4CSTA

Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords PROTEIN FIMH
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cstA00
4J3OH 4J3OG 4AUYA 4X5QA 4X50A 5LNGA 1UWFA 4AVKA 4XOAA 5FLUA 2UY6B 3RFZA 4AVJA 3JWNE 4AUJA 1N12A 4AUUA 5AAPA 4CA4A 4AV0A 3SQBB 5CGBA 1QUNB 4AV4A 3ME0B 1TR7A 5IQNA 3ZL1A 1ZE3H 5F3FA 3JWNH 4XODA 4CSSA 5F2FA 5JQIB 2J2ZB 3BFWA 3ZL2A 4BUQA 5AALA 4CSTA 5ABZA 3BFQG 5IQMA 4XOCA 4LOVA 2JTYA 2XG5B 4J3OF 4XO9A 4XOEA 5IQOA 5AB1A 1PDKB 2W07B 2WMPB 2XG4B 4AVHA 3ZPDA 4XO8A 4X5RA 1KLFB 5FS5A 3MCYA 1N0LB 2VCOA 5FX3A 2UY7B 3BWUF 5FWRA 2JMRA 4X5PA 1KIUB 4XOBA 4AVIA 4ATTA 4AV5A 5LNEA 3JWNG
chains in the Genus database with same CATH superfamily
4K9EC 2DJMA 4ESKA 4JO2L 4FTVD 4Y9BA 3V6FA 5ACLA 3KJ4B 4RZKA 4V2BA 2MOGA 1M3JA 5DK0A 2D2CC 1F4XH 4DTGH 1F90H 3WIFB 4RX4A 1GIGH 2FQFA 5D1QD 1IC1A 3ULAB 3WLWD 4G7YL 3IGAB 2X3CA 3AZUA 4UT7H 3DRQA 2H1PL 2Q1EA 2WNXA 3MMEA 3QDHA 5C0CB 4IIQA 1BF5A 5CP7A 1OARH 5JQHC 2JKWA 1CF1A 2ZF8A 2EADA 2NXYC 2NNAB 1JPTL 4Y2DD 4HSQA 4YE4H 1FC1A 4IMKA 2Z64C 2BIPA 3VX0A 2CK0H 5C0EA 4KKAC 2H7WA 2NUPA 2RCSH 4JZOA 1D6VL 4AENA 2VRQA 4DK5A 1HH6B 5HVHC 1MUJB 2ZJSH 4GNKB 2XN9D 3E9UA 2CBMA 5L2KB 3IXAA 1YUHB 3EF4A 3EFFB 4EQ3A 5EEVA 3T2NH 1TUPA 4KAQH 3IJHA 4TSCH 2IMNA 3ZDZF 2YD5A 1NINA 1IBGL 5EU6E 5EU6A 3MCYA 2G5RA 1BQUA 2E6PA 3MYJA 2GIYA 1T66D 3NABH 5KN5A 1X6NA 2DJ4A 2DW5A 3C75A 3VFWA 1PS3A 1K9TA 2X4NA 4JCMA 4PLNC 2VQ1B 5EOTA 3HZMA 4ZD3H 1QSEB 1NCNA 3WEAA 5HI4C 5B4MC 1TIUA 2DD8H 5D4JA 3RL1A 4ZK8A 5GJSL 5IZ7A 1EVUA 4TOYL 5JO5A 3FQNA 5C0JB 4HMCA 2WY3B 1JNJA 1D5XA 2Z4TA 3N43B 4PGDA 2E9WA 2E75C 4CC4A 1RULH 2NDGA 5D4HA 4TKWA 5FWRA 5TDPB 4YXLL 5DHDA 4F7MA 3MNWA 3O9WB 5LVEA 3II2A 3OKLB 1H0DB 3TASA 5H4ZA 5I1AB 1FLTX 2QQKH 4OAWB 5DJCB 4JPKL 2X1XR 4YXLH 3P0GB 1UA3A 2YK1L 4Z7WE 3C2AL 3TFBA 4OLUH 1CL7I 5AAWC 4OGXL 3SCMB 2NY7H 2UV3A 3FB8B 3T08A 5KYUB 4JFVA 5DJAB 3PJSA 1G9MC 4UM9B 3T77A 3KWVA 2IADA 5MERA 4R96B 3VI4E 1OPGH 2EP6A 3NIFE 1Y7VA 4HDIB 1HU8A 4OLUL 3E0GA 1AOHA 2BMKB 4WENB 1CDHA 3WTSA 3APCA 2IOOA 1AGBA 3WKML 2BINA 5MENB 3T77B 1ZGLM 4L4VA 3GSQB 3DXAB 2L0DA 1OPGL 5IQ9B 4HK3J 4XAKD 1KB5A 3I9GL 3D7PA 1T04A 3K6FA 3N06B 4S0TD 1XGYL 3O6LH 2OXGA 1DUZA 4MJHA 4CSTA 1TZ8A 4MAYD 4R83A 2CGYA 2HUEA 4C83B 4DO6A 3C08H 3KPPA 4MD5A 5ETUB 5FO8A 1JZEA 2A77H 3HS0B 2G5BA 3T4YA 4OZGF 4M3KB 4QOKB 4DGVL 1E67A 4LF3B 3WDJA 3CDGB 5I71C 1INEH 5F72S 5ADPL 3US1A 1T83A 4WJKB 1T7YA 3LCYA 3DTDA 4FQ2H 2YXWA 1QD0A 3TJEH 3FK3A 2YZ1A 3MRFA 5C0AA 3VXME 5F1NA 4M8VA 4Z78B 2JB6A 1F3DJ 5T1KA 2X70B 4WV1A 4UYPA 3LQAH 2KLTA 1EJFA 2WINB 3BUPA 5DD6B 4PV8B 1N5AA 3N04A 4P5MB 1S78C 3U0TA 2Z7WA 1EAPB 4Y8DC 3KZ8A 4BCZA 1AXSB 2G0KA 2OMXA 3KWWA 4GMTH 1KPVB 3PWVB 2FYVA 2IEPA 1TCRA 4N0FA 4ZFFB 3JWDC 3MV7A 5CUSH 3QXDB 2N4IA 3WYRA 5I1IH 1M9WA 3AGWA 2IO5A 3QW9A 4XGZA 1J88A 3SKMA 4KKQA 1W0VA 2OULB 3AAZB 3IK2A 4MMYA 2DDQL 4MQTB 5IQNA 5IK3A 2XQ0A 4EBQH 2WXHA 1I7ZB 2NR6A 4XMUA 3QDMA 5LN4A 2C9PA 1BP3B 3C6LD 3WIHL 2YA1A 4AQ1C 3FB6A 3GMLB 2C4FT 4FNLL 3WXWH 1GA2A 5B8CC 3VUAA 5D7IE 1AZBA 5KBLA 1O9VA 4NCC2 4NNPL 1U91B 2UZIH 2YOCA 3ALPA 5IB1A 3B8YA 4AYID 1GTFA 5IHWA 3VXSD 1BQKA 3G5XB 4LVHB 2VAAB 3I6SA 4ZDHA 3QXWA 4MQXD 4YLCA 1L6ZA 1U8JB 5CGBA 3RWGA 3ILQC 3QIWA 4PJGF 2K8QA 1WICA 4WHTA 3WL9A 1WWWX 1DHKA 1KPUB 3HC0A 4FD0A 4JFZH 5ELIA 1IAIM 1XGPB 4CL7A 5G5DA 3ZDYB 1AQKL 1IGFL 2EC8A 1ET5A 3HNTL 4QMEA 5FK9A 2RA1A 3A47A 3O6KL 1Z5LB 5C0FA 3BZFA 1WIUA 1KGYE 2AXFA 5EUOF 2H1XA 2Q8BH 3T8MA 3P9WB 3QXAB 4QHUA 1R3HA 2QVTA 1D7CA 1FYTE 2A6KB 2MKWA 1S9YA 1HSAB 1ZTMA 5BRQA 4Y1AD 3DSNA 5JOFA 4WK0B 4UIKH 1U2CA 3EOYG 3L5JA 1KGCE 1VCAA 4ODVH 3CSFA 3ZT6A 3HN8A 1OP3K 2R8SL 4HGWB 4JM2B 2N7AA 1I7TA 1XL6A 4MJIB 4MQ7A 3D25B 5JORA 2KUTA 1RHFA 3BH8A 3KCWA 4L5FL 4IIQC 2I5YL 1O7DC 4OFVA 2ZOKB 4X0KB 4BSWA 4ZAKC 1A6ZA 4RLDA 2YEVB 4JGMA 3WKMH 1NUFA 2R1WB 4KRNA 1BEXA 2MCG1 2EEAA 3WXVH 3QNYA 2R1XA 1LK3L 3STLB 4JFEA 1ZK9A 4MMYB 4F5CE 1INQB 1XXDC 2DQIH 2B8OT 5HVGB 3KYOB 4UYQA 5KSVA 1KGWA 4IHOA 4NJ9L 1R1CA 4FNQA 1QRND 4MSWB 4EXPX 4N3UA 3ARFB 3BP7B 3RX9A 2NY2B 4G8EA 5CJQH 5IW1B 4YFLI 4DGIL 4Z76B 3SY6A 5BXFA 2P8LB 1JI2A 1S3KL 1GL4B 3S8WA 4F58L 4KGLA 2DICA 5DJZB 5B4MD 4N28A 1I8KA 4M02A 2HMID 2WBJD 4UQ3B 5I1HL 5FV2A 3OLIA 5E8EB 4KJWC 2R83A 3ZTNH 2NW3B 4RWYL 3ESMA 1RIVH 4KU1A 5SWSA 5AAMC 1RIHL 2CIIA 1BPVA 1RK7A 2VSCA 1N64H 1IAOA 1F11B 3OF6A 1T5XB 3HZVB 2AGJH 4LLAA 4OV5B 1G7IB 2AQQA 3O2WL 3R18A 5BRZB 4GT0A 3FU7B 4JFQA 3OZ9H 3IS0X 1DCLA 2VR3A 3L9BA 4IBUA 1I7RB 4NO2B 2CO4A 4IDJH 4Y8AA 4GO8A 1QSVA 1BVKA 1JXFA 4NC1E 2Z34A 5K9KB 3IRZA 3KBHE 2BSTA 2G3NA 4WW2F 3V7MA 1I1AB 3VDCA 1F86A 1HHIA 4V1DA 1E9OB 3ZJAA 3D9AH 5KANI 4HUUB 5LCVL 5CSGA 3MUGA 1BBDL 5CIPA 1MCKA 3T1FA 4AQAB 4NCC1 3QHZH 5I8EA 4PWGA 4Z95H 4L8BB 2J71A 4TUOA 1PKOA 3U4BL 1AP2A 5DS1A 1NDGB 1TOXA 3L4ZA 3PIQA 3HS0C 2H8PA 1K2DB 3D25A 3KLSA 1B4TA 5E6RB 4G9DA 2AJZA 1GPOL 2J8HA 2PCFA 3ARGA 4X9FA 1FNAA 4GQQA 3X14A 4N0CD 1XGUB 3CLWA 3TEYA 2R0KH 4RRPM 1GOHA 4WQOA 3AG3B 4O58H 4MCYB 1C08A 2X4UB 2ALAA 1N7MH 4RMVA 4Y9EA 1WFIA 4WI9A 1EBAA 4JRLA 