9A 3TF7C 4NJAL 1JZJA 4JHAL 1HNFA 1A21A 1QO3B 1UH3A 1BV8A 4PSPA 5SWZE 1OP5K 3VWJC 5IJCC 3FMGL 3R0NA 5GSRB 2GFBA 9CGTA 2DJUA 4RFNC 5JHDE 1W0WA 2Z1KA 2PCPA 3HHMA 5FPIA 5FYJD 4WDIA 5D7LE 3WHE1 3UEZA 1EPFA 2OR8A 4YLCA 4MKMA 3RL2B 2DRUA 2VR9A 1XT5A 3NDYE 2OMVA 4ZUTB 1RK7A 5SX4I 3DX0A 2D3JA 4M6NL 1LP9A 2UYLB 3GBNH 3ZZSA 2NNXA 3I75B 3VFRB 3VFUA 2JCCF 4GW1A 3V0WL 4QTHB 1NIFA 3VU2A 1JBJA 1ZGLB 1AGBB 2HVKA 5MI0C 2XN9D 4NT6B 1DQKA 2UZPA 3HE6D 5L0QB 1CTOA 2DQMA 3H42L 3A23A 2CO7B 3MMEB 3QZWG 4M1CC 4M6OL 4NC1E 5BO0D 5E2UH 2EACA 2ZJSH 3O9WC 4M56A 1P6WA 1NBYB 3O2DL 3T9WA 2FX7H 4R4BA 3LPWA 1FZJA 1DFXA 2XBTA 3L4ZA 5B4MC 3MLWL 4XE5B 3SE3A 5LO7A 4KH2A 2A83A 3EO9H 4Y2LA 3WKPA 5JPNC 1JZFA 2K3TA 3R8BB 4FXLA 4NAJA 5DEFB 1G7JA 4AE1A 2BVQA 4KI1A 4BFIA 1OCWL 2R69H 4Z3IA 4JZJB 5E7BA 2IAMD 1X6LA 5CGYC 4ZNEA 1JVLA 1N6UA 2RAMA 5CBEB 2B4CL 3QCVH 5ECGA 5GS1B 1MAJA 2HAZA 2LT9A 5CINL 3S48A 4EUPA 3RWJB 2IALA 4KHTH 4KMTL 1CDHA 4W9IC 4G42A 5BUAA 4KRLB 2EXWC 4FFZH 4QRPA 3CVHL 4OD3L 3UL4A 1ORSB 2HX8A 3HLAA 5GGUA 1MJJB 3NJKA 1VGKB 1JS4A 3ZKNC 1E27A 4N6QA 4X6DE 4AV4A 3TJEH 3IGKA 3BFQG 4IHBA 3MRMB 2ZUSA 1OAYH 2YA2A 1ZA6B 2ESVB 5INCA 2OLDA 4JFYA 4QNPF 4HKBA 3ARGC 2QDVA 5JW3H 2PPFA 4KNSA 2DH2A 1NM4A 5EN3A 2A4ZA 4UT7L 5I30L 5F1NB 2FO8A 1ZE3H 2R2EB 3SDDB 4V11A 3F58H 3B56A 4QUOA 2VDQH 1KJVB 3O2WH 1BXAA 2XQ0A 1DANT 2UY7B 4UOZA 1EANA 2UXVA 1T1XB 2GY5A 4JFDE 4LLVA 4HV8A 3I9AA 1A9EA 3OMIB 4P23D 5C0IB 5FW7A 4PBVC 5CNHA 2IGTA 1MJ8L 5EWIH 3QXUA 1X4ZA 2ZX8A 1LL1A 2Y0SA 2BPBA 4YGAB 4R90H 5TE6L 2WWKO 2D4FA 4BJLA 4OW6A 3D33A 3L08A 3BP5A 3U48A 3H53A 3H6JA 4U0QB 5HDLA 1T5XA 4K15A 3HZVA 4LSQH 1HXYB 4TNVK 1INDL 3L1GA 3G5ZB 4ODSH 1MJ7L 4YDJA 5E6ID 4DUVA 1EX0A 4OF3A 2V9QA 3UZQA 5A3ID 1E4JA 2FD6L 1A1OB 2A9ML 2JELL 5BJTA 4R3SA 4YHYC 4KZ0A 3L9EA 5DF0A 2ZUTA 2NY5H 2PR9A 4LDCA 3FRUA 3SKMB 4FP8H 5JTWA 3NIGB 6CGTA 4E9QA 1ED3A 1N12A 3SE3C 5DD0L 2DQCH 1XD1A 3DO4A 5C0FA 5HD8C 5F7YC 3RFZB 4WIQA 3BCFA 3ZZLA 2EYRB 2HX7A 2QSCH 3CZJA 4OZHF 4UAOC 4G59C 1MCEA 3VRIB 4OF7A 3IWVA 3O6FB 3BZ4A 4EJ1C 3MOBL 4XN9A 1WFNA 2UZYB 4ORZC 3KEDA 1BZ7A 2OX5A 1EAQA 3FT2B 1BW8A 6PAZA 1IQWL 3DRQA 3LIZL 1SNRA 4NQXA 4Y19E 4A2GA 1PDKA 3CK0L 2BP5M 4QTFA 1FJ1A 4LLMB 4GFXA 1N64H 2YGNA 3N42B 2X3AA 1FYTA 2XPGA 4WNSA 4XXCC 2EEFA 1A14H 1WEJH 4APQC 3MRDA 4JFXA 5DZPA 5KANG 4BELD 4GSXA 4Y5XB 1XEDA 1K3IA 4U1JA 2CDEB 2WXPA 5FYLE 2Z34A 2NY2D 3SDCD 4TUJA 4BCXA 5J3HD 4Z5RB 1Z9LA 3MCG1 4P06A 2GK0B 3FAWA 5E6SB 1ZHKB 5GSVA 1JVKA 2CLZB 1K8DA 1RL1A 1T5WA 4HOZA 3GSRA 4J8RB 3BDXA 3WXVH 4EIBA 2AK4A 1FGVL 3GXMA 3I6SA 4ZS7H 2O4EA 2YBRA 4WWPA 5EPMB 2NXZD 4O2FA 4A2DA 1N6VA 1PX8A 1Z9OA 1P4BL 2WLZA 2X10A 2I60L 1TYRA 4BSWA 3AFLA 3K8KA 2X87A 2YJLA 5DJ8A 3BPNB 1BREA 3RWDB 3SKJH 2J7LA 4P4KA 4W4NA 1URLA 5AOLA 1NGPH 3CFQA 3KXFA 4MMYA 2ODIA 