4RGNC

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DIVMTQSPATLSVTPGDRVSLSCRASQSIGDYLHWYQQKSHESPRLLINYASQSISGIPSRFSGSGSGSDFTLIINSVEPEDVGVYYCQNGHSFPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 49
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnC01
4X9BA 1VENA 4PP1C 3S36H 4F9PA 1UCTA 1LK3L 2BVPB 2NY0B 3GBML 3HHRB 4PUBH 5HD8C 4BZYA 4WJ5A 4Y8DC 1JZ8A 4LCIH 5CAYB 1YQVL 2E7MA 5EH1A 3CVHL 4L5FL 2I27N 1AXTH 1WITA 3SCMB 5DJ2B 1CGTA 1FVDB 2X89A 3S97C 4JPKH 4Y5XB 4H25A 2VAAB 1JPTL 4H1LA 1NJ9A 4I18B 4KI1A 3BGFB 4JVUA 3ZHKA 4U33A 5LJYH 1AQDB 1WTGT 1RZKL 2IPKB 3BKML 3H6JA 4PRPA 3OSKA 3SDCC 3VGGA 5LQBL 1ZLWK 2CLZB 4OZHB 3MA7B 4Q6IB 4L29A 4PG2C 1E6JL 2XKSA 1EMTH 3BXNB 1FJ1A 2BC4B 2I26N 1PYWA 3T0WA 2E9IA 3PP4L 4WVRA 3UTSE 3DROB 4JN1L 2P8PB 5GJSL 4EKXA 5EBLB 5C0IB 1K4CB 1U0QA 1LNUB 1TZIB 4JRWA 3G5YB 3EJYD 4W81A 3STLB 5F1OB 5AZ2H 3OKMA 1I85C 1WZ1L 3VFOA 1EZVY 5E9DE 2GEEA 3L9RA 3PL6C 5IHBA 4BSVA 5F70A 5DQJA 4TNVK 4U1NA 5I8EB 4X7FC 4QRQA 4PRBB 2UWEA 4UU9B 2XA3A 3F7PC 4OIBA 5DWUL 4XP4H 4BKLB 3SDXB 2ZUTA 3V6ZB 2QADB 1DBKH 3IDXH 3BSZL 7FABL 1PGRB 4LSUH 1BREA 1AO7A 4Q58C 1I8IA 3MLRH 3WS3B 4KGJA 2AXGB 5ESQB 3HE6C 4MCYA 1FLRH 4HK3J 1WIUA 4H20H 3WFCH 2DKUA 2R39A 5HHME 1JNHA 3FB5B 2AXFA 1U8NA 1J1XL 2AS5M 3D18B 1T1ZB 3QPXL 3TO4D 2BSSB 3EDKA 4XPBH 3KVQA 5HDBE 3ZKNC 1Y6NR 5DLML 3LS4L 5HGBA 4NO5B 4F7TA 3DGGA 1JMZA 4ZFOB 1RIVL 1D6EA 4J8RB 4MSWA 4ZDHB 3FCTB 5FA4A 1G7JA 2YWZA 2IPTH 4M5ZH 3HR6A 3IVKA 2EZ0D 2X5PA 5BXFB 2X1WL 1AGEA 1L7TH 3AGVA 2M8XA 4PRPE 5CFHA 2NY7L 4L4TA 4RMVA 3QIBB 2B7DT 1DL7H 2VDLL 5JNYA 3S88L 1WBYA 1HCFX 4RRPG 1AI1H 3CC5A 2VQUA 3ARXA 4LSPH 5JA9A 1QLFB 5CGYC 2D4FA 4PJCB 5KSBF 2P43B 2CKNA 2H2PC 3RVWD 4R97B 5INCA 5D1QD 2QQNH 4MNHA 5IB2B 3TC9A 4Z78A 1EEZA 4FZ8H 3IKKA 1G0DA 3QDMD 4S1DD 4R26H 1JE6A 4HV8A 4WUUA 2YD7A 3QXDA 1IAKA 5TDOA 4MXVF 1OVZA 3O2DL 1QNZH 4BZ1H 3QIUC 3P4NA 4GRLC 4NZTL 3RRQA 5ICYB 4KKAC 4Y2DD 1UH2A 4MX7A 4D9LL 3NCYS 5FGSA 5BRZD 1XF2A 5EU6A 2R29L 3NACH 3MODH 1INQA 5F89B 1AO7E 4FFZL 3RKDC 3CLEH 3VFSB 5I8CA 5D4QA 5TDPB 4JFEA 2JB6B 4YHOL 5L6YL 1XGRA 2ZNWA 4QLRA 5HHOD 1P7KA 2E9JA 5DQ9A 5GPRA 1CLOH 3PWUB 4YNYA 5DD0H 1YYLL 5I6XC 4IOSD 43C9A 2K1MA 1TJGL 4OZFG 3SDCB 3V5KB 3PHQB 3F5WB 4ORGA 3MNWA 3OXSA 4AY0A 5BCAA 1BVLB 4UDUB 4RX4D 4UOW0 5C6TL 4V2BA 5IB1B 3HRZA 1AY1H 3E8UH 3QUKA 3TLRA 3NA4A 5KS9A 4JRXD 4OTXH 3TWCH 4NC1E 2HH0L 3BFOA 4XPGL 2DJUA 4KQ4L 1EV2E 3CMOH 1KV3A 1DJSA 1S9VA 2JLLA 4Z7WE 4PPTA 4ZXBD 3RZCC 1EAPA 2DQTH 3H2WA 3ILPA 3HUJB 4PTTA 3ZE0F 4IDLA 1D5XB 4NWTH 1MJJB 1Z9OA 2BDNL 4MA1B 3WIIH 1PLGH 3Q6FA 4X5WA 1DQMH 5FV1L 5D1XD 5T3XH 3ZSSA 5D2LE 1MCNA 1U9KA 5FEBA 3EKCA 2J8OA 4JZOA 3HAEA 3VGDA 3S4SG 1RK1B 4P46B 1JGLL 1T0MB 4PJGA 1AE6L 5JPNA 4HZAA 3LHPL 1VEOA 1NC4B 1HXMA 1OOAA 3LN9A 4X6BB 1QRNE 5GRJH 1PY9A 3HE6B 3VXMD 3C60B 3KLHC 3GI9L 2D7TL 4RAHA 2NYYC 1DBMH 1VESA 3GNML 2FBJH 3RTQA 4QHUB 2F5AL 1LE9B 5FKAA 3NOIA 3LCYA 5EU6E 4F7PB 3SGKC 4TVPL 2C3XA 5D2NC 2BVTA 3LKSA 5FECA 4MQXD 1J0IA 3KJ6H 5E8OB 4YHNB 1N59A 2HMIC 1CYGA 4P2CG 3L5WA 5IBTL 5HHVH 3J7HA 4LLQA 2EYRA 3PHOB 3PQYB 4M93B 3G6AB 3ZE2E 4AIZB 1ACYH 3OG4B 5GRWA 5DJDB 2VXUL 2APBA 1RJYB 4PRID 5LWYH 3PGDA 3ARGB 1IL1B 3SN6N 4WNQA 2WBJA 4GFTB 3GSNL 3N1QC 2VDQH 2BFVH 4XCEA 1MH5B 1F4YL 4UT9H 4OCYL 5KS9E 5FFLA 5IIEB 4L3ED 4OZFB 4XCFL 3OGCA 2F8OA 4FQHA 4IRSC 1RZGB 3I6LE 3U7YL 5F7YC 1VPOH 3EYSL 2A9MH 1R3IL 4YDLC 4G8EA 1S9XA 5EOCJ 3GSXA 1DQLH 3JUZA 1H3TA 4F9PC 4JR9L 1DVFC 3BPCB 3X3FL 3AXLA 5IBLC 1V7NH 4BH8B 5C0EA 1ORSA 3NIDF 4ENEC 3TBVB 3GIVA 2Y5EA 4XVUD 5DK0B 3MA9H 1JIBA 4D94A 3QIUB 1QBAA 3BMWA 1SY6L 1VGKA 2LVEA 5DUBA 3T77A 5JTWA 4X80L 1DQJA 4PJGE 1L0YA 4ZQKA 5JDSB 4DGIL 1DE4A 5SWSD 3OKOB 4AZ8A 4LQ1A 2YBRA 5BOZG 1DQQB 2C4FU 2HG5A 3C6SA 5DVOA 1XAUA 2XG5A 4XNUH 4XAKD 3W9DA 3ZHDA 2XV6B 3SQOL 4Z7OF 4HZLB 4OCXL 5I6XB 4KZDH 3MRBA 4JGJA 3E1F1 3WL9A 1TTGA 1S7XA 4G7VL 3KPRB 1XGUA 4NRZB 2I25N 3PJSB 4I48B 2PTUA 2YD8A 5FA3A 1FGNH 3MLWL 1JGUH 3OX8B 3U7WH 4NPYB 3AAZA 5C0AB 5HYFA 5CILL 3LZFL 3T0DA 1BOGB 1YECH 5DHYB 3ZTJH 3VFMB 2Y06H 2GJ6E 4PV8B 1YDPB 3D9AL 2XPGA 4U7MA 1HZHH 1S78C 4HH9A 1ADQL 2OL3L 2NY1C 5I8KH 1L7IL 4D9RE 1IM3B 2VDPH 2V2XB 3MRIB 1J0ZA 2D7OA 3MRGA 3AVEA 4MJIA 1JWSA 2IBZX 3SJVD 5IQ9B 4GRMB 1J5OH 2R8SL 4PJ7A 4NQED 4EBQL 1DEEB 1ROWA 4Y16A 5HYSG 1YY8B 4HQQL 1WWAX 3U4BL 4WU5B 3F58H 3RUGE 2ATPA 4DVBA 4L1DA 1ZLUH 2RCSH 4KWUA 1KYOJ 3OAZK 3QEQE 3BP6B 2CGRL 4FQPA 2HYMA 2DBLH 2HKFH 4YQXL 1GXEA 5EZIL 2NXYD 1UB5A 3PE9A 4U6YA 2EKJA 1CXLA 2PNDA 4FQ2H 4JY4A 4X5LA 5D2NB 1KC5H 4KMLB 4KDTA 3W9EA 2AJUL 2CK0L 2R0ZL 4PJ5D 1MFCH 5C86A 5C0ND 1I3RA 2EXWC 3CXDH 2ZSVA 2H6PA 1JK8B 1SEBB 3DV4B 5E70A 1OM3H 4XCCH 3O2WL 1ZTXH 3WFHB 3BKJH 1C08B 1EO8H 3V5DA 5ID1B 3O41B 1RSFA 1T2QL 4PB0H 3S34H 3VXSB 2R0LH 3CXHK 3G04B 3MRFB 4OF7A 4NJ9H 3SGEI 5FYLH 1FBIL 4XP5H 1FGVL 4BUHA 1QQDB 3LPWA 5B22A 3IB4A 4RCAA 4V1DA 3DO3A 3GHEL 4IRSB 1FNEB 1HHKA 3S7GA 4O58L 4N8VG 3RWDA 5ALBH 2BERA 1TVBB 5IEKA 4OIAA 3BAEL 1M7IA 4NO0B 4G42A 5HHPB 4DVRH 2W9LA 4YDJB 5MENB 3LMJL 1DVFB 2SEBB 3BJ91 1QFWM 