4CSTA

Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cstA00
4AVIA 4X50A 4AV0A 3BWUF 5CGBA 2XG5B 5F2FA 4AV4A 4X5QA 2XG4B 4X5PA 4XOAA 1TR7A 3JWNG 5LNGA 3JWNE 4XO9A 4AV5A 4CA4A 2JMRA 4AVJA 5JQIB 1N12A 4CSSA 5FLUA 4J3OG 2UY7B 1PDKB 5IQOA 1QUNB 2WMPB 4AVHA 1KLFB 5AAPA 3BFWA 3BFQG 4BUQA 2JTYA 4XOCA 4ATTA 4X5RA 4AUYA 5LNEA 3ZPDA 2UY6B 3JWNH 5FWRA 2VCOA 4XO8A 4CSTA 5FX3A 5FS5A 5F3FA 5AB1A 4XOBA 1UWFA 2J2ZB 5IQMA 5IQNA 3ZL1A 4AVKA 4J3OH 5ABZA 4J3OF 4AUUA 4XODA 1N0LB 3MCYA 3SQBB 5AALA 4AUJA 1ZE3H 3RFZA 4XOEA 2W07B 1KIUB 3ME0B 3ZL2A 4LOVA
chains in the Genus database with same CATH superfamily
4GQ9L 5I75C 2P5WB 4XN8A 1VFBB 2AS5M 1YYML 3ZN6A 3EFOA 1V05A 4JANA 1CZ8L 5E7FA 3OF6A 4FE9A 1U8MA 3P69A 4G8FB 4KJQC 1JGEB 4ENED 3QZLA 1NAMA 5IVXF 3FF7A 3SDCA 5MEPA 1U58B 3GKWH 3E2HC 4L4JA 5HDQL 1IFHH 2OI9B 3KGTA 4GP4B 1GAFH 5FHBH 3TN0B 4HKZB 4DGIH 2WXRA 1L0QA 3N50A 4PLNC 2D73A 4NO0D 2VJ8A 1AO7B 3QFDA 4MASA 4FNPA 3BW9B 2UWEA 5FDYA 5DO2C 3OJMB 4FQIH 1M6UA 3HC2A 2FYYB 1ZOXA 1FBIL 4P3DA 5HHPB 4EI5A 3QAZC 2FGWL 2OJ1A 3ZLQC 4ACPA 3RJQB 4UB0H 4LHQB 4HD5A 5EN3A 3MA9L 2CKBA 2FUTA 1X6NA 1AFVH 3WL9B 3FDWA 2VIRA 1EFXA 4TNWF 5E2VL 1WC7B 2W9DL 1J48A 1TKWB 2FEJA 2GB2A 2IPTL 2Z8VC 4YDIH 4ZX5A 3DDGA 3LNGA 3KLLA 3MLXH 3RVWD 2P4AB 4HZ1A 3D39A 1EFXD 3TO2A 1IZJA 5DK0B 1PG7L 3BFWA 4HFUL 3OKKB 3TA4D 2IDCA 4YC2C 1N64L 3WENA 4PJ9C 3RURA 4OFYA 4X6DB 5JA8B 2GITA 1D5BA 5DQJA 5KG9A 1R3JA 5E9DB 2BIOA 4JCWA 5FEBA 4XBEH 5JXEC 4GI6A 1BBDL 4EN3A 4LVHB 2MOVA 3Q6GL 4UNIA 5L6YH 4MVBC 1MCLA 5G5DA 4H40A 1AGFB 4WEBL 1NBCA 2W65B 3BUIA 4PAZA 3FULA 3JVGA 4MA1C 1EO8H 4D8PA 1LDSA 3IFLL 4NLHA 4QHNB 2JCWA 2DLTA 4GRMB 1MREH 4GAJL 4EN3D 1HNGA 1DANT 1INDH 4JFUA 4GQRA 5IQNA 1N4XH 1L0YA 1JNLH 2OMVB 3HR5B 1P7KB 2OBGA 4QXUH 3GZKA 3QUMH 4KI5D 1CWVA 2ZKYA 3FT2B 1MWAL 