4RGNC

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DIVMTQSPATLSVTPGDRVSLSCRASQSIGDYLHWYQQKSHESPRLLINYASQSISGIPSRFSGSGSGSDFTLIINSVEPEDVGVYYCQNGHSFPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnC01
2ZCHL 4WO4A 5ID0A 1P2CA 2CJUH 2VLRD 3H9HB 1WTLA 3CCHB 1WWAX 1MRCH 2X9YA 1YEEH 4TUJA 5CCKH 4LLQA 1E4XI 1D5MA 3O11B 5IF0A 1IAOA 1ACYL 2IBGA 3CFJA 3ZE1F 4NHUB 1RIUH 1G7JA 2IGFL 2ZSWB 1IM9B 4R96B 2NLJA 3BKYH 1U93A 3MROA 3UJTL 1GCFA 4RRPG 1LILA 3MUY1 5CHNB 2GJZA 2F8XC 2F8VA 3SKOB 2ZG1A 3W81A 3TWCL 3DX6A 4JLRB 4RFEB 4YX2L 4I2XB 4JHAL 2AKRB 5SWSE 3HUJF 3RZCA 3PXJA 4OGAD 1RULH 2MQCA 1S5HA 2EDYA 1J5OH 2WUBL 2ZCLH 4JFQB 5MP6H 5KVMC 1AHWA 5IFAL 4TUOB 3H9SA 4BK5A 1CDBA 1RZIA 5BRZB 3G08B 1BPVA 3DVGB 5JQ6H 1CXLA 2C1OA 1JI1A 5T1MA 2F54D 4Y5XA 1U3HD 2GK2A 2Z92A 4U6XB 1FFPA 2F8OA 3MRLA 2Q76B 3Q5YA 5TPWL 1NAMH 4RMUA 2ZPKL 3LV3B 4DVBB 1HHGA 4H26B 1H8NA 1Z0MA 5BZDB 3MOAL 2LQRA 4GMSH 3HG1E 1JFQH 1Z0NA 2BSRA 4G9FB 5IMKB 2YSSA 4X6EA 2J12B 4RISL 4XP9H 3T8XB 3QEQB 2CDGB 1RUPH 3MLRH 5J3HC 3VFRA 1PKOA 4F8TA 4EI5C 2OI9B 4ISVB 3ARDA 3QDHA 4DZ8A 4JREC 1DSFL 5B39B 2XTLA 3SO5A 3UPCA 4IIQA 1WITA 2VSDA 2FATH 3VXME 2VLJD 3OBAA 4P4KB 1JHKL 3RWGA 3GSNA 5IBTH 2V7HA 1MI5D 3OX8A 3RIFF 4WW1A 1QO3A 4EDWH 4NCDA 1H5BA 3QH3A 3BKJL 4PUBL 4IBLT 2EDTA 4U0RB 1P4LB 4PJFE 3KYOB 2BOCA 4DKFH 4P23D 3DXAD 2AK1L 3SO3C 1FC2D 3WDIA 1OD9A 1A8JH 1E28A 4MJ5B 4NQDD 4GQ9H 3IS1X 1LDPL 3N0PB 4U1JB 1N26A 4PJ9D 1OT1A 2AJ3B 4JRXE 2I27N 3BP4B 5KAQF 2JCCE 2VITB 3BKML 4I48A 5E6IA 1JV5B 2HT4D 3SDCD 1DBKL 1HKLL 3KLSA 2EE9A 5TQ0L 1FCCA 2FEDD 1BOGB 2WP3O 4TQEL 1YNTA 4K71B 2PCPB 3L9RB 1HYSD 3T09A 1XGUB 5DZNA 1P7KA 1U91A 1EPFA 4KJQC 1TTFA 4M61A 2XKNB 1PX4A 3WNKA 2NW2A 3EJJX 3UXFA 4AK1A 1AKJB 4X4MA 2EH7L 1CGSL 4GS7B 5DA4A 4JFDA 4IOFD 4G8EA 1UADC 2CLVB 1EVTC 3O3UN 4OZHB 3VFGL 2VR5A 5IKCA 5F1IB 2ED9A 3WJJA 4LQFL 3UTTD 2FEEI 3EUUA 3NIGF 1XR8B 3SGDI 1U95A 4GAGH 2C1PB 4LASH 5DD6B 2H2PC 2R1XB 3BDYH 4KMTL 5ITFB 3TA3C 1ZANL 2DRUA 3VD5A 5E08H 1FO0B 3WN5B 5FGSA 1T03H 3BP7A 4ZS6D 3BH9B 3LZFL 3VRIA 5CUSL 1A21A 3O6LH 4OJFL 1TZIB 1XGRA 4ETQB 5BMFL 4HMDA 1G6RA 2ORBL 2QV2A 1NCBL 4BH7A 2OZ4A 3VGEA 4J3VA 1S8DB 3MBED 4CVXB 1WCQA 4GG8B 5E9DD 4DQOL 1S9WB 3HRZB 5HHVH 3P2TA 4QF1B 3ZKMD 4OZGA 2L7UA 3IFPA 4AIOA 1A7QL 5F7DB 2UYLB 4PJXB 5GJSH 2HTLC 5D1QA 5DQDH 3T0EB 5J1AB 1H8SA 3L6FA 1QOKA 1WTGT 4PRID 1FDLH 3BIKB 4X6CE 4Y16A 1SEQH 1BMGA 3C6LB 3O6FC 3MLVL 1UCTA 3TN0B 5AEAA 5ICZB 1A6TA 4U7MA 1D9KC 3H6JA 2VWEC 1OM3L 2V9TA 1CF8H 4YXLH 3PHOA 3RIAK 3V6OE 3W2DH 5IEHA 1CL7L 4LCUB 1W0WB 5FKPA 2FR4B 3I85A 3BDXA 4XPFH 1WISA 3GHBL 1OP3K 3WEXA 4HBCH 4MXWH 4EBQL 1I1FB 4YHNA 4TNVF 2WIMA 5KSUB 3HE7B 4LVNB 2D3VA 3DGCR 5DUMH 1GOFA 4U31A 4HF5L 4NFCA 1YEFH 2DL9A 4PJBF 5FA3B 4MVBC 5DEGA 5J11B 1YYLL 3UPRA 4C4KO 3SKOA 3B5TA 1BX2A 3O6KH 4FXGB 5F7EH 1MWAB 4MB5A 2HLAB 2AKRA 3CIQA 4GQPH 4PG2C 4XNQB 3C2AH 1CBVH 5DYOB 3L3KB 4UTAL 4QHMA 5EU6A 3OGOE 1RZ7H 3WSQL 2R1WB 1N6QL 5IT2H 3S35L 1AR2A 4PGCB 2IH1A 5GGQL 3LKOB 5BRZA 1AD9B 2VDRH 1I3GL 1X44A 1V3KA 4F57H 2A38A 2NY3B 1CE6A 1W8OA 4KQ3L 2P4AB 1URLA 5HD8D 4GKSA 1G7HA 3ULSB 12E8H 3MREA 1CD9B 4I9WE 4DVBA 4L3ED 3PQYE 5DSCB 5HYFA 3HAEA 1UB5B 1WQVT 3UTSB 1YEJL 3VWJC 3WD5H 1KIPA 3IDMB 4QNPF 3ABZA 1QSED 4KVCH 4XCNB 4HZAA 2HLFC 5DGQA 2X89D 5F9WB 5FYJE 2CDGA 3MGAA 3B8YA 2QQLH 3P4MB 1T1YB 3GRWA 5GRUH 4XBEL 2J8UB 3LHPH 5HHXL 5CZVL 5JXEA 2UWEA 3TO4A 4NFDA 5C0AB 2R0LL 4WHCA 5FM5O 5T1LD 1X7QB 5JW4R 2YEZA 3G9AB 1MCCA 2WQ8A 1J0IA 1ZK9A 2HTKD 3IU3A 4XHJD 5I74B 1UKTA 1F4YL 5FO8A 1S9VA 5EDXA 3QULA 2A1WH 5DVOA 1OLLA 1KJVB 4U1JA 1OP5K 1AO7B 5GS0D 5ERWA 1PYWA 2YPLE 1NJ9A 5ALCL 2AJ3A 5DEZA 3PXHA 1Y18B 2VITA 1FNAA 3HB3C 4LHUB 5M95B 2XICA 5K9KA 5HYSB 3O2VH 3CLFL 5D7KD 1F90L 2CIKB 3ZYIA 4X4XB 3BPNC 4HS3B 2ICCA 4GKNB 3OKLA 4Q2ZB 4HH9B 2DM4A 4HJGA 3UC0H 2PCPA 2X4PB 4U33A 4NC2B 2ICEB 1EFXD 3ZTJH 5CEZH 2ARJB 3GBML 4JRYA 4M1GL 3LEVL 1X4XA 1BQUA 1WICA 1I7ZA 2B20A 2NCMA 3CNKA 5DD0H 4KHXH 3C2SA 5C2BL 2PYEE 4DEPB 1FNGB 1AKJA 4ZOBA 4I18C 5BOPA 3JUZA 4L4TE 5L8KB 2RCSH 5FUZH 3NABH 4KUZH 5H35B 5FGBC 1IAIL 4ERSH 4KZDL 1UM5L 1P84J 3STBA 4F7TB 1J0YA 1UXSB 3VFNA 3RVWD 1YQVH 4R0LA 5DJ0B 1T3FA 1CU4L 4NKMA 3IF1B 1XFPA 5EWIL 4OBSA 4AL8L 5J12B 3ARFC 2HMID 3GMRA 5DWUL 1OHQA 1NGWB 2VZ3A 4W68A 5BJTB 3U36A 5J56B 3T0WA 1SJEA 5FCSH 3OHXB 4ODTL 4ETQA 1FCGA 1JNNL 1IC4H 2YUWA 2ILLA 2JELH 3BPLC 5JW5B 3QUYA 4I5BA 2HFTA 4CVXA 4GG8A 1YEGL 1MCIA 3TYGH 1KT2A 4HX1A 4BK4A 3IDJB 2CRZA 3VGAC 5TDPA 3MLPA 2BVPA 2CJUL 3MV9B 1V3MA 1AQDB 1F4AA 2V5RA 4LLYA 1A4KB 1MRCL 1YEEL 3WNMA 2EDEA 4IJ3C 5CCKL 3S35X 1U8LA 4OCNC 1MRDH 2AEIT 8FABB 3B83A 3G9VA 3O2WL 1RIUL 4YBQC 2GHWB 3BKYL 4K7PY 5D1XB 1WLHA 1CDHA 4X7EC 2B1AH 1QRNE 4HZLB 4AMKH 4TRPH 5J13C 3PWUA 2HT2D 3RL2B 1ZT7B 3MJ8A 4RDQG 4WWKB 1KB5A 4JZNA 1T1ZB 3QDJA 4ODUB 5J4MA 1PD6A 3KPNA 1CN4A 1CZ8H 3VXOB 4FXLA 4LEOB 1RULL 4ZFOL 2NY4D 1J05B 1J5OL 4ZODA 4B41A 2ZCLL 5MP6L 2QADB 4MNQE 5HDLA 3EO0A 2VAJA 5JQ6L 3PP3H 1T5XA 1A5FH 4X99B 5F89B 3T2OA 5D9SA 4RWHA 1NFIB 1NAML 2V5SA 1M4KA 4CNIB 4PJ7B 4OKVA 