4U1SA 3QWRD 1XGPA 2OJZL 3U4EB 5AG8A 4XNQA 3IKCA 2P7TA 3FN3A 3GMQB 2FWOA 4PJ8D 1DR9A 1FLTX 2XG4A 3C5ZA 2C3HA 4UV7L 4MJIE 4QRRA 3MV9E 2H45A 4RAUA 2RAMA 5H2BB 1NAML 2ZPKL 1CL7I 3OJVC 4K3DH 3P0YL 5IROA 4PJ7E 5JOPD 5FUOL 3JV6A 3KPOB 3IXAB 5FOBA 1R3JB 3KJ4C 4HC1A 3RQ3A 1QFUL 4PRNA 4Y88A 1HXYB 1ND0A 4Z7UF 1HSBA 5JIIA 2BRRL 2HTKD 4NQDD 2B1AL 3D39A 2AEIT 2WUBL 1HHJA 3CAFA 4JKPL 5HYSB 4ZFGL 3MUJA 1FZJA 5JQHC 3ALXA 3CCHA 3VI4F 1MCCA 2ORBH 3C6LA 5BQ7A 5I75B 2P49B 4OUUA 3L3GB 3PIQB 5SWQB 5GGSA 3WHE0 4JZNA 4HBCL 2X4NB 3MRRB 1I3GL 2BX5A 4AEEA 4D3CH 1CR9L 4F3FB 4OM0L 1T21B 1X5FA 1RUQH 5IWLC 3VU2A 5HGAA 3O3UN 1JHKH 4HKZB 3EOAB 4P23C 4EZMA 3FQTA 4OJFL 2GJJA 5D6CB 5HBBA 3UBXA 4U6TA 5I8OL 3DGCR 4RDQF 1BX2A 3HS0B 1JWMA 4TQEH 5C08B 1IC7L 2DQJH 5ICXB 4FZEH 4LHUG 5FHBL 4GS7C 5IMKB 2B2XH 3CVIL 4JFQA 4M6AA 3QUMA 5I1LA 3O6FB 4UOW1 5I66A 1OSPL 3L3OA 4XMPL 2F8XC 2PW2A 5D7SL 3LEYL 2VAAA 3GGWB 3RWHB 3SKNA 2XXCB 4XMKL 1UYWL 5KSUA 1CGUA 1KBGL 2CJUH 1RJCA 1BJ1H 3QCUL 1F8TL 3L3DA 2EIZA 1LMKA 1MHCB 3LDBC 1UXSA 2C9AA 1JF1A 3QNZA 1A3LH 1IARB 4ZUTA 3LEVH 1CFVH 3EZJB 3NMEA 4AQ1B 1XGYL 2BC4A 4NJAL 2BHZA 1RV6X 5K9QG 3RVVD 4QRTA 2DDQL 3QDAA 4QNPF 4HWBL 3PGFL 5ADOH 3KYOA 1JWUA 1U58A 1MJ8L 5I19L 4PJAE 4Z7QE 1FFRA 3NFSL 1FO0A 4XP1H 5K59E 2AGJH 1EDQA 4O2CA 5E4IA 1H3GA 4WEBH 2FD6H 3UYRH 1CD8A 1QHOA 4YH6A 3T2NH 1U6AH 3GSQA 3GMPA 1ZANH 1RHFA 2WBJC 5C07D 1I7UA 2F5BL 2DI9A 4NZRL 2IH1B 4TVPD 4PRBA 1GGBH 2BCKA 4OD3H 2HTLC 4L4VD 1KJVB 2Q6WA 1JP5A 4F15B 4OCRL 1ZXQA 1WFTA 3VXRE 4PJ9A 5HGHB 5ESQA 5I2IA 3S3JA 4IRJC 2JJVA 3KPLA 1I1FA 4JDZB 4Z0XA 2VLRD 2ZOKA 1I9IH 4TPRL 4LK4A 4LRNL 3D48R 1HINL 3RIAK 5D7JA 4K8RH 2PTTB 1MCQA 5E99L 2XZAH 1V3LA 1NLDL 2NX5D 4JFOB 4DCQA 1B0RA 2CRYA 3L95B 5CIPA 3TPKA 3ALPA 1KEGH 1AXSA 2MNUA 4E41D 1QLRB 5F96H 4ZDHA 5DSCB 3KJ4B 1DUZB 2ITCA 4WI3A 3QIWC 4PJIB 4PD4J 5E8PA 4JO3L 5DEGB 2OMNA 4YXKL 1VACA 1F4AA 4GXUM 3BVNB 1TTUA 2HLAB 3TESA 4NBZB 1I1AA 5J89A 5DD1H 5GHWL 5F6IC 4C56D 4JFFB 2QR0A 4LCWB 1U93A 4HWZB 2HN7B 3KHQA 3HG1D 4CGTA 4ZO8A 4CU6A 3WNPA 5T1DH 3MRLB 2YS4A 3C09C 1UACL 4MNQA 3SGDI 4H26B 1FE8H 4HC1H 3JV4A 3PUCA 1QHPA 3LV3B 4D0BB 1K5NA 4JFPB 1RUAL 4Y1AD 3QCTH 3MJ8A 3FB6B 4P23B 2H9GB 3ZYOA 3WIFA 3VFNA 1P69B 1KB5A 3GSOA 3BEVA 3QISA 4WFHD 2A6JB 3QZWB 2IMNA 5KSBB 3VDBA 4X4YA 5T1KB 2PXYA 3EGSB 2ZOLB 3SDXE 3WEXB 1Y6MR 2I9TB 3EOTL 2NTSP 3TZVC 5F89A 3A6BH 4Y16C 4WFEE 4OGYL 5DQDH 4YX2H 3TN0D 3JTSA 4M00A 3SKUD 3DNKA 2HJKA 1IAIH 3PV6B 3HC4H 4WO4D 3ROOA 2JB6A 2I5YL 1Y0LB 2MQCA 2RGSA 3IDJA 5FHAL 3GJFH 3QNXA 4TNVF 4OF5A 4I0PC 3PHQA 3F8UB 3LDBB 4QHLB 2DWDA 2EDKA 2FL5B 1IILE 2OJEA 3P11L 3QDGD 4LP4A 2W65A 1JZ2A 2BMKB 4PLOB 4M61B 5CBAA 4XXCA 3CNKA 5IB3B 4XBGB 2XOTA 4RISH 4HWEL 5HHQA 5FYJE 1ULVA 4U1LA 3KR3L 1IQDA 1KN4H 3DX8A 2DB8A 1EHAA 3QA3B 4P57B 4KDVA 2WZPD 3WKNA 1LEGA 1ODAA 3MOAH 3BIKA 4OGZA 2LFGA 4LAQH 1OT1A 4K8RC 4LLAA 5IM7B 2MOVA 4WWKA 4NFBA 4YFLI 1RZ7H 2ADFL 3UTPE 4FMKA 1K9TA 5EA0H 5IGXL 3WJJA 4JPIA 3C2AH 3X11B 1GZQB 2X4SB 3LSOB 5HHXL 4G9FA 2XZQL 4NWUL 3LKRB 1MEXL 2A6KA 4PJCE 1RK1A 2N7BA 4P9MH 3U9UB 1A6VL 5J1AB 4ODWA 2VXSL 4RRPA 1P1ZA 3MV8D 1FNGA 3CFEB 2LTQC 3HMXH 2CIKA 5J8OA 1RJZA 3RGVA 4X6BA 3NCBB 4K71C 1FO0H 1RVFL 3U2SB 4IRJB 3V4VH 3C60A 1B6DA 4LSSL 4IBLT 3GBNH 4Y4HC 5C09B 1WVZA 4UBDD 5ERWB 3FQWB 3CLFL 4QHUA 4M62H 3FFCD 2CRZA 4QWWD 2NY3C 1IM9D 5IROC 3UC0H 5J9PA 3HNSH 4FG6D 4PJBA 3LKOB 3OWEA 1ZVHA 2F54A 4ODHL 1MJUH 2BXYA 2J3SA 1R3KB 1K8DB 4MA8L 3MBXH 5LXGL 3QIWB 4M8QB 4PRHB 1AGBB 2Y5TB 5AWNH 2R9HC 2Z91B 3PHOA 1AD0A 1ZT4A 2VWEE 3HE7C 1RZIB 4ISVA 4PGBB 4OBSA 3J8F7 3ROLA 1JCKA 1QBMH 1AKJA 1EFXB 2E3VA 2ZKHL 1BGXL 5HYJB 2OR7A 1IL1A 3ARGA 5CEXA 3MPCA 2DYPA 4LCUA 3LKNB 1XGQB 2DQEL 4P3DA 1Z3GL 1YEDA 5DEZA 5GJTH 2HFFB 2O5ZH 5CIPH 4EI5A 5T5NG 5HXMA 2AK1H 4OZFA 1MCKA 2YN5A 3MRPB 5E56A 2ESVB 4DN4L 1CWVA 4G43B 1PG7X 3BPNB 1KNOB 5D5MA 1NGQH 3HUJE 2J4WH 3OR6B 3NIGF 2XWBA 3VE0B 1CCZA 1PZ5A 4MXWL 3CH1B 4FFVD 3ZE1E 1JZ3A 2R2HA 3QYCA 2PUQT 4I5BB 4NYLA 1RD6A 1H5BC 5E1AA 5M94B 3BRFA 4I77H 1H8NA 4JG1L 3NH7H 1CFSB 1F02I 1MCPH 5B39B 1Z9MA 5DRZA 3T2QA 4RFOL 3WFEL 4Z8FL 2NZ9D 2R4SH 3TNNB 4JCMA 3TZVB 3L7FA 4WHYH 3UTQB 2DJ4A 4NQXB 3HC3H 3S4SA 5A2FA 4R2GD 2XZCH 2W0KA 4OZGB 1OAXL 5KW9H 2G5RA 1KB5H 5GGQH 1ZHBB 5CSBA 2WINB 3VWJA 1U3YA 3HFMH 3IGAB 1CE6B 2BRQA 1INEH 5E4EC 4PJBE 4FFYL 4APQB 3T0EB 3ARUA 3IETA 4X6DF 3T1FA 4OM1L 2EXYC 4M43H 5MEOB 4JVPA 3AUVA 3MLXH 3OX8A 5DI8A 3CDGB 1GGIL 4NQCD 1CT8A 2Q20A 5F97E 5LAXB 1JN6B 1Q94B 3ARFD 3PQYE 2IAMC 3I3EA 4NNXA 3FTGA 3H9SB 4G6AC 4XPFH 2BNUA 5EU7C 2AV1A 2DRUA 3MFFA 1MFAL 4LU5H 1VFAA 4EI6A 1T5WA 5HTSA 1U42A 3T65B 1BFTA 4HX1A 4FXKA 4F58L 4NZUL 2IAND 2JB5H 4F80A 5IQ9A 5INDA 3BI9X 4PJ9C 5I16B 5JOFB 2EIEA 1ZGLM 1ZWIA 3G5ZB 3D3VD 4J1UB 2Z4QB 3P77A 5D5ME 2LTQB 4IRZL 5IK3B 5DS8B 3PWLA 1FN4B 3CFCL 1WC7A 3Q5YA 4Z18A 2F74A 2NR6D 3TT3H 2G5BA 1HCVA 4QYOA 5J3HC 1K2DB 2HFTA 2A73B 4UB0L 3DVNA 1CGSH 1CN4A 1T7YA 2WV3A 4JM2F 1YEIL 3OKLA 3TVMB 1HK6A 3F7VA 2AJYL 2NY3B 2CUMA 2V5MA 2XTJB 5ISZB 1KCSL 2X4RB 3BW9B 4X4XB 1X5XA 5IF0B 4QGYA 3D0VB 1FVCB 