2HB0A 2BIHA 3B37A 2NTFB 1YUHB 1J9SA 2BXZA 4YO0B 2HLAB 4LPTA 1WIOA 3PWPB 3CNKA 2YPKB 4PJIF 2PPEA 2R0ZH 4Y8DC 1IC7L 1SY6H 4GSRA 3P11H 4O02L 5CCKH 2APWA 2O6PA 2F74B 2Z7WA 1L9SA 3O9WC 2R8SL 1O9WA 1OE1A 4GIAA 4A7GF 2BVEA 4JO2H 1SLUA 1OB1B 4PJDF 3PHOB 3L5WA 3NRFA 3ZZ1A 2GK0B 2ZYHA 3CK0H 5J8OA 2OSLB 2EDQA 4HJTA 5EDXA 1I8MB 4A66A 4I0PB 3RGVD 3O8XC 5CWSB 2DQCL 1ZGLB 3VDCA 4XNZB 2ZCLL 2Q0ZX 3MV9A 4LQFH 4TUUA 1SN2A 2XWRA 4RFOH 5ICZA 3LNFA 2YSTA 3DRQB 3JXAA 1PZ3A 1S8DB 1JD7A 4FXGC 4JMXA 1HT6A 5BRPA 3SY0A 4YHOH 3MROA 4L37B 4FGMA 4MXVF 4AC2A 1JZGA 1DVFD 3HRZB 3LIZL 3FB6A 3CDCA 3CLEL 4HH9B 3C2AL 3C5JA 3HN5A 4PGBA 3L3HA 5F7WC 4U3SA 3EH2A 5CNHA 4YDKL 3QARA 1ND0A 1WS7A 1NQBA 3E6FA 4AJ0A 3KPPB 4LBAA 3QJHA 4YWGL 2J1YA 4ZFOL 2EDBA 1XXFC 2JK5A 4HISA 4MMZB 1M1SA 1AGDB 2YLHA 4KOCA 4ZPTB 4K5PA 2W0FB 1Z5LA 4P2CG 1PDKB 1EUTA 2GUOA 1ZA6B 4IRSC 4PRHD 4PTTB 4IMKC 3QIBA 5BQ7B 3BN3B 1MHEB 3MODH 5ANME 4Y16C 4ZS7H 2X2HA 4XO3A 3F65A 4KKLD 3WN5C 4HT1H 2Y7SA 3D0VA 4YDVB 3DVIA 3QJOA 4BH7A 1DEEB 3ULUE 3BQUC 3SD5A 5IQLA 4ZMNA 2AQ3A 1UG9A 5TF1H 4MXWL 3QA3B 4M93B 4WWOA 5BO1L 1A8JH 4CRPA 3U6RA 3OVUB 3VH8A 1I1AD 3TT3H 1OCWH 4MA7L 3SE3C 3VD4A 1U3NA 4PHXA 2XX1A 3OKLA 4I87A 1FORL 1ILSA 4JUTA 4WHTA 1KPUB 2F54A 3WY1A 1JS4A 3FCSB 3DX1A 4R2GD 5FECB 1WUNT 2NY2B 1XCWA 2NZ1A 4QWWD 6TAAA 3DX7B 4WHDA 5B1JA 1CLCA 4OFQA 1PL3A 4A2DA 3T0DA 3FKUS 2F8VA 2MRYA 2WLKA 4GQZA 4LIQH 4OFVA 5F7FA 4KK6D 1LVEA 3NRQA 4QHLB 5FYLH 1A5FH 1MJJB 1OSYA 3C6LB 5E24E 1HH6A 3FFCB 5JOFB 3P9MB 4RAUB 5DMGD 1VACB 2ITCB 4JFOB 2DQDL 2Y06H 4LRNL 1RUQH 4QTHB 1QSVA 4DQOL 4BM7A 3AACA 3HBZA 2ENQA 1FVCB 3QDMA 2WQAA 3I75A 4EQ3A 1CL7L 3BUDA 4PLOB 3UZQB 1XIWB 2CH8A 3VRIB 1TVBB 2XG4A 5DMKB 4F9LA 1KBPA 5CJBA 1QFWL 4ODWA 3CZFB 1CG9A 4HCRA 4GKSA 2AEPH 4W1TA 2HX8A 2ETWA 1NAKL 1NC4A 4H26B 4TQEL 