5H4YA

Crystal structure of human synaptotagmin 5 c2a domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
ELGQLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Synaptotagmin-5
publication title Structural analysis of Ca(2+)-binding pocket of synaptotagmin 5 C2A domain
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5h4yA00
3IBEA 4QJ5B 2K4AA 4GB9A 5KJ7E 4ANWA 3F04A 2CHWA 2UZPA 4XX5A 5H4ZA 2CJTA 3L9BA 3TJPA 2WXOA 1E90A 4PS8A 4F1SA 4KITB 3QAQA 4NPJA 4HVBA 3ZVVA 1DJIA 3MJWA 4MJJA 2QZ5A 4TUUA 3W56A 3PREA 5CCGE 3FBKA 1E8WA 2Y3AA 1DJXA 1DJYA 3DBSA 4ANVA 3RPBA 4F93B 2NSQA 1RLWA 3R7RA 3ENEA 1RH8A 2K3HA 4ANXA 2Z0UA 2ENJA 3ZIMA 5EDSA 4QJ3B 3GPEA 4WAFA 2V4LA 4IHBA 2A5UA 4FLHA 1E8ZA 3NZSA 4L2YA 4A55A 5CCJA 2WXFA 2CHDA 5H4YA 4FJZA 3HN8A 2WXNA 2DMGA 1A25A 2WXQA 2B3RA 3CSFA 1DJZA 4NS0A 3M7FB 4PS3A 3KWTA 2CJSA 3F05A 5G55A 2K45A 3ML9A 1DQVA 1QASA 1YRKA 2FJUB 2Q0ZX 3L16A 2WXGA 1QATA 4QJ4B 3APCA 1CJYA 3B7YA 4WWPA 3NZUA 4XZ4A 1HE8A 2RD0A 1UOWA 4F92B 1WFJA 1E8YA 2CM5A 2D8KA 3HHMA 2WXKA 1UGKA 4WEEA 3APFA 4QAMB 4DNLA 4XE0A 3L54A 4BFRA 5T8IA 4HLEA 3P2BA 1TJXA 3TWYA 2WXJA 3QR1A 4LCVA 4EZLA 1GMIA 2WXPA 4GNKB 4DK5A 3KWUA 1V27A 4G11A 2WXLA 4NP9A 4WWNA 2QZQA 4ANUA 4BGDA 2A4ZA 4EZKA 3ZW3A 1E7VA 4FA6A 2NQ3A 3JZYA 4KZCA 4J6IA 1DJHA 4ICWA 1DJGA 3DPDA 3ML8A 3NSJA 3SD5A 1WFMA 4EZJA 3CSTA 4Y1TA 2WXMA 4KZ0A 1E7UA 4FULA 2K8MA 2Q3XA 2WXHA 5CCHE 1W16A 3F01A 2BWQA 3TL5A 2ZKMX 5JHAA 4IQHA 4FADA 1BCIA 2FK9A 4PS7A 5JHBA 2LHAA 4FJYA 2R83A 4NPKA 3L13A 3FDWA 3R7QA 3OHMB 2NCEA 4URKA 3APDA 3N5AA 3PRZA 3PYCA 2ENPA 4AJWA 2EP6A 4L1BA 3W57A 1TJMA 4JPSA 3S2AA 2X38A 4OVVA 4F91B 2WXRA 3QJZA 4AOFA 2CHZA 3F00A 4TS6A 2CM6A 4L1LA 4LT7A 3QK0A 3QR0A 1UOVA 3PS6A 4FHKA 4WWOA 3LJ3A 4L23A 2ISDA 2WXIA 2YOAA 3L17A 3OAWA 4LDCA 3QARA 1K5WA 5G2NA 2KI6A 4TV3A 2ENQA 3L08A 4FHJA 4OVUA 4Y1SA 2YRBA 3L4CA 4ICXA 2CHXA 1DJWA 3IM1A 2DMHA 2N1TE 1RSYA 3T8MA 3HIZA 1BDYA 1W15A 4V11A 3RDJA 1BYNA 2JQZA 3PFQA 1E8XA 1DSYA
chains in the Genus database with same CATH superfamily
1KB5H 2CGYA 5F96L 4JG0H 4K3GA 1YJDC 5B1AB 4FABL 4DP4X 4BCYA 1TKWB 4YR6A 1NFDB 3QIUA 3FMGH 4YMPA 4OZHF 1XGUB 2Z9TA 4QRRB 5KVEL 1CBJA 3X1FA 2DLEA 1IAOA 2JI1A 1JPSL 3LH8A 4PCYA 1EHAA 1Q9LA 1WZ1L 1U8MA 4KKPA 1R24B 3QDHA 4OD2A 4PGDA 3RUGF 3S4SA 1LL1A 5EO9B 4YSTA 3BPLC 2F0CA 4PJBF 5DHEA 2V3DA 3DMMA 4MX7A 4NQDD 3D12B 3GRGA 3S3PA 2B3RA 1AZZC 1JI2A 1CTMA 5GGTL 3KLKA 3LEYL 3BRFA 4ETQA 1DQJB 2VLRD 1HDMB 2Y72A 2B16A 4L37B 1OAKL 3GHBL 3RP1A 3IDJA 4EE2A 1MLBA 3VWKA 3IU3A 3PQYB 5KAQF 2YUVA 1ZGLM 3P0YL 2ZPKH 3MRKA 1WO2A 3HE6B 3X1GA 4AC2A 4NN7C 2DQGL 4O2EA 5FO8B 5KW9L 1JHKH 2VO5A 5JIPA 4PN6A 1LLAA 1WZKA 2EIZA 1MEXH 4Z7UF 2F5AL 2LR4A 4JPWH 5E4EC 2BK8A 3FL7A 3L9YA 1SUJA 1QWHA 5B7MA 5IHZB 3RB5A 4EJ1C 1NLDH 5IJCC 2G30A 2EE9A 3O4LE 3P9MB 1I7TA 5I5RA 1QPXA 1AR1B 1YEFH 4P2OA 3PWPB 5HYFA 1KB5L 4KH2A 3PXHA 4WUKH 4JG0L 5I74C 5I1LB 4Q0XH 2J8UB 2PR4H 1LE5B 3ILQC 2VH5H 2ITCA 3TBTB 3D4CA 3WIFB 4FTDA 3JUZA 3MNZB 3KPNB 4F27A 5B3SB 1TQWA 4MSWB 2BRRH 5L6YH 1X5IA 5GGVH 4JG5A 1MAMH 1AGCB 5E99H 1ERNA 3TFKC 3EH3B 4HIQA 2XNAB 3NN8A 3AS2A 3FZUC 3T2LA 2WWOA 3EGDB 4UT6H 4WFED 1QOKA 2IGFL 3AMKA 4PJ8A 2Y6TE 3ARPA 4MAZA 3VGDA 4NUMA 5EU5A 5E9DA 1ZLUH 4NENA 2PCPA 4A2LA 1R9FA 5TE4L 2D4DA 3CV5A 1YEHH 3ZDYB 1LO3H 2ZPKL 1C8PA 1PF3A 1ZLEA 5IR1B 1UEMA 3EJQA 4UT7H 2GI0A 3BISA 4RNRB 2MMXA 1MHHA 4JPWL 1DUYB 3PABA 1KZQA 1NMCB 5F9AC 5K9KB 1FBIH 1TVHB 3ZQXA 4F7MA 1EDHA 2R1WB 5F7DA 1NLDL 2XG4A 2VUOA 1YEFL 3AXLA 4HH9A 4W4OA 2XRAH 2BNQE 2FWUA 3EHBB 5F7KC 3BT0A 2EZ0C 4Q0XL 2EXWC 4GO6B 4FNPA 1MRFL 4IBQA 4ZTOH 2PR4L 3V55A 1DQQA 1CL7H 1NCIA 2EE3A 3QG7H 2YEQA 2PYED 4J3OG 5CLYA 1BFVH 5DRZB 2UY6A 4E41A 2XWZA 5CD5D 2BRRL 5CUSH 3HPLA 4HISA 5DJ0A 3QHZH 4PIRF 4Y19B 5GGVL 1MAML 1PFOA 1Z7JA 5E99L 2QFPA 3IDXH 5B21A 5CJ5A 5C8JB 5JOEA 3ZY7A 3FFCB 2FJFA 2EIEA 2J6WA 5DRWB 5HYJD 4NB7A 4RFOH 1XH3B 1OOWA 5CJQH 3PLYA 1HXKA 1IFHH 3AB0C 1JRHL 4UT6L 3KBPA 3ALPA 4PRDB 3TA3D 1XD0A 3RTQD 3QEQB 5JQ6H 1M57B 2HVKA 3S5LA 5IFHH 5KBKA 3LV3A 4NQQA 2AJVH 1YEJH 4Y4HD 3A67H 4ZO7A 4XZUA 1YEHL 1Q4NX 1PPIA 3TTSA 1UTDA 1LO3L 5DEFA 2J4WL 1S9VB 5DVLA 3RVXD 3VD5A 3QUMB 3TYFA 2X1OA 2M83A 5CSGA 5SX4I 2OSWA 3VX1A 3O3EA 4U1SB 2YEVB 1CI3M 1FBIL 2F53E 1RJLA 2HYMA 3CZKA 4U6VH 4KMTL 3KYNB 5JW3H 4OZFG 3GZOA 4G7QB 4PJGA 5KSBA 2BSSB 1RK0A 4P8QA 2UWEE 2XA8H 2XRAL 1A6PA 3VFGL 1QO3A 1YUHB 4M56A 1UT9A 4ZTOL 3MJ9H 3KWWA 1M7DA 4N1CA 4GAYA 2BNUB 4M62H 4HG4K 5I1CH 4EZMA 5D1XC 1MFCH 5IFJB 2O93L 4DP0X 4PLJD 1BFVL 1CF8H 2AQSA 5LQBH 1JDAA 3GSWB 1H15A 2XVGA 3QHZL 1HS6A 3B83A 3JV6B 3MRPB 1UEYA 1RAMA 3MXWL 5CFAA 1VADB 1BOYA 4LT7A 2VZOA 5CF3A 1OANA 4M7LH 1FCCA 2XXCB 4YHYC 3QYNA 1YQ2A 3DDGA 1OSZA 3LDBC 4R2GC 4EUPB 5J06A 4RFOL 2I5YH 4C56D 1PQZB 1VEOA 3U9PH 4E0RB 3QW9A 2EH8H 4LLVA 5CJQL 5T3XE 4ZPTA 1IFHL 3PJLA 3WS6A 5IFHL 1I8IB 2NOYA 2AJVL 1L7TH 3GPSA 1S9XB 1G7LA 3VU2A 3KMDA 2IBZY 2K7QA 2HKHH 3JTTB 4ANKA 1BLIA 5FOBB 4NN6B 2FX7H 4WO4A 5E8EA 1R46A 2R1XA 3QORD 4ADJA 1I1FA 2QKIC 3AUVA 1FYTD 4DKFL 1HI6B 3KPOA 4FZEH 4IRJA 2X87A 3CDZA 1QSZA 5H94B 