5H4YA

Crystal structure of human synaptotagmin 5 c2a domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
ELGQLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Ca(2+)-binding pocket of synaptotagmin 5 C2A domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Synaptotagmin-5
total genus 23
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5h4yA00
3FDWA 1DSYA 3GPEA 2CM6A 3L13A 4URKA 3T8MA 2KI6A 5G2NA 2UZPA 4AJWA 3HHMA 4QJ4B 1DJIA 3ML8A 4EZJA 2WXOA 2N1TE 2V4LA 4L1LA 3MJWA 4KZCA 3FBKA 2CHZA 5H4YA 1CJYA 3L08A 4G11A 2EP6A 2ENJA 4NPJA 1V27A 3L16A 3W57A 3APDA 3NSJA 5KJ7E 3PRZA 1GMIA 3OAWA 3W56A 4DK5A 1BDYA 2DMGA 3QR1A 3SD5A 4F92B 3RDJA 4TUUA 4ICWA 1A25A 4DNLA 3LJ3A 4QJ3B 2CHWA 2NCEA 4J6IA 4ANXA 2ZKMX 5T8IA 1TJXA 2WXMA 2CHDA 4FADA 3QARA 1K5WA 2WXFA 4V11A 2D8KA 1RLWA 3CSFA 3B7YA 3NZSA 4F1SA 4ICXA 2WXGA 4ANUA 3TJPA 4LT7A 5CCGE 3S2AA 2R83A 2CJTA 2WXNA 2FJUB 3QJZA 4OVVA 3R7QA 5CCHE 3OHMB 2YRBA 2A4ZA 2RD0A 3ZW3A 4Y1TA 3RPBA 4WWPA 1QASA 4XX5A 4LDCA 1UGKA 3F01A 4XE0A 1DJYA 2K8MA 5G55A 1BYNA 1W15A 2WXLA 4WEEA 2WXHA 4HVBA 2WXPA 4GB9A 3CSTA 4OVUA 1E7VA 2Q0ZX 4KITB 2QZQA 2K45A 3F00A 4QJ5B 1WFJA 2X38A 4AOFA 4QAMB 1DJGA 3APFA 3HIZA 1QATA 2NSQA 2DMHA 4IQHA 1E90A 4L23A 5EDSA 1UOVA 5JHAA 4GNKB 1DJWA 4PS3A 3KWTA 2WXKA 2WXIA 3IM1A 4KZ0A 2CHXA 3L17A 3PFQA 3TWYA 2A5UA 5H4ZA 2QZ5A 2WXQA 1E8ZA 4LCVA 4IHBA 4A55A 3F05A 2K4AA 4FHJA 1UOWA 2Q3XA 4EZLA 5CCJA 1E8XA 4FA6A 4ANVA 4WWNA 1W16A 4FLHA 3R7RA 4PS7A 2JQZA 3PREA 4XZ4A 4ANWA 4EZKA 4WWOA 2WXRA 3L4CA 2WXJA 4FJZA 2ENPA 4FJYA 3PS6A 4Y1SA 3TL5A 3KWUA 3ML9A 4FULA 4NPKA 4TV3A 1E8YA 2ISDA 2NQ3A 3PYCA 1DJZA 1DJXA 4NS0A 4JPSA 1WFMA 4F91B 3M7FB 3IBEA 4FHKA 1DQVA 3QK0A 4L2YA 2CM5A 1YRKA 3N5AA 3QR0A 3ZVVA 2Z0UA 2BWQA 4MJJA 2ENQA 4WAFA 2CJSA 4L1BA 2YOAA 4PS8A 5JHBA 1E7UA 2FK9A 3P2BA 3DPDA 4TS6A 1DJHA 3L54A 1RH8A 3NZUA 4BFRA 2LHAA 1E8WA 3L9BA 1TJMA 4BGDA 3ENEA 2B3RA 3ZIMA 3APCA 2Y3AA 3JZYA 4F93B 3DBSA 2K3HA 1HE8A 4HLEA 1BCIA 1RSYA 4NP9A 3HN8A 3QAQA 3F04A
chains in the Genus database with same CATH superfamily
3UJTL 1FVEB 1MW2A 3OD3A 3US0A 4TSCL 3FTGB 3EKCA 3VH8A 1EXUA 2VLLA 3A4FA 5J12B 5KSUB 2UUDH 3HC4L 4AKPA 5DJ6A 5J9PB 5F1SA 2DQTH 4RMRA 1BAWA 1HDMB 2ZXWB 1Y1DA 4FQ1H 4KKCC 3L6FA 1KGYE 1SOQA 3S2CA 2BRQA 3RWEA 3VB9A 4HBCL 2VDLB 1JGUL 1PLGL 1QYGL 1N8ZA 2RCSL 3DUHA 4UMGA 1XGUA 4LASH 4ELDA 2AK1H 3P73B 5AEAA 3ET9F 2GAZA 1AQ8A 1SNRA 3TT1L 1LHZA 5E6IC 1RLWA 1FO0B 4KKBC 4MB1A 4Y9EA 3V7AE 5I8OL 2WINB 3HKFA 4HHAA 3IYLW 3WJMB 3G5ZB 5GS2H 3ATBA 3MOBH 2G4GA 2I27N 2WQRA 5F0JB 3RGVB 3LZFH 4M9PA 4Q6YA 2GJJA 4MTMA 2ZUSA 1HWWA 1N4XL 43C9B 1S8DA 3U7AA 1QO3B 2NY1C 4R5XA 2AV1B 5LNDA 4JLRA 3TV3L 3WKYA 5EU4B 2EE2A 3CFNA 3SE9L 4OLWH 5C0GA 2Z7ZA 2V9UA 2F0CA 5C2UB 4JZOA 2ZYHA 5IHLB 5FF6A 2YD2A 3LH2L 1HXKA 3CDGB 3VM7A 4I3GA 3MFGB 2ZCKL 1JPFB 1YMMB 4O4YH 1HTYA 3IAQA 4OM0H 4I0CC 3ULUD 1JNHB 3PUCA 1CIUA 3LSOB 1JYNA 4POZD 5LG1A 3C6LB 4WKZA 1N70A 4IDJH 3KYKL 4YNYB 1WIUA 4F3FB 2R0ZL 1GS6X 2ZP9A 1A64A 4DVBA 1IJ9A 3NJHA 5I8OH 4NUJA 4KZEL 3ARRA 1U8PA 3GIZH 4UV4H 2J5LC 1QTPA 2CLVA 4KJQC 3K74B 2H26A 3T2PA 1FE8H 3VXRA 3GLDA 3IBEA 3W39A 4AQ1C 4TVSa 3WAKA 1G7JA 3MRPB 4FQCH 1T7ZA 1QFWM 3Q9QA 5E5LA 4PJDB 4DP2X 2ICWB 2DD8H 1CGTA 2XWBB 4JJOA 5D7IA 3SDDC 1NFIA 5MENB 2G9HB 1ND0A 1AZNA 1FFNB 4TUJA 4P2QD 3MZTA 2UXTA 4DVRL 3L1GA 3EDKA 4G6FB 1T80A 1PZAA 3N9GL 4X4ME 4NZJA 1T2XA 5CN3A 2JFCA 4Z3HA 5ETUB 3KPQA 4QTFA 1YEIH 2NRDA 4P0DA 1UTDA 3NABL 1XZ0A 3B43A 3F84A 3C5ZD 1RUPH 3M17B 2JJVA 1BZEA 1NGWB 3D9AH 4K2UH 3MDJA 1H15B 3FKUS 2NNAA 4HS3A 2B14A 4N2GA 1MPAL 1T7VA 3C8KB 2WUBL 1NWOA 1S9VB 5JW5B 4YL9A 1ZHNA 3GMQB 2DLTA 3IMRA 3C12A 2VABB 4FYRA 3I2CH 5B39A 3QCVH 3FOMA 1G7MA 5CLXA 2XN9B 3FUIA 3NJKA 5EUKB 4I8DA 4KJPC 3IPEA 4Y19E 2Q86B 4YHKH 5C0CB 4AYMC 3V8CA 3E6FA 5FW6A 2E7LC 1WV7T 1UD5A 2FGWL 1J9CT 1GYCA 1BZ7B 2A77L 3JTSA 3QDMB 1JZ3A 2RGSA 3H3PH 1FFNA 3LPWA 4TUJB 4XAKE 4XR8C 3WE6B 1DQJA 1DVFD 1YN6A 1QATA 1AYRA 3SKMA 4AI7A 4OU3A 4XNQA 5T5NF 4GBXD 1P2CA 4JQVA 1L5GB 1KXTB 4QRRD 1Q0XL 1P5UA 1S3RA 1ZEAH 2JKTM 1CPUA 2CDEA 1ZLUK 5I2IB 5I66B 2HJFB 2XTJB 1GYVA 2HAZA 3E1F1 3G6JA 1YEEL 4GP8B 3VRLF 2QV4A 4FF9A 4WWNA 4C56B 1JGDB 3W9DB 4KROB 1H5BC 5D93C 1YCSA 2L4OA 1Q38A 4P2OA 1S7XB 3RB5A 3U46A 2PLTA 4QRAA 1QQDA 4NFBA 2XQYK 3BSZH 4L4TB 2B20A 3MV01 4HUUB 3AWEA 3CUPB 1WWCA 4MA8H 4NM4L 3WXWH 7FABH 2VLJB 4MJJA 1XD1A 4MS8D 1LP9F 3AY4A 4MA1C 2Z31B 3PJNA 5E8PB 4AVJA 2YGPA 4BFRA 2UUDK 4FLRA 4KO9A 3BCDA 3ELQA 4KI5E 4ZBJA 3T9WA 3W9EA 1ZA3B 1KGCE 4FRWA 2I26N 2G2NA 3OHXC 4GW1B 4JN1H 1QSEB 3CPLA 5E4EC 3FFDA 2NY5C 1TJIH 4XHJD 3TV8A 4XPGH 4HSQA 1PU0A 3PDOB 3PWLB 3T08A 3WN6A 4Z3GA 1JPSL 1S3KH 4NHCH 4KQ4H 5JHDE 1HH9A 4XWOC 3A4AA 5DVMA 3EGDA 4XCCL 4YR6A 3BN9C 4L1DA 1YY9D 5EU5A 3TXAA 5FDWA 4ZMXA 1YPZA 2CLRB 5AW0B 5C92A 2F7OA 5JXEC 1EHKB 5FKAA 2A9CA 3GF8A 4L3FA 3T77B 2PYEB 2WUCL 3MYJA 3O6MH 4ZFGL 3MXWH 5HGGS 4GFXA 2A77H 4JANA 4NPYA 5I66A 2AJYH 3BPNB 2ZUYA 1SBSL 3DOSA 3SGJC 5I75B 5FKPB 2P47B 2QQLH 1IAMA 2DMCA 2VTFA 3IJEA 2CKBH 3OB0K 2H9GB 4F57H 2EE9A 3HZKA 1A8ZA 3ZT7A 2WXFA 4X98A 5A2BA 