4CSTA

Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cstA00
2XG4B 1N12A 2UY7B 3JWNE 4AUJA 2WMPB 3RFZA 5FWRA 4AV5A 3BFQG 4AV4A 3ZL2A 4AUUA 5IQNA 1KIUB 4AUYA 4AVIA 2JMRA 5AAPA 4J3OH 4XOAA 1UWFA 5F3FA 4XO9A 5CGBA 4XOEA 3ZPDA 4BUQA 4AVKA 4CSSA 1ZE3H 3SQBB 3ME0B 1KLFB 4AV0A 5JQIB 1QUNB 5IQOA 5FX3A 3BFWA 5LNGA 4XOCA 4J3OF 5FS5A 2XG5B 2J2ZB 3JWNG 2VCOA 1PDKB 5IQMA 5AB1A 3BWUF 3JWNH 4X5RA 4AVJA 4X50A 2JTYA 4CSTA 4X5PA 5F2FA 2W07B 4XO8A 4AVHA 3MCYA 4X5QA 1TR7A 5AALA 5LNEA 4ATTA 4CA4A 5ABZA 1N0LB 2UY6B 4XOBA 4XODA 4J3OG 4LOVA 3ZL1A 5FLUA
chains in the Genus database with same CATH superfamily
5JNYA 3N9GH 1UOVA 2ARJA 2YD7A 1M6UA 1N59B 4UAOC 4FDWA 4MSWA 1JGVH 4ORGA 3TCLB 2GTZA 1EIBA 2HKAA 3VXQA 2CPCA 3QO1B 1I7RB 4YDVA 1XH3B 2CRZA 4IU2B 5F7WC 4EOWH 1MUJB 1JZ5A 4HUXB 5IEHB 4JZJB 1N19A 3AXLB 3BKYL 3LPWA 3QHFH 3K8KA 4EBQL 1BREA 4JY5H 3ZTJG 1PZCA 5C0DA 4A7GF 4G8EA 1JN6B 3O6KL 2BIQA 2TAAA 3ZL2A 3CHXA 1PG7X 2CA4A 1JWUB 4AJWA 4N9GB 3C75A 5HHPA 2UUDH 3LXBA 5ALCL 5INDA 3VXMB 1Q1JH 1JGDB 1MCKA 4I3GA 4Y16C 2PCPB 3NG5A 1FDLH 2VZ1A 4TQEL 4RSYA 3I2CH 1DEEA 5GGVH 1ORQB 5EOCJ 1MFEL 5IROD 4LSTL 4PRBA 3MFFA 4MMXA 4BDVA 3QIWC 4UB0H 2XWTB 1BAGA 2BM3A 5FA3B 1EZUA 3IJYA 1Q0YH 5F3BB 1F4XL 4JHAL 1KJMA 3EJZC 1JHTA 3HRZB 1BYPA 4QTHA 3FTYA 4IBUA 4OLZL 2IWGA 2WGXA 4P9ML 5BVPL 3U6XA 4X4XB 3DSFH 2DKMA 2R83A 3GZPA 1IARB 3MOAH 1CFTB 3LQMA 2R8SH 4LSSH 1AI1L 2WLKA 1T5WB 3MOBH 4M48H 5AZUA 4X2UA 4FP8L 1BQLL 4XR8C 3K2KA 5A6MA 3MJ8B 5T33L 4AE1A 3EO0B 2ZKYA 1NC2A 1EJOL 1UH4A 3JTBA 4HC1L 4MMZC 4XP1L 2WVTA 3WE1A 3DTXB 4GG8A 1FRGL 4ZO9A 4RGOH 4TN9A 4AK2A 4NZTH 4OM1L 4Y4HC 4EO5A 3BGFB 5ABDE 4XCNA 1M9SA 3HKZA 1JPSH 1KCVL 1NJ9B 4I3SH 2O5XL 3NDZE 2NR6C 3OWEA 4XZUB 4XVSL 5D5MA 2F0CA 2YRZA 3CBKB 4LO9A 3H3KA 4LCWE 5LBSL 4QPEA 1VKXB 2EYRB 4N85A 3G08A 3TA3A 2G5BB 3JVGC 4Z7QE 3VFRA 4PJXA 3QXDA 3FT0A 3S9DB 1LWRA 4P3DA 2MOQA 2H0FA 4OFIA 3PXJA 3TYFA 4D7BA 5JPNA 5DD3L 2F54B 2OXGB 3HG0A 4KITB 1MCWM 1SVBA 3T77A 4KROB 2FX9L 5C09B 1MVFA 1OHQA 1GKOA 2ZF8A 3AQDA 2CHXA 3V0AC 1ZHNA 3JUZA 2EDYA 5DFWH 4AQZA 2CO4A 3V95A 1MREH 4JFDD 1NTDA 2IFFH 4JL2A 4K71B 2UVEA 4C55A 2X0VA 5FOJA 3AU1B 1OCWL 1XF3A 5T1KB 3IMWA 5F7DA 1FGVL 4YXHH 1A6TB 1XCQB 2BS9A 1T03H 4QKTA 4QJ3B 2AERT 4G3YL 1SLVA 3OHMB 2VN3A 4RIRB 3WJLA 5TE7H 1HCVA 1KBGH 1MF2L 3V52H 1IGFH 1J9SA 4PRAB 4LSQL 2A77L 2B5IC 2M8XA 2YO3A 4PN6A 4WEMB 2VUOA 1S6NA 1J0YA 1XTLA 2CHNA 4N4YB 4TULH 4OZGA 3ES6A 3AWEA 4QY8A 3O9WB 1FL5B 4QD2E 5CGBA 3TEXA 3MLZL 3FQRA 3TVMA 4GKSB 4GI6A 4NUMA 5HHMD 4L3EB 2B1AL 4FZ8H 4OF6A 1OLLA 3VG0H 4KK5C 1F45A 2JCCA 1MRCL 1ZVNA 3IDIA 1OSZA 1R1CA 3VXOB 4PJGF 2ZT9C 3RX7A 2JF1A 4YPJA 2WLYA 4XVTL 3G04B 1ZA6A 1QPPA 2XJLA 4JRYE 5FFGA 4BFJA 4CU6A 3FRPG 1BGXH 2V2TA 1JYVA 3QWOB 4OCMC 2YPVL 1QUNA 3F7YB 2X44D 3SE8H 3CLFH 4MXVE 1DSYA 1NCIA 3GSQB 5SWSD 2FIKA 5F8RC 1S7WB 1EK3A 4PLNC 1KGYE 3GSRB 4F2FA 4AQOA 1FCGA 3V6FB 3MX0A 3N40F 1J9QA 4XX5A 2NX5E 3V10A 5GS0L 3MNWA 3FQWB 4KKPA 1NIBA 3OHXB 4P2QE 4QRBA 4MMYB 4TNWK 1GOFA 1MOEA 2OLDA 3KJ6H 3QPKA 5C0EA 1TZHA 4HFWA 4JFOA 3T8XB 3RX5A 4BV1A 4HHWA 3T3PB 2I32A 4OJYA 1K5NA 1GHFL 2J3SA 4ZUUB 5CEXA 5EZIH 5K5YA 3QCTH 5DSCB 1BOYA 2XI9A 4NJ9H 1RU9H 4OLVL 2X3CA 1WTLA 5AAWC 4OH2A 1RZJH 1TG8A 2XQYA 3OG4B 3U2SA 3V4VH 1SXSA 3EBGA 1S9XA 1G9NH 4PVBA 1KULA 4HWZB 5J12C 5DUJA 1O75A 2EEBA 2KLTA 2X6UA 2MCPL 4NKMA 2ROYA 2FECI 2PYEA 3IPBA 4JAMA 3RB5A 3TPUA 3F00A 5I75B 2NZ9C 2YJQA 2X2UA 1VERA 2D2CC 3L5XL 3QUYC 4HWEL 4EKJA 1QNZH 2Y7MA 4S11A 1G4RA 3IXAA 2Y06H 5GGRB 5GJTH 3WLWC 4I0PB 4NO3B 5EO0A 3LS4L 5IB1A 3BZFB 4FMFA 4Q89A 4YH6A 4NPJA 1S3KL 3FB5B 1X5FA 2BCKB 1FG2A 4OJDH 1KCRH 3WL9B 4M6NL 3FPYA 2L04A 5KYWB 3ZGIA 3JYCA 1E6JH 1L6ZA 1OAYH 4JG1H 4I2XE 3BUDA 4KH2A 1XH0A 3HG2A 3SPVB 1Q72L 1VADA 4HSQA 2YIHA 3GMMB 1KBPA 3IGAA 3VXRD 1XDTT 3ARBB 5FHAL 1C5CL 5T5FA 2BRQA 1OCCB 4B97A 1AKJA 4W68A 4QTFA 3ABMB 4OFVA 1A1NB 2W1NA 3FUFA 1DE4B 4UQ2A 1CI5A 4A6YH 1DQMH 1FZJB 4H4NA 4K3EL 2XVGA 4OKVB 1GCFA 4KXCA 3VSTA 5AFAA 1O5DT 3SBQA 4YPGB 4RMBA 3RHWF 2WZPA 4M62H 4PW4A 4DW2H 3GYRA 3B3IA 4UANA 5ESAB 3K6IA 4WK0B 3IPFA 5HHVH 4DP1X 2YC1A 4WHTA 2Q9OA 2YAEA 2KPWA 3OGOE 3RVXC 4J27A 2NLJA 1EO5A 4F24A 4QTIH 2YGOA 3VFTA 2DYPA 2XWJB 1J1XH 3RPIB 3U0TA 5LHDA 1K85A 1DUZA 2ADJB 4ONGH 4M7ZB 4Y9BA 2R0LL 1IIIA 4ZW5A 2WZ5A 3JV0A 2J88H 3AS3A 4HUUA 1RQ5A 1HEZA 1MCFA 1S7UB 5EU6A 1OGAB 3CGTA 3ZE2F 3RDTD 8PAZA 5ISZE 4B96A 4TNGA 2CUIA 3FMGH 3QQ9D 4ZFFB 4F9LA 3D3VE 1Q9KB 3F3HA 3QQNA 2EICA 4GQRA 3OXSA 4MMXC 3DJRA 5GGSB 4H25A 3G6DL 2W59A 4IRZA 7PAZA 3QNZB 2DPKA 1JNHA 3PHQA 1EHXA 2R56H 4TLSA 1DVFB 1AFVH 3P0VH 3L3HB 5A16A 2AK4D 2NY7L 1THAA 4F58H 1R17A 1JTTA 4HT1L 4R3SB 4RGNC 5AEAA 3FQUA 5A2LH 3GBNL 1HZHH 3MLVL 3UGUA 3WMSA 1N5AA 5AKVA 1JGUH 2Z35B 3W82A 1YY9C 3GKZA 3VFMB 3ARFA 1J05B 1QFWI 2V37A 3H0TB 4OIFA 3SDCB 2IH3B 1IU1A 4XC3L 4XN8A 1KB9J 5IVNA 3S8FB 5EPMA 1HSBB 4M03A 5IJCC 4Q74A 4UT6H 4ZUWA 5EB9A 4FHJA 4JDZA 4UZUA 4C54A 2J1XA 2O72A 3RWHA 1ET7A 5AW7B 1JK8A 1SXBA 2X89D 2DQJL 4KRLB 2FWSA 4G9FA 4YNYB 1RIHL 3V9EA 5LVEA 5C0NC 3LEXA 