4P2OD 4XXDB 4B0MM 1NUGA 2VMFA 4NHUA 2DM2A 3L1OH 2VABA 1ZLWH 1F3JB 4KI5E 2Q7YB 3VDCA 4BZ2H 1WGOA 2A77L 3FO1B 1N7MH 3HE7B 3ETBF 4NOFA 2WBWB 4E42B 3O3EB 3NFPA 2OK0H 2BJML 2FJHB 5DUML 4HIEA 5JZ7D 3P30L 5DD3L 1BEYL 1N3NA 1NC2D 1H3WM 3DOSA 5CJQH 2QLVB 5C0AE 3BZ4A 4G6JH 1CK0L 4JFDD 6CGTA 5M7QA 5LVEA 1FNSL 2QHRH 2YZ8A 2BNQB 1AXIB 5HHPA 1J8HB 4GBXD 2NY4C 4ODTH 4U6XA 1JYXA 4JFHE 1CI5A 5EORH 3GJFB 5KBNC 4KROC 3CFDB 5DVLA 4JZJB 3LPGA 3U4EA 1H5BB 4HXBH 1F13A 4LGPB 3MNVB 1TNMA 4JQVA 5IESL 1N64H 5IFJB 1UZ6E 4OZ4B 4JAMA 5HJ3A 2HLFD 4YPGB 5IMOA 2H26A 9CGTA 4XBEH 1R3JA 5JIKA 7CGTA 1MI5B 3DIFB 1IKNA 4Y19B 2WLYA 4GT7A 1LO3H 2DLFL 4EN3B 3MRQA 4PV9A 1NL0L 1IFHL 1KULA 2NY6B 3TP4A 5I17A 1GVIA 4XVSH 1NLBH 1TXKA 3QUXA 3SDDD 3FOMB 3DRTA 1EBAA 2R1YA 1Q72L 4HPOH 5D9SB 2NZIA 3S5LG 3G6JB 1MAMH 2J8UB 4CJ0A 1XF1A 3CGTA 3W5NA 1QSFA 3NIFE 1BWWA 1A7BA 3VCLA 4X8XA 1RUPH 4G8GD 4Z7UB 4H8WH 3QG7L 2JIXD 1M6OB 5ANMA 2OCFD 4HKZA 3U46A 4MVBC 3O4OC 3FMGL 3K8KA 2VXTL 2IAMB 4G80A 3WJJC 3FN0H 4EJ1C 1FFNA 4RGNC 5ESVA 1Q9LB 3QAZC 4FQJH 4MDIA 4XNMB 3T0BA 1KOAA 1CG9A 2Q86B 5IMKA 4GRWF 5GGRB 3HPJB 1SYVA 1MCBA 1WUNT 2XWTA 1QOKA 2G60L 5FB8A 5L8LB 3L6FB 2FBOJ 3RGVC 1A9EA 4LLYB 4GKZB 4IDJL 4UV4H 5H37G 2XKNB 5D72L 3DBXB 3VW3H 4AJ0A 3IS1X 3FJTA 1LO4L 5MENE 2UZIL 1ZSDA 2EO1A 2A0LD 2E8YA 4KGLA 1U92B 4B5EA 4N8VA 3TT1L 5TF0A 4KKBD 5CP7A 3VFRB 8FABA 1U3HA 4G8IB 4XTRC 3SO3B 5F1NB 5IW1B 4YXHL 1J05B 1UJ3C 3BP4B 3EYUL 2HJLB 1MHHB 1S7SA 4M7KH 5A1AA 4LSRL 3GMOB 2FLBT 4JM4H 3S9DB 3M8OL 1KTLB 5E8NA 3P4MB 1FH5L 4Y5YC 1BAFH 1MY7A 3GK8L 3O4LA 3RPIB 4MB5A 4OAWA 4HCRA 3X13A 5DEFB 5CEZD 1UXWB 4R0LA 1KFAL 3EAKA 1L4IA 4JDTL 3QSKB 5F7HA 1BQHG 4OLUL 3B9KC 2W60B 3DMMD 1NBYB 5TDNB 3BUYB 4DUWA 3KPNA 2PO6C 5JW5B 1JBJA 3PGCA 1BFVL 4FQXD 4XC1L 1L0XA 1K85A 1YPZF 1FAIH 2P5WA 1YEHH 4XVJH 1AGFA 3R8QA 1XF4B 2WUCL 4N5ED 3CX5K 4KVCH 1JNNH 5FM5M 2QL1A 4R3SB 4XP9L 5L9DL 3C8KB 2V2WB 3B5GA 4HJGB 1MRCL 2HVKA 4TUOA 1BD2A 4EUPA 3HC0B 4KROB 2DM4A 2X9YA 3BP5B 4P3WA 1A7OH 1F2XK 3X3GL 4HH8A 5DJ8A 4CVXA 4AMKL 3WHXB 1CICC 1CF8H 3CFBB 2BNRB 4H8WC 1T22A 1W0VA 5D1ZA 3RWCB 4L8DA 4LHUA 1YMMB 4U1IB 1M4KA 2V5TA 2VLKB 4PJIA 4F9LA 3UTSD 2ITDA 1KELH 4K7FB 4OD2A 5E6ID 1IGCH 5IW3A 3MREA 1FYTB 4HKXB 4LPYA 1DBBH 5EUOB 1QFOA 1TZGL 1H15A 2YD3A 3QXVA 3O3DB 1HHHA 1CDCA 2Q8AH 2ERJC 3L3IA 1HEZA 1YJDH 4P2QA 4LEOA 5GIRA 1JPGA 5C2BL 4MB3A 4HIHB 1RUMH 4ZAKA 4RMWA 1A4KB 3BH9B 1ZHLA 4FTVD 3CPLB 1YEKH 2VDNH 1TJHL 4LDEB 3QBTB 4UNUA 4HGWA 1DQDH 3OHXA 5FK9B 3S35L 1X5HA 1AJ7H 3ARTA 1EUUA 3GDBA 3BH8A 1OTUC 1XMWA 2LU7A 3OZ9H 5HHMD 3TM6A 2OBGA 1A7NH 1VGEH 3EGSA 5D7KD 4XVTL 1FZMB 4R4ND 3KPTA 1MUJB 5GSRB 2X41A 1OAZH 4UNVA 1NCDL 4JB9H 1EGJA 1P2CA 5KAQF 4YFDB 4LLUA 3NAAH 1FV1B 3KXFB 3QQ3B 4HKJB 4XNXL 3BN9C 1F4WH 3BWUC 5H8DA 4NO3A 2ATKA 2YZ1A 1YYMH 3B8YA 2ED7A 1RZJH 1TMCB 4XCNA 4GQ9H 1MRDL 3Q1SL 4I0CC 1I9JL 2CO6B 4L8BA 5LGJA 1NDMB 2GITB 5DK2B 2QJDA 5E8EB 3O6LL 2CMRL 4PJEF 4XBPA 3REWB 3IXTA 4HLZH 2X9XA 1A4JB 2P5EA 2VOTA 4KRNA 5CZVL 3M17A 2AI0L 4QRPA 2P42B 4XAWH 2R2EB 4YPJA 4PJIE 4XGZA 4ZTPH 3H7BB 4RSVA 4IIQA 4Y5YB 5EPMA 3TA3A 4MQTB 3RIAF 3BMVA 1MJ7H 5EB9A 4HUVB 4G3YH 5IM7A 4ZMAT 1QSZA 4PFEA 5F7NC 1YMHB 1BBDH 1HSAB 1CQKA 5GGSY 2IC2A 5K9JL 3L7EB 3V6OC 2PO6B 4LPXA 5DD6A 4JQXA 5IQ7L 1DFBH 3KYAA 2VIRA 1LEKB 5FM5O 5BJTB 1KPRB 1XCTB 2R2CA 5KG9B 1J7VR 1MLCB 3KPSB 1RAMA 4NT6A 3U2SA 1YN6B 4I13B 4HCRH 3I2CL 4H88H 1U8QB 3SEPA 2Z35A 1I4FA 5KN5A 2ZCKH 3FQWA 3MBEC 4G6MH 5IHLB 5JORB 4JQVC 3A6CH 5KSBE 2YEZA 4XHJC 3VFWA 3E6HB 1HI6B 1YJDC 4DGVL 1A2YA 1MQ8A 1IAOA 1CICB 1OAYH 1IKNC 6FABH 3MTRA 1QACA 2DM7A 5TF1H 2BVUA 3P4OA 3RX7A 2JJSA 5MERA 2Q8BL 3OAZH 2LQRA 3MUGA 4Z9KB 2R23A 4JM2C 4RA0C 3W0WB 3U82B 5TFSH 5ESAB 1U8KB 4EUPH 2X44D 3ZYJA 4UINH 2DJSA 3Q3GA 3FQNB 5FYLE 4B50A 2JELL 4PJEA 4GRWH 5EC1A 3RIFK 2J5LB 5CSZB 1OAKH 1S7WB 2DAVA 32C2A 3U0PB 3GIZH 4RWYH 3LB6C 1NCBH 1GSMA 1N5YL 3MRPA 1FL5B 1ZS8B 1Q9WB 4P2RB 2BSTB 4M1CD 1T89C 4G43A 1YA5A 4YHYB 2ZG1A 3BGMB 3SQBA 3DJ9A 3VE0A 1I9RH 3SE8H 1RZJC 3EFDH 1SVZA 3VGFA 1I7RB 3AU1B 2ICEA 1QRND 4KMTL 5F7WC 5HDOA 5I1EL 5F88A 1NKOA 3E6FB 2HFGH 2VZOA 3MYJA 4OT1H 5I1HL 3VXTA 2OTWB 2X7LA 2B0SL 1VADA 3T4AB 2FZ3A 2XFXA 1LEIB 5DJCA 1MCOL 1A6ZB 2GTWB 2R1XB 2G75B 3JWOL 3UYPA 2NLJA 3I6GA 2E8ZA 3OKKA 3RWIB 3TO4A 1T83C 3O2VL 5C09E 1TCMA 1U3HC 3GRWA 3GBLA 5DRNB 3UO1H 5KVDH 1LP9F 2OR9L 1BOYA 1RHHA 3FO0L 3MLVH 2IQAA 5DGQA 3T0AA 2VUOA 1RUKL 4N0UB 3EYFA 1YEJH 1MHEB 4R4FL 2UY7A 4YZFE 1T66D 3CFIC 4YAQA 4MJ5A 4AH2B 4WW2B 3QUYD 3ZKXB 1NAKL 4IMLB 1EVUA 1MCIA 2FSEA 4MWFA 4PRHE 5GGTA 3ZKQD 3G6DL 3QUML 4JKKA 3O6KL 1NGPL 2A6DA 3FO9A 3I6LD 3WFZA 3UPRA 4U1MA 1UWEH 3ZL4L 4HS8H 4X9IA 3D5OF 35C8H 4X6DB 4Z95H 3EO0B 2WIIA 5D1QA 3LS5L 4HMCA 4RMQA 3QNYB 2E7BA 5C2UB 5MEQB 1ZVSB 5JOFA 5F7EH 1MY5A 3RNQB 3QDMA 4DWHA 2YXMA 4HSQA 3EZ8A 2AP2A 1CBVH 1MIMH 2DIJA 3PWVA 4KZEL 5A2JH 3OPZH 5CCKH 1ED3B 1OSZB 1WZMA 5CJOL 4P9HH 2EH7H 5SV4A 2DQUH 1U3ZA 4Y2DA 4MNGA 2IQ9H 3HCVA 3WLWD 1KCUH 4GAGH 5BRZA 3MBEB 5DVMA 3UDWA 4ALAH 2W9EL 2OM5A 1KB9J 4NQVA 2W0FB 1L6XA 4P3CL 4OGXL 