2FX8H 4HSQA 2XPZA 3LNEA 2WWKT 4L8DA 3EYVB 3DX3A 1CIDA 2CIKB 3MLZL 2AJUH 4NFBA 4OZGF 4P46A 3MJ8B 5H94B 3D3VD 4HISA 1LVEA 3V4PA 2OW7A 5CILH 1IARB 4N0RA 2JB6B 3PWJB 4QHLA 3QUXD 2QPDB 4FJ6A 4E2OA 2P5WD 3HE7C 1MVUA 1QSEE 2X4NA 3NJVA 2C7UB 3QYNA 1QG3A 5FM8A 1KN4H 2IAND 2IF7A 4PWIA 4PJBE 2FJGB 4EI0A 3NH7H 5DJDB 5JLZA 3ULUF 4DT2A 2K7PA 5IB1B 3UGXA 1CFVL 3G6DL 5DYOA 1U6AH 4IRSB 4AEIH 1QATA 5F9JA 4MNGE 2EDOA 4XMUA 3BZEA 3TA3D 5H2BA 3MRGB 1AHWC 3IMWA 2WWNA 1CWVA 2IC2A 2ENSA 3JV4B 2P49B 1OT1A 2O61B 4BK5C 1PZBA 2V7HB 5B8CB 4OQ1A 1MCPL 5D70L 4MCNA 3VXUE 2B9AA 1QA9B 3EO1B 5B1BB 2HRHA 5I6PA 3DOIA 2CO4A 1TU2A 2WIMA 1RLBA 3MRFA 4X7EC 2UVEA 1QBBA 3PWNB 3V52H 4HZ1A 1V7MH 5ABAA 1A7RH 3QHTC 4D8OA 4NKOB 4AE0A 4N5ED 3U9UA 1PZSA 4XCEB 3M17A 4G43A 1HHJB 4HXAL 5I15H 2VKXA 2F74B 1X44A 3B6SB 5EZLA 2CMRL 4OZIF 2P8MA 3MJGX 1KIRA 4KFMA 4MCYB 1LO0H 3ZIMA 2XZCH 3KCPB 4JM2A 3IFPA 3DMMB 3Q01A 4ABVA 5FV1L 1LYQA 4A6YH 1UJ3A 1F1DA 5GS0H 4Y5YB 5JHMA 3QNXB 4JJ5B 4X5XA 1OHQA 1XIWD 2I5YL 3HG3A 4PS4L 3LZFL 2ZUVA 3L3DB 2B1AH 3RWFB 4OJFH 1S9KC 3FUKA 3D85A 4HGMA 4UB0L 3ATDA 4OAWA 3OGCA 5FYJL 5GRJH 2E27L 3DSNB 3JUZA 4HXBL 2VDPB 2Z31D 3Q7JA 4H13C 2VITB 2HPTA 3V7AG 4P46C 2R0ZL 1F4WH 3KPSD 1N4XH 2CDFA 3OXRB 3BZFB 4XBEH 4B0MM 4X4ZA 2VWEC 2AEPH 4OCSL 1IM3D 5AD0A 1KENL 1N70A 1FNHA 4G7RB 3V6BR 2CXKA 3KBPA 3OJMB 1MY5A 1U3HB 4OV5B 1FFOA 4JO2L 5FKPB 3BAWA 4U1LA 3HW7A 1BVKA 3QORD 2F53A 3FTZA 3IFNH 1WWBX 5G5DA 4NGHL 1R6VA 4HPYH 4YEEA 3BKJH 3KPMB 1B4TA 3P4MA 1XEUA 2P7TB 4YHLH 5K39B 1CCZA 4NUGL 5FGBA 4U3HA 3CZKA 4DIXA 4X5WA 1GY2A 5C8JA 1OAZL 3VWKD 4Z7UF 5FHBH 4Y4KD 3TNNA 5JOFB 2QKIB 1P5VA 2DDQL 4KY1H 5DJXA 2CUMA 4P2RD 2QQKL 3FHEA 4HIEB 4A7QA 3NIDE 3RB7A 5HI4D 1NM9A 1FZMB 5H37G 3HC4L 3BVNA 1NLDL 1NJ9B 3PUCA 4IGBA 1UADC 3WSQL 1N8ZB 2CJSA 3C6SA 3I6LD 2DICA 2WVVA 1OM3L 5ECJE 3OHXA 3V8CA 1TKWA 4JDZA 1K8IA 2G9HB 4ZZFA 1F41A 5EBMA 1JGEA 4QRRB 2OL3B 4PRPB 4LCYA 2AKRA 5ALCH 4J39A 3OB0K 3ROOB 5HYJA 4QXWA 3IDJA 1L6ZA 3R8QA 2UWEF 2HKFH 1PZ5B 3AG1B 5AWNH 5D71H 4A04A 2ARWA 4JM2C 1LK3L 2OR9L 1M71A 1PG7L 2P24B 5B38B 2XPYA 3T1FB 3GZPA 2VDNB 5EEYA 2R4SH 1I82A 3UH8A 1BZ8A 1DJHA 3CSFA 2O5ZL 3HBGA 1OGAD 5D2LF 1QVOB 4ONFH 4AM0A 4HMEA 2V2XA 1DBKL 2BVEA 5IFHL 5L9DH 5FYJU 1PFOA 2E0PA 2ZKHL 2JCCE 4WI2A 4BFFA 1UURA 4BFBD 4FNSA 3MCLL 1P5UA 2AV7B 2ZF8A 3QUMA 4L37A 3GC3A 3SYAA 2MCPH 5C86A 2XWTB 5A7EA 1NCIA 5C0CE 1ZJAA 3CUPB 4NENA 3M88A 2YKLL 1AG0A 2ZXDA 3VWJB 4ACPA 5IFAH 1CD8A 1UOVA 2R39A 4FKKA 4QWWD 3FTSA 3P9LA 1SXSA 2DWEB 1ZT1A 2QADD 1CFMA 3GO1H 1YYLL 4LASL 4YUEH 3SJVE 2AXJA 4UIKL 3FQXA 2E7MA 4RFNB 3LPPA 4HKJA 4UV4L 5FHAL 3TBBA 4B95C 4HKZA 3GSWB 1PG7X 5DHDA 1WZ1H 2NZIA 4G6KL 4HUXB 3FU6A 5HHOE 1SDDA 3NSXA 4JPIB 1GC1L 4YLBA 3JTTA 4ZO9A 2EEBA 3CFCH 4WEUD 3OSKA 2DMCA 5EB9A 3GS7A 5C0DA 2J5LC 4LFHG 