4WV1B 4C4BA 4KRPD 4TM9A 5I1HL 3X13A 2FAUA 3HNTH 2QHLA 3KW8A 5D5MA 4PJCA 3B2XA 5FYKL 3K8MA 5HDQL 3ARBC 3U7WH 4ZDHB 2Q8AL 3T2OA 5B1AB 1X5IA 4JZJB 2ZWKA 1GC1H 4GSDL 1P9MA 3L1EA 2J1ZA 2R27A 3EF7A 5HVHC 4MMYA 4JY5H 2FZ3A 4A7TA 4GG6F 2W94A 3A6BL 5BRZA 1SPDA 1OF2A 5LN4A 2PYFA 1OANA 1T1WA 4OFDA 4P23A 3ARSA 2Z35B 3SKNA 3CHPA 3S35H 4CW1A 3CPLB 4R2GD 1LLAA 4FKHA 3EZJB 5D1XA 5TF0A 4UIKH 1BZDA 4X6EB 1TETH 3IXTB 1LD9B 2WC7A 1UWGH 3H1ZA 1WT5A 2PR4L 4GNKB 4K8RC 4PJ9A 2IWGA 2G75A 3BH8A 1KIUB 5C08D 3HZVB 2ADJB 4X99A 1DVFC 1MNUL 5T1MA 4A55A 1CUOA 2QLVB 4NZDA 1OAXL 3AACA 4EVNB 3MPCA 5HDLA 5GGTA 3HG1A 3V6ZA 1K8DA 1UXSB 3SBPA 4DT2A 2Z31A 3LPFA 5TJWK 1J9TA 2IFFL 3CMGA 1Y18A 1Z9SB 5D1ZD 4PRPD 4NC2B 5SWSB 2E47A 4BWTA 4JFEB 2FGWH 4N6RA 2I60L 3IJEB 5AG8A 5A3IC 1T5WA 2G60L 4Z95H 3L45A 4YHKL 4ZPTA 1OSZA 2BVPA 4F7EB 3WKMH 1V8HA 5A6LA 5I18L 5JO5A 1MCPL 1J5DA 4NNXB 3ZPDA 4FKKA 1NGPH 5TK4A 3L4TA 4LU5L 3CDZB 5I6XC 1PKQB 5EFIB 4D9LL 4HIEA 4QRPA 3I3DA 2N7SA 3OKOB 2WUBH 1BFOB 4CSTA 2QADB 2EO9A 4CGTA 4Q4IA 1AOHA 4AQ8C 2G9KA 2ED7A 3WG7B 5JQIB 1FNGB 3RA7H 5EOCJ 2OLDA 4WFGE 3SJVE 2P48B 1LD9A 2YXMA 3ATEA 3J8F7 3ZT6A 1T0MB 4LP4A 2DI9A 2QADD 4D0CA 3OXRB 5FUZH 3VGDA 2DQGL 2XT1B 3BX7C 1BA9A 3T71A 2JKSA 2V2WA 4Q74A 3UO1H 5C0JA 4NYLB 4YSRA 4G7YL 2YUVA 1S9WB 2FBJL 4N2MA 2HLAA 1LDPH 1BJ1J 4LSSL 2NZ1A 4EI6A 3V6OE 2VB5A 3TZVC 3WIFA 4B9FA 5EF3A 1MHPL 1VKXB 2KQMA 5JYLA 4F15B 1BBJA 1QBBA 3GXFA 5BRQA 2ZCHL 1WAAA 1DEEA 3JVFC 3PL6A 5IJVB 4YSDA 1RJYB 3CCHB 3T2NH 3QCTL 4Q0XL 3Q1EA 3NCXA 1VCBC 4JFPA 4M3KB 5TH2A 2PWHA 1DJYA 4JO3H 4MNGB 4X9IA 4B5ZA 4RGNB 2NXZD 1C1EH 4TULL 3EO0A 4PGCA 1ZIAA 1DBAH 3GBLA 1H8OA 3HE7D 1GW0A 3TF7C 1MFDH 4UINL 4X4ZA 3WLBB 1U8QB 3JWOC 4MNQD 5JYMA 2XJLA 1REIA 5I1IL 4RGOH 1C7SA 1FNGA 1P1ZB 1T21A 2ZOOA 1Z9LA 2XJKA 5FM5O 3PY9A 2CAKA 2GY5A 4P3CH 3TPUA 2HUHA 1NMCB 2X4RA 3WNNA 4NRYB 3D3VD 3I84A 1NANH 5IB1A 1OE1A 3PIQA 2BXZA 3LQMA 2DM3A 4ANVA 4KKAD 1NOFA 1CFQA 1QP1A 4KY1L 4NQDA 1VGEH 3KWUA 5T5FH 4FULA 2C7UB 5DJZB 3SGKA 4X6CB 5C0AA 3U4KA 4QRPB 4PPTA 1KYFA 5AZUA 3OXSB 1VDGA 2Z92B 3GSQB 1QFOA 2CJUH 2Z0UA 3K3QA 3EIFA 5FA3A 4WAFA 2X4QA 2VN7A 4U6VH 2DQHH 3NGBC 3F7VB 4PRPE 5IMMB 1W8NA 4DJMA 3ZMEA 3KBFA 2F54A 2NUPA 2PMZA 4L3EB 1TVDA 3PXHA 4A2GA 2XZAH 3NZHL 3APCA 3ZGHA 1KXTA 4M7JL 3JUYA 5EO1A 4C58B 4YSCA 5I17A 5FXCH 4OFYA 2NPLX 2B9BA 5DJCB 3V6FA 4O02H 1VJSA 4PJ7B 1KULA 4NAMA 3K2KA 4JAMB 1JNNH 3NCCB 1UATA 2Q76B 2N1KA 2FCBA 2XX1A 4MHHG 4NQCD 1IGTA 3L3KB 3S96A 1NM4A 4L3ED 2CE6A 5CEZD 1KJ2A 2CBPA 4YPGA 1YNTB 4GBXA 3SOTA 3KH4A 1Y6KR 1D9KC 1JTTA 3I9AA 1KTLB 1W72A 5KYUA 5D7IE 3WTXA 2H8PA 2WO3B 2CUHA 1GMIA 3TFKD 2BS8A 4XBPB 2JJTA 1I9RL 3QR1A 1NLDL 3OMNB 5D6DA 5CIPB 1AE6L 4ODHL 4HUWB 1CICB 3SODB 1JHTB 2WAQA 3K71A 2FJFA 3E2HC 4QRFA 4HU8A 3RWIA 5F71A 2BY3A 1F13A 3RTQB 3D30A 2VJXA 2B2XH 1VERA 4L3CB 2P5PA 2GPZA 3N44B 1PIGA 2VDQL 1CICD 3FUFA 5E1IA 3VYPA 1FQ9C 4S1SL 3P69A 2NY6D 4MRBA 3KDMB 3QORA 3PG2A 3TWCL 1QX1A 5I26A 2RFXA 1DCLA 3IDIA 3N91A 1NAMB 4W9KC 1LO3L 4ZFOA 2JJWA 4EE2A 1UQSA 4WRLA 5FUCE 3L3OC 1UXLA 4LQFH 3RX9A 5IMKB 4JR9L 3VXPB 3APFA 5L8KB 1RHHA 2NSMA 4XVSH 3RWHA 1L0QA 3M46A 3HBGA 5ALCL 3LRKA 3T3MB 2J4WL 1LK3L 3WD5L 1KN4L 5EOTA 3TA4D 2CO2A 2FDBP 2WBJB 3KPOB 2BY2A 3TNMB 4QXGH 3KVDD 4N25A 5EORL 5SWZA 2FEDD 4FQLL 4WNQA 3V5HA 3HRZA 4TQPA 1DN0A 3PREA 1QAWA 1GGYA 1ZHBB 3MV7B 2DEXX 2ENPA 4IGBC 1VZGA 5IMMA 1VACA 4PBXA 1U8KA 3JV6A 4FG2A 2KZKA 1DVTA 1FJ1B 4UF7C 2K1MA 1YECL 4XMWA 3M1BB 1UA7A 4L37B 1A1MB 2O26U 3S36H 2A6DA 4W9JC 5EZIL 3AG1B 1BECA 3ATDA 2R69A 2NNAB 4I3RH 5KJRH 4UU9B 4N2NA 5IJDC 4LPYA 5HGDA 4RAVA 2IH1A 2YZ1A 5C9KA 4OZGB 1JZFA 3P77B 3BD5A 2PNDA 4KGJA 3NFSH 2XWRA 5C8JB 3N3EA 4DESA 4IM8A 5C9JB 1E4HA 1NWPA 5IB3A 2BERA 4P57B 1R1CA 4DEPB 2L04A 1II4E 4PREA 1T22B 1LO0H 4PRPA 3ULVF 1A4JB 4OZIE 3UTSB 4NKOA 3VFPA 4ZUTA 3ZZ1A 5CIPA 3LH9A 4PSRA 3H7LA 3PP3K 5FYJD 2X4PA 2J8UA 3M1CA 3VXUB 3WEAA 3LEXB 3QO0A 4P2QB 4RETB 4XN2A 3LIZA 1B3JA 1DVXA 5CMAB 3T2QA 4FX5A 4XAKD 4EIBA 1OT2A 2ZUTA 5J4MA 2JJTC 3AG2B 1KBKA 1H5BA 2VDOB 4DZBA 3C9NA 2ILLA 3N43F 3FOLB 4XPAH 4Z7AA 1A25A 3VW3L 1L9OA 1E43A 4QLRA 4HISA 1BZ7A 3JTSB 2JI1A 2LVCA 1YNKH 1U8OA 5ICXB 2CHDA 2F9BT 2PW1B 4JO2L 4R0LC 3GBML 1QEWB 4L8SB 4LEBA 3BFQG 3CMOH 5EFIA 3GRGA 5K1JA 1KGWA 1G7PA 3KXFE 3AY4C 1MCIA 4QXGL 3MLXH 5B1CA 5IQ9A 4HOMA 2ZX9A 3O3EB 1E4XL 4GQZA 3CH1B 4JHUA 5TE6L 2VZSA 1RKRA 2H3NB 2UZIH 2OR9H 1WZAA 1JXJA 3KLDA 5I2IA 3U4BH 2IAMB 4BFEA 4RGMB 2ZOKB 5I71C 2A6IA 1RZ7L 2X09A 4OZGA 3K8KA 4C56A 5B1BB 1CICC 3PP4L 5EUOA 4GB9A 4RDQG 4ATTA 5E2UH 3DKHA 4OJYA 2J20A 4HETA 1RIHH 1EJOL 3SDCC 2QTEA 3CZEA 3N85L 3SO5A 1OGTA 4NHUA 4R5TA 3L5XH 4XC3L 43C9A 3RFZC 3O3BB 3KXFB 3BE1H 3O41A 4NN6C 1DFBH 4IOIA 1NGZA 1KV3A 2CO3A 1ZLWK 3BKCL 3NJNA 1ACXA 4KI5F 3SYQA 3AG4B 3MRRA 1UOWA 3HLAB 1WC7B 3JWOH 3LEXA 2APWA 5EOCL 4CUCA 5BS0A 1JMXA 4MCZA 3UADA 2HUEA 4G6JL 1JRHL 4WUKL 5E56A 5EU5B 5GRJL 3ZKXB 3HG3A 2IDTA 2YHGA 5AVTB 4ZW3A 2G3XA 2GAZB 3OKLA 2F8IA 5EO0A 1FFOB 5D4IA 1I7UB 3QGVA 4JO3L 4KRNA 2WINA 4HHAB 4WW2B 2DYPB 4NOBA 2BNUB 3HS0A 2PN5A 3QCTH 1DQVA 5IB3B 1M2OA 