3QNZA 5I66A 4WFEE 4GMSL 1AGFA 1JFQL 2OBGA 4P5MA 3OKDA 3VXSB 1Y6KR 5BS0B 4APQC 1YMHB 1MWAA 1CXEA 4XP9L 4NUJB 4QRSB 1G0DA 2OM5A 3UTZA 1QYGH 1RUPL 5IJKC 3MLRL 4PJAE 4LVEA 3LEYH 1IEAA 2D7PA 4KXZH 1DUYB 4FABH 3OKNB 3PWPD 3GJEB 2FATL 4GKOA 4X9FA 3SGEH 4X6BA 4EDWL 1S3KH 3GM8A 4YDJA 2A0LC 1KPVA 1LK2B 3U4AA 2QL1A 2E9BA 5C0JA 3TO2B 4DKFL 2XWTB 5F1KC 1JPFA 4GQ9L 4H0IA 2NY2B 4NN6C 1B90A 5GXBB 1J87A 3B9EA 2X4QB 1MUJA 5CJ8A 2P5WE 3P4MA 4UAOC 4PJEF 2CH8A 1T1YA 5I1KH 3MRGB 4LCCC 2J8UA 1KPRA 3QPXH 4JFEB 2IC2A 4LU5H 2FJHA 3OXRA 3MRNB 4HEPG 1WK0A 2BC4B 1FL5A 4MD4B 4F58H 2DI8A 1JGEB 2BOBB 3SPVA 4Y1AD 4HSQA 2GCYA 4MD0B 3BJLA 4K2UH 3O3EA 4K23H 5BW7C 4KHTH 4MAYB 4PJIA 5D1ZA 4WI5A 1F13A 3O9WC 3KAAA 3QIBC 4NT6A 3VI3F 2H41A 4EN3B 2C3VB 1IGJB 4O51A 3RWEB 3WL9B 1RIVH 2XQYK 4LDOB 4EI5D 1O7SA 4LHUA 2WWMC 5HYSA 1ZA6A 2UUDH 3HE6D 4GXVH 4BKLB 4JM2A 4CUCA 3T77A 4X4XA 4GAGL 4HS3A 2DQIH 1YDPA 4GKNA 2X7LB 2GFBA 3BDBA 4MMZC 4O2CB 4Q2ZA 4LASL 3I02A 3F7YA 2B4CC 3BDYL 2D31A 4QKXB 2ICEA 3U7AA 5E08L 4Y0GA 1T03L 3N1GC 2XWBB 1EBAA 5I0DA 1R3HB 3ZSTA 3U4EA 1M71A 5ESAA 1FNGA 3O6LL 5EA0H 4JY6B 3CC5B 3EOBA 2H32B 5D7IE 5EB9A 4ELMB 3U79A 1HHKB 2J5LB 1RURH 2IADA 3RIFK 2IFFH 4NNXA 5HHVL 3SCMC 2BMKA 1E27A 5IG7A 1IAKB 2B5IC 3PL6A 1AIFA 1F2QA 1SMAA 3RZWA 4DKEH 5KSAA 4K8RH 1DBBH 5GJSL 1QR1A 1INEH 5DQDL 4KJQD 2XFXB 4WUUD 1NGWA 3DROA 1NFDF 3IKKA 5I1AB 2P44B 2XTJC 3BRFA 1FYTA 4NKOB 3S88H 4OIBA 5FA4B 1SEQL 1IGCH 4JO3H 4QRTB 4LKXA 5E00B 3T04D 3VMOA 2KQMA 1A64A 4JVPA 4LP5A 3WXVH 2XA8H 5JDJA 1CF8L 1B2WH 4YXLL 3W2DL 1HQRB 1QRKA 5HPMB 4OV5B 3D9AH 1QLFA 4U1KB 1RAMA 4GUPA 5EFIB 4XPFL 3QUKB 5K59E 2FRGP 3MV9A 3MTRA 1AQDA 4PV9B 2H2PD 1JWUA 3SE4C 3A6OA 3TA3D 1ERNA 1VA9A 2FECI 3BSZH 1OB1B 4P2OC 2P49B 1GC1H 4UILH 5DUML 4F7EA 4RX4D 2C3WA 5D1XA 1YEFL 4OZIE 3MJ7B 4N8PA 3CK0H 2VERN 4GAJH 4ZTOH 5EBLA 3RL2A 3MLXH 1ZT7A 3O6KL 5I1GH 5F7EL 3U6RA 4WWKA 2WSKA 1IC7H 4J8RA 4CW1B 3JBG7 2FJGB 2VN4A 4HDIA 3C2AL 1CBVL 2VLKA 3VXOA 4LEOA 4JN1H 5D8JH 2V5MA 1RZ7L 4LCIH 2AK4D 4MD5B 3AREC 1JNJA 5GJTH 3BZFB 5IT2L 1Y0LA 4LCWA 5ICXB 3UROR 5T3XH 4JM4H 2MJWA 2VDRL 4WFFE 4V1DD 2HTLD 1WC7B 4F57L 5F89A 3IJSA 1H15A 3MRDB 2HVJA 3EOTH 5FUCE 3HC0A 1V7MH 12E8L 2DD8H 3Q5TA 4NDMA 4JVUA 3WD5L 2ICWB 1R3IH 1AP2B 4KVCL 3UYPA 1EEYB 1BD2B 3O6FD 3K8LA 5BS0A 4M3KB 1YMHA 5EBMA 4NUJA 4YDLB 2CQVA 4NNYB 1D9KD 2QQLL 1ZLSH 3ZKNC 1TDQA 3NCEB 3IXAB 1EO5A 4NO5A 4JR9H 3GDBA 5GRUL 1FG2A 3HI1B 3LHPL 5H2BB 3INUH 5C70A 4RGNE 3SDXE 4YHPA 2NNAB 3WKNA 1FFNB 3KVQA 1YN7B 4RWYH 3DV4A 4YK4B 1NC4B 5DD1H 3LDBC 2NW3A 2Q7YA 3TO2A 4MVBD 3GHEH 4UV4H 3SY0A 3KHOA 5DI8A 3LQAC 3O3BA 1U8PB 3ARGC 1T4KA 2A1WL 3D18B 1UEMA 4PJ8A 1D5ZB 2XIDA 3LOWA 4Q9QH 3F62A 4KK5D 5TDNB 2X4QA 3R06A 3O2VL 4MDIB 3MRGA 3UJIH 2CLZB 3V52H 4JFEA 5EU7E 1DVFC 3UC0L 1IT9H 3ARXA 4MD4A 1JGEA 2BOBA 5CEZL 3C5ZA 3R0MA 3ARYA 5BV7H 4ZQKA 1EXUB 2DBLH 3IFLH 4B5EA 5DD0L 4KHXL 3VWJD 3HZMA 1A1OB 2HLFD 5J89A 1WEJH 1MFNA 5HXMA 5F3BB 5EU4A 2N7BA 2RCSL 2UVFA 5FUZL 3NABL 1P6FA 2BVQA 4KUZL 4Z7UE 2D2OA 2JJSC 5DC4B 4HKBA 4ERSL 5JMOC 5KVGH 1XGPB 5DS8B 5IVXB 3N1PC 2Q8BH 3MLSH 3W0WE 4ODBD 4YGVA 3B9KC 1YQVL 4YHZH 1NGXA 3MR9A 2BVYA 1DN0B 1BECA 2ZUXA 3ZYJA 2PTVA 2JIXB 5SWZA 1BZ7B 4NRXB 3S5LB 4W4NA 3VGDA 5HSFA 4KUCD 2DN7A 1QSZA 1MFCH 4D9LH 1R3HA 1R0AH 3PV7A 4FFWD 3CFIC 1ZA3B 3QI9B 3NFPB 4Z7VE 1IC4L 1RIHH 4ZSOE 3MCLH 2IF7A 1A4JB 5FDYA 2JELL 4LPYA 4ELMA 1JZ3A 3HB3D 5IQ9B 2BXZA 4FTVA 3VFSB 3TYGL 4DCQB 3DNKA 4UI2A 3KYNB 3G6JE 4ORGA 3S37H 1LEKB 4OFIA 3UYRH 1HEZB 5IMMB 1MRDL 1ORQB 2FJFA 3QDGD 3VFOB 4GAYA 3IS0X 2NYYC 3H7LA 3K4AA 4Y4FB 1HHIB 4WFHD 3Q0HA 4OF0A 3UPAA 2HN7B 4NRZA 1ZHNA 4U6VH 4AMKL 5C9JB 1X5YA 4TRPL 3VRLE 3X3GH 3FT3A 2Z8SA 4LNRB 4R3SB 1UEYA 4C56A 3HR5A 1MCSA 5I1EH 1F97A 1CZ8L 2X4OA 1HQRA 1S7SB 1CE1H 4FMKA 3KXFE 4L9LA 1P4IH 3ZE1E 5GZOC 5I1JH 1Z9SA 4RNRB 3AS1A 5HHQA 3ARFD 5HHOB 1A5FL 1PG7L 3MQIA 3GMLB 3MPCA 3O45B 2EXYC 2PF6A 1I8LA 1KIQB 3VXRE 3BPOB 3QZWB 1U58A 1X5IA 4U1LA 3HUJE 3PHQA 5CMAB 5C8JA 1JZ7A 4PJCB 2LAAA 1TCRA 4PRPD 1DE4B 4N9OB 2I07B 3MRKB 1QYGL 4UUJA 3MRQA 2DBJA 5EU3B 5DQ9A 1G6RH 3NFNB 3LEYL 2OZ4H 5EIVA 5JOEA 4FABL 4MHHG 2X10A 1CK0H 4XBGB 4GLRH 2V2WB 2DTSA 2J7LA 3UEZA 5HYJA 1CVSC 3DLQR 3DUUB 3RL1B 4DZBB 1HE7A 1S3KL 1WC7A 2B8OT 2J6EH 3OV6A 2X9XA 4YBQD 3WHXA 5JOFB 3MV7D 2F53D 4AJ0A 1YMMD 2A6JB 3ZKQD 2YPKA 1B0RA 4Q58C 1YNLH 1ZS8B 3JTSA 1LEIB 4KK8C 2QR0B 4A2LA 1JWMA 3NH7H 4UQ3A 2QKIA 3TJEH 5C0DB 3C60C 2KZ1B 4OBRA 1H8OA 1Q9OB 1NANH 4X8JB 2NX5A 4JRXA 5BQ7A 3OKOB 5I1KL 4LIQH 1JTTA 4MNGA 2KQNA 3DV6B 4N0UE 3FQNA 4LU5L 5HGDA 3VXPB 5J57B 1EA9C 1JGVH 3C5SA 1TXKA 3D3VB 3FN3A 2VKXA 2QSTA 5C09D 5DVMA 1FFNA 4F58L 2VLLA 2CDEB 4PJ5E 2F54B 4K2UL 3DHJA 4K23L 4RCAA 2BNQB 4KHTL 4LCYB 4OF5A 4WTWA 1OSZA 1A7PH 2I24N 2Y5TB 1A14H 2DYPA 2IFGA 4MJ6A 1IM3A 1NMAH 4APQD 3SQOH 2GJ6E 2NXYC 1RIVL 1D5ZA 4RBPH 1J18A 4P57B 4WEBH 3CXDH 4OLVH 4GXVL 5LCVH 4JPIA 4JFXB 5TQ2H 2CLZA 3BRDA 2M2DA 2DQIL 3HPJB 3FFCE 3NA4A 3PQYD 1T0MB 1FZOB 1T22A 4PY7B 2A0LD 4EQ2A 3SKMB 2X4RB 4ZXBC 1FNLA 1R3KB 3QRGH 1ZMYA 3RX8A 3WS6A 1FQ9C 