4Y2NA 3P02A 3MNVA 1P9MC 2E7DA 5DURB 5C3TA 3ETBJ 2EE9A 3MRLB 3D08A 2IPKB 1UWXK 2PPCA 4I89A 2DM4A 4MJ6A 3O9WD 3QVAA 3SE8L 1J9CT 4ODBD 2UUDH 1S7SB 2K0RA 4NQQA 3IFLL 1YQ2A 3BZFB 3U9WA 4BA8A 1XSJA 1OZTG 3HCVB 3B2PA 5HGDA 1BYNA 3ULVC 4NRZB 4JK0D 4GAJL 4PRNA 5FYKU 4XP1H 1KN2H 3VB8A 4QGTA 4NZJA 5FGBA 3CZLA 3GMOA 3GRGA 2WUCL 4OGQC 4R4FL 4Z7UB 1E8ZA 4O2EA 5F88B 3TO2B 4MJJA 5HDBB 1ICTA 4Q9QL 3FCGA 2ADIA 4EN3A 5HYSA 3KGTA 2QV4A 3RILA 1XZ0A 1OSZB 1KJVA 5SWQB 2WVTA 4ZW8A 2XWJB 1NGYA 2K4AA 3ROLB 2FWLB 1T6VN 1MIEH 1UXWA 4OQ1A 3VWJC 5FUZL 3Q8CA 4K8RH 4ISVB 3EOTL 1ZE3H 3OJDB 2D3NA 4WV1B 1E90A 1T1ZB 4L23A 1OE1A 1UB5A 4OCMC 4AENB 5JW4Q 5KVGH 1KY6A 1G7HB 2NY6C 2YJQA 2XX1A 3F7VB 2KPWA 3B2VL 3L9RA 1HN1A 4PRPD 1JGLH 2DWEB 4PREB 2EIBA 4LHUD 4AQ1A 3CHOA 1JWUA 3B3IB 5TFSH 4YLBA 1H15B 2DL2A 1U33A 2G9KA 2NDFA 4CA4A 4QXWA 1PSKH 4QPEA 3L4UA 3TEZA 5D1QB 5MEOA 4LCYA 2FK9A 5D1XE 5IJKA 3C87A 1IGJA 1IFHL 4XP6L 1NKOA 1JFHA 1G1KA 3FSZA 4P4RB 2IANB 2VLRE 3EOAB 5HGHA 3UBXI 3VRJB 4Z7VF 4XMZA 4FNSA 4F7TB 5GS1B 5IFJB 3ABLB 1PSKL 4N0YH 1FH2A 3TBSA 4BFKA 3C6SB 1ASQA 2CALA 2GQHA 3Q06A 3IWVA 1C5DA 1PZ3A 4Q2ZA 5AKRA 3QEQD 2F7OA 3LN9A 3LPPA 4CJ0A 5AVRB 1UM5L 1Z0NA 5DD1L 3SDDB 4ZMVA 2C3VB 3QISA 4HIQA 5AKTA 1QFWM 3GMNB 3BFQG 4Y4FC 1XCQB 2BWIA 1ULVA 3MI6A 5GSRB 5HGGS 3PWPE 3UZQA 5E4EB 5JPMA 2A9DA 2K78A 2OMTA 5L4MA 2NY2C 5C0IB 1A6PA 3HN5A 4JHAH 1XTMA 1QBMH 5CD5D 1BM7A 2GJ6B 3UC0H 5IG7B 5E7BA 3SKNB 2EKSA 5INCA 4G6KH 1E9OA 1J9SA 2CCWA 1F4HA 3PUUA 5TE4H 5I30H 4Q58C 5D1XA 4K0OA 1PZDA 5AZUA 2ZZUT 1XB6A 2EO1A 4JFHE 3VSVA 2A9AA 1MI5A 3RVUC 4M4RB 4PR5B 4XR8C 3WY3A 1B0WA 1XD1A 1JZFA 4KKAD 2CXKA 1XHHA 4PS3A 4ATWA 1T6WA 3AXHA 2WQWA 4KXDA 4XOEA 4TM9A 1K8IB 5SWZA 1NGXB 5GS0D 4PREA 1U95B 4B9FA 1T2QL 3AMKA 4HJIA 5HYJA 2DWXA 5JPNA 3VI4F 3GO1H 1Q94B 2YRLA 4GXUM 1OGTB 1AVAA 3DTUB 3MOBL 5IROD 2IMMA 1JK8B 4F92B 1RPQA 2ITDB 1VFUA 3AREA 3EO9L 3GBLA 3LIZH 1MLCB 4OV6F 4XPBL 3EFFA 3UGUA 3KAAA 5IHLB 3LNGA 3LKPB 4XPTH 2YHGA 2K6YA 2RB8A 1GHFL 4I0KA 5EF2A 1TT6A 2PW2B 3SE4C 5AW1B 3ZMRA 1LMKA 2DLGA 4LZKA 2JQMA 4ZX6A 1TSHA 3QIBB 2YAQA 4Z7WA 3T5WA 3TA3D 4G71B 4TNGA 3ZRFC 2XWCA 4BQ8A 3VM7A 2ZONA 2MQ3A 3DMMC 3W39B 1R5WB 4I2XE 2NY3D 1U8QB 4FP8H 4NIYE 3ARDC 4F20A 1AG0A 3KYOA 3SO5A 3PL6D 4HEPG 2J6EL 1I4FA 4HA1A 3I2CH 2VXTH 4NQUA 1HXYA 2DEWX 3S3SA 4C58B 2HA1A 5KYWA 1F4WL 5DLLA 3QQNA 1CTNA 1VPOL 4R4BB 1S5IL 4G8GE 2A9BA 4JY6A 1F3JB 3TT1H 4CBPA 3FHQA 2OCCB 3ISWA 1GSKA 12E8L 1R9FA 2X2IA 3VTTA 2V2WA 1PZCA 1E2WA 5TE7H 3QEUB 1LO4H 2A4CA 4IJ3C 4RZCB 3BJ91 3ZDYF 1U4EA 1OANA 2A1WL 4HV8A 4BZ2A 1L0QA 5IEHA 4R2GD 3HC0B 4LXFA 5DO2D 3SPGA 2X4UA 5KTEL 4XXDB 1QEWB 2UWEF 3EO0A 1OGSA 1L9PA 3SJVE 4XE5B 3RY6C 3IXTA 4JFFB 2RGSA 2Q0ZX 5E70A 5HDQH 2ATPA 2YO3A 1AOZA 2CUAA 2EVFA 5FW6A 3PIQB 3ALXA 3LNHA 5LXGH 2ICWI 2KLRA 2JKNA 5T1MB 3IMRA 1IBBA 1CD9B 2DRUA 3I3BA 5F1OB 5AW9B 1KENH 1ZA3A 3LMJH 4N2LA 2HKAA 2ITEA 5HHVL 4PTTA 3EG9B 32C2A 5CS7A 2C9SA 4Q7DA 4H0IA 5J5EA 2VXVH 2VR8A 4WAFA 3RWEB 1VAHA 3EGSA 4P2YA 2IH1A 3P4MA 5E4AA 5AVQB 3TYFA 2E4FA 4N3TA 4CJ1A 4PJ8B 3VXRB 5HDRA 1SOSA 4N8VG 2MCPL 1UZ8B 4UINL 5I0VA 3D18B 2PXYA 2R9HD 2JK5B 1CFVH 3ZRSA 4YSEA 3GUFA 1VACA 4GXUN 4N9GB 1KIUA 4FI6A 2KYIA 2XYCA 5EO1B 3ULSB 3MLTA 3C2SA 1RJYA 4M6OL 5HYIA 1SDAB 4NNYB 3IM1A 4QAMB 5DJYA 2BFGA 4UNIA 5F96L 5C0AD 4X98A 1QABA 4AOFA 3ZKMD 1CE1L 4YXHH 5KYXA 1EHLL 1KBGL 3ABGA 4HWZA 3TS8A 1MF2H 1W2KT 2AJUL 4HETA 4HBCH 1DVFA 2P5EE 1QHPA 4GIAA 1Z5HA 3LKNB 3K4AA 4G6FD 3I6KA 4W9KC 2IJ0C 1N68A 3BWUF 3WKQA 3DO4A 4FG4A 4AVIA 4PHZA 4BUHA 3IN0A 3ASWA 1OSEA 2WYZA 1YEWA 1TQUA 4C4UA 2VDRL 5D2NA 1ED3B 2Y1YA 3MOBH 4F8PA 4U33A 2F1BA 1KGCD 2V33A 3PQYB 2JQZA 3EO1B 1V05A 4NIKB 4PJ7B 2OXHA 5CSZA 4HJ0C 2GAZA 1XR9B 3CHXA 2NMSA 3BO8B 1ESOA 2AAAA 3BVNA 4JHWH 3K4DA 1I3VA 3NEXA 1WVZA 4R0LB 4B50A 2HAZA 1Z9LA 3KPSB 4DP1X 4WWOA 4A55A 4JFPB 1H8OA 1NCBL 2I07B 2F8XC 3LIUA 3FU9A 2QFPA 4ZTOH 1IEAB 3SOBH 1VEMA 3OGOE 1IM9B 1NBYA 3BW9B 1XF3B 4K4KA 4L0ZA 5DQDH 4DK6A 5F1IB 2ARWA 3LEVL 2AJSH 4YUEL 2WBJC 5EBMA 3UJJH 2UWEA 4J3BA 2WXIA 4JKKA 1KV3A 1CTMA 4AT6B 1ZVNA 1A1NB 5DWPA 2XG5B 4GUQA 1V10A 2DL9A 3VJ6A 3L1EA 1YMHB 3FN0H 4PUBL 4NP4H 2ATAA 1TJMA 3EZ8A 2JMRA 3REVB 2NZ1A 4UM9A 4BK8A 1UWFA 4PY8J 1P7QB 4ZTEA 4R5VA 5DGQA 5ITBL 3QRFM 2VITA 3QEQA 3K7UA 4U31A 2XN0A 4U3SB 2K3TA 3MA9L 5JDSB 3R4DA 1UVQB 3BAIA 3ML9A 5HYQA 4ZAKD 3SHSA 5I0ZA 3HC4H 5AOJA 1LNUA 4J2QA 2HT3C 1HDMB 4L37B 1G6RH 4FFYL 4YC2B 5K5YA 2BP8A 3GDBA 5KS9B 2H47C 4HCRA 2X7LA 4BCXA 4D0CB 2LU3A 2FT7A 4LLMB 3BEWA 2XTSA 3EF7A 5FYKE 4ODHH 1SEQL 2W60A 2F68X 3CMOH 3D0VA 3NG5A 4XCYB 1BJ1J 4E68A 4U1MB 5TGBB 1OAUH 2V2XB 4MNQB 5BZZA 3R1GL 5DQJA 3A3YB 3ZN6A 4BQ6A 3HI5L 1H9VA 3NTCH 3PCYA 4WEEA 1FSKB 1NFIA 1BLIA 2ICWA 4EOWL 2NYKA 2CO7A 2R29A 2WXQA 4MMXB 3AU1A 1EMTL 4IMKC 1KCWA 2MCPH 3R06A 1XXFC 1BMZA 4MZ3A 1E5BA 2YXMA 4E42B 3S6CA 5CINL 4FNUA 2R15A 2XRAL 3OX8A 4NAMA 4HIHB 4ZMYA 5C8JA 1A7NL 4N2OA 5DD6A 2K9UA 4YSPA 4KK8C 2YAMA 2WXOA 3BUQA 4WFGE 5IQ7H 4PJBF 1XH3B 4H1LG 1TTRA 4R7VA 1DSYA 3FW6A 1JRHL 1RURH 3O8XA 4AGMA 4JNXA 3WDHA 