3U9UB 4PJXE 1JZJA 2D9QB 1CDUA 2OSXA 3HZYA 3PWJB 3NCJL 1UATA 3FU6A 4PJ7F 1KIQA 2EJ1A 2YO3A 3QNFA 2MMXA 1NC4D 4OF7A 3RX9A 4F2EA 4FDWA 1ZHKB 5DHMC 4CC4C 1ZGLM 3NSYA 1TU2B 2FBJH 2K7QA 3PL6C 2G2NA 4ELME 1I1FB 4JFFA 3QEQE 2WTOA 4FA6A 4E36A 1Z9MA 5ACZA 3UTSD 3GMNA 3MRBB 4FFZL 3BP5B 2DDQH 4YDJA 1JWMA 2FDBP 4DF9A 1KV3A 4FEMA 2GSMB 3RFZB 4H20H 3P3RA 1OTSC 3VB9A 1S7XA 4PB9L 5E8DL 2WINA 4QRSA 5MENA 4MMXA 4OJAA 2HKFH 4HPYH 5EZIL 1IGML 1S5IL 3UTOA 2WKGA 3JV0A 1DN0B 5CLWA 4GAGL 4OT1H 4TUJA 1EDYA 4A6YB 4JRXA 1DVZA 4E42B 4ALAH 3FO9A 5CXPA 1U8PA 5F0PB 1H15A 5IFAL 5HYFA 1F3JA 1FDLL 1WK0A 4PVNA 2GSGA 2O6CA 4KVNL 3T9WA 2NY7L 1L9QA 4J4PD 4KXZH 2BVTA 3II1A 2DD8H 4N90E 3H9HA 4KC3B 3KLAB 4BJLA 3LKQA 3L54A 5IOPB 1MI5B 3O6FA 3B43A 1F90H 5FX3A 4ERSL 1XO8A 5GGQH 1J05A 4GJTB 3TA3D 2IH3A 3A6CL 3L5XL 4LBEA 2VH5H 1TVDA 1WSST 4JEGB 3FN0H 1LP9F 1UYWH 3QO0B 3K6IA 3V0VB 2Z35A 1AQKL 3VM5A 1CK0L 1FLRH 4YH6A 2L8AA 4N20A 1WA1X 4GG8B 4J8QA 2X3AA 3CC1A 3GSQB 5J6GB 3SPVB 5L7XL 4WSJA 1R34A 4Z7NF 3F84A 1ZSDA 2WXJA 2NXZC 1S7TA 3E7JA 1FRGL 4OZFH 5F9JA 4UTBL 3RLSA 1J0KA 3SYCA 2P1YA 3DVGA 4L23A 1FZKA 5HHNA 3RWHA 1F18A 3LZOA 1CC3A 3KBPA 4U1IA 4HS3A 4ZAKB 2NX5D 4KRPB 4P04A 1T22B 4XOEA 3UZEC 1BFVL 3VSTA 2P8PA 2OQJB 2AK4A 1AQ8A 1OTUC 4BK8A 2WO4A 3CSBA 3LN5A 3SJVB 2PPCA 2K9UA 2CSPA 4U0RC 2D31B 5GRXG 2I24N 3EBGA 3SE8L 4UZUA 3ZSTA 4F7PB 3REVB 1KG0A 4EOWL 1R5IB 4Y9EA 1NCDL 2EC9T 3T4AA 2XWJA 1Y6MR 3FRUA 3PGFH 5B39A 1HQ4B 2OZ4A 1AGEB 1E6OH 5DMJB 2B59B 3FSAA 4LGSB 3RI5F 2VW4A 1U95A 3ULVD 3CFTA 2OMWA 4BGLA 3G6AB 1Q72H 2X9ZA 5EO9A 5A2JH 4J23A 3IKCB 3RIAK 1BJ8A 5LBVA 3NGBB 1ILUA 4YHKL 3FO2A 4M7ZB 3TJHD 5EEVA 5B3SB 2VQ1B 5JPMC 2YUWA 4AEHH 2Q7AA 2VC2H 3K71A 3QC5X 4JO5A 3IMTA 1FE8H 1MCNA 5CBAA 2CR0A 5E2JA 1FJ1A 4Z95L 5LGJA 3KD4A 4GRLA 4IBVA 3KJ6H 1IC0A 3EFOB 4IHBA 