2NY7L 4XCEA 3PWNB 4I4WA 1Q9WB 4JVWA 5EA0L 1BFOA 3WHE0 2ED7A 5FXCH 1A6ZA 4U05A 1YPZB 3HAEH 5F3BA 3NIGE 3RVUC 1XGQA 3IDYB 4IDLA 4PRBA 3IJHB 1RUQH 1RURL 1ZVSB 2UY7A 5JHLH 5DS8A 4J7RA 2IFFL 4E42B 4OFYA 3PV6B 3MRJB 5JHDD 4PD4K 3WLBB 5CJXA 1DDHB 3GJFA 4QRPD 5EH1A 4DKEL 3MLUH 1C08B 5FV1L 4K8RL 1DBBL 3VH8B 3GRWH 1M1SA 1RI8A 1CDCA 4LSVH 1BZ7A 3ARUA 3CLEH 3RWIB 1INEL 4I0CC 2X4TA 3QQ3A 3GO1H 5I9QC 1PG7X 5CIPB 3T0VA 1JGDA 1I1YA 4MZ3A 4RFNB 2G75A 4G9DA 1FFOB 1BFVH 3QI9A 1DEEA 3O9WD 3QIBD 3S88L 4JO3L 1IGCL 4ZUVB 4P2QE 4X5LA 5JPMB 2YZ8A 5T1DH 3V4PH 5DJDB 1AFVH 1G7QA 1LE5B 3WXVL 2XA8L 2CXKA 4PGEB 3A6BH 2WWMD 4OZGF 5IQ9A 1B2WL 1J8HA 2ENSA 4YHKH 3RWDB 3D9AL 1M6OA 5ISZD 3U9UA 2WLYA 2CKBB 4ZYKB 3V6OA 1U3JA 3UTTB 2J8OA 1LEKA 4KKNA 4RMTA 5D7LE 1ZWIB 4HT1H 5DK0A 5I75B 4YWGH 5IMMA 2CK0H 1I1AC 1MJ7H 4CN4A 1S7QB 4JFFE 1BQHB 4P3DB 2Y1VA 3BSZL 2ADGA 2V5YA 1HWGB 1GC1L 3CXHJ 4UILL 5FB8A 4R9HA 2ENYA 2HN7A 2V2XA 3L3GB 3TESA 2EEAA 1HH6A 1LNUB 3CK0L 4HUXB 1ES0B 4GAJL 4W70A 3SKJH 4ZTOL 3MLXL 1S9XA 4L3AA 3VD7A 5I1GL 3K3QA 1OTSC 1IC7L 3L3DA 1RJZB 3ALPA 4P5TC 5C08A 3MA9L 5DZLA 4PRDB 5F21B 5ITBH 2CR3A 4H0GA 3F7RA 3ULUC 4JN1L 5D8JL 4YE4H 1FV1A 3SCMD 2NXZB 5E9DB 3D6GA 4Z95H 4LCIL 4MJ2A 4D94A 3RJQB 1T20B 4LF3B 5GJTL 1WFOA 1MFBH 3GMNB 5T3XL 3RWFB 4JM4L 2P5ED 1X5ZA 4PJBE 3VXNA 1UENA 3CFEB 3O45A 1O0VA 3EOTL 3MZGB 2A6KB 3E6HB 1PDKA 1KIQA 1V7ML 1WGOA 4N5UA 3UTPE 2DD8L 2XTJD 3QZWA 4HW6A 1R3IL 1RJCA 4PJCA 4ZNEA 4LVOC 3PP3K 4PRIB 1RK0B 1T66D 4HC1A 2I07A 3UBXI 3MLYH 3MBXH 3WXWH 1NH6A 1A6UL 5EU3A 1JE6A 4XWGH 1ZLSL 2ZOKB 1G0YR 2EYTB 2Z0BA 4P59H 4Y2DC 3A0OA 5EOQH 2WP3T 1OT2A 3INUL 4XBGA 1U3YA 3K1KC 2VLRA 2OTPA 4JQXA 1U3ZA 2ED8A 2DM7A 1IGTB 1AGCA 4UT6H 4DZBA 4E41B 3J8F7 1FJ1B 5I1DB 4ZAKA 4G6JH 1RHFA 2BY1A 4QNPE 2HG5B 4P2OD 3EYOB 3KYKH 4RWYL 2DQFB 1YC8A 3V2AR 3BE1H 5DD1L 2AV1A 3BWAB 5J1TC 2A6JA 3F6LA 3DX7B 4YPGA 3NPSC 4UV4L 3GHEL 2R1YB 4FNLH 4K3DH 4AIXA 1B6DA 4RZCA 3LRSB 1RFDH 2R39A 2OYPA 1L4IA 2N4IA 2X9WA 4LLWA 5D4QA 1YJDC 5DRWA 3DECA 3BXNB 4Q9QL 2UWEF 2XT1B 5FOBA 3RUGA 4L4VE 1NGZB 3ZE0F 1KB5H 4IRZH 3ARED 3UJIL 4DJMA 5DJ2B 2QSQA 5A2JH 3V52L 4F7PB 5D2NE 1Z5LB 3OR7A 4WRLA 5F88B 2AJYH 5SWQA 5A43C 5KANI 4NQED 3MCG1 1IT9L 2EECA 3VG9C 5GS1B 1U41A 5BV7L 3BIBX 2D7TH 2F54A 1NMBH 2DBLL 1U3HA 2P43B 3IFLL 1HSAB 2VH5H 4LCYA 4NWUH 1QSFD 5E95B 2I5YH 5BOZG 2P8PB 3HNVH 3DRQA 2DQJH 1WEJL 5I8EB 5BXFA 1K3IA 1QSEB 1G7PA 1EZVY 4NOBA 5IV2A 5F3HA 3GUTB 1UCBH 3ZKND 2YD1A 3EYFB 5F97E 4L4TA 2YRPA 5KVGL 1JUFB 1MWAH 4BSWB 4NKQB 2Q8BL 1N59B 3MLSL 1HSBA 3MNWA 1QFWI 2A6IB 5DK2B 1CD8A 2QHRH 2N56A 2Y7QB 1GVIA 3HPJA 4YHZL 2VLJA 5TFSH 3U1SH 4O02H 5IB4A 4AQOA 1R5WB 1MI5A 1I3RA 1W0VA 2UUDK 5T1LB 3I6LE 2X4RA 4MA8H 3ME0A 3BZEB 1R3KA 4FQ2H 1MFCL 4D9LL 4UIKH 1R0AL 2OI9C 5CWSB 5SX4I 4JHWH 2W91A 3PIQB 3ARGD 3LPGA 4P23A 3DXAA 5LKNA 1RIHL 1VHPA 1XR9A 3MCLL 4TTGA 4NQDA 3DTXB 2X1PA 3IDIA 2RBLA 3X12A 1X4ZA 3H9YA 3KS0J 3TT1L 4PJ9A 1VEPA 3PNWA 3WLBA 1FYHB 4R4NC 3S37L 3SDCA 4XCFH 4U0RC 5T5NF 3DMMB 1CGWA 3RHWF 3UYRL 1DVFD 3DYMA 1X5HA 4OZ4B 4GSDH 1ETZB 1C8PA 2EH8H 3Q48A 1EFXB 5E4EB 5KN5A 1T83C 4U6VL 1FFOA 4OCYH 1U8IA 2C4XA 2C26A 3JWDH 5DHYA 1Z2KA 3IDGB 4MHHI 3X3GL 3RNKB 5JPMA 1HCFX 2VAAA 4JFPA 2OR9H 4MDJB 4WVRA 3TBSB 4KDTA 2FX9H 2LU4A 1ONQB 3WIFB 1DL7H 5I1EL 1CE1L 3FQXB 4GW5A 5IFJB 4BH8B 1DQQB 3TNNB 3TZVB 4ZYKA 1P4IL 1QHPA 2NY1B 3MCKB 4ONOA 3QQ4B 5I1JL 5C0IB 3ECBA 4ZTPH 4GS7C 4MNQA 1NC2D 4NC1E 3TYFA 3IKCB 5F9JB 3HHRB 5LXGH 3L3HB 4MSWA 5HDBF 4JY5H 4S2SA 3QEUB 4YC2B 4TTDC 2R4SH 1GIGH 1LNUA 4G80A 5DDHA 1ES0A 1HYRC 2Y6SC 1F3RB 3SJVE 3BYYA 1JHTB 2DLFH 3G5ZA 3IFOB 4MB4A 1ZGLM 1R24B 1CVRA 2AS5M 1RJZA 4JJHA 4BA8A 3DX9A 1G6RL 1C16A 1DQDH 4OGZA 2OZ4L 3MBEA 1P5VA 3WN5C 3PABB 5E9DA 4PJAA 1CK0L 5C0CD 4QT5B 1EX0A 1U8HB 4Y5YB 3C8DA 4WI6A 4UZGA 4PJDB 2NYYD 1S7UA 3CX5J 2J6EL 3MRCA 4NO3B 4YXKH 4F9LC 5TF1H 1FGVH 1UH4A 2B1HH 5DJ6A 2GSGB 5A16A 2V9QA 1RD6A 2P8LB 3KPSE 5C07E 3SKNA 4PRIA 1A7NH 5CEZE 5I6XB 1RK0A 4MMXC 1AGEA 5IWLC 3NH7L 1RHHA 4WU5A 3TJEL 4WHDA 2ZG3A 3QWOA 3T0EC 3SE3A 5JW4N 3MGOB 4LIQL 2NY4B 3S4SG 5GZOD 1L0QA 1FZMB 1CFNA 1JGVL 5I1DA 3PE9A 4Q6YA 1PKQA 5INDB 3O4LD 3C6LC 3TN0C 2DMBA 2EXYD 3BUTA 3TIEA 2YD8A 1TTGA 5CZXC 1F6AB 1FVDA 4LGPB 3ZYZA 5FDWA 5CSZA 3LQMA 2BCKA 3DX7A 3NBNA 1A7PL 3IAQA 5L2KB 1A14L 3CMOH 4M00A 5D2LB 1NMAL 3SQOL 4PJEE 2ESVD 2VQ1A 4NBYB 3ZE2F 1U8KB 1S7TA 2J8UF 2X1XR 3MXVH 2MHAA 1DQLH 1KB9K 3OZ9H 1MJUH 4WEBL 3CXDL 1GOHA 3VDBA 3FO1B 4OLVL 5LCVL 2Z8WC 2EYSB 1T89A 5TQ2L 3PP4H 3I3DA 1UXWB 4LSRH 3PWPB 2VZTA 3QXDB 3S37X 2G2RA 2X4SA 4JGMA 2OTWB 5J11C 4PRHD 2W9DH 1EERB 5DRXA 1SVZA 4P2RD 4PJIF 1BFTA 3VI3E 3NTCH 3QRGL 4XCYA 4GW1B 4YR6B 1SHMA 3HCVA 3CSYB 4Y4KD 4L3EA 4KK8D 1DQML 3UCRA 4MXVE 1VKXB 2E6JA 2LFGA 2N1KA 3GFUA 4JM2F 3GUTA 3C60D 3LKRA 2OR7A 2P24A 1RUQL 3EAKA 1MHCB 1N2RB 3F65A 5D7IA 2NY3C 3F5WA 2A6IA 4RRPA 4BZ1H 5HBBA 1FZKA 4RGOH 2Y7QA 1A9BA 5HYQB 3MLUL 2WZPD 3MA7B 4HWEH 3MRRB 5MENB 3GRWL 4LSVL 4J1UA 5D5MB 3CLEL 3M8OH 3GO1L 3HN3A 3NIFF 4QXTA 1ZT1B 4Y1AB 4XZUB 1C5CH 3QDMB 1J0JA 4C59B 1BFVL 