1MN4A 2CNZA 1RZJL 4XN8A 3HPLB 2QR0B 3P2BA 1ECYA 3HMXH 4FTDA 3D07A 2YMOA 3AREA 1PZ5A 3DJTA 4G8IA 3T6QC 1ODUA 4WV1A 3WFCH 3Q43A 4IKNA 2A3TA 1LYQA 4K9EH 1AAJA 2OFQA 5KAQF 3RQ3A 3NIDB 4NC1C 5TDNA 4JPVH 2JK5A 2X4OA 1AANA 4B96A 1INDL 1H6EA 1Q9WB 1UWXK 1JPFA 1FC1A 3QWOA 5KYNA 3I6GB 4Z3JA 1DJIA 1JF5A 1OGAB 2AP2A 3VFRB 1JN6B 2FJGA 2AEQL 2MFNA 2OTPA 4MJHA 4QAWA 2ICCA 4IOIB 4P2RE 4BUGA 1DVYA 3RFRA 4PWHA 3H9SE 3P0VH 4P4RA 5JA9A 4M3HA 2Z7YA 4WGKA 1R34A 1WC7A 4G6AD 2MOGA 3RVXD 4Y5VC 3S36X 3SD5A 4ZUUB 3X3GH 2MPAL 3REWB 1ZOXA 2Z93A 4OCRL 1JZ4A 3GHBH 3MV9A 4NWTL 1NEUA 4JFTA 2OX5A 3Q8FA 1OP5K 2PYED 5FGCE 1Q9KB 2YD5A 1I8MB 1YC7A 3H6JA 2MNJB 3WS3A 1PYWA 1CI3M 2XZCH 4NZFA 3GHEL 4MCYB 5JQHC 1HJCA 5EWIL 2W81C 4N87A 4Q56A 1PDKA 3OKNB 4HPOH 4YFEA 1KENL 4G8FA 2AEIT 3RI5F 4J3XA 5DGQA 5I8KL 4UDTA 5ACLA 1NC2D 2A74C 4PRBA 5LDUA 1QHPA 2VABA 3NP3A 4MAYD 4NO0A 2AJXL 3A67L 3DYPA 4GQQA 3EYVA 4FYSA 1DL7H 4QJ5B 1J11A 3PWPB 5AW5B 1W72B 2Y25A 4J23A 4UB0H 5AZEH 3MLZL 3R4DA 1HQ4B 5I6MA 4LVNC 4X6DB 2VISB 2XWDA 3L5JA 3MV7D 5TQ0L 4JNXA 2CGRH 2GABA 3FUEA 3QDMA 3MV9D 1KB5A 1NCAL 5CIPH 4R96A 3SZKC 1W0VA 2KHAA 5J13B 3OQ3B 1DQLH 1AY1H 1CGSH 4NFDA 2P45B 3CFEA 3LV3A 1GGIH 3HJ0A 4G1MB 4F8PA 1YDPA 4OCYH 1CU4L 4JUSA 3RL1B 3OSVA 4EN3C 3GZQA 3R0MA 2FBJH 3C60B 3DMMC 3SDCB 1IC4L 3KDMA 3V0DA 3KGUA 4X6DE 4ZTOH 1X44A 4BZ1H 5CS7A 5B39G 1EZUA 2UXVA 5E6RB 3SYOA 3RNQA 4HK3N 3Q5TA 2GITB 3BWAA 1A9BA 3U2SA 4AZ8B 4HIIA 2JNZA 1DVFB 2G5BA 3HN5A 4BGDA 3BOVA 1IM3B 1EO5A 3MLZH 3JV5A 1EJ6A 4WWKC 3FTVA 1TYRA 1DSWA 2AK4A 1JGLL 4JPWL 2PPDA 3ULVL 3OQRA 2Y36L 1G5GA 2EVFA 2W60B 2DH2A 3GXDA 1D7FA 3A3YB 2ZSWA 3H2WA 3NSXA 3PNWA 4Y2DA 4YX2L 2YMXL 5EWIH 3ZTNL 3RRQA 4QRQB 2NR6D 3MCYA 3QUYA 3TO2A 3VRIA 1MI5B 4GW4B 3MUJA 3PDOA 1G7IB 1MAJA 3WHE1 5LVEA 4QF1A 2EDMA 2X4SB 5DVPA 4F20A 5JUEH 1T66C 4TL5A 3GKWL 3LS4L 3FUHA 5LGHH 3U2IA 1PSKH 4IRSB 5D2LB 2LQRA 3QJHA 4IRJB 1AO7A 4FQJL 4DETA 3E80A 1PDKB 2W0FB 2XVBA 4LSRH 4MJIA 5DURD 2DDQH 1MWOA 1RSFA 3WIAA 2C9UA 4ZTPL 2VR7A 1VFMA 4HJ0C 4FQIH 2J72A 4M5ZL 4GRMA 1IAIH 1CDCA 2LLGA 1H3WM 2V9RA 1UJ3B 1JHKL 4H26A 1FNFA 3Q2LA 3BT2L 3DARA 5KEZA 2Y24A 4Y19A 4PH8A 4DQOL 4P05A 4X5RA 3GM8A 1JERA 5SX5H 3NG5A 2X3AA 1JK8B 5F7EH 5AYUL 3GXTA 3DLQR 4JFFE 4NQDB 5F70A 3QH3B 1SVCP 2CWRA 4TQEH 2NSQA 2OYMA 1G7HB 3G08B 4G59C 2ERJB 4W93A 1YDPB 4POUB 4GBXC 3RG1C 2VGLM 1ZGLA 3UO8B 2I07B 1C16B 2QVMA 4TL4A 4XO9A 3IKKA 3P1VA 3VI4E 2PW1A 2YUXA 4ODSH 1W6WA 2E7LA 3FF8A 4ONFH 4DOHB 2WSDA 4I2XA 3NUKA 4PLJD 5JHLL 3QDME 2BVUA 3KJ4C 1FHGA 4F5CA 4BCZA 3L5WB 3ZDYE 3N42B 3NJGA 4APQC 1U3JA 4WHCA 5AOLA 1WFMA 1KIRB 3FQRB 3NVQA 3U4EA 1MRDL 3QWNA 4FQQB 1NFKA 3T4YA 3VWJD 1EPFA 5EUOB 3GMNA 5K9JH 4M5SA 3X14A 4OUOA 4PR5A 1EBPA 4WW1B 1DFBL 1TU2A 4M5ZH 2H1LM 1MNNA 3KPSE 4NP4H 2J7LA 3WYRA 3KEHA 3UAFA 5LLIC 3E0GA 3V4VL 3CQFA 1MJJA 3GQFA 1XMWA 2DQMA 4OI8A 4AGPA 5BVJA 1KT2B 3MRRB 1ZV5A 4JKLA 1K2DA 2QKIB 4KMQA 4N0YH 1MVUB 2B77A 1E3FA 4LMQI 2VCOA 1N12A 5EMYA 4XXDB 2OR9L 2ITDA 3ZO9A 5B7EA 2WB7A 2X4TB 3D18B 1UOLA 3TTSA 4MA8L 4W9IC 2JELL 1NCCL 4YFLF 3ARED 5I15L 3H3PL 2YLHA 5C0EB 3KPMA 3V4PB 4FNTA 3ARDB 4DVRH 4IBYA 4ABQA 4J5VA 3HE6C 2D7QA 1X4ZA 4WU7B 4X5LA 1OTTD 1Q9WA 3AVEA 1BOGB 1U2HA 1DO6A 3D33A 2BSSA 3QEQA 4M6MH 4AQ1B 4Y16D 3C8DA 1UD3A 1JK8A 3F5WB 3VFGL 3CBRA 3MTXA 4QMEA 2GSMB 5G5DB 3WUWA 1X5HA 4FFTA 4DZ8B 3GRWH 4H2CA 4A38A 4AEEA 4IIQB 5G4OA 1E65A 1BG1A 1AGFA 2CKNA 3ZW3A 3ZTJG 4ZTOL 1D5XB 4QTHB 2NT1A 1BD2A 2A9DA 4R8WH 3IDXH 4LDCA 4A6YB 1OF0A 4NBYB 3QIUA 3GB7B 4K9EC 1DYZA 5HY9A 5CCKL 1IBBA 3O81A 5ANMA 2A73B 2E5EA 2IMMA 2QZQA 3MRQA 1FYTD 3H3BC 3BH9B 1RUKL 4BFJA 1QLRB 4M6NL 1FJ1A 1F45A 2F61A 3T3MF 4ETQA 5L4FA 4XPFL 1HNFA 3WN5A 3GSRA 5HJDA 4AT6B 2Z93B 5GS0D 5E00B 4JFED 2J8UE 2BWIA 4IKIA 5TQ0H 2A0LC 3TZVB 1SVZA 3T0EA 5L4MA 2FX9L 5CLYA 3P9LB 5J12C 3AS2A 1SMDA 2AXWA 1YY8A 2BM3A 2DDQL 4TLTA 4QEGA 3VQMA 1JIBA 1KJ3H 4D3CH 1SLUA 4PRAB 4BFIA 1FNAA 3QPXL 5DS1A 1LO4L 1G43A 5I8KH 3ECQA 2W0PA 4HGWA 1UZ8A 3QXAA 2VISA 1N2RB 1X7QB 3CFCL 4P04A 1CXKA 4QGYA 3H85A 2EXWD 1OAKH 4R97B 2VXVL 1IBZA 4G3YL 4OUUB 2BSTB 2MSPA 2DZEA 3D85D 3HMWL 3BESR 5CINH 3CU7A 2J5LB 3X3FH 1IEBA 1KY7A 4P48A 4P2YA 5MHSD 1HVXA 1U2CA 4W9FC 4Q97A 3V55A 1BMWA 3GSQA 3HUJA 1QTYT 3DIVA 3B34A 1A4CA 4LVOC 3H0TB 1WIPA 3HZMA 2CM6A 2JB6B 4AEHH 2MHAA 4YFDB 4BSWA 4GRLD 4OD2B 3ROOB 4JFDA 2ZWSA 1B3IA 2I9LB 3BQUB 4CILA 2WBKA 4AL8H 3ULUC 3IFNH 2EUWA 3RBGA 4K71B 2BZDA 4Y0GA 1VA9A 4PTTB 3ZDYF 3KEDA 5CJXC 4AENA 5L9DH 2JLPA 1XAKA 4MQXC 1NGZB 3TZVD 3G5VB 1OALA 5AUMB 4RAUA 4NOFA 1M42A 4NQVB 2GG1A 3VXRE 3RHWF 3CN0A 1JTOA 3NN8A 3OTTA 1M2VB 1P7KB 1EVTC 5KSVA 4KZDL 1NCAH 5I82A 1P0SE 4KFZC 2P42B 4OVVA 2BIPA 3RL2B 3H9SA 1R4XA 3NA4A 2XN1A 2YWYA 3IE9A 4R6UA 3NESA 1KFAL 5MI0C 5I8CA 2AK1L 1A6VH 3TA3A 3GSRB 1KLFA 4UIMB 4XE0A 4R7VA 5CU9A 1IU1A 2WBWB 3TV3H 1JRHH 4WUKH 4AOFA 4M62H 1XEDA 1KLUB 3TOPA 1QBAA 2BNUA 3HS0B 3UTTA 1K8DB 1UXSA 3WFHB 4GG6B 5D1QA 3D2UA 5AQ0A 3GT6A 3GMRB 4U6HA 1UJ3A 1KC5H 4BFIB 2XN9E 3QO1B 4ZMAT 4IRJA 2WXQA 4RISH 3T2LA 1PY0A 1MWAA 2MPVA 4M7KL 3UYOD 3S5YA 3C5XA 1RD6A 2N59A 35C8H 