4MVBC 4M6OH 2FT6A 4YAQA 5I0VA 1X44A 2GFBB 2ZCKH 3TA3C 5M94B 4KX9A 4KKCD 3S35H 2VXTL 4YGVA 2YUWA 3OAUL 1RZFH 5LDUA 1D6EA 5JW4N 4L29A 4WTQA 5DRZB 2V33A 4OZFB 5DVKA 5JPNC 5EDXA 3TURA 2GJ6E 3OD3A 3DETD 4AM0A 3WJJA 4A2FA 5IGXL 1YPZF 1ZOXA 2P5WA 3EG9A 4GW5B 4YMPA 1KEGL 1VFMA 1DLFL 4QEGA 1ES0B 5CLYA 4NUJA 5HTSA 1R5VA 4XAKD 4HUMB 2QQLL 3LRHA 4M5ZH 3GUTA 2KZ1B 3CFCH 3FW6A 1G7LB 3OKNB 3RBSA 1B2YA 2P8LA 4JMXA 4GQQA 3ZQWA 4ABWA 3D9AH 3HI6H 1C5DA 4ELME 2NNAA 4KPHH 4EI5D 1FH5L 4WZ9A 3B9KB 3WJLC 4AQAA 1VFAB 3QA3B 4GBXB 1T6VN 4GUPB 1SGKA 4Z7NF 2ZOUA 3AB0B 4TS6A 5CGYD 1CZ8L 2XU9A 3DBXA 3K91A 5DK3A 3OZKA 5ERWB 2JKXA 2EEXA 5F97E 1KTKE 4BQCA 1F8TL 3WMPA 3MMEB 1RSYA 1QSEE 4JE0A 4ZFGL 3C5ZD 3AXIA 3GSUA 3TVMC 3Q5TA 5IT2H 2WKLA 3LAFA 3BP6B 3KH3A 3S5YA 4Z0XB 4LVOC 1SYVB 4FLQA 4TVSa 4WFGE 3SDAA 5JHLL 2R0ZH 3MA9L 2W07B 4N8VG 4NWUL 1GSMA 1IC5L 1V3MA 2KI6A 3CMOL 2HPTA 1EX0A 3C5XA 4KXZI 4WNQB 3MCYA 4XP6L 2OKMA 4LVEA 4X5QA 3V0IA 1GJWA 2JLPA 4OF0A 5J6HA 5LNEA 2A4CA 1TQCB 2X9ZA 1RFDL 5F9OH 4S1QH 5I23A 3GD1C 2XIBA 4DPBX 3L8QA 1A4KB 4Z7UF 4JO3L 3MGTB 2XKUA 2B59A 2JKJA 1AGDB 2WQRA 1ITCA 5EZJB 4PJBB 4NM8L 5ICYB 2JKSA 3LXCA 3DYPA 4OZHF 2K7QA 3KYNB 1H6TA 1Z2KA 4AYEC 2NYYC 3B1UA 2I27N 3WO3B 4YN3A 5FYKD 3VQ1C 2R29A 4NNPH 35C8L 4WFFD 3VFOA 2WZ0A 3FSWA 2NTSP 4NQDA 3C9NA 3VTAA 3UBHA 3QUXB 1QTYT 1X9RA 4S1RH 2VMDA 2JIXB 4Y1AB 4G6FB 4XNZC 1W0WA 3ALPA 2F53E 3ET9F 4U7SA 2DIBA 2H6OA 4FG6D 4PHXA 2NMSA 4K7PL 2PXYA 4V1DB 5BO0D 2B4CC 4PLJD 1HHIB 1KTCA 3ZTCC 1IKNA 4XMXA 3HW7A 5FGCB 4Z77A 3HB3D 2GEEA 3PDOB 5IVXB 4KI1A 1ZS8B 3RGBA 2EDRA 2Y5TA 5FYKL 2R69H 4H8WL 1I3RA 2BVQA 3EOYG 3UPCA 4BCZA 1T0MA 2R7EA 3LHPL 4PJHB 3BH9A 5KTEL 3IMSA 3BSHA 3HPJA 3ZE0B 4L9LB 2VB5A 3RU8H 4YSUA 1T1ZB 4XT1C 2NY3D 5KG9B 1KENH 4NKQB 4UV7L 5D6DC 3A4DA 4OF5A 2MCAA 1ZTXE 1Z32X 3N85L 5C3TA 1T22B 4TSAH 4P9HC 1TEYA 4B41A 3DXAE 4K94H 4MZ2A 5DEJA 2VLRE 4DFHA 1SQMA 3SGEH 1BZOA 1WDAA 3S5LB 4TOYH 1NGZB 5B1BB 1D5XA 2VM9A 1A4AA 3WTSA 5D2LB 4CVUA 4NZFA 4XB7A 3OKOB 3TBYB 2PP7A 2AZAA 1MW2A 3NIFF 4G7YH 4FS0A 1IL1B 1WISA 4M4RB 5L2KD 3FO2A 3FSZA 1M42A 2XPYA 5C92A 1CS6A 3PGDB 4LZKA 4ANWA 4Z7OF 4CGTA 4N2GA 1CE6B 1HSAB 5BXFA 1NKGA 1YEIH 4BK5A 5KJRH 2UZPA 5HYJE 3C5SA 5GISH 1Z9PA 4BHUI 1DBBH 3D7PA 1RVFH 4IOSD 5FGSA 2IAND 4YUEH 3AG2B 4HCGA 2VDRB 3BIAX 3ZDXB 2AABH 2OYMA 3DJSA 5K9JL 1H3XA 1KIQB 3GO1L 1Y6MR 4U1JB 1IIKA 3DX6A 4LGPB 3D4YA 1HC1A 3DVIA 1BLNA 2JI3A 4L1LA 4QOKB 4YSPA 3BE1H 5IMKA 3S8GB 4F9LC 2H3NA 2VLKB 3BXNB 5IR1A 5K59F 1U8CB 1NM9A 3H6JA 3T4AB 2WMPB 4UILL 4Q2ZB 5I9QB 3MRDB 2ZKHL 4PUBH 3VGAC 2DQCL 1DVUA 2WUCH 1B90A 3ULUE 3IFOB 3AAZA 1W8NA 1DR9A 5AW9B 1SHSA 3FN0H 3CX5J 3O4LA 4KWUA 5D96B 1RUAL 4HKXB 3VRLF 1S4IA 4EZLA 2VH5L 2G60H 4JG0L 4EI6B 3NFPA 3V0GA 5CEZE 3WXWL 1KEML 1G0DA 3K46A 2IC2A 2OXHA 2CLRB 3U4AA 4APXB 5CZXC 3ARFC 4CADB 3CDGA 1U3NA 2WPGA 2VZUA 1K4DA 3H55A 3B7UX 3EOBB 2H9GB 2ID5A 4U1KB 3NJLA 1QAWA 4LCCA 4K9EH 3AABA 1NC4B 1LEIA 5BVJA 1LK3H 2OQJB 3EH4B 3SD2A 3NMEA 4KMLB 5L7XH 5DJ6B 2D0FA 3NACL 1T2JA 2JH2A 4IQHA 1CIDA 3BCDA 2X4OB 4ETQB 2K4AA 2Z4QB 2EXTA 5KANG 3REVB 4UTBA 3IFPA 2JVUA 2X2HA 1KFGA 3K0YA 1R47A 3QIUB 4N2BA 4AJVA 1NGYB 3HG1E 5B21A 3LZPA 2XBDA 3WXVL 1ETZA 3DX0A 1LEGA 4XBEL 3LEYL 1KJ2A 3DV6B 4W9EC 3DUUA 1F6AB 2AXHA 4QRPA 4FNSA 3HNSH 4AT6B 4CBPA 4NRXB 3Q5OA 3F12B 3JWNG 4FQHA 1ZLWK 3ZZLA 5JXAL 5FM5M 2DYSB 4UCFA 3MNVA 2MCMA 3WJJC 4EDWH 5JW4R 2IWKA 3T0VA 2Y7NA 4P2OB 1HOEA 1F3RB 1R3IL 4IDJH 1JNNH 1II4E 3RWFB 32C2B 3ETBJ 5CFHA 1D9KA 1TZAA 3OAZK 4FL4B 4S1DC 3DVFA 1YYMH 4LCUA 2ENPA 4HALA 5CR1A 4HDIB 3RGHA 5L8LB 4GG6A 1DJWA 1SRDA 2UY6A 1CD8A 2D0GA 4WDIA 1AD9B 2NW2B 4GSRA 5FYKU 4L2YA 3QPQD 1T04B 3P1VA 4OUUB 5T3XL 1TCMA 5FO9B 3KR3L 4CMMB 3K2MC 1IAKB 3V5HB 3WFCL 3BUYB 1CC3A 3GM8A 3FAXA 4UQEA 4RZCB 4JFEE 5C2BL 8FABA 3W2DL 3ZW3A 1SFDA 3SOBH 4YHYC 2WIIA 4O5LH 1NQBA 3TNNB 2Q7YA 3UG3A 2UZYA 1WFTA 4RDBA 5CN3A 1NMBH 2AEQL 1FHNA 5I6XB 3SDAC 2WLIA 4I48A 4TF4A 4C59B 3RFZB 2IH1B 2YSSA 4DCQB 1KT2A 3BFQG 4HPYH 3UBFA 4R7DB 4OLYL 4QHLB 4GXVH 1QPXA 4YO0A 3K0WA 4POZC 3MJ7B 2OJZH 3C8HA 3FHEA 1AHWB 4PJDA 4D0BB 3LIUA 1FAIL 3MRPA 1PFCA 1J8HD 5EORH 3IJ8A 5DHVA 4P5TD 5K39A 2D03L 4ZNEA 2VNCA 4RMWA 2JQMA 4S0HA 4DZ8A 1QNIA 1XO8A 4QRRA 4XOEA 3RTLA 3W9EB 1A9BA 1A3QA 4L1SA 3OKDB 1OZUA 5KUKA 3QZOA 4L37A 1ID2A 3E1F1 3NOIA 4X6DE 2B2XH 4P23D 4Y2DB 2YA0A 4A7TA 3DVGB 3QGVA 3QXAB 1FF5A 2NT0A 1H19A 5DYFA 2PCYA 3PIQA 4UQ3B 5IMLA 5E95B 1BD2E 1FNFA 1NWOA 3ISRA 3RY4A 1DBKH 4B50A 5C0IB 4NIYE 4A66A 4D0DB 1CICD 2UZIL 3LPPA 3WNOA 3KPLA 1RAMA 3BAYA 3VXSD 3ME0B 5E94A 4RWHA 3VWKB 4X7TA 4ZMAT 2EZ0C 3PWUA 15C8L 1HZKA 2X4UB 4ERSH 2Z31A 1RZPA 2VDNH 4IJ3B 1CLZH 4YHZH 2YSTA 1JZIA 2FATH 5EU7C 2ESVB 2PXYC 4X6EA 3LMJL 4MD4A 3NPSC 3RHWK 3SY0B 4UQBA 1IKNC 1QWNA 2DMGA 1PY4A 1OSYA 2FECL 3MLSL 4X9FA 4OCRH 2WTRA 3WE6B 4DKEH 2Z1PA 2ZCLH 4QXUH 4WUUA 1AKJD 5SX4H 2YD1A 4A2HA 3PQYA 1WAPA 4PY8J 4HCRL 3KGSA 1MQKL 3UABA 5JIMA 2ZAIA 1EH9A 5LCVL 2K8MA 4XNXL 4RESB 3D39D 4KI5F 3SN6N 1AGBB 2Q3AA 1ORSA 4JPIA 3AG4B 1CLOH 5I1JL 1FGNL 5J1TC 1P2CB 