3PIQA 5I2IA 3GMQB 2BFVL 4M93B 4O2EB 4AH2A 1IGYA 4QYOA 2NXYD 5T1DL 3QNYB 1XH3B 3V4PL 1AFVL 1J0HA 3N50A 4Z7WA 3A6BL 4MGXA 1M7XA 4YHKL 4MNHB 5EC1B 1FLTX 1B0GA 3EDEA 3HE6B 4J4PC 4HT1L 1NFDE 4YWGL 2CK0L 1MJ7L 1AC6A 2WLZA 4ZXBD 3HI5H 5CP3A 4HBQA 3TV3H 1A9EA 2I60H 3MYZA 1CXIA 3MRHB 1I7UB 2M8XA 5I8CA 4Z7NF 5CJ5A 3UO1H 3SO3B 3LSOA 3SKJL 3EFDH 1Q9KA 4DUWA 3RVUD 2X44D 4MDJA 2IMNA 4GG6A 5ITBL 2Z93A 3E2HB 3RWJB 4BQ9A 4WY7H 4YE4L 5IFJA 1EEZB 3OTTA 4TVPD 4Z95L 5JIHA 1DQQA 1KLUB 5C6PB 1ZE3C 3QQ4A 1MFBL 5C0IA 4DEPC 5C6TH 3ELAT 4L1HA 3CSGA 5EIIB 3L3HA 3MZTA 4FQIH 1VFUA 4MXQC 4PBWD 1SYVB 1HNFA 3MV8B 5DJZB 1G1CA 4PGDB 1ZHKA 4LDEB 3TBYA 3D39D 1FO0L 5EO0B 5ADPL 3W9EB 1FAKT 5J9PA 3ETBF 1EHNA 1R24A 3MLYL 3MBXL 3WXWL 1CTOA 2R2CA 3SE8H 5JNYA 4XWGL 3KDMB 3L7FB 5J12C 4OLZH 3H3BC 1W72B 1X9QA 3G5XB 4P59L 5JPNA 1ZGLA 4HKXA 4P46C 5EOQL 3KLAB 3Q2CA 1XF4B 4IS6A 1I1AD 4ONGH 3RTQC 4UT6L 3H7BA 3RQ3A 2VDKH 3QFJB 4G6JL 2FD6H 4HUVB 3KYKL 3BE1L 5DT1H 4BZ2H 3J7HA 2FX7H 3C8KA 4PGZA 2BK8A 4PREA 4V2BA 4DFIA 1I4FB 4S11A 4FNLL 4K3DL 3CUPB 1YEDA 2JF1A 5GPRA 1RFDL 1OTSD 3AXLB 2EYRB 3CFBA 3LQZB 2WIIA 2XN9E 1OGAD 3GGWB 4P5TD 4JG0H 1KUMA 4U1HA 2AJZB 3ULUD 1INQB 4XAKD 3STZB 1KB5L 4IRZL 5TH2B 4OQ1A 4PG9B 3FCTB 2M26A 4YDVA 1YN6B 2YC1B 1KXTB 3WIHH 5L0QB 2AK4B 5CGMA 2AJYL 5C0BE 3RVTC 1FP5A 1CL7I 5CP7A 1WCBA 4V1DB 2QTEA 2XYCA 1NMBL 2VABA 4NIKB 4QRRD 4Y19E 2VH5L 1AJ7H 2LTQC 4NWUL 2I5YL 4XNYH 3V6FB 3HNVL 4P3CH 3P9WB 1RJLB 3ES6A 5FYLH 2DQJL 5T1KB 1P7HL 3K2MC 1K2DB 2QADC 1TPXC 1UCBL 4I13B 1HIMH 3OAZH 3SGKC 5F70A 5FYJU 1U8QA 2DM3A 2OL3B 1MWAL 2PW2B 2ZSVB 3BESR 2IAMC 2M1KA 3MYJB 4Y2DD 4U3HA 2QHRL 1RU9H 5D7JB 1F4HA 4ZPVB 5J1SC 3PWPA 2OTWA 5KVDH 4FFYH 4RBPK 5TFSL 3U1SL 4O02L 1JN6A 2ID5A 4FS0A 3DPBA 1HHHA 1RVFH 3B6SB 3AUVA 3ZL4H 4J12A 4MA8L 2DI7A 4FQ2L 4FHBD 5CGTA 4YR6A 4AZ8A 3QWRD 5FECA 4UIKL 1UVQA 4LPVA 2GQHA 2HWZH 4YPJA 4MCZA 4ZFGH 1K5NB 1NFKA 5HYEA 4ZSOA 3MJGX 4FQHA 4K3JH 3VDCA 3RWCA 4LSPH 1SMOA 2WINB 4WNQB 1IM9D 5IMOB 1LE9A 3IDNA 4XCFL 3V7AG 5IVZA 4WI8A 5DTFB 3F7VA 3ROOA 3G6JA 3MA7A 4WGWB 3WFDH 5JLZA 4YFEA 4H8WH 1SJXA 1BJMA 4GSDL 2NY2C 3HFMH 4LVHC 2P8MA 2HRPH 4IRJA 2EH8L 3PHSA 4D8PB 3HG1B 5T3XE 4U0QB 1D6EB 1ORSB 4DFHA 1TTUA 4ELMF 5JMRA 4OCYL 3JWDL 1M7IB 3PWLB 1C12B 1ED3A 1EZVX 3UTQB 2XXCB 2OR9L 2FX9L 1DL7L 3VXMB 3KR3H 3E6FA 4EI5A 3H3PH 1R3LB 4KMQA 4HIJB 4NCC1 2YWZA 3K0WA 1V3JA 4L8DA 4MAYC 3RGVA 3MXWL 5EUOA 3S34H 5H37H 5DFVC 5K9JH 5FYKD 3Q6GH 4ZTPL 4RMVA 1H0DB 3F6IA 4JQVC 4XVJH 4PLKC 4EN3C 3QEQD 4PJFB 1AQKH 5LXGL 2VB5A 4U6HB 1A1NA 3MRIA 5H94B 4JY5L 3OXSA 2VUYA 3HPLA 3QEGH 1KPUA 5DUPH 2HFFA 2GEEA 2R4SL 1GIGL 1S9YB 4LSDA 4D9RE 1HDMA 1B9ZA 1HZHH 3P77A 4OZFA 5GGRA 2JCCB 2DLFL 1AGBA 2A74A 4AQ1B 2Q3AA 2H3NB 1TFHA 2XWJA 2BP3A 1UH3A 4M4RA 1DQDL 1NBZA 3TVMC 1KCSH 4R4ND 4LDLB 3QIUB 2GITB 1ZOXA 3VA2C 3MRFB 5E2WH 3B8SA 1IAII 2BRRH 4TSCH 1IL1A 2ARJQ 3VFWB 3GJFH 2PO6D 4YXKL 5TF1L 1FGVL 2J5LC 5JO5A 5FFLA 2B1HL 4WUUA 2YD7A 4MQXD 5EO0A 4JZJC 1KGCD 1A7NL 2IEPA 5FK9B 2Q86B 1BOYA 2HJLB 2EC9U 3CMGA 3QP3A 4I18B 1VB9A 3L3JA 1KJ2A 3OAUH 5DMKB 1P5UA 1U8JA 3GSOB 3KDMA 5HHME 1XF5B 5I16A 3K2UH 3RHWK 4CMHB 2AQ3A 4QEGA 3G5XA 1KN4H 4ZFFA 3RVVD 3HZYB 4LHQB 2BY2A 2Q6WA 1QKZH 5EG6C 3B2UC 5JOPE 3BO8B 4FQCH 4NZDA 1JZ8A 3NFSH 4QWWC 3TA3A 3KPPB 3ARFB 4LNVA 5IVOA 3X14B 4TTDD 1QQDB 1KEMH 5HY9A 3CMOL 4H1LB 2Y6SD 2EYRA 2YD6A 3GGWA 4LKCA 3VFTA 4N9GA 1WFTA 5CD3A 2MFNA 3BPLB 4PRPB 3U2SB 3MXVL 1T1WA 2ZOLA 1DQLL 1PGRB 3BH8B 3OZ9L 1MJUL 4BQCA 4J3XA 5TH2A 4WU7B 1P4BH 2R2EB 4LSRL 1BF2A 5DJYB 5ENWA 1GL4B 2GTZB 4DW2H 1JNLH 2W9DL 2EDDA 1UJ3B 4GBXB 2IBZY 2OQJB 4HG4K 3FFCA 2FZ3A 1MH5A 4U3CA 1RZGB 4L8SA 4X6CB 4ZUUA 2X1QA 3NTCL 4PYHA 1CGUA 1FIEA 1BLNA 5F7FA 3MV7B 2VJXA 3V6FA 3DUSB 2APBA 3OKKB 1LGVA 3BZDA 3DURA 5CEXA 5KS9A 3DX8A 4Z5RA 3O6FA 3QUMB 2P7TB 4YBLC 2IAND 5HHPA 5DQJB 4KVNH 1YEIL 3K81A 4M8QB 4XT1C 1D9KA 2GY5A 1TVBA 2ZSVA 3T0ED 4AT6A 4D0DA 3ULVH 4ONFH 3O4OB 2VZSA 4BZ1L 4RGOL 4W6WB 3CVHB 4P99A 4Q6IB 4X4ME 4LSUH 3GSXA 3O0RH 4HWEL 3VXTB 1XGTA 1S5IH 3C6LD 4AIZB 1CGXA 5K33A 1XZ0A 4HMCA 4EOWH 2J88H 1ZLWH 1T1XA 4YDLC 3M8OL 5C09B 1I75A 5CZXD 3AMKA 3LKPA 5GSRB 4P0DA 1EHLH 3MUHL 1LEGB 3RGHA 1C5CL 1KCKA 1WAAA 1F8TH 1L6ZA 1X5LA 1A2YA 3I6GB 3DVNA 2F15A 4WI7A 4NN7B 3RY6C 4APQB 4PRNB 5J6HB 4HLZH 1NSNL 1CFTB 4P2QA 2BSED 2Y06H 4G8GA 3L3OA 2HYMA 2VMFA 4YK4C 3QXUA 1LMKA 2MSPA 3P4NA 3BN3B 1T0NB 3GB7B 1WFNA 2ZP0T 1H9VA 2H9GB 3JWOC 3ZO0A 1JF5A 2BNUA 2FHCA 1KACB 3PQYB 4KH2A 4G42B 2VISA 3HI5L 1SYSA 3TV3L 4D8PA 4JFFA 2YRLA 4JPKH 2I60L 4LLMA 6FABH 1D6EA 3HZVA 2PYFB 4NQCE 1ZHLA 4PRAA 3T1FB 3VWJA 5DGRA 4OZGE 5CS7A 4YGAB 2Y4SA 4ZUWB 2XZZA 5GGVH 3UO1L 3EFDL 3FQTA 2EDRA 3E3QC 3L7EB 3T3PF 2ZNWA 4D9QE 4YO0B 4WY7L 5KZCD 2YZ1A 3TPUB 3V4UH 3LPFA 3SGDH 4UAOB 1F42A 1HI6B 1JPGB 5IK3B 3UTSD 2KBGA 3BIAX 5JHDB 3FQRB 3RP1A 5E7BA 5C6TL 3REWA 3A6CH 3MUGA 1J0KA 4S1SH 1WIOA 3GKZA 4LIQE 4FQIL 3FRUA 1SJHA 5HGBA 3MGTA 2HFEB 1LO5A 3X17A 4L8CA 3UBXB 1Q9LB 4JFYB 3HC4H 4PIRF 2YPLB 3P73B 2GT9A 3O9WB 4QHUA 5AG8A 3RDTB 3ALWA 2H3NA 1NEUA 3L1OH 2HAZA 3Q6FA 