4JFOB 5C0CE 3H9YA 4FL4B 2APFA 2IG2L 3R0NA 4K8RH 1OM3H 4XZUB 2R29A 2Y4SA 3LH8A 4I9WE 4BHUI 3RVXC 4WWOA 2R1YA 1XF4B 1GGBH 4HEMA 3HAEG 4AV0A 3QXTA 1NMAH 2OL3A 4XOBA 1FL6B 3ARBB 2Q2EB 4KKNA 5TDOB 4Y4KB 4KQ3L 2XY2A 4UV7L 1NBQA 4N3UA 1ZE3C 2EDLA 2NY7H 4UT9L 1LQBC 3ARVA 3DSFH 4GG6E 5AWNH 4G72B 2V5SA 2MTAA 4X7TA 3D39A 2ZAGA 1XX9C 2XIDA 1ZANH 4PJEB 3IFNL 2XTJE 4OD2A 1KDIA 5FYJU 1E5YA 2V3FA 4OIAA 4UQ9A 1S7QA 1AI1H 5AW3B 1KLFB 4UIMA 1C16A 3KDPB 4UV7H 3VWJB 4YXLL 3TBYB 3C09C 1MRFH 4XPAL 3MCKA 2BVOB 3NMEA 3S5LG 5BRPA 1JPTL 4J2QA 5GJSL 1FO0A 2CDFB 3Q1SH 1XCTB 5T3ZL 5I0DA 3DO7A 4UDTB 3T4YB 3HMXL 1G1CA 2N1TE 3MJWA 1S7TB 5FHAL 2JI3A 5AVXB 1B4JH 5D1QC 3T0XA 1MLBA 2Y5TA 2QPEB 4K3JL 1KCBA 2ZCHH 4IGBB 4WNQB 3V5HB 1RZFL 3MC0A 4E42A 3UBXG 2EVJA 5IQ7H 2R2HB 1MZYA 1YMMA 2G3MA 4CVXA 2OMZA 3VCLA 3VD9A 4J6IA 2GUOB 2QDVA 1KTJA 3G6AA 3BP6B 4YHYB 3H4HA 2YQBA 5F44A 1MFEL 1IQDB 4PJ5B 5E51A 2OMBA 3GSOB 4X6DA 3B7UX 1KEGH 3BKCH 4JZNA 1CR9L 3VXOA 5HHOA 3DXAB 5B3JF 1MJJB 3HUJE 3DYMA 5CJQL 5GS1C 4PJFA 1NKGA 1BQHG 2IH3B 4UM8B 1T3FA 4Q14A 3TJEL 2EVHA 1NIFA 2AQPA 3H54A 4QHMB 4JFXA 1VPOH 3AB0B 1T22A 5T1LB 4XN9A 3OMIB 4KOCA 4M7LH 4E41D 1HN1A 1G6RA 3CH1A 2XPYA 3C60A 5KSBA 4U1HB 1I3GH 3LNGA 5J5EA 1O7DC 2KQNA 1CMOA 2C3XA 2WXIA 2IPUK 3BXNA 3NCBB 3DX8A 3QPQD 5IUSA 2L7QA 5DEJA 2WJ5A 1JWUB 2J4WH 4PS4H 3Q8CA 2CQVA 4PGDA 5HP5A 1XB8A 3QORC 4AZ8A 3U2SB 4TSAH 1SMAA 5DO2D 3T0WA 1JGEA 2A38A 3GJFK 1AQKL 1OL0A 2DOCA 4HAGA 3W11D 1KF9B 4ZAKA 2XU9A 1TCRA 2Z35A 2YOCA 1ADQH 3FUKA 4J3SA 2Y7QA 1H3PH 4FQXC 1U8IB 4X6EA 1CGWA 2P5WB 3WBDA 4PJCE 2AERT 2Y2YA 2PYFB 5FGSA 2HLEB 4JHAL 1ORSA 5K69A 5HVWA 2B2XL 3MFFA 2F15A 1S9VA 2YEZB 3D25B 1BYPA 3O2WH 1JNLH 4FMVA 4UT6H 4JM2C 1KPRB 2DWYA 1JYXA 1URZA 2CO6B 1OEZW 1W6LA 1CI5A 2XWZA 4AK1A 2ZKYA 4LHUD 4WI0A 2K3HA 4X5XA 3T1FA 3WEXA 3NOIA 5AVRB 1IX2A 1RP9A 4R2GC 1URIA 4P2OC 4QXUH 3FONB 3RIFF 4S0TD 5KZCB 1X7QA 1FNEA 1PZ5B 4PRNB 2DYRB 4ZSOB 4NUMA 3K6SA 2H6OA 2J2ZA 4AIZB 5JO5B 2L7EA 3PAUA 3INOA 3TURA 2KZBA 4LF3A 5LXGL 1QOKA 2OJZL 2VXSH 1NKOA 4NZTL 3QI9D 1YNLL 5C0BE 1QRNE 4JRYE 1XF3B 1ODAA 5DJYB 1BWMA 1FFOA 5D1ZC 2WO2B 3B2MA 1F3DH 4MB3A 4LRIC 1G9ML 1QLEB 1EERB 2VO8A 1NEPA 3G3LA 3QP3A 1IC7L 1TEYA 2MJWA 3DSNB 3QARA 3RNKB 5E94A 5DD1L 4U7MA 4K94L 2WUCH 3O6ML 4ZFGH 1FA4A 3OR6A 3BSGA 2YGNA 3ZT5A 4ZD3H 4XCEA 2EAEA 4CRPA 1EO7A 1GMEA 3EH3B 4GIPD 3NRPA 1A14L 2E6JA 4YWGL 2L7JA 2NY1B 2WXLA 3ULUE 4D94A 3KLHC 4Z77B 1FSKC 4L05A 3V0EA 3VWKD 2XA3A 2JKWA 4GO9A 2BVYA 4E9XA 1LWHA 3K2MC 3CD4A 1FAIL 2WY3B 3HS0C 4I7ZC 5TQ2H 4U6TA 1B0RA 1HNYA 3SJVA 5JZ7D 3NCEB 5EZJA 1UD6A 4JG9A 4EI6B 2WVSA 4F5CE 4DQOH 3J7HA 2UYLB 4IHBA 4N85A 3PWLA 5IB4B 4LFHG 1OD9A 3LPPA 1CK0H 2QPFA 2LLNA 1DZBA 1RMFL 3QPQC 3NT0A 4AYBA 1G0DA 2C3VB 3MFFB 1UADC 2HRHA 2X4TA 2WANA 1D6VH 4P23C 2CO6A 1VEPA 2RIKA 1YYLH 3GSVB 3H2QA 4L4VE 3STLA 4PJAF 3UC2A 5I1KL 1ET8A 1AR2A 3SKOA 5HSFA 1JPEA 2VDMB 1X5LA 2FLMA 3P0YH 4RWYL 2X4NA 1IAII 4MZIA 1N19A 4DKDC 1FDLL 3OX8A 3T8VA 2DRUA 4AEIL 3QUXA 5D1XE 2FB4H 2ZOLA 3L9BA 1Y7VA 4WY7H 2EIJB 1IMHC 5IK3B 5F7MC 5C0EA 2WKOA 3UYPB 1XDTT 4LHJB 4XGZB 1XH1A 4KKLC 1EEYB 3KLLA 2P24A 4ELMB 5C0AB 5F0MB 2DWXA 3QZPA 3G5XA 1J1PH 3S3SA 5DJXB 5HYSA 1KYOK 4A37A 3BT2H 4GSXA 1NBYB 1QWHA 4X7TB 5GQBA 5IM7A 5GS0C 2W59A 2H0FA 1ZHLA 3RAJH 1KPUB 4P2RA 2FHCA 4PJ5D 3QCVL 4GKLA 2WZ5A 4PWJA 5IOKA 4BH7B 9PCYA 2Q20A 1USQA 1LILA 1S9XA 1MPAH 3HZVA 3R06B 3A24A 1BM3H 4YHYC 2E9IA 4A2EA 2CXKA 1BEYH 5AYUH 5JW4R 1Z3GL 5DQJB 2BP0B 2EH7H 3CIAA 4X5QA 3B5TA 3T6ZA 5MEND 1U8JB 5HJBA 4NM8L 3UOAB 1YEIL 4QHKI 2VDQB 2E9GA 3GXNA 3VGAB 3VXNB 5D7IB 2XG5A 3WV0A 5I0VA 1NGQL 4DGYL 3F2LA 1N7ML 4HOWA 2Y36H 1OOWA 4NEHB 5JPNB 3QUXC 2WZPA 4OLVH 3BQUC 4NERA 4XVTH 2WXHA 4XNDA 2VLKA 3B6SA 5E5MA 2K45A 4X5PA 3T8XB 4EN3A 5DD5H 1MI5D 2JH2A 1H8NA 4E9QA 1EEYA 2XQBL 2VC2H 4ELMA 1PKQA 5HPOA 3LQZA 3CVIH 4YAQB 3HJEA 4JMXA 3CFBB 2VDKB 1NCTA 4UQCA 3H4FA 3VWKC 3MA9L 3AQDA 1ZTXL 2F58L 5FYKU 4OCSL 4R90L 2HT3C 4D8PA 2YN3A 4JY6B 2B1OA 4TRPL 3AC0A 4FFZA 5EZLB 1IEBB 4Y1AE 1Z3GH 4PAZA 3ARFB 3BKJH 1IGYB 3PS6A 1Q9LA 2TSAA 4U05A 3OX8B 1CU4H 5D7IF 4OH2A 5FCUH 3RE0A 3ZE2B 4XPBH 3MRNB 3UAJD 4AENB 3V5KB 5HDOA 3V0VA 4YS4A 4QYOB 4BKTC 4TNGA 3MACH 4RBPH 4HFWA 4U2YA 1F6AB 3RVUD 4WLCA 4HFUL 4JGUA 2OMXA 4PS8A 3MMEA 4RRPG 5C0CA 1YN7B 2W0KA 2EDHA 5A1AA 1YPZF 5C3LD 3I6GA 1TPXC 2YXFA 4DCQA 3VFMB 1TUPA 5CO1A 3BZFA 3L95A 2NNXA 1IB5A 2CDGB 4L1HA 2AJYL 4LAQH 3HEIB 5J1AB 1IRAY 3MBEB 1JD7A 4OCMC 3IFLL 5DMKA 3C75A 3VE0B 5E99L 1RAMA 2CRMA 4KFMA 1O7DE 3HPJB 4TRPH 4PY7B 5BO1L 3G6DH 1EVUA 4HDIB 4N0UE 4RAVB 4BQCA 5CLZA 3A0OA 1CYGA 3HC2A 4A6YL 5IV2B 2ZOWA 1ZTXH 2BHFA 4R26L 1XGPB 3WS3B 1VZHA 2P4AB 4P4KB 5E6UB 4ZO8A 4MA7H 5IVXA 3AY2A 1ORSB 2VQUA 1MVFA 2HTKD 3AS0A 4PRHD 4LPWA 4OZIB 2FQEA 2X3CA 2ATPB 3PV6B 4HKJA 4D7PA 1OAJA 5IB1B 3LEYL 4NFCA 1DANU 1CVRA 5DK0B 3DX9B 1OAXH 1DZ0A 1TENA 4WO4A 3KPMB 4W9GC 3VXUA 3VQ2C 4FXGA 4BZ2H 1C8PA 2A1WL 1HSBA 1AHWC 1FORL 4XP6L 4NWUL 3SBWA 3NPSC 4NKIL 4RH4A 5M95B 1HXYA 3B7TA 3ZQXA 1UGKA 1UWXH 4PHXA 2CZNA 4ZSOA 5FA3B 3K6SB 5CD5D 5D2LE 1AOZA 1AR1D 1MVUA 4Q9RL 2KUTA 