4U2YA 3V6FA 1DLFH 1N8ZA 5D1ZC 4DQOL 1OTSC 2XICA 3OV6A 4ZTOH 1FVCA 4WY7L 4F9LC 2DWEB 2IFGA 5HHOA 3V4UL 3Q5OA 1F3JA 4LSTL 4UT6H 1K8IA 1P6AB 4OSUH 3QG6A 1NFIB 3NFNB 4OZGE 3RAJH 2FYYA 1MREH 3D0LB 4NKIL 3NA9H 2GJ6D 5GZND 5TQ0H 4RX4A 4WTZA 3O9WB 4Q9QL 5C3LD 3T1WA 5CINL 3UX9B 1A1OB 5F3BA 2PW1B 5F9JA 3QXAB 1HYSC 4JRXA 3T0EE 4J3XA 3MROA 4NGHL 1S9WA 4D9RD 1OD9A 4GH7B 3FB8A 4ZXBA 5T33L 4UI2A 3O8XC 2FB4H 1ZHNA 3T3MF 4HW6A 1KLUA 4ZFOL 1LQSR 5J11C 4K9EH 2C1PA 1LO5B 1QA9B 2NY5H 5FYJL 3TIEB 2YA1A 5D1XA 4FP8H 3QB7C 4Z5RA 1P84J 5FDWB 4CMHB 1UM4L 1HDMA 2FIKB 5TGBA 4HEME 5T3ZH 1JVKA 1HQRB 1D3CA 3RWFB 3QEQD 5JHLL 4OZ4A 5LBSH 5CP3H 4O51A 1KPUA 1UM6H 1G7IA 3MLUL 4NZDA 3QI9C 3VJ6A 5HY9B 3VXMA 4PY7A 2YSSA 3QUZD 3WJLA 4EN3A 1I8LA 1KENL 1PDKA 1QKZH 3W2DL 1FNHA 4F7EB 2XXMB 3PNWB 3VGAB 3KPPA 4O2FA 2NQCA 4HPYL 4HG4K 5DMIH 2A1WH 3AS2A 3GO1H 4JY5L 1LE5B 5FO8B 1I7ZB 2B39A 5IVXF 4PLNC 4G7YH 4HAGA 1A7QL 3MGTB 2F8VA 4MD4A 2P8MA 1NUFA 4C4KO 3DI3B 3A67L 5AAWA 4U49A 2XTJE 1EFQA 1MF2L 2FX7H 5ISZE 4L3CA 3K1DA 2UZYB 4ZUSB 4YDKL 2G2RB 4LLMB 1XF3A 3TA3C 4JFYB 4HIJA 1G9NH 4P9HC 1FIGH 1IC4H 5DRXB 3W39B 1Q9KB 1WFOA 3GSVB 1TZHB 2Y4SA 2XY1A 4PRIA 5KVEH 3F6LA 4LVNC 3UXFA 4Z7VA 1T1WB 5ACZA 4A6YA 5GRYA 1Q9LA 3DUUA 3VI3F 1K4DA 1Z6JT 1Q9OA 4L3EA 1XGTA 5CJXC 2KZ1B 1M7XA 4DKEL 4HJ0C 5CBEB 1UADC 4F8QA 2ADJA 5I15H 1B2WL 4MJID 4D8PA 3MV9D 4ELMB 5JUEL 2LE9A 4JQIL 4K7PL 4GKZA 3IFLL 5E95B 2OZ4H 3M1BA 3EO1B 4WI7A 2BNQE 5EOTB 4OLWH 1J8HE 3O3BA 3H42L 5EC2A 4FQIH 1RMFL 1NBZB 5E08L 2OTUA 3QO1A 4PJDA 4F7CB 5F7DB 1JUFB 4LDLB 5J4MA 1MFBL 3L3HB 5IMLB 1J0KA 3AREB 1UENA 4DGYL 2AJZB 5E6YA 2XWJB 1M7DA 1NMAH 1P6FA 2J88L 5KVFL 4G8IA 4ZPVA 5ECJE 5TE6H 1J05A 5E8DL 1ZK9A 1MNUH 3GMOA 5SWSA 1MI5E 5CLWA 4EDWH 4Y19E 4XMLH 2PF6A 2ICWB 3HNTH 5C0GA 2F19L 1OGTB 4K3JL 5EUKA 4K9EC 1NCWH 3MV7D 4OD1H 3QFDB 2NY5C 1OW0A 3SOBH 4K94H 1KCKA 5CMAA 4U7SA 2GAZB 4RFEA 5A43C 2ARJA 1MWAH 3TBSA 1IGIH 5DURB 1N6VA 1I9EA 4WCYL 4YO0B 5CWSA 3MNZA 4RGMC 3U1SH 3CVHA 3G6JE 1KT2A 4GSDH 2R4RH 5HDLA 2J8UE 4MJ4A 4X7CC 2X70B 4MDJA 3WIHL 4CUCA 1U2HA 3IJHB 4ZS6D 3S5LA 4X7TA 3BKCH 5D8JH 3C5JA 1ZA3A 5AUMA 1GOHA 3TO2A 1YEEH 1NSNL 5EU7E 3GSUA 5KVGH 4Z7VE 2BVEA 2YKLH 1N6QL 4KJWC 5E94B 3R1GH 4D0CB 5TPWH 2UY6A 1OTTC 1XCQA 4WDIB 3C5SB 1N0LA 3RDTB 2IEPA 5HHNA 1YPZB 4FN0A 3E2HC 4NKDA 2A6IB 4NQEA 4W4OC 1UVQB 2BVOA 1F58H 1NBVL 2X4PB 5B3JE 1X5LA 5JHDB 4P59H 4UMGA 5ADPL 1L6ZA 5F1IB 4LCIL 2WLZA 2HJFA 1G9NC 4MYWB 3VXOA 3V79C 1X5YA 1WLHA 3QI9B 3VWKC 1RZFH 3TYGL 5DHXB 3TO4C 3BQUD 3LN4A 4PJDE 2HRLA 1JV5B 4NC2B 3BGAA 3JWDL 3TBYB 3VXNB 2WW8A 2BOCA 1W8NA 5DJ0B 1WT5C 1MCRA 3VA2C 2Z31A 4I3RH 5EIVA 2VLJB 4QHNB 4WTWA 3RPKA 4PJ5A 1AGDB 1W72A 4ZO7A 3RNKB 2EZ0C 4GXVH 5GISH 3MRJB 1CVSC 2KZWA 1YUHB 1PG7H 1SJEB 3WUWB 3GUTA 4JKMA 1F90H 2AQ2A 2EDOA 4PY8J 4YXLH 5TE4L 1E0OB 3E3QE 1D9KD 2H3NA 3VXRD 1E4XL 1NGYA 2ADGB 4Y4KB 4HLJA 4LVNB 3IRPX 5B38G 3HKFA 3MRNB 3SKOB 3WNOA 3RVWC 1G7MA 2FX9L 4OFYD 2AK4B 5C70A 2YR3A 2VZVA 1N2RB 1IC1A 2NY0D 4L9LC 4NUGH 3QHFL 4S1DC 3F12B 1ITCA 4QXUH 1PSKH 1BQHA 5IG7B 1G7LB 2ZUXA 1VA9A 4DKFL 3Q5TA 4K94C 3KXFA 4ZOAA 3SCMD 4WI2A 3DETD 4M1DH 1HILA 4JO2L 4Y2DC 2XQBL 3QWRA 3MLRL 5TE7L 1GGUA 4FQLL 4NDMB 4ODVH 2CLVB 1E4WL 3UDWC 3ULSB 4A6YH 5I1IL 3K2UH 5DDHA 5ITBH 1MVUA 4OLZL 1V5JA 1EEYA 4GW5B 2GITA 4EIGB 1AD9B 2QQKL 4HULB 4Q2ZA 1C16A 2OQJA 2Y36H 5ELIA 4M6OH 2BNRE 2CDFA 4RMSA 1C7TA 3EYVA 5ID0B 1F11A 3PDDA 2VN4A 4NRXB 3MZGB 4Y7MA 5JXED 1D6VL 2NW3A 1YMME 1ETZB 4JHWL 2Y7QB 2H1PH 4UQ2B 4NQDA 3B83A 4UQ3B 4GMSL 1FYTE 3VRLF 4GAJL 5GRVL 2YD5A 4KK5C 5EUOE 1FORL 4XZUB 1SM3H 3MACL 1FG2B 3SDYH 1A9BB 4KK9C 4M6ML 1IGYA 3QFJB 4RGMB 4OCLC 3BD3A 5L88H 3IJYA 5CD5C 1GGCH 1VKXB 1PBYA 1G7PA 4PJ5E 5I30L 3THML 1AI1L 4F2MB 5D7IB 3U83A 2H32B 5ALCL 3NGBC 5EU3B 2YA0A 5BJTA 3LH2H 1XCTA 3BPOB 2D31A 4HJJH 4BFBD 3U6RB 2QADD 1W2KT 1LK3H 1YN6A 2EKSA 1KF9B 1TITA 4FXGB 3GBMH 5CJBA 2P45B 1OB1B 2NXZC 3LPFA 4EQ3A 4KUCF 1W0WB 1G0YR 1UEYA 4DUVA 4P99A 2YD4A 3DO7B 1YQVH 1EX0A 1NGZA 4CU7A 4U6VH 3MCG1 1FZOB 4OLEA 4X8JB 4DAGL 3BO8B 3UJIL 4NN5C 4GG6A 1S7VA 1T1XB 2XNAA 3PDGA 1J86A 3P73B 3WJLC 5IV2A 1FSKB 1KJMA 4ODXB 5EO1A 4TNWK 4TUJB 3RFZC 1QPPA 2IMMA 3KXFE 3ARWA 5TJWK 2F53A 5H35A 4DOHB 1IQWL 2XKUA 3QDJB 3VWKB 3BKMH 4PR5B 5LQBH 3IDGB 1UB6B 5FYJD 3ULVD 1E6JH 4YUEL 1II4E 4CU8A 4ZFFA 4DZBB 1UT9A 2B20A 3PP4H 4W68A 5C0JA 2A83A 4JO4L 4JN1H 5CSZA 3UTTB 3O0RL 2AV7A 5GJSH 2ZG2A 1J88A 1UZ8A 1ZLVK 3QIBD 2YOCA 3LEXA 4LLWB 2WSKA 4BQ8A 2GYSA 4NSKB 1MCSA 2IALB 3HLAA 2GT9B 4OTXL 1WZ1H 2H8PA 2DQCL 3DXAB 1DQTA 3CMOL 5IMMA 1B90A 4WHDA 3UJTL 1TQBC 4PJXF 3BIAX 3AU1A 2GTZB 3ZDYF 4NWTL 5DWUH 5C0DB 3RL1B 1B4RA 4L4VA 3BSZH 4JN2B 5D7LB 4O2EB 1DUYA 1AP2B 2E9WA 4L9LB 5E2JA 1RULH 5HD8D 1M1SA 3T4AA 2D0FA 2VLRA 3KPSE 4ODSL 4XVUC 2NW2A 1LEIA 5EFIB 1J1XH 2IH3B 3QPXH 1YEGL 1P4LA 1XR8B 1PEZA 2DLGA 1ZA6A 4HF5L 3NPSB 1U95A 4BUGA 1MWAB 2NX5A 3L5HA 4JG0L 1SEQH 3GSNA 5DRNA 1S9YB 2V7NA 3SPVA 4XCYB 2F58L 4H5SB 4GG6E 3BZFB 3V0VA 1DBML 3IJSA 4S1SL 1RIVH 1QPXA 1DN0B 5TH2A 4E41A 3SDCD 1CDGA 3DYPA 4BM7A 3H7LA 3ZT7A 2FIRT 