4JANB 4GRWE 4AEIL 3AS0A 3VFGL 2VLRA 3W3BA 1U8MB 1ZHLA 4WW2C 3GFUA 1A4BA 3SDAA 4E0RA 3GI9L 1WBXA 1UVQB 1F1GA 2J5LB 2XZCH 1J8HE 3FUJA 2YPLD 1I7TB 1GGCH 4HALA 4L4VD 5MEPB 5CF3A 3UABA 5HHQA 3SDXF 4LARL 2NNRA 2A9CA 1CBJA 1NFAA 1RIVL 3SDAD 5HDBB 3U82B 4N26A 3VD9A 5B7EA 4U1LA 4IRJA 4Q9RH 4PRAA 3QFDB 4LVOB 1HHKB 1X6LA 2UWEB 4EI5B 5L9DH 3L1FA 5FKPB 4HKXA 3DV4A 1OAZL 4CU7A 5CLXA 4ETYA 1LNUB 5K59E 2YD0A 1RUPH 4FC3E 3C75A 4NFDA 5DJCA 1AY1H 4K3HA 2X89D 2NZ9D 5ITBL 3V0AC 3C09B 3QDJE 3P9WB 4OLUL 4OZGE 1NCAL 2VIRB 3EDFA 4W9FC 1EFXB 2EP6A 3QWQB 4KBPA 1VADB 2E46A 4LSPH 4QJ3B 2R1WB 3ZTJG 1E4HA 2C3VA 2R0LL 1QKZH 2JKTM 3ZRFC 2EVHA 3ZKMC 3TO2B 1R75A 1AE6H 5IKCA 4X83A 2VZ1A 5DD3H 4DSYA 1T1WA 1F4WH 4NNYA 5KG9B 2A77H 4F15B 3DUSB 3HIZA 1P53A 4ZNEE 3KPTA 3FQTA 4LK4A 1YY9C 2XTJC 3NSCA 3DJRA 4Y4HD 3WV0A 4E9LA 4EN3B 5DRZA 1M71A 5AVWB 5G5DB 2ZKXA 4G1EA 3CPUA 3BWAA 3L3JA 5JW4R 3QR0A 5EOQH 4D8PB 4PREA 3ERXA 2J5WA 4K3DH 1QA9B 1OAXH 3MN8A 2FECL 2LFEA 5KVGH 4QRTA 4K71C 2VDKB 2YD6A 1YEEH 3ATBA 3MRIB 1ID2A 2AJSL 3U36A 4OZHE 2F15A 2WGNB 4DGUA 4FXTA 4QJ5B 4QHKJ 5G4OA 5E1IA 1I9JH 1BZQK 3LVTA 4FFYL 4M9OA 3MJ9A 5I8EA 5IMLB 1Q1PA 2AFNA 5AUMA 3WXVH 4DP6X 3UACA 3RGVB 2WP3T 1IUZA 2R2BA 4QKXB 2WQUA 1UOVA 1U8NB 3KWWA 3QZPA 4JKPL 3F7YB 3VGDA 3T0AA 2WJ5A 3U9PL 4N2CA 2Q86A 5ITFA 2X40A 1KGCE 4X5XB 4FABH 5BZWA 3FU0A 2ILLA 4OIBA 1DVFB 1DSFH 1UUSA 4BWWA 4N6QA 4K9EH 5ICZB 4KNSA 2CM6A 1D7FA 3HFMH 1EPFA 3NCYP 3FQUB 4WJG3 3MROB 2HTLC 3LVEA 4R4BB 2MCAA 3JTSA 3LDBC 2W92A 3SDYH 4JG0L 4M7JL 2E8YA 4K9JA 1ZV2A 1OD7A 4XVTL 1RMFL 1LXMA 4IBUA 3C5JB 5K69A 4PGBB 3WXWL 4NP4H 3TIEA 4U3SB 2N56A 1ND0B 5HDLA 3TNMA 4U1KB 3STBA 3QJHB 2DWYA 3BT2L 4QTIH 2XTLA 4K3JL 4Q9QL 2JK5B 4A7VA 5D1XD 3MXWL 2IGFL 3BWSA 4MQXC 1Z5LB 2X4RA 1W8OA 5DT1H 2EILB 4IM8A 1G0DA 3QIBB 1IM9A 4XNYH 