5IVXB 1S7RA 4U6VL 1KLUB 5JW3L 3UAJA 3SGJC 2I9TA 4ODSH 1URLA 2Q7YB 2GVYA 2XA8L 4EI6B 2CO2A 1WFOA 2ADYA 5FKPA 4P4KA 4WTZA 3ZYOA 2CHDA 3MJ9L 3IRZA 1TO4A 3MYJA 3ROOA 3FCUB 1LWRA 4M62L 5I1CL 3MRQB 2CBTA 1MFCL 5F1SA 3ATFA 1CF8L 3FQTB 4Z78A 4JY5L 5LQBL 4Y2DD 5KZCD 4RAVA 2X4SA 2E9WA 4ZSOA 4BE6A 1PLGH 2YD8A 4YBQC 4M7LL 1T4WA 1Z5YD 3DURB 3CHOA 2XPYA 5DQJA 1HQRB 3FFOA 4I3SH 4DF9A 2TSAA 3GDCA 2I5YL 4H5SA 1CXIA 3FO1B 4PGCB 3BVNA 2EH8L 4KO5A 4LESA 4A7UA 4L4JA 4UU9A 2NNXA 3UTSA 3KDPB 3LQAH 3U0WH 3VFPB 2R2EB 4ZMTA 4L3EE 4JRYE 1JD9A 1TJIH 3FTSA 1GGCH 1SLXA 4EOWH 4DGVH 3GBEA 1K6QH 5CMAA 2WNKA 2HKHL 2WV3A 3IS0X 1ZE3H 1FN4A 5JW4M 3LEVL 1H8OA 5LXGH 3EZJB 3DX7B 4QAWA 2DM2A 1MLCA 1YEIH 2FX7L 3ABGA 2WINA 1X9LA 1AD9B 1MCRA 3CFTA 1XGRA 4HD5A 4LSSH 4PBXA 3UROR 1IZJA 5KYNA 3L4TA 2D03H 1SEBB 1NC2A 3JVGC 1F3DJ 4FZEL 4X4MA 3P11L 3BWZA 5CIPH 5I73B 2NY1D 3FN3A 3NA9H 3RWEA 5CEZD 4G8IA 4Z77A 4ODSL 3DXAD 4PRHA 5AFAA 4ABVA 5LG6A 2ZJSL 2NY4C 3LKOA 4WW2B 4O4YH 4ERSH 4X9HA 4IM8A 1HHGB 1OD7A 5DLMH 1QI5A 3T0ED 3SQOH 2BHUA 5LB1A 4GP4B 2VDKH 4LSRH 5DZ9A 1DANT 2P26A 4AG4H 2EAEA 1ED3A 4QY8A 3KXFE 1KNOA 4QHKJ 2CDEB 4G7RB 1DBAL 4N28A 3MAWA 5DWPA 4CVXA 5E6RB 1E4XH 3FYEB 4HKZA 3SKNB 2CHXA 2WWNA 1S9WA 1F1DA 1LQSR 1A1NB 4TLUA 4FFZH 3FB8A 1SJVA 4I3SL 5CLTA 2OM5A 3M17A 5D2LA 3FOLB 3OAUH 2KH2B 3CFBA 4G5AA 4YDJB 2ZSWB 3UPCA 2YRPA 3Q2CA 1XF4A 4PI2A 2ROYA 1F42A 5DS8A 5EU6E 3U0WL 4N0CD 1QBLH 3T77A 5BV7B 3NEEA 3CFDA 5E2TH 4B9ZA 4HLZG 1GGCL 5B7EA 3ZVVA 4EOWL 2AJYH 3ARFC 3CZLA 2XETA 5LXGL 4RX4A 5G5DA 1IBHA 2QQNH 3WE6A 1YEIL 4OIAA 2WCGA 1OF2B 4DZBB 2GJ6D 2W8CA 3WTXA 5JHLA 4KHTH 3ZUCA 4LSSL 1I8MB 1MCKA 2ENJA 4XN5A 5EULV 3IDYC 1FPTH 2D03L 1AI1H 3K3QA 4MKTA 2JJSA 5D71H 4XX1E 3VH8A 1MNNA 1TZAA 4XNDA 3QJXA 3FUMA 2QT6A 3ABKB 2WXNA 3NA9L 4JFFB 1JK9A 1GZHC 1XGQB 3I2CL 4Q6IA 4ZTEA 2IH1B 2VLKA 2H9GA 4P2RE 4ERSL 4O4YL 4KAQH 2ZXWB 2LLNA 4UUJB 2JKWA 3MV8E 3APCA 4LSRL 4AG4L 2R4RL 4W9KC 4F92B 2FZ3B 4TVPD 3NIDE 4HD9A 1B2WL 4HCRA 3BN9D 3U0TB 1E4XL 4Z7WF 4PB0L 1HEZB 3CDGA 3WAJA 1ZLDA 5HGDA 4TMPA 3LKPB 4TTDD 2IDSA 4PW9A 3EYOA 1NGPH 3PDOA 3MV7E 3DECA 4NNYB 5ESQA 4ZFFB 1QSFE 3OAUL 2CBOA 3SOBH 1O7DC 4IGBD 3ETSA 1HQ4A 2K1MA 3U2SA 5IQ7L 2VZSA 3FRPA 1BZ8A 2UYLB 1WUZA 2XZQH 4W9ZA 1SXNA 5F72S 4L4VD 3V52H 1PGRB 4L3CA 1QBLL 4NUGH 3BZFB 4KRPD 3MGTB 5E2TL 5DZPA 3K81A 4P46C 5KSAC 1BD2A 3WKQA 5CSZA 1OSYA 4AV4A 4LAQH 1WDAA 2QQNL 3BSGA 4UNTA 3W11C 2HT2D 4GLRI 5F1NA 4P2QE 2IALA 4KO9A 1QRNB 4KHTL 5IQLA 1J8KA 1Z9OA 3UTPD 4H8VA 5F6HJ 5C0GA 1D5ZB 3KYKH 1FPTL 4AX3A 4Q2ZA 3MU3A 5EV7A 1MOEA 3VSQA 2E9GA 2YXMA 3ARBD 3QBTB 2KDYA 4OZ4A 3U30B 1J9TA 3T5WA 3T4AC 1CDHA 2VQ1B 4NO2B 5JXED 1H8LA 4YHOL 5CJOH 4X6FB 4KAQL 3JWOH 3DTDA 1R3JB 4GEIA 2VAAA 1NCJA 4E9XA 3BQUD 1S9YA 1T89C 2K6ZA 2Q2LA 3ARDB 3S3CB 1N6VA 1PX8A 4XCCH 3GB7A 5BVPH 2OR7A 2ZUUA 4MAUH 3ULVC 3O0LA 3LRGA 2M26A 32C2A 1WD9A 4YE0A 2CLZB 4Z7NB 3CFQA 3L1EA 4PG9A 4XVUD 3SDXF 4M43H 2HFEA 1UASA 3HKZA 4BZ2A 3NSDA 5F6HI 3ZE2F 4Y5VA 1FLRH 1NCWH 5D1XE 1T20B 5DVPA 5GGRY 2DWSA 3SOBL 2QVTA 2X2HA 1Q94B 1B6DA 4HHWA 4WI3A 1E27B 1WP6A 2UVEA 4POZD 4NUGL 2Y3AA 5C7ZA 4YGVA 3BN3B 4I0PC 5F7YC 4H8PA 3MREB 2C3XA 4ZYKA 1IBYA 1QTSA 3V0JA 4LAQL 4JFDB 1I7RA 1ES0B 2XZAH 1QEWB 4LCYB 3WJMB 3VI4A 2YD0A 5IUCA 3OKDB 4FYQA 3Q8BA 1AIFA 1ET7A 4KZDH 1KF9B 4NS0A 5B39A 4V33A 3CC5B 1MFMA 5SV4A 5EIIA 1S7QA 1OWRM 3TIDA 1FG2B 2OL3A 4ZS7H 3ES6B 1YY8B 1I8AA 4JFHE 5CJOL 3QDJB 4KI5E 3JWOL 3SGEI 3EOTH 5BS0B 2YR3A 1T7VA 4N8VG 5EUOB 4V2CB 5B38G 5BVPL 3K6IA 2A74B 4QKTA 4XCCL 4MAUL 2QR0B 1JXKA 1KPVB 1PU0A 4PBWD 3UABA 5FFLA 4KK8D 2QQLH 3V10A 2Z8WC 4AKQA 3O6LH 4F5CA 2O5ZL 3BSHA 3IF1A 4M43L 4YSRA 2QHRL 3LN4B 4AQAA 3C8DA 1IM9A 4C58B 3SN6N 3AGWA 1FLRL 4ZQKA 4JDTH 3UTQA 1JPFA 3VD9A 3UXFA 1IAKA 5I5IA 2OXHA 4TUJA 5FFOA 1DZ0A 4N20A 4G8EB 5EC2A 5JHDE 3SO3C 3IAPA 2IAMB 3Q05A 1JZFA 1TLKA 3HS8A 5ANMA 4M48L 3T3PE 4QRAA 1I9RH 4RH4A 1CDIA 2VXQH 2XZAL 2FX8H 5IFAH 4LARL 5LAXB 3SE6A 1GY1A 4U1NA 5EFIB 3SDAD 5BRPA 3QHFL 4NI3A 4KZDL 2GITA 1MNUH 2L8AA 4YFLI 4H13C 1FYHB 3Q0HA 3K74B 4NAQA 3EJUA 3PXLA 5D7SH 4ZX4A 4M4RA 1CXLA 1TETH 4UDTA 1F6AA 1T6BX 4ZS7L 3B43A 1LQBC 3SPIA 1X6LA 1CXFA 4ZUVA 3UIZA 4NPYA 5EMYA 3HHSB 2C5DC 5HPOA 4FQLH 1R47A 3HFML 4P9HC 4X6CE 1DZBA 4Z7VF 5J56B 4P0DA 3O45A 2QQLL 1VFAA 3O4LB 4NIYE 3VXNB 3O6LL 1I3VA 2IDQA 3VQMA 1HSBB 3CK0H 5SWSB 4KKLD 2HPTA 1V3MA 1I85A 4ZAKC 3WIHH 5ERWB 4JDTL 3H3PH 2WLIA 3NUKA 2V9RA 3BP5B 4JO2L 4NFDA 3WO4C 1PD6A 1MI5A 5D7LA 1LGVA 5AZ2H 3L3IB 2JK5B 3KH3A 4F9LA 3BDXA 4BSVA 4AJ0A 5FXCH 5I0YA 2PWDA 3E1F1 4W4NA 2X3AA 5D7IF 1XXDC 4QF1B 1I9RL 2OK0H 2NY5C 3AY2A 2AQRA 1BPLB 2VXQL 4UTBA 1P4LB 1SJHB 3CZFB 1M56B 1PJWA 2FX8L 5IFAL 2EXYC 5FGRA 4PJEE 4WI0A 4AQ1B 1JJUA 1J11A 1FORH 1MNUL 1QD0A 2FT8A 1CMOA 3S3JA 1E9OA 4YXKL 3VM5A 3MC0A 3EDDA 2XTJB 2X1XR 1JPEA 1TETL 5DHXB 3FQNB 3SJVB 5SWZD 4AQEB 1JYWA 1AHWB 1N0XH 1V27A 4PGEA 2EDTA 4U1MB 3V95A 3SDYH 5EU4B 1RVFH 3LY6A 2OTUA 1GZPA 4AKOA 2VL4A 4FQLL 5CINL 5FYKE 4JM0A 2XWJA 3H8NA 4QOKA 4JLRA 5HY9A 5GZND 3F01A 3ET9F 3CK0L 4DAGH 3VWJC 2XVKA 3QIBB 4IQHA 1MQKH 1WBXA 2BNQB 2IANB 