1QR1A 4X6CF 3ORJA 4AH2A 3QHTC 2HFEB 5I76B 5E7FA 2F53E 3IFPB 4LLVA 4C56A 1HH6B 2NY7H 3PXHA 3PWNB 4OFDA 2VDLH 3HG1A 4ONGL 3P9WB 3S88H 1PEWA 2JCCA 1K3IA 5HHVL 1SY6A 4ZODA 1IT9L 3MJ7B 5EO0B 3KNBA 3DUHA 2AJ3B 1C5BL 1WWCA 4JHBA 4XWGL 2FEDC 3OJDB 2VZSA 3TBTA 1ZT7B 5ENWB 5KJRH 2R1WB 4P2RE 4P49A 4S10A 5DJXB 1S7QB 1IKFL 3ZT5A 3JZ7A 4FHBD 4P46D 1RPQA 1X4XA 3CJJA 5C92A 4PRDA 1G7HA 3O2DH 4PJXA 2L7JA 4GAYB 2A9ML 1OSZA 5KSAA 5JQ6L 1E4XI 1NC4D 4D9LH 1FFPB 2NXZB 2W0LA 3RIFF 4G9DB 3HE6D 4G6FB 3C60D 5FKPA 1V7NL 1XF5A 2R29H 5IBUG 1R3LB 1GAFL 2W07A 3I6KA 3MA9L 2I9LA 4FFZH 1JZ6A 4M7LH 4UDTA 4UIMB 3ZZ1A 3PDOA 3MRHB 4WO4A 2GCYA 4YHOH 5L6YH 3ZKND 4QHKJ 5KZCB 1CE1L 3RWJB 4LCYA 4ZG1A 5FAAA 1YYLH 4I2XB 1ADQA 4I9WD 4YBHA 2OL3A 1UC6A 2NXYC 1TJGH 3U0TB 4W6XB 3ES6A 2NX5E 3RZWA 1ZHKA 5DT1L 3QULB 3SGEH 4U6HB 5C6TH 4DFIA 4DW2L 3PQYD 3O9WA 2GJZA 5E5UB 4N0UE 2IADA 1AR1C 1RJLB 3U4AA 3MJ6A 3VFPB 3C8DA 2HH0H 1AKJD 4YBQC 5C0NC 4Y89A 3NPZB 4XPGH 4X6CA 1KTRL 3U30B 1OP3K 3ARGD 4KQ4H 4U3XA 1HOCB 3OTTA 3KS0H 2X4QA 4C56E 5I0DA 1FAKT 2BDNH 4IHOA 4N5UA 1FL6B 5BVPL 5FO9B 1QBBA 4N9OB 3CX2A 2GUOA 2X05A 4OCMC 4QTHB 2H2PD 2JCCE 43CAB 5C0FA 1YECL 3GMRA 4XRCA 3G5XB 3VFGH 5JW4Q 4YFLF 1TQBB 2HT2D 4Y8AA 2FIKA 5EN2A 1KJ2B 3I84A 1JGLH 1AE6H 1A7PL 2V2TA 2VL5B 4P4KB 1NANI 3LHPH 3VRIA 2J2ZA 3MLSL 4JPWL 4NM8H 3QIUD 3WLBB 1UQSB 4OKDA 2DF3A 1QZ1A 4KKAD 2X1XR 3VFTB 4ZUVB 1ZLSL 2YPLB 4LF3B 3BEWB 3HI6L 2D7TH 4IOIB 5A40E 4PJ8C 4BFEA 3GNMH 4U1GC 3AB0B 4WFHE 3I02B 1OARL 2F5AH 1WFUA 3GMMB 5K9OB 3FFCA 3BZDA 5FO8A 4KI5D 4J6RL 4U2ZA 4GG8B 5EZJB 1P7QB 1U8OA 2P44B 3MRDA 1Y6KR 4GLRH 5CHNB 4BK4A 3MLTA 5BS0B 1KACB 3H9HB 2G2RA 1DSFL 3MRKA 2HTKC 3KPRD 2H41A 2HKHL 2A74A 1R3HA 4UTAL 4YR6B 4N0FA 1CTNA 3FFDB 4X99B 3NZ8B 2VXUH 5C0CB 5C0AD 3BZEB 1EGJL 3QPQD 1IC5H 3EOBA 3GSNH 2RR3A 1NAMA 1F4YH 1EO8L 2KKQA 5FM8A 1BM3L 4XCFH 4JFHD 5EZOL 2EC8A 1JPFA 2YRZA 4P5TB 4NKOA 3U7YH 1T3FB 4P5MA 1DBJL 1KPVA 1R3IH 5FYLL 4BQCA 2ICWJ 1R6VA 4ELMA 3X3FH 1A3QA 3LRSA 3S35X 4AK1A 4U1HA 3K0WA 3CDFA 1LO0L 5DMGD 5I9QC 4PTUB 3KDMB 1NBZA 4LCCA 2FO1A 1LD9A 3OKNA 5F7DA 3STZB 2ZG3A 1SY6H 3SJVB 3AREA 4X80H 2XWJA 3GSRB 4YWGL 1D5BB 4RGOH 3TNMA 3FRUB 3K4DA 1A3RH 2C3WA 5MI0C 1HYRC 3QCVL 3K4ZA 4ZOEA 4DGIH 5JW3L 1NCCH 5DJYA 1F42A 2VJXA 3MXWL 2R0WL 1GL4B 2WP3O 4P2YA 4UNTA 5DRWA 4WWID 1BLNB 1CD0A 5IHZA 1BZ9B 1ZOXA 3ALWA 4P5KA 3SQOH 4PJHA 4MD0B 2Y72A 3PHSA 1Q1JL 2NXYB 2YUXA 3FFCE 2HMID 5DGRA 3L5XL 3RVVC 4CMMB 4HUWA 4X7DC 3SY0B 1F6AB 3QRGL 3MLWH 1ZT1B 1M71B 3KLAA 5CILH 3LZFH 3FL7A 3GMNB 3VXSD 2ORBL 1GPOL 4NQCA 1V05A 4AL8L 3D9AH 1ES0B 3ARDB 4C83A 5A2LH 4X5XA 1I8KB 1T1YA 4LNVA 1B4JH 1NCAL 1TQCC 3T4YA 4DZ8B 5LGHL 5IJKA 2OL3H 1G7QB 3NTCL 3HR5A 4IRSD 1L7IH 3FZUC 1RUQL 1G6RB 3OKEB 3P9LA 1C12B 1G84A 5J12C 1Y18A 4NO0D 4Y4FB 4FMFA 2IANA 2LAAA 3EUUA 4WI9A 1B0GB 1IGTB 3ZHLA 5MEND 1DVFD 2VISB 4QOKB 4XP6L 2R8SH 4Z76B 4EBQH 4HWBA 3VXQB 2BZDA 3D3VA 1KYOK 2DQFA 1NCNA 2Y1VA 1TIUA 3TV3L 4HQQH 2R15A 4ELME 1JTOA 3U4BH 2APWA 3RP1A 1J10A 3HN3A 2FH6A 2RQ8A 4R4BA 1GCFA 2CGRH 2W1NA 3X14B 4EEEA 5EG6C 3FKUS 4NN7C 3TCLA 5EZIH 5HDQL 1OHQA 5C0BB 3TBYA 2QKIA 3MUHL 4E9LA 2CJUL 3BYYA 1A0QL 4UOJA 2I24N 5F7LB 4LVEA 3SKMB 5CD3B 4ZOCA 2Q76B 3LKPB 5IVOA 3V8OA 2VLJA 3EFFA 3SGDH 4P2OA 1MELA 2R0ZH 1IEBA 5K93A 5BO1L 1HH9A 2G9HB 5AZEL 4QRUB 2IBGA 3O2WH 3VH8B 4WW1B 3DV6A 3DX7B 4PJHE 1CD1B 2DLHA 3RX5A 2BY3A 1T2QH 1BJ8A 5IW6A 1FBIH 2AGJL 1FGVH 4ZSOB 3SKOA 4WEBL 1BZ7A 3UYRL 1NC2A 1BJMA 1U6AL 5FYKU 1S78D 3GRWL 3LAFA 3GHEH 4HK0A 1NGXB 3I3BA 1J9CT 1FFOB 1MFDL 4O58H 4NQSB 4JFDA 5C08D 3NCJL 4S2SB 3BAEH 1KLGA 3MR9A 4JLRB 2ZP0T 1WJ3A 4URTB 4GBXA 2FGWL 4XPTH 1JI2A 3LMJH 3SE3C 3O6FD 2OJZH 5I9QB 5IOPA 1CXKA 4CADA 1N4XL 2IFFL 4UV7H 4HS3B 2IANE 5FYKE 1T4KA 1NAMH 5C8JA 3WO4C 4ZOBA 4BH7A 3WFDL 5FUOH 2VZ3A 4GW5A 3MCKA 3TN0C 1J12A 1XIWC 1CIUA 3WD5L 1E4KC 4J3TA 1QFUH 2JJUA 3BIBX 5JHDE 5SX4I 3HZMA 4GKNB 2MPAL 1YC7A 4Y5VB 1BVKB 4XI5D 4CJ1A 3DVGB 2MJWA 3WN5C 5SWZB 1IEAB 1HQ4A 1ITBB 3JVGC 2UYLA 2BRRH 2WUBH 3MMEB 3SDDA 4UUJB 4JKPH 5FDYA 2W0PA 4ZFGH 4PJFB 2DQHL 2VUYA 3O11A 2AJXL 4YIQB 4O4YL 1FG2A 5K9QI 2EICA 1XZ0A 2EXWD 4ELKB 2V7HB 4JANB 3G08B 1X44A 2VR5A 4HBCH 2VTFA 2WBKA 2VLJE 5K9KA 1I3GH 3CFJA 1YY9C 4XPHL 5A16B 1CR9H 5CJ5A 4G8GA 1HHGA 3GB7B 4OM0H 2BOBA 4I3SL 2JIXA 2H32A 4QXGH 3LQAL 5EU3A 2EEBA 4TN9A 4NM4L 5GS1C 2APFA 1TQCB 5I8OH 4HUXA 3L3KB 4NRYB 5MP6L 2EDHA 2H2SC 4CRPA 1IC7H 4OKVB 4IM8A 2Z93B 1P5VA 5FHBH 1ZGLA 5J12B 3CVIH 2AK4E 5FUZL 1OSPH 4RQQB 3PABB 1FRGH 5D7SH 5B38A 1UYWH 3QEHB 1KBGH 4UIKL 4QT5B 4KJPC 3TIDB 4GKOA 1F8TH 5ITFA 1YNTA 3A6BL 4WGVB 4LKCA 5EU4A 1I7TA 1IMHC 5DMKB 4JKWA 1IAIL 1CDYA 4KTYA 5E1HB 4FG6C 4NN7B 1XGYH 4W6WB 4NJAH 4CNIB 3JWNC 2R0KH 3C9NA 1TCRA 4X0KA 4JFFD 3FN9A 4LCWD 4OV5B 1AHWC 4OZIA 2LAGB 3FO2B 4HWBH 3PGFH 3WKML 1GOFA 1MJ8H 1CLZL 2FJGB 5I19H 4QO1A 4YHZH 2EDRA 1FVEA 3NFSH 1RZ8A 2NTFA 4ODUA 4FNLH 4ONHB 5JO5B 2CIIB 3KYNB 4RISL 3F62A 1D5ZA 1L0QA 3V4PL 3IDMB 4NO2A 4OF6A 3DMMA 4NZRH 1QR4A 3MOAL 3QFJE 4P23D 5AYUL 5C0DA 3ZYIA 5J56B 5MEPA 1T6WA 4FQXA 5D7LA 2DMKA 1U8IA 