1JGDB 4U05A 3SYAA 4LAJH 3BN3B 4X9HA 3NA4A 3QG6A 1MHCA 2NQDA 3H9ZA 4GAGH 2WAQA 3MXWL 1KFAH 4JG1L 1DQKA 4M6NL 4KTDH 3FPYA 1DQDL 4DN3L 2BY0A 4B9GA 3O6FC 1GSMA 2ROYA 3OG4B 1HJBC 1A5FH 2ICES 5TD4A 1A7BA 1CE6A 1L9NA 4JPIB 4U1JB 1J10A 3SBQA 3VRLE 4PHXA 4LL1A 1RUAL 1MW3A 4PJEF 1ZGLA 2OYKA 4CNIB 4F9LC 4MBRA 3OJVC 5DT1H 5GGRY 3WFEH 1HJCA 5MENE 4CN4A 1NLBH 4NN5B 2FATH 4BFIA 1PW3A 4K7PY 5I1KH 2O6CA 1GRWA 3X13A 1FVDB 4H8HA 4QXTB 3IYLW 3RTQB 2E7HA 4OFYD 5GGVH 4Y1SA 5ACZB 5BRZD 2FEDD 3CVHA 2OSWA 1N26A 3MLWL 1TZGL 3SOBL 5DC0A 4NOFA 4NZFA 4UUJB 1ACYH 4E9QA 5K9KA 4FFVC 2BOBB 5CU9A 3JSSA 4LLVB 3QYCA 2VXUH 3T0EC 2MFNA 5I1GH 4PWKA 2Q8AH 4LPWA 2AXGB 1ZY9A 2Z8SA 2HTKC 3KNBA 4FCHA 1DSFH 4PJCE 4H8PA 3RDTC 1CBVH 1BZOA 1KTCA 4P4KC 2LLGA 2ESVA 2XIDA 3U2JA 1ZT4B 2R4SH 3FF7A 3MLUH 4AVKA 1AXTH 3OPUA 1BJ8A 2VDRB 4RAHA 2AABH 3VX1A 3GLEA 3WHXA 2BIQA 4JZNA 1DE4B 5HHQA 3P30L 5JOEA 3BQUB 1P5UC 1MPAL 4OLVL 2DN7A 1NCCL 1OM9A 1TVHB 2MOVA 1XGYH 2JTDA 3Q1SH 2Y2WA 4NXKA 1G9EA 2DEXX 1DO6A 1EFXD 3M07A 3WIAA 4QHMB 4X0NA 3APMA 3P54A 3MNZB 5D7IF 1TXKA 4TUKL 3JV0A 3Q6GL 3G5ZB 1KBKA 3ECBA 4PB0H 1INEL 3NSYA 4TULH 4TQEH 4Z7VA 1DLHA 1MREL 3FJTA 1MUJA 2WBJB 3D85D 5SX5K 4XVTH 2J2ZB 3ZDWA 3MREA 4UT7L 3U1SH 3NAAL 4KO9A 4EOWH 5J13B 4JFEE 1WDAA 2QGDA 3B7YA 2G60L 5LGKA 3UBXA 5BS0D 3FO0L 5DA4A 3BKJL 1XR8A 2XU9A 3D2UB 1A7OL 1S7SA 3BZ5A 1OWRM 1DQJB 3LXUX 4MJ5A 4DESA 4XNXL 3O3DA 1NWPA 3D3VD 4UDTA 4F91B 3VO0A 3F64A 4OI8A 1CIUA 3CWGA 1FIGL 4JHZA 1K8DA 1G6VK 2PTUA 3JQOB 3VI3E 1JWSA 2VDKB 4LRNL 2OZ4L 2GCYB 4WO4C 3OVUB 4NQEB 4QYAA 3UG4A 1PZBA 2NX5A 1MLBB 3FO2B 5EOQL 4NERA 4LSSH 4MB4A 3CFEB 5CZRA 2DF3A 1I9JH 1Q1JH 3BUDA 4M43L 3ZLQC 2JF1A 4ENEC 3TJHD 1WUNT 3NACL 5CFHA 3MV9A 1PZ2A 2D3LA 1LK3H 4WI3A 1MLBA 4FQJH 4K07A 3UTSB 3DHUA 5TH2A 2XKNB 3OMAB 2YRBA 5F7LB 2LV4A 3BRDA 3GMRB 3UTTD 3JV4A 1E5AA 3MZTA 1GYAA 1KGJA 2NTFB 1U8NB 5IW3A 4OZ4A 3RX7A 4QT5A 1XV8A 1S5HB 4LNVA 3NSFA 2QQLH 3MGAA 4PRHB 4XPGL 3VG0H 3FRPA 5E08H 4YZFF 1NDTA 3QRGH 4H26B 4MMXC 2ICCA 4YHLL 1SGKA 1LE9A 3FS9A 4UOW1 3QQ4B 5I1HH 1SFHA 2N1KA 4M1CD 3U4AA 2Y2TA 3KDMB 4DVBB 3VD7A 2VZVA 4PJHA 5D72L 5DMIL 1X5GA 2IAMD 3MUJA 3GK8L 3EFDL 1Z32X 4OIFA 4ZPVA 4Z7VB 5DWUH 5DMJB 3WNNA 3HB3D 5AWNL 5HHXH 2L7JA 4KI5F 3SQBB 3GMPB 3G04B 1FWXA 5CEXA 4Z7WF 1ZJBA 2Q86B 1BM3L 4ZT1A 3E1F1 3WY2A 2RIKA 1ORQA 1QHQA 3WN5A 5D96B 1IX2A 2EDYA 2EDWA 5HJ3A 2F53E 2BVOB 5D7KD 3HIZA 2EH8L 2CUIA 3ZHFA 5LJYH 2YBRA 2XHNA 4N90D 4N9GA 5CWSB 5FXCH 3T8VA 3WN5B 4AGQA 5I0WA 2DV6A 4KXBA 1KDIA 2IC2A 1HEZA 2OTUA 3O6FB 2AGJL 3FFDA 4L1DA 3DYOA 3BAEL 2P8MB 3FZUC 3EYUH 5F1NB 4APQA 1XT5A 4OZHB 1QQDA 3QZWG 4PJEA 1YHPA 5I5JA 5JLZB 2N0MA 3PLYA 2XSKA 4NM8L 3BI9X 4EZLA 2ESVB 1TTUA 4TTDC 2IFGA 4KKNA 4P3DB 3UEQA 3NEOA 4NN5C 5BPPA 2QTEA 5F7UA 5C0IA 4B5EA 3NJGA 1EX0A 1N67A 2W07A 3K46A 3UZVB 1MJUL 2CWRA 5BOZG 1TETH 2ZXQA 4HJJL 2W8CA 4AL8L 3STBA 3KVQA 1E4KC 4HIIA 1TNNA 1KBWA 2FJUB 5MEQA 3LQZA 4ANXA 2FEJA 4OD3L 4X7DC 3AG4B 4U1JA 1XMEB 5F3BA 3ZL4H 4XNQA 32C2B 1JN6B 1XF4A 3ZE1E 1A3LH 1XEUA 2JKSA 3TN0C 4Y2DB 3KM2A 5F89A 2BMKA 4TS6A 3D48R 2AMGA 4YXKH 2ZXAA 1SJMA 3G9VA 3LZLA 4LPYA 2EDHA 2VL4A 3DSFL 3RDTB 3WO3B 3ESVF 5GRZA 5KEZA 2B1OA 1EAOA 1EEZA 3DIFA 4FN0A 4QRRD 4W6WB 5F93C 4WI0A 4AI7A 1SJEA 2B15A 5C0GA 3SCMA 2CLVA 3ZQ9A 3ABMB 4TYUA 5DUBA 1CE6B 4NUGL 3H8NA 5KYWB 3E2HB 3QIWB 4QJ4B 3HJEA 3T8XB 3V0AC 3OF6D 1B3IA 1D6EB 4FNLH 1J48A 5TDOA 2N0KA 2VN7A 5TDNB 4XNMA 3DOSA 4L1TA 4ZUWA 3UAJA 4RBPK 2W1NA 3LX9A 4IYKA 1UWEL 1MFNA 3WHE1 1V7ML 4MAUH 1YN7B 3Q5TA 2WKLA 3MBED 2CRZA 1AZRA 4GLRI 4PFEA 5D7JB 4YSSA 2EVHA 4IBVA 3QUXD 2A6DB 4HUWB 3LN5B 5CLTA 3P4NB 1S7UA 3ZDZE 3SGDH 4N2FA 3VM5A 5HHPB 5D2NE 2JKTM 3H3PL 3WUZA 4PRPB 4I2XB 4GBXC 4LLYB 4LP5A 1MAMH 4KNUA 5FYLH 4F37F 1CXKA 1UZ6E 2JCCB 3DX7B 3GXPA 2P7TB 5IBTL 2EDNA 1C5BL 2ENPA 3IKCA 4YL9A 2OMXB 2OW6A 3R8BB 1SLWA 3AXIA 3GMMA 1ETZA 4HCRH 4K2UL 1AZNA 2Z7YA 5CEZE 4PJAE 1CLYL 3ZUCA 2BY2A 1MRFL 2XI9A 5TTRA 5KWYC 4OCLC 4LDEB 1MFAL 5DF0A 1Y1DA 1E4WH 35C8H 1P84K 4M1GL 2WXGA 5DMIH 3BH9A 3V9EA 2HT2C 5DQJB 1N12A 2K6WA 3C5ZD 3NA9L 5FYJL 1DE4A 5DLML 2HFEA 2XXCB 1RP8A 4B53A 4H8WH 4J27A 3M7OA 3DOIA 4UTBA 1QTYT 2ITDA 1NGPH 1YDPB 1AQHA 4XNYL 3DHPA 4AL8C 5B1JA 4CMHB 2QQNH 4Y5YB 3S5LB 4Q6YA 3BDYL 3T65B 3X1EA 4GKNB 2NNAA 3NCXA 4ANVA 1HNYA 5J4MA 4FOMA 4JKPL 3MRHA 1MXDA 2ENYA 2ZPKH 1FN4A 2HG0A 3H3BC 3ZOAA 5E6IB 2GIMA 2XTJE 4LVEA 1USZA 3ZMNA 2X3AA 4EIBA 4ABVA 2M8XA 2VTFA 1J7VR 5E2WL 1DVSA 2OYPA 2DM2A 4ONFH 3ZTJG 2VITB 3QEQB 5CBAB 1VZIA 4GMSL 4CSZA 1EJOL 4FTVB 1T83C 4U7MA 3VFMB 4GKZA 1BQHB 4H0LC 3BXNB 4YO0B 2DMHA 5H37A 3CVHB 1Q9KB 2YAPA 3FN3A 3HHMA 5I1DB 1Q9OB 4J3OD 4HFUH 1JHTA 1EV2E 2Q6WB 4YFLF 2FECL 1GH7A 4N2GA 4TUOB 3DJZA 2EQDA 3STZB 4GRWE 1E9QA 3HBGA 4BFEA 2CJTA 5J6HA 4PRID 4XBGA 4DQOH 3BO8A 3V8CA 4XBEH 3B2UD 4HD5A 4HWBA 2IOIA 1GGCH 3TZVA 4IOSA 1YECH 5ESAB 1DVYA 4OCYH 4F8OA 4WW2C 5LNDA 2YSTA 1RIHH 1I7RA 4HBCL 1J0KA 4HKXA 4NO2A 5KSAD 3KVPA 3CNKA 1OAKL 3GC3A 3D87B 5HDWA 1JTOA 5L8LB 5K59F 5L9DH 3SGEH 1D7FA 3BKCL 2JV6A 3TIDA 5EBLB 3KPOA 4U1KA 4HJSA 1F11A 