3W9DB 3SE8L 4AENB 4MYWB 1QEWA 3HLAB 1AGDB 1QA9A 4OLZL 3H3KA 1G0XA 4WFGD 1CD1A 2Y23A 4R26H 5FAAA 2QJDA 5ELIA 5ISZB 3LKSB 3GNMH 1IEHA 4J4PD 5CKGA 3CZJA 1JNHA 4ONHA 2Z9TA 4OSUH 4ONGL 2H8PB 2IPKA 4MCYB 4YNYB 3S9DB 1U6AH 1UQSB 3U30B 2FD6L 2FIRT 4WEMB 1AO7D 2R8SH 1AHWC 4PJCF 3QDGA 2DWEA 4NQTA 1XIWD 5DT1L 3ULVF 1NCDH 4BZ2L 2FX7L 4NO0D 1QVOB 3VD3A 3MLWH 2OK0H 2G5BB 1OQOA 5BRZE 4I18A 3GSUB 2BZDA 4JG0L 5GGVY 3U83A 3BMVA 5FGBA 3TJHC 4JO4H 5I17B 5IW6A 3F12B 4Y4FC 1NCTA 2GAZA 2A2QT 3P40A 3HZYA 1K4DA 2JJWA 4GMTL 4L4VA 5CZKA 3SCMB 3OJDA 3WIHL 4G9FE 4HWUA 4LSQH 3BAEL 1IAMA 5BZWA 1IGMH 2DWDA 3ARTA 2MPAH 1IJ9A 3B3IA 4X6DA 3ARFA 4MXQD 1AI1H 1PFCA 1AJ7L 4P9HH 4XNYL 4YFLF 3AU1B 4PTUA 1CFVH 2ZUYA 4P3CL 3OF6D 4JANB 5HYIA 5FYLL 2UWEE 4X80H 3FN9A 3RUGF 3VXUD 1HIML 2EDWA 3DYPA 4OCRH 3U2SA 1N5YH 1EEQA 3W82A 2O61A 1E4WH 1NBYB 4GRLB 4N0RA 4R7DB 3PGDA 1KTDB 3AB0B 4P46D 1RU9L 4G8FB 1BIHA 3DBXA 3BPOC 1U36A 3RTQD 1LD9B 5KVDL 4FFYL 3HS0A 4HS6A 3DI3B 1ZHBB 4J6RH 5E6YA 1RVFL 3ZL4L 1RZGA 1QRNB 2D4FA 3TNMA 4BSVB 2DIJA 2XG5A 1N6UA 1T80A 2F53A 1YMMA 2XRAH 2HWZL 3KJ4C 1WSST 4ZFGL 3PWVB 1XT5A 2YUZA 5EZJA 4HGKC 4XPGH 4K3JL 1ACZA 4LSPL 4GOSA 3EFFA 1IQDA 4OI9A 3CFDB 3B9AA 2RJMA 3RVTD 3LS4H 3WFDL 4H8WL 4LRIC 5FHAH 3HFML 2QSCH 4OZHE 4K9EC 2HRPL 1IEBA 4QLRA 1CFQB 3CSBA 4NO2B 4HH8A 1QSFB 3D25A 3GIVB 3QHFH 5GGUA 1OWWA 2OMNA 1UB6A 3L5HA 4PD4J 3B2VH 5J6HA 3BOVA 4O2FB 4WJ5A 2IAMD 3CSPA 3KR3L 4KY1H 4ODXB 3STLB 1A7BA 3H3PL 4D3CH 4E5XB 3EJZC 3S34L 5K9JL 2H9GA 5F93C 3Q6GL 2W9LA 2F5AH 3HZKA 4Z76B 2R69H 4IRSB 1I8KB 1AQKL 3O3AB 1U2HA 3O2DA 3IDUA 3GBNH 2VNCA 3QEGL 5DUPL 1RJYB 1ADQA 3DOSA 3NZ8A 2JB6B 2P1YA 1T21A 2AAVA 2ZCHH 4G6KH 3MO1B 1HZHL 2RFXB 2ITCA 1RY7B 3SBWC 2E8ZA 2P5WB 2UVEA 3FQWA 4EUPB 3P3YA 4Y16C 3AM8A 4PGBB 4U6YB 4F15C 1A6AA 1KCSL 3A67H 3C87A 3D85B 5JHDA 4LCCA 4HLJA 4Q9BA 5E2WL 1H3TA 4AEIH 4L9DA 4XBPB 4QRPA 4X0KA 1F3JA 2BRRL 4TSCL 4Z0XA 1NKOA 4F33A 5JA9A 2NY2D 3MRMA 5MEOB 1B6UA 2NZ9D 1DVFB 3QDJE 3V5DA 2DQTL 3SDAC 1XCQB 3FOMA 4RA3A 2DKUA 4FQLH 3QPQC 5KTEH 4PV8A 1Q8MA 4IOIB 1T04B 2DIBA 1TZGH 1CDGA 2VDQH 5DJ8B 1K4CA 4R4BB 5AD0B 1EHAA 1PQZA 3QIBA 5C07A 1JZ5A 5IFAH 1TQBC 4PJAF 3OAUL 3C08H 5IHZB 3VFMA 4KKCC 2FHFA 3PDDA 1J1PH 5IIEA 1KG0A 3I3EA 3K2UL 5DJXA 3LD8C 1KN4L 4MAYD 4OCXH 1A22B 4RFNC 5DFVD 5GS0H 1U8NB 2L7JA 1VFAA 2ZCKH 3KNBA 3MNVB 1LO4H 1QKZL 4FQCL 3QO0A 3VJ6A 3NFSL 4PLKD 3S98A 4EN3D 43CAB 1T7VA 4Z7OF 4Z78B 1KEML 1X3DA 5CP3H 5B4MC 3QA3A 3FRPG 4ZUSB 3BUYB 4ZPTB 5GSVA 1G7MA 5I75C 1VGKA 2YS4A 4RIRA 1J8KA 4L1DA 3ARRA 3TVMD 5B8CC 5KSVB 1FN4B 1JK8A 3ROLA 3U82B 1OARL 1KELH 1P4BL 5AUMA 2BVTA 3SCMA 4ACPA 4DW2L 1JNLL 1FPTH 5ANMA 3Q1SH 4RQQA 2P5EA 4LBEB 5JXEC 3I6KA 3FB5B 5KG9A 5GGSB 3I3BA 4IMKC 3ZE2E 2XXMB 4X4YA 2FBJH 2J8UE 5K9QI 1RZJH 4JANA 2NXZC 2AJSH 3QXAB 5C0AE 2AVGA 3U0PB 2OJEA 5EO9A 2R2BB 2V7NB 3RIAF 1PEWA 4QRQA 3I2CH 4KVNL 2PW1B 3T4YB 2VQUA 3ULVL 2W59A 1IGFH 1S7XB 4R7DA 4ONFL 4MJID 1UM4H 4G7YH 3G04B 4OUUA 4X7DC 1NLBH 2Z31A 1M05A 2JJTC 4LSUL 3B2UD 3O0RL 2BVOA 3SE4A 4QWWD 5DR5H 4XVSH 4A6YB 1S5IL 4KXZI 1MCWM 1OTUC 2J88L 4MX7B 4OZIB 1W0YT 3FT2B 4P2OA 3SGEI 1EHLL 5F1NA 5ESVA 3IFNH 1F8TL 5BVJB 1FVEA 1KOAA 1M7DB 5E8DH 1A7RH 4XX1G 3U46B 4S1DC 5E1AB 5D7IF 3VWKB 1JTPA 1MSPA 4ZO9A 1BIIA 2NY0B 2ESVB 2KH2B 2Y06L 3TH3T 1N3NA 1OL0A 5HGHA 2AERT 4Z18A 4P2CG 1FFQA 1BBJB 1X5FA 3D0VB 1NDGB 3CFDA 3AREA 1OGTB 3FOLB 3NIFE 4I0KA 3UYOD 4AG4H 3M17B 2QEJA 1QBMH 3LEXB 4OJFH 4MLSA 5FOJA 4Y4HB 2D0FA 4PRHB 2FSEA 1SEBB 3L95A 4NQEA 2EDNA 4R0LC 5E94A 4X5WA 2A9MH 5DRNB 1X5GA 4OCMC 4JPKL 6FABL 4P2RB 2V6HA 2H26A 5A40E 5FHBH 3WLWC 1SBBA 3GIVA 4Z7WF 1E4KC 4ODWA 5GGVL 4Y4KB 1Z9MA 5J6GB 1ND0B 2HFGH 2K7QA 1HXYA 4GH7B 4HAFA 2DKMA 4N90E 3HMWH 4CJ1A 1NGPH 2LABA 3ARQA 5GS1C 4KQ4H 1FGNH 1HH9B 1NCCH 4RGNB 3KYMA 4QTHA 3V4UL 2HVKB 3SDXB 1CLYH 3F7QA 4K94H 2HJFB 1QFUH 1MAJA 2V17H 3A6CL 4ODHH 4Z76A 5J7CC 4S1SL 3VFUB 1W2KT 5DEFB 3WNPA 4Z7NE 3QJHB 1MHHB 2BSTB 3P0VH 5E03A 3V5HB 4Z8FH 2EIZA 1HWHB 1I8MB 3BPCA 1UWXH 1RJYA 3MV9E 4GG6F 5IW1B 5MHSE 3HC4L 4HPYH 3SKUD 5L7XH 3ESVF 4PLJC 1PVHA 3ARGA 2G9HB 3WNOA 4GKZB 5MERB 3L1OL 15C8H 5SV3A 5CEYA 3L5WA 2Q8AH 2XNAA 4JEGB 1U8MA 1CFSA 1WBXB 2MKLC 2W0FB 4JDVB 4R26L 3IVKB 3U0TB 3GNML 5IEKB 4OSUL 3IXTB 4UDTB 4KFZC 1U6AL 1HXMA 1DVFA 1D5BA 1XCQA 2VL5A 2R8SL 3KPRD 1YZZA 4JDZA 2A6DB 2VLKE 1GH7A 2PETA 3CFKA 4ZXBB 1KJ3H 4MA3A 1NCDL 3VFPA 3AMLA 4YFDB 3DUHA 3WHE1 3MLWL 5DJ8A 3GJFK 4Z7UB 2OK0L 1GYAA 3GMMA 4UNVA 3DMMC 4HUWB 1DQTA 2I9LA 4QHNB 2VSCA 4X7TA 3W0WB 3IJYB 5EOTA 4JO4L 5SV4A 2EICA 2JJSA 1UFUA 2D03H 3OKEB 4OD3H 2BNRD 4YHIB 5MEQA 5E4EC 2XZCH 1MJJB 1U8NA 3B9KA 2WBJC 5I30H 2E6PA 3VXSE 2HJKA 1YEJH 5DHVB 4LSQL 3ET9F 5BS0E 3SEPA 4NWTH 1JWSA 2FLBT 1IGML 1IC1A 3CDCA 2MPAL 3TBVA 1NC2A 2ZZUT 5C0EB 1AI1L 4OD1H 1J1OH 3RPIA 4P9HL 1BQHG 3SDYH 5L2JB 1FE8H 1CFVL 3BI9X 1ROWA 2E9JA 3GSVA 1IARB 3TZVC 1MELA 4X80L 2NY1C 4ZPTA 4WI2A 2D7QA 4RAUA 3O8XB 1IKNC 4OCRL 1N5YL 4U1GB 4WHTA 1E4WL 3X3FH 4KMLB 5A1AA 2WV3A 4L29B 3MFFB 5C0CA 2FL5B 5EUKA 5IHUH 4J6RL 1B4JH 1DJSA 3FTGB 1N6VA 3H9SD 