1QBLH 3BPNB 1PX3A 3P3RA 4KK9D 4LOFA 4QR7A 5E2TL 4G8GA 4ZI8A 3RRQA 2AF2A 4URKA 1TETL 2GVYA 1AQKH 1CFBA 4P04A 4X0NA 1DLHB 3K2UH 1TTAA 3MR9A 4OT1H 4U6VH 5LG1A 5CU5A 3ZDZE 2ZTBA 1Q0XL 1KGUA 3IJSB 4PJFE 4ZT1A 4NN7C 1DTUA 3Q6GL 3QFJE 1MXGA 2VXVH 4KNSA 2IFGA 4EXPX 4GRMA 1L6XA 2CDEA 3BDXA 3GXMA 4ODSL 3EO1A 1OTSC 4UAHA 4D9LH 1V3JA 5D4JA 3HUJA 4DK6A 5SWZD 2GABA 2BSTA 4MNQE 2C4XA 4JFTA 1QEWA 5K9OB 1J0KA 4FJYA 2VMJA 1J0JA 2R27A 5DQDL 3UOAB 3BGMB 1TVHB 1I1CA 5TF1L 2DQGL 4H20L 4BK5C 1P7BA 1B3JA 5C08A 2KHAA 2V5MA 4NKDB 2EE6A 2GYSA 3QQDB 4FG2A 5A3IC 2DWDB 2J73A 4FXGA 1GA2A 2ZYIA 4N3TA 3E3QC 1N68A 3H3PL 2VN4A 4I1NB 3FRUB 1DQQA 3WFBH 2F2HA 4E5XG 3NJMA 1J1OL 1A6UL 1F4XH 3KWVA 3MUGB 2NY1C 4BE6A 5D1XA 3BD4A 1AS6A 4OLZH 2BP0A 1P7HL 1NUNB 4P9MH 3QDGE 1D5RA 2C1PB 3ULVL 4MZIA 4L1DA 1UOWA 3QP3A 1JXFA 2CGYA 2IMMA 2HTLC 3D34A 3L3OB 1M9WA 5AOJA 2IDFA 3F7QA 1RUKL 4L4VD 2L3BA 1AI1H 1RJZA 1YEGH 4AITA 1RK1B 1C08A 1BZ8A 1WFOA 4JY6B 1X7TA 1R5IB 1AO7E 1I9RH 3L1GA 4K7FA 4Y4FD 4ZW6A 4U3XA 5FV2A 4G9FD 1CTNA 2ZSVA 1DUYB 1S7RB 1FYTE 2HVJB 1QKZH 1QFWM 1SJHA 4F57H 4V33A 5MENA 3OM3B 5DI8B 4GOSA 2HG5B 1FRGH 4Z5RB 4OM1H 2COVD 4LVHB 1YEWA 4KKLC 4NSKA 3VO0A 1QFWL 1AG0A 4ZTOH 1NFDB 1SUHA 1TO4A 5IUSA 3BWUF 3FB6B 1BXUA 3L4WA 2O5XH 1TKWA 2VW4A 4XCEA 4LCCC 4LGSB 4G8FA 3OSVA 1FZKA 3MO1A 2B0SH 3HJ0A 1ZLSL 3KBHE 3ILDA 4HEPA 4LSVL 2J5LC 1UWYA 3DRQB 1YEKH 4U33A 1PCSA 3ARDA 4KUCF 4NEHB 1LP9F 2H1PL 3P69A 1M7IA 5DD3H 2FHCA 5LBVA 2Z92A 3HBGA 3BWSA 3POHA 3ZDYE 4YBLC 4A7GA 2HJFB 3TPKA 2VR6A 2WTOA 3FUMA 5HHMB 4FQ1L 5E8OB 3B9VA 4BH8B 1NDMB 2HJKB 1HK6A 1K2DA 4N0UA 2E5EA 3C2AH 2WBJB 4LLMA 3RILA 4JFSA 4J3WA 4PJEB 2EEFA 1ASQA 3O11A 4LBAA 3WMQA 4G3YH 2G75B 5FUOL 5A1AA 2IALB 3GRWH 5KYUB 2ZCHL 5CIPB 4AEHL 1RZ7L 2J1WA 1DN0B 2AJZB 5ITBL 1Z3RA 2IJ0C 3QEUB 3NP3A 4P4KD 4XPAH 1LO2H 3L3JA 2R23B 1RV6X 2NY0D 5IBUG 1D9KC 1INEH 2B3RA 2TRHA 2A77H 1RUQL 3S4SG 1F4YL 3BH8A 5TGBA 2GC7C 5C0BD 4YWGL 3UAEA 1G94A 1E9QA 2VWEE 2E56A 4JHBA 4JO2H 3OF6A 4H8QA 3FPXA 3VXME 5C6PB 4NO0A 4HIXH 2JMRA 5B4MC 1D7BA 3B2MA 1YRKA 2SODB 1KB5A 2A83B 3L5JA 1SY6L 5I5IA 3C60D 4IMLA 5GGTA 4O02B 4XVTH 3LZQA 1NGQL 2HLAA 4LPUA 4NPYB 4NX0A 4X6BA 5I1LA 1UD8A 4ODTL 2P9RA 3UYRH 2F19L 5J0BA 1MFAL 2WXGA 3Q8EA 2WVUA 1QABA 3BVWA 3O2DA 5FUZH 1X5JA 1KOAA 3ZT7A 1IO4C 3I6GB 3WKYA 3ESUF 1KLFA 5EFIA 5FO2A 1NGWB 2XA8L 2W9LA 3GBEA 1NLBH 1KNOA 5CR8A 4I3RL 2ZX9A 2NCEA 4X0KB 4MAZA 3ZTDC 2EADA 1VACB 3BQUA 3TO2B 1X5YA 3CVHH 3PWNA 2EZ0D 2XA3A 4YXLH 1FFPB 4E41A 1AR1B 4KBPA 4ZW7A 5KAQF 3QORD 1GAFH 1M71B 1MRDL 5CIPH 2GTWA 1OF0A 2PN5A 2E76C 4JHZA 2BSEA 2VJ8A 3G5ZB 1V7ML 4RA0C 1HOCB 2J25A 4PRNA 3GHEH 4UAOB 2Q10A 5C6TL 4JZOB 4CC1A 2AQ2A 3UG5A 3TL5A 2XPZA 1WZ1H 3L08A 3P0YH 1GCYA 1Q8MA 1QBAA 4CN1A 1HJBC 2P49B 2UX7A 5A2IH 5KSAA 2VLJA 4I13B 3LS5H 1WCBB 5B3JE 1XZ0A 3RVUD 1K8IA 2E59A 3RNQB 3IETB 1IC7L 1TMQA 5GQBA 4NXSA 3C12A 2F54E 5EN3A 4F7TA 4MCZA 1KSRA 3L5XH 1I31A 4OIIH 4ZX3A 1U8JA 1T3FB 3KPRD 1ZHLA 4OCXL 2Z31C 3X1EA 4CVZA 4MX7B 4PU2A 4Y16B 1QZ1A 1JF5A 5CBAB 4FMKA 1FQ9C 4JX0A 3LS4H 5EF3A 5BRZA 4PQXA 4BGDA 1P4BH 3QIWB 5ADPH 2XY2A 3O0LA 2IPKA 4KXDA 2MQ0A 5HHXL 1CD1B 1J8SA 2WSDA 3T1FB 4B5ZA 1OZTG 2BJMH 3HG5A 4GJTB 3PL6A 5BCAA 2EKSB 3EDJA 4PJGA 4ZZKA 1NGXB 3TT1L 1BAFH 4PTTB 4KZDH 5CZKA 3EH1A 1KXVA 4JZNA 2ODHA 2J57A 1AOHA 3A0OA 5AD0B 3FOLB 4JRYA 2Z0BA 4PGEA 5ADOH 5KYXA 4AUYA 4JFXB 4MGXA 5ID1A 3NAAH 3QUHA 4NI6A 4I18A 2R1XB 4L3EE 3EOAB 5G5DA 3QNXB 4MMZB 4Q56A 3S0PA 1TSHA 3V4PA 1A1OB 1PG7H 3RUGF 4DP0X 5IBUB 1LHZA 1SDDA 4XMVA 3R06B 4P46A 1IBHA 3Q01A 4RFOL 4BQ9A 4LVNC 3S5ZA 4Y4HB 2NY1D 3EW3B 1V27A 4GXUM 5CMAB 4AZ8A 2NX5A 3NP4A 5FM4A 3PGFL 1DVSA 1MQ8A 4P2QA 2VITB 1HL4A 1RHFA 3LPOA 5E5LA 2D7TH 2FX7L 3MLTA 1TQWA 4Y0GA 2HTLD 1ILSA 4JFVA 2VDLL 3ALWA 3VFWA 2JB5L 4M5TA 2VZSA 3LKPB 3HNTH 4FXGC 3VXTA 3EFFB 3CXHJ 3P30L 3S88L 3TOPA 3FO1A 3L5WB 5HJ3A 1UVQB 3TNMB 1BVNP 3GMRB 4CKQA 4ZW8A 3TH4T 4AZUA 1XR9A 2BSRA 5DZNA 4BWTA 4XNQA 1EAOA 4HOMA 3DYMA 4HKBB 3DGGA 1UWXK 1EEYB 1E30A 4JN2B 2DICA 3T3PE 5D1XC 9PCYA 4QHUA 2EDHA 2HX9A 2NY7H 3UTTB 4HT1H 2WV3A 3HG3A 3L1OL 1CE1L 5F6HJ 2Q86B 5C97A 5AW2B 1MFDH 1P1VA 3GJFK 5GRVL 2AEPL 3D4CA 1QPKA 4LLDA 1JZGA 3D4ZA 3P4OA 2CD0A 4NENA 3F8UB 3MODH 5HHOB 2B5IB 3G7TA 4MD5A 4PS4L 3Q2WA 4JKNA 3ABKB 3O3DB 5EC1B 5B38B 4ZJ9A 4I2XA 4FQXA 5A2JH 1E4HA 4JDTL 4OTXH 5BQ7A 4ZMNA 4LEOB 3LRMA 3U7WL 3I3DA 2GUOB 4HXBH 4GH7B 1EDHA 3GK8L 5GIRA 1IAOA 1EERB 1SBBA 3BMVA 1AHKA 3GLEA 2P7TB 3GKWL 3I3EA 3MLRL 3RL1B 2CR6A 4L4TE 4LHUG 2QSQA 4GP4B 4UT9H 3CV5A 5ENWA 3ZX1A 5AOLA 3CBRA 4TQ8A 5BS0A 4A37A 2VIRA 3VXNB 4UM9B 5D1QE 1JBJA 2VE6A 2F58H 1IEAB 2VAAA 5B7EA 2OMZA 1B6UA 2VSKB 1RZKH 3OAUH 4RMSA 4G6AD 4GUQA 3UMTA 3ARDC 3ORJA 3WD5H 1YMHB 3MROA 4L8CA 1MFCH 5ESVA 3D25B 2XWBA 1RD6A 1UZGA 3GRBA 5HJDA 3TU6A 4JO1L 4HK0A 1JZ8A 2EVJA 1HE7A 2QL1A 4L3FA 5FKPB 4RVBA 3SDXF 2RCSL 3OQ3B 1UC6A 2C9XA 2HUEA 2UWEB 3NA9H 1XGYL 2CGZA 4AYBA 1N7MH 1MH5A 4OJFH 3CLEL 1G1YA 2VM4A 5I5JA 4UTAH 4PY7A 1FH5H 5EV7A 4GFTB 1U21A 1MHPH 3T0DA 1GS6X 4QI3A 4Q4EA 1HHGB 5ILTL 4ZFQA 3WUWA 