2JJTC 4KROC 4O02H 2IQAA 4PRAA 3WIHL 5DJ6A 3H3PL 4LCCB 3HUJF 3BEVA 4R7NB 4AMWA 1GZQA 2F7IA 4CDHA 5EPMB 2A6JB 1FNFA 1IEAA 1II4E 1J9SA 2WTRA 4ZUUB 3T6ZA 3VFWB 3HPJB 4H1LG 5DHYB 2BVOB 2V6HA 5I15L 1J12A 3ZU8A 4LGPB 2VISA 1I7UA 1O7DE 2R0KH 1V7ML 4G1EB 4RFNC 5C08A 3TPUB 4M03A 2OK0L 2CRMA 4HHAA 3TH2T 3ALWA 2AXHA 1KEMH 2Q8BH 5BW7C 2ALWA 3DUSB 4IK6A 4Q9QH 2F54E 3KLSA 1FORL 1YN6A 4NQCA 3MKGA 5TK4A 3O41A 3OSVA 4HFUL 5IROA 4G43B 5I8KH 5TQ0H 5E5MA 4Y16C 4GUQA 5ETUA 3DETC 5BUGA 1EXHA 4BINA 3PIQB 4D0BA 5FB8A 3SDYL 1RVFL 3HZYA 3CU1A 1B9ZA 1DQKA 3QH3B 4I77H 1DJIA 1GOGA 1UD6A 2OP4H 2YAHA 4WWKD 3LKSB 5JORA 2FLRT 3C09B 4Z7IA 2F53B 1VERA 1SLUA 3FUHA 4F2FA 4KXDA 7CGTA 4IIQC 4G6AC 3CFUA 3DX4A 5DHVB 1G7QB 3FSWA 4DAGL 4IK7A 1ZTXL 4HWZA 4JGMA 2UWEB 1MQKL 2CJUH 1BGXH 5CCJA 1JMZA 2H1PH 3AWGA 1PX3A 2NY2C 4QRPE 3W9DA 5K1VA 3ULVE 3RVWC 4GRLD 1WIPA 2H7WA 3BH8B 3L7EB 2NUPA 4NUJB 3T1FB 2E7LA 2YLKA 4J3OC 4ELME 3II3A 1E5ZA 2Q0ZX 3VFRB 15C8H 3E0GA 3W82A 2R29A 1ADWA 5FOJA 2ZUQC 5IIEB 4WENB 2JKRM 2R0KL 3SDDC 2WZPD 4GSRA 1EFXB 4NAMA 3ZJAA 1FC2D 5BOZG 3QUZD 4UDUB 3FTWA 1KEML 1MKFA 1EAOA 2Q8BL 4GINA 4LCIL 2KLRA 4Q9QL 3FQRA 1MDTA 2YRLA 1WICA 3BFQG 3E2HC 2A6DB 3GIZH 4NDMA 2H45A 4XXCA 5HI4C 1Q9OA 3RVVD 4BGDA 2E5EA 3ARED 4BZ1H 2DLFH 2IO5A 1MFAH 4ZFZA 5I8KL 1XBDA 4FXLA 1IL1A 2WQAA 4S1SH 1N8OE 4JDZB 4UOQA 3SYCA 2OKMA 1MHCB 1RK1B 4OFVA 3S8WA 1DEEA 1QLRA 4I77L 2OP4L 1RULH 1EO5A 3RGVC 3F7YB 3FSAA 1JZ4A 3ETTA 5AD0B 1DN0B 1ECZA 1TKWA 1NFDA 4JQIA 4ZT1A 2P48B 3CGTA 1H6FA 5DK0B 3MBEB 4A66A 4FE9A 2YPLB 5C1MB 1XGUA 2CJUL 2P80D 1BGXL 1EPFA 4QRRA 4OGXL 3VQ2C 3VSTA 2H1PL 4XCFH 5B1CA 4MLIA 4RBPK 4XP6L 3O81A 2XQBH 2X9ZA 1R24A 1P84K 4NQEE 5EO9A 3Q06A 4MA8H 3GBLA 2KI6A 1MQ8A 4YHNB 5DO2D 4W9CC 4LNVA 1DQJA 4L37A 1ZHLB 2PUQT 2IBZX 5J57B 2Q5BA 4CILA 2BJML 2ZX8A 3PQYA 3VWKD 4XBGB 3DX0A 3GIZL 3HE6A 4NZRH 2UZPA 5I8OH 1TENA 5FO8A 2Y7QB 4L3EB 4JRYB 2DLFL 4BZ1L 1MFAL 1KTKE 2A9ML 1EHNA 3ISRA 3BPLB 4S1SL 3GJFK 4TUUA 2E46A 1CLCA 4BA8A 2HJKB 4XPGH 5HD8D 2BIHA 1GKOA 3QXVA 3KLHC 3P9MA 3WXVL 4WTQA 1OD9A 1EEYA 1SJEB 1RULL 3PWPA 4P2OD 2GHZA 2KC0A 2A5UA 3EBIA 2DKMA 5D4HA 4LK4A 2J8UA 3I3BA 1AKJD 4U1KB 4ZI8A 1W0VB 4LSTH 1LE5A 5FX3A 3QUXC 3TBTA 5LBSH 4KKAD 4U2YA 1BWMA 3MNZA 3KPNA 2M1KA 1BZ7B 2V0AA 4KGLA 1OZTG 3CSYA 4H8QA 4MSWA 1L4IA 1MXDA 4XCFL 2GY5A 2H1LM 3F05A 5AG9A 3N1MC 2K45A 1JWMB 4LASL 5E4EB 3SD2A 1AGCA 2GUOB 3DC0A 3L16A 4JFWA 1UWXK 4JRWA 2XICA 4KJWD 3TNMB 1G87A 5EOCJ 2FQGA 4MA8L 2XNAA 3GXTA 1YZZA 3KXFB 3OG4B 2VC2H 4LVHC 2UVFA 4PJIE 1SOSA 2DL2A 5A7EA 1HYSC 3EJRA 1AE6L 3KG5A 5IJBC 2WQUA 4L9LC 3P2BA 4JVPA 3B2VH 4PJ7E 5I74B 1CS6A 3EJPA 5KBPA 4HS3B 1ZLVK 2Y24A 2J7LA 2IPKB 5JLZB 4F8PA 4EZKA 5I24A 1RZQA 1U33A 4YHPB 5CGYC 2HT4C 5A6MA 4WKXA 2AXFA 2XA3A 2VSKB 2APVA 2YD7A 3WHXB 3TA4D 4DEPB 5I8OL 5IR1A 3TO4D 5DO8A 1YEKH 3DI2B 3ZSTA 4RNRA 1N2RB 5IW6B 3VGAB 1HH9B 1DUYA 1DDHB 1TVHA 5CKAA 1KYDA 1RJZB 3MRDB 2R1WA 4XPGL 4BUGA 3KW8A 4WJKB 3A23A 5IVNA 4G8FB 1TOXA 4ALAH 5IMLB 2F1EA 3C6LA 4L0YA 3FQ2A 5KANI 1ZV5A 4LIQH 1NGWA 2AV1B 4A2DA 1F18A 4LSTL 2BHZA 2P28B 3CFKB 3A6BH 3F62A 5LBSL 3HJEA 1SXCA 2BZCA 2FD6H 2VDNH 2ZIDA 2QSQA 4NJAH 5AOLA 4C83A 5DRZA 4P2RB 5D1ZB 2PPEA 1JF1B 3FYIB 4Y19A 1ZD6A 5EO0B 1HKLH 3MV8B 1AKPA 2IFFL 2CUHA 5C8JA 3R4RA 3FFCA 3WJJA 5I0WA 3LRHA 5DRWA 2VC2L 1G94A 1ANUA 3B7RL 3LB6C 1XH3A 2IWKA 5C09E 1XF3B 3B2VL 1JXDA 2ADJA 3L3OC 4JE0A 4PRDA 4JG1H 2DAVA 1KGCD 4DP5X 2CIIB 5BZDB 4LZKA 4L1HA 1QSFB 2C26A 4FI8A 3TURA 2YIHA 2DQJL 4MJJA 1HZLA 2V5TA 1HHIB 1IC1A 1C7SA 4J3UA 3UMTA 1A21A 4I48B 4RWYH 4KX7A 1S9VA 4UT9L 4YDIH 1XTMA 2GIMA 1YEKL 1XAUA 3QUMA 4GBXD 4EN3C 1CCZA 2Z0UA 3NIFF 3CXHK 2CUMA 2PO6D 2NDFA 3NJIA 3QWQB 3S88H 1R0AL 3EOBB 2Q7NA 1NM9A 4XMKH 5GGSY 3AB0B 2VN4A 3KYNA 4P2QB 3X11B 4WK2B 1B3IA 1OP5H 3TO2B 3UC0H 3SKJH 1D5IH 1YUHA 3A4DA 3P73B 5IQNA 1G0YR 3UACA 3O3UN 4LIQL 1ZLSL 2PCFB 4QGTA 1T7ZA 3DX8B 5IFJA 2BNUA 4G9FE 3A6BL 2FD6L 1H8SA 5GRJH 5J13C 1D6EB 1U42A 4M7KL 4NJAL 3VW3L 1BHGA 2BDNH 5JPNC 3GSWA 2RCSH 5CO1A 5EF1A 3JV6A 2GC7C 3MRPA 1AXSA 3KJ6H 3VYOA 2AHIA 1HKLL 1VADA 3QZMA 2W07A 4ATWA 1ZTMA 1ZHKB 1VCAA 4ZW3A 3BIKB 4KK5C 4XNMB 5B1KA 1GCFA 2F2HA 3EOAB 1OK8A 4EUPA 2EUZA 4E0RA 1PQZA 4UILH 4WDIB 3PP3K 5MEPB 2F8XC 4X42A 4JG1L 1JG9A 2JI3A 4PJFA 3E6HB 3LIZA 4J6RL 5D1XB 3QXTA 3FAXA 4K5NA 1I8IA 1P7QB 3TF4A 5F3BB 1S9XA 3JTTA 3IMRA 5L0QB 4MZRA 4PJGF 4WVRA 3EOYG 4PS7A 2WVUA 4OFYD 4YDIL 5IV2B 4WO4D 4WRLA 2ZCZA 5FUCE 1U3HD 1JZ3A 2CPCA 4YHYB 3HAEG 4OF8A 4WJ5B 3APDA 3DSNB 3LDBB 4BFNA 4R2GB 2BIPA 1HI6A 1Y6KR 2NXZD 5C7XH 3S88L 3EYUH 1V10A 5H94A 5HJDA 5IVXA 5ICYB 4XMKL 4Z1PA 1KLUA 4YN3A 4JKPH 3QDMB 2QVMA 2VR8A 2Q7YA 3SKJL 3UC0L 2DQUH 4EI6A 1D5IL 2HTLD 1KENH 4N3UA 4IMKC 1KBWA 4P4KD 3FH7A 5FO9B 1MCNA 1SBSL 4FHJA 4H0LC 3BLKA 3GUFA 3KBHE 3KCPB 3INOA 3O11B 5F9WC 4LSUH 5GRJL 3ZL1A 4HT1L 1KIUB 1CVRA 3EYQC 3ARZA 2ZUSA 2QKIB 2BDNL 1J5IA 5C3IA 2Y5TB 1OEZW 1F4HA 1J0ZA 2Z7UA 5EF0A 5LN8A 3PWVB 4AITA 3KJ6L 1DO6A 3DURA 2ARJB 1HQRA 5IJDC 4UILL 2MHAB 4PGCA 2X89A 3U48A 4BUQA 3UBHA 3VFPA 2R2EA 1OP9A 1AS7A 2YKLL 4K23H 3R7RA 1G4RA 1L9SA 