3WU1A 2XWXA 3MX0A 3ABKB 5CLTA 4ANKA 4UM9B 5DZNA 3L17A 1Q9LB 5CEZL 1RZ7H 1WT5C 3WKNA 3O3EA 1NC2A 3L9RB 4Z18A 4AYDC 4DN4L 1MW0A 1PBYA 1M1SA 3OAYK 5ILTL 4HDIA 2ADFH 5E9DD 1E8XA 3IDMA 5IB2A 2F54B 1KBWA 5F7NC 3QUZD 1JDCA 3DO7B 4QRSA 1AXSB 1SXCA 1CURA 1E3XA 5DJ0A 5GS1B 1HHKB 1QD0A 4NPKA 5I1JL 3JBG7 4MB4A 1KTLA 3E3QE 5KYUB 1SYSA 2FL5A 4PQXA 5GGRA 1DLFL 1IGFL 2AJSH 3U0TB 1C5BH 2ATPA 4HKJB 1C12A 1WA2X 1ZJBA 1ZA6B 1XBDA 1NBZB 2F2HA 3EBGA 3S96B 5JNYB 2H47C 3DROA 1FH5L 4UNIA 4KX9A 1V7NH 1AQMA 3U1SL 2OTWA 4PJXF 2UWEE 5KJ4A 5FOJA 1DLHB 2EEBA 3NEXA 4GW5B 1I9JL 3HHSA 4PJ5A 5INCA 2EH8L 3ARXA 1GTNA 4A7GF 1PX4A 3GSNA 2OL3L 1GZQA 3EDJA 4FEMA 4PJ6A 1BYNA 2OM5A 4ETQB 5SWZE 4POZC 3BEVA 3MLSL 1EZLA 2VDRL 4G5ZH 4J3OG 2QMJA 3FQ4A 4Y2NA 5HTSA 2XTSA 4JFXB 1CK0L 4N0RA 1XF5B 2F7RA 3FBKA 3NFSL 3N06B 3DUSB 3IPBA 1CN4A 1FI8C 1BD2E 4OF0A 4XB7A 2CJ3A 4KKCD 4PJFB 1INQA 3KPSB 4ZXBA 3F65A 2DQFA 1E2WA 1R3KA 1E2ZA 4QXTA 4TUUA 3D1MC 5C09D 3QNYA 4N0UA 3QA3A 1TQUA 3D3VB 1UZ8B 3P9MB 5MEQA 2R29H 4Z5RB 1RUQH 3FC8A 5E5UB 3D2UD 4C56D 2ZOLB 4X7CC 5KSUA 2JIXB 4YHPB 1FCGA 4B3VA 2HTKC 1PZ3A 4JM0A 3KL5A 3CDZA 4PP1D 2IOIA 1GY1A 1E4XH 2SEBB 5I9QB 1QASA 3MRFB 1ID5I 1BFOA 3BW9B 3PAVA 4YDLB 1NAKH 1EXHA 4N1HB 2B15A 4PJAA 2XXMB 1ID2A 3FTZA 1I9JH 1IC7H 2F08A 2GHWB 3MA7A 2HLFC 2AF2A 2IH1B 3CHSA 4Y8DC 3S35X 1HILB 1I9IH 3QQXA 2QGCA 3KH3A 4PJBF 3ZO0A 4PJ8B 3V4PL 2AAVA 3GEFA 3GLEA 2BMKB 1J8HD 2AXGB 1RV6X 3IGFA 3LTVA 3SDXB 3VFOA 4NC0B 2VR5A 1T1XA 2P46B 3FCSB 4GRWE 5C2BL 2LW3A 4PTTA 3TT3L 5EZIH 3RVTD 2YMTA 5E8NB 3NFNA 4DP5X 5D4HA 4E5XA 1KPRA 2BIOA 2X1QA 2XICA 2A74A 4PRIB 2BZ7A 3T1FB 3TH2T 5CEYB 3N1PC 1CE1H 4P46B 2VR3A 4PJ9C 1SDYA 3HZ3A 4MWFA 5CJ8A 4ODHH 1RUPL 2GCYB 5KYXB 4W6XB 1H8LA 3PFUA 3TCXA 1VF5C 1U3HA 4GKSB 3ZE1B 1RZFH 1PJ9A 5CD5C 1AS7A 3WEMA 4N9GA 5EHFA 1FL6A 3ARBA 3ISYA 4GXVH 1OW0C 1T7WA 3GRBA 2DQCL 3DTXA 1UKSA 3DGGA 1GPOH 3G04B 3HS8A 2XBDA 1QZNA 4FQPA 2VRKA 4NKIH 4R96B 1MHEA 2B16A 1GR7A 5E2TH 5BW7C 4QXTB 1A4AA 3DSNA 2O5YL 4J4PC 3Q2WA 4G70B 4BZ2L 4G43B 4D8PB 4Z0XB 1QR1A 2VWEE 2I7OA 2WHVA 3VGGA 4TSAL 4GIOA 4PGZA 4ZXBC 5E8EA 2QQNL 2VC2L 5IQ9B 2VQTA 5IW6A 1QSVA 1SLXA 4JJ5A 3KPLB 3OZ9H 1DVFA 2G5BB 4LVNB 4YHML 1J48A 4W9EC 4DEWA 1V10A 5TGBB 1YYMH 4P99A 1U4FA 4ZQTA 2CCVA 2QFPA 2AHIA 1ZLWH 4IU3A 2HPOA 3HI6L 3E7JA 3GIVB 2A74B 4JO4H 4MXVE 2EJ1A 4KMTH 4D8OA 2D8KA 3HLKA 4V1DA 2OMVA 3NZSA 1USZA 2ROYA 2Y7LA 3MNMA 4Y89A 4MZ2A 5GRUL 1XCQA 2LT9A 4PB0H 3BUBA 5EBWB 1H0DB 5AZ2H 4PJEA 4UQ3A 1EA9C 2UXFA 2RD0A 5DHXB 3GUFA 4Z7NF 4LLMB 4X4XB 4P3CL 4N9OB 4Q52A 1KBGL 3PGDA 2Q8BH 1JNNL 2VMEA 5C0DA 1NFDF 1ZXKA 2WLHA 3QJHB 4O5LL 4KH9A 1EEZB 2BDNL 1X6LA 1NOAA 4H13C 3TCLB 3K6FA 5IP4A 4QF1B 2VAAB 4DKAA 5HGBB 2DJMA 1C1EL 3PJSB 4MASA 4OB5H 5E08L 5AD0A 5DHVA 4MBRA 5IVNA 2WQ8A 1MLBB 3HMXA 3MRLB 2E27H 1WBYA 4DO6A 3MQIA 5CP3A 2WQAA 2YJLA 3IDNB 1S7VA 2AGJL 4E41E 4Y19B 5T1KA 5FO7B 2UY6B 1HL9A 4NLAA 3PWJB 3KBEA 4KO5A 4XO8A 5JQ6H 1K5NB 1E9QA 1EMTH 4WUUB 4WI5A 5IY5B 4EI0A 1EV2E 1NFAA 4YQXH 5GJSH 1AO7E 5DZPA 3RWIB 5FYJH 1NDGB 4JFYB 1YN6B 2JF1A 4PG9B 3MX0B 4W9DC 4R4BB 4KNQA 4OFPA 5E2WH 5AB2A 4EF3A 5ACZA 1T0PB 3V0FA 2PWEA 3FMGH 3JWNH 3CVIL 3D85A 3ZIYA 4AV5A 4TS6A 3EH5B 1TO4A 4OKVA 3JQOB 1I7RA 3ZDXE 5EIIB 4MJ2A 3B2DC 5HDBB 4DOHE 1GGTA 1RUMH 3EJYC 1M1XB 2YD1A 4N22A 1S9XB 4K8RD 4Y5VA 2GB2A 3MLRH 3UG3A 4JVPA 5GRYA 3ZHFA 4JFQA 3MBXL 5JPMA 1GJUA 3KYOA 4OGYL 4YSAA 2EO7A 3RGHA 4ONGL 3QC5X 5FCSH 1R24A 4G8AC 5F7KC 1F5WA 3WAJA 1E27B 4NPJA 1ZMYA 4LEOA 2WLLA 1ILUA 5ANHA 5HVHB 4PJIF 3NEOA 2YJQA 4HJSA 4AQEA 3KPNB 4FNSA 1S7VB 5GGRB 3PHQB 4U6XA 4ALAC 4G8FB 4I77H 4PMFA 1CCZA 3X1GA 3MLPA 3W2DL 1K5NA 3GI9L 1GZHC 1U8LB 5HI4C 3DA0A 1A14H 3IU4H 4XWGL 3FO1A 1S46A 5JTWA 3T8XA 2ZNWA 4HXBL 5I0XA 5E4AA 4RVBA 2EDFA 4E9LA 1P5VA 3VA2C 4G1MA 1CF8H 2EEFA 1HYRC 2HG0A 3IDGA 1D5IH 3BPNC 1A7BA 5H37H 4WSKA 5MERA 2X5PA 3DYOA 4X6CF 3QXUA 1NAMH 4JMNA 3AT0A 4ZPVA 4ZYKB 4WENB 1L6PA 4OV5A 4LCCA 2PUQT 5J6GA 4MSWB 1U6AH 1HH9B 4FERA 2Z4TA 4KDTC 1YHPA 3UFIA 3LV3B 4XXDA 3MRPA 1AGBB 5BRZE 4FZ8H 1OTUC 2Z31D 4MMXB 1JYVA 2OSWA 3IWUA 1J5OL 3SY0B 2APVA 4OVUA 1Q1JL 1NC4A 3OR6B 4J8RA 4ZUTB 5C71A 2ICWA 3SQOL 1NUNB 1UVQB 1WZMA 5AKVA 5LXGH 3RILA 5D7KD 5LWYL 3QI9B 2PABA 5E8OB 3P4MB 1GZPA 4A7UA 2BOCA 1T2QL 3IDXL 4MKTA 3L2MA 5INDA 3SPVA 4ZI8A 1IGML 3TO4C 4CAGA 2NYZA 2BFVH 3N42F 3QXDB 1Q1PA 4N5EC 2HMIC 1TZGL 2EKJA 1QACA 1WFNA 2V6HA 4JL2A 3X1FA 4HSAC 4WW2C 4EO5A 3LKSA 3C5ZA 2FSEA 3SYAA 2NT0A 3WXVL 3D0AA 3M17A 3DUUA 4XXCC 4PV9B 3GM0A 1U3ZA 5CZVL 2YSSB 2VM9A 4UUJA 1H15A 1ULVA 2G75B 1KNOA 3LS5H 5D8JL 3RZWA 3ABGA 1JZJA 2BP8B 5GSVA 3N04A 5I0WA 3BP5B 1V55B 3BIAX 2Q76A 3Q5YA 2OQJA 2XFGB 4LQ1A 1OCWL 4I85A 5SWSD 5C7XL 1IBGL 4PW3A 1TVBB 1HILA 2CPUA 4JHVA 3EJRA 5DMIL 1SLVA 1XIWD 1GHFH 2CLZA 2YRPA 2ADGA 4XCCH 1IZKA 4WK2B 2I24N 5D2LA 2FRGP 5AKRA 3SHSA 3SE4A 1QI4A 2ZF9A 4U1NA 5GGTH 1A7NH 2FH8A 2VLME 5HHOD 1EUUA 3O3BA 4MDRA 4HGKC 4Y2LA 4NN5B 1A1OB 3V0WH 3QAZC 1BVKA 4JG0L 2CA4A 3IK2A 5IVXE 2IAMC 4TLUA 5LWYH 5A40E 1M3JA 4C55A 1G5AA 2ZIDA 1OHZA 3M7OA 1G9MH 4HZLB 1YMMD 1NLBL 1RJLA 1XQ4A 4CL7A 2JCCE 