3O2VL 4J23A 3BP5B 5EUKA 3ZUNC 4HKZB 2N7BA 4G7VH 3HC3L 5EOQL 5JPMA 5CJQH 2V9RA 3VD0A 2GAZB 4CBZA 5J12B 3PFQA 1OGAE 1C8QA 4ZFGH 4N1EA 1AQDA 3BD5A 4GMSL 5DJ2A 2YWZA 1PYWB 1J1PL 2XTJD 3ZKXC 3LIZL 4EN3D 4MHHI 5I24A 1H8NA 2O30A 3QUYB 5F7YC 3SBRA 3CFBA 1JZDC 4ODUA 4W6YB 4HSCX 2CGRL 1HWWA 2QLVB 1NKOA 1OARL 3MA9H 4GAAA 3LVTA 4Y2LA 1IC5H 3GBDA 4OZIF 3HPLB 3HZKB 4WHYG 1BX2A 1XR8B 4TKWA 4PJ7B 1I8KA 4FAAB 1HWHB 3HI1B 5GSRA 3COOA 4M1CD 3SHSA 4JPKL 2PF6A 3HMXL 5C0CA 1A2YA 4DTGL 3VYOA 2D3VA 3D06A 1N0LA 4KX8A 2ATKA 4GO9A 5FC9A 4JO3H 1OPGL 4LEXL 5J5EA 3VRIA 3SDDC 3B6SA 2F1AA 5IOKA 3BQUC 1T20B 5E1QA 1QHPA 2L7UA 4XOBA 5CP3H 3IN2A 4GSDL 4IRSA 2EDOA 3QCUL 4OGAC 3ZU8A 43C9A 4XWGL 3SKUD 2VZTA 2EDMA 3A6BH 3KWUA 3N1FC 5KSBF 4LKXB 3CQQA 4OV5A 4DN4H 2EILB 4Z7AA 2ARJB 2X1OA 3QJXA 4EPSA 2OSLA 1A7BA 1W0YT 2BOCA 3ARRA 4MSWB 4ORGB 1QRND 2GTZB 3D2UA 5BQDA 4NM4H 1RURL 2YJLA 4B95C 3VXQB 1KTRL 1ZXKA 2DF3A 3T3MF 4YDVB 4Z3GA 4X6FA 5DJ8A 4AK1A 3B5HA 12E8L 5KSAC 4HUKB 4MS6A 1KIUA 5C0DB 3EFOA 4CJ1A 4F37K 1TJIH 2OTWB 2E7DA 2FT7A 2LE9A 1P69B 1NFKA 2BNRD 4R0LA 5HHPB 3C87A 5FYKH 1U3ZA 5J11C 2G5UA 5INDB 1TZIA 1SBSL 5KTEH 4XRCA 3GEWB 2LLLA 4IK7A 1OPOA 4ZS6C 3NCYP 4PRHA 2AJXH 4R84A 1DEEB 3E2HC 4UV7H 4X4YA 3KG5A 5JHDD 4HJUA 4PRBB 2ZUYA 1XB8A 3MFFB 4MMXB 5JUEL 3GF8A 1F1GA 4QRQA 4BDVB 4PRIE 3BAJA 1OOWA 1XIWB 2IVFC 3IJYB 4HJEA 1Q4NX 1KJMB 5I1HL 1HEJC 1JHTB 5C8JA 5B8CA 4QTHB 2XXCB 3UJTH 1TU2A 1YEDA 3PL6C 3L9EA 2H3KA 4RGNB 5TH2A 3EJQA 4NP9A 1UACH 4YHLL 1KXVC 5JQIB 5ES4B 5MEQA 2P46B 3TBBA 2VDOH 1Z3GH 3ARQA 4KGLA 2WXFA 3LDBC 1CXLA 4LAQH 4XPTH 5DU7A 4Y5XA 2JLLA 3UZEA 1NPUA 4I18C 4NOFA 2LLGA 1IEHA 4CKVX 1NC2B 1PBYA 4AYFA 2C3GA 4Z7UA 3IGLA 4PJAF 1HXMA 2BP5M 4RMQA 3OGCA 3CH8A 4GG8B 1CFQA 4OFYD 4P46C 1AP2A 3DX7A 1Z5HA 3AW5A 4OZHA 1S3RA 2Z6FA 4XCNB 4V2CB 2OCJA 3QW9A 4ETYA 4X99A 5D5MB 3N42F 1SDAB 2P5EA 4F33A 2AQ3A 3MPCA 5D7KE 4NO2A 3BCFA 2D9CA 2JJUA 2WK2A 5LGJA 2RGSA 4R83A 3VACA 4M29A 1R9FA 2AGJH 3G08B 3TA3B 2F5AL 3TV8A 3QJOA 3S36X 4PJXB 1A6ZB 3QXDB 4S10A 3VFRB 4DVRH 5B7MA 4NN6C 4P3DB 1CDBA 4K4KA 5FR3A 3A22A 2F53A 3PREA 5AYTA 1B0WA 3O3BA 3TYFB 4CU8A 3L4TA 3VCLA 5JPNB 3TEYA 3MC0A 1J0ZA 3T77B 2NPLX 4F27A 3EDDA 3EJCA 1QSFE 1JZJA 3WS3A 4C56D 4UILH 4FTVA 4J8RA 1ZHNB 2ZKHH 2DQCH 5CZVL 3DHMA 3MBEA 1P84K 5D1ZA 3KLDA 4Z6AT 1UWGH 2GY7B 4Y1AE 1X9UA 1XF3B 2FNWA 1RUAH 5F7DB 3VFGH 3VG9C 3LKNA 4ES9A 2E6QA 3A24A 3KYKL 4V1DE 1J11A 3G6JF 3VW3L 3LNEA 4AUUA 2CDGA 1HL8A 5FGCE 3LQAC 1N70A 2J8UA 3GXTA 4M3HA 3MYZA 4J2QA 4W6XB 2C9QA 4Z0BL 1UKQA 3FT4A 2VN6A 4TVPD 2QV2A 2VLRA 4FQXC 4OZGB 2X6BA 1NFIA 3ES6B 4QY8B 2F7OA 1IV8A 5F1NA 3VWJD 3FQRB 3NABL 1ND0A 3TVMB 4HCIA 4HG4J 1WFNA 5LJYH 4HQQH 4UOW0 4IKLA 3HMWL 4QHNA 2JCCB 1ZK5A 3IDIB 1JXKA 1OSZB 3N44F 4LOEA 3WSQL 1RULH 4HYTB 3I75A 4LVOB 5CKAA 1EA9C 2CXGA 3KL3A 1SNRA 1BFOA 1L9PA 5K1JA 1ZA6B 3I3BA 2OZ4L 3WNKA 1BIHA 1PNDA 4IS6A 2ALWA 2AVGA 4TVPL 3C6SA 2APTA 1HCFX 2AHIA 1OAUH 2UXVA 4HHGA 5FYJU 5HYJA 1QUNB 1X4YA 1EXUA 1OLZA 2DQIL 2FIKB 1PEZA 2DQ6A 4JDVA 4QAWA 3MX0B 1T89A 5IJVA 1IBFA 3LKSA 2FVNA 1B2WL 1CL7I 1OEZW 1WWBX 2WNXA 2WOYA 3MNWB 4GP5B 5CILL 5EZLA 5H37A 1SM3H 5C0EB 3CD4A 1KPUA 1TZHB 1I3VA 4HFWB 3HHSA 5C7ZA 3V7AE 4PJIF 3NIDB 3ZIYA 2COQA 1GC1L 2X6CA 1K5NB 4OGZA 3D5OF 4GW4A 4OJAA 2HRLA 3WFCH 3B2VL 3U2SB 2NY5H 3PCYA 2WWMC 3L6FA 5T3ZL 5JPMC 5ETUB 1S9XB 3H54A 5IVZA 1FNHA 1WWAX 1YYLL 2MNUA 3W2DH 4NKMB 2PYEB 4JAMB 2KZBA 3TPUB 4QOKE 4JRWA 4E36A 2MFNA 2VLKE 3X12B 3UO1H 3ZE1F 2H32A 2W65A 2X9YA 3K72A 4U1LA 2YOAA 3IXAB 1MLBA 4JM0A 4Q9BA 1UB5A 3L17A 4DGVL 4K8RC 5L4FA 5EO0B 5IB1B 5LXGL 1A3RH 5I2IA 4WWNA 1NCBL 3H9YA 1AYOA 3EDFA 5CSZA 4W1TA 5F72S 2YK1H 1YUHA 4PJ5E 1VB9A 3RURA 2KYIA 1ACXA 4ILDA 4NQCE 2MNWA 1F3DJ 1VADB 4ZD3H 1T6WA 2V2WB 3IGAB 4OUOA 3MV01 1ADQA 1R3KB 1TDQA 4IRSC 2ZD0A 1BG1A 3GJFA 3GHBH 3VQ2C 3W11D 1PZ3A 4PV1C 3HVDA 4HSAC 4U6HA 4UQ2B 5JTWA 1LXMA 2EC9T 2UZIH 1U93A 4JLRA 1A4BA 3T0ED 3PHSA 3GIZL 2EH7L 5BRZD 3OKMA 3MCG1 2ICCA 3QS2A 3B3IB 2F68X 4AQ1A 4PW9A 4W93A 5L4IA 2YC1B 4FQIH 2FEEI 2B4CH 4WHTB 1KELL 1YNKL 3QI9D 5HVHC 2L7EA 4J6IA 4DEPC 2NLJB 1BF8A 3VSVA 4NIKB 2QADD 3Q2NA 3SCMD 5AYQA 3VFTB 2DYPB 3VYNA 4B5EA 3QEGL 1VEPA 5JQ6L 3U0TB 1DUZB 3EOTH 4HXAH 2JK5A 2GK0A 2MJWA 3JWDL 1WA0X 2A0LC 3W9DA 4PW3A 2KDGA 1ETA1 3ZQ9A 3NRQA 1SOSA 3IDXL 4R0LC 3NJHA 1G87A 4HUUB 4JUTA 1HEZB 1BPVA 1MQKH 5EU6B 1YEFH 4UZGA 3SO3C 1JWMA 4U1NA 3MJGX 5BMFL 4X50A 3KM2A 3O6ML 1UT9A 3H56A 3FO0L 1B88A 1FGNH 3VI3F 1G7PB 3OXSB 5E2TH 4D9QE 4H25B 1G7HA 2A74A 1NAML 4GRLA 3VGAB 1S9KC 2WN3A 5E9DD 4ICWA 4P06A 3SPGA 1EBPA 1IFGA 4BWWA 4HVBA 1AGEA 4WSGA 1JNHB 3PHQB 2ZWZA 2BVPA 4LPWA 5D72L 2YR3A 5B8CC 3RZCA 1ZVSA 2BNUA 5A16B 5FIEA 1N6QH 4KKRA 3UBXG 2AXFA 3P3SA 1H15A 4BBWA 2OJEA 4LQ1A 4ZFOA 3FF8A 4NZUL 1U8MA 1N5AB 3IK2A 1KCUH 4IOFC 3ZRSA 1E7VA 3K4AA 4Y5XC 3ARFB 1ZD6A 2BNQD 2X1QA 1SN5A 3UZEC 1EAPA 1MVUA 3F84A 4JN1H 3TO4D 3UAJD 5HHNA 2APSA 3V0FA 2V3FA 1LMKA 1PZSA 2ZJSH 5EPMB 5BZDA 2YQGA 4Q9QH 3T9WA 1CF1A 1E5CA 2QPFA 1D5BA 4MNGE 4ZUWB 1M7XA 5D7HA 4JDZB 1JE6A 4HWBA 3RWHB 