4BDVB 2FGWL 5FGBC 2NDGA 3T0DA 4KI5D 5MI0B 4R5TA 2PABA 3UZEA 3T4AA 1DUYB 3FQYA 2Z93A 3MOAL 1WT5A 2Y7QA 4WJKB 3WNMA 1MWAL 3O9WB 2V2TA 3AGWA 4I0PA 3JBG7 4N68A 3EFOB 3EGSA 2MEJB 1A4KB 4KNUA 2VZTA 4AQEA 4F9PA 3QRBA 4YS4A 2XWXA 1DDHA 1WQVT 2ZUXA 3LNFA 3JXAA 1CK0L 3K6DA 5TQ2L 3OHXC 4QNPE 1NIEA 4ODWB 4MQ7A 1T6BX 1JMXA 1AGEA 4IRZH 2YD9A 1CD0A 1RUPH 3EDEA 4WHYG 1JYVA 3HZMB 2H4EA 1L9RA 2XWZA 3BE1H 1G7IB 3OLDA 4ETQA 5DO8A 1VGEH 5IOPA 1VPOH 3EHBC 3KL3A 3V55A 3QYMA 1OCRB 2YWYA 3QEGL 4LRNL 5CMAA 5J6GB 3QDMA 4QOKE 1LK2A 2VDKB 3CFKA 3VXPB 5MEQB 4YHKH 4ZT1A 3H9SB 1QLFB 5D7KD 3FSVA 3OTTA 4GXVH 2NY0D 1XH3A 2F54B 4NQEA 1G6RL 3AUWB 1P5UC 3CSYB 1NCJA 3IJ7A 2X1OA 4KXAA 3ARGB 2R27A 4LLWB 4YBQC 5ABZA 1DQTA 4TM9A 4OLVH 2EE6A 3WE1A 1J7VR 5EMYA 2H6OA 1A3LH 5PAZA 3QXDB 4OM0L 4OCRH 2RCSH 3H0TB 4DGVH 1NOLA 2EC8A 5EORH 4JFSA 5J89A 4TRPH 1TETH 2XSKA 4M3JA 1Z5LA 3DHUA 1RZ7H 4X7DC 1ZT7A 1CDCA 1HN1A 1YYCA 3Q44A 2PCPB 5ALBL 5CLYA 4OR1A 4WDIB 1HE8A 2DIEA 4OZHE 1Q0YL 1PPIA 3RBGA 1HCZA 3P4LA 4GRLD 4H7VA 3IVKA 2BNQA 3MRNA 4LL1A 5CJXA 1MQKL 1AAJA 2YMTA 4ZZKA 5AZ2H 2CJTA 5KOVC 1A4BA 1QI5A 2C3GA 2Z35A 7FABL 3VJ6A 3U46A 4GW1B 3ELAT 3QXWA 2HVKB 5CD5D 3RU8L 3PUUA 3UZEC 3T4AC 1BQHA 1WT5C 5AALA 2WYHA 3F6LA 1N0LB 2ZPKL 5B38G 1JI2A 4K55A 3WY2A 4G7SB 4I0PC 1BOYA 3U6RA 4YHYB 2PMZA 5EU4B 3RNKB 3WS6C 1OK0A 5CBAB 4DO4A 4R4BB 4F9PC 2VKWA 5IB4A 4P5TB 5I8EA 1NUGA 3I9GL 2GCYB 1S7QA 2ICCA 4L1TA 2Y4SA 2BJML 2VSKB 1IQDA 4ZW5A 2ZX6A 1DN2A 1G7JB 3KYMA 1YAIA 4UAOB 5DU7A 2BVQB 4ELMA 5F96H 5GZND 2H6UA 1AIZA 3VTMA 4N5UA 1MFCH 5T3ZH 3ZMRA 4OCWH 4M7JL 3KPLB 5I16A 1CLOL 4NQDA 3QWNA 4EUPB 1HC1A 2WP3O 3EYOA 2APBA 1NAKH 1AOZA 2XHNA 1X7QA 4OIIL 2YD6A 4M1DH 4QRPB 3HLAB 4R4NC 5GGUB 2BNRD 4KK9C 2EDTA 4X6BA 5C0AA 5AW5B 4APQB 3QS3A 3GEFA 1E27B 4PGDA 2HH0L 2VERA 4DKEH 1XVSA 4PI0A 5TE7L 5FUZH 3ZMNA 1MCRA 3BN3B 4ZW3A 1MZYA 1UWEH 3ISYA 1IT9H 2K0RA 4NZ8A 2VO5A 4YZFF 3RJQB 2HT3C 4UUJB 2HZHA 3V0GA 3X3FH 5INCB 5L7XL 4OZ4A 2E9WA 3ZTCC 4HKBB 3WJLA 5E2VH 3QO1A 2NTSP 1U8QA 3HB3C 2JFCA 4P2QE 3BN9C 2FTAA 2VZSA 2MQCA 3DX1A 4HJ1A 2CR3A 5B7FA 2R23A 4O58H 1ZVNA 4DVRL 4LHUA 1HL9A 2D2CC 4XCYB 4DGUA 1I7TA 3LZNA 2C4XA 3IEAA 4FQ1L 3HZKB 1AZBA 1CS6A 3F65A 1TCRA 3LS5L 5IBTH 4S2SA 5AG9A 5CJXC 2MTPA 5HJDA 1JD9A 1AZRA 1H3GA 3L95A 1JSYA 4LCIH 3UPAA 5KG9A 2XX0A 1IBGH 4XP6H 1IFRA 1T5XB 1ZPLA 3HUJA 2KBGA 4HEME 2PWGA 5TF1H 4YDJB 3HC3L 2DPKA 1XXFC 3HE7B 3UZQB 2HJFB 3LNDA 3A3YB 4JGNA 5LCVL 5BJTB 4NZRH 4WCYH 2YMXH 3JUYA 4ILDA 1KY6A 1OO2A 2WM0A 4XAWH 3X3GL 4U3CA 4GQPH 2QMKA 4NSKA 1VZGA 1WCQA 1TNMA 4ZOBA 3MGAA 2Y5TA 4NO5B 4WO4D 3VQLA 2P5ED 4ONHA 4CJ0A 4OZIE 1E90A 5C0FB 1X5IA 4HX1A 3OV6A 2GI0A 4UI2A 4GXFA 3K72A 1KMGA 4KTGA 3SGDI 1AHWB 4NN7C 1EEQA 4MA8H 4E9YA 4OB5L 1HVXA 1BZ7B 4JKPL 3HPJB 4BH7A 4TNWK 3WNKA 4DTGL 3DRQB 2N0KA 