3HN3A 1JDDA 3MTXA 2KQMA 4ZX5A 2Z93A 3WAKA 4DJMA 1MVUB 5I19H 1IGJB 4GRWH 4GO6B 3CBRA 5D2LF 1TJIH 3JTBA 5L9DL 3BP5A 4FKHA 1F58H 3CZFB 4O2FA 4B9ZA 1MCBA 2DAVA 3N41B 1AO7E 3WJMB 2FT6A 5LDSA 1T5WA 3FQ2A 1B4JH 3SQRA 5JHLH 4JANB 1KB9K 4ZO6A 4A67A 5DHVB 2VISA 4NC2B 3NRPA 4R4FH 5D93B 4Q9QH 3ZR6A 2PCPB 1WBXB 2EYSB 3VSTA 3N6YA 2BK8A 3ARBA 2RHEA 2CE6A 2XV6B 1V3KA 3FH7A 3G7TA 4PJ8A 3N55A 5IMKA 3VXRA 2FH8A 5F9AC 3DO7B 5FYKH 2VZTA 1T89A 4TL5A 5CZKA 3G04A 3KPRD 5SX4I 4ZO7A 5IMOB 1SXBA 2Y6SC 4NO3A 5C09A 2WYIA 3MLXH 1F1DA 3ARZA 5D7JA 5HVFB 3CN0A 1ILUA 2CLRA 1PEWA 3KPRB 1QRNB 4X2UA 2ZX6A 2YFOA 1ZT1A 2VDLL 4DP5X 3L3IA 3S34H 3MRDA 3WKYA 1L9TA 4MD4A 3BPCA 3NDYE 3FCUB 3BYYA 4D8PB 3EJCA 2E86A 5IBLD 3KL0A 3GMMB 1QLFA 2AQ3A 4F15B 1FVCB 5T3XE 2FD6H 4JM2D 4CDHA 3DX7A 4RNRB 2EIZB 1P69B 2D0HA 4H2CA 3CQFA 4OFKA 4UI2A 1B2WH 3CUPB 2P80D 3QIWC 3M7FB 4MHHI 4OB5L 5BZXA 1QA9A 1TQCB 4FFYH 4EAEA 3O4OB 2R69H 3GJFB 3GSNL 3VE0B 4HW6A 4F7EB 2LLLA 3FT4B 1CQYA 1U8HB 4KQ4H 1PFOA 3QJTB 1KB9J 5A2CA 1RZGA 3ARBC 3BZ4B 3N85L 4GINA 4JO3L 4YHKH 5B8CA 1Z6JT 2KH2B 2BVYA 2X4TB 5B39B 2OLDA 2MQCA 4WFHD 3DYMA 2WZPA 3V5HB 1P1VA 1U3HD 2MSPA 1QYGH 1XVSA 2YUVA 2EVIA 1DBBL 2A6JA 5HVHB 4XCFH 3HR6A 3HA0A 4HHWA 4MLIA 1A4KA 1EANA 3LVTA 1OW0A 5FYKD 1PD6A 2AK1L 3KBFA 4NKIH 3CHQA 5IFHH 4S1QL 3FQWA 1MFCL 1WSST 2NYYD 5I66A 4S1RH 4FYTA 3G5VB 5LBVA 4EIUA 4L4JA 5A1AA 2F58L 5KSBF 4PJ8D 4XWGL 3VXRD 4HKJA 1D6VH 1U92B 1A7NH 3IMWA 4AW7A 5TFSL 2NXYD 4XHJC 3L16A 4J7RA 4AYSA 3PWPD 1M2VA 1V8HA 2OQJB 4TVUA 3TNNA 5E8OA 2EDDA 3BDBA 4M93B 4FTDA 3D4YA 4I0CC 2C5DC 3M8OH 3ECBB 3NIGF 1DZ0A 2ZCKL 4PRAA 3BMWA 5E5LA 1CLCA 2EXWD 2TRYA 1IEBB 1U8MB 5PCYA 3W39A 3AITA 5C0NC 2VMDA 4PJFA 1A66A 2I85A 4J28A 3D4GA 1CN4A 4BZYA 3FUDA 2QR0B 1AMYA 4JFXA 3PGDA 4DN3H 1ZD6A 1NUDA 2AKRA 4JY4A 3ZU8A 1IEBA 1DBJH 1F2XK 3POCA 4QTIL 3DV4A 5HHQB 5HY9B 3L5HA 3QQDB 4QDGA 4KI5C 1S3RA 2C3HA 1XGRA 2OR9H 5E5MB 4Y1TA 4X5XA 1NCBH 3BJLA 1GHFH 2B7DT 4OIAA 1N3NB 5DZLA 2QR0A 4EI6A 4NZTL 3KNBB 4G7VH 4OUUB 4J1UA 4L29A 4K3DH 3BH8B 1OCWH 1WBYB 4FFZA 1SJXA 4KUCD 4PRPE 3TV3L 3PABB 1OOAA 3QFJD 4H20H 2FJHB 4MASA 3CFCH 4JGUA 1KWGA 4NRXA 1EAJA 2D4DA 1OARL 1G9HA 1NFDE 1WTGT 1WPCA 4N6RB 3GMRA 2G2RA 2JKLA 4WW2B 3IFNH 3B5GA 1N5YL 2ZUXA 4DKFH 3TX4A 5FAAA 1JPFB 5ID0B 1NC4D 4PRHE 3DARA 2L8AA 5E5UB 1H6UA 3HPJA 4YHPB 4ZS7H 2NZ9D 3TT1L 2BSEA 2WQ8A 4YUEH 1Z1WA 3PWJB 3WG7B 2AJUH 5ILTH 1CF8L 4NSKB 3QQ9D 4KKCC 5HPOA 2HFFA 3U46A 3IFNL 4R96A 2Y1AA 3OGCB 4R7DB 3I9GH 4B9KC 1AXTL 2ZWNA 2BHYA 2QADD 4KH2A 1VKXB 2WLHA 4F9PA 1Q90A 1WK0A 3KD4A 5T5FA 3QR0A 2P5PA 4WJ5A 5AVZB 5D1QA 5IT2L 5MEOB 5GGTH 7CGTA 3OB0H 3VI3B 1CGXA 1NCDL 2NY1B 5J1SC 3B37A 1NSNL 4JRYE 3FH5A 5GZOA 4JR9H 4J4PC 1OEZW 2J55A 3B7RL 3FUHA 5J3HC 4NOBA 4K23H 3GXIA 4HULB 1BZ8A 2WNKA 3C6SA 1L9OA 3MBEB 2XTJD 2VJ0A 4GG6B 2VDPH 2IBZX 5DQ9A 2FO4A 1HC1A 3DO3A 4PJEE 4U1SB 1RPUA 2E74C 3BGAA 4RMSA 2YGVA 1VGEL 1E4XL 3QQ3B 4HLZG 4JM2F 5C71A 5C0RH 4AVJA 3CCHA 3TH2T 4R26H 1H3TA 4YDZA 3VW3L 1BYOA 2VLRD 1DLHB 4M6MH 5FKPB 5C3LD 3GRWL 2BNQE 1IGFH 3HE6A 4PSPA 4O5LL 1J8KA 4DVRL 4WFFE 3FMGH 4QXUL 3OLGA 2OMWB 3R06B 1YY9D 3CLEH 4UWQB 4HUVB 3QFJB 3X11B 4P9HC 1ONQA 1IKNC 5IESL 4NQSB 4Y2OB 4O02L 3HE7B 1HHKA 2NNXA 1A6UH 1Z2KA 4LVNB 3U6RA 3AM8C 1S7UB 2C9QA 5F96H 1I7ZA 2AK4E 5IMOA 3ZE0E 1V55B 3NABL 1IE5A 1CD8A 1FBIL 2IXQB 2Z0BA 4WW1A 3SKMB 1GYVA 3UFIA 5EOQH 2AW2A 4GUPB 4LLQB 1BQLH 1EGJA 4MMZA 3QPXL 3O4OC 4BQBA 1OLZA 4YHYC 2A99A 4UQ2A 4FQIL 2WMPB 2N7SA 3SPJA 3ROOB 3T0XA 1HWGB 3R0MA 3RJQB 3ARBB 4Y7OC 3TA3A 2XA8H 5FDWB 4KZEH 3TGXA 4PJDB 2XN1A 3GMOB 1WBXA 3F05A 3LMJL 4DKEL 3ULUL 3C8KA 1XBRA 3OKKA 5E94B 1QMUA 2FGWH 2Q87A 4DPAX 3BD5A 2LFGA 4BH7A 4LRIC 4GW5B 5I1KL 2IBBA 4AG4L 4HAGA 2CLVB 2OCJA 3IJ7A 3JWNH 4XC3L 1RV6X 5AQ0A 4M5YL 4XVUC 4NZDA 5EN2B 2PWGA 5C0GB 5GRVL 5K1JA 4XTRC 3EYVB 3VFGL 3MJ9A 2ZUUA 1CGUA 3BHBB 4PV9A 5C08E 4D9LL 3QCUL 2WXFA 2AFNA 3FSWA 5MENA 1ZLEA 3HZYB 4HJEA 2JKJA 4CVWA 5HHNA 1OKEA 3W3BA 5C97A 1GGYA 3PHOA 3X13B 3M17B 1NMBH 2DS4A 4NO0D 1QKZH 2EO7A 3IDNA 3LY6A 2XJLA 5GSRA 3BIBX 3CN2A 1QRNE 5LAPA 4P59L 3IT8D 4XBPA 3D8MA 3DX2A 2LE9A 4M48L 3VGAC 3C5ZC 1QKZL 1BFTA 3D4CA 3EBGA 5T3ZD 3WUWG 4P49A 4NYLB 5CD5C 1N64L 3KVDD 5D2LE 5I75B 3MLSH 3M17A 4XPHL 2J1ZA 4FCAA 4Z3IA 4KUCF 5BRZE 5I1DA 1C7SA 4FFYA 4Z8FH 4H1LB 1EUTA 7FABL 2YIHA 2EKJA 4IGBD 4RSVA 2XIIA 3R7QA 2IANA 4ELMB 3CVBA 2VDOL 5FGRA 1TLKA 3BLBA 3IRPX 4O4YL 1IIIA 1CD0A 4CADB 2VL5B 4JRYA 2HVKA 1CFNB 2Z1KA 4Z8FL 4QIRA 1WF5A 4X4ZA 3H3KA 4EI5B 3BC9A 4XNAA 4EN3D 1WWAX 2VUKA 3G5WA 4GKOA 1LWJA 1QBLL 3JYCA 3LN4B 1AQDA 4V1DD 2HXAA 1JVOA 3QORD 3C60B 4MSWA 4RCAA 2V7HA 4AKQA 3U7YH 3VXTB 3NIDB 5J9PA 2ERJC 4ODHL 2MPAL 1XGTB 3NSDA 4Y4HD 4FADA 4BHUA 3L45A 1MG3C 1K5WA 5FHBL 4HU8A 5IP4A 2HJLA 4L9LA 4NCDA 5AW7B 5ABAA 3DGDA 3MRGB 3HVDA 4BA0A 2NNCA 3GS4A 4ZFGL 4GUCA 2NY3B 2R0ZL 3CFKB 4ETQA 4NS0A 4PVMA 1T1WA 3ULUF 3BAXA 4XXCA 5KVMC 1CG9A 3QUKB 1XL4A 5SX5H 5JNYB 3BPOC 4OF0A 2WYHA 4X5WA 3SDCC 2OL3H 3SDAB 4Z7OE 1VACB 2VXUL 2ZOTA 4XNMB 4ELDA 2E9IA 5EO9B 1T2JA 4FHBD 4G80A 1MCPL 2NXYB 