3IT8D 5E94B 4XNXH 1ACXA 2DQIL 5B1BB 4KJPD 3V0EA 5C6WH 1II4E 4BH7B 4NJ9L 2DWEA 5C86A 2HZHA 5INCA 3UMNA 1NFDE 3VWJA 5LQBL 2KDYA 3U6RB 3VH8B 4R2GB 1E27A 4MMYA 4C56A 4XBGB 2DF3A 3OKLB 3QSKB 2VRKA 5I24A 2F54B 1A66A 4KXDA 3GXMA 4X50A 4Z1PA 4UF7C 3F05A 1T7YA 2VN6A 1WHPA 2ZJSL 4PJEF 5DQDH 1PQZA 1QBLH 1MJ7L 4KAQH 1EZUA 4KROC 3UP1A 1W0WB 5FCSH 4NN6B 3ESNA 5D7SH 1K5NB 4L8DA 4S1DC 3MCKA 2H2SD 3B9AA 4Z7OE 3TBBA 1HEZA 1NEUA 5IR1A 1UD3A 1BVNP 4JREC 2HAZA 2Y1AA 2C7UA 1NDGB 2WBJA 4HIPA 4OGYL 3TGXA 4MJ4A 3ZE1B 5HY9B 1IQWL 4XVJH 3VNYA 3L13A 3K2IA 3RU8L 4BFIA 4LDEB 4GUPB 4CADB 1GRWA 1LO0H 5SV4A 3I75B 2OCJA 4FMVA 4U1GB 2ZSVA 1U91B 1ZPUA 4I9WD 4KY2A 4TXVB 1GCFA 3MRRA 4XC3H 4GT7A 2KC0A 4NWUH 4ODWB 1NGQL 1CG9B 1LJMA 4C83A 4GKSB 1BX2A 5HHXH 3SKMA 2K4AA 1E65A 1NC4B 3QBTB 1SOQA 1KJ3H 4DK6A 5ALBH 1E6JL 3ZYIA 1BFSA 2LTQB 3HZYB 4D9QE 4YAQA 1SOXA 4HS8H 5KBDA 1GTNA 4Q2ZB 2H1LM 2H47C 4NPKA 1R5WB 1CU4L 4HQQL 4AQ1C 4JM2D 3L4CA 2VXVL 3FH7A 2ZX9A 4S1SL 1IT9L 1EAOA 1CXLA 3PF2A 1RAMA 3FTWA 5D7EA 2Y7QA 5ACZB 3GMNB 4V2CB 4A6YL 2WXNA 1AI1H 1QABA 4BFGA 1TLMA 4M61B 4MHHG 1JWMB 4HIEA 3KLHC 1S5HB 4HIIB 1E4KA 2MNWA 1YLBB 5CIPB 5DUPH 1Z9PA 5SX4H 1A6ZA 4O9HH 3SOTA 2VR6A 3NCBB 4OCSH 1S7XB 4LPYA 2WINB 2AERT 2AMGA 3AB0C 5MENB 4MMXB 4QKTA 3ES6A 5DVNA 1A4CA 1SMOA 2OS7A 3ZJAA 2C1PA 3FZUD 1MLCB 4TUJB 2X4QA 4AIOA 5E00B 4PJFB 4MCZA 2P46B 1FSKC 3PDOA 3S3BB 4Y2OA 4FQLL 1H15B 2X1WL 3TASA 5KS9E 3WFDH 4YSAA 1F3JB 4Z7UE 4ZPVA 1JZ5A 4BCZA 5C0GB 1XB3A 2P52A 3MBWA 4PLJC 3H9HB 2I9TA 4BZ1H 3TA3B 1SLXA 1JNNL 3LKQB 5KEZA 3WE6A 2PTUA 3SPHA 3FCGA 3HUJF 1QTSA 4BQCA 1IGIH 3WKNA 1J05B 3E38A 2ZG3A 2IH3B 3B7UX 4APXA 2F7QA 3AQDA 5D1QE 2XLLA 1PZSA 1RIHL 2ZOUA 1WWWX 4MHHI 4TSCH 5AB9A 1IKNC 1TQBB 2I5YL 2IDSA 4FLSA 4YLQT 5F97E 3RWFA 3CN2A 3VUAA 3VXOA 4RSVA 1SJXA 1A7OL 4OCWH 4V33A 