1PDKB 2BS9A 2DIAA 4XN7A 2F08A 4X6DB 4MCZB 2WP3T 2XPGB 4F2EA 1HXMA 3LKQB 2NZ9D 4EOWL 1SUJA 5ISZD 4N2KA 4S0SD 1RZKC 1ZLEA 3MRDB 4JFXB 5BS0A 5GS0D 3NJLA 1FLRH 5EUKB 1PNDA 1UEMA 1UKQA 4U1JB 4QHMA 4RMUA 2FSEA 2VJ0A 1XCQB 3MRPA 4AZ8A 4W6XB 1FSKC 1LHZA 5GRWA 3QWOA 3WJLC 3MNDA 5GSVB 5GRXG 1U8IB 2VDLB 4GXUM 3WFZA 3V7AE 3GSRB 4J4PA 1T7WA 3F7VA 3VD5A 2KZKA 4AC4A 4U3SA 2H2PC 3KYNA 2AK4B 4JFDB 2CNZA 2YBRB 4HWZB 3QNZA 2J5WA 2GHZA 2V9RA 3GBNL 1AQ8A 4BSWB 2NPLX 1JGUH 1YQVH 4W1TA 2WB7A 4MAYA 3IYLW 1BEXA 1GSKA 2CD0A 4TNVF 2XKSA 4NJ9H 3UTTA 4Z7UE 3MBEA 4B50A 1GYUA 3QJZA 3KXFB 4MMYB 1OF2A 5JDSA 1KJMB 1YEWA 2G75A 2XN2A 3N0PB 2FX7L 4TQ8A 4IMLA 4P46B 1KCWA 4WU7B 3V4PB 5LQBH 1H9DA 1ZLWH 2ZUQC 3O8XA 4M5ZL 3UMTA 1XGQB 4QHLB 4TS6A 4EUPG 2C4FU 2IDTA 3FUJA 3G7TA 4YBHA 1P7KA 2ED9A 1IJNA 5TJWK 4GO9A 1CLYH 3UCRA 5JLZB 3GK8H 1FNAA 3E6FA 3HG4A 3QCVL 3TS8A 3LRKA 1DUZA 1RFDH 2AW2A 2GKIA 5F7NC 1XAUA 1IIKA 5DYOB 5I75B 1FV1A 4AEHH 1KTDA 1O6TA 1K72A 3KPNB 5F9JB 3U1PA 4NHUA 5KSBF 3TYGH 4L4VA 2UWEE 3NAAH 2YSSA 4KHTL 3BZEB 1QASA 5H2BB 5KYYA 4POYA 3OQRA 3PFUA 4OVUA 2V7NB 4TTDC 4LCCC 4RA3A 4U6HA 2ERJC 2RIKA 5KSUA 2DQHH 3VRJB 5D2LE 1NCCH 1OAYL 1ECZA 3MHZA 4F93B 1RP8A 4ZXBD 4Y16D 3OZ9H 3BI9X 4BE6A 1TU2B 3DBSA 5I0ZA 3DDGA 4FJZA 1GS7A 2D73A 5JW3L 2Z4QA 1EXUB 5EU6D 1T1YB 4QD2E 3D4CA 4K71C 2CDGA 4L29A 3B5TA 1X4XA 3F58L 4G43B 4TUUA 4LPWA 3P77B 3H4FA 5CCKH 2QVMA 4AIEA 3O2WL 2AHIA 3FCGA 4XO4A 3WFBH 3ULUC 4Y8AA 1YEHL 4PLKD 1AXTH 2P8MB 4DZ8B 1KIRB 1EHXA 2PCYA 1MWOA 4J4PC 4R8WH 4IHOA 1JPST 2GG1A 4ETYA 3RY4A 2R1XA 4POUB 25C8H 1XSOA 4IOFC 3IFPB 2BSTA 4AYGA 1CE6B 5E8PB 3UJTL 1BDYA 2AVFA 4R90L 1H3WM 4Y89A 3TV3H 4X5XB 3S0PA 4R7LA 4DKFL 4JGJA 4KO6A 4OJAA 2WZPA 3PWPD 5E2JA 4MAYC 5IBLC 5LG1A 1ZHNA 1XB3A 1LQSR 2AJXH 1DQIA 3MBEC 3WEOA 2XV3A 4HMCA 3QQXA 4N2EA 2IADA 2NY5L 4FP8L 4NC2B 5E24E 3BO8B 2N1KA 3VQMA 1SJHA 3DX9A 2RR3A 3O8XC 3VYNA 3WENA 4KVPA 3VO0A 2DQCL 4RMWA 3T77A 3WI9A 1X9QA 4C4UA 3P0VL 2QSCL 5EOTA 3O41A 1X5HA 3C9NA 2IMMA 1FO0H 1KLUA 1OGPA 3GBEA 1FAIL 1EAOA 3M07A 4U1LB 1BVKB 1MW1A 2BVPB 3GHBL 4G6AC 3F7RA 3DGCR 1A6TA 1WCBA 3FTUA 1VERA 2X6BA 2XQBL 3FQ1A 2ZCKH 1I1YA 3M7FB 3P4MB 1XH2A 2J5LB 1N64L 4KKAD 4ENED 4MNQE 3SE4A 3HNTH 3IAQA 5C8JB 4X5WB 1H3PH 2NYYC 3VXUB 2X6VA 1WEJL 5TF0A 2XZAH 3W3BA 5DMKA 2KLTA 1MFDH 2CBPA 5E94A 3TNNB 5IB2A 4PAZA 1TUPA 3V9FA 5DJXB 4AC2A 1NL0L 3QG6B 5F7BA 3TJHC 2H26A 4OH2A 3QR2A 5HDWA 3M6DA 2DMBA 2ZSVA 3FQWA 5E23A 2GJPA 3Q8BA 2K7QA 3WHXA 4NQVA 3BVNB 4K8RH 1P4LA 4RFOL 4X6FB 4CGTA 5MHSE 1YNLH 2YEQA 3R1GH 3ROLB 1B4LA 2VLKA 4GQRA 4L2LA 2WVVB 2DMKA 3QIUD 5T3XL 4XP4H 2N01B 4FXKA 4KKZA 2IH8A 3OHXB 3FU9A 5ICUA 1TKWB 5BUPA 4JDZB 1JXFA 5HHME 1K8IB 1AKJA 3WXVL 1GOGA 1JGEB 1XTLA 2RHEA 5DLLA 5MP6H 2AKRB 3L4CA 3MRQB 5DFAA 5AKSA 3OKKB 2V6HA 3FTGB 1JPEA 1YA5A 