3LB6C 1RZKC 4NZUH 5C0GB 3RX5A 3QIWA 4QHLB 3QHTC 3P9MB 4PP1C 2XRAL 4JFEE 3QXAA 1KB9J 1G7LB 3MLTA 5DFWH 3ZDZF 5B21A 3QO1A 3KXFB 3JSSA 3HNTL 4Y5YC 3TJHD 4HK0B 4RAVB 4XPGL 4Y4FD 5LAXA 2ITDA 1CTNA 2AXHA 4XTRC 4PR5B 4HKZB 1KJ2H 2ATPA 3ILPB 2CO7B 4EVNB 2BERA 4Y5VB 4P48A 1W72H 3LS4L 2AV7A 4XGZB 5I6XC 5IOPB 4NNPH 4F3FA 1HOCB 5I8OH 5FHAL 3EGSB 2QSCL 1YY8B 3S8WA 1QLRB 5E8EB 3AC0A 3FT2A 3O4LA 5KVEH 1I3UA 1HILB 3FFDA 3EYSH 2YBRA 4HUNB 2W38A 1AD0A 4QRRB 3GMPB 4HWNA 1K8DA 5CLTA 3AROA 3QHFL 2MQ0A 3K1DA 4BFBD 1GZPB 5E99H 1OD7A 1ZLWK 1G84A 5FM8A 1V3LA 1U8OA 4WV1A 3B2VL 3BWUC 5HHOD 2ESVA 4LPXA 4KY1L 4POZC 3G6JF 2I25N 4D3CL 2ADIA 4DKDC 1TNMA 5GGRY 1MREL 2BSSB 2VZ1A 1FL6A 4Y2DB 2W60A 2YA0A 4GW4B 2F5AL 1G7IB 2A73B 3CZFB 3LEXA 2XKUA 3MC0A 2R69L 4KRNA 3W39B 5D72H 4ELME 1VFBB 4ZFZB 3PL6C 4P2RA 3GBNL 1E6JH 2DDQH 3S4SB 3GSQB 1D3CA 4P4RB 4LSTH 4G6KL 4GT7A 2C7UA 3KPLB 5I0ZA 2YA2A 4FRWA 4DWHA 5A3IC 4ENEC 4JFDD 5EUOF 1L7IH 3C60A 1NCWH 4N0UB 4HIEA 5ACLA 43C9B 3A67L 3O2WH 4WW2A 2FGWH 3QWQB 1UG9A 2PXYB 4EDXA 4PJ5B 1LO3H 4AEIL 1QTYT 2GJJA 1LO2H 4X5XB 4CVZB 3TGXA 4C56E 3BGMA 4URTB 2O5YH 1BQSA 3VXQB 3WCYA 3VG9B 3EO9H 4FQLL 1J88A 4N0FB 5KTEL 3EOAA 5A2LH 3VMNA 1TZGL 2DMKA 5CAYB 4PP2A 2A9NH 4JFOB 2VDQL 1PZ5A 4H25A 4K7FB 4HIHA 1X5KA 4AM0B 4XHQA 2FIKA 3D3VD 4JJ5B 3C08L 2VOTA 4MWFA 1J1PL 3KWWB 1OF2A 4OFDA 2IBBA 3EJZD 5ALBH 2BNQD 3OR6B 3U0TA 1EAPB 4OCXL 2YK1H 5GS0L 5JIKA 2ZCKL 5F7UA 1A3LH 4JN2B 1LO4L 1RQ5A 4X6FA 4M93C 1WV7T 3MMEA 2NZIA 1Y6MR 5LGJB 4CMMB 1A6WH 3TBWB 5DLMH 4UIMB 5HGGS 2KL6A 2D9QB 2L0DA 3DHMA 4ZXBA 2YD3A 3BEVA 1AXSB 1C5DB 3BHBB 3S96B 4YHOH 2H6PB 3C5JB 4G6AC 4OCWH 5I71B 1T6WA 5HYJE 4H5SA 5FM5M 3HE6C 1DZBA 3ARWA 4HUWA 2C4FT 2AQ2A 4QHNA 5F44A 3BW9B 1QBLH 2MNUA 4Y16D 1XF2B 2APWA 3IETA 4EEEA 2B0SH 5IM7A 4JG1H 3WS3B 1MY5A 1KELL 4ZFOB 3RVXC 5D93B 2CDFB 1BD2E 3DO7B 2IH3B 3Q3GA 5DHVA 1WT5A 1FPTL 3Q1SL 3EW3B 5FCUL 3SDAD 3B43A 5HGAB 4ESKA 5IMLB 3QPQD 2WBKA 3PF2A 4HKJB 3NCYP 2PO6B 4LK4A 2NX5E 1NDMB 3E2HC 4MNGE 1NAMB 2FBJL 1RZJL 2AJSL 3D39A 1X5XA 2Z91A 2XZAH 2V9RA 4YLQT 3AS2A 4KKCD 1GZQA 3I2CL 4MQ7B 1IGFL 3FAWA 1FZJB 5D7LB 3UDWC 2CKNA 1UM4L 4G7YL 2H45A 3BP6A 1KLGA 1NLBL 1QD0A 3LPWA 4J3UA 5EU6D 1Z9OA 4F2MB 4S0SD 5DJAB 3D87B 5DMGC 5DR5L 1DR9A 2FL5A 4XVSL 2EEDA 1J10A 4C57C 1I1AA 3KPMA 1I7RB 2R9HC 4GLRI 5KS9F 2WMPA 1VACB 4KI5C 3C6SB 3IFNL 5B4MD 2I9TA 5E8DL 1A7RL 1G7LA 5DUBB 1PG7W 3C9NB 4QOKA 4YAQB 4U1MB 3E8UH 2ERJB 1MCFA 3EOYG 1FSKB 4QCIA 4RMSA 3GSRB 4PTTA 1TJGH 4I3SH 4P5TA 1OGAA 2BHUA 4HFWB 3HKFA 2J4WL 4RDQF 1MLCB 3IGAB 2PTTA 3TCLA 3KYAA 4PJBB 3P9LB 3PG2A 5EZLA 5LWYH 4QRUB 3BQUB 1DBJH 1EJOH 4NUGH 4AG4L 5IOPA 1QBML 4PJGA 4YUEH 1NANI 2AXGA 3EGSA 3QJFB 5JXED 3TO4D 1WAAF 5E8EA 2A9ML 3T2NH 5IVXE 2R2HB 1MOEA 1BJ1J 2GKIA 1P1ZB 5FHBL 1XCTA 32C2B 4NM4L 4QRRA 2NXZD 3BGAA 4CDHA 1I3VA 2E7LC 4NQCA 3NCMA 3SGJC 3U9PH 5FO7A 5L0QC 4XCCH 2HFGL 4P5KA 5MEPB 2J6EA 3G5VB 3HMWL 1NGPL 3OAYH 5JORB 2IALA 2IANB 1FGNL 4KQ4L 1JGUH 1NCCL 3FB6B 1JBJA 1CLYL 3U7WH 4K94L 4Y2DA 1QFUL 4Q9RH 1FRGH 2QHLA 2V17L 1G7IA 4ODHL 5D71H 3T65B 1OTUD 1VFBA 1DBAH 3LN5A 1J8HE 1N64H 4LMQE 1XGYH 2JK5B 4UDUA 3T3PE 1KXVC 3OB8A 3P0VL 4Z8FL 5ESQA 4JRYD 1A3RH 3QWRA 2CUIA 4S1DD 2R29H 4HPYL 5L7XL 3EJYC 5D7JC 1P53A 3KPLA 3H9HA 4DAGL 4E41D 1WWBX 3CCHA 15C8L 3CH1B 3QYCA 4CVWA 4YIQB 2VIRB 1LO0H 2Q8AL 3QUXB 1K6QH 5C0FB 3O11A 5GQBA 3QUMH 4NHUA 4D0CB 5DK3A 2ZSWA 1IM9A 4R96A 2GY7B 3OJ2C 4F37K 4OCSH 5CHNA 4KUCF 5C08E 4DUVA 4JLRA 4RFEA 4I2XA 2DOCA 1KJ3L 2VUOA 3GSWB 1QFOA 3WLWD 4I0PB 2X4UB 1Z3GH 3WBDA 2WWKT 2NTFB 3FO2B 1MFAH 4CU6A 5L8LB 4KK5C 5HDOA 1BREA 1UA6H 4JFQA 1CIUA 1F3DJ 4AM0A 3LKNB 4MS8C 3RKDC 4TUOA 3RWHB 1CGTA 2YN3A 2IPTH 1VFOA 3G08A 3FO9B 4JCMA 3DVGA 3LKQB 2D03L 4OD3L 4U6XA 4WDIB 3OR6A 2XZCL 5GRJH 3V0VB 3R0NA 2Q76A 4PJCE 4ZNEE 5KZCB 3QEHB 3LV3A 5I30L 2BHZA 4H26A 3WFZA 5E7FA 4WI9A 5BZDA 4LQ1A 3ULVE 3NIDE 4NWTL 1DQJB 4BFGA 5LGJA 1RUKH 4G9FA 4UIMA 5IMKA 3GMOB 3LH2H 3QEQA 4OD1L 3T8XA 1J1OL 2Q1EA 1ZT4B 3MNZB 3SDYL 1FE8L 1P84K 4ISVA 3O2DH 4PLJD 5B39A 2VLRE 2VC2H 2IPUG 1G6VK 4P4KA 1ADQH 1IZJA 4LLDB 3ZDXF 5ETUB 4NYLB 5CGYC 3X3FL 5IR1B 2C3HA 4JAMB 1GXEA 2CDFA 4HFUH 1P4LA 4X6DF 4RMRA 5CBEB 3KYOA 4FFWC 5IHUL 3DRTB 3CAFA 5HGAA 1B4JL 4MJ5A 1KCUH 5IMLA 1K8IB 3FB8B 4R4FH 4NZUL 3RUGE 4OAWB 4JFHD 1MCPH 1F4XH 3BP4A 1KJMB 1XIWB 4TVSa 1T83A 1JV5A 1MIMH 4NO0B 3DMMD 3QIUC 4JQIH 1BOGA 3ARSA 2OXHA 5FEBA 2F54E 2EO1A 4UB0H 4W6XB 3L9RA 1K9TA 2V2TB 1ZEAH 1KJ2L 1XGUA 1MHEB 4HG4J 2WBJD 5DRZB 2XKNA 2VE6B 4NFBA 1W72L 4F2MA 4NNPL 4GJTB 5I8OL 3QNXB 1CG9B 2CLVA 5KVEL 1P7QB 4XI5C 1MCWW 3EYSL 4ZDHB 3SJVB 2B4CH 2YA1A 4OZHA 2AEQH 5DO2C 2K7PA 2RGSA 4CMHC 2CO6B 5F1IA 3TZVD 4EQ3A 1BBDH 2NY1D 5E99L 1O7VA 2VLJE 1XR8A 4YAQA 1FBIH 1MI5E 5ILTH 2C1PA 5E24E 5DD6A 4O5LH 3SE9H 3VXUB 3WNNA 2R1XA 5ITFA 4POUB 1XEDA 2VRAA 3OB0H 1FO0A 3ARBB 3WN5A 4HJ0C 1EMTH 4ZO8A 3BH9A 5TE4H 2MCG1 4P46B 3DXAE 4C58B 4NQDE 3RTQB 1TZIA 5D72L 5F9OH 3CH8A 3LB6D 5DD3H 2VXQH 3KPSB 4LHJB 5EC2B 1S8DA 3G6AB 4ELKB 4F9LA 1E6JL 2DDQL 4PP1D 5AAMA 3VFVB 1CR9H 2C3XA 1MQKH 