3KLHC 3MJ9L 3WS6C 4HKBA 3Q5YA 4MYWB 3EJYC 1QG3A 3L7EA 1EUUA 1H3VA 5D7LB 3TBTA 3VXUD 5TF1L 1BOGA 1CT8B 4X6BA 3SD2A 4YSUA 1T1WB 4LSTH 3W57A 5GZOD 5HHPA 4YIQA 1KTLB 4MXQD 4L9LC 1KNOB 3KLAA 1CGWA 1HSAA 1JV5A 3RVWC 5J56B 1G6RL 1D7BA 3V6OE 1A6AB 4B5ZA 1YO4A 1YEHH 1R3HB 3AJ7A 3E6HB 3NK4A 5I8KH 2O5YH 2R69A 1L9RA 1OSPL 1N0LA 4FQQA 3ERXA 5DEZA 1MW0A 3H7LA 4JM2A 3ZYJA 3BKYH 1JPST 3NJIA 1JF1A 4PRBA 2FHFA 3EOBB 2CO2A 1UZ6F 2X40A 2OTPA 4K7PH 2X9XA 4U3CA 2M26A 3O41A 3RNQA 1NBZB 3EYOA 1KJMA 3Q6GH 5EZLA 2YBGA 2OX5A 2WZ5A 3RNKB 3WU1A 4PYHA 2IWEA 4OJEH 4G6MH 1BWMA 4Q8BA 1CFNA 2Z8WC 3EJSA 1P4LB 2EINB 2B1HH 4R6UA 3PAVA 1ZKAA 4HFWB 4RISH 1MQKL 2WWMD 1Z3RA 4OFYA 1P7QA 4WU5B 3FQTB 2MQGA 4P4KA 3L3DB 4G43B 3BQUD 4AKPA 2AK4B 2VR7A 3JTTA 3KDPB 4LOUD 4QHNB 4XNXH 2CU9A 4LVNC 3T0EA 5HHOA 4RGNE 4HKZA 4YSAA 5AYQA 1FZMA 4X8JB 5GRYA 5GRJH 3FQYA 4JQVA 3AW5A 5CJ5A 2YARA 5IMKB 3DO7A 4WF7A 5PAZA 1G1CA 3MSPA 3D50A 3QUMA 4FJYA 2NUTA 4BXVA 1EO8H 4M7KL 3ZO9A 2WM0A 3OB8A 1ND0B 3QO0B 5E0QA 4NKOA 4DN4L 3VD4A 2V8LA 4OFPA 2FWUA 2XN2A 4V33A 4TQPA 1D5ZA 5DUPL 1WQVT 2ITFA 5E0FA 1UQSB 3R19A 5GRXG 2Y6TE 4PJGB 1LO0L 1YN6B 3QIUA 2Y0SA 2PWHA 3Q43A 2I7OA 2Q3XA 1EWHA 4UQDA 4ZW6A 1RZ7H 2F7PA 4YHOL 3VH8A 2IQ9H 3VMPA 1R3IH 6PAZA 4KROD 3L81A 4EUPH 2P8MA 4L18A 3VFVA 2XT1B 3INUL 1L7TL 2EO9A 1FNFA 4PJEB 3DBXA 4LRIA 4FQ1L 1HQRA 5F7FA 4XCEB 1UTDA 1AD0B 4ENZA 4U1KB 2EIMB 1HZHH 1BZQK 2M2DA 2F74B 2NSQA 1EK3A 4Z3HA 2GJ6D 4MDJB 1J86A 1UJTA 1UOVA 2VDKH 3CVIL 4N2NA 4M1DL 1K85A 4RAVB 3A24A 1Q72H 3CSYB 5J12C 3P3RA 5E1AB 1S5HA 3P4MB 3RIAF 3STLA 4OD1H 4F2MA 1ZK5A 1J8SA 3C5ZB 1HESA 5HHOE 1BZ9A 1BECA 4L8CA 1TFHA 2OZ4A 5DFWH 1ZT7A 3V4PH 4DWHA 4DVBA 1TZAA 3TEWA 1YEIH 4QRUB 2O6EA 1XCXA 4HFWA 3TVMA 4H7VA 2WC7A 2XWDA 4HH9A 2IADB 2PYED 3QXTA 3ULSA 3FCSB 1KZYA 4KUZH 3DPDA 3QI9C 4NNXB 3CFDA 3ZQWA 5I66B 2ZWYA 4I3RL 2AABL 4QT5B 3O2WH 5GJTH 4G5ZL 4X6CA 2J25A 3GIZL 1D5MB 4JKLA 5CLWA 1KCVH 2ZXEB 4YGVB 1KGIA 4L4VB 4JAMA 4Q9RL 4B7IA 2CKBA 3Q0HA 4NO5B 4DW2L 5EORH 4JE4B 2VXQL 3IDYB 1P2CA 2XXGA 4HOXA 5I6LA 5E1QA 3SJVB 2O61B 1QPPA 3C6LA 4KC3B 3RUGA 1MHCB 3HUJE 5KZCD 1KYAA 1QO3B 2ICEA 4XNBA 3C60C 5L2KD 1QASA 4X5PA 3LXAA 1A6AA 1UJ3C 3TBCA 4N26A 2VZOA 4MCMA 5DJXA 2J8UF 2ERJB 4GI8A 3NCYS 5CCGE 1TQBB 3I50H 5FW7A 4MA8H 3WO4C 4ICWA 3SDDD 4IKKA 3ECQA 3MRCB 1WJ3A 1MJ8L 1SMDA 3VD3A 4OZIF 2FDBP 1R5VB 4NQEA 2IDTA 5T5NF 5C09D 3QZBA 5JA8B 2P5WA 5GGTA 4YAQB 5DJ2B 3MYJB 5T3XD 1Z9SB 3I6GB 1NMCC 5HJBA 5FYJH 3WUWB 1QBBA 2VDNL 2ADYA 3WFBH 3DMMB 2W9LA 4OTXH 5C9JB 5E8NA 2L7UA 3CZJA 4X7TA 5E9NA 1U58B 1NANH 1BREA 5CLZA 3LS4H 2EDXA 1E8YA 2YN3A 5DVKA 5I16A 4HPYL 3EFDH 4F5CA 1NEPA 4FA8A 1BFOA 1SYSA 1YYMH 4KO6A 4WZ9A 3UYRL 1NIFA 4H88H 2BSSA 2BP0A 4F2MB 4EUPB 3MR9B 2IQAB 2RFXB 5KAQG 4N2MA 2EICA 4HBQA 1YYML 3C60A 2WNGA 2FLBT 5F7EH 4FXTA 2WUCH 4KI5E 1MCFA 3VXTA 3C6LC 4EDXB 4WI4A 5CP7B 2QGCA 1YEEL 1CB4A 4IIQB 1N9PA 3MKGA 3AXLB 4XWOC 4FFZL 2VDLB 4G42B 3N9GH 5G4OA 4HP5A 5IBLC 1KIQB 4BUGA 5IMLB 2XN9E 2VE6B 4RBPH 4U2YA 1A1OB 4KHXL 3FONA 4EN2A 2EKSB 1S78D 3GQFA 4LF3A 1DANU 5ID1A 1KDJA 3RJOA 2HSIA 5JHAA 2ENSA 2W0FB 3IETB 4Z7UF 1XCQA 3KPMA 1PQZA 3CVIH 1CLYH 3IE9A 4OSUL 3PAYA 3AC0A 3IDGA 5IB5B 1HK6A 2VUYA 5CR8A 2H0JA 3CZEA 2R2HB 3KJ6H 3GSVA 5DDHA 5T1JA 3NJHA 2CUMA 6FABH 4MXWL 5E51A 1W9XA 5ECGA 3GBNL 5AFAA 1Z9PA 2VDPB 1FL6B 1LLAA 4URKA 4KMLB 3ZSTA 5E99L 5E9DE 1WS8A 5EU3B 2PYEA 3P2TA 4C54A 3EO9H 3LIZL 1J8HD 4K5MA 3IDNB 4Q6IC 1EZUA 2IWKA 1KELH 3B2XA 2WHVA 2YPVA 1DBJL 3OKNB 3DX8B 5E00B 5LBSH 3UBFA 3KPTA 2DKSA 5HHMD 5LQBH 2OXHB 4IDJL 3JXAA 4WUUE 2AHIA 4M5ZL 4NC1C 4J8RA 3BKCH 4NYLA 2BWDA 4UZGA 5I18L 3T6QC 2I7SA 4UAOB 5LBSL 3NJNA 2YD8A 3D9AL 2ZKXA 1I1AC 3FTGA 2A6JB 1NTDA 1FL3B 1B3JA 1EXGA 2QL1A 2LU5A 4WWKC 1G87A 2L7QA 2J88L 4GSUA 4PBDA 5D6DA 1AC0A 1AFVH 3FPXA 2VZSA 4F57H 1HHHB 5I1IL 1QWUA 4H13C 2PNDA 1FCCA 3IGLA 4DFHA 2H3NB 2VIRB 5EA0L 4OFQA 1ADWA 3DV6A 3NFNA 1BX2A 1FQ9C 4HHGA 4OF6A 4HJ1A 1QATA 3DJRA 4RGOH 4NJAL 2CA4A 3FTWA 3A22A 2Y24A 4PIBA 1W72B 2WQUA 3BPNB 4HUVA 3VFWB 2X41A 5DR5L 2BFVL 3L7EB 3PHAA 3TBTB 4NN6B 2LU4A 4LHUA 5FS5A 3K6NA 1JYNA 1BD2D 4K7FA 3JWOC 1P0SE 3QI9B 4HOMA 3DTXA 1F8TH 4JFDA 2B9BA 4HT1H 4BFBD 1E4XI 3ATAA 2PR4H 2XWTB 1F56A 3ZHDA 1M2OA 3BD3A 4PJCF 4XRCA 4HUWA 4A68A 4POYA 1UM4L 1KC5H 2Y3NA 5FFLA 2UYLB 3ZR5A 4N20A 4NP9A 4YEFA 4LQFL 1FRGL 5EDXA 2Y7NA 2UVEA 3ARVA 4Y2OA 4LPUA 4G8IA 1J1OL 2NY5C 3D0VB 2QDWA 2FWOB 3TU6A 3V4UH 1JYWA 4YPGA 3ISRA 1A65A 5DQDL 2J57A 2KZWA 4MAUL 4XNUH 2ZWZA 3MTRA 3ZUNC 4UDUA 3F7LA 4UTCA 5DFTA 3GPSA 3QEHB 4HIJB 1THCA 2H6OA 4XXDA 1RJLB 2V9TA 2XY1A 5GHWH 3NQKA 3SN6N 1H8SA 3L5IA 4XB7A 1M7UA 4EI5D 5JHDB 3FTZA 2JNZA 3I02A 4W6YB 1A25A 2Y5TB 5E6ZA 3POHA 4RETB 2WZ0A 3KS0H 3KXFD 4OZFB 5IW6B 3GJEA 1B90A 5AB2A 1NGQL 2NY6B 3MBXH 1RSYA 3OAUH 3NCYP 5FOBB 5IMMB 4ODWB 5BZDB 3TCLA 2WV3A 3B9VA 3VJ6B 3PU7A 4XPFH 3UOAB 2ZWLT 4TSBL 2HH0H 3TA4D 3PL6A 2NY4B 3VAEA 1HZKA 1TO4A 2EDMA 1TEFA 1O7DE 4K3JH 3IGUA 5A2LH 3VB9A 1LEIA 1PIGA 2G30A 3BUYA 3ESPA 3NZSA 1JPFA 3O0RH 3SCMD 2XKUA 3BWSA 2IWGA 1QHOA 3FUIA 5D5ME 3QPXH 