5GRVL 4MCMA 3WD5H 4TLTA 2AFNA 5AOZA 2VLJE 3DX7A 1HEHC 4X5RA 4KOCA 4ZFOL 1AD9A 4OKDA 1ZSHA 4KDTA 3R19A 3WKNA 4HIJB 1B88A 2J88L 3H9SE 3IMVA 3T3PB 1SEBA 2FJHB 5C7XL 3EYUL 3WFZA 3OKKA 1E4WH 5KTEH 4JKPL 2FWOB 2VW4A 4QJ4B 3LNFA 2NR6D 2DQUL 4OLWH 4U1IA 5L88H 1FGVH 4MVBC 1KENL 4WW2A 4AIZB 1UGKA 1GGIH 2BPBA 2WNXA 1HHGA 1GIGH 3PXJA 2PETA 5INDB 4HUXB 1ETJA 3W39B 4NN5C 1GSMA 5DQ9B 1LEKB 5HGAB 3RVTD 2CDEA 4AIXA 1A4KB 4YBLC 3HLAA 3AG1B 3SKNA 4CKVX 2IQ9L 1SY6L 5IUSA 3SBQA 1A1NA 4GW1B 2PCYA 1L9OA 5HDWA 5LVEA 12E8H 3F6IA 4QXTB 2YAEA 3FOLA 5DQDL 3PWNB 4NZJA 4JNXA 3TL5A 2NY4B 4YDJA 2MPAH 3G6AB 1ZKAA 3QQ9D 5MP6H 3TWCH 2B9BA 2XHNA 3SDCC 4EVNB 4OGAD 3OD3A 4GUPB 1I1YB 3RJDA 3V4LA 3GI9L 4MB3A 5LBVA 1JHLH 3D34A 3U0PB 4WGKA 1LP9E 3Q2VA 4X7CC 3WD5L 3QIWC 1VLXA 4RX4D 5DJDA 4ZUWB 1FNSH 5TK2A 1OF2A 2JQAA 5BRZB 1JXJA 1NCBL 2V5YA 5A2FA 5E5RB 5LDSA 4AEHL 1I8MA 1FV1B 3N41B 2XT1B 1EX0A 3KGSA 2BNRE 5E0QA 2H32H 3P40A 1U8PB 1BSIA 4JMXA 1YY9C 1E4WL 1FAKT 2OZ4L 4WNJA 1B4RA 2WB1A 1XGQA 3MRBB 4JFFA 4ICXA 3KYAA 2Q3ZA 2PR9A 4FTVE 4OLWL 2XN9E 5L88L 2IH1A 1CLOH 2VSCA 4NC1C 2R39A 1GGIL 4BFKA 3ARFB 2WO2B 4U31A 1GIGL 2A9CA 4UUJA 3HRZC 1NKRA 3K91A 4GKSB 4ZW6A 5HXMA 2BCKA 1JUFB 4NBYB 2JJUA 2P52A 3BMWA 1TU2B 3ETBF 2FZ3A 4AY0A 5H4ZA 4FG2A 4FERA 3GYRA 3IDYB 3U0TA 2DIBA 1E65A 1HEZA 2MNUA 2VUYA 1I75A 3LKPA 4WFFE 4ZOAA 2YXWA 1HSAA 4P23D 4BHUI 4NNYA 12E8L 4ZFFA 4FNRA 1WV7T 1FRGH 3UH8A 3BCFA 3HHRB 3I6SA 2C9VA 2YRZA 5FKAB 2MPAL 4JGNA 5MP6L 2UYLA 3TWCL 1KJMB 2ZXBA 3OF6D 3MLRH 4XOBA 4YK4C 1KTJA 4Z7QE 3BZFA 1X5JA 3MGTA 3FT0A 3ZMNA 2JIXD 2D31B 1JHLL 1AD0B 5L7XH 3MRIB 3QXWA 1G6VK 4ZNEE 4I1RA 2CO7B 4XBEL 1SN5A 5EU6D 3CHSA 3DGDA 1WFUA 4J3WA 4HH8A 1QRNA 1OB1B 3CUPB 1CTOA 3MUY1 1CJYA 1D5ZA 2FB4H 4Y2OB 4TYUA 1W91A 1WC7B 2N0MA 4ELKA 2HFGH 3CZSA 2BWIA 5CLWA 4TLKA 4D9RE 3QRBA 2B2XH 1UWYA 2NYZA 4NO2A 2F54B 4HKJA 4M3HA 4LSDA 2PPAA 4W9JC 4G8AC 4P46B 1CLOL 1KV7A 2ZTBA 4X6FA 5KSAB 1FVDB 1R3JA 3MLUH 5BQDA 1L6ZA 3ARDA 3S7GA 1CGSH 3H4HA 4JM2D 4P59L 2WO3B 2AZUA 3L1OH 1VFUA 4HEMA 4Y1TA 5E9AA 5KVDE 2HRGA 2DWTA 2CLZA 2AP2A 4WFHD 4A39A 1HAUA 3BO8B 4PRBB 4X6DE 4HXBH 4R6UA 2QPFA 1DJSA 2XWBB 3SPJA 4GO8A 3I75B 1NFKA 3ZDXE 3T4AB 1T20A 2ALAA 3CBJB 3PWUB 4UTAH 1FRGL 3HNVH 1Q94A 2OYMA 4JQXA 4KI1A 2E7CA 3AM8C 2RMNA 1BBDH 3MLRL 4R4ND 4FQIH 4C4KT 4MAYC 4QRPB 2JKJA 5C0BE 3MREA 4AW7A 5L7XL 3N55A 4NOBA 1PYWB 3VDAA 2DWDA 3X17A 3DWTA 4P5KB 3FPYA 4JFDA 4E9SA 1ES0A 3Q48A 4L23A 5AAMC 3T3MF 4LCYA 1QEWA 3WJMA 2EDOA 4ELMB 4KX8A 3OKDA 4M7ZB 3EUUA 3WGUB 2VR6A 1RPQA 4I2XE 2FB4L 1FI8C 2YA2A 1VPOH 4JHBA 5C0IB 1QHPA 2MNWA 4YZWA 2HFGL 1EFQA 1JVLA 4PJ9D 2APBA 3CC5A 3RDJA 2ZG3A 4QHLB 1CVSC 4KH9A 3PFQA 1FG2A 2AV7B 2B2XL 1A47A 3LNDA 3ES6A 2ZCLH 2YZ1A 4I0PB 3B1UA 3QDJA 2P24A 3MLUL 4OLXH 5BS0A 5EUOA 4Y4KB 2A74A 1P4UA 1CGSL 1PFCA 4ZOBA 2WNWA 3B9KD 4Q74A 5I1GL 1CFVH 3QQ4A 3FUDA 3OB0K 2H26B 3PY9A 1X7SA 3EFFB 4XXWC 2FIKB 3IFNH 4MZ3A 2BOBB 3CTTA 3Q2NA 4H25B 4PUBH 2EDMA 2HJLB 4BRVA 4KTDH 3LN4A 1BX2B 4HXBL 1X5XA 1S7XA 3WLWD 4GRWF 1ORQB 2X70B 2NMSA 4JFSA 4UTAL 1ZV9A 2J1KA 2DQCH 2N1KA 3HZMB 2D3JA 3VI4F 5T1MB 1F90H 3RWGA 4APQD 1DBMH 2W9EH 1KYOJ 4G8EA 4XCNB 5CCKH 1EEQA 4KKBD 2KBGA 4H40A 4AIOA 2IAMA 1A4AA 3IJEB 3C87A 4WO0A 4YLCA 4H8WC 1E28B 3WNMA 3RE0A 4NQEB 1I3UA 1EAQA 1JMXA 2WQVA 1KACB 3LKQB 1OP3K 2VE6B 5LAXA 5K9QG 3US0A 5MENA 1E3ZA 5EFIA 1WRFA 2QPEB 3EXLA 1NOLA 3TFBA 3MI6A 5E94B 1U8JA 2Q76A 2VDKB 4QRFA 5D9SB 1A6VH 2A4ZA 1NKGA 4KNTA 5AVXB 2DMKA 4TRPH 4LAJH 2AABL 2DDQH 3SO3B 2FEEI 1SDDB 1VRSA 4OR1A 4BA0A 3RX7A 2WN3A 5DRNB 1L7IH 2XLLA 4OLXL 5AOKA 4LOFA 4R8WH 2R2BB 3LRSB 3SY6A 2ROXA 4K8RC 3HHSA 5SX4H 4JANB 3CLFH 1MRDL 2DWYA 1CFVL 1PCSA 2C9PA 5MEOB 3LXCA 5LO7A 3FU6A 4KI5D 3QPQD 3B7SA 3O4LA 2F1AA 2QSVA 3IFNL 3VXNA 4MBRA 4M1GH 1HSBA 3ESMA 1NPNA 4KTDL 2DBJA 5SWSA 4GXUN 4YSAA 3MXVH 4ONGL 1IUZA 5ERWA 2DD8H 2IG2H 3QXDB 3BGMB 2BH0A 3BP5A 2G75B 5T5FH 1UH3A 3MNVB 3VTAA 2WVVB 1MI5D 2BY3A 4RMUA 5D7LD 1CFMA 3L3IA 2JK5A 4HUMB 4TUKH 4YHLH 1F90L 1BV8A 3NTCH 1DBML 2HX7A 2W9EL 5CCKL 3RNKB 2FYVA 3VTMA 1RKRA 3L08A 5T33H 1J9RA 3U4BH 3WGVB 1A14H 4QF1A 4HEPG 1NUNB 1P4LA 5JPMC 1SJHA 1X9UA 3CZFA 4PJIB 5JHDD 4N5ED 5L9DL 1EO7A 9PCYA 2H47C 4ZAKB 3LTVA 4IOIB 4AQ1A 4LLUB 5A2KH 3WO4B 4KJQD 1CB4A 4TSBH 2VDMB 2VERN 3N43B 4DPCX 5J1AB 4XX5A 1NA8A 1A6VL 1LDPH 1FQ9C 3ZMEA 4I9XA 4TRPL 1NCHA 4AYEC 2UZXB 4EIZC 5AB2A 5CNHA 2DDQL 5GRZA 5EZJB 3FQNA 3HKFA 3SJVA 4AQEA 1AHWA 4NNPL 5CCGE 1TQTA 4U1MA 1L7IL 4OQTH 1LD9B 3DJZA 4OM0H 5EU4A 4HULB 4AQ8C 2ICWI 3EJYC 4NC2B 5E9NA 3OMZA 4CSTA 2O1AA 4PV8B 3CLFL 3BLBA 2R56L 1OL0A 3L1FA 1K8IB 3K80A 4GIOA 2DMGA 4GXVH 4PTUB 1MCDA 4G3YL 2PCXA 3K2KA 1WAAF 2IANA 2KT6A 5FM8A 1JWUA 5IK3B 4UOZA 4M6ML 4FQXD 4P5TC 4AGOA 2DD8L 5T5FL 3LX9A 3NMEA 4LCCA 5F0MB 4LPYA 2FJUB 1RHFA 1RK7A 2A77H 2QTVA 4R7NA 2G5UA 3QNFA 2JFCA 4TUKL 2HCZX 5EPMA 3NTCL 1HE8A 1E5AA 2A6JA 3AFLA 5I1DB 4KQ0A 2ARJQ 4AT6B 4ZUUA 3QDGA 2VAJA 3VFWA 5T33L 3HPJA 3L4WA 5DHYA 1FZMB 3TXAA 4ABQA 5BJTB 1A14L 1P4IH 4G80B 4LCVA 4G1EA 4EZLA 1QVOB 3TPUA 4MJIB 1XXFC 1CGXA 1CYWA 5GPRA 1JWSB 2I27N 2B5IB 3VWJB 