1S9WA 5J8OA 3HRZA 4LSTL 4QF1A 4L3CB 5D1ZD 4IMLB 3IAGC 4UOJA 1UJ3C 1DANU 4GBXC 5F7DA 3PWJB 1L7IL 1T5WB 2UYLA 4PJXA 4XTRD 1NCWL 3TT3H 3FB6A 5T3ZD 4K3HA 3CDGB 2B7DT 3T0EA 5J1AA 3CU7A 2FGWL 5IQ7H 4C83B 4IHOB 4LLUB 1N8ZB 1LO3L 3BIKA 1LO2L 1CT8B 2PKDA 1S78D 2ZUTA 4KJPC 2O5YL 3V6OC 3EO9L 3C6LA 3DGGB 3TN0A 5ICZA 3RNQB 3BEWB 5EPMB 4RMQA 2ZWLT 1MCEA 5SX4H 4PJEB 3S6CA 3IU4H 2LTQB 2A9NL 1JHLH 3UTTE 3O4OC 4LCUA 1W0WA 3IRPX 2FR4A 1F6LL 3AAZB 2R23B 3CPLB 4Q6IC 5HJ3B 1MCRA 3UP1A 3CH1A 1MCQA 3ZKSD 1TPXB 2LV4A 4POZD 5HHNB 1I1FA 1UWXK 2X4NB 1F11B 1KTKE 5ALBL 1PG7H 5KSUA 1PAMA 3HE7A 2IAMB 5E56A 2YK1L 4D0BB 5L2KD 4XNMB 5C0NC 1NEZG 1A3LL 1KBGH 4FP8H 2YUVA 5FA3A 3L5IA 3S3SA 3U4BH 3BVNB 4NN7C 1G9NH 1A6WL 3PL6D 5DLML 3QUZB 4FXGA 3D69B 1RSFA 3BP5B 2HLAA 3NVQA 4XNQA 5F7KC 1OAXH 5E9DE 2OSLB 4YHOL 1NPUA 5DYOA 3L3KA 3UX9B 1I7TB 4OCWL 1T6VN 1V7NH 3BGFB 5JUEH 4R6UA 5E8OB 2R1WA 2X6MA 5A3ID 1FYTD 4ENED 2CSPA 1QBLL 4PGCA 4F7MB 3S36H 5E5MB 3LKOA 3ZHLA 1AD9A 2B0SL 4ETYA 5JA8B 4JG1L 2X41A 2YXMA 4WDIA 3V0VA 2KPNA 3ULSA 4PRIE 4NSKB 5DSCA 1UB5A 3M1BB 3UTSA 4Z7OE 3IDMA 4KKLC 4XCNA 1TJIH 1FNEB 1NQBA 4I3GA 5F72S 3UZEA 4LVHB 3S7GA 3E0GA 4UNUA 4G8IB 3MNZA 4ZAKC 5IB5B 5IHBA 1I1CA 4IM8A 2J8HA 4CN1A 2XZAL 4MA1B 5MEND 1PKQE 5C0AA 1A1MB 1T7XA 4NKIH 1S7RB 4LLDA 3LQAH 1X7QA 2JTDA 1MFEL 1NFDB 5E8PB 1A02N 1WBYB 3QDMD 1YC7A 1RZ8B 5CBEA 1YUHB 3DIFB 4PB9H 4J4PA 2LU3A 3DRTA 1VADB 5DJCB 4LCWD 3RDTC 2PN5A 1G9MC 1KJVA 1EIBA 3KG5A 3BFOA 1AO7A 4MQSB 4XMPH 1R5VB 4G6AD 3KJ6H 1Y18A 1TETH 5L88H 5JR1H 2HKHH 4MXVF 4NO0A 1KIRB 1S7VB 4KJYB 2CIKA 3E8UL 3WJLC 2NY5C 1OSPH 5BCAA 5TE7H 1TJGL 3QG7H 4HH9A 4I3SL 5JDSB 3U30C 1N0LA 2VLMD 1SY6A 2X4PA 3RVXD 2ARJA 3FT4B 4R7NB 1VESA 1KF9B 3TVMB 4L3EE 3M45A 1LK3H 5LWYL 1DBJL 1EJOL 1QSEE 2NY7H 4NUGL 1CGYA 5F1OB 3G5YB 4YUEL 3ZHKA 5TF0A 3JV4B 4OTXH 3T2NL 5H35A 3ZYOA 2DMCA 4BYHA 4RMWA 2DM2A 5GRVL 4JZJB 4F7TA 3OGCB 3OF6A 3MOBH 1UXSA 4U6TA 3U9PL 4XCCL 5DJ0A 5JIIA 1KTRL 4H1LG 1LDSA 3IF1A 5ICYB 2XQBH 4HV8B 1B3JA 2WW8A 1JGUL 2BVEA 3WFHB 4GRWH 5C9KA 5I76B 1NGYB 3U7WL 3MV8D 2COQA 2EKSB 4CADB 2W0PA 4M02A 4MJIB 4ZUTB 4Q9RL 1FRGL 4U1IB 5DMGD 5BJTA 3REVB 2CK2A 5D71L 4NQXB 4Z6AT 2R0ZH 3RTQA 3OHXA 1F5WA 2R9HD 1RMFH 1DBAL 1T66C 4Z7WE 5CKAA 2MQ3A 1N64L 4TNWK 1XGYL 3V5KB 2X70B 2OTUB 5EC2A 5JW5A 1D5XB 4HD9A 4KI5D 2Y25A 5C71A 3DSFH 3C5ZD 4GRLC 1A3RL 2XN9B 5B38B 5D7KE 4ZO7A 2WK2A 3GI9H 2FYYB 2R29L 3AB0C 3IDJA 4XP5H 3NMEA 4OLYH 2ATKB 1A4KA 3KPQB 3QFJD 2JKXA 4YQXL 1LO0L 3DETC 1A7OH 1WZ1H 1K6QL 4DOHE 8FABA 3QUML 3CDGA 5C0BB 1KCVH 4HCRA 1MCOL 1OY3B 1WWCA 4C83A 5DD5H 1CT8A 4HZLA 4OCSL 4Y19B 5EN2B 3TIDB 4GG6E 3N1FC 4LLVB 3GBLA 3VW3H 2HKFH 3HTLX 1OTTC 1T2QH 3UTOA 4M62H 4ODUA 1T1ZA 4A6YH 3JZ7A 5SWZD 5CD5C 2LVCA 3MA9H 1SBSH 4RFOH 1Z3GL 1MFAL 1J05A 3CPLA 1G9NC 1UA6L 5HJ3A 3T0BA 2IPTL 3SGKA 1X6NA 4YBLB 4WHYH 5FM4A 5SX5H 4X99A 1F11A 1P9MC 3FB7B 2JB5H 1EEUA 1MCDA 5GRJL 1NFIA 4TSAH 4FTVD 4CNIA 4PJ7A 2ZG2A 5T1KD 3U7YH 1RUKL 3NCJH 4NQVB 3VXSA 3DARA 1EHXA 5C86A 1ZV5A 3LH2L 4QRSA 5HI3C 5F7MC 4JFZH 1XF3B 2OSLA 1A6UH 1JRHI 4G7VH 1I7TA 3O2DL 1DUYA 3EJYD 5D7JD 3OKNA 3B9DA 1BP3B 2VC2L 3GJEA 1T7YA 2Z35B 1L7TH 1ADQL 5TGBB 4F7MA 5F1SA 1RK1B 4IRSC 2W0LA 5AYUH 3K46A 1LK2A 4N8VG 5FO9B 4HFUL 3JTTB 5SWSD 3JV6B 2XWTA 3MRPB 2A83B 1KCUL 1FNEA 4Z77B 4R4FL 1MCPL 3KPRB 4UQ2B 1F4XL 1H3XA 5IB5A 4M5ZH 1CDYA 4GRWF 1MIML 4MS8D 3RKDD 4JQIL 3WMSA 1A1MA 3UBXG 4PS4H 3MRNA 4UB0L 3WUWB 2BC4A 3SDDB 3WE6B 1ZEAL 1ZKAA 3HG1D 3PDOB 5E8PA 4MD0A 4KZEL 3H0TB 2BNRB 3EO1B 4MAYA 5IB3B 4HHAB 1Q94B 4HIIB 1VADA 5DJCA 2X5PA 3O41B 5ID0B 2X1WL 4JQVA 1P2CB 4EN3A 2C3VA 1IGJA 3ZDZE 1N0XH 2W1NA 1OAUH 5HDQH 3RWEA 3VXMD 3WL9A 2B4CL 4TUJB 2AEQL 4WTXA 4NGHH 5I8KL 4GFTB 1D5MB 5DMIH 3PWPE 5IF0B 1BBDL 2CIIB 1IAOB 1KIRA 4BKLA 3CFJB 2DKSA 1FBIL 1QG3A 2KKQA 1G7JB 5ILTL 2X7LA 4O2CA 1TQCC 2NLJB 1FL3B 1U93B 3MROB 4O5LL 3SE9L 3UAJC 5CGYD 3K80A 2GJZB 4KROB 1MRFH 3DX6B 3QQ9C 4ODVH 1EMTL 2XWBA 5IB1B 5TE4L 4OLEA 2J1KA 4OFVA 4JRXD 3G5YA 5DVLA 1S5HB 4JY6A 5KANG 4POYA 1B4RA 2NPLX 3CC5A 5F9OL 2H32A 4TVPH 2YN5A 5DD3L 2VXQL 5DHVH 1AHWB 5LJYH 2XI9A 3SN6N 3H9SB 1HHKA 1RZIB 2C1OB 1CR9L 3TT1H 1MQKL 4Y5XB 3AY4C 2DJ4A 2Z92B 3QIUD 4JZJA 1FFPB 3MRLB 5HHMB 2DQCH 1IAKA 1A6PA 1HHGB 2DYPD 4U1NB 1MCLA 3TT3L 4Y1AE 2BSRB 3WFHA 3RU8H 5GRVK 4L5FH 4DUXA 2YSSB 4X6EB 2XFXA 4CADA 5IQ7L 4MJIA 5I1AA 1H3PH 3VFRB 2DAVA 4I1NB 3N1MC 3ARDB 3OAYK 4DZ8B 4NKOA 2EDOA 2BX5A 1UACH 5FA4A 4QRTA 4IIQB 1P69B 5E00A 4XPTH 4FQXC 2X70A 3GSNB 4XI5D 1AC0A 2V7HB 5DO2D 5FGCB 4WW1B 5B3JF 4NZRH 5KVFH 3IU4L 1QO3B 1JHLL 3WIHA 5HPMA 5EUOE 4OV5A 4U1KA 1H5BB 3QH3B 4WGVB 5EFIA 1T2XA 1QFPA 3QUKA 4PV9A 5EOCH 4WW2F 2BOCB 3KLDA 4K3EH 5D6CB 4UOW0 1E28B 4HJ0D 1OB1A 4XB7A 3ARZA 2P48B 4PYGA 2W65B 5I1LB 2WUCH 2P42B 3HMXA 1VGEH 1KBGL 4FP8L 1PJ9A 3ULUH 4X7CC 5E6IB 3U4BL 3MJ7A 2VZVA 1G9NL 3VWKC 4XPAH 2NY0C 4CW1A 1KEGH 1YNTB 2FJGA 3EYUH 1OAXL 2H1PH 2WQRA 4Y8DC 3FO0H 2I26N 1CDUA 1V7NL 5JUEL 3KJ4B 4MD5A 1P7KB 1U91B 3T2QA 5T5FH 3BZFA 2GI7A 5ICXA 4M61B 7FABH 5FUCC 1MQ8A 1I9JH 4YZFE 5F6HJ 4GBXD 3S36L 4DN3H 