4M61A 2PPEA 4XE0A 3L2LA 3KWTA 5HYJB 2PWDA 4B97A 2TAAA 1J0JA 3EHBB 1NCUA 3U6XS 1M71B 4LRIA 1DVFA 2CXGA 4IBQA 5I23A 2ZUWA 4ZPTA 2Y1VA 4UM8B 4TNFA 4ZTEA 1GH7A 3GSOA 3TN0A 2A0LC 4UTAA 1UYWH 2W07A 3RAJH 1X5LA 3G6JF 1KY7A 4UILH 3RY5A 2V2XB 3S3PA 5KZCD 3NCEB 3CPUA 2DQGH 3RVXD 4CMMA 1UZ6F 3BKYH 2X7LB 3QI9D 1EJ8A 1T7XA 5DO2C 1C9SA 1ZDQA 2ISDA 1P5UB 5CN3A 2BMKA 4L37B 1KN4L 1OAXH 3WMPA 4FDWA 4XMPL 4GSRA 3JV6A 3CPLA 2MWCA 3EOYG 4LBEA 4NENB 4BHUA 2VMFA 1UT9A 4OI9A 1U6AL 1KBWA 1OALA 3P9LB 4IRJD 3FTXA 1ZT1B 4NDMA 2VERN 4AEIL 4HUVB 3NYKA 3FQXB 4WUKH 3V5HA 1KNOA 1M6UA 3L4VA 4HKJB 2E74C 4E9WA 3CGTA 1R3KB 2HRPH 4HKZB 3VXSB 2AMUA 4TULL 4YXLH 4X9BA 2EADA 4JZOB 3LKPA 5GIRB 2V0AA 4OD1H 3JTTB 5CGBA 5FDWA 2BOLA 3SOBH 3B7TA 4N2GA 1U3HD 2NX5D 5IVZA 4XHJC 4JL2A 3SE4C 4XVSH 3GS4A 2WJ5A 4Z95H 5BZWA 3DGGB 4XBPA 3CFJA 5AB1A 2BFVH 4N3UA 3V6FA 4N90E 3T4AB 1P0SE 2EXYD 2VE6A 2Z93B 3K6FA 2Y7QB 5DHMC 3V52L 1V7ML 1A7RL 5T1LB 5T3ZD 2V2TB 3L1FA 5DRNA 5JOPD 4I0PB 4PJ9A 1CD1A 3EGSB 3OZLA 1CE1L 3D4YA 5TPWH 5I15L 4AQEB 5IQ9B 4KKBC 1JHLL 1MIMH 2XWRA 1NANH 3LB6D 4GT7A 1DDHB 2APXA 2XTJD 4YZFE 1KGCD 2IOIA 1V3JA 2NW3A 2AVGA 3NN8A 3SKOA 5IJVB 4OF6A 4DEUA 3S5YA 2OTUA 1YO4A 1JZDC 2ADFL 1TQSA 2DWYA 4O02H 4LPYA 4D9QE 3G6AB 1SDAB 1AGEB 4PR5A 4A6YL 4W81A 5GS0L 3F6IA 4PVBA 3PJNA 3UO1H 1CURA 3QPKA 3EFDH 1OOWA 2VDMH 2VJ8A 5AB0A 1IGFH 5INDA 2B1AL 4OJFL 4WFED 2H47C 4KKQA 2CKNA 3O2VH 5IOPB 3EO0B 3B5GA 4YPGB 4P3CH 2BSSA 4LRIC 1DVFC 3BUIA 5CMAB 3GDBA 1LK2B 3TN0C 1XSKA 1F4WL 4L3ED 1JWMB 2CBTA 5FYLH 3LS4L 3LVEA 5K9QG 1XH3B 2R29A 2ZG2A 3IXTB 5DHVA 4NQEB 1AYRA 3BCDA 3GXNA 2UZXA 1I3RA 4FFWC 4KDTA 1BJ1J 5JIDA 5LG6A 1RZIA 3SBRA 4AIXA 1ZAGA 3WELA 4ZNCD 3TH3T 1S7TA 3WDJA 3HB3B 1RZJH 4JHVA 3VGHA 1ROCA 3Q0HA 5TDNA 5KSAA 3IFNL 1FH2A 1NSNL 3ARSA 3ZYOA 3TBCA 4HPYL 4V33A 4ZX5A 4ZMNA 3BKJL 2HCZX 4XNUH 5EOQL 1SLXA 1QUPA 5D4QA 1J1XL 3S3CB 1ZT7B 3WE6A 4BGLA 4DEWA 4YHLL 2AEQH 3UBXI 4XGZB 5FHBL 1PLGH 1RU9L 5LXVA 4GUOA 1F18A 3IVKB 2BNQB 2K1MA 3MRNB 3OAYH 3MO1A 4AWJC 5FOBA 4DEPC 3O4OC 2FQDA 1Y6MR 2CIIB 5CZXD 2Z35B 3MV8A 4UQ3A 4UM9A 3U46B 3VJ6B 3INOA 3WKMH 3S4SA 1ACCA 1Z1WA 4N28A 4RSYA 1BQHB 4J3OH 1BZOA 1F5WA 4HCGA 1ZVYA 3U30C 5DC4B 2K9UA 5KBDA 3EJJX 4XN4A 3AABA 4N2LA 3U6RB 1ACXA 3AXLA 1EXHA 2DH3A 1AC0A 4L4TA 3GMNA 4FMVA 4X8JB 2FLBT 5ALCL 5IB4B 3A6BL 5I8EB 1T0MA 1N68A 2UUDK 2MCG1 3D4GA 2E56A 3IGUA 5AWNL 5D71L 1IQDB 3MJ6A 3CCHB 3KYMB 3D07A 5K93A 4ZTOL 4NI6A 4EI5D 4ELMB 4NCDA 2J88H 3A22A 8PAZA 5D5MF 2R4SL 4F7EA 4NN7B 2WB1A 4DH2A 3QARA 4E41A 4ONFL 1M4KA 4LCWA 3HS0C 4H8UA 2DQ6A 5IMKA 2XTLA 3DX4A 1R19A 5L9DL 4Y1AA 4AGNA 4YE4H 1J9QA 2E8YA 3EH5B 4PLJC 1X7QB 3WAKA 1JXJA 4CRPA 4HIQA 1HYSC 1EO7A 2WC7A 2YXFA 3I3EA 4X6BB 5C0AB 3DKHA 4PGDB 4NZTH 5E1QA 5IFAL 3QXTA 3LZLA 1TLMA 5FO7A 4RZKA 2OCFD 4L18A 4FABL 