2F2HA 4X6EA 3VFPB 1U91A 5IB1B 3AU0A 5A7BA 1CGSH 2NNFA 2F54E 2F5AL 3EJUA 1JGUH 4N8UA 4N0YL 4UF7C 1RUML 5KSAA 3B8SA 4ZMAT 1WWCA 2CJUH 1QW9A 3M6DA 3KHOA 2XTJC 3S4SG 4QHKJ 4X5QA 1MVFA 2BIMA 3HNVH 3HBPA 1RFDL 2JI2A 4L3EA 5H37G 3RA7L 3T1FB 2CJUL 1F5WA 4DK3A 3IPEA 4BWUA 2PPAA 3ME0A 3JUZA 5EN2A 4TLTA 4X5XB 2OK0H 1JPSL 4J6RL 4WHCA 4IEFB 2E9JA 2BNRB 1SUHA 1IBHA 4HXBH 2OTUB 3O6FA 1OCZB 3WI9A 4YSTA 4PJGA 3DRTA 5E4EC 5BMFH 1FFOA 1QW8A 2R29H 4OCNC 3QUYD 3NIDE 3IVKB 2K6ZA 4L29B 15C8H 1HINL 3EADA 2WTPA 4OJCA 1NEUA 5T3ZL 2UZPA 4FI7A 2KDYA 4LSPH 1E42A 2BOBA 4NUQA 5KG9B 4QCIA 2MPVA 3K8LA 3EGSB 5HDOA 2QFRA 3P2BA 1I1FB 2DQDH 4EZKA 2BSSB 1AXIB 4OIIL 4PJAB 1H3GA 4XODA 1M1SA 4JRFA 2A38A 1B9KA 5TPWL 2V9RA 3MXWH 1JSYA 1YMMB 2WSDA 1A02N 1ZPLA 1OAKH 1IAKA 3FB7B 3VFNA 4ZPVB 1SHSA 1CVSC 1KXHA 1RZIB 1PG7W 3PP3H 2FQDA 3EJJX 3NH7H 2RR3A 2A4EA 2OPCA 2ZWKA 5KBDA 3RVXD 3ARXA 5DJYB 3RPBA 4EF3A 1KG0B 3GSXB 3NDZE 5I5MA 1MAJA 1FFPB 3IXTB 4GG8A 4JFFA 3VMNA 3ZIYA 5DI8A 1E5CA 4U1IA 3FZUD 5GGRA 1HKFA 2V4LA 1BEYL 4UV7H 4HT1L 4GBXA 2Z0UA 3QJUB 5K1VA 2IH8A 2TSAA 5DRXA 2YPKB 4U1NB 4OZ4B 1QI3A 4B9JA 3THML 3T0EB 2N7BA 2ZG3A 3I75B 4LB8A 3EG9A 1ADQA 2G75A 4FLSA 2UXFA 1AQMA 4ZSOB 3AROA 4YX2H 1XIWB 4GB9A 2XZQH 4GPVA 2YD0A 3QEQE 4U1SA 3H9HA 5LGHH 1W0WB 3VQMA 1M9SA 1U3YA 2XV0A 3MRNB 1CFBA 2DYPD 4YDJA 1OV8A 3ARDB 5FYKL 5T1DL 5TDOB 4E9SA 2WWNA 5F6IC 2HVJB 4JRXB 1BXAA 1EO7A 4RNRA 3CDZA 2TAAA 4RESB 4XX1G 4IKLA 4WHYH 3FTYA 2VDQL 2A74C 3DX6B 4PW9A 3BGFC 1BJMA 2VO8A 3U7WL 4ZX3A 3V7AG 4JN1H 1IKNA 5IV2A 4X6DE 1S6NA 5C07D 2B59A 4XX5A 3V6ZA 1N0LB 1QRNA 2XBDA 4ODXB 5B3SB 3HG3A 1UWGL 2P48B 1U6AL 4P4KD 4KTGA 3D4ZA 1JJUA 4NFBA 2ESVD 2ZP8A 3O2VH 3OJDA 3FFCD 1FIEA 2YD3A 4HG4K 3LKPA 4LDLB 3OC8A 4MX7A 3ARGD 4JO1L 4YIQB 3OKMA 1KIPA 3GSWB 2PUQT 1QZNA 3HE7D 3BFWA 3BE1H 4ODTL 3LPOA 3H4FA 5J13C 3EH3B 5F0MB 1GAFL 2GUYA 3TJHC 4PSRA 5D7LE 5ESQA 1IQWH 2HLFC 2Q7AA 5LGJA 4YL4A 2BO0A 3AG1B 5KW9L 4Z7WB 4G6AD 2E46A 1HYSC 4X5WB 1NUNB 3SDAA 4OGAD 2Z91A 3REWB 2V9UA 4N2DA 4UCFA 2MOQA 5JDSA 4OJFH 2AQPA 5AVVB 1AGCA 4FMVA 2G60H 2C3XA 4PJAF 2FE0A 2WBKA 4U6YA 4APQC 5E5MA 3UMTA 5C70A 5IFAH 3P4OA 3SKNA 5IG7A 4L3CA 1B0IA 3V0WH 1M7XA 5F9WC 4L0YA 1NDMA 4OBSA 4QR7A 4OGXH 4LSQH 1B6UA 1YN6A 3MOQA 4APXA 2ZX9A 4GQRA 2XZZA 3DRTB 3TN0A 2FO1A 3R8QA 1FA4A 1QSEE 1KTDB 1GYWA 4D9RE 1VLXA 1Y0LB 5EEWA 3EXLA 3FO1A 2QVKA 4LSPL 4LCWD 5BOJA 3BFOA 2BDNL 4L2YA 2YGPA 5K9OA 3EDFA 5DS8A 3DIVA 4FYRA 1VGKB 1M6OB 1FGVL 1K2DA 3W56A 2YK1H 2XUWA 1TQVA 4P9MH 1AE6L 3O11A 3EJZC 3UEZA 3IMBA 4XN4A 1PKQB 1RAMA 1YVLA 1XH2A 3O6LL 5JPMB 3KH3A 4N0RA 1TFPA 4AYGA 1RZ7L 3BVNB 1FORL 4HWEL 1KLUA 1RJZB 4YHMH 4LDCA 2FR4B 3KWUA 1MHEA 1YYLL 1RUKH 3GZQA 3IMTA 1BGXL 5I8CB 3K0YA 1UFUA 2XACC 1DQDH 4JCWA 3O8XD 3PFQA 4KQ3H 3B9KC 1UEMA 5BV7C 5JHDD 4G2AA 1H15A 3DWTA 3L3HB 5DHVH 1EEUA 1RJZA 4X7EC 1IKFL 3DROA 4JHUA 5BZWB 1NSNH 3DXAA 3QIUC 3CQPA 4ZMQA 4M5YH 4PP1D 3EOBA 1HCVA 4K9EH 3I6KB 3B7TA 4Z77A 2VW7A 4DP8X 3IKKA 5KSBB 1ERNA 1YJDC 3MV7D 2J12B 4J3OH 1WZMA 5AW6B 3WN5C 3EGDA 1Q9KA 1IARB 4W70A 4WNJA 3T0DA 4NKQB 2EIEA 5GGVL 1LO2H 1HWWA 4UT9A 3QNZA 3EYVA 2AQRA 2UVFA 3IFPA 3RG1C 5HGAB 3TIEB 3BKJH 4MKTA 3V79C 3CDCA 2HT3D 3KXFE 3NZHL 2P42B 5M94B 4HIHA 2VC2H 1MCOH 4G42A 3MV8E 5GIRA 3O0LA 4QRTB 5BNXD 3RFZC 2AZUA 1NGYB 3F7KA 4KOBA 3UTPD 1OSZA 4U0RC 2Z1PA 2H5UA 5SV4A 5DD0L 5KVDE 2XWBA 3DPBA 3EYUL 1URLA 1KCSH 2YEZA 1UB5B 5IESH 4N2IA 4X6DF 2DMBA 3G3LA 1U21A 1EDQA 1U6AH 2X44D 3D2UD 4EUPA 4L0PB 4PJXA 4YNYB 1ZPUA 3WEBA 3MREB 1U0QA 5CZVL 3CPLA 3UJTL 1SXNA 4OLWH 1EZVY 3GSNA 3BUTA 1QFUH 2NOYA 1ZS8B 1CCZA 3UZEA 3VXRE 2DOCA 4FC3E 3H9SE 4L3EE 2ROXA 2J72A 1XZ0B 5JORB 4QRPE 2ALWA 4BZ2L 1A9EA 1DQML 4BKLA 3DMMA 2XWJA 2Y69B 3QH3B 4Y1AA 2P43B 3VFSA 3QDJE 1TVDA 2P7TA 3FT2B 1QFOA 2PABA 3CZKA 4DO5A 4DGUA 1EIBA 2GFBA 2P5EA 4AUJA 5KVDH 3N5AA 2Y22A 4I2XA 4LLYA 1TEYA 4BZ2H 4WTZA 1MQKH 2HP4A 1AHWC 4IW4C 1NLDL 1HFUA 4NRYB 4QRSA 5DVMA 2A74B 1YCSA 3BGFB 5KYYA 1M3IA 3JTSA 1NMAH 2B39A 1X5IA 3BAJA 4YZFE 4WK2B 2R0ZH 3GIVB 4N22A 4D9LH 1BQHG 2QJDA 4YR6A 5CJXA 5HYJE 4LARH 4R90H 4JG0H 4K3EL 3KHQA 3A6OA 3O2DL 4O02H 3LZFL 2MJWA 1DBAH 4K71B 3TXAA 3SJVA 1H3PH 2IPKA 2ZCHL 3QDJB 5F3HA 1OP4A 5AZ2H 4WHTB 3WL9B 1JP5A 4R3SA 3G5YA 2VOTA 3AG2B 3BN9C 3MNVB 4XN8A 3TM6A 1SDYA 3T8XA 3VXNB 3US9A 3WIFA 3CFMA 3EFOB 5DCCA 1A14L 4GBXB 3LOWA 3W37A 2FNWA 1FH5H 2BS71 4U1IB 2HKFL 1SVZA 3TO4A 1JCVA 3WTVA 3U0WL 3WE6A 4OV5A 3ZT7A 3BP6B 4M4PA 3VYNA 1JCKA 5I1CH 3KYKH 1J1PL 3GSOA 2J1WA 3MAWA 1V54B 3QCVL 2X4SA 1CE1H 2G2PA 2O4EA 2HPOA 3EOTH 1RZFH 5EWIH 3P3TA 5DD3L 4LHUG 1JZ8A 3NJVA 5EDSA 1C8PA 4YO0A 1UKSA 2CQVA 4TRPH 2VE6A 2BSTB 4LSDA 4NHUA 4PWEA 4F3FA 1WLHA 3GEFA 4KZCA 2C9AA 3A6CL 2Z7ZA 1N6QH 1IT9L 4P9HH 2FATL 4Z3JA 3SSGA 2J73A 4NM4H 2XZCH 2ARJB 3BWUC 4LIQE 5ENWA 4Z7NE 3K6DA 5E6IC 4UQBA 3GM8A 1GR7A 5L0QB 3U7YL 1UADC 2B4CL 4KJYB 4WO0A 3A6BH 43C9A 5JW4M 1QFPA 2DQUH 4NM4L 2LAGB 5D70L 3TN0D 1UXMA 1XCWA 1BAFL 4PLOB 5F44A 1FFTB 1YDPA 4QF1B 4OM0H 1A3RH 1OGAA 4AQ8C 4N1CA 1DJHA 1QUPA 2EDFA 3HG1D 2HFEB 5EZOH 1R24A 5IVZB 1IGYA 