2NW2B 3FQUB 4N1CA 4Y4HC 5B22A 3WYRA 4JFDB 5GRWA 4G8EB 3MRDA 5GGTA 4WUUE 4EIZC 3KLHC 1L6XA 2ICWA 2XOTA 5IKCB 1U0QA 1AP2A 5IGXH 4KJPD 1JZ2A 1EEYA 4Y4KC 1BD2A 1TJIL 1CI5A 4PB0H 4Q0XH 1U95B 4N0YH 4NN5B 4NNYA 1K3ZA 5KOMC 3LY6A 4RGNC 5JTWA 5I15H 3IXAA 4X7SH 2EDFA 2AEPH 3BP7B 3HI1A 5H2BA 3RY6A 1DANT 3VRIB 4NKIL 3V0WH 3LQAL 2NNAA 1XGRB 1G6RB 1YN7A 4BH7B 4W4OC 2VXUH 4DKAA 5F6HI 1NC4A 4EUPG 1YJDH 5FO9A 5C0ND 4PB9L 1E6OH 1U8PA 3MRBB 4Z77A 3LN9A 3D18A 4KRLB 4UBDC 4OZGB 2YHGA 4Q97A 3KPRA 3IFPB 3P11H 4XMPL 3N9GH 3KJ6L 1TETL 5L88L 2CR6A 5JR1L 2HKHL 5TDNA 3NCYS 5EU7C 4KV5F 4MDIA 3R8BB 2AK4E 5D1QB 4HUMB 4J2XA 3P0GB 4OI7A 1OSPL 4B7LA 2AABH 4I9WD 5TE7L 3QG7L 4V1DE 1F02I 4Y16B 2VXSH 3P0YH 4F15B 4JZOB 1EXUA 1A6TB 5E8NB 2BNRA 5FYJD 1LK3L 5IB3A 4XP4L 2WBWB 4KKLD 5KS9E 5IEHB 3PHOB 1ODAA 1A1OA 5DC9B 2DF3A 3O41A 1DQMH 5FKPB 2AEWA 3SDAB 4OTXL 4LMQI 5F9AC 2VWEE 3WEXB 5FYKH 4XNZB 5LG1A 2GSIB 4ZAKD 4E0RB 3V95A 2NY6B 4YDIH 4YHNB 1XGPA 5IVXA 2CIIA 3MOBL 3RY5A 3ULUF 4XNUL 1FL3A 1TQBB 1DN0A 2XQBL 5DEGB 2JIXA 4OUOA 3UPRB 4NRXA 1TENA 3S5LA 4EXKA 2QBWA 3V9FA 3X11B 4PJGF 1BX2B 2OCFD 4P3WA 35C8H 1WAAE 3LD8B 5IB1A 2YPLD 1ZA3A 3PGFL 5KJRH 2R0ZL 4QHMB 5EU6B 2BFVH 4HJJH 3RDTD 1RMFL 3NFPA 3OB0K 3O8XC 1A4JA 4G8GE 4U1GC 2IH1B 3GM0A 3DSFL 4DK3A 2E6QA 4NQSB 3VFSA 3GI9L 4RA0C 4IRJC 4DCQA 2RR3A 4XP5L 1CE6B 3KYNA 1LP9B 4M7ZB 1INDH 4GKSB 1G7HB 2IG2H 1H3UA 4OLYL 3MREB 2O93L 4JKMA 1X6LA 2G5RA 4M6MH 3HAEB 4U1NA 1HEZA 1KIPB 2KUTA 1A7OL 1WZ1L 1ORQA 2PYED 4OM1H 3S36X 1GOGA 3VFOA 3FRPA 5B8CB 1KCVL 4Y4FA 1HHIA 4OFPA 4L4TD 2MKWA 3NPZB 5DD5L 5C9JA 3RJDA 3S3JA 2YKLH 2F19H 3VW3L 5EZIH 1A0QH 3RGVC 4DTGL 2HKFL 1CLZH 4JY4B 4LNRA 4R3SA 1T2QL 2UWEB 4M62L 3TO4B 4A6YL 4OI8A 4J3OC 1U92B 1SBSL 4RFOL 1S7SA 1WUNT 4FOMA 5JIPA 2YEZB 4HXBH 4Y5VC 3IU3B 2ZUSA 2NQCA 3TH4T 4FQJH 4RNRA 5FO8B 1S9VB 2EE3A 2SEBB 5D6CA 4WHYG 5HHOA 3QULB 3GMLA 1Y6NR 2JB5L 2W65A 5I1LA 2MCPH 4TSAL 5ERWB 1PYWB 1NJ9B 1IGIH 5CSBA 4HQQH 3U7YL 1BM3H 5CMAA 1FO0H 2P46B 5K9KB 4YFLI 5ADPH 3NCJL 5DMJB 3OPZH 1DE4A 4XRCB 3FHQA 2VL4A 3MRKA 1WZLA 3OKLB 4KKBC 4JFZL 4GRLD 2RB8A 3PGCB 4G7VL 2Z4QB 4HJGB 3NFNA 4EJ1C 5DF0A 1H3GA 1I85C 1F6FB 4JRYB 1CS6A 1BAFH 1I7ZB 1L7TL 1KN2H 2V2WA 3F7PC 3DETD 2LVEA 3DUUA 3QDGE 5HTSA 3FQUA 1U42A 3RL1A 1QRND 5AYUL 3QCTH 4WFHE 5JOFA 5IROC 2FX8H 2DJUA 4BUHA 4CRPA 1ITCA 1UM6H 5C3LD 1U9KA 1ZS8A 3DO3A 1LEIA 1JJUA 1DFBH 4LRIA 2QR0A 1OTTD 3EIFA 3VFNB 5CD5D 4R0LB 1T3FB 4NKMB 4MNQD 5C0DA 4M5ZL 2BY0A 3ZDXE 1Q9OA 2DI9A 1GGTA 1AXTH 3GMRB 4X8JA 3OKOA 25C8H 1SM3H 2PXYC 3DV6A 1R3JB 4PS4L 3U36B 4Y7MA 3VXPA 4X6DE 1SJEB 3D3VA 3PJSB 4NKDB 4WFED 2EDHA 2CDEA 4NCC2 2UY6A 3JWNC 1OCWH 1RUMH 3QUYB 4I5BB 3GIZL 2BNQA 1KYOK 2Y5TA 5HVGB 3AFLA 1KT2B 2VTFA 4HX1B 2CXGA 3DJ9A 3MRBA 4G6FB 5TDPB 4PRPE 1JYXA 2BVPB 3CVIH 2EKJA 5HI3D 1N0XL 4TUKH 1OAUL 5HDQL 3FJTA 4LLYB 3QSKB 1SQ2N 1U8LB 4IOSD 4NGHL 4JO1H 4P57A 4L8SC 4NRYB 5DMIL 2VQTA 3NA9H 5INCB 2W92A 3HNSH 4JFXA 2AQ1A 2R56H 3NGBB 3SBWA 2QQKH 2EDXA 3RBGA 1T0MA 1FZOA 2RAMA 4IRSD 5D7SH 3WFEH 4PY7A 1MRFL 3SKMA 3PWUB 3MV7E 4JZOA 2W9EH 2F53E 4ODVL 3BRGC 3MJ8B 1YMME 1YEKH 1KB5B 5E8NA 1V05A 4JZNB 3QDJB 2HT3C 3KPNB 1QFHA 3PWNA 5DURD 5I71C 1YA5A 1Q9WA 1VPOH 4OZHF 3FONB 2P5WD 3DWTA 4TVPL 1YPZA 3SDAA 5IVNA 3GK8H 3MACH 2GSIA 3EO0B 4E0RA 4ZNCD 3H9ZA 3IJHA 5IBUG 1ZVSA 2ZUQB 1T5XB 1QZ1A 4E42A 3PV6A 3D85D 3MRJA 5D93C 5D9SB 1DDHA 5I18H 1QPXA 2DQCL 4OKVB 3QNZB 1C08A 2E3VA 5C09E 3VH8A 5KSBB 3HI6H 3WNLA 5I66B 3CX5K 4G3YH 1AGFB 2Y36H 4P5MB 3CJJA 3OKDB 1WIPA 3RWIA 3RU8L 3X11A 1TNNA 4L5FL 2DIAA 2PO6C 5CIPA 4LEXH 1HINH 3UTZB 5HI4C 1H3PL 2WBJB 2FHBA 1IEAB 3NCCB 2RQ8A 1LHZA 2G60H 1UACL 4C4KT 4MQXC 4ZUVA 4XPTL 5IUSA 5D96C 5DJDA 2VDMH 3WO4B 1LE5A 4NZRL 1U2CA 5KVFL 4PGEA 4JKPH 4X6BB 5FIEA 4NQSA 3EZ8A 3RWDA 4YDJB 1KPVB 1LP9A 4PJXF 4R97B 2CKBA 3WO3B 3RVVC 3UTTA 3MXWH 3ZKXB 4EXPX 5EOCL 3MSPA 1EBPA 3UAJD 1ZWIA 5C0JB 4KDWA 1H3WM 1S7QA 4K3EL 1JPFB 3TEUA 1BQHA 4P3DA 2R0KH 1JYVA 4NZJA 3QQ9D 4YBHA 5B8CA 1OVZA 2WUCL 1SY6H 1VGEL 3B9VA 2X40A 3FHAA 3L3GA 3ULUL 1II4E 1MUJB 4JKWA 4HUXA 2ERJC 5B3NA 4JY4A 1FSKC 1KPRB 3EDKA 1GGIH 1GRWA 4XPAL 5C7XH 4N8CH 1KEGL 1U92A 2FJHB 3EYUL 3MUZ1 2H1PL 3OXRB 1I8IB 1T2JA 3FO0L 4PRDA 4IMKA 4OZFG 2VO5A 5MI0B 4MQTB 1FL5B 5JHDE 3SPVB 5C0RH 2GCYB 4QRPE 1T20A 4LF3A 5T5FL 3O3EB 3BQUC 7FABL 2CD0A 1I9JL 1L0XA 2XQYG 3GMNA 3MJ9A 4DN3L 3RWFA 4DN4H 2SEBA 4PJIB 5D1ZB 4NT6B 3ARVA 3CFEA 1VCAA 4UT7H 4UNTA 2A6KA 3E6HA 4O51B 1ZAGA 2MMXA 1DCLA 3MODH 2JJTA 3ZDYF 5IGXL 5SX5K 1ZA6B 1EDQA 4JM2B 2VZOA 3T77B 4PB0L 4Q0XL 5I1HH 4FQXD 5GS2D 4XRCA 2R15A 4N0YL 1YDPB 2GFBB 5HPOA 3I02B 3F7YB 4R2GC 3PGCA 4XP6H 2Z4QA 3TBTB 1EV2E 2ZOKA 5I15L 4XP1H 2D31B 4X7SL 5ISZE 2EYTA 5A2KH 2AEPL 2YR3A 1G1YA 4K7PH 3QCUH 1MCKA 2E8YA 2DS4A 2VDOH 1DEDA 5F71A 3U4EB 1M71B 5ESAB 3V0WL 5C92A 1IGTA 3JVGA 3R8QA 1UWGH 4E41A 3ZLQC 1FJ1A 4KK9C 1J9CT 2HG5A 3EOBB 3EYOA 2IWGA 2DQFA 2VXUL 4FQ1H 3OG4B 1YJDL 3BWAA 1AE6H 2R1YA 1E6OL 4HCRH 2IADB 3VWKD 4NNXB 3NCFB 3LRSA 4N5EC 5E2UH 1JP5A 2BMKB 2NY0D 1E27B 5IG7B 3MV01 3PL6B 2D4DA 3VGFA 1AIFB</