4H20H 1E0OB 3OMZA 3AWGA 2QQQA 2I85A 1JK8B 5KS9F 2YRLA 4JFQA 2Y1YA 1N18A 1LO3L 3LEXB 3UTZA 2PNDA 3H3PH 2Q2LA 4KMTL 3BJ91 2G9HA 1WIUA 4YAQB 1BVZA 3HR6A 1HIMH 1OT2A 3RAJL 1JZFA 5DD1L 1AOZA 4F8LA 2F8IA 1KFAH 4TVUA 4YGVB 3QCVL 1FJ1A 2IF7A 2NQ3A 2WXIA 1D6EB 1DSWA 4Z18A 5DVOA 5FOBA 4L29B 1USZA 4N28A 3MKKA 3GBLA 2ZOTA 5IB3A 3G9VA 4IRZH 2KBGA 4AM0B 1MCDA 4NZ8A 3D52A 1N67A 4WENB 3TTYA 4AYMC 5DQ9B 1RUKH 2P5WB 4K55A 6FABL 3EG9B 2YPKA 3MBEC 3V6ZA 5D4QA 2GUYA 5D1ZC 4HZLA 4NUJB 1MWAL 1R5VB 5AOZA 4OQTH 1YHPA 3GUTB 4ZAKA 2VZVA 5E2UH 2P8LB 2HKHL 5DURB 4A1RA 1SEBA 4FERA 4AV0A 1C5DB 2ESVE 2CAKA 2NNAB 5I8OL 3UL4A 1C1EH 4HEMA 2JJVA 4AQAB 2HTKD 5JZ7C 4HAFA 1UKSA 1CDGA 1GY1A 1ROWA 1G7MA 3DBXB 4MB4A 2ZAHA 5HPOA 1LDSA 4F3FA 1PDKA 3QUKA 1LWJA 1NFAA 3TWCL 3A4AA 2ZWSA 2GI7A 3QFJA 1ZLSH 3Q9QA 4YHYB 3GSUB 2XACC 3GSNA 1KGWA 1F11A 1ECYA 5CXPA 1Q0EA 4NO5B 3RPBA 5I0YA 1F97A 3NGBC 5E6IA 3SDAB 4PJCF 4FHBD 1E5BA 5FYJE 2VDKL 1PY9A 4MNQA 1RP8A 5TJWK 3ULSB 4F1ZA 4FZEL 1L9OA 1PU0A 3GGWA 1WT5A 1AZCA 2ZKMX 5C70A 4WAFA 4FQ1H 2OYKA 5HYSG 1MAMH 5J6HB 1FO0A 4XMPH 5BOJA 5KVFL 4GKOA 4WFED 1A9VA 5DLLA 1SJXA 1MCPL 4MASA 4CDGC 2B59B 1V3LA 4P2RD 1RZ7H 4HV8A 4BZ2L 3QWNA 4JJ5A 4KVNH 1T89C 3CVCA 5MHSD 1E3FA 3BVXA 3BPOC 5F21B 5L9DL 1F86A 1HCZA 1RUQH 1MXDA 2WSKA 2DH3A 2XZAL 4KH9A 4MCMA 4IKNA 4IBWA 1M6OA 3A47A 3VFOB 2P80A 3QDGA 4K5PA 2AANA 2WXRA 4NQDB 3C9NB 4LHUD 2C9VA 1WBZA 5IBTL 3SE3A 3M07A 2NCMA 1OOAA 1OAQL 4TSBL 1ETB1 1W0WB 2ZWLT 3WNIA 4RAVA 1J0IA 2PXYB 4EUPH 1AO7A 1OSPL 1RUPH 2OBGA 3QDJA 4ZXBA 2IOOA 4YSEA 2GBAA 1WYJA 4Z77B 4IBQA 3B9EA 3IRPX 4K3JL 2W91A 3VB8A 4IRSD 2Y5TB 1I3RB 2BVQB 5SWQA 1DHKA 1T0MB 2QVKA 2R7EB 5I15H 3BH9B 3SGDH 3H7LA 4QXVA 2VLMD 3HPJB 4G7SB 4I3RH 2CO6A 3HBQA 4UINH 3VI4F 1N4XL 4MA1C 1QI5A 1UB6A 1UXSA 3MLWH 3DHJA 2KUTA 3QZBA 3ZHNA 1LVEA 2UX6A 3ZYOA 3K6SA 3CSYA 5FDWA 2GJRA 1KV3A 1MRDH 1WZAA 7TAAA 5IF0B 4ECNA 1PPIA 4BFKA 4MKMA 5DWPA 1LP9A 4NN7B 4PRPD 1HINL 2WVSA 3WAJA 5D9SA 4QUOA 2PO6D 3P0GB 5C0AD 4KZEL 3BUTA 4XWOD 3U0WL 5DJCB 4FGMA 4WLCA 3DPDA 2N7AA 1FNGA 1MY7A 5D7LA 25C8L 1WHOA 2LU3A 3FO2B 3HFMH 5HDBB 3OPZH 3FHQA 1Z1WA 1USQA 3CXDL 1LL1A 3CFDA 2PTUA 3GSVA 3QHTC 5DUPL 1K5WA 4AQ1C 4KRPD 3CJJA 3QK0A 3SO5A 1U8QA 3C5SB 2WLJA 2X2YA 4Z7IA 3D2TA 4WO4D 5HHME 2IAAC 1S5HA 3LZFL 2FB4H 3LD8C 4LGRB 3AT8A 4R90L 4UBDD 3WY3A 1QWUA 1A7RL 1A6AA 1AMXA 1MNUH 3R4DA 4CNIA 2YEQA 3FU8A 4J3OG 4R7LA 4PJEE 2QSCL 5HHXH 1A7PL 2NY1B 4NUGL 1FLRL 4Y89A 5E2JA 3DX6B 3US1A 5FECA 1S7SA 1BLNB 1E40A 3DJZA 5EEZA 1IAII 2CK0H 1VGKA 5BJTA 5IMKB 1KYFA 1RHHA 1LJMA 2H3NB 2H47C 3RVTC 2OV0A 5IR1B 3VDBA 4B9ZA 3OPUA 4XTRC 3GWJA 2A74C 4GRLC 1HYSC 3JZYA 5IOPB 3UACA 2V6HA 1KLGA 2V3EA 3ARED 4O2CA 3FDWA 4AGPA 3AAZB 5HI3C 4GAFB 3RZCC 2X3AA 5EOCL 4F7KA 1TNMA 1B0GB 1QLEL 3O4LB 5FHBH 4DKFL 1W16A 1DJSA 5T5NG 2P5ED 4RDQF 3T71A 4JCMA 5A2CA 3NFPB 1TENA 5AYUH 1ZPUA 2WNWA 4XCCH 2OXHB 2L7QA 1NUGA 4ZX6A 3CDGB 3JVFC 4JY4A 3TV3H 1KIRA 5F7BA 2JKWA 4GO6B 1MAKA 5BV7C 5AVZB 1KUMA 1WFUA 5I5RA 4LCCB 2HFTA 1PS3A 4PPTA 2WTPA 5BVJB 2XXGA 2YAPA 3QEQD 1YJDC 4OD2A 2X4PA 4N0FA 1XX9C 3P3YA 4MAYA 1W6LA 4NRYA 1FV1B 2J5LB 2R9HC 3IBOA 3IB4A 2AEOA 5JLZA 4YSQA 5C0FA 1OAZL 2WC7A 5I0WA 4YBLB 3IFPB 5E08H 2HVKA 5LWYL 1HU8A 2ADFH 4PGBA 1FH2A 1QEXA 2VT0A 5DFAA 3IDNA 4GYBA 1ETZB 1LEGB 1KJ2B 3SJVD 1BBJA 3FT3A 3DUUB 4U0QB 4QRPB 4IIQA 4NUPA 2I5YL 3W0WD 1UXWA 2A9AA 3HS9A 2M83A 3D07A 4FQHB 3OXRA 2DWTA 3MNVB 4I5BA 5HJBA 2H1LM 4LPXA 3SD5A 1CXFA 3P4MA 5I1GH 1L9NA 4N26A 3VXRE 2H45A 4G82A 4Z95L 5E7BA 1D9KB 2H26A 1D6VL 4FXLA 4L0PB 4PS4H 5E6ZA 4LCUB 2E6JA 4O51A 3TF7C 2HMID 3MGOA 4HBCL 2Y3NA 4KI5C 4ZAKC 4GG6B 2RAMA 2WXKA 4ENZA 1ACYL 2QELA 3CUPA 3AZUA 2UY6B 1GGIL 1A64A 4WDIB 2IIJA 4FFYA 5GRJL 4P2CG 2HT4D 5E56A 3EBHA 2FO1A 2AQQA 5I74C 3E6FA 4TM9A 4AL8H 3P40A 3V4VA 3GKWH 1EDQA 2C3XA 1RJYA 1ZANL 2EXWD 1QWHA 1BBDL 3KLKA 4OM0H 2XIDA 3TN0A 8FABB 2Z3FA 4IMKA 4U6YA 1GGCL 2H5UA 1U8HA 2WIIB 4G43A 2Q7YB 4AG4H 5E0QA 4NWTL 3GDCA 2B39A 5IFHL 5E6IC 2WLIB 1UFUA 2YSSB 1OTTC 1KT2B 4FI8A 2QGDA 4YO0B 1WT5C 2XSKA 3A6CL 4NNXA 4PJDB 2ITCA 4JM4H 5LXVA 4UQDA 1KYDA 2P28B 3MRPB 2YMXH 3H85A 4H1LG 1UWFA 5DHVB 5K39B 2IAMD 4U1HA 3OR6A 2DQEL 4XP5L 4DPCX 1XGYH 2FIRT 3I6SA 4DZ8B 2ODIA 4QRRB 5INCA 2R4SH 2EDQA 5EEXA 1IMHC 1A9BB 3CLEH 2Y2WA 4P9HL 3GQFA 3CH1A 3BDYL 4L37B 3FQNA 1AR2A 2E86A 4MB5A 1MN4A 3QDMA 1FE8H 3AS0A 3IS0X 3J8F7 4MTMA 4WU5B 2F15A 4XPFL 3QXVA 1P7QD 3WHXA 4FNQA 3PIQB 5T5FL 3UC2A 1MY5A 1YA5A 5IMLB 5ITFA 2D7MA 2GITA 4A6YA 2ETWA 2J43A 4Z8FH 3O6FD 3RY5A 3TP4A 1IFHL 3MCKA 3RX8A 4LL4A 4O9HL 5E4IA 3KPLB 4GMSH 1WE5A 1TTUA 3UBGA 1J1PH 2RMNA 3A67L 5E94B 4DGYL 4GAJL 4W70A 1NCAL 2EAEA 1GGBH 1MPAH 3BYYA 3FU5A 3LIZH 3P54A 3PWUB 4X7TB 5DVNA 1GGYA 2X2JA 1IC4L 3DKHA 1QFHA 5HVFB 3ZHKA 2Z31B 1CG9A 1CJYA 2CGRH 4A39A 2C7FA 1T80A 3ECVA 1UWEL 4X6EB 4BFFA 3MTXA 3V4UL 4MD4B 3H2WA 3C6LD 2E9WA 4ZXBC 4HLJA 3EHBD 3UTTE 1BM3H 4N6QA 4A2DA 1ZGLA 3T2PA 2WTRB 3H9SA 3BSZH 4WUUB 1AACA 1WV7T 1QHQA 3PQYB 1PNCA 4ZO8A 5D71L 4JFYA 4JPKH 4GSUA 1JV5A 5I30L 5I8KL 1VFBA 4Y19A 1I8LA 1FBIH 