3HS9A 3GO1L 4YUEL 3DIDA 3BYYA 2DQIH 2YAFA 4PRBA 2GIXA 4KDTC 4Q0XL 5GZOA 2PYEE 3MX0A 4RZCA 1MRFH 2EXSA 3QO1B 4Z7VF 5TQ0H 1WZ1L 3T8XA 4JFHE 1BZQK 3KLSA 1OZUA 2Q9OA 2FBJL 5KSAC 1SFDA 1XDTT 2RACA 4WI9A 3K80A 4EIZC 2DL9A 3GB7B 1BGXH 4JHBA 3CFCL 1MAMH 1FAKT 1QFUH 1FL6B 4NPJA 2HUHA 4LHUB 4WTXA 3DXAD 3IMVA 3IXAA 1PCSA 5ANMA 2WLIA 3MLTA 5KSBE 2KZBA 2DJMA 2I25N 3VNZA 4WI0B 4MVBD 1WICA 1TCRB 1EDQA 3LX9A 4MD5B 4S2SB 3IS1X 2G0KA 5DS8A 1C08A 4LGPB 2ZOKA 3HMXA 4X8CA 1H8OA 3L95B 1K5NA 3QJQB 3L7FA 5KG9B 1FGNH 1MCBA 3RVVC 1T6WA 3X12A 3GMRA 3O0RH 2ZUQB 3EDDA 3CQFA 1KYAA 4RSVA 8CGTA 1JHKH 2YD7A 1JPTL 1M2OA 2NY1D 3PL6D 3NABH 1U8OA 3QEQA 1U36A 1A5FL 5I26A 4ANXA 1E9OA 5ESVA 1EZSA 3OJVC 1RAMA 5J11C 3C5XA 3GSUA 2XBDA 3PCYA 5AKRA 4JRWA 1RUPL 2H45A 4C4KO 4NSKB 4XN5A 1KXQA 1QHPA 2E46A 2Y5TB 4K3GA 1FFRA 4ONHB 3DI3B 4L8SA 3U0TA 4HX1B 3BWUC 4TVUA 1E4WH 3K72B 4QXTB 5FK9A 3LV3B 1AXSA 4BEIA 5AVVB 1KIPA 1ZLSL 2LU7A 3FB7A 4LCCB 4HIIA 2ERJB 4BH7B 1N0XL 1TTCA 3H55A 2D31A 2XI9A 4GMSH 1DVUA 2X0WA 4JFEE 4YHKL 3RWCA 1NKGA 1JXGA 4AW4A 4FYTA 4N8UA 2Y2YA 3BHBB 1QPKA 2O26U 4PB9H 1CXFA 4U4BA 1KTRL 1HXMB 5D1QD 4NFDA 1LGVA 1F4HA 3PP3H 1CD9B 1E3ZA 1FDLH 1HSAA 3I02A 4OZGB 4OLVL 3IJ8A 3FFCA 3ZT5A 3GIZL 1YNTF 2DQDL 3KVQA 2RCSL 5F1IB 2ENPA 3BLBA 4K71B 1SN5A 4QHMB 5EORL 2FSEB 2HLFC 3MRPB 4AZ8B 5CSZA 1AC6A 1MHHA 2C9UA 2X9XA 1I8UA 1X5AA 3WNNA 1NEZB 1A7NH 4PRHE 3NCMA 4Y2OA 1H3VA 1RUML 5GJTH 5DEGA 3C6LA 3F7VB 1NAMH 5EHFA 1MJUH 3T0VA 1P69B 3PAUA 1BQHG 3F64A 3KYNB 4OSUL 4U3SB 1R0AH 2IH3B 3CZEA 5CIPA 3VFNB 5SWZD 2DTMH 4FLOA 4G6FB 3D39E 3QNZB 1NGQH 5JHDD 4D0CB 1G9NH 3RGBA 2Y07H 4MAYB 4MAZA 5D7LD 3CFTA 1GGTA 4KC3B 2WKGA 3UTTB 3MBEB 1MHCA 3ESPA 4PJ7A 1JZ2A 2XX1A 1O9ZA 3HMWH 5JDSB 3ZZQA 5AW4B 2G75B 4PJAA 1J1PL 4BGDA 4GQQA 1UD6A 3LRLA 1Q9OA 4QO1A 3O8XB 5I0XA 1QSVA 4R7NA 5L2JA 4G9DA 3N9GL 2Z64C 3HTLX 3EJUA 3VAEA 2XQYK 5F96L 4G8IA 5AOIA 4HDIA 1GGIH 4HOMA 1BIHA 2W0FA 4FLQA 4HH8A 1MFCL 1DUZB 2OMZA 2ID5A 4C4KT 1RPKA 3FT3A 4K8RD 4OCWL 1ID5I 1KTDB 4L8SC 4TNWF 4NHUB 2PPCA 1D5XA 1NIAA 2AEOA 4L4VB 2WLYA 2YSSB 4HD5A 4GI8A 5HJ3A 5A16A 5KYYB 1A7BA 4M1DL 1DQQA 3AREA 4N85A 4XVJH 5DMGD 3GNMH 1T04B 1VEMA 4U6HB 1XGPA 5KSUB 1GSMA 4DKEL 2FATH 5FUZL 4LLUB 5IW1A 1CIUA 1S6NA 3G6JE 3FB8B 8FABA 4PW3A 1UWEL 4DUXA 3ULSA 1R3IL 1IT9L 2YOAA 4XC3H 1NCHA 3X3FL 1EEZA 1UZ6E 1PBYA 3AS1A 5DC9B 4LHUG 1L9QA 3KGSA 1TQUA 3H3KA 4MMXA 3VXNA 2Z4QB 4YC2C 2DWXA 4PJHA 3LRHA 1U3NA 3VTAA 3MUZ1 2R1YB 2QKSA 1NGZA 4L29B 1J8HE 1QMUA 1RSFA 2Z8VC 3GJFA 4EZKA 2OP4L 3LH2L 4O58L 3KPRD 3PWUA 4U6TA 4WTQA 3T0EA 1U42A 3C6LC 5E6YA 3TU6A 2R1XB 1NCBL 4DGWC 1EEYA 4RMRA 2BSTB 4ZFFA 1TMQA 5IZ7A 3L3JA 5MENA 2KH2B 4LCIL 4GSDH 5D1XA 2PP9A 1EHNA 1A6AB 2XXFA 4WW2F 4FA7B 4PRNA 3GQFA 4XP6L 1W8OA 1SEBA 3DHJA 2YUVA 4FE9A 4YHPA 3RKPA 5CF3A 3H3BC 