2ZT9C 1ZLWK 5K5YA 2VDNL 1XR9B 1RZKL 4RMWA 3U7AA 4AZUA 4RGNE 5EZOL 5FYKD 4WWKA 5IP4A 1TZIA 5F9JB 2NX5B 1JNJA 1PEZA 2ESVA 3DVGB 4MJJA 5HHNB 3CE1A 3BGFC 4UQ3A 3U4EB 4JFQA 5CCGE 4U1IB 4ODTL 4HS3B 2ICEA 4AIEA 2EXTA 1P1ZA 3FUEA 2IADA 4FP8L 4OJYA 1T0MA 2QQNH 4MDIA 4J3OG 4NQXA 2AK4B 3WCYA 2HA1A 2QZQA 4V1DE 2R56H 1QSFD 1ADQL 4OJCA 2OP4L 3I9GH 4AMKH 1YSOA 2WVVB 1HSAB 2XA8H 4B3EA 4BQ8A 4UIKL 4R97B 2CO7A 1QPKA 2X70B 3B2DC 4AT6B 2XWJB 5B39B 1TZGL 5MEOA 2BS8A 2J6EH 2WVSA 3GJFK 5I82A 2GIXA 4MJHA 4Z76A 4HPOL 4F93B 2RA1A 2VZSA 1A22B 1VSCA 2WVTA 1AJ7H 2OMWB 2EIKB 5EO9B 1SYSB 1A6UL 1AKPA 5DZPA 3T8VA 4XXCC 3NCCB 2EXSA 4XVSL 1NAML 1U3HD 1JN6A 2H0JA 1ADWA 2ITEA 2OTUA 2GY7B 4H1LB 2F9BT 3OTTA 2J12B 2Z1PA 4QXVA 3K71B 3RY4A 4N0UB 4OU3A 4ABUA 4DOHB 1CO1A 2FHBA 5CJQL 5CBAB 3QI9C 1FJ1B 3ML9A 4RVBA 5L8JB 2FQEA 3CX5J 3FTSA 5L4JA 4L4VB 2YPLB 2J4WH 3MYJB 1KWGA 3ARGA 2QSTA 3ZHLA 3WIAA 2EVGA 1R3IL 4ZUTA 3SDAB 3NDYE 5GGSY 3S8FB 3L81A 3QULA 5GRUH 5ADPL 2BLFA 4HS6A 4K23H 5HHQB 2XBTA 2CKBL 1BZDA 3BHBA 4JCMA 2APXA 1KDIA 3VDBA 3SE6A 1KXVA 2LLLA 4GMTH 4WI0A 3HB3C 5AW5B 3FB7A 2WQXA 3Q6FA 5E4EB 4IRJB 1Y6NR 1EX0A 2HRPH 4UINL 4BK5A 5B7FA 5DVLA 4ZI8A 3CFKA 4WUUD 5G4NA 4FP8H 2HLFD 4FMFA 3DV4B 3IETA 3IMWA 3SKOB 3H85A 4LKCB 3RILA 1A7NL 1JDAA 4MCYA 2OP4H 4QYOB 3PXHA 5C08A 3U1SH 4NWTL 1BQHA 3QR1A 1MIEL 4TKWA 4KJWD 4LCCC 1V54B 4YZFE 4FL4C 1SMDA 4OLZL 5J3HD 4PJGB 4HEME 4LAJH 1L6PA 4D9LL 2HG0A 3PWLA 1CDCA 4FD0A 5IKCB 3QC6X 3RAJH 4F37K 1T1WB 2KUTA 4CL7A 1HKLH 1ZLVH 1OGPA 1G9MC 4RSYA 4NNYB 3GBML 3KPRD 1F8TH 4Z7VA 2VDKL 5ISZA 2AQRA 4L1BA 3W39B 4MYWB 1CFVL 4W6YB 4JFED 3FQTB 4LHJB 3NEEA 5DRZB 3CFMA 2X6AA 2R7EA 3NQIA 3BWAB 5D9SA 3W9DA 4PWHA 4UQ9A 4IU3A 2F7PA 3QRBA 4PREB 2WXGA 3VG0L 3UFIA 5IEHA 5LN8A 5I23A 2ZONA 3HW7A 4MAUL 3S7GA 2V5RA 1KEGL 4QRTB 3QUYA 