4RDQG 3ZTNL 4XPHH 2OJEB 5I26A 2HJFB 3ZGHA 4IRZA 5AOIA 5EMYA 5FECA 3QFJA 5JPMC 2Q10A 3T04D 3CMGA 3KR3L 3QQ4A 2WIIB 3LEVH 3KM1A 4TNWF 4JGNA 4UT6L 6CGTA 4L1HA 4ORGB 5EPMA 1RVFL 3V55A 3N43F 5L8KB 4PRAB 1D5BB 2BS8A 2GPZA 4QRRB 4OLZH 3UTSA 1P5UB 2C3WA 3FULA 4BH8A 5KJ7E 4LOVA 3D06A 5EO0A 4D9QE 4A7TA 3HW7A 1M1XB 4KNQA 2IDUA 1JD7A 5LCVH 4AIXA 1KWKA 4XO3A 4XMVA 3F7RA 4LVOB 4TTGA 1ITCA 3LTVA 4YBQD 2FHCA 3HLAA 5MI0B 1LGVA 5A6LA 5E2TH 1F6FB 1G9NH 1MJUH 3V9FA 3SE8H 2EEBA 1D6EA 4MA1B 1VFOA 4HCRL 3OWEA 4QGYA 4MA3A 5AB9A 1QUNA 3PAUA 1AHWA 1YEDB 2ZKYA 1KACB 5DJ0A 5DTFB 4HEPA 1AJ7L 2J6EA 5BQDA 1DFBL 2GK0A 5IQOA 1DVZA 1TMQA 2R9HC 1BZDA 3KEHA 4RGND 2H6UA 5C0BE 4FQLL 2DQTH 1JBJA 3HUJB 3DX4A 3GJFH 3HG0A 4XPBH 3S97C 5C0JA 1S7WB 1K4CA 4I9WE 2PR4L 2FLMA 1DBAL 5LHDA 3FTSA 4FQLH 4ISVA 2CO1A 3ATEA 4JJHA 2IH9A 3SDCD 3I02B 1CU4L 4PCYA 3VGFA 1RZKL 4Z6AT 4XN9A 2I9LA 3GDCA 1ZANH 4MNQD 1IC4H 2PP8A 2DPKA 3MGOB 1RUPH 3T2OA 1I9JL 1Q1JL 4KQ4L 1P6AB 1E6OL 4HIPA 4HHAA 3NCWA 4M7KH 3CSYA 5I1LA 1BBJA 2DIJA 3QIUD 2XXFA 3K91A 4PW3A 4DP4X 3MBWA 4Q9CA 1TKWB 1E4JA 4Z7UA 3QORA 1YUHA 5L6YH 3S9DB 3MJ8A 2EE3A 3QJVB 1DL7H 2ZSWA 4HQQL 4F2EA 4QRQB 1ZT7B 2B4CC 2ZNWA 3BT2H 3FB6B 1W0VB 3AAZA 3ILEA 3CPLB 5C0EB 4PWHA 3QPKA 4M61A 5ABDE 1MDAA 4NENA 2Z65C 3QDMB 4ZMWA 4ECNA 2WTRA 1VIWA 4ZO8A 2J1XA 4PMEA 4DUXA 3MV8B 5HDBE 2JXMA 3TOPA 4WEBL 2K8MA 3QO1A 3PWLA 1G4RA 2X87A 2GG1A 2W65A 3PV6A 1FDLH 4C56D 2VCOA 1B0RB 3VD1A 3QG7H 4PYGA 1A5FL 4M8RA 1S9VB 5LUMA 1JGVL 3WMQA 3PREA 1Q72L 4PWFA 3ZVVA 4EZMA 2WIMA 2HX9A 4CVXB 2VO5A 2BW4A 2P46B 3E7JA 4M4RA 3TF7C 5F7WC 2NRDA 3KH4A 3NYKA 3CVHL 1KT2B 1KIRB 1MN4A 1SZNA 2IG2L 3RWHB 3HAEA 4DP0X 2AXWA 3GS7A 3KLQA 2NCEA 3WAJA 2D0GA 5FGCE 4Z9KB 1ZLWK 5K9QI 1IM3D 3OZ9L 4NWTH 3GZPA 2RD0A 2OMYB 3QDGE 5FHAH 2JK5A 3BKML 4KX8A 2OSLA 5KYUA 1J5OL 2JIXB 5E9DB 2WQXA 1HNFA 3T9WA 2K7QA 2OI9B 5T5FH 1CDBA 1T2XA 3LHPL 5G4NA 4BYHA 3AS1A 5ICZB 1BBDH 2Q8AL 4B7LA 3GKWL 5IB2B 5ANMA 4NZTH 3ULVE 3GSQA 3QRLA 3FOLA 4DW2H 1JF1B 5C1MB 2COVD 4Y5VA 1FLRH 2GUOB 3LHPH 1S9KC 2J8OA 5JDJA 3LKSB 4PG2A 3RDTD 2ZX5A 3P2DA 3UX9B 3V7AE 2QPFA 3BISA 4PRDB 4N68A 3CH1A 3UC0L 5JQ6L 4FTVA 4WFFD 1OP9A 4Z5RA 4OQTA 4ZXBB 3EYFB 1J0JA 1H3UA 5F97E 1DLFH 5AL8A 1L6PA 2EE2A 1NICA 1WBZA 3HTLX 4CILA 4XO9A 4LL9A 4S2SB 4Y2DC 3E6FA 5CEZD 2W0FA 4JDTL 1AJ7H 3AXLA 6FABL 1JK9B 1ZEAL 3W0WA 5T33L 3ARFA 3LV3B 5FO9A 5FM5O 4KNTA 5FDYA 1E9PB 1RZJL 1L4IA 5EBWB 1U9KA 2AQTA 2FVNA 4X9BA 3GTVA 4RGNC 1BMWA 3RZCD 1B0GA 4MNQA 3IFLH 4HXAH 1JVKA 4KNSA 4CU7A 3ZL1A 5D9SB 5E23A 4A04A 5EORL 2JELH 3GXTA 1B0GB 4AZUA 3GINA 1CK0L 1NGWA 3VXQA 3VCLB 3F85A 4LLMA 1ZJAA 4TMPA 5EBWA 2X4NB 2Y5EA 4EQ2A 4F33B 1IO4C 2X1PA 3QSKB 1FL5A 2EAEA 3PP3K 3KYMA 3PFUA 4MFHA 4XXWA 3WUWA 1MFBL 1SUJA 4G7SB 1PNCA 1WH0A 4IBQA 1WFUA 1HI6B 1PBYA 4MA8L 3MGOA 1AQDB 3V4VB 5DZPA 3WFCL 4B0MB 1A8JH 2WWOA 1T5WB 4IJTA 1JNNL 3FFOA 1MI5E 3SKUD 4HC1A 2Q7YA 3GZOA 3T3MF 4Y19E 5I73B 5IHUL 2HLEB 4PUBH 5FF6B 2APTA 3WHXB 1U8PA 1BX2B 1Q38A 3CZNA 3MJ7A 3QT2A 1CLVA 5KS9F 1BIIB 3LRLA 3MRJB 4JKWA 3KXFB 2P4AB 3BP4A 4YSRA 5G5DB 4MYPA 1JN6A 1XF4B 2DTML 1TITA 3O2VL 1MKFA 3VU1A 3LXBA 1SHMA 4PJ9D 4MJ4A 4JQIL 4OT1H 5F7BA 4P07A 3FTGB 4XB8A 3FU5A 5TE7L 1H19A 3V5DB 2JFCA 4GIPD 1PTZA 3QUML 4KRPD 4FHKA 2BOCA 4CSSA 4JM4H 1MI5B 3L3GA 5JYLA 4L4TE 4UZUA 2DWYA 2BVEA 2VDPL 2Z6FA 3NFSH 2MHAA 3MRRB 2D3VA 3GBNH 1XWVA 4XN7A 4KJWD 4WK4B 4CMHC 4GJTB 1ROCA 1WT5A 1KY7A 2E9BA 1MHHA 3E38A 3SGJA 1BMGA 5BS0E 2CIKA 5E6ID 4HH9B 4P5TB 2X1QA 3L9YA 4ZSOA 4FNRA 2PTTA 3HAEB 3ESOA 3UP1A 3F12B 1IGTB 2V3FA 4OVVA 4H8WC 4YHKL 2NR6C 4NWUH 2FQGA 2Z31B 3ULVD 3BHBA 4DKAA 4LBEA 4YGVA 4W81A 3BD4A 4EDWL 1EMTH 4H44C 3GMQB 4FZ8H 4PJFE 1TVBB 5E9DA 4WWPA 4PWJA 3HNSL 5C86A 1FVEB 1A7QL 3FT1A 3NGBC 5KJRL 2AJVH 2FJHA 4LCCB 3VNYA 5CHNB 5HD8C 2FO8A 4L8SC 4U1HB 1J8HB 4PJXF 1EFXA 3U79A 2FEEI 1NUGA 2R23A 4BFFA 1QWHA 5BS0B 1S4IA 3QR2A 4JHAL 4PJIE 3FSAA 1OQOA 5KSUA 3FQ4A 4E9LA 2PYFB 1R46A 3GBEA 1FNGB 3O45A 1KEGH 4TSAH 3ZDYE 4X6DA 5L4FA 3K5RA 3RTQD 1JF5A 5BS0A 4PY7A 1QSFB 3VDBA 4MB1A 1KYDA 4WNQB 1QR4A 3X12B 4RIRB 1BBJB 2O6PA 5I71B 3HKFA 5LGJB 3CLFH 1O9WA 1BGXH 4B3EA 1E65A 1J5HA 4X6CF 3MCG1 4QWWC 5C0DA 4J12A 2AVFA 3F58L 1BD2A 2NYYC 3UTZB 1X5YA 4HPOH 4YWGH 5IHHA 3FF8A 5IQ9A 4GG6F 4HJ0D 4ZFOB 2I32A 3X1FA 2F1AA 2IVFC 5D55A 5M7QA 1Z0MA 5E8OB 3GNML 5I0XA 4YXKL 3R7RA 3K72B 4JQIA 4LMQI 1KFGA 2ATKA 4TLKA 1JPSH 3FU8A 1HL9A 4J6RH 2HKHL 5SWSD 3MV9D 3UTOA 2AJYL 1MCSA 5BO1H 1Q0XH 3VW3H 2HTLD 2AJ3B 3FL7A 1Z9SA 1OO2A 3I6GA 5KBMA 3SYPA 4BFNA 5FFOA 3V0HA 1E28B 5DZJA 3JT0A 4NUGH 3VU2A 5HYSB 3M1CA 5E8DL 1NAMA 4JPQA 3ZT5A 8CGTA 1JPGB 3NK3A 3M1BA 2FRGP 4I3GA 3DX9B 4ZXBC 5JYMA 2QSTA 1NOLA 3S37H 1L3WA 3L1FA 3QIWD 1RZQA 4YBHA 3ZKMC 4RFNB 2LAAA 4QHUB 2VLRB 5CN1A 1KTRL 1Y6MR 5H94A 2HYMA 3EH1A 4U1GC 2CJSA 3OLEA 5FCUH 3TCLB 3NJJA 4I18C 4GW1A 3Q2NA 1LM8V 4HS8H 4LKCB 4DP9X 3JV6A 1QLEH 4AXWA 4EI0A 1ZTXL 1A7RL 1FZJA 5TF1H 4RGMC 5FF6A 1OHZA 1KJ2L 1OZUA 2A74A 4O2CA 4F15C 4L4TA 3DX9A 3UZEC 3C8DA 4KFMA 5BQ7A 1FUNA 4G3YL 4MZ2A 2QSQA 3Q1SL 3GT6A 3GPEA 3FQUB 