3NMEA 5I17A 3JV0A 4LOFA 2Q7AA 1CGVA 2B20A 3V0VA 4PP2A 4NKDA 3I6GA 4NZRL 4GKZA 4WCYL 1OCOB 2YMXL 1KYDA 3ZUCA 5D7SH 2IADB 4XAWL 3JVGA 3QC6X 3BWZA 1T4KA 1SJHB 2Y23A 4JM4H 2P43B 2FWLB 1IGTA 2DQEL 5LBSH 3WMQA 1KIQB 4BWWA 3O41B 2ZXGA 2JJVA 1KLUB 3GM8A 4FQJH 4MA8L 4GH7B 1E8WA 2UWEB 4B9KC 3LPFA 1E50A 1A6TB 1DQMH 4UNIA 4UQBA 4JO3L 4BQ9A 5HI3D 1D5MA 4Q9CA 1I1YB 2Y7OA 3FCTA 1YLBB 4OD2A 1U8MA 2CBQA 2RFXA 3FXIC 4W4OA 2XV2A 4X9GA 4JAMA 1T3FB 4PJ8A 2FB4H 3P3YA 3CN4A 4JHWH 4KVNH 5E94B 1X9RA 5I8KL 3AITA 3HBQA 4Y19D 4JN2A 4LP8A 1N59A 2ZSVB 3UAAA 1C5DA 2XVBA 5AKVA 4MBOA 5EIQA 4L9LC 3UJJH 2VLKB 2J2ZA 3LN5A 3E9TA 2ODHA 4MMXC 4F8PA 2I85A 5B21A 2W0PA 1U95A 1AKJB 2ZWSA 4MRCA 4LIQE 3X2QB 5FECA 5L2KE 1KB5B 1G1OA 5FYLD 3F7PC 5CD3B 4QXGL 2ADJB 3BVUA 4GS7C 2WXIA 4M61B 3T0EC 1JGUL 2Q0ZX 4UQAA 4Z7IA 2BCKB 4QRQB 1J88A 3WFEL 1BIIA 5C08A 4NJ9L 3SGEI 3FUDA 1DVFB 1UCTA 3GS0A 2IDSA 1C5BH 1F2XK 4YR6A 3TN0B 4D3CL 2W07B 5D1XC 1L6PA 1KGYE 1YG9A 3BUBA 4AMWA 3KBEA 1BFVH 2OK0L 1LTXA 1H6TA 5LQBL 4Z7QF 2ATPB 1QNZH 5M7QA 5GHWH 1YY9D 1HHIA 4JG0H 3GSNH 5JIKA 2BMKB 4F2MA 3GUTB 4JB9H 3US1A 2XOTA 3JV6B 4C59B 3CPLB 1F3JA 3GK8L 4I1RA 4DOHE 3Q2CA 2FGZA 3JVGC 3OGOE 3D48R 4LBEB 2HXAA 1RFDL 2NY3D 5SWSD 4PHXA 1F3DJ 3HG1E 4KJQD 4AEHL 5DUBA 4NDMB 3HPLA 1KOAA 3S5LG 1QSED 1A8ZA 1KF9B 5DRWA 3TYGL 3EJPA 5B39B 1ZGLP 4J3OD 1I8KA 1L0PA 3UROR 3DOSA 2I9LA 5D7HA 5KJ7E 2X05A 1M53A 2BRRH 3LKPB 5D5ME 3ZDYF 2DQHL 3MV9E 1MCHA 4QT5A 4CBZA 2ZXBA 5FDWB 2CM5A 3MRJB 4DEPB 1NCCL 4OIFA 3DHMA 2JKLA 5JW4N 2BS71 3ECQA 3X13B 2AJVH 3B9KD 4YWGL 4W4OC 3OZ9L 2LR4A 4PJ8C 2B8OT 1HKFA 1MH5A 1KBPA 4XBPB 3HRPA 3CDGB 5J7CC 3OR6A 3V6FB 2VE6B 1JGDA 3WO4C 1A4CA 1EO5A 1DBAH 1SJEB 5F3FA 3EZJB 4NQSA 3U30B 2FZ3A 1C5CH 1W72H 5DRNB 2ADGA 3T2PA 3VSUA 5EZOH 1CD1B 3ZTJG 4IMKC 5CCKL 1WD9A 2NOYA 3UC0H 3MRRA 1NGWA 1L6XA 5SWQB 3AZUA 4IYKA 3WFBL 1SLUA 2ARJA 2FUTA 1AXTL 2RQEA 2A9NL 2NW3B 4LEXH 3NN8B 1NGYA 4R8WL 5HDRA 3F84A 25C8L 2OTUB 4Z7VE 4HETA 1Y7VA 4UV7H 1YC8A 2E9IA 4QJ3B 4PR5B 1EFXD 4KJPD 4OFYA 3OC8A 4JR9H 5GGSY 3TV3L 2NR6D 1WWCA 3GSQA 3J07A 2APWA 3UAJD 3HS0B 3WO3B 4KHXL 4Z0BH 2HJLA 3H9ZA 1W0YT 1AXIB 1NEPA 2VDOH 3CHQA 2AJXL 2X4OB 3H4HA 4LK4A 5EOCH 2KLRA 5ETUA 2BSSB 3U4BH 3KJ6H 4YDNA 1L7IL 1UM4H 2AF2A 3TV8A 2YIHA 3H9YA 2FAUA 4AUJA 5F8RC 3AM8C 5K69A 5KEZA 1IIIA 2B0SH 4S1DD 5CU9A 3MLXH 5ITBH 3FRPA 1P53A 3X1EA 4PVNA 2ZWZA 2UZXB 1I3RB 1ZK5A 3PPEA 2DWDA 2FO4A 1FYHB 1RZIB 3EGXB 2HRLA 3IDNA 1S7TB 2IDQA 5JHAA 3QB7C 5DHYB 3KVPA 4V1DE 2WVSA 5JQ6H 2MJWA 2OMXA 4Z7AA 1BOGA 3L9BA 4UNTA 4Y4FA 5TDNB 4ISVA 4QHKI 3DPDA 4CU7A 1OT4A 4QHPA 2ZCKL 4TQIA 3VQ2C 5EEXA 3ARTA 3EUUA 4XB7A 2D7NA 4JPQA 2WQUA 1KUMA 3WE6B 4GOSA 3DV6B 3HNTL 3TIDA 4A2HA 1ZHBB 1H3PL 2DLFH 2Z6FA 1RZFH 2OSYA 2XZAL 1U3JA 1MFDL 3VXRE 3CVHA 4WEBH 3SCMA 3VXMD 1TEGA 4IKLA 