4IYKA 3RG1C 4TV3A 2QDVA 3BWUC 4YHNA 2YS4A 3BP7A 1OPGH 1LEKA 1ORSB 4GP8B 4IJTA 4JPIB 2DDQL 5DHVH 5HHOE 4M7LL 4ZODA 2VSDA 1T4KA 3HBZA 4G8GB 4Y4KD 5D1QA 3BRFA 3BD3A 3WFHB 1U8OA 2HRPH 2ISDA 4APQD 4ENED 1U91A 3MR9B 4I4WA 4XB8A 3GFUA 2E74C 4JFZH 2I60L 2ZXWB 3F6JA 2FQDA 4IHBA 1JNLL 2IQAA 1IM9D 1NIAA 3F83A 3RWGA 4GRMB 3M1OA 5D7IF 4XAKE 2CDEB 4OY9A 3EO1B 1RURH 4LVNB 2PWFA 2VRQA 4UQAA 4R8WL 1ASPA 1XGTA 2E4TA 4AIOA 4KAQL 3FC8A 4XO3A 2BSTB 3SDXA 5EN2A 1QEWB 5LAXA 4DK5A 3B2UC 2PWGA 2WXOA 5TFSL 3LNHA 5SV4A 3CHQA 4KVCL 5FEBA 2FEEL 5IZ7A 1JZEA 5C08B 1SBSH 2J55A 4WJKB 4JRXA 3KWTA 4DEUA 1JDCA 4JKKA 5T1LA 2F1EA 4FXGB 3DO3A 3HNVL 4AM0Q 1DQQB 1CO1A 2NZ1A 2MMXA 4KY1L 3OLDA 4MS8D 3RDJA 4AI7A 5M7QA 1S46A 5D1XB 3WEMA 3JZ7A 5E4EB 3KXFD 3MREA 2BP0B 4LLAA 4BKSC 4M1DL 3ZKNC 3HE7A 1IX2A 2GB2A 2W9EL 5HY9A 3PXHA 3SQBA 2VGLM 4RQQA 3M86A 4OZIA 1S2EA 1I75A 3HS0A 4A2GA 1XD0A 1RJZB 1C08B 1BOGA 3Q2CA 3BIBX 4K7FB 4LLWA 1KC5H 3REWA 4LRNH 5F0MB 2OR7A 2ZSVB 4W9DC 1SJHB 5HDQL 3DA0A 5MENB 4NT6A 1O9VA 4AC2A 1JP5A 4N0YL 4H26A 4WFFE 1S7QA 3SYPA 2R2BA 4HA1A 2YPLD 4NSKB 3WTUA 1UFGA 2AXGA 3FJTA 2CBQA 4MQXD 4B9KC 4HUCA 1U3HA 1TKWB 4XCEB 1A02N 5KSBA 1JGEA 2W94A 2WYTA 4G8FB 1FZKB 3MO1B 4MBRA 5D4HA 1ZXQA 2ICES 2E7HA 4PWHA 2A6JA 2ZG3A 2EE9A 4C83A 5TD4A 4NKIH 3CZGA 4DGIH 5EEWA 4BQ6A 4MAYC 3L9BA 3VB9A 3KLSA 3ARDB 1DBMH 3HN3A 3QJQB 1M7IB 4PCYA 1RJLA 3B2XA 4X9HA 1PW3A 4IRJD 4UZSA 1JVOA 1BHGA 4DFIA 1A7QH 1F41A 1LQBC 2AS5M 4NQEA 2RA1A 1K2DB 4N0UB 3VMOA 1FCCA 4LLMB 4IIQC 4HIQA 2LOEA 2YAHA 4RX4D 5IV2A 3O11B 5KVEE 4HGKC 4X6CA 4E68A 3VAEA 4XI5C 4P57A 3PWPA 1DO6A 1WLHA 5TF0A 3O3EA 4PRIA 2EVHA 5EU4A 3L3JB 1BF5A 2XZCL 5F7LB 2ZP9A 3FB8A 4DP9X 5TQ0L 1FNEA 1GL4B 1K9TA 3BH8B 3MUY1 5TGBB 5AB2A 1E9QB 4BINA 1AHMA 4ADJA 3N1MC 4NO0B 3IBEA 1Z9MA 2K7PA 1O6VA 2QPUA 1YEJL 2VO8A 1CN4A 2EC9U 3CFKB 3ZKXB 1KB5B 4P3CL 1LMIA 2E9BA 2CRYA 3WSQH 1RZJC 4I88A 3FN3A 4FQQA 4IMLB 3C8DA 4IKJA 2HLAB 3TN0C 4X6BB 5I1LB 4PJAA 2GK2A 2IANE 4IMKC 3NIGE 2O6CA 2H2SC 1UG9A 2GBUA 2RFXA 1KCSH 2R69A 3A4EA 4MDJA 3TIEA 3ABLB 4D9RD 5IJBC 3KW7A 1KLFB 4R2GD 2ZX6A 5EFIB 1A6WH 1MIEH 1WC7A 5JXED 1JFQL 2Q0ZX 1A7NH 1OY3B 3EYQC 3NJIA 1DEDA 1KNOB 2WYZA 5G4MA 3VRJA 2NY4D 3SDDB 2ORBL 4PWGA 3BQUB 5F9JA 3GZQA 3W1ZA 2MHAA 3PWNB 1EUTA 3Q7JA 5C7XL 2CZNA 4E41B 1B2WH 4KGJA 4AENA 2H8PA 5CILH 2O6DA 4PB0H 1J5OL 3JV5A 4BE5A 4TMPA 3T2OA 2K3TA 4LCIL 4AWJC 2YUVA 4O4YL 3QDJD 1Q1PA 3LRGA 4PRNB 4H8HA 1VIWA 3FUHA 3SQOH 3MGAA 1JRHH 5D5ME 1EANA 1KACB 4OCYL 3RIFK 5EIIA 3MUJA 3I9GH 1TZGL 4LCVA 4XNUL 1XBRA 3MV8D 2P8MA 4P3WA 1TTBA 5KSAB 2VLJB 1N0XH 5IG7A 4PJXE 2VDML 2H6UA 1LGVA 2BFVH 1KB5H 1XZ0B 1K8IB 4W6WB 3H8NA 1OV8A 3V8OA 4YVUA 3PXLA 4F7TB 3G6JA 4MCZB 5GGTH 1U8JB 1DQIA 5J11B 1ZHLB 5TDNA 2O6PA 2YD3A 2DB8A 4KRMB 3TJHD 4GB9A 3QHZH 4CVZB 1MCHA 1EFXD 2WO2B 4KUCD 4BELD 3FT2A 3PUUA 1G84A 2EH8L 3E2HB 1WJ3A 5BRZB 2OL3H 4BD4A 3BUQA 2FGWH 5DF0A 1OAJA 2DQTH 1WVZA 2D7NA 2IPKB 1RP9A 3OZ9H 1SEQL 4AMXA 5GXBB 4QF1A 3ZKMC 4WW2A 3VSQA 1I8LC 2PWHA 3PL6B 3QR1A 4PJGB 1YMMD 3HC4L 4U49A 5I73C 1NBZA 4JHWH 4JZNB 3GI8H 2B1HH 1QA9A 3LDBB 5AVTB 4JRYB 4OZGE 2JKIS 5D1QC 3MV7D 4PGEB 5KYXB 5CSBA 3GBML 4B9YA 5ID1B 1QI4A 2AJYL 2C34A 4I18B 1JTOA 1RZIA 1W8OA 5G5DB 2DKSA 1YNLH 3GIZH 4A63A 1O5PA 2JCCE 5ACZA 2TSAA 3V4PB 3TBCA 1SDDB 3FN9A 1GXEA 3IXTA 1T5XA 4P46B 5D8JH 5GGVY 4AE0A 2OK0L 3D50A 1YNKH 1O7VA 5L0QC 1V8HA 2PPDA 1HESA 4AZ8B 1EEZA 1RJCA 1TOXA 2NX5B 3KLLA 4NDMA 1F0LA 4G7QB 1S5IH 1BJ1J 4NNYA 4P2QB 3ZKND 3LEVH 4XE5B 4A67A 1OE1A 1TXKA 2IADA 2WXHA 5K69A 2C9AA 1JPFA 3PAZA 3IDMA 2JNZA 3MLTB 4PJIA 3VA2C 4AKPA 4CW1A 5AOMA 1I9IH 4N2EA 3UTSA 3VFWB 3WDIA 1KDJA 5DC9B 1U8NA 4Q7DA 4ACPA 5IQOA 4NN6B 4M6ML 3V6OA 4JFPA 4QWWC 2DQDL 3O6MH 4NB7A 3IGUA 1OXYA 4PBXA 3FO0H 2GHWB 3D33A 3FO1B 5HJ3B 5L8KB 2XN9A 4LF3A 3ZXAC 5JA9A 5IQMA 1XR9B 2BSRB 4Z1PA 1IAIM 4TL5A 4XNQB 3F85A 3NTCL 3NIDE 4J4PA 4U1MA 4UTBL 1WCQA 5D72H 5IQLA 5C2UB 4QHUB 2LU4A 2WKOF 3MBXH 4J7RA 4Z3EA 1J8HE 3HE7C 1S9YA 4DUWA 1IAIL 3BZEA 1KJ2L 1SJMA 3TFKC 3VG9B 2WZAA 3T4YA 4B3EA 4UNUA 2W8CA 3S35X 1ODUA 1E42A 3HS0C 4Y7OC 4LLDB 3UJIH 3P4OB 2PYEE 1BFVH 4NENB 5F6HI 2ZWYA 4MDRA 3V4PH 4PJ5A 5CCKL 4F8NA 4MD5B 1TYJA 3OJVC 4I2XB 4FQXB 4NQCA 5BQ7B 2MQCA 3HE6A 3Q05A 1MJ7L 4XVJH 3MNDA 1R19A 1BEYL 4EMZA 3S36H 5GIRB 1IAOB 1GYWA 4HF5H 5F7EH 4J3OD 3DMMA 4K3HA 2QMJA 3B1TA 4MA7L 2AQPA 1U3HC 5CJXA 4LASH 3B7TA 1X7QA 4JO4L 5ENWB 3NCJL 4ZRGA 4KMTH 1FIGH 3OBAA 4WK4B 5BS0B 2VIRB 3R1GH 5TE4H 4X9BA 2VE6B 5GRZA 3RAJH 4JJHA 4B9CA 1SLWA 2VAAB 1SMOA 2OMZB 5LDSA 3QCVH 3RTQD 4ZOBA 3WAKA 1PJ9A 5EMYA 1XGQA 1C7TA 3PWVB 4CC4A 3MROB 4L8CB 5ESVB 3P9MA 5DZLA 5PAZA 3KLHC 2AK1H 2XWBB 5KJ4A 2VERA 2GCYA 4LFHG 1N9PA 4NAMA 4XCYB 3NEXA 4CSPA 2YHGA 4HK0B 2NXZD 3CU7A 4JREC 2QTEA 1TSRA 2WYHA 5GRUH 4OR1A 1MWAH 3ZE2B 1DCEA 4ODHL 5FO8A 2QVTA 3RLSA 1MH5B 4XMWA 4GRWF 1MCLA 3LQAH 4A7UA 1PX4A 3VI3A 1DP0A 2BIPA 4PY7B 1M05A 1R4XA 2KQNA 3WUWB 1UEMA 5DJZA 1A1MA 1M4KA 3QG7L 5EUKB 5KVGE 1G4MA 1MAJA 5LGKA 5JPMB 3KBPA 3K1DA 4WUKL 2Z8SA 2E3VA 3DSNA 1KN2H 2Y6SC 3EGXA 4X9GA 