4N28A 4XO4A 1LEKB 3IETA 3TBCA 2WBXA 2W38A 3FCTA 4PCYA 3C5ZB 4ZMWA 3E2HB 3QDJE 3J07A 1BVOA 1WAAE 3ESPA 4UTAA 4F37F 3EJYD 1FIEA 4UAOB 2H0EA 3QYCA 5CUSL 5HHNB 4Z7VF 1T0MA 1BFVH 2BW5A 3ZTCC 5LGJB 2J57A 2HSIA 5GS2D 1PZUB 1CTMA 2BCMA 3EZ8A 4NYLA 4KV5E 1EDYA 4JRYB 3WIHA 4Z1PA 4HCRL 3IVKA 1AG6A 2YD6A 2WBJA 2X4OB 1CLVA 3JVGA 1QUNA 3W5MA 2NY6C 4WHTA 4IS6B 3FTGA 5TF1H 2OMWA 3VH8B 2W92A 4F8QA 2FT6A 1DLHA 1XGTB 2MTPA 1OTUD 3K5RA 4URTB 4FXKA 2NDGA 2XA8H 3NZ8A 3ARDD 4AZUA 2QZ5A 3GIVA 3WNPA 2JELH 5A2AA 3QJRB 5IOPA 1CD1B 5F7YC 5BV7C 2DWEB 2DM4A 1MREH 5CSZB 1ZE3H 4W6YB 1JV2A 4UANA 2VJ8A 3R06A 1BQHB 5ALBL 3TO4D 1SJVA 4N2BA 5L2KD 3TCLA 4NCDA 4XCYA 4I77L 1UCTA 1TJIL 1F3RB 2UVEA 2YEVB 2EDTA 3CJJA 3D08A 3HZYA 3NCMA 3ZDWA 2OPCA 4L48A 3GK8L 3X2QB 2DM2A 2DQUH 1WISA 3O6LL 4X5XB 4K73A 5JDSA 2Z8RA 3AGVA 2N0MA 3FONA 4GAGL 3TO4B 5T33H 3O8XD 5I5IA 1KMGA 3DX4A 4WQOA 5FWRA 1NMAL 3RJQB 1UB5A 3DIFA 2DQIL 1R17A 2HT2D 3U7YL 4PGBA 2OL3B 1JWSA 1F6AA 4P5RA 3L3OB 1KJVA 3RUGA 2WO4A 1I8KB 2FX8L 4MXQD 1IC5L 4RX4A 1BXAA 3MRMA 3QRLA 1D5IL 4RLDA 4IBWA 4KZCA 2Z1PA 1MUJA 2JKJA 1H6UA 3UTZB 3BH9A 4N0CC 4O02A 2NXYC 2NUPB 3IU4L 4FGMA 2Z92A 5CGBA 3S37L 1M71A 1A6WL 3VX1A 1ZGLP 4IU2A 4KRMB 5JHLA 2AJ3B 4AH2A 1U8PB 4OW6A 4DP4X 1UM6H 1A6VL 3FCSA 4BSJA 1UD8A 4PY7A 1G6VK 3MRQB 4X7SL 5I5JA 5GZOC 1NDTA 1ACCA 2JJSA 2XRAH 3PQYD 1YMME 1ANUA 1RZQA 2A2QT 3NIGB 2GJ6E 3LX9A 1CLYH 5LBSL 4BK8A 5F6IB 3VFOB 1A9BB 1KB5L 4L8DB 3MNZB 1DFXA 1UM4H 1N0LB 1WCBB 3F6LA 4OF5A 4Z7UF 2VZOA 3D50A 5HJ3A 4LB8A 4XH2B 3WGVB 5D7LD 3VA6A 2IMNA 4Y4HA 4ES8A 4LESA 1WWAX 2PTTA 3WUZA 3NFPA 3DVIA 4YPGB 1E7VA 4RA3A 3X11A 1F56A 2Z91A 2GVYA 4PGBB 4G1EA 4N2IA 1BQ5A 3ARUA 3EOAA 2CG9X 3MKKA 3P4NA 3CZFB 1BAFH 2CALA 3NIGE 4XMPL 1KG0B 2V7HB 4NB7A 3GHPA 1XL6A 4U31A 1THCA 3FCGA 5GRVL 3SYCA 1S6NA 1KB3A 4U1KA 4IRJD 5EIIG 4JGNA 2D73A 3MRCA 5FYJL 3L3DB 3C87A 1CDUA 4M8QA 3JXAA 1Q72H 1CDIA 4RQQB 4R9HA 4GXVL 2IO5A 2ZQKA 3KPSD 3HAEA 2R0ZH 2I69A 5K33A 3ARGB 1IM3D 2MHAB 2VXVH 4G3YH 1TPXB 4KRLB 5ISZB 5I19H 1BAGA 1JHLH 5TGBA 1QR1B 2ENQA 2JE8A 3KPOA 5E24E 3RVUC 2ZXDA 2XBZA 5KBMA 4HAKA 4O4YL 3GBNH 2AEQH 1O5PA 3EH2A 5KSAD 1EQWA 4AXWA 5FB8B 2XZQH 4CJ0A 2WYZA 5D1QE 4Y88A 3SCMD 1K6QH 4Y1AB 1J9RA 1KBGH 4OJCA 4KDWA 1E4WH 4RAUB 4Z7UA 5LNGA 3TS8A 1JF6A 2M1KA 2BIQA 3ILEA 1M57B 2BIMA 3CFKB 4PJHB 2OMVB 2RA1A 4RCAA 5DD3H 5K59F 5T3XE 2P5WE 4B9YA 4UTAL 5IUCA 1IAOB 2WVVB 3DHPA 3TBBA 3DJSA 1N6VA 1RZIA 4PJBB 4YK4C 4HLJA 5DO8A 5CGTA 3IU3A 2IBBA 3S98A 1OZUA 1CLYL 3ULVE 3FN9A 5DQJA 1P6WA 4GXUN 2OP4H 3TJHC 1J0HA 1SN2A 2FECI 1QWUA 1J8HB 2WWNA 1SXSA 1U95A 3W11C 1F4YH 5D1QB 3CNKA 4MVBD 4NI3A 1LMIA 3UGXA 4MCYA 3LH2H 4R8WL 4HJIA 3DOHA 4RQQA 3QJUB 1JZEA 5E6IA 2GIMA 4FQQA 3QQDA 3VUAA 3H56A 4AYEC 5LJYH 2XQYG 1O0VA 2FQFA 4LT7A 1VB9A 3TT3H 4X0KB 2CJTA 2W07A 3K72B 5TD4A 2O6PA 4YXKH 5IMOB 4BCXA 3NTCL 4U6YA 4TQ8A 4YE0A 3DVNB 4C56E 2P8PA 5KANG 1KGIA 3N85H 5AAMC 2PCPB 2WLIB 4R4NC 4ODXA 1TZIA 2IALA 1MFMA 1NAKL 1E6OH 1T04A 2RMNA 3CFEB 3MGTB 5IVOA 1SMOA 5ELIA 1IM9D 5DF0A 4AG4H 2ID5A 5IB5B 3DPBA 1S4IA 4GXUM 2H1PH 1CIDA 3UL4A 2UZXB 4Q9QH 3FCTB 4QXWA 1OARL 1PX8A 2EDNA 2H45A 3BD4A 3DIDA 4PJDF 2DQEH 2AI0H 2FE0A 1D2PA 4LKXA 2H32H 3L3KA 3Q8AA 2VXTH 5GGVL 2MOQA 4WEBL 1X9QA 4NQCE 3RWJB 2H9GA 3AXHA 1EX0A 3TBWA 3HW7A 2FIRT 3MODL 4LPXA 1H3GA 5JIPA 4HUVB 2W9DL 4GAYA 1HJBC 5F96L 4BQ6A 3ZHLA 4HF5H 5JHDB 5C2BH 2V8LA 3VW3H 2EC9U 3G9AB 3WO3B 1VESA 3MRDA 4LOFA 4KK6C 1RY7B 2D2OA 1N6UA 3OLEA 4WEMB 2RBLA 4UTCA 5BOPA 2C4FU 4PMEA 2B3IA 3RJDA 2RQEA 2XRAL 5MI0B 5PAZA 3WFEL 5H37A 5CCKH 2DYPD 1JV2B 1BQUA 3DDGA 3H42L 4P5TB 3MA7B 1ZDSA 1J1XH 1X5ZA 4XC1L 2J1YA 4BH8B 4JM2B 5E1QA 1NCDH 1B0IA 1A9EA 2PPEA 3HI5L 4UBDC 2O61A 2FTAA 3L48A 4E9TA 1FAKT 3O2DL 4ZUSB 3SKOB 3S9DB 3B5HA 4EUPG 1A6UH 4HMEA 3SY0A 4M6ML 3ESVF 3VVWA 3L3JA 3LRSA 4MQTB 4NN7C 5IW3A 3KCPA 4WO0A 3LB6D 3OGCB 3AQZA 3D7PA 3HZYB 3UTTE 3OAWA 4MAUH 4NZRL 3IPFA 1BZQK 4WFGD 5GSRA 1HSBB 5CEYA 3QIUD 2NTSP 3SBRA 3WMSA 3QUMB 1AP2B 3AGWA 2Q86A 4M93B 1O7SA 3BZEB 4KI5C 3QXDA 5K39B 1F3JB 4NWUH 2W9EL 2WQSA 4XNYL 4JVUA 2A1WH 2DIBA 4F1SA 1QBLL 5GGSB 1OGAE 5AW6B 5CBAB 3B7SA 2PTVA 1ILSA 2WP3O 1MH5A 2O5XL 4G5ZL 1UACL 1KTCA 1KPUA 4P2RB 1BGXL 1TZAA 1B2WH 1BWWA 4XNQB 4PLKC 1EEUA 3GI8H 3ZR6A 5D2LF 4DN3H 3KLSA 3G04A 4Q9RH 1A1MA 4MS8C 4ZUUA 1EAPA 3UBFA 3TESA 3U0WL 1NEZB 4RMTA 1SHXA 1U42A 4R26H 5JR1H 5HHVL 2K9UA 2OK0H 3SZ6A 2YAQA 2PWFA 3LRMA 3LNEA 1UOVA 1Z32X 4X8CA 4EUPA 5TE7L 2BVQB 3IM1A 4PY8I 2WZAA 4XHJC 1A7PL 3RY4A 2DIJA 1SUHA 3F8UB 3LCYA 4PTUB 4FABH 4EIGB 5IHZB 3LS5L 4I1RA 5D2NC 2J21A 4K5PA 4B0MM 2YPLD 1KWGA 4XI5D 2VE6A 4E9YA 3EYVB 2VDML 1WFIA 2FEEI 2IPUG 3WJLA 2P8LB 4DFIA 5MEOB 4RFNB 4AQAA 1O5DT 1JZ7A 3LN4B 1AHKA 2A4CA 5KS9A 5B7MA 4XN4A 2VT0A 2Z7WA 3WELA 2XV0A 4PRNA 2MCAA 5I30L 1FSKB 4OZHF 4YDNA 2P26A 3FB7B 1U3YA 1IC4H 3D39D 5CUSH 1VEMA 1VZIA 3QJFB 5E99H 5BV7B 4U0QB 4L29B 4N2LA 1P7BA 3D48R 3ARGD 2C7FA 3VWJC 2CCLA 3RY6A 2XWJA 2QHRH 2Y3AA 3PWUA 1NA8A 2Z4QB 4E9WA 2EYTB 2F53A 1K6QL 4G8GD 1YPZE 4GJTB 1G6RL 4WTZG 4IW4C 2D9QB 4LRNL 4QTIL 2AV7A 1JHKH 2FT7A 2P9RA 3P3TA 