2WLJA 1B4LA 3GZQA 4KROB 3DUSA 3MN8A 1MZYA 2AGJH 4UV7H 3RILA 4HUCA 2XY2A 4JRFA 4HWUA 2K8MA 5ID0B 5IROD 1LDPL 4GFXA 1U3ZA 2IWFA 4L8BB 2XN2A 1BAGA 2J56A 4X8CA 5IEKB 4PJCB 4QEGA 2VZVA 2D9QB 4OQTL 1DSFH 3NZHH 1YYCA 4JZOB 4N25A 2EDHA 2D0HA 3QH3A 4RFNB 5DJCB 4HJTA 5FHBH 3LKSA 5HVHC 1MCSA 1X4XA 4N85A 1SHMA 5AW4B 3FQUB 4MJ4A 4AYSA 5I1HL 1M6OB 5DHVA 1G7QA 2I69A 4UQ9A 5J12C 4BFFA 2UWEA 3TASA 3U46B 2CKNA 4MA1C 4RDQF 4PRIA 4Y16B 1JGEB 3NABL 3OM3B 3ZMRA 5HDBE 2R59A 2A77L 3BH8A 1HL8A 3IN0A 3L7EA 4G9FB 4IBZA 4XNZC 4NKQB 5IMMB 4O00A 4NUJA 3TV3L 4FYRA 3T1FA 4GKOA 4A1RA 3U83A 4K2UL 1HNFA 4QWWC 2NY0D 2YBRB 3VNYA 4TQHA 3VFRA 1THAA 2R0LH 1R4XA 5IIEA 4U0RC 1DVFD 1QEXA 2EE2A 4IIQB 1K5NB 4WQOA 4HIIA 1EFXA 4FL4C 3WLBB 4UDUA 1KUMA 3U7WH 5J5EA 2YD6A 1E9PB 1JIBA 4R96B 2RBLA 4WZ9A 3W56A 1T80A 1ETB1 2NY2B 2A6DA 3AAZA 3BT2L 5LGYA 2Y07H 4M9PA 1CPUA 4W81A 5TDNB 1NWOA 5E2WL 4KFZC 4Y9BA 4GW4B 4LRIC 3Q5TA 2EKSB 4JDZA 5E00A 1HNYA 1DSFL 1BQHG 3NZHL 2ZUQB 1MHCA 1RK1A 3PV6B 4IOFC 3QCUH 3SDDB 5FHBL 4UTCA 5CWSB 4YSUA 3ZE1E 2FNBA 5KW9H 3F7YA 5J3HC 4XP9H 4PS3A 3LZLA 1CYXA 5AD0A 5TJWK 1DN0A 2BY0A 3E2HB 5DK0A 3MBEA 1MAKA 2YPLA 1DFXA 1VFBB 2WQ8A 3BZDA 1HYRC 3HFFA 3JSSA 3ZKMC 1HCYA 1MXGA 5FGCE 5GS1A 4Y4FD 3DHMA 4LXFA 5D1QE 1JYNA 3VE0B 1CZ8H 1ID5I 3NQKA 1BECA 3MACH 5HDRA 1YNTA 2FHBA 2ZOLB 4U1JB 5IGXH 4RFEB 2KLSA 2WN2A 3C9NB 3RIFK 4CRPA 4YHNA 2R0LL 1RZFL 4WFGD 3RGVB 4OLUH 1KGJA 2D3VA 1UADC 2IC2A 3ULUH 5E7FA 5A2JH 4GEJA 1ZHLA 1ET5A 2Q7AA 3U7WL 4XVSH 2VQUA 2O5YL 2VDRL 3GNMH 4FP8L 1F2QA 4XBGA 5D8JH 3DUHA 4JPKH 4KUCF 1WCBB 2Y07L 3KS0J 4HDIB 2Y7QA 4HS8H 3INUH 4JO3H 4GAJH 4JRYA 4L3EA 5I1JH 4TPRH 3PWJB 3VVWA 3FT3B 3PRZA 3AJ7A 1NFDF 3GI8L 3U6XA 2VLJB 5HTSA 3T2QA 1FH5H 1SY6A 3S5YA 4GLRH 1JERA 2V9UA 3QCUL 5GS0C 1SJEA 1PG7X 1VB9A 3H9SB 5AVTB 3ZRFC 4FHKA 1NBQA 4NCDA 4XP9L 1CI5A 1GR7A 1JGLH 3D69B 5DC9B 1ZXKA 3AXIA 1W0VA 3E3QC 1V3LA 3FHQA 3MZTA 4TQIA 4U1KA 1FWXA 2FT7A 4JQVC 5DMKB 1BZ7A 2DKSA 2BX5A 5TE7L 2J8OA 3MUGB 4JFEE 4JFYA 3X1EA 1JWMA 4PHXA 4CBPA 2GUOA 3TNMA 2NQCA 4MMXC 1CZ8L 4UZSA 4MHHI 3MACL 2GJJA 1OAUH 2CXGA 2QPSA 3EGSB 3HW7A 5IGXL 3BVXA 3BFOA 2MQGA 3KR3H 2VMJA 2FIRT 3KPSD 2ADGB 5AW8B 2BY1A 3HBZA 5C2UB 3KPRE 3VD4A 2QLVB 1NIDA 3GLDA 4FI7A 4A7GA 4HS3A 1NGQL 4XMUA 2OJEA 5T3ZH 4OSUH 2VXTH 3QUXB 1XIWC 4I4WB 2WUBH 4XVSL 4YHPA 1BZ9B 1J88A 5A6LA 3GNML 4LPVA 4I88A 5D8JL 4QJ3B 4DP1X 4K15A 3WHXA 4JPKL 5F0JB 4ZJ9A 3D0VB 4L8CA 2EDDA 3INUL 4K4KA 4JO3L 2F15A 4GAJL 3HA0A 4TPRL 1CD8A 4HJJH 2J8UF 4DUWA 1HH9A 1LP9B 2J8HA 4LVHB 5JQIB 1TNNA 4QT5B 1RJZA 3VCLA 1KGYE 3CN3A 3MRDA 4HAFA 3D8MA 4P9HL 4X6BB 1FH5L 4PGBB 1NC4B 2K9UA 4O02B 2CNZA 2EEBA 4G8FA 2X4NB 3ZDZF 3HG4A 2X7LA 43CAB 3BAJA 5IMLA 4CW1B 3P0VH 4W9FC 4FA8A 4RWHA 3C6LD 5FO7B 4KVCH 5C0RH 1JGLL 2AV1A 5HHOB 3CFKA 3B5GA 2JKTM 4FTVB 1WZLA 1NDGA 1PEZA 1YG9A 4P2RA 4HJEA 3OAYH 1JF1A 3VXME 4CN4A 1YNKL 3NIGE 2D0GA 1A7BA 3MV8A 3I9AA 5E56A 2Y7MA 4C59B 3FFCD 3PL6C 4JFTA 1NGYB 1AOHA 4PJXA 4TL4A 3RY6C 1CE1L 5HSFA 3KR3L 4KWUA 3EDJA 1N12A 3MKKA 4GG6E 5I1EL 1XF3A 2JMRA 4J3VA 2N3JA 1RZKC 2XSKA 2AKRA 5GSVB 5T3ZL 3T2PA 5BZDA 4ZRGA 4OSUL 2VXTL 1OHZA 1J05B 3KGUA 2WUBL 4N2BA 3KH4A 1Y7VA 2NCEA 4ODWB 3V0HA 3H85A 4AJYV 1HCZA 3A24A 1S3RA 2QV2A 3PAZA 3W2DL 4OU3A 3GXPA 4Z7QB 3U4AA 4WJG3 4F24A 3LKRB 1R5WB 2WD0A 1JDDA 2OMTA 2NZ9C 4I89A 1KPUA 4P2AA 5E2UH 1JZEA 1BIIB 3EOBA 4Q4IA 1VSCA 5B3JF 3L3OB 4DTGL 3X11A 3S6CA 3D5OF 3TO2A 1RP8A 3P73A 3L45A 1IIKA 3CXDH 1Z2KA 5DZJA 4DKDC 4KVCL 2Y36H 5C0RL 3DX8A 2XPZA 1D9KC 3PAVA 4MQXC 1Z3GH 5GISH 4AVIA 1NCNA 3ILPB 3QS3A 5H37H 3R8BB 1D6EA 5J4MA 3K7UA 1G5AA 1DE4B 2CHWA 4DFHA 4EN3B 3C5XA 3RWIB 1R0AH 1WWBX 1EAPB 3AG2B 4U3CA 5EZIH 1RCYA 1F4XH 3VFMB 1ZHKA 3BIKA 2BVPB 5D5ME 3VYNA 1FO0H 3UG3A 3EOAA 4K0OA 1JZDC 2NY6D 2BSED 3HVDA 1DVSA 2ICES 2W59A 2AEPH 3EJZC 4WDIA 1UATA 5MEPA 3EH5B 5K9QI 4TM9A 4X6DB 1XEUA 3MCYA 5CSBA 3E6HA 2I25N 5D1XA 1N3NA 1P7QA 5EA0H 2W9DL 5F3BA 5KWYC 1TMCB 3GSXB 3HZKB 4LKCB 5JPNB 3HC0B 5C9KA 3BIAX 5ITBH 1OSPH 1X6NA 4XPAH 3GMLA 3HG1E 5C9JB 5C0BB 4WJ5A 5I0VA 2GB2A 3DSNA 1T1XB 1HN1A 2EDNA 2EIMB 1WAPA 2WLHA 3GMRB 3MA9H 4U4IA 3OTTA 1WLHA 3BH9B 5D7HA 2EYSB 4JGUA 3MNMA 2LU5A 2DF3A 3QDMA 4ZDHB 4I2XB 1VFOA 3WENA 1JNHB 4XTRC 4KMLB 3CXDL 3N44B 5JMOC 1U30A 5HHVH 5ISZE 3UBXG 2Y36L 5FO9A 3KGRA 3OHXB 4JDEB 5F1IB 1Z3GL 5GISL 1KCBA 2JLPA 5DFAA 4ENZA 1KIUA 2X4RB 1J0IA 2QKIA 1QPKA 2Y5TA 3DTXA 3TZVD 4YZFE 2V2XB 1TIUA 2QGEA 3PWVA 1IIIA 5EZIL 9CGTA 1RUPH 1F4XL 1ZDQA 3EH1A 3BPCB 1HZHH 3MRGB 1FO0L 3SGJA 3R0NA 3DK2A 3KJ4C 4F8NA 4LLWA 2AEPL 1A6UL 4IBUA 2OJ1A 1RZJC 3ASWA 5CZXD 2AF2A 4UMSA 5B7FA 2XACC 5AKVA 3HI5L 2WANA 5F9WB 2VDLB 5T1LD 5IVXF 4K9EC 2CHZA 1G6RB 3JWDC 1OHQA 1LK3H 1OALA 2XQYK 1LE9B 1OSPL 2JTYA 3VQLA 2P3YA 2E76C 2UX6A 4GUOA 2A9AA 4HIJA 3U9WA 1H3VA 4OJFH 2FJHA 2NX5E 1C1EH 1NINA 3BGFB 2D9CA 1EMTH 2EDJA 2FWOA 2FQDA 5ESVB 5GRWA 3DX1A 1E5UI 1TQBC 5DEZA 1CGUA 1RLBA 2WWMD 4GG8B 4WY7H 2OXGA 4Y1AE 2DJUA 1EXGA 4Q14A 2QGBA 4XBPB 3SSGA 2LVCA 2VMCA 3V8CA 4ZMYA 5INDA 5IHLB 4HUXA 2E47A 3W39A 4AGPA 3WEAA 3CZJA 4FS0A 5DQ9A 1LEKA 5HGAA 1AYRA 2WTOA 