1XCXA 3DYOA 1M1XA 5E5UB 3TWCH 4LU5H 5SWZE 3U4BL 1AQDB 1NLDH 5DJ2B 2AJUH 5LNGA 3W38A 2X09A 4KQ0A 1G6RH 1BZDA 3BT2H 3CFBB 4ODUB 2Y3AA 5CZRA 4HU8A 2OMTA 3ULVF 3FBQA 4LLUA 3BVUA 3O0RL 1BX2B 1FZOB 4J39A 4YBQC 1I8KB 3NK4A 4XO8A 4MNGA 4F92B 4LL9A 1I53A 5GSRB 4I7ZC 4X7SL 4HW6A 1OIOA 1ZIBA 2EIBA 5C0CB 1A2YB 5KS9A 2VN5A 3MRQA 1N0LB 4JFHE 5J6GA 1MCPH 1ZLEA 2ATKB 2ENYA 2N59A 5I8CA 5LB1A 3VRIB 3APDA 3B6SB 4BZ2H 1EJFA 5AZEH 2YAFA 3KW8A 3RGVD 4PM1A 4IRSB 2Z8VC 43C9B 2P47B 4GQPH 2WAQA 3LX9A 3WTVA 4M7JL 1EHLL 4Q9CA 4K94C 1JZHA 5B22A 4M43L 1VFUA 2H3XC 3F64A 4OV5B 1HILA 4G9FE 4BJLA 5FF6A 2OSLB 2BOCB 3E6HA 5IBTH 3TJEH 3H9SD 3ZO0A 4FG0A 3D2UB 1LWHA 4NKOA 4P4RA 5HVHB 5J56B 5KZCD 3QYMA 4DEPB 1JPTH 4X6FB 5AQ0A 3CZEA 5DJ8B 3D85D 1A9EA 4DH2A 1KIUB 3EFOB 3QQ4A 4NUQA 2FTAA 1LLAA 5FA4A 1FWXA 1IQWL 3E7JA 3OC8A 4WV1A 3W39A 4K3JH 3ZMRA 4NCC2 4R0LB 3ZBMA 3APNA 3PV7A 1E50A 3N43B 4K8RH 2H2PD 4Z7NB 1TZIB 2CPUA 4MAUL 3MV9D 5D7JD 3EO9H 4XRCB 5GRXG 1P9MA 3MSPA 3SO3B 3L3IA 4PRHB 2GSMB 1N4XH 3F05A 5IIEA 4X4YB 1XSJA 3TIDA 3TFBA 2YA2A 2OX5A 4QRQB 3E8VA 1RIVL 1E9PA 5GSVA 3GXNA 2MSPA 4B0MM 5C8JB 4PJBF 5B8CB 1PKOA 4WW2C 4Q4IA 1TU2B 1YEDB 2QZ5A 1JF6A 4PJCA 3SPHA 5C07D 1A25A 5TH2B 5D1ZI 5MEQB 4MXQD 5F1IA 4MCYA 4KZEH 2KPNA 2L8AA 4RRPA 3TZVD 4Y5XB 4HHAA 1Q9OA 2O61A 3LKRA 4LHJB 1TQVA 5GGRY 5IROA 4TL4A 4EF3A 5T1LD 1JERA 1PAMA 1UKTA 4AYFB 1XVSA 4R97C 5DUPH 3ROOB 5KYYA 5F96L 1HXMB 1AGCA 4WCYL 3OGCB 4LIQL 5C0BE 1CFQB 1AP2B 2GSGB 5EEYA 2J7LA 3DDFA 5AOKA 4OZHB 5IVXF 3VXUD 1K6QL 2JXMA 2XXMB 4X99B 1A7RH 4JM2D 3TS8A 4XBPA 1TF4A 1P4IL 5B39G 4PJHF 2OCCB 1MKFA 3F6LA 4K9EC 4F33B 3ZE0F 4N9OB 4NO2B 3B37A 4E9SA 5I1EL 5LGJB 3K4ZA 5ALBL 3SKJH 3FH7A 4HOXA 3FZUC 3IU4L 2Y24A 3W81A 1FFTB 3QWQB 3U7YH 3V5KA 3V6OC 2F53B 3O3BB 3VCLB 4PJ8D 1FNSH 1ZTMA 2PW2A 3F7LA 3MOQA 3WS3B 3K8MA 4FTVB 1XGZA 3LKQA 4YDLC 3QVAA 3EJJX 4U7KA 3BJLA 3HC2A 3MCLL 3MBEB 4U6TA 4J4PC 3SGKA 5D2LF 2AEIT 5D1ZB 1MELA 2HFEA 4AEIH 2X4QA 3FUJA 2E27H 3BZDA 2WBKA 1QLEH 5CD5C 2ZICA 4IU3A 2F74A 3BN9D 3FTXA 3L7FA 3LKNB 5HYQA 4FADA 4DOHB 3GRWA 2Y7SA 5E2WL 5E70A 4K07A 4HJ1A 1BP3B 4B7LA 1BYOA 1T7XA 2AJ3A 2CDGB 5J3HC 2J8UB 2FD6H 3EYUH 2V4LA 1MCSA 1MJUL 2R51A 5L88L 1P5VB 3TEWA 3FT4B 3WNNA 5I1IH 3FSOA 4DP5X 2HCZX 2GG1A 1DFBL 4Y9GA 1VGEH 1BVKA 3MACL 2VLRB 1JAEA 1NFIB 5F1NB 5GGSY 3HE6C 4JFDA 3H7BA 4P05A 1ND0B 3ZDXF 3GSXA 3VD5A 2YN5A 1NICA 4XMTA 1BECA 1QFUH 4QHNB 1I1RA 3S3CB 3DMMC 3NGBB 3GTTA 2ZOWA 3I75B 3QNFA 5CJXC 3NCCB 2VLLB 1FFOA 1BFOB 3KPRE 4KKBC 2FO4A 2IGFH 4RNRB 2WXPA 3H1ZA 4LCWD 4H88H 1XSOA 2W95A 4IS6B 5DCCA 4Z7OB 1JVKA 1L7IL 4JK0D 2A9MH 1QBML 3TCXA 3H53A 3HR5A 4Y1TA 2JKRM 2BDNH 4XXWA 1BXVA 5HYJB 2A2QT 4LDLB 1S8DA 4NERA 5I6KA 2BHYA 3QJTB 1EXUB 3OLGA 4CC4C 2X6VA 2Y6SD 5LQBL 4KK6C 1SXCA 5FK9A 1WAAE 2AQTA 3PAUA 3LZRA 5HDBE 4JDVB 4OZ4A 3CVHA 5IJVB 4KTDH 2E4FA 5T8IA 3LKSB 3U46A 2WBXA 3QZWA 1QO3A 3BPOB 3ECQA 5H8DA 2BWQA 3V0VA 4WI0A 3Q6FA 1GS7A 4KQ4L 3GMPA 2PCFA 4ZQKA 1LDPL 2IH8A 3GPEA 5D6CA 5EZLB 5F89A 4AOFA 5KSVA 3M46A 5I1CH 3WENA 5JOPD 1UM4L 3HHSB 1K72A 2BPBA 1Z5LA 3MRLA 2FZ3A 5I8EA 3M8OH 3W5MA 5LG6A 3E3QE 4GW4B 3DHUA 5SWSA 3EZ8A 5ABZA 5JW5A 2EVFA 4DIXA 1CTMA 4AMKH 2FAUA 3L6FB 2WLNA 3ESVF 4A7VA 4FKEA 4W9HC 1THCA 3CK0H 1A65A 5IVZB 3RWJA 3MTRA 4EIBA 1J9RA 2HYMA 4XP4H 5E8PA 1CVSC 1JTPA 2XV3A 3KS0J 3TX4A 5FYLD 2EYTA 2V17H 1MEXL 2R0WH 3R18A 2H32B 4KFZC 2W65B 5IFHH 3K72B 3MUZ1 4U1LB 2ROXA 1MLBB 2YFNA 3QPXL 3EJYD 1L6PA 1UB5B 1ACCA 4YHML 4LB8A 3K74B 5E51A 2MOVA 5I2IB 4MA1B 3QO0A 4LKCA 2XRAH 1OAKL 3O4LE 4ODWA 5CSZB 2FR4A 3EYSL 3LB6D 4P5MA 1AZUA 3GMNA 5EUOF 3N04A 4KTEH 1AQMA 2DQEH 3BEVA 3JWOL 4QT5A 4JS7A 2DBLH 2Y7QA 4TSCH 5E1IA 3QYCA 4FFZL 4G6ML 3LZLA 2UZXA 3ILPA 1LNUA 4LPTA 2QVFB 1F56A 5DO2C 3WELA 2VDPL 2DWXA 4ODVL 1MZYA 4N0CC 4L1TA 2OR9H 3GJFB 4JHUA 1NL0L 1JYNA 3WEBA 4AJ0A 2E9IA 4U6HB 1MWOA 1Q9LA 2Z7UA 5JW4M 1JXDA 3NCYS 3W57A 2B9AA 3DIFA 3GSOA 4CSZA 3HAEG 1U93B 4JLRB 1GPOH 3T6QC 3P73B 3VU2A 5CBEA 3OKMB 1G43A 3N2JA 3A67H 4LEEA 2FYVA 4Z3FA 4AQ1B 1UQSA 2ZZUT 4XN2A 3MN8A 4M02A 1R3LA 1BJMA 1IC4H 2GBTA 2ENJA 5B3NA 2CHWA 5K93A 1N26A 4HLZG 4NC1C 3VXRA 5IHHA 1U6AL 3LD8B 4IGBD 3V4UH 5F1KC 4J8QA 5EEUA 4LSPH 1FORL 4XHJD 4NC2B 3ZMNA 2JK5B 2H32H 2GK0B 1J7VR 3QJSB 4FKKA 4WV1C 2JI1A 3W9DB 5IJKA 1OD7A 5D71H 2QKIA 3WTTA 5I8KH 3UC0L 3RVWD 3Q44A 3TF4A 1P9MC 1JWMB 3R19A 4U1NB 2QHLA 2BIOA 1RZGA 5A6LA 2BSCA 2DDQH 4M5YL 1LM8V 3MRIA 1UWXH 1G7HB 2A74B 4GRLB 4UDUA 4GG6E 5CWSA 4NN5C 4F93B 1XSIA 2ITDA 3B83A 1BSIA 1AGEB 2YUXA 5AWNH 2V2TB 2BVPB 4YFLF 2IDUA 3RZCB 1ZVSB 4HGWA 2BNUB 1JHKL 4U05A 2AXFB 1H15B 1OK0A 1GYCA 2OJEB 1PG7W 2YMTA 2BZ7A 3POCA 4ZFOB 5E24E 3N41F 1EO8L 1IT9H 1MHCA 1U8MB 3RDTA 5IEKB 3N3EA 1E5ZA 4R8WH 4PS7A 3G5WA 2HKFL 2LT9A 2XWZA 3MNZA 3FU3A 5CLXA 1MVUB 1NBVL 5D2NA 4E9YA 1Y18A 3BPCA 5HHNB 5IROC 5IVOA 1JNJA 5BV7B 1HEHC 1TJHH 3PAYA 1CBVH 5BZDB 1A4JA 5DC4B 3R0NA 1D5BB 5DT1L 5IQ7H 4U2YA 4B53A 1X5XA 2RJMA 5EBLA 1F4WH 1NOLA 2AK4A 1BQHG 4NP4H 3IJ9A 2FWUA 2E7BA 2IDSA 3GMQA 1EAJA 4KJQD 4M7KH 4PJDE 1MCNA 5J8OA 1JZ4A 4JFQB 