4NUJB 1NDGA 4O2EA 4OCRH 5D7IE 1S9KC 4J3SA 4WI8A 4Q0XH 3WYRA 1X3DA 4MA7L 5HDBF 1TPXC 5T1KD 4EDXB 4FFVC 3DUSB 4L4JA 4MJ6B 4FQCH 4LRNH 5EFIA 1HINH 3MGOB 5E00B 2IH3A 5I1KL 5E99H 3IDYC 3K8MA 3FT4A 4HS6A 5DJZB 4XCYA 4P4RB 1P4BH 4PD4K 1P9MA 1JNLL 1BQLL 1U8LA 3WO4B 1BIHA 4I4WA 1XIWB 2GSIA 3MJ9H 5FYLD 3JTTB 3UC0L 5F3HA 4JO3H 4R2GC 4YXKH 3UTSA 5E6IA 3IAGC 1D5MB 1W8OA 25C8H 2HFEA 3ET9F 5GHWH 3IFPA 4DOHE 3FOLA 5HPMB 3WN5B 1MJUL 4PGDA 3IDNA 3QH3B 4JFXB 2O5XH 3UJJL 1FPTL 4JKLA 5J6GB 4HFUL 3CH8A 4LARL 4KK6D 3MJ7A 3DYOA 3Q0HA 2MHAB 4NHCL 1UACH 4D0DB 2CO7B 3UTTE 4OZIE 4YDVA 3LIZL 1QBML 3ESUF 2KBGA 1RK0B 4DK6A 4CVZB 3ARFC 5I1GL 4TNWF 4MAYC 5FF6A 2NNAB 4KTDH 2ZCHL 4YGVB 5GJTL 4FTVA 2R1WA 1S8DA 1RUAH 4WV1B 4ZFZB 5L8KB 4BQ6A 3REVB 5CEZE 5IJKC 1W0YT 1NEZB 4RAVB 3MUY1 5GS1B 1OGAB 2HTLD 4MAUL 3DXAE 5FCSH 4KK8D 1KJ3L 4WFFD 3FQXA 1H3PL 4M48L 4U1KB 4IRJD 4E0RB 5JIHA 3V7AG 5C09D 2WAHA 3EOTH 3MV8B 5D7LE 4YBLB 3GJEB 4OGYH 2GW5A 3BJLA 2N7AA 3QQ4B 4K7PX 4N9GA 4RZCB 5F8QC 5E2TL 3FQUB 4CAGA 5T1LA 4LNRA 4K55A 2I5YH 2MCPL 2YPVL 2FGZA 2R2BA 3UEZA 1T7WA 3AMLA 1JHLL 5FHAH 2VRAA 2MKWA 1A1NA 5IP4A 4PGCA 3NCYP 3OG6B 2ARJQ 1XEDA 5IFAL 3PWJA 3AROA 3WNMA 2VDRL 1QG3A 3QIWD 2HAZA 4MQ7A 4PRHD 4Z7WF 3P11H 5IB5A 1FL3B 3LQMA 1RJLA 1T5XB 5KW9L 2HT3D 1PKQA 3R0MA 4HWEH 1AHWB 1EFXD 3H3KA 3KR3H 5BV7L 4K3EL 1M05A 2VNCA 2YHGA 5D2LF 3DX9A 1MCWM 1EXUA 3S37L 1J1OL 4HDIA 4AM0A 4QKXB 4M43L 4MCZB 2X10A 3WSQL 5BZWB 4TTDC 2HWZL 4AENA 2ESVD 2ADFH 2Q87A 2E27L 3IU3B 5IGXH 5JZ7C 3MV01 2EIDA 4R7DB 5HHXH 1A14L 2XZQH 4NWUH 2WANA 1IAIM 3T08A 2VXQH 4LU5L 1A7RL 1A6VH 3T2OA 2VXSH 5I73B 3EO9L 5D71L 1S5HA 4FTVE 4GBXC 5ABDE 5J06A 1RVFH 3Q6GL 4HEPG 3BEWA 4LSSH 4R7NA 2WWKO 5E03A 1W72L 5HSFA 3WDJA 3TZVD 3CLFH 3P9MA 3H3BC 4BFIA 3BHBB 3IDYB 5GS0L 4D2NA 4R8WL 5D7KE 3V0AC 3HPLB 5L0QB 1T04B 3ZKMC 4GG8A 3ZE2F 1V3KA 3B6SA 3D69A 4KUZL 5J13C 4ODHH 3T3PE 3HRPA 3I75A 5CGTA 1Z5LB 3OAUL 1KN2L 4MA8H 4OF3A 5LXGH 2CKBB 5EBWB 4APQD 3T0ED 1TDQA 3SDDC 4S11A 2OP4L 5KS9F 2YPKB 2YC1A 4PREB 4WFGE 1DANT 2WIMA 5GGUB 1IAII 4Z7WA 1FNLA 4LGSB 5H94B 1S7UA 1A02N 4NKMA 2X1OA 1Z3GH 1JGDB 3H9SD 5D70L 2VXVL 1PKQE 1P53A 4K8RD 4P5TA 1QFHA 2B8OT 5D2LA 3I3DA 4DN4H 2EYSA 2Z92A 1KG0B 5FO7A 3WFBH 3LN5A 4GW1A 1S5IL 4MAYB 5DFVD 5ICZB 5AD0A 2P8LB 4RA3A 4PJGF 5C7XL 1I1RA 3SDAB 3V5HA 5ACMA 2P24A 3ECBB 2JJTA 4OCWL 1QRNA 4J4PC 4F37K 4ZYKA 1LWRA 2BP3A 3EYOA 2RIKA 3CZFA 5ETUB 2VE6A 4JG1H 3STZA 3VMOA 3VXUB 1EH9A 3L5IA 4ODTL 2AEQL 4RFOH 4AG4L 3RL2B 4LVOC 3MRCA 3WFEH 3L3JA 5KVMC 4Z8FH 2Q3ZA 4AEIL 1UM5L 2ENYA 1MCHA 1F5WA 4OI9A 1XFPA 1MIEL 4CN4A 4Z77B 2YUVA 4RNRA 5IEHA 2HVJB 3TVMD 2C3VA 3BKYL 4DTGL 2YPLE 1JGEB 3KPQA 1T0NA 2MTPA 1GZPB 4L8SA 2XTJD 2OX5A 5ISZD 3HI1B 1OAXH 2VAJA 1LILA 1JHTA 5EBMA 5GRVK 2FJFB 3TF7C 1UCBH 2VC2L 2D0HA 4FFYH 1FZKB 3D2UB 3BP7A 4OM1H 1S7RB 3HE7D 5EZLB 1C8PA 3QUYA 3GEWB 1GGIH 5DO2C 5BS0E 1WCBA 4YHIB 1YQ2A 1ES0A 3OKDA 1MAML 3S96A 5J7CC 1U8PA 3ZT6A 2EE9A 1MFAH 4X6FB 4QTIH 1QSEB 2EYTB 4H1LH 5C0CE 3HI5H 1OP5K 5I1AB 5TQ2L 1YZZA 2WWMC 3NZHL 4UT7H 3HZVB 1C12A 3QJHA 4XH2A 1T03L 4NZUH 2BNQD 1J8HD 3FT3A 4JFZL 3CFKB 2B4CL 5SV3A 3RUGF 3UCRA 4C57C 3PL6B 4JHAH 4ZPTB 3FN0L 1R5VB 4PGEB 4WU7A 2I60H 3DTXA 3MO1A 3KYMB 3T0XA 3PF2A 1WBZB 1CL7L 3FONB 3CFCH 3O3AB 1SBSL 4QF1B 3OGOE 4PRAA 5L2KB 2VZ1A 3OR7A 5JOEA 1MI5D 4FS0A 4Y19D 1HHIA 4YHML 1NMBL 2C1OB 4UV4L 3MLZL 4EN3D 1P9MC 3VW3L 1RY7B 3O45B 1GRWA 2AJYH 3R06B 2KDGA 1WBXB 4MZ2A 2JK5A 2NY6D 1KCSH 2CD0A 5DTFA 3LKPA 2DICA 4WHTA 2DL2A 5KSVA 3RWEB 4HFWA 1CU4L 2OI9C 4I0KA 4QCIA 2VERN 1KIUA 2G9HA 3LKQA 1QBLL 3BOVA 2A77H 2APXA 3UTZA 1MCWW 4OIIL 3DX7A 4G8FB 2EXYD 2L7UA 1QFWL 3ARBC 2GJ6A 2HRPH 3CSYA 3ZDZE 3SE4A 1ZLVH 2BJMH 4HUUA 5DD3H 4D9QE 1BEYH 2DQIH 2IAMD 2Y6SC 1LDSA 4G6AD 2MMXA 4J12A 4X6EB 4ZO6A 1SYSB 1KTDB 1FNSH 5HYQA 4HWNA 5B8CA 4GKSA 4PP2A 1YN7A 2AKRB 4PJ7F 3DRQB 3Q2CA 2VQ1A 1E28B 4G6KL 2QEJA 2ADIA 2GHWB 3RUGA 4R4NC 5HGDA 3RVXC 5DXWA 4R90L 3IF1B 4QOKE 3QEQA 1BWMA 4FQQB 4GRLB 5LGKA 4LVOB 4LIQE 5DC0A 1TVHA 1LDPL 4AT6A 5J3HD 1A7OL 2X9WA 1C5DB 3QUZA 3OXRB 1NL0H 5I74C 3QRFM 5SWZA 1IEAA 1X4YA 3SBWA 1IFHH 2XY2A 4NNYB 1B3JA 3VFVB 3MMEA 2GFBB 5L2JB 2D3VA 5DUPH 4DJMA 1XR9B 5C0BE 4JREC 1IGCL 4XNZC 5AAMA 3B3IA 4HXAH 4ELKA 1SJHB 1IGJB 4GOSA 4UTBL 4X98A 3N50A 1A5FL 2VITB 3QG7H 3GB7A 1BP3B 1F6FB 3RWGB 3GSWB 3U79A 5F72S 3FMGH 2VXTH 4K3HA 1R5WA 1DDHB 4N0CD 2DD8L 4YHLH 1I1YA 2P4AB 1XH3B 2I07A 1T20A 3QJFA 1DLHA 3TGXA 4CW1B 5E5MA 5BW7A 3RZCB 1NFKA 1A1MB 1WQVT 4ZSOE 5BZDB 1QO3A 4PY8I 3DX6B 2GSGB 1DQDL 5IVNA 2G60H 3EIFA 3X12B 5T1MB 4KROD 3DURA 5IR1A 3MV9A 1A6TB 1NFDB 4IDJH 3ZYZA 5D72H 3N85H 1A7NL 5F21B 5DFWH 4F8TA 2NCMA 1U8HB 2EDJA 5EIIB 2BNRD 3Q48A 3TBWB 4ZUUB 3GMLB 2KH2B 1U91B 3BE1L 3TT1H 5GZOC 1FCGA 2X4OA 1YMMD 1N5AB 2VLKD 3D85B 4PJAF 5DHVA 4Z7QF 15C8L 4Z0BH 4YXHH 5K59F 2W59A 3EYUH 1ORQA 2MKLC 1FYTD 3MRMA 4LSRH 2Z8SA 5F8RC 1YYML 5EO9B 5GRXG 1X6LA 3HAEH 3M8OH 3H0TB 5JPMB 3ULUE 2OI9B 1BBJB 1NMCC 2Z31D 2EH8L 3MV7A 4NC1C 3G9VA 5SWZE 1I8MB 1N0XL 1QVOA 5BMFL 5CZKA 1X5ZA 1KFAH 4PJFE 4W70A 5GSVB 4O9HH 4XAWL 