4U1IB 1IL1B 3WL9A 5FOBB 1QLEB 5DR5H 5HJBA 3W2DH 5CJQH 9PCYA 3MV8B 4K8RL 4UQ3B 4UM9B 2RMNA 3R1GL 5K1NA 1VFBA 4M48L 3S4SB 1JYWA 1FL3B 4KK6C 2EIDA 1NMCC 4CSPA 1DQLH 4LPVA 4Z7OF 4S0TD 3D5OF 4NS0A 5GGRY 5J11B 3AXLB 3HAEA 1TXKA 3MAWA 5MP6L 3DO7A 4L4TB 5T5NG 3GMNB 1A7QH 3EF4A 1SXCA 2WSPA 3FSZA 2DYPA 4KOBA 2E7LA 2G2NA 3MU3A 4ZFOL 5I24A 4PN6A 4M6MH 2CO6A 2XG4A 3WTWA 1OTSD 2DM2A 2HX9A 4BZ1L 4F37F 4F7EB 4BZYA 3RAJL 4B9CA 2AZAA 2C9AA 2OTWA 1J1OL 4LCWB 2JKXA 1Z0NA 3B37A 1T1WA 5IMKB 4Y1AB 3BKYL 4PJFF 3C8KA 4HQQH 2O6EA 4YL4A 3APFA 1NMBH 4H44C 1EDYA 1I7RA 1BVNP 1OAXL 1MG3C 4Y2NA 2JXMB 4JQIL 4PBWD 3V6ZA 3TEUA 3TP4A 4YGVB 1AHMA 1RD6A 3ZGIA 4BH8A 3IJYA 3LKOA 4UOW1 1O6SB 1GS6X 5FO7B 1AO7E 4X7SL 5GJSL 3HN5A 3U7AA 4YSSA 4RZCB 1IFHH 5I6LA 2WXQA 4LQ1A 2DYRB 2L7EA 3S37H 1ROWA 5LN4A 2GB2A 5C0CD 4NLHA 4GB9A 2Q87A 3FQUA 3ZBMA 4OD1L 4Y4FC 3TWYA 1SGKA 3WUZA 2B4CC 2X70A 4NQDE 3SOBL 2CSPA 4WK0B 2OMYB 3SJVD 3LIZA 1UJTA 3RVWD 1CMOA 2AANA 1SY6H 1AS8A 2R4RH 3T3MF 1H19A 2QQQA 3UTSD 2PXYC 3IXAB 4Z95L 5ANMB 5I1HH 3MLTB 5AUMA 2BFVL 2OW6A 4LCUB 3QDGE 3K8MA 3MA7A 5HHOD 3SCMC 3TM6A 4ZUSA 3RB5A 1GGCH 1JYNA 2BIIA 2PCFA 5DS8B 1C08B 3PHOB 4H1LA 4N9OB 2ZOKB 3KWUA 3O4LB 3RUGA 5E00A 2BERA 2J1XA 2W94A 1V54B 4OV6F 4WUUA 3L7FB 5TPWL 1WIOA 3GMRB 4UT6H 1PEZA 3LZPA 1BD2A 4PB0H 1V7NH 4JLRA 5IJKC 3JWOH 5HGAA 2L7JA 4WI7A 2JKWA 1ADQH 3G3LA 2DBLL 5AFAA 5FAAA 1M1SA 2QZ5A 3QEQB 1U8OB 4DFHA 1E9OB 5ESVB 4YX2H 2VLJA 4O02L 4TVSa 1I8AA 3GSUB 4KRMB 5KVFE 5CHNA 3UO1L 2Q2EB 2YD2A 4CW1B 1P7QD 2QFPA 3EFDL 2VDML 3TGXA 1HI6B 5DJCB 3CMOH 4L8SB 2B1HH 4PJ5D 2E7LC 3PQYA 3O2VL 2E7HA 1PJWA 3MZGB 3MJ7A 4P3CL 4WHYH 4ZAKA 5FK9B 3HR6A 3MV01 1AXSB 3WFCH 3GKZA 4HWBL 3OM3B 3FB7B 4HIIB 4O9HL 4PTTA 3HUJE 1H6FA 2D31B 5IP4A 2C34A 3RWCB 5FYLL 1BX2A 2I7SA 2P9RA 1WG3A 3GKWL 4WHCA 1HNYA 3BSZA 5HVGB 1T83A 3ALXA 4MD4A 2DQJH 1RSYA 1KLFB 1Q4NX 3MRHB 4QOKD 2JKJA 1JZIA 4TV3A 2FEEI 3ZKMC 4JK0D 2Y7SA 3FFCB 2I24N 4YC2B 5F89A 2PYEB 1Y1UA 4TL5A 1IGYB 3ATAA 1E6JH 3QWRA 4F92B 3IN0A 4ZFZB 1MHHB 4XNUL 4G8GA 1ZHLA 2YPVA 4I5BA 2FX9L 1OARH 3PGDB 3QXAA 2GI7A 3TO2A 1TTUA 4PP1D 4Y2OB 3S4SG 4LOUC 43CAA 4FTDA 2JJUA 4XXDA 3C6LB 4DSYA 2A6JA 3IDYC 4HSAC 1QW8A 3NPSC 3TZVA 5CIPB 2VM9A 1MCFA 4P4RA 1XMWA 4TSAH 3V8OA 5BQ7A 1RIUH 4TF4A 5ID1A 3KWXA 3SYOA 4I9XA 2CHNA 1EZVY 4WRLA 3GMOA 2PO6A 3I2CH 3M1BA 4G9FA 5HGDA 3TCLA 5AW3B 2ZOWA 4BQCA 3JV5A 5BS0E 2RD0A 3BUDA 1S7SA 5L4FA 2WOYA 1CR9H 4NO0A 2EUVA 1KCUL 4NZUL 2BIHA 1PLAA 1UQSA 3NJMA 5ELIA 4PJ7B 4GP4B 2AFNA 2J6EA 4KOCA 3LKNA 5C6WH 2Y72A 4JFWA 4PJAB 3UACA 3QUZD 4Y4HD 1AR1D 3WCYA 5HDQH 2BW4A 5IEKA 4QO1B 4KX9A 5IMOA 4R7NB 2BHZA 5L2JB 1XGRA 5C0JB 2ZOTA 4G9DB 1MPAH 4XPTL 1JN6A 4M4RB 3MLUH 1E7VA 3E6HA 1RHHA 2IPUG 3L7EB 2J88L 3QFJA 5JUEL 4G8IB 1NCWH 4HDIB 2XWDA 5CZVL 2QMJA 3LEYH 5JZ7C 2W0FB