1KWKA 3DOIA 1F4AA 3UTZB 4ZNEE 1A3LL 1OGTA 5PCYA 4QRRE 2P42B 4QDGA 2CKBH 4KNQA 2NY6D 4KY1H 3NUKA 5DDHA 3DK2A 3I50L 4HWNA 2RH0A 4Q6IA 1FJ1B 2RR3A 4R4BA 4M1DH 1WIOA 5ISZD 2FUQA 1MG3C 5FOBB 1G9ML 1LK2A 5IB3B 1TQBC 4ELKA 2WQWA 3NRPA 3UAFA 2X89A 1HN1A 3ZIMA 3ETTA 1S9VA 1U2CA 4EJ1C 2YPKB 4N8CL 3V6ZB 3QJVB 3VH8A 3SGKC 4MWFA 3NESA 4KOBA 4HZLB 3QQ3A 5FAAA 1DQLL 2EDTA 4ZAKB 1TVDA 4J12A 2F8OA 1SEBB 2Y2YA 3ENEA 3WIAA 3FFCD 4N0YH 4JFFA 3LN5A 5TE6H 4MA3A 2JJTA 4YX2H 4YQXL 3N1QC 5I74B 1G7MB 3S48A 1QRNE 4H0HB 4WUUE 4E2OA 4F3FB 3EADA 3FKUS 1PDKB 3PQYE 2W38A 2BXZA 3QUKB 3OB8A 3ZDZB 3SYAA 4F80A 3U30C 1TJXA 3QFJB 4YE0A 1HNYA 4E9VA 1X5IA 3D12B 4GMTH 1B4LA 2DM3A 4S0TD 2HWZH 5E6IB 4G8GE 3EFDL 2PMZA 4Y5VA 4EI5A 4N2CA 4MNQB 4K9JA 2Y7LA 3PHOA 1EGJL 3CQFA 2DJ4A 3GGWB 3I9IA 4UIMA 1MHEA 2NRDA 3IMBA 5JHDE 5LAPA 1FO0B 2DEXX 2EE3A 3GNMH 4XXWC 1R0AH 1J10A 3C5ZA 3EYOA 3GUFA 2UV3A 4DF9A 3IKCA 2GJ6D 3HUJE 3U0PA 4QLWA 2VXUL 2UY7B 4HV8B 4JJ5B 1I3GL 1R34A 5CP3A 2YBRA 3CPUA 2XZCH 1CIUA 4XP9L 4G7RB 4OB5H 1NCDL 2Q20A 4KU1A 2WHVA 2NZIA 4LSDA 3NCFB 2W80C 1NFDF 4KV5E 3B7SA 3QDGB 3CNKA 5DLMH 2D3JA 2PR4L 4YXKL 5KJ7E 1WBZB 2WUBH 2DZEA 2MKLC 2IPUG 2X10A 5E6SB 2LV4A 1H3PL 4P49A 5DFVD 4RAVB 3R7QA 1CLVA 4MCNA 2B8OT 1AO7B 3D0AA 2YGQA 4Z7WA 2F1BA 4JQIL 1K3ZA 2CJSA 3GSNH 4XPHH 5EOTA 2X70A 4D3CH 1QSED 1TNNA 3AQXA 3LZOA 4ONOA 5AL0A 5E99H 4ZXBB 2VSMB 4PD4J 1PFOA 3KPOB 1KYOJ 1DVQA 2FBOJ 3ARGD 3K5RA 4N0CD 5ICXA 5FLVA 5SWQB 2OM5A 3KDPB 4PREA 4WFGD 1B4RA 4WI6A 3ASWA 1PZBA 3BZ4A 3S98A 1NGPH 2CO6B 3PP4L 1J5IA 1X4ZA 2A5UA 4KJPD 4PS3A 4FE9A 3WYRA 2R0KH 1UB6B 1KIPA 1PGRB 1UXSB 4XO5A 3KPSD 5C7XH 5ANHA 4M8UA 5TQ2L 4JE4B 3K6SB 3VM7A 3CSYB 4F1SA 5FDWB 4C56E 5CINL 2ZOLA 2XWTA 1J5OH 4PMFA 5F3BA 1YEHL 2VXQL 3T0BA 4TUKH 1LP9B 5D9SB 3L95A 4EAEA 5A43C 2X2IA 1GMIA 2W60A 5D7SH 3FCGA 2D8KA 3LRSA 5TDOA 4UTCA 2Z65C 1FNGB 3CZLA 5D7LB 5DA0B 4RBPK 3LHAA 2VDMH 2HB0A 3GM0A 3M1CA 3CFDB 4PVNA 2Q76A 3GSVB 4KHXH 4YDIH 5LGHH 4JCWA 4LNRB 1D5IH 2NOYA 2KT6A 3WKMH 2YD9A 1RH8A 2ZXBA 1U8QB 4MA8L 5JIHA 2BRRH 5DO8A 5IB2A 1N3NA 4G11A 3BAWA 2LAAA 1RLWA 2NY2D 1S5HB 1MJ8H 2GSIA 3D1MC 1A6AB 4FQLH 2VQUA 4N0UE 4CNIB 1NCNA 3WLBA 1NJ9A 4BK8A 3IJEA 3BH4A 5L2KA 2PTVA 3M45A 3THML 2G3XA 3NK3A 4FJZA 1DQJA 5IJKC 4YDKL 2QKIC 2W0LA 5I82A 2NXYD 5FECB 1EBAA 1ZT7A 1ET5A 2FEJA 1IGML 1S7SB 2NUTA 3VGDA 3U1PA 1VGKB 3OL2A 5BJTB 1RHHB 1CTOA 2QPDB 5F44A 3NZHH 3HZMA 2HT2D 1EMTL 4IOSA 3BW9A 2IANA 1JGLL 1KLGB 2XV6B 4O2CB 3GBMH 1N8ZA 2FSDA 2AJYH 1FA4A 1Z7JA 2EP6A 3E8UH 3F58L 2ZG2A 4XAWL 2AQSA 4OCWL 1H6FA 3LXAA 5JIQA 1OAXH 5C1MB 5DD0L 4PI0A 2GIYA 1OT4A 3UX9B 3V0WH 3RDTC 2OK0H 1BJ8A 5I19L 5JOFA 1NDTA 2JV6A 3BWZA 4FXTA 3QIBD 3QQ9C 1ZV5A 4PB9L 1F13A 1WO2A 4LOUC 4JY4B 5D2NC 1KIRB 3FO9A 3HJEA 1L7TH 1U41A 1RZQA 1ZTXL 3B5GA 3HFFA 1A14L 1M2OA 4S2SA 4K23L 3QARA 1KGCE 5IKCA 2AC0A 4YSRA 2C9SA 4OD2B 2X4PB 4UIKL 3L4CA 5F3HA 4N0FB 4HP5A 1HJCA 4MAYB 4KO6A 4BSVA 4NRYB 3H6AA 1SVCP 3MLYL 4M6MH 4KMQA 2A9NL 5JLZB 4E41E 5C0FB 3LRKA 4A7QA 4NQSA 4LE8A 1BW8A 3DX4A 1XBDA 3VXOA 3TASA 3EF4A 3TTSA 3SODB 2HVKB 4Z9KB 1T7ZA 4PGBB 3V79C 3IDNB 3QUGA 4GS7C 4NQXA 3MRBA 1RZKC 1BBJB 3DURA 4Q6IC 3FT3B 1OTUC 3STZA 4ZMZA 4DJMA 4IIQB 3F01A 2F8XC 4TRPH 1BLIA 1UXWB 2ZONA 1V7NL 2X88A 1WA1X 5HHQA 4OFKA 3LH2L 2GPZA 3OXRB 4TPRL 3STLA 4I5BB 2MKWA 3FH5A 3NFSL 4OFDA 2VLJE 4QRSA 2M2DA 3S37L 1S7WA 1E2WA 1U9KA 3P4MB 2DKUA 3EJPA 1C9SA 3BZ5A 1U4EA 3IWUA 3TEUA 2IPTL 3ZL4L 5E8DL 2H26B 5AALA 1CFVH 1U36A 2XZQH 3MGOB 3T2NL 2ZUXA 1HKFA 4KKCC 1MJ7H 3X3FH 3CUPB 5CEZD 2I25N 1BFSA 2JJTC 1WIPA 1LO0H 2EIJB 2XDHA 4YC2C 3ZMEA 5BRZE 4XMKL 4ZOCA 3RVVD 3W3BA 3E6FB 3DETC 1INDL 2BXYA 3V4VB 3Q13A 1TMCB 4LP8A 4NQQA 1RJYB 1CR9H 3U82B 1Z0NA 4N1CA 1E3XA 1MDTA 3VXPA 4JO4H 3AQYA 4F20A 4OGQC 3TN0B 3ULUL 1ZT4A 4FYRA 4PJGE 4C58B 4FFWD 4U6YB 3N6YA 1U8HB 1EZVX 1H5BA 4G43B 2WCPA 3IMRA 4FNUA 5GS0D 4ODXA 4PGCA 5IHLB 4AV4A 1NDGA 5CEZL 4EI5C 1FC2D 1JOIA 5F71A 5SX5H 5MEPA 3FAWA 4J3OH 4U3SA 5CGYC 3HG1D 1X9QA 3ZOAA 4L18A 3BKML 3E9UA 2D9QB 2ZAGA 4O2EA 1UA6H 1CD0A 1YY8B 4U1HB 1B9KA 3OR6B 4IOIA 7FABH 4MJID 4ODHH 4RFNC 4NYLA 2NSQA 2LU5A 2XHNA 3C5ZC 1UCBL 2VR5A 5E9DE 5INCB 3CWGA 5IQ9A 4OLWH 3SYOA 4LSRH 2BO0A 5GRVK 3CH1B 2AAVA 1CYGA 3FQNB 5I18H 3RKDD 1C16A 4GQ9L 3QDMB 2G9KA 3SYQA 3WFDL 3WHXB 3ILQD 2CNZA 2O5NA 5BPPA 3QUZD 3PS6A 5ITFB 4ZMPA 2GITB 4A6YB 5GRWA 4BRJA 5IUCA 2WKOA 3Q8FA 3SDYL 2X4TB 3IDGA 4FFYH 3G9AB 2OI9C 1KTDA 2Q7AA 1MIML 1J8HA 3MCKB 3U4BH 4F2ME 4GEJA 4N24A 1PQZA 4P5TA 3O41A 3F7KA 4IBVA 2FBJH 1DL7H 4KDTA 1GTNA 1JMZA 1E6OL 5FKAA 4MXWH 3KPNA 4P23A 2A4EA 3VFNA 5MP6L 2LLNA 4ALAH 1CDCA 2DI7A 2KH2B 4LP5A 4JFED 3BHBA 4PSRA 2IOMA 1ZGLB 1IAMA 4XE0A 5KVDE 3H9SB 2J4WL 4K7PX 4KTGA 1IEBA 1CICA 2CWRA 1E67A 4H8WC 4HCRA 4X7SH 4JFYB 1JV5B 2V8LA 2K78A 1EXGA 1VFBB 2V7HB 3MJ6A 4Y19B 3VXSA 4YZFF 4OZFG 5T1DL 4YHNB 1JF1A 3BKCL 2UWEF 5I73B 3DGDA 4L4TB 4FG6C 3ZVVA 3FRPA 4ZFFA 1E4XL 1DQKA 1UM5L 5D1QB 4PLJC 3VSUA 5DEFA 1U8OB 2P3YA 5JQ6H 1U91B 2D4FA 2XG4A 4I4WB 4FQJL 3HB3C 3LCYA 3LOWA 1AS8A 1M1SA 3K7UA 2BP3A 2J44A 3RWGB