2APSA 1A4KA 3JVGA 1NCCH 1HXMB 4G6FB 4OCWH 4ONHB 2ED7A 1CFQB 1RUPL 4GW1A 5JZ7C 1HZHL 5IBLD 2R8SH 5L4JA 4PJ5D 2NPLX 4M5ZH 4QXTA 2A9NH 4WHDA 4IBLT 1UWEH 1A3LH 2XTLA 2XBTA 3G6AA 2B4CH 2WBJD 5LCVH 4S1DD 1MW0A 2OMUB 5DD0H 3MOAH 2H3XC 4EVNA 2X0VA 4OLYH 1DP0A 1ZWIB 3H2PA 4GUPA 5GGQH 2I60H 3U0PA 4LEXL 2H6UA 2I24N 2VMFA 3B9AA 5GJSH 1LK3L 3OKMB 2AQ1A 1RJCA 3AU0A 3OKNB 3W0WD 4YBLB 4AVHA 3RNQA 2X4PB 2V9TA 4N8VB 5BRZA 5B38B 2VUKA 4WW2F 2FGZA 3FTZA 1Z9SB 5EB9A 5CEXB 1FV1A 3CN4A 3HS0C 5LDUA 4NZUH 3WXWH 1N5YH 4OJFL 1C1EL 1U8PA 3VDCA 2H4EA 2VDNB 3QG6B 3VFSB 3ZW3A 1G7IA 2XWCA 3AZUA 4Y5YC 2WCPA 3MRBA 3SDCB 4NBZB 1XH2A 4X6EB 4DPRA 4RMVA 4WI2A 3L95B 1IVTA 1CWVA 4IMLA 1E7UA 4GW5B 2AQPA 2WLNA 3ARFA 4WY7L 2EECA 2BIOA 4RBPH 4GKSA 3QO0B 1TVDA 4AYID 1JUFA 3B9DA 4JFPB 4RA0C 2MCG1 4W93A 5B8CB 1TU2A 4MCZB 3B7UX 1BJ1J 4N2DA 3VGEA 5E51A 2DJMA 3BW9B 2AK4E 2IGTA 1NCCL 1WS7A 3DOSB 3US9A 4KRLB 4YDLC 3AWEA 1U8IB 4ONOA 1GZHA 4M5ZL 5HHXH 3DUUB 2A9NL 4KQ3L 4DCQB 3ZYZA 1PZ2A 3TYGH 4WSGA 1A3LL 5FKAA 4AOFA 2B4CL 2D0FA 5LCVL 1AACA 1KJMA 2WM0A 2YPVH 2ISDA 3HRZB 3V6BR 4OLYL 2I60L 3CDCA 4KK6C 2D31A 3UP6A 3WEOA 5GJSL 3MRIA 3WYRA 2FYYB 5DS2A 2CO7A 4WTXA 4XT1C 1RSYA 5B4MD 1W15A 3PCYA 3HRPA 4QPEA 1QRND 3CUPA 1MWAB 4XMWA 5F7AA 4NZUL 4Y2OA 3WXWL 2WMPB 3ELAT 1WC7A 2N0KA 1ZLWH 4V1DE 2GJRA 4DHLA 1XH0A 2HTKD 3UTTD 2Z31B 3QUYC 3VRIB 4YK4B 1OCRB 4JPIB 4HK3J 2F54A 2AVFA 3JUYA 3QNZA 4KY1L 5FYLH 4P46A 5KSAA 2Y5EA 2BNRD 4XC1H 1FVDA 3CFJA 1F11B 1CDCA 5KYUB 1DJXA 1FNAA 3MSPA 4KKNA 2E7MA 4O5LH 1NIEA 2ORBH 3GS7A 1WPCA 4P9MH 2GK2A 1INEL 1QI4A 2CO3A 3OKYA 2R2HB 4WAFA 3SHSA 1KGIA 5MHSD 1RUKL 3P3UA 3EDEA 2XN9D 4KXAA 1A65A 1QWUA 3LH2H 4MXWH 5JIDA 1RUQH 3OJ2C 3FT2B 4XGZB 1RUML 4PRBA 3JQOB 1HU8A 1L9NA 2AK1H 2AITA 2D3LA 3IXTB 3NRFA 4MB4A 3I75A 3T4AA 3HZVB 3ARGD 3PWUA 3TYGL 3B34A 5BMFH 2QVFB 3Q01A 5FIEA 4LL9A 1H3UA 1RXLA 4WFFD 3ELQA 1E8YA 1T89A 3E8VA 5T1JA 3ESPA 2RHEA 1OE2A 3FCSB 4YUEH 2RAMA 4QRPA 2WZAA 4RMQA 4ODXB 1KYFA 2D7OA 1PYWA 2FWLB 2B3IA 4P5KA 5C0AE 1P5UC 4D7BA 2HG0A 2YHGA 4FJ6A 2CRIA 1NZRA 2FBRA 4NP4L 2XC8A 3TNNB 5JMRA 2N4IA 1XCQB 5C3LD 2B20A 3S35X 1F2XK 4QHLA 4N2IA 2AV7A 4PYHA 1PZSA 3V4PH 3QJOA 4Z7NF 4H2AA 4I0PA 4MAYB 4Z18A 5FYLL 1OPGH 4N87A 1HCVA 3IPFA 2ZWZA 4H2CA 4DK3A 3ULUE 4O5LL 4D8PA 2ORBL 4P9ML 4FLQA 4P3WA 4JVUA 1Y0LB 1MUJB 4YS4A 4Y88A 3NT0A 3QEHB 2W0FB 3LH2L 5EOCH 4PP1D 1BZEA 1RUQL 2FIKA 3V6OC 2BOBA 1ZLUK 2HJLA 3Q7JA 2XKNB 2AK1L 3D06A 4KY2A 3P4MA 1BX2A 3SE9H 3UZVB 2ZNWA 4GMTH 1EVUA 4GOSA 1ORQA 2X70A 3G6JE 3HZMA 1EDYA 4OVUA 4FG6D 1P1ZA 5BMFL 2J1ZA 1NH6A 2P9RA 3T08A 5EOTA 4XCNA 7PCYA 1UM5H 4N90E 5FGCB 1TNMA 4YUEL 3MRLB 4PBDA 3IJEA 5HYIA 4Y8AA 1E28A 4Q97A 4Q6YA 2AQNA 4NQEA 3O8XC 1OAJA 3UYPB 4YPJA 2AZAA 2F7OA 3MZGB 1GS6X 2I7OA 4JREC 4UQ2B 4ACTA 5B22A 4MNGA 3LKQA 2VE6A 1I9IH 4GKNA 5MEND 3U9UB 4DKEH 5EUOF 1W6LA 3DOHA 1A7OL 2XVBA 3RL1B 4L1TA 4OH2A 3NDYE 1WISA 4JJHA 3KL0A 2CRYA 3V4PL 1SDDA 3CXFA 5E1AB 3O9WC 4G1MB 3NJJA 4FFZA 5T3ZE 2R2BA 1EJ6A 1T04B 3LRSA 3OB8A 3IN2A 4BK8A 3DYMA 1WBZB 5MEOA 5D6CB 4NHUB 3LZNA 5EOCL 5DMIH 3EF7A 2AMUA 4G6JH 4JO8A 5D7IB 5CD5C 2X3BA 3FRUB 1SFDA 5HJ3B 4S0SD 3SE9L 4GMTL 2APXA 4FYTA 2W60B 1N10A 2FBJL 2G75A 3MNVA 2I07A 1XL4A 2WVVA 3REWB 3KLQA 4BSJA 3D2UD 3KWUA 1WD8A 3RNKA 2IWEA 5DHMC 3TA3C 1NCTA 3RTQC 5ALBL 2JV6A 3JWNH 1JI1A 1F4YH 4XXDB 1ITCA 2YC1A 1F58H 2ESVE 2HH0L 2WXMA 4Y4HC 4X5PA 3QS2A 3X12B 1FAIH 1I9IL 5F9JB 4ZAKA 3KPRB 4LLUA 4P3CH 2D7MA 4B3EA 5I71C 1BCIA 1C08A 2LHAA 5J1AA 2BHYA 8CGTA 1OAQH 2X09A 1AG0A 4QTHB 3HJ0A 5J1SC 1J8HA 1A7RL 5EZJA 1PG7W 1O75A 3BKYL 1H0DB 1LD9A 5FDWB 5FK9B 4AL8L 3B2DC 3K6FA 5GS3A 2G3ZA 4PV8A 3VFUB 3LPOA 1TZOA 4BRJA 4YIQB 3U1SH 4AGLA 1I1RA 5DMIL 1GAFL 4PLJC 3I6KB 1K8IA 4G6JL 4PTUA 3H3KA 3L5XH 1N26A 4J1UB 2LU7A 5IK3A 2ZX7A 2DYPA 1S7VB 4E42B 1IQWL 4Y89A 1BYNA 2WIMA 4K3HA 1ZT4B 2HMID 2CDGB 1JFQH 5I1DA 3QNXB 3F04A 2BIIA 5IJVB 4AT6A 4AZ8A 3VXMB 1S9KC 3NIGB 3QDGD 1FZMA 1WH0A 3UYRH 1F4YL 3PPSA 2BOLA 5BJTA 1E5CA 4G80A 1QVOA 2DQ6A 3ECQA 4MJIA 4NGHL 1JWSA 5DFVD 3EG9B 2YJLA 3VWJA 1AP2B 1FAIL 1G9EA 1L9QA 2JJTA 3B2PA 1U2YA 3ZO9A 4A67A 4AJVA 4P5TB 4F8OA 4P3CL 1CFNB 1EJOH 2I9LB 3QRLA 1JDCA 5BO1H 5ID0A 4L8BA 1P9MC 2C3HA 2JTDA 4HJUA 3RUGE 1XCXA 3II1A 5IEKA 4PJCA 2WB7A 4PJBE 3PJNA 4JUTA 3DJTA 4JZOA 1MH5B 2GSIB 3WN5C 2EO9A 4IRSD 1UZ6E 3QWNA 4M3KB 1UOWA 3VA6A 1NJ9B 3U1SL 4XHJC 4DFIA 5BW7A 3FQUA 1HJCA 2XFGB 3U1PA 3MFFA 2YMXH 4Q58C 1M6OA 2NUTB 1T66D 1U93B 2DV6A 1TSRA 3J27A 3ESOA 2VXSH 3L5XL 4Y2DC 5GRXG 2MH4A 3QA3B 3VFNB 3U46A 3KCWA 4Y16A 1IM3B 1JGEA 4PRID 5IMOB 4Z7UE 5DC2A 4CADA 2IIJA 4N6RB 5IMMA 4G9FA 4ZW5A 1S2EA 2JKXA 3E9TA 2VDPB 4N0RA 2ZP9A 4HSCX 2IMMA 4YC2B 2YAPA 1UGNA 2YBRA 3H55A 5HVHB 2J5LC 5F6IC 1I4FB 5D2NC 3S0PA 3UYRL 4B9IA 4MMZC 2L4OA 1GW0A 5JIHA 3LAFA 1K5NA 3LN5B 4IIQA 5D5MB 2PTVA 5JNYB 3WLBA 2MJWA 4AEFA 1K9TA 3SB3A 5MI0C 4GPVA 1GY2A 4R96A 3QZNA 4NQDE 4MA1B 5K39B 1MFVA 4R0LC 1FL3B 4ZW8A 1R3KA 4G70B 3IFLH 1EJOL 3DIFA 4X5LA 1Q72H 4AJWA 1QHOA 3S48A 4XNZB 1MCJA 1ADQH 2LLLA 5HYQB 1PZ5B 2ZCHH 1T21A 1H6TA 2MCAA 1P5VB 1F6FB 4GW4A 2EKSA 3EGXB 