1AS6A 4ODWB 2CU9A 1X5GA 2IC2A 1MCJA 2CNYA 2GC4C 3L8QA 1T03H 2WSKA 4C54A 1SFDA 4PJDA 1AACA 1Y0LA 3ZQ9A 1YEGH 1YUHB 1CTOA 4K9JA 1NTDA 3KL3A 1CGYA 1F58H 4OR1A 4APQD 2OULB 3BSHA 4LHQB 3RX8A 4CDGC 5I76B 1ZLSL 4A2DA 3KHQA 4QJ3B 2XNAB 3MO1B 2JJUA 3T0VA 4H25B 4PG9A 2K7PA 1D5XA 4QTHA 2RHEA 4JKKA 3NIFB 4MJIE 3V7AG 1OPGH 1FN4A 4JFZL 3GHEH 3VE0A 1U91B 3G6DL 1ZPUA 4L3AA 3UTTD 4MNQA 5C7XH 1N5AB 5DYOB 3AQYA 3UZQB 5IBTL 5DJAA 2QGBA 4ENZA 1KJMA 1G7QA 4IIZA 5DRWB 4ZX3A 2A4ZA 1JD9A 2NX5B 2WYTA 3QFJA 1IKFH 2AANA 3MBEA 3VD7A 4FAAB 4YBQD 1HHIA 5D72L 3O2VH 5CSZA 2XQ0A 5DA0B 3U9PH 3VDBA 1UXWB 2QV2A 1CFMA 1P84J 3GSNL 1G9NL 2OJ1A 2YC1B 5J6HA 5ECGA 3S48A 4MJIB 1N7MH 5D1XC 1PD6A 4QRPE 5HYJA 1YQ2A 3UMTA 4HFUH 4L9LC 4HXAH 4LLWA 1I7ZA 3OC8A 2GHZA 1UM4L 2X88A 4XBEH 1IC1A 2NY0B 5F21B 4Z7WF 5KVEH 3O6FA 4MMXA 4Q0XH 3RWFA 1L7TH 1T2QH 2QSTA 4G7QB 1ZT1B 3KL0A 5FUOH 4A7SA 5AW4B 2DLFL 2E9WA 1ERNA 2OMTA 3FZUC 4ALAL 4JDZA 4DW2H 3GSWB 1O6SA 5CJXA 2APSA 1A7RH 2BS71 4IYKA 2BSDA 4UT7H 4NQDE 1Q0EA 2E7CA 4MX7B 3FT2B 3VX0A 3OB8A 4R90H 4O9HL 2DWSA 1JFQH 2NY5H 3CVHB 3ZZQA 3Q6FA 4Y5XA 5ESVB 1JG9A 3RWEB 3P2TA 2CGRL 5FOBA 3T09A 4CC4C 2VDLL 2YGQA 4GMSL 5IBLD 4PRHB 3WJJA 3WIHH 4O58H 4OFIA 2VR8A 1YYLL 1IBYA 1DJHA 1S7RA 3GJFH 1WUZA 1U4EA 2F6AA 3FK3A 5JOFA 1JWMB 4H2AA 4JB9H 5DSCB 2DQHL 4C83A 1ZV9A 1YEWA 1CXLA 4GMSH 4N8VA 2DI7A 1I8MA 1WA0X 4AYFB 5FK9B 2DF3A 1Y0LB 3O9WD 1U41A 2F19H 4OJFH 4FMFA 1YG9A 1FZOA 2ZG1A 2BPBA 4H0HB 4YBHA 2DQDL 4IDLA 3T8MA 4R7LA 2OJEA 3MCG1 3HHMA 5EOTB 1EAJA 1C5CL 4JG1H 4L9LA 3BMWA 1MG2C 1PZ2A 3T0ED 5ENWA 2ATAA 2J6EH 4QOKB 1FAIH 2ITCB 5DA4A 5HYFA 4G1EB 4MRCA 4FYQA 5DHMC 4NWTH 1T83A 2QFRA 1KIRA 3FQRA 3U4EB 5C07B 1KOAA 4XODA 1XBRA 2WK2A 3EJPA 2DMGA 4M5TA 3BUTA 1QUPA 1UH4A 1QSFB 4PWGA 4ANXA 1DUZA 3V4VA 3I75A 4LLDB 2LFGA 1A1NA 3BWSA 4HPHA 1DQQB 3SDAB 3CSFA 3IKCA 4LSQH 1FG2A 4BFBD 1H9DA 2CD0A 4HZLA 3ARGC 1MWAH 4Z7OB 1FFRA 4ZG1A 3D09A 3I02B 1CGXA 3WNKA 1P6AB 3RWCB 4EKXA 2NY3B 3CFDA 4I3SH 5EZOH 1NEZG 5BVJB 2PYEA 1T03L 1G0XA 4JRXE 3GXPA 2MOVA 3PJSA 1A3QA 2X87A 3B2VL 4QTIH 5GSRB 5FGBC 4DAGL 5ITBH 2WXPA 3QQ3B 4WU7A 4M61A 3ILPB 1WWBX 4TNEA 5GZNC 4XN5A 3QFJE 1OCCB 2H3KA 2B0SL 3P3YA 1FGNH 1I31A 1LTXA 2GT9A 2VQ1B 3QUGA 2HX8A 4Y9BA 5DUPH 1VSCA 1RZJH 2ZONA 3GSWA 2HCZX 3VFMA 5CR8A 3HBPA 3WDHA 4D9QE 3GTTA 3KPTA 1LEGB 4I1PA 2YA0A 3H7BB 2IQAB 3B3IA 3ARQA 1P4BH 3NJXA 4MDIA 1MHHA 3N6YA 2MCG1 4QOKA 4HKBB 4OGQC 4UYQA 1F1DA 1IEHA 5ETUA 5BRZB 5I1HH 3VD2A 5E4EB 4HUMB 5IFAH 2WTRB 4HWBA 4RMBA 3E6HA 4N8UA 2NY2C 1F41A 3QHZL 3RNKA 4B9GA 5DD0L 3AADB 4PGJA 3S88H 1N5YH 2WSPA 3ZKMD 3T3PB 4EDWH 4LVHB 2UVFA 2WQVA 3SDXE 5A2LH 2KS0A 4I1NB 3GMMB 5E00A 1WEJH 2OXGA 4HS3B 1WBZB 2IAMA 1P4IL 1E7UA 2DQ6A 5IWLC 1J8RA 4FZEH 5A2IH 5E2UL 1HQRA 5D2NE 1QLRA 1T7XA 1ADQL 2SODB 3ARWA 5EOQL 5AOZA 2HG5A 5F93C 1R24B 3O6KL 3VXMD 4NO5B 3FU8A 3O45A 1QVOA 4XNMA 2LOEA 3ECWA 1U9KA 4N8CH 2P8LA 4BGLA 4CN6A 4JHZA 2AS5M 1ZLVK 1RSYA 4LSPL 4AQEB 3CFQA 1YYML 5H94B 1JPGB 4JY4B 4URKA 5KYWB 3LPOA 3QQDB 3CU1A 3NZ8B 3EHBC 2R2CA 4FG4A 3ML8A 4KWUA 3ZE0F 1BGXH 4XP5H 4FXGB 4XVSL 1DDHB 3EBAA 1GCYA 4PJIB 1KJVB 3RUGB 4BELD 3IGLA 1U8HA 2IDQA 5B8CC 2AEPL 2RALA 1R3HB 1KFGA 2UX6A 2EDWA 2WQWA 1G6RH 3FQ1A 2LTQB 2I07A 3TJEH 3S8GB 1UWFA 1PKOA 5CEXB 4F9PA 2QHRL 1A4KA 2R9HD 1Q9OB 4A2FA 5C6TL 4JFDD 4ICXA 4R7NA 4NAQA 2J1XA 1AGBA 3HG0A 2H26B 2BFVL 4JCLA 2XWJB 1PLCA 1EHXA 4MQ7A 5E6SB 1I1AD 1NDMB 3AAZB 1HEZA 4HKZB 4TPRL 1MFEH 1BLIA 5KSBB 1U8MB 3SPIA 4PJIE 2Q8AH 1QFUL 1LK2B 2VKWA 5JHDA 2HKHH 2Q3AA 3MZGB 1OLZA 4XGZA 4JFDB 3SQOH 2YARA 4K4KA 3PQYE 3G7TA 2DLGA 2PO6B 4IOFD 4X83A 3ZDZB 5IQ7L 2W9EH 1FUNA 3CSTA 5CZRA 5DRZA 1VKXA 4JKPL 1MF2H 4HT1H 3V10A 2WWMC 3H42H 1JL8A 4XNXL 4J4PD 4YSSA 2Z8WC 1J5CA 1N5AA 5DYOA 5EO9A 1NAML 5L88H 2GBTA 3U1SH 3RB7A 5BV7H 1QI5A 3KPRD 3GO1L 2K6ZA 4GFTB 4M93C 4ENEC 4LLMA 2I25N 3MRKA 1KBVA 3WNIA 2R1XA 3EW3B 4HWEL 1ICTA 4HF5L 1UH3A 1JZDC 4HIXL 3K2IA 2FIKA 3INUL 4UNTA 5I1JH 1CC3A 3DGDA 3H6AA 3GI9H 4P5KA 3QULB 4X42A 2X89D 3E8VA 3HCVB 1E6JL 2HG5B 5E6ID 4TOYH 5FYLD 3EBIA 1R0AL 4JREC 4WI9A 1UH2A 4GG6A 2EDYA 3VFTA 5J11C 1OAUL 3QUZB 4HS8L 3D9AL 3N1GC 5LBSA 2X0VA 5SX4H 3RTLA 4HULB 5C3TA 3VU1A 1YZZA 3C08H 4OGYH 2F74A 1G9HA 2DQFB 5HGBA 4LLVA 3RY6C 4HU2A 3V6OC 5ERWA 3JZYA 1O6SB 2R29L 2EYSA 2FHFA 3QSKB 4P06A 4TVPD 1I1YB 2FWUA 5D5MF 5BQ7B 3QO1A 4UAOC 2IG2H 2BP5M 1OM3L 3TWCH 4JFHE 4HLEA 1N59B 5I1EH 2R2BB 1MFBL 2BSBA 1ZT1A 1AGFB 1NCNA 3FDWA 4ORGB 1OB1B 2PPCA 3QRGH 3EG9B 2ARWA 4YDVB 4DUXA 3U79A 3V9EA 4WUUA 3GDCA 4X80H 3DETC 1TYJA 1J86A 4M43H 4O2EA 3NTCH 4YDLC 2EP6A 3D0VB 3KAAA 3AT8A 4M62L 5AWNL 4HJEA 2YKKA 1EJFA 2P52A 1ACYL 3OF6A 4ODVL 4PJEE 3C60D 3CHQA 4BFFA 2Y07L 3ZDXB 5EIIA 4KXAA 3ARFA 1A47A 2R39A 1M6OA 2XFXB 3HI5H 3CK0L 3MUGB 4MDJB 1VENA 5F88A 1HH6B 2FX7L 3C6EA 1IJNA 1CFBA 3OZKA 1QI3A 3IE4A 2EH8H 3T0BA 3QIBB 2YAFA 4JRYA 1MFCL 3O8XA 4GOSA 4QD2E 1HESA 1JZIA 1ZSHA 2CDFA 4Z9KB 3SPGA 4CJ1A 4KZEH 1JF1B 3KS0J 4X4YB 5A6MA 1UHVA 2AGJH 1LXMA 4AYFA 2R56H 3U0PA 5DUMH 3L3GA 2X9YA 1CYXA 2X42A 3Q1SL 3BPLB 1CXHA 4Q89A 3ZGIA 5HVGB 3QZWG 4PJEF 1FYHB 4N90E 