5FIEA 3ZDZB 5KYXA 1IILE 1OK8A 4JDTH 3GPSA 3BD3A 1MRDH 3P73B 4MX7B 3LS5L 1NCBL 2BC4A 4C55A 4PVLA 3IN0A 3E8UH 1CYXA 3B34A 4K3EH 5EU6D 1VJSA 5D7LA 1BSIA 3AM8C 4EUPB 5I8EB 1CDGA 5EWIH 2FATH 3IAQA 3E9TA 2GJZA 4FLRA 3KWWB 4KVCH 1E5AA 4AYID 4B9ZA 4QRBA 5E9DE 2IIJA 3ZE2B 2Q86B 4PWIA 5ITFB 1QO3A 4X4XA 1IC5L 2NYYD 1U2CA 1A9BA 2YS4A 1NCCH 3SBWA 1E3ZA 3DXAA 2IDTA 3VQMA 1RPQA 5FF6A 2J8HA 3QPXH 3SN6N 3KMDA 2VN7A 1A3LH 2YEZB 3UJJL 5GISL 3IDXL 1ZD6A 3T0ED 4E68A 4BSVA 3UADA 1BFOA 3TIEB 5HDOA 5I6KA 1LWRA 5HYJE 1MFNA 1FO0H 1R46A 3D08A 3PWPE 5D1XB 1AHMA 3NJIA 4P23A 1U8IA 3F58L 1QFOA 3CUPA 2VJXA 5A16A 3FH5A 1RXLA 4UAOB 1NLDH 2A9AA 1TO5A 2QPDB 4P46A 2IH1A 5AVUB 4H8WH 5JW5A 2IALA 3QRFM 2B1HH 1FNSH 1F2XK 5C0FA 1HEHC 1IM9B 4ANVA 2HVKA 3HHRB 3ARBC 3PP3K 3H9SA 4UV7L 4HVBA 2GJ6D 5IUSA 2WXQA 2IV8A 2X4SA 4HJGA 4JZJC 2EE0A 3V6OE 5INCB 4EN2A 3H9SD 2X4NA 2Y36L 2A1WH 4LCIH 1CTNA 4WI9A 3VWJB 4HG4J 3QCVL 1EAPB 2P44B 5IROA 1GXEA 1QZ1A 2OL3A 4M8QA 4I13B 3CZUB 1WE5A 3WNIA 1KN2H 1ETA1 4HD9A 1PKQE 1L9RA 3Q5TA 4MQ7B 2A9NH 1Q94A 4P2RA 4G6JH 4JQXA 3RUGA 1CLOH 4YFLI 1M7XA 1XBRA 4Y19D 4FKKA 2HVBA 4LSRL 3RVTC 4P2RD 5ICYB 3ZX1A 1CBVH 2QTVA 2O5YH 1F11B 3NSXA 3OJ2C 4L8DB 5J6HA 1NBQA 2FWOA 3MCKB 1KGYE 4KZEH 3MUJA 4OCNC 4P3WA 4X6CA 1HEZB 5C0CA 5CLYA 5IR1B 4IIQC 4HCRL 4FNUA 5TDPB 1HNYA 3O3DB 2PWDA 4TOYH 3GT6A 3QZBA 5FKAA 3C12A 2IMMA 2N4IA 4NT6A 4O4YH 3RIFF 4AQZA 4Z8FH 2DBJA 1V5JA 3DO7B 4G82A 3OR6B 3NCMA 4BFIB 4NQUA 1FF5A 4A2EA 2V5YA 3F58H 1UWFA 4EJ1C 1CVSC 5I0ZA 2NW3B 1J1OH 2XWZA 2R0WL 4R5XA 4JO1L 1KB5B 4C83B 1M56B 1WBYA 2XSKA 3ZZSA 3D8MA 3SKMB 1JHTA 4XAWH 2J1ZA 2ZZUT 3EFDL 4HEPA 2PYEA 4HBCH 4ZJ9A 3UAJC 4OD3H 1N3NB 3KPNA 1YECL 1KCRL 3PAYA 5C2BL 3D2UA 4HUVA 5B8CB 3Q9PA 3RZWA 2AAAA 2BVUA 4JL1A 5DFWH 3H56A 1CXHA 3VFTA 2C3HA 4TPRH 4YFDB 2HJLA 1P7QD 