1A6AA 4HIIA 4JDTH 5JLZB 5EU5B 3ARBB 3MGAA 5GS0D 3ZTNL 4OLUH 4OFKA 2BVQA 3QO0B 4YHPB 4POZD 4KJYA 5E9DB 4ZNEE 1OP3H 1OD7A 4TVSa 1R5IA 4G3YL 2VDKH 2X1QA 2N1KA 3QEUA 1G1YA 2PYEB 4XC1H 2ZSWA 4BYHA 1AIFB 3KPMB 4RIRB 1OP9A 2FR4B 2WUCH 4U1JA 1WV7T 2ZUQC 5FGCB 2M1KA 1FG9C 4YDIL 1OCWL 4WRLA 4XP9H 5L9DH 2GK0B 2XACC 4ETQB 1MRCH 1DFBL 2MQ0A 2BSRA 2DQDL 2PYFA 4YDLB 4TUKL 1TJIL 3X3GH 1CLYL 5IJVA 4AMKH 3KXFD 1EK3A 1PY4A 3QHZL 1OPGL 4MGXA 1S3KL 4HHAB 4C58B 4WJ5B 2J12B 2QQLL 1KIPA 4G6ML 3OQ3B 4HBQA 4R96A 3JTTA 4L8SC 3BQUA 4XTRD 5I74B 4H25B 2X4UA 5HI3D 6FABL 4H1LB 1NJ9B 5TF1L 1TZGH 1WAAA 1VERA 3RVTD 4EVNA 3QH3A 4PJAA 2DMBA 3HZKA 4JY6A 5BVJA 4TSAL 4DKDC 4PRPB 2V17L 4PYHA 4X9HA 4S1RH 3RY6A 1JTTA 4U0RC 3BWAA 4L29B 1FC2D 3QUYC 2OSLA 5C2BH 4IS6A 1PYWB 3LVEA 2VQTA 3B5TA 3MV7E 3VRJA 2NNAA 1TJHH 3I9GL 1BIIB 4LMQE 3SDXF 2PO6D 2D9QB 3S35H 1D9KA 3VXRA 4PS4L 1QFWI 4ONFH 4O5LL 3VG9C 3OKMB 4OFYA 3EYQD 3VFOB 3KPSD 3L9RB 4E0RA 3SE8L 4BSVB 4XVTH 5DQJB 4U1NB 2BVPA 2NY1B 2EDTA 2KL6A 3EFDL 3K81A 4YJZL 4QRQB 1KCVL 2UWEB 3ZTJG 3ARPA 1OAUL 3SCMA 1CZ8L 2XRAL 1AO7B 4HKBB 2AABL 5DJ2A 1CICD 1I8IB 1FVDA 1PFCA 1Z0NA 3WLWC 4Y5XA 4MCYB 5IB4B 5I18H 4I18A 4N1CA 3Q1SH 1I9JH 2A9NH 4OFIA 3O81A 1JNHB 2AXFB 1H3VA 1U8NB 2F53D 3VD5A 3RTQC 1AQDA 1JGVL 2IPKA 3O6LH 1OLZA 5KOVC 3W0WD 4XWOD 2CLZA 4OZHA 1O7SA 2YUWA 3MA7A 1KIRB 4HWUA 4HUKB 4Q6IA 4S1QL 5CZVH 3UO1L 3OKYA 3RA7L 2AI0H 3BXNA 5HGBB 5JXEA 2L4OA 1A8JH 4F7TB 2YD9A 3MOBH 5FYKL 3DGGB 1CIDA 3DROA 4DEPC 2ICCA 1BFOB 1D6EB 4MSWB 2P8PA 2WWKT 4YFEA 4PJCF 1WAAE 5EBLA 5FA4B 5GZNC 1G7JB 5C0IA 3F7RA 1K4CA 3IVKB 1LNUA 1TZIA 4JHZA 4AEHL 3QZWG 3G5YA 4P2RD 1AGEB 1C5CL 3N9GH 4L4TB 3STLA 1ZGLP 4R7DA 4AEFA 1WBYB 1J1PL 2EIBA 3WNNA 3CC5B 1UWEL 2CUIA 4HS8L 1GGTA 1WCQA 5I8EA 4Z95L 1JRHH 3BDYL 4UU9A 1OQOA 4XHQA 4BKLA 5INCB 3SDXA 4MNHB 1OTUD 3V6ZA 3LRGA 3I2CH 2IGFL 1EEZB 3WS3A 2AXGA 4HV8B 4WUUB 1UA6L 5LG1A 1X7QB 3QXDB 1IAKB 5TDOB 1O5DT 1CFTB 4U0QB 3FB5A 4DGVH 3P4NB 3D18A 1T1ZA 1T04A 4M3KB 4KRLB 2EH7L 2DQUL 2X1PA 4MX7B 2BSSA 2IQ9L 1WIPA 1XF2B 5EU6B 2DIBA 1RIHL 5EWIL 3K1KC 2Q8BH 1INQB 4NO5A 4LQFL 3EJZD 4ZFOA 1KUMA 4J8RA 4MMXC 5I8CB 4HMEA 4ZTOL 3FCTA 4JFEB 2E6PA 1XGRB 3HZYB 4IOFD 4X9FA 1UGNA 1P7KB 2JELH 5DQ9B 4QHKI 1A64A 4YNYB 5BXFA 3C87A 43C9B 3HUJF 4OZHE 4CN6A 2NY2C 3QIBA 3UAJC 4ORGB 4TSBH 3RAJL 3MNWB 3TH2T 3OXSB 3ZE1F 2VLME 5I71C 5TQ0L 3HRZB 3QUKB 2UUDK 4OQTL 3RVUC 1QLFA 5KS9B 4PJCA 3PWPB 5HI4D 1DEDA 3U9PL 5E5RB 5IB2A 4M3JA 1XT5A 4EXPX 1S9VB 3SDAA 1EAPB 4PTTB 3ILPB 1MCDA 3VG9B 3ESVF 5I1EH 4K9EL 4X5WB 2Y07L 3H3PL 5KSAD 3RL2A 3AS3A 5ICYA 2VDOL 5I1HH 4JZOB 3HAEB 1CGXA 4N8PA 2B0SH 3VXPB 1A6PA 3MBED 4PIRF 4GS7B 4PJGB 5JPNB 1MCOH 2X2YA 4X83A 3TJHC 3JWOH 5JW4M 4PJBF 4W4NA 1HXMB 1CDHA 1UM6L 5FYJU 3VFSA 2DI8A 1SHMA 1CQYA 3KYKL 5A2IH 2OR9H 5TDPA 3FO0H 1BECA 1RUKH 5DZLA 3TJEL 3PWUA 3RTQB 4HD9A 4R4FH 1MCFA 2CR3A 2VDML 2XQYG 5FKAB 3SDCA 3V5KA 1C7SA 5A3IC 5GS2D 2O26U 3F5WA 3DHMA 4PG2A 1BVLA 2QSVA 3LKSB 4UDUA 5FECB 3O9WD 5IB1A 4N0YH 3BT2L 4KDTC 3V7AE 3CDCA 5AG9A 3G6DH 3QUMH 3O6KH 4K23L 1NGPH 3IAQA 3MC0A 3ULVE 1IJ9A 4X6FA 3L5WB 3LB6D 3ZL4H 1T80A 5D93C 4LLQB 2EYRB 3RJQB 4MLIA 3HUJA 1D5XA 1MJJA 5D5MF 5B39G 2DL9A 3SHSA 3LS5H 3PP3K 4WNQB 3BPLC 2WBJB 3PL6A 5F9OL 4DUXA 4XCEB 1EBPA 3KYMA 3RHWK 3OGCB 1GC1L 1WBZA 4JVWA 4P46A 4KZEH 1T0MA 5DC9B 4HIXL 1KB9K 5CJOH 4G8EB 4WUKL 5L2KA 4OFPA 3GSXB 1NC4A 3HE6A 2ICWI 2LV4A 3AXLB 3VXUE 4NNPL 5C0EB 4UAOC 1ORSB 2W9EH 5CEZL 3AC0A 3GIVB 5J1SC 4P3CH 4OGXH 4KI5F 3C5ZC 4O02L 3WIHA 4N1HB 1X5GA 1LE9A 1VGKB 2X4TB 5DUBB 3T77B 3GJFK 4WY7H 5DK3A 1B9ZA 4F7PA 2AEPL 1DQJB 2D7MA 3BQUC 1P4IL 4ZQKB 3V4UH 4LSTH 5E8OA 1DE4B 1MNUL 4YHNA 2YBRB 4KV5E 4F37F 2HG5B 4XMLL 4ZD3L 4Q9QH 3PQYA 3RY6C 5CINH 5C0RL 2HT4D 3G6AA 3W9DB 4AIZA 4U7KA 5F6IB 1RI8A 3GKZA 4NGHH 3C6LC 5DJDA 3MV11 1RU9L 2NY2B 1RJYA 3WL9B 4Y0GA 1S7XB 1MWAL 3B2UD 1XGUB 3JWOC 1SYSA 5T33H 1MH5A 5I1CL 4GSDL 5IIEA 4L8CB 3C09B 3AAZB 2CH8A 1RZGA 4UILL 4OLXL 1QSEE 1UZ6F 2M2DA 1F45A 4C54A 2VH5L 2XPGB 1UM4H 3O6MH 3BPCA 4QY8B 4HH9B 4BH8A 2CLRB 4M7JL 2NY0C 3TBVA 5DK0A 5JHLH 3QIUA 1FHGA 2AW2A 2FLRT 3R1GL 3MRGB 1EHLL 4GAFB 1JWSB 5TPWL 3ARED 4WI6A 3MLUH 4XT1C 3SCMC 4KQ3L 3ZKSD 3DETC 4Q9BA 1MPAL 4CVUA 4PJ7B 1KENH 3W2DH 4Y5XC 5JDSA 5L2KE 1TETH 4Y16B 4HPYH 4H0HB 4P59L 3OKOA 3WHE1 3NIFF 3OJ2C 4NNYA 4JY5H 3BD5A 1DQQA 4TSCL 2ATPB 4X7SL 4DVBB 3ISWA 3LY6A 3A67H 1E6OH 1SJHA 1MLBB 1MF2H 4HZLA 3SE9L 5JXEC 4U6YB 4I0PB 2E6QA 4NBXB 4WTXA 2VITA 4YDKH 5DURD 4JY4B 1GIGL 2OXHA 1AFVL 3KPRA 4NRZA 3PJSA 4I48A 4I3RL 4NP4H 4I9WE 1QYGL 3W9EB 3B5HA 4NPYA 5C0AA 1BOGA 5DZOA 2E7LA 2H6PB 5DHYA 3VFMA 4OLYL 1A22B 4PV8A 4OBRA 1MAKA 1YDPA 2ZUYA 3RZCA 3V5DB 1H8OA 3HNVL 1GOGA 4ZO9A 3X12A 1IM3A 3BPLB 2V2XA 3DECA 3MRIA 4ETYA 1B2WH 3KG5A 1R24B 4JQIH 5E7BA 2QADC 3RDTD 4K7PH 5FYKD 3IFLH 1LO2H 3IS0X 4V1DB 2PR4H 2BHUA 4GRMA 2DTMH 2IPUG 2APVA 3H42H 4MXQC 1HHKB 1RMFH 5E08H 3RWDB 4NUGL 1DEEA 5B4MC 5IEKB 3IU4H 5JHDD 4LPTA 1AC6A 1M7IB 1MFBH 1YY8A 4G42B 5DD5L 4WU5A 4K71B 3NBNA 1BQSA 5D7JC 3QI9D 4UAOB 3K7UA 2J88H 4U1SB 5KVFH 4M1DL 