5BUGA 4MCYA 1RK0A 1G7JA 4AMKH 3K8MA 1RZPA 4JM4L 3A4EA 4IMLA 4K2UH 4OUOA 5HDQL 3KW8A 3I74A 1DFXA 3OKOB 4JDEB 1FFPA 2MIZA 2ZX8A 1DDHA 4HWUA 1I1AD 3VVVA 3DVNA 3MDJA 4P0DA 4NQDB 3PWJA 2HJFA 3AGVA 1OAQH 1YEGL 2GSIA 4W9CC 4FX5A 2DBLH 4JMNA 1KCKA 3ARQA 1QX1A 4X83A 5IR1A 2C34A 2Y1ZA 1RHHB 2V5YA 1RZKC 4HF5H 5BRPA 2Q3AA 1ZLUH 4ES8A 5DGRA 4FEMA 1PLGH 4G9FD 1HAUA 2HJLB 3BDYH 4L9LB 1SY6L 5EPMB 3LHAA 1M7IB 2CUHA 4HAKA 3G5ZA 3B5TA 2VDQH 3G6DL 2GJJA 2AJVL 4WI8A 4LCVA 3P0YL 4G83A 1T03L 1FFOB 1JK9A 5D6DC 4QO1B 5JW4R 4L4VD 1L5GA 4EO5A 3MU3A 5DRWA 4ZAKB 3ULVF 3MHZA 1T5XA 1J1XH 2G0LA 5CINH 4DSYA 5M95B 1YPZB 2W0KA 3W1ZA 2B1AL 5EU5B 5KBKA 5ICXA 4YDLB 1U8IA 3OXRA 2HVKB 5INCB 3CDGA 4KX9A 1CGSL 3G6AB 5ABZA 2E56A 5ALCL 3IWUA 3HS0A 3C2AH 3WNIA 3ARDD 3VXMB 5C92A 5E5RB 2ARJA 5ENWB 2XV3A 2OMBA 3TWCL 5LB1A 1KPRB 4NHCH 3WXVL 4CGUB 3IMSA 1XCTB 2X4OA 4RMRA 4KZEL 2Q76B 4KWUA 3ZHKA 4QYOB 1YNTA 4JM0A 1MWAL 4QLWA 3MRIB 4RISL 1RLWA 4MNGB 1NPJA 1U8KA 1VFBB 3QNYB 2GBUA 1IT9H 5D5MF 4F1ZA 5CJQL 1E6JH 3JV4B 4ELMA 3S7GA 3WIIH 2LLNA 2QGBA 3F7YA 3TC9A 2XKNA 2FX9H 1HT6A 4N2BA 5AEAA 1JD9A 1ZA3B 2YRZA 3RU8L 3L3DA 2HFTA 3TBSB 2Z8VC 3KW7A 4K5PA 1NL0H 1C5DB 4WU5A 5HI5C 3K71A 1T66C 3BLPX 4G6JL 2HLFD 2OKMA 3JTSB 4MNHA 5IUSA 1CFTA 1HE7A 5EZIH 4CNIA 2VABA 1E2VA 4KJQD 4DGVH 3GMNA 5F7AA 2WLLA 3FN9A 3X3GL 4DN4H 3E8UH 1A6TA 3SDDA 2ZQKA 3G5YB 1H0DA 5IF0A 3AQZA 2J20A 1PQZB 4GYBA 4RVBA 3S36H 2VDOB 4KDTA 2P45B 4OAWA 2WVVA 4QXGH 4EBQL 1G7MA 4UQIM 1VRSA 3HZKB 5H2BB 4PB9H 5CCKH 1EAQA 4OLEA 2NY2D 3ABKB 1BZ7A 2FWOA 2EYRA 4M62H 1F4AA 4LAQL 4UT6H 3NUKA 4U3XA 5J12B 1JYVA 5BOPA 5IHBA 2O6FA 3I9PA 3CZUB 4IHBA 4W9EC 5HJDA 1NM9A 4NDMA 1J18A 4Y4FD 2E8YA 4Y4HB 4ZUTB 4KRPB 3VWKA 5FR3A 2G3MA 1CLOH 2NY1C 3HZ3A 5I2IB 3DI2B 5DA0B 2A73B 1N18A 1HL5A 2VXQH 3D85B 4RMWA 5T1LD 2CDFA 4P2QB 3X1GA 4D94A 1WAAF 2H26B 5BUPA 4U4BA 4YSDA 5AW2B 3S3DB 1ROWA 3MGTB 3MBEC 4CMMA 1MEXH 3OZKA 3HHSB 1BG9A 1PD0A 2VDQB 2A6IA 1JNLL 2ADGB 4Y16B 3AU1B 3L8QA 5I8OL 1T1YB 3QWQB 2C7FA 2Q8BL 3QWRD 5I2IA 2DBLL 5JIKA 3H9SD 1BIHA 4A6YB 1JZGA 3P3YA 4JCLA 3RAJH 3WNLA 3GWJA 1DFBH 2VXSL 3FB5B 3BP5B 2FBOJ 2W9EL 4N5ED 3REVA 5DC9B 4K94H 4NQCA 4AITA 5E8NB 1MVUA 5FO2A 1FYTA 1QWNA 1P6FA 2WYTA 2UXVA 1PY4A 3MRLA 1R3JA 4U1GB 2FO4B 2CK0L 1TCMA 1X3DA 2ICEC 4MJ6B 2PCPA 4ZJ9A 2AI0L 5A16A 1TQBC 3L95B 3WO4B 3VWJB 1A6TB 2OJZH 2PTVA 5FKPA 1P7KA 4WV1C 3WFDL 1S7QB 4BKTC 2QEJA 2F19L 2X88A 1XSKA 3QRBA 5DC4B 5I6PA 1EEYB 5CZXD 2WCPA 5FB8B 5CCJA 3VWJD 3F62A 2X42A 2CBPA 4MD0A 3TTSA 4KKRA 1J9RA 5ALCH 5GRVK 1NMCB 3B2MA 2D7OA 4X7FC 5DUJA 4UTBL 3GUTA 2IFFH 2EDLA 3EH4B 5ICYB 1HHIB 1DR9A 4V1DB 4DT2A 1KBGH 1P5UA 4BH8B 4DF9A 4KVCH 1LQBC 3K6OA 4FNTA 4AQAA 1E5YA 4EIGB 1XTLA 3L54A 5IVXB 2E3VA 4JQXA 3B2DC 1F41A 2HN7A 5D72H 1NAMB 1R19A 4AQ8A 5L7XH 3GBMH 4JO4H 5DT1L 3WFEL 3QJFA 4B6ZA 1NBVH 1JNHA 3KLLA 3J27A 3IDGB 5IB5A 3PGCA 5GS1C 3FAXA 1ZLVH 1YYCA 1QFWL 1EO5A 2EE6A 3L4YA 5GRJL 1DQLH 5I74C 3DXAD 4JFQB 2F18A 1H3XA 3WLWC 4DPRA 2XPGA 3KYAA 4LCIH 4AWJC 2HFGL 3MLRH 2ZKHH 4DZBA 4U3HA 4R0LA 2FTAA 2ISDA 4NBXB 4N1EA 3VFOB 3X17A 5AAPA 4GUOA 2VLLA 3BMVA 4QF1A 4LCIL 4H25B 3FFCA 3OKEA 4DEWA 1KYOJ 3FO1B 4I88A 5CGYD 5F7EL 3H1ZA 1FGVH 1INDL 3BX7C 1AH1A 4YBQC 4GOSA 3MA7A 2F53D 3MLTB 2EXYD 2YPLD 4C57C 3BH9B 4Z76A 1EO8L 5FDWA 2AEOA 5JUEL 3PAZA 2PXYD 3RB5A 4G7RB 2R4SL 3MLUL 5E2WH 4G8EB 3JWOL 3PY9A 1HSBA 4J3OG 4CC4C 5IW1A 3PG2A 5LQBL 1RUKL 2F5BL 4HK3N 4MMZB 3DC0A 4H25A 2HZHA 2EZ0D 1V27A 2NW3A 2Y7MA 4QOKD 4CVZB 3W81A 4GI6A 2XPZA 3AWGA 3QNFA 4QRQA 3WIHH 4EI5C 3NJXA 1NCCH 4TNWK 1QNIA 3MJ8B 3TESA 3P30H 3HZMB 4OGYL 4O58L 4U49A 3QJHA 4Q6IB 3A6CH 3PDOB 2IV9A 4QO1A 1A47A 5EO1A 4PJFB 5DJ8A 1UH4A 3GEWB 3B3BA 3O3BA 4H8VA 5KS9A 1C16B 2ADIB 1FZKA 3S5YA 1IRAY 1BOYA 2JLLA 5D2LB 2UZIL 4E41A 1OW0C 5IVXA 4R7LA 2NTFA 1K4DA 4F8LA 2JB5H 2AK4A 3NCBB 1IBGH 1BA9A 3GSOB 4WWKB 1AS7A 2ESVE 1UCBH 4WDIB 2ZUSA 1KTBA 3S96A 4BHUI 3U82B 1TSRA 3EIFA 4YR6B 4D0BA 4ODUA 1I8LC 1ZHNB 5B1CA 3MBEA 5TDNA 1KEMH 2FZ3B 2BOCB 1URIA 4H8UA 4ALAL 9PCYA 5F1SA 2YUXA 3KEDA 3ML8A 5AZ2L 2F54D 4FJZA 3VXUE 4Y4HC 3CUPA 1CYWA 1IUZA 3L95A 3LS5L 1NAKL 1FRGH 2UWEB 4I3SL 4WRLA 3T4AB 2GFBB 2P5EB 3LH8A 3VWKC 5ACMA 1T20B 1CK0H 3KPNB 4KKZA 1I85A 4ODUB 3V6FB 4RZCA 2HWZH 3DIFB 4RSYA 5AW3B 2V3EA 4BZ1A 2W0LA 1IGCH 4EN3C 1IC4L 4YPJA 2VKWA 3HG2A 2X10A 4XHQA 5JXAH 1A6UL 2EYTA 3T0EE 2AQ2A 4YHPA 1ZT1B 2D7QA 5DC2A 4Y16C 4JPKH 4MKMA 3JZ7A 4Q6KA 1PGRB 1P7BA 3MRBB 1EZSA 3K3QA 2VDNH 1T7XA 4JB9L 4N2HA 4Q0XH 2FB4H 3V4PA 1CR9H 1KCRL 3AS3A 1MCNA 1S7VB 1QQDB 4F2FA 1M53A 3BSHA 4GSDL 5E1AA 5E8PB 4IRZH 5MEPA 1A7PL 4ZMOA 2KI6A 1MCWM 2WO4A 2YAEA 1FC2D 1GKOA 4MRCA 4QLRA 5CF3A 4YDKL 4LHUB 2X3BA 3VI4B 1OY3B 3LRKA 1P9MA 2YBRB 4ZNEE 5DEFB 2WB1A 3HMXL 2SODB 2DI9A 5AUMA 2BZ7A 1SYVA 1PKQE 2UY6B 4R8WH 2ZKHL 3GSNB 3KLKA 4X6DB 4YBLC 2G3XA 1MFAH 3HI1B 3D05A 3D12B 5SWSB 3L3OC 3B9KA 2EVGA 5D8JH 4YMPA 1HEZB 2K3HA 3SQBA 4Q4EA 1WC7A 4NI3A 5K33A 4FFVD 3VH8G 1TCRB 4N0FB 1ZLSL 4DETA 2V9QA 3G08A 3N0PB 4ONFL 5I0DA 3VD2A 5EC1B 4AM0B 4ZG1A 4JFXB 5EBLA 1QYGL 3ZW3A 2E76C 3H6JA