3IGUA 2UWEF 1KFAH 2EC8A 3UDWC 3WNKA 4U0RB 3PV6A 3R1GL 3WNJA 4HETA 3MBXH 3IWUA 3WMPA 3U4KA 3SDDA 5CWSA 2UZIL 3UPRB 2BSDA 4FL4B 3C60A 1JE6A 1ETZB 1X7QB 2YGPA 1YEEH 3MLTA 4AMXA 1Y18B 2YMXL 2LFEA 4M8VA 2CMRH 4Z0XB 1IRAY 1DSYA 2H6PB 2YPLD 4LB8A 4XN1A 3P2TA 1ETA1 1FZKB 1KJ2H 2H0EA 2VTFA 5ISZB 2AEWA 5F7UA 3BUYB 4DKAA 3VE0A 4RMTA 4POUB 3GLZA 4BCZA 5FR3A 5E4IA 2ZOLA 5AAWC 3V6OE 5T5NG 3C9NA 3H54A 1YSOA 1FH2A 3CBKB 1MCCA 3RGVA 1OAZL 3Q43A 4N0CC 5D7JB 3NZ8A 4HQQL 4MXQC 4QXVA 3L3KB 1N7MH 1XD1A 4HMEA 4NZFA 4LSQH 1URZA 3CLWA 1PMYA 4OZFA 4IRZH 2W9LA 1T2JA 4U2ZA 4CJ1A 3QJFB 3IFLL 1DJZA 1Q72L 3MNWB 1WCBA 2OSLB 1OM3H 4HDIA 4NX0A 1ADQL 2NYYC 3DVNB 2ZCHL 3PWJA 2HG5B 3FT3A 4BFIB 4NO5B 2ICWB 2VLJA 2OR8A 3WTSA 2OMWB 1KFAL 2GABA 1QTYT 3TVMD 3MBXL 1WE5A 3R0MA 4HLEA 3H9SA 4GT7A 3TWYA 1GYAA 1JYVA 3BE1H 3QQ3B 3HC3H 4GNKB 2NX5B 4J8RB 2OSXA 4MWFB 4XMZA 1MCBA 4LF3B 4I85A 1NTDA 3D69A 1MG3C 1E7VA 4ZFQA 1IT9H 4YAQB 1LDSA 5HP5A 5DMKA 5K1NA 2BOCB 5JTWA 3BN9C 2K4WA 4K7PY 1QFWH 1KJ2L 3MUGA 5FEBA 3WMSA 1LO0H 4TTDC 3WKMH 4Y1AB 3STLB 2FO1A 3CZUB 3NJVA 1JD7A 5CGTA 1EUTA 3F7KA 2PYEE 3EGSA 1VF5C 4FADA 5H8DA 2R83A 5CHNB 2ADGA 1JK8B 3WS3B 3D07A 3HAEB 3MMEB 1KEGL 4DGIL 3ILDA 1YECH 4NFBA 3H2QA 3ZZQA 4TKWA 1N7ML 1LO4L 1YMMB 4OTXH 5I0ZA 4P05A 4LSQL 2AJUH 3QUXA 5FDYA 5HYJE 4NQVA 4I4WA 1TPXC 1X5AA 4IRZL 1NGXA 2RR3A 1BZ9A 5IB3B 1A9EB 3ZTCC 2NT1A 4I18C 2HT2C 3MCLH 5EUKA 5HHPB 2CA3A 5I0DA 5GXBB 1OM3L 3D0VA 4X0KB 4MMXB 1G9MC 5B3NA 5DZAA 5BUPA 1BM3H 4K8RL 5I23A 1LP9A 1GA2A 1P4BH 1UJ3C 3ARBC 3B6SB 3OAZH 3DARA 4QT5A 4K94C 4L9LA 4GSQA 3OKOB 4PGBA 1NC4A 3SYAA 1DLFH 1OVZA 5IBUG 1M2VA 4HF5H 5HGHB 5JXEC 5EO1B 43CAA 1D7BA 1XIWB 3BE1L 3BQUC 3UJTL 1FZJB 5FO7A 4D9QE 2YGVA 5TGBB 4WU5B 1LK2B 2E27H 1IT9L 2W1NA 5HHOA 1UD3A 2BVUA 5D4IA 3WFBH 2OCFD 4FTVA 2Q8AH 2HLFC 1QFWL 4JFQA 2QVKA 4XVUC 3O2VH 1LO0L 3WKML 1JFHA 2GBVA 3WEMA 1K8DA 3UGXA 1NGYA 4IHBA 5CP3H 1Z9PA 4JFED 3RWHB 2F8OA 4P5MB 4POZC 3ZTDC 2EZ0D 1ACYL 2VNCA 3RKDD 1HILB 5KOVC 4HWNA 5BRQA 5GSVA 4OTXL 3JV0A 2AJUL 2B1OA 1J05A 3QWOB 4UM9A 4C56E 3FULA 2OPCA 2WXGA 1EIBA 3MCLL 4ODWA 1RI8A 3TU6A 2EDLA 1RZ7H 4X0NA 4ZXBB 2YGNA 4AUUA 3PL6B 2QSCL 1R5WA 1BM3L 1P4BL 3H53A 3ZT7A 5L2KE 1BIIA 3PDGA 4FNQA 4A7TA 1QMUA 3L3OA 3RZCD 4HF5L 1TJHH 5HYSB 1OKEA 3ASOB 2W81C 4ES9A 1E30A 4V1DB 3GKWH 2E27L 2WLKA 4GAGH 4RMSA 4X8JB 3WFBL 3ILPA 4PIBA 1LWHA 4W6WB 4KK8C 3LSOB 2Q8AL 3OKEB 3V6FB 1NICA 3D05A 3T9WA 5JHBA 1DE4A 5L4MA 2OV0A 4EN3A 3O2VL 3RWIA 3D0LB 4D8OA 3TBCA 3NG5A 1IAII 3ESNA 2Z34A 1AFVL 4KV5F 1KXVC 3VFMA 4YSSA 4L29B 4YDVB 2BVPA 3II2A 3IDGB 4WSJA 2F19H 5LWYL 3BI9X 2EDKA 1S8DB 1MAJA 2LVEA 3SEPA 4Y7MA 4ZMWA 5E6IC 3EJSA 1KG0B 1UXSB 3MLZH 4ZO6A 1D9KB 3RAJH 1SVCP 3QHTC 4YSQA 2LLGA 4M9OA 4NOFA 3UZQA 3BP7B 2X42A 2ZOUA 3T6XA 3HZKA 1ML0A 3GSXA 4LKCA 5SWQB 1AC6A 3HC0A 1SLWA 4RLDA 1RZ7L 3SDAC 5D2NE 1MCLA 5JYLA 5C9JA 1VHPA 2WWKO 5C0BA 2V2WB 1T1XA 2VDOL 1KCUH 4JGJA 1M7XA 3GMRA 3H6AA 4R2GD 3LPFA 5F0PB 3L3GB 4D94A 4J8QA 3BH9A 4JUSA 1BFTA 5F9DC 2EYSA 3GSNB 3L7FB 4UNIA 2EKJA 4UOJA 1B4TA 2CUAA 1CT8B 2MNJB 4ZDHA 4I2XA 3TN0B 1JNHA 1NEZG 3ECUA 3O2DL 4WHCA 2IH9A 3A4EA 2YAOA 4JDEA 2DZEA 3KL5A 5F1IA 3GKWL 4A2FA 2VQ4A 4ZZKA 4N9GB 4OCSH 1I53A 1S7SB 1QQDB 2FEEL 3FONB 3IEAA 1L6PA 2X4RA 1I1CA 3AS1A 4OJAA 3X14B 1RIHH 3C5JB 5BCAA 5E23A 2WQSA 3EYSH 4KKLC 2V2XA 3T0EE 4TNVK 4BUHA 5IMKB 5F7MC 4N2MA 3QYMA 1F8TL 2KS0A 1A1MB 3BPCA 4RZKA 3MRGA 1JZJA 1U8HB 2DOCA 2R15A 4TNWK 1NGZB 2IADB 5FUOH 1ND0B 3BUQA 3ME0B 3IYLW 4Z8FH 3CH8A 2XQYG 2WOYA 4IMKA 4ZZFA 1E4KC 2EH7H 3ZL2A 2FATH 1U58A 2X4QB 3MLZL 2CRZA 3RAJL 3LRKA 1CO1A 3P77B 3G6JB 1VACB 4ISVB 3V0FA 2IWGA 2Y25A 3FTXA 1ZK9A 4OFKA 3AITA 3LNHA 1G6RA 2OYPA 2X41A 3T0VA 1LE9A 3K6NA 1PG7H 1YPZE 4Z7WE 4YBQD 4OD1H 3LOWA 3F12B 3SQBB 3DYOA 3L4ZA 1HWWA 2IDFA 5EN2B 1ZEAH 2GJ6E 2VRQA 1EZVY 4LOUC 4MA3B 4HXAH 3IVKB 5ESVA 4GIPD 3L3HB 5DSCB 3N9GH 3JWNE 2L3BA 1BXUA 3EO0A 3BYTA 4OCSL 1IAIM 4WI9A 1VZHA 3HTLX 1KYAA 5GZNC 1XF5B 1RIHL 4YSDA 1YEWA 3EYSL 4OIIH 1HXMA 3F7RA 3MGAA 4ONHA 1GYCA 4GI6A 1CFQA 4ENED 1PZBA 4C57C 2EC9U 2HRHA 2V7HB 5FUOL 4MQ7B 1INQB 4LCWB 1TFHA 4NNXB 4NO3B 5GS2H 4K9JA 4QTIH 3RKPA 3WNOA 1MCWW 1TQBB 1TTRA 2EH7L 2OMUA 3RI5K 2FATL 2UUDH 4PS4H 5E2VL 3T3PF 4N6QA 1DBJH 3D0AA 1BF5A 2EYTB 1UA6H 2RQEA 2BHFA 4RISH 2R2CA 3NVQA 5D7EA 3DSFH 2JSFA 3OKMA 3OKNA 4L4VE 1WWAX 2ZUXA 1PG7L 2NNCA 2X4PA 5E6SB 4IBWA 4N8VA 2W88A 5B38A 5CEXA 4OD1L 1QKZH 4J3TA 3D87B 4Y9GA 3UCQA 4TLSA 4YDNA 2X88A 3QG6A 1RZ8B 1ZEAL 3FU0A 5DUJA 3IMSA 1BF2A 3EKCA 2HRPL 3SDCA 4HXAL 4OFIA 4X6EA 3DX6B 3UTPE 4N0YH 5I8EB 3N9GL 3U7YH 3L95A 4WI8A 4N2HA 5FM5M 4GW5A 4A55A 4WWKC 3DPBB 4PY7B 1I7ZB 3QIWA 1FNEB 3QO0A 1SVBA 3I9PA 4JFPA 1IGTB 4WV1C 4MCZA 3MDJA 1B0RB 3HS0B 4H26B 3DO7B 3JYBA 4OCLC 4B60A 1R17A 3BW9A 2ODHA 3DOSA 3V5DB 2DQFB 1U8IA 4GRLC 4Y5YB 2D8KA 2ZOTA 3C6SB 3VXUD 4LE8A 1FUNA 4DCQA 4QTIL 2K8QA 1NDMB 2BXZA 2ZUTA 4N0UE 3H7LA 4I13B 4Q9RL 2V8LA 4HALA 3HRZA 3N41F 1KCKA 1IGFH 1UA6L 4RISL 2QELA 3D39E 3KNBB 1D5MB 4UMGA 3DSFL 4AVJA 1F3JB 5KYWB 2XXFA 3CVHB 3O3AB 2FYYA 3APMA 3I3DA 1OQOA 1HVXA 1WFMA 3DK0A 4KDVA 