1XGPB 4NQUA 4Y4HB 2OMBA 3BP6A 2P7TB 3IKCB 4XNQB 2FWOB 5E8DH 3U7AA 3C5ZB 4QRRB 4DN3L 4RAUB 5CUSL 4TOYL 2EEAA 3MQIA 5ITBL 5I0ZA 2F19H 4K3JH 3JV6B 5EBGA 1KJ2L 5D2NA 5FOBB 2VLJD 1F4XL 4PRNB 2R69H 1I1AC 4B41A 2BHYA 1ND0B 1JK8A 1SEBA 3DV4A 4WCYH 1HSBB 3IFNL 4S0TD 1JI1A 3D39B 3WFHA 1C08A 1HHJB 3CU1A 5ID1A 3O41A 1FZJB 1PJ9A 4GUPB 2AJSL 3CCHB 3WIHH 3C6LB 3VXSA 1DBAL 2FATL 3SDYL 3G04A 3MRFA 4Y4KD 1AGCB 5BQ7B 3S37X 2ZCLL 4N8CL 3KPRE 4OUUB 1QQDA 3JV0A 4YE4L 5GGSB 5KTEL 2EDBA 4R97C 2OXGA 2AK4D 2OS7A 4RDQG 4KHXH 2GK0A 4IRSA 1FNEA 1DANU 3QQ9C 1N6QH 5HGAB 4HJ0D 1BMGA 1TVBA 1O0VA 3FQTB 3WNLA 2CDGB 3KGRA 3LH2L 4NO0A 3GM0A 4HJJL 1GGYA 1HN1A 4YDJA 3UBXB 2Q3AA 5MENA 1DVFA 2SEBA 1NGWB 2FX8L 1BX2B 1JWMB 1NBVH 4HHAA 2PXYC 3GMQA 1EJOL 5ADPH 1CS6A 4U4BA 4LLDB 1NFDE 4U6VL 5H2BA 1EO7A 4JFQB 3QUMB 5I1LB 3U36B 5L7XH 3TYGH 4OZFH 5I66B 5FXCH 5K33A 3FHQA 3KPOA 3L3OB 3IXAA 2PW2B 3SKNB 3JWDH 5KSUB 4M7ZC 3MCLL 1IGML 1T7VA 1HXYA 2VWEC 3GI8L 3L3DB 2EIZB 3V0WH 4Q9RH 1P5UA 3C8HA 2YN3A 1UXSB 4NQTA 5HYSA 1CDIA 1JF1B 2JE8A 3QNZB 4ZUTB 4WHYG 4ODBD 5F1KC 1CFQB 4XXCC 5DVKA 5T3ZD 4QRTB 3QFJD 5D2NE 2ZUSA 1MFEH 3L3GA 4LSVL 3PIQA 5E4EB 5SWQA 1AQKL 2X4NA 3KYOB 3MRRA 1BIIA 1JWUB 1KXVC 1U58B 5TE4H 5JR1L 4F3FA 1E4XH 1T21A 1FO0B 4M1GH 4O2CB 3EOAA 4MA1C 4WWKC 2FX9H 2V5SA 5D6CA 3GSQB 3GMPB 4C55A 1I7UB 4HK3N 3VXSE 2PYEE 3HS0A 3QHFH 5C08A 5ICXA 2BCKB 4KJWD 12E8L 4P46C 4PYGA 3M07A 5IT2L 5GGVL 5FGCE 1OTTD 4ZS7L 1Q0YL 4DKFH 2Q6WB 2PKDA 3O6FA 4HKBA 4JO2H 1MHPL 2XQBH 4PJ9B 5TE7H 5HI5D 5I2IB 4FQLH 5IB4A 3RWHA 1RULL 3GGWA 1E4WH 3C60C 5J1TC 3KPLB 1RURL 1I1FB 1CXEA 4Z0XB 5I1IH 2ZOKB 4OLZH 4PJIF 2CR6A 5D7JB 2QQKH 3QDJD 3VWKD 3K4AA 4GW4B 1MHCA 3ILQD 4OCSL 4LVHC 1NPUA 1SEQL 1KIRA 4DCQB 1B0RB 1G6RL 2DLEA 3VD9A 1D6VH 5CIPB 4JHWH 4KKLD 4HUNB 1AXSB 3UTTD 1BFOA 4GMSH 4GAJH 4LIQL 2ITCB 1FORH 4PB9L 5E8PB 3MACH 1VACB 4FOMA 4M93C 4M6MH 1I1AB 2CQVA 1OL0A 3TFKD 2QR0B 2QSCH 1U93B 3ARGC 1NANH 5T3XE 2D2OA 2K7QA 5CZXC 5I30H 2DI7A 3ARYA 3THMH 3DXAD 1YNKH 3U0WL 4EI5C 5ALCH 1Q0XH 3WMSA 1CDUA 2IH1A 4MNQB 5C3TA 4CDGC 4LSQL 4G5ZL 1INDL 3ARZA 1OP5H 1G6VK 3GM8A 1KJVA 1CDBA 3JWDC 5D7LD 3JV4B 2HT2C 5CLTA 3ZDXE 5HGHA 1K5NB 3TPUB 5KJRL 3MJ8B 2KQNA 4JDZA 1X7QA 1WWWX 1CFTA 3VFNB 3WIFB 2NY4B 4DAGH 3UJIH 3C08L 1FQ9C 1KB5B 3GSOB 1F3DH 1S7TB 2ZJSL 3BEVB 1FC1A 2PTTA 4KJQC 5C08E 4X4YB 2UWEE 4JFOA 2PXYB 3L95A 5GRZA 2ZWLT 5E2UL 1IQWH 2J6EL 3AY4A 4J3UA 3JTSB 4M7LL 4LL9A 1QLRA 2HJKB 1X5AA 3MLYL 5DSCA 1DUZA 4YUEH 3ROOB 4KI5C 5DEGA 3HZYA 4M9OA 3GHBL 4M7ZB 3BVNA 2HLAA 3ARRA 2P48B 3IDJB 4JO4H 3NABL 3QNXB 4GQPH 4JFFA 3O0RH 4PLJC 4LCWA 4HWZA 3VWJC 2HN7A 4FXLA 2FDBP 3LD8C 4QRSB 2DWDB 4KK5D 2OJEB 1IBGL 3DPBA 2D03H 2W65B 4BELD 3MRLA 5CBAB 1IVLA 4KK9D 3PWPA 4XB8A 2UV3A 5HHQB 3BRGC 4N90E 4U1LB 2E7LC 4H26A 1IQDB 3QPQC 3DX8B 5CD5D 2DQCH 1LEGB 3B2VL 3UJTH 3LV3A 1IGFH 3ZO0A 2QBWA 3BIKB 3ULUL 4D0BA 2KQMA 4JFPA 2X09A 5IWLA 4L4TE 3FB6A 4P23A 3O4OB 2H9GA 4WWKB 2W9DL 2FECL 5EOCL 2J8HA 2UVFA 4JPIB 3X17A 4KAQL 4RGNB 4F57L 3VFGL 2A6JA 2DLTA 3QZWA 3UZEA 2NXZD 3QAZB 4G9FB 5HGGS 5KSBA 4M6NL 2A6KB 2W91A 5T1KA 1V3JA 4G6FD 3VXPA 5DMGC 4OLVL 4WIQA 2ZOLA 4ODSH 4ODWB 1HKFA 1P1ZB 3WEXA 2I9TA 1FNGB 1YEGH 4NM8L 2CIKB 1RJZB 3CUPB 4HF5H 3RGVB 4KMQA 2QQQA 4JG0H 3PV6A 4YZFF 4WUUE 5T1LD 3CSPA 5KZCD 2F58H 5FV2A 1Y0LA 4LEXL 4S1SH 2VKXA 2AJVL 4WFGD 1HIML 1PVHA 1QSVA 4LVHB 5J9PB 4QHLA 2FL5A 3RY4A 4PJBB 1A6WL 1CFBA 1NQBA 1UKQA 2BMKA 1UJ3B 4M61A 5F1SA 2YD6A 2F54B 5IB3A 4XBGA 2Z8RA 4GMTL 4ONGH 1YEFL 1HNFA 4JFEE 4P57A 3QA3A 1IT9H 1Z0MA 3DI2B 1GJIA 4KPHH 1AD0B 1ZT4B 4L1HA 4ISVB 4JFFE 3HTLX 4NCC2 4LCWE 3NVQA 1C5BH 3ROLB 4LBEB 1AKJB 4XWGH 4MS8D 3WO3B 4NIKB 5CEXB 4C59B 1ACZA 2DYPB 1IC5L 2B1HH 4LCUB 1C1EH 4P3DB 1YEDB 3X11A 1GZQA 2X4SA 3B9KB 4EI5B 3LSOA 1IKFH 3LKRA 1FIEA 3PWPE 3R0NA 4OF8A 3ABZA 3U9UA 5J1AA 4P4KD 3T0VA 1F97A 5JQ6H 3CFEA 5D5MB 1TFHA 1CD9B 2XWBB 3OB0K 2V5YA 4PLKC 1PZ5B 2IG2L 4IRJA 2YPLD 4KKCD 4OB5H 2R2HB 4X7EC 1GAFH 4NYLB 5E1AB 4YEFA 5C09A 5ERWA 2NPLX 5LCVL 4JGMA 4OZGF 2VZTA 5GRUH 2X4TA 2BY2A 5DRZB 1PG7W 1CE1H 3B43A 4RGOL 3LKOA 1P7QD 1WZLA 1A3RL 3GFUA 3L7FB 1NCCL 1PZUB 3S4SB 1R3KA 1K8DA 5BS0D 5DT1H 4MXVE 5FCUL 2VR4A 1F6LL 3QIWA 4M8QA 1AGBA 4PRHA 5EOQL 2Y5TA 5AYQA 4DW2H 1BJ1J 2Z91A 3QUXC 3VG0L 1RFDL 3EOYG 2XA8L 1BQUA 1RZIA 4PGBA 5E2WH 5FIEA 3IAPA 1KCRL 5C0CD 1EFXA 3VWJB 4JJHA 5HYJA 5I75C 3LD8B 3INUL 3LKNA 1XGQA 2CXGA 3T1FB 2HFFA 3IETB 3WDIA 2ERJB 4L8CA 5BVPH 4P5TD 2XI9A 1VSCA 5DI8B 3CDYA 3K80A 3ARSA 2ESVA 1KEML 1CT8B 2FEDD 2YUZA 4KDWA 3CZJA 1KNOA 4NNXB 3FTGB 4J3VA 2BNUB 2AV1B 1B4JL 3MFFB 1WZKA 3GZKA 3OR6A 5F44A 4QY8A 1VFAB 3CH1A 5T5NF 4EI6B 1A7PH 1T5WB 2CLRA 2LU4A 3P4LA 3WXVL 5JXAL 4I5BA 3MLSH 4JPWH 5SX4H 1QLEL 4HX1B 4FXKB 2FO4B 3MZTA 2ZNXA 1CFSA 3BN3B 5B39A 1ZLSH 3HI6H 3O6FC 5INDB 2DKMA 4Q97A 2XN9B 2YMXH 1ZWIB 3F7QA 5GXBB 3TNNA 3ZE0E 3P77B 3TZVA 4WFFE 1OARH 3DSFL 3UTQA 3PWLB 2XTLA 4NQXA 4TTGA 1JTPA 1WC7B 4JE4B 3BUTA 2F74B 3SKJL 4J6RH 2G5BB 4EOWH 1D5IL 3WXWL 3VMNA 4S0SD 4QYOB 4O00A 5JIPA 5KANG 5E2VH 4OZGA 1GHFH 3DVNB 1MLBA 1ZHBA 4K2UH 4XI5C