4K5OA 4JE4B 1FP5A 4YXKL 1OGTB 4FN0A 4NHUB 3CQQA 5F1NB 4XMZA 4ZX4A 4R4FL 5ECJE 2DEYX 5DS8B 4FG0A 1G1OA 3AFLA 1ZLDA 1YO4A 1TZHB 3QAZB 3S3JA 1I1CA 3KD4A 1AZRA 1YEHH 4DKEH 3ETSA 5GGVH 5BZDA 1SOSA 4G9FB 1HWGB 2BSCA 1FG2B 4PJXA 4BQBA 3HPJA 1G7LB 3ETBF 4U6VL 3JUZA 5H37G 2NW2A 3IBOA 1J0KA 1MHCA 4DUWA 3V4VB 3LD8C 4W1TA 5CKAA 1U3HB 4GKSA 2VLMD 1A4BA 1G7IA 5CWSA 5ICZB 3K2UL 4FNLH 3F05A 3ALWA 4AG4L 3QR2A 1TZIB 2IALB 3S3PA 4LLQA 1T3FB 4DO4A 4MYWB 4P9ML 5F9JB 3GSOA 2R9HC 4IRSA 2VDKL 3QUZA 4B9CA 3BFWA 4Z0XA 2R0KH 3GBEA 1H3UA 3QZWA 4MKMA 1AGEB 1I1AC 3RJOA 1MIEH 5L2JA 4KTDH 2FT8A 3WL9A 2K3TA 4JFVA 2ISDA 4ZS7H 3SGEI 1BZ9B 2YUZA 5IR1B 1A7OH 4ZMQA 4KVPA 1PVHA 1I3RA 3JV4B 3S3CB 1S78D 1KC5L 3K72A 4LE8A 4X98B 2A9ML 2JTYA 4MD0A 4Q6IC 3WJJC 4RRPA 3GJFA 1LEGA 1N59A 4U1GC 5KBNC 4HP5A 4M61B 2W88A 1J1OL 4W4NA 2F7PA 1W72L 4XRCB 1TEGA 4HA1A 1G6RB 5SWZD 5AKSA 2H2PC 1ZVHA 2DQTL 2ZUWA 3V52H 3E1ZA 3EYSL 4L5FH 2OYKA 2IWEA 1VFBB 5IT2H 4DEUA 4U1LA 5D96B 4HJJH 3UTZA 1A7OL 2KDYA 1QBML 3CGTA 4HIHB 3CK0H 5DHYB 4U1JB 4AE0A 4P3WA 3VFSB 4NSKB 3HR6A 3MHZA 3WHE0 1NINA 4MAYC 3MOQA 5F0PB 4MMXC 4PJAE 5EZPA 2PR4H 4CMMB 1XIWB 4Q9BA 4LGPB 1KIUA 4TQHA 3DJZA 5GGSY 5FR3A 1Q9KA 1PPIA 1JCKA 1QRNA 3T4AA 4P59L 4EVNA 1HNGA 2VYRE 3D87B 4UI2A 4F92B 1UCBL 3L5WA 4DNLA 2DLIA 4ABVA 1QKZL 2V37A 5FV2A 3ZYIA 1JXGA 2XI9A 1G9MC 5L2JB 1YEHL 2AV1A 4Q58C 4L0ZA 1M7IA 2L3BA 4HUCA 3WNJA 5IEHA 1A6AA 4P3DA 5IHWA 1KTDA 3MJ9H 4JGMA 2QVTA 2Y3NA 4N2HA 4ZPTB 4X7FC 3KNBB 4CN1A 4FDWA 2ZD0A 2XWTA 3NSDA 4G9FA 3U36A 1NM9A 2OMUB 5M7QA 2Q7NA 1U58B 4NNXA 1AXTL 5D7SH 5DUML 5F2FA 1J8HE 1XIWC 3VB8A 1CXIA 2PCFB 3FULA 1U8NA 1VFBA 3LKQA 3O9WC 3ZDYB 4KUZL 4E36A 1NDGA 4XMKH 1NCOA 2FX7H 1UM6L 4CGUB 2YKLL 4Y5XB 5ESVA 3C60C 5AVQB 3SN6N 3QZMA 4WWKD 4XBGA 2KZWA 1ZAGA 3FH7A 1PX3A 2Q7YA 1INQB 2WMPB 3BIKB 3KPSA 4I9XA 4N0YL 5GRXG 4ZXBB 5L88L 5HDWA 4QHPA 1ACZA 3O6LH 3PHSA 1KCUH 2V3EA 2KPWA 2OMYB 1KBBA 3ES6B 2TRYA 4M43L 1WLHA 2H6UA 3UAAA 4BE5A 2JCCA 3FB5B 1D6VL 5DT1L 3CFMA 1QSEE 1MFUA 3MMEB 1KCLA 4KDTA 2GK0B 4PUBL 4MYPA 2QEJA 2FO4A 1KXQE 3NIDE 3ZTJH 3W38A 1FZOB 2XQYA 4HWBH 1LMKA 2K0RA 4DCQB 4JQVC 1O9ZA 4DIXA 1JUFB 3LXBA 3PPSA 2PKDA 3ZE0E 4Y1AA 5FW7A 1P5UC 4K3HA 4FMKA 4KROD 1PZBA 4MAYB 3K81A 2JXMA 1L9PA 4FFWC 4DGVH 5IBUB 1VCAA 4Z7NE 4ELMF 4XO3A 2OBGA 2RR3A 3NJMA 2YO3A 4BSVB 4H8QA 1IVLA 3ZIMA 1IAIM 5GZNA 5ANMB 2OW7A 2GC7C 4HEPG 3RWDB 4ONFL 1CQYA 2ZWLT 2C9AA 5DLLA 1GXEA 2EEXA 5FM8A 4B60A 4YWGH 4UBDD 2UZPA 4JRXD 3V4UH 2AXGA 4IJ3C 3SDXA 4ODBD 4Y7MA 1MEXL 4HWEH 2Q1EA 3EOBA 4PTUA 1P1ZA 5H4YA 3BAKA 3L08A 1FG9C 3VYOA 5EU7E 3PGFH 1S5IH 4KTEH 1QHOA 3O6FD 4K5NA 1DBKH 5DHVH 5DK0A 3AREC 5B8CA 3GSVA 5F3HB 5KVEE 1ORQB 3VFTB 5ANME 2ED6A 4M7ZC 3J27A 3SDDA 4LLYB 4W70A 4KVCL 3NJFA 4TUOB 1A22B 4PGDB 1ADWA 4OZFG 3SOBL 5CD3A 5IHHA 2ZX8A 2GW5A 4HKBA 3V6BR 15C8L 2CR3A 3BYTA 1W8OA 1JGEB 1JN6A 3RPIB 2ODIA 1J5HA 3A21A 3AT9A 2HKHL 4GAGH 3BWUC 3LKQB 3WTTA 2ERJC 3QZBA 5GHWL 2HVKA 5GS3A 4Y16A 2OXHB 5J3HC 1BFVL 1UUNA 4LCIL 4Y9GA 5I6XB 2NW3B 5D2NA 4TQEL 2VITA 1ZGLB 5G55A 2IH9A 3FS9A 4GIAA 3ZYJA 3ALPA 4M8UA 2BRRL 2CO1A 3FTSA 5JUEL 1LNUA 1WF5A 2YPVL 3DK2A 1RL1A 3NIFF 3VFWB 3F58H 5IQOA 1T89A 3PXLA 4TTGA 3ABMB 4NIKB 4OTXL 3ISWA 3OKEA 4M03A 4AYGA 4IU2B 1XXFC 4V1DD 1RZGB 1E67A 1P7QB 1H9VA 4J6RH 2ZUUA 4BRJA 3BDYL 1FL3B 2NCMA 4PLJC 3BWUF 4EBQL 5I73C 2R8SH 3EFDH 2X0UA 1JUFA 2EDDA 1HQRB 1J0YA 3KBPA 1NGYA 1NBZA 4OM1H 5JNYA 4GY4A 3CDFA 3MCLH 5DVOA 3QG7H 1ORQA 3UC0L 3EUUA 4G8EA 4WJ5B 1PSKL 2HJLB 2OTWB 1PLBA 1WFTA 3LS4H 3MXVL 2FJHA 3GMPA 4MJ4A 4ADJA 3U9UA 1BG9A 3WIIL 4ZMOA 1Q0XH 4N8CL 4XH2A 2IGLA 3EO9L 4FHKA 1YEJL 5C0CD 1QSEA 3RKPA 2NW2B 4UWQB 3L9YA 1SEBB 3CWGA 3I9PA 1SRDA 3CZJA 2WZ0A 3LKPB 3BFOA 5K1VA 1JCVA 4AIXA 5AFAA 5BZDB 3I6KA 3VJ6A 1F90H 3H9ZA 3QIWB 5AOIA 4Z7WE 4YAQA 3UYRL 8PAZA 4U0RC 2Q5BA 5HYQB 1OAYH 5FS5A 2E6QA 1SXAA 4RNRB 2R4SL 4PRHA 4ZQKA 3VG0H 3D5OF 3LQAL 3OWRA 3VXRB 4JANB 4NPYB 5G2NA 1JWMA 5T1LD 3K7UA 2YPLA 3BUDA 4QKTA 4X6DF 1NDMA 1R3IH 4ZTPH 3MACL 3MV8E 4FTVB 2GITA 1BOGA 1CR9H 2LE9A 4JHWL 5IMLB 5DQ9B 2WIMA 1WZ1L 1QKZH 2ZTBA 2G0KA 2A4EA 3KWXA 4YL4A 1ND0B 1TMQA 4MD0B 3BRGC 4QXUL 3DVFA 1UA6L 4MX7A 2CO7B 1QHQA 4S1DC 4AJ0A 2R7EA 2ZX6A 3T0AA 1FGNL 3T0EE 1KCSH 3MLVL 5HYJE 4XRCA 4Z7UB 5ICUA 1GHFL 2YQ2A 3IDYB 3HS9A 3MI6A 2W60A 1JYWA 1CFTB 4C4UA 1SN5A 3RZCC 2A99A 1H3XA 1IAOA 3IF1B 3MLWL 3NIGF 3QDHA 4M1CD 1AR1B 1M7DB 3P9WB 2FJUB 4O2CA 5FO2A 4KJPD 1AMXA 2CO4A 3DV6B 3AZUA 1HFUA 3IDJB 3KW7A 4LNRA 4MXWH 1ADQA 1JGLH 3EYUL 4I18C 3GHBL 2R1XB 4R5VA 2XKUA 1WRFA 4O9HH 1TQBB 4MS6A 2V2TA 3U48A 1P6FA 2W80C 5B4MD 3T0EB 3TZVA 4Z7UE 4Y2OA 3B8SA 4OD1L 2DN7A 1UURA 4Y5XC 4IRZH 3GUTB 5AVYB 2E7BA 5I1GL 2CHXA 3FU7B 2WLLB 5F9OH 5CHNB 2DKSA 4FE9A 1FE8L 4XBEL 3MREA 2OMUA 2HRGA 2FO1A 2GBAA 3VFVB 4WF7A 4KTDL 3K1KC 4IRSC 2QT6A 1EFXA 4M6OH 4KQ3H 1KTDB 3VD0A 3FB8A 1QZ1A 1UB5B 2H6PB 3DIFB 5DJ2A 1J10A 3BP6A 2JWYA 5EV7A 2JIXD 2X6UA 3WO4C 1I8IA 3D06A 3WY2A 4G80B 5M94B 1HK6A 1GGBL 4LVHC 5D72H 4RSYA 1EMTL 4F1ZA 3GLAA 4HC1A 3MGTA 1XVSA 3BH4A 3N50A 3DGGB 2BC4A 5AB1A 3N5AA 2XFXA 1E50A 3VGHA 4EXPX 2VW4A