5D4JA 4ODHH 4LMQE 1SM3H 3STZA 1VEMA 1MWAA 2WKOA 2AXGB 2FH6A 3GXIA 3RVVC 5F7EH 2WMPA 3AREC 5IJKC 2R1YA 1QKZL 3MV9B 3QCVH 3U30C 4OD3H 3FUNA 4HS6B 3ARTA 1UG9A 5KG9B 4I0CC 3NJHA 4GAFB 2V3EA 3VRIA 3SDXA 4JPIA 4N0YL 3U7YL 1E6OH 4L0PB 1Z9LA 5KYUA 2VN3A 2Z8RA 3D4YA 5B1JC 3W11D 3R8QA 2R2HA 1PAZA 4G8GE 5I6MA 5DDHB 1GC1C 4GP5B 4JPQA 2CIKB 1SMAA 3ZR5A 2HFFB 1LEIB 2G0LA 1HJBC 3IXTA 3D7PA 3A6CH 3CFIC 4MS8D 3HZVA 3QUYB 2VW7A 5F7BA 4OJDH 1MREH 3R06B 1SRDA 1THCA 3MCKB 4AV0A 2AK4D 5CP7B 5IB5B 4F2EA 1WSST 3FCSA 2BP5M 4N68A 3KS0H 5DUPL 4NPJA 3THMH 4YLBA 1VFMA 1DTUA 4ZPVB 4Z7VE 2YPKB 4AYMC 3VXQB 1MJ7H 3ABLB 4JAMA 3VACA 5HVWA 4CVZB 4NHCH 4ODHL 5AW1B 1WITA 2O5XL 2UX7A 1N5AB 5HHMD 4XN8A 3TNNA 3E8UH 1YLBB 4UQDA 1U3JA 3M86A 1XCQA 3QCVL 4OD3L 4X4YB 1ZHBA 5G4MA 3AM8A 2O6FA 4DETA 1KOAA 4NQDB 5HD8C 1RURH 1Z0NA 2ZP0T 1E6OL 4MAYA 4XAKD 4Y9CA 3LZFL 5DWUH 2VLRB 3OPZH 2YFOA 1OLLA 3ZKND 5AAMA 1P5UB 1SFHA 1Y0LA 1IV8A 1HHKB 3A0OA 2W0FA 3M6DA 1KFGA 4KKAC 2DN7A 4H1LA 4E9LA 5IY5B 4LHUD 2XKNA 3ULVF 3UZVA 3FN0L 3Q8AA 3A6CL 4G5ZH 4KJWC 5IEHA 5GZOD 1L5GB 4LVOC 2DY2A 4ELMF 2FO4A 4DGYH 1QSED 4MDIB 4N1EA 5DVMA 2MKWA 3ZBMA 2PF6A 4ELDA 4MBOA 1IEHA 4R7VA 2BWQA 2Z6FA 2WLZA 3WFDH 2V17H 3UYPA 4Z7OE 4XXWA 1MJ7L 2AQ2A 3DHPA 3P4NB 1MY7A 3KEDA 4UQ2A 4Y8DC 4F9PC 1ZVSB 3PP4H 4YE4H 3U9UA 3TO4C 5TF0A 3E8UL 3FQXB 2ZWYA 1BJ8A 5C0AD 3M8OH 5E8OB 4EO5A 2V8MA 5I17B 3F7LA 1G9NC 3T0WA 4CMMB 1RURL 3JTSB 3MVSA 5E1AA 4G1MA 4WWOA 2GIXA 4DKTA 3LVEA 5DD1H 4NQSA 1T04A 4OM1H 4JREB 1KLFB 3DO4A 5SWZE 4M00A 1WBZA 1CFTB 4L1DA 5D6CA 4AXWB 4NHUA 4WEBH 4ZK8A 1KTLB 3X3FH 3SKOB 1J0HA 2WVTA 5D93C 2QQKH 5D7IA 4BHUA 3CH1B 3H42H 3FRUA 3LQMA 5HJ3A 3IBEA 4G5ZL 4AM0Q 2MQ0A 3O9WB 2C3WA 4TL5A 4XPBH 2XG5B 3REWA 5AZUA 3SPVB 5FW6A 4FLSA 3ZHNA 5JHLH 3KGTA 4EI5D 1XGZA 3LS4H 4XXDA 3MUHL 2N7AA 2AERT 4JG9A 1OP5K 3RX8A 2D7NA 2CHNA 1BQHB 2PYEB 5EZOH 4NZ8A 1U9KA 2ZKYA 4N2FA 3X12A 1FC1A 4N90D 3QI9D 5F9JA 2C1OA 5FGSA 3KPRA 1W8NA 4GBXC 3V4VL 4ZQTA 3VAEA 3M8OL 4BWTA 4U0QB 1JNNH 2PO6C 3TCLB 5I2IB 5KSUB 1CBVH 3BAEH 4QTHA 2YGOA 4F37K 1J8HD 1KGUA 3NK3A 3TA3B 3BPNC 2PYFB 3D4GA 1NAMB 4HCRH 3RTQB 1H0DA 5FK9A 1KPRB 5FDWA 3IDIB 2ZKHH 3K5SA 2D7QA 3HVNA 4HA1A 1K72A 4K73A 5DD1L 3HUJA 4XO5A 4AEIH 4OM1L 1AGFB 3B2XA 4Y4HB 3L3JB 3VFUA 4BH8B 4BK5C 5JPMA 3KVQA 3TONA 1BXVA 4OT1L 3SPHA 4YIQA 4G83A 1HWHB 4WEBL 4WKZB 1OB0A 2PXYD 3I6KA 3X3FL 5I71B 3QIBC 2QQKL 4EDWH 5T3ZD 3H42L 4K7PX 2OS7A 4J1UA 5E8NB 1TDQA 3JVFC 1MIML 4QYOB 1OSEA 4LHQB 1UC6A 4QHNB 2DYPD 3GJFB 4E42A 2EDXA 5DA4A 4PJIF 4XPBL 4GRMB 3CWGA 3BVTA 1ZT4A 5CFHA 4AQ8A 2B9AA 1PY0A 3LN9A 1PW3A 5IJVA 2NW2B 3N43F 3CDFA 1IVLA 4LLYB 2IF7A 3LS4L 4RRPG 4E68A 2YXFA 1MFDL 3RY5A 4A6YB 3EXJA 1ITBB 4XR8C 2PP7A 1D7FA 5EZOL 4MJID 2EDRA 2DM7A 3EG9A 1AQDB 4JRXE 4QLRA 1I9JH 1AP2A 3CDYA 4HZAA 3OR7B 5CBAA 3ERXA 1PKQE 4P5TA 1MVUB 1U3HC 1L6XA 1CFNA 2I9LA 2ESVD 3NA4A 1CDBA 4GI9A 4HUVB 2J43A 1F41A 2NXZC 3QWRA 4C56B 1CBVL 3Q1EA 3AROA 1S7WB 2DJ4A 1PLCA 2GK0A 3L4VA 1I9EA 1JPGB 4HCRL 2D2CC 1G7PB 1Q1PA 2XWEA 2ZKHL 1FGNH 1YC7A 1MH5A 2XOTA 1SEQH 5E70A 2HTLC 2GSIA 4BZ2H 1UWGH 3S8FB 3GINA 1NJ9A 3D3VE 1SXBA 1L9RA 1E90A 4HJ0D 3QORB 2NUTA 4IJ3C 5AVRB 2MEJB 3VFNA 3HI1B 1FYTB 3QA3A 5CZKA 2G3NA 4XAWH 3I6LE 1IM3A 4ORZC 1JZ2A 5IMOA 4XP4H 4FLOA 2PWFA 2L0DA 4GRWH 1FVCA 1FFRA 2X4UB 2VJ8A 3KLAB 5GHWH 3VXTB 3BESR 3WN5B 6FABL 5F96H 3BOVA 3EBGA 1OGAD 3LPWA 3S35H 1I4FA 2CO6B 2R27A 3V5HB 4OV5B 1PAMA 5JNYA 3LN5A 5D5MA 3RZWA 3ZE0E 3I02B 1DVUA 5KVEH 2OR9H 4BFOA 4Y2DB 1R75A 2OL3H 3O2DA 1A2YB 1LO5B 4DGWC 5KZCB 1SYSB 5K39A 1FL3A 3DV6B 4FXKC 5D1ZI 4Z0BL 3GMPA 2EDYA 4YWGH 4Y0GA 1FE8H 1KTDB 2FAUA 5HYQA 3MRNB 3FUKA 1PZ5A 4PW3A 5EORH 1I3GL 3GSRB 3KE0A 4IBVA 1P5VA 2NW3B 4GXFA 5AKRA 2VM9A 2LTQC 4HP5A 1GTNA 4Q9BA 3OZ9H 4QLWA 2J5LB 5F6IB 3LEYH 3MBWA 2NR6C 5D2NB 4E36A 1SPDA 4MMZB 1SEQL 4LBAA 3AQZA 3V7AE 5J9PA 2QFRA 1OAKH 4BZ2L 1QUNB 3GHBH 4XNQB 1IEBB 1UWGL 1AXTH 1LEGB 3C60D 4HK0B 5MI0B 1ETZA 3HN3A 3P0YH 5HVGB 3GMOB 3WDJA 4R0LB 1Y18A 1AYOA 3CMOH 4FXGC 4NWUH 1NM4A 2Q10A 4Z0XA 2X4OB 2H6PA 1PZDA 3SGKC 4PRPD 3TEZA 3L8QA 3H1ZA 1FZKA 2YWYA 1QFOA 4HZLB 4KMQA 5ISZA 3CSBA 1ACXA 4LRIA 4XP4L 3BUYA 1XGPB 2NY1B 5GQBA 5F8QC 2AJ3B 1UA3A 3NFPB 4PGZA 5D55A 3D08A 5DYOB 4ZMXA 3DXAB 2X28A 2VXVH 5GHWL 5M95B 3L6FB 3MJ6A 1K85A 1BQLH 3SKMB 3SZ6A 2NQDA 2P8PB 3RGVD 3S35L 1KY6A 2VDQB 3QC6X 1DHKA 3L3KA 4OB5H 1UOVA 4J3OF 1TQCC 3GGWB 4NXKA 2OR9L 2OL3L 2HWZH 1IGML 3ARRA 4TV3A 2JKSA 1FJ1B 3QJFA 2JKIS 3MNWA 5FF6B 2VR7A 2OSLA 3ISWA 5ABDE 4YWGL 1E42A 2KUTA 1Q90A 4O58H 1FE8L 3T8MA 4ZUTB 1QPPA 3DVNA 3F65A 5EORL 2OMYB 2HG5A 3FB7B 4BFIA 5DVKA 1QTPA 2ICWA 2MTAA 3OZ9L 2DLHA 1EUUA 4CJ0A 2OMWA 2IGFH 1S7TB 5C0CA 1Z9NA 1YPZB 2ZWLT 1BJ1H 4ABWA 3ATDA 1ONQB 4M3JA 1AXTL 2Z65C 1AR2A 3QQ3A 4J8RA 2NX5A 5TE4H 4LF3A 5A2BA 4ZMZA 2GJ6B 3CMOL 5DC4B 4NWUL 3VB8A 2BOCA 3O6FD 3VD2A 4F57L 4ZMLA 4Y1AA 3STLA 3FTGB 4QO1B 1YEGH 4P23C 5C0JA 2L7JA 3BHBA 3BUPA 5GJTH 3GF8A 2XKSA 4PJAB 4UTBH 4OZGB 2VXVL 1DVQA 4E41E 3OV6A 5FFGA 1JK8A 1T22A 2XN0A 5G55A 1BQLL 3HAEA 3MMEA 4OZIE 5IW1B 4C54A 1MRFH 3FQ4A 3IJ8A 4PREB 4N8CL