3P2DA 4NKIH 3AS1A 3FFCE 2Y7QB 3NG5A 4WU7A 3PP4H 3ESOA 5AVQB 3KPSD 3NAAL 2EH8H 4AEEA 4M1CD 3BAKA 3ARFA 2CO6A 2NYZA 3R18A 1IIKA 1IEAB 4JHWH 3F6JA 3DSFL 1MF2L 3T3PE 5F7DA 5J56B 4PP2A 1T83A 2AJYH 2YA2A 3NSDA 4JPKL 2GSIA 2ZKMX 1UD2A 4E41D 1Z0MA 3MOQA 1QX1A 2C1PB 3CXFA 1F2QA 4PR5B 2Z92B 2X4QB 4ORGA 2XYCA 4MCZB 2XPGA 3PDOB 1C8QA 2W9EH 1IX2A 4TSBH 5IJCC 3L2MA 1DBML 4YLCA 5JO5A 4R84A 2Z7YA 3Q8EA 4N8CL 1ZTMA 4BFEA 1XZ0A 2P48B 1I9RL 1IIIA 3MBWB 3MLWL 5F71A 2I9TB 1BVLA 2WCPA 2VM4A 1FH5H 1U8OA 4LPCA 4M4RB 1OAYH 3S97C 2BFVH 1W2KT 2BPBA 2R69H 3P3TA 5EV7A 3RPIB 4LSVH 1TG8A 3DYPA 4YHNB 2A0LC 2IV9A 5KTEH 3HPJB 4WRLA 3RWFB 1EGJH 4RWYL 3HAEA 1OTTD 3KEHA 3NPSC 1KCWA 1S7RA 5BPPA 2H3XC 3IJSA 3ATDA 1SM3H 5CIPH 5DK2A 4BK4A 2AABH 1ZV9A 3PUUA 1LMIA 3H2QA 5FGBA 5FUZL 3P0YH 4PRIE 3RFRA 1MG2C 1CF1A 5DLML 3CBKB 5I73C 4WWKB 2YA1A 2VDQB 3S0PA 1Q0XH 4PW3A 2R1XA 5DHVH 1P6WA 3ULVL 5D72L 2OZ4L 4JFQB 2VXQA 3KGSA 2ICEB 1X9UA 1T2QL 1PFCA 2ZUUA 1QSFB 5EORH 4N5EC 3RP1A 3UC0L 4OV5A 2R23A 3NIGF 4ZMXA 1LO2H 2IADB 4Z7WA 4GXFA 1CS6A 1DL7L 2AXGB 4N3UA 5E0FA 3T65A 1NWPA 4XN2A 1R0AL 4M03A 2W80C 2EDJA 3BE1L 2IPUK 1MI5E 1S7QB 3QXAA 4XMKL 2P45B 3O3BB 2EAEA 5L4MA 1SN5A 2H1PL 2B3RA 4KWUA 4TQ8A 2L7UA 1SYVB 1V7NL 4NFCA 4E9SA 5HHVL 1UCTA 4HCGA 5DYOA 3EJYD 3SQBB 4Z76B 5J1AB 5D2LA 2IOOA 2K6ZA 2WHVA 4L8BA 3RGBA 1IM3D 3VNZA 2Y1ZA 3WNMA 3C5ZA 2BCKA 3QJVB 1A1OA 4HK0B 1RZKC 4JDVB 1JN6B 2J72A 3N85L 3X3FH 2BMKA 3SPJA 2OTUB 3GBDA 3UTPD 1MN4A 2WUBH 3Q5YA 2QBWA 2K6YA 4DAGL 5C0AD 4Q9CA 2EH7L 3L9YA 4H8UA 3KHQA 3LH2H 3EDEA 3L3KA 5GS0C 3ZKND 4FQ2L 1TJHH 4NRXA 3SOBH 5GGVH 4YS4A 3TVMD 1KCVL 2DM7A 2PTVA 3OR7A 3TWCH 4KI5F 2EKJA 4NM8L 4G6KH 3QULB 3TH2T 2Z31D 1T1YA 3BJLA 4HS6B 2AKRA 3BHBB 3NIDF 1G9NC 2BSDA 4B53A 1RZJL 1JHKL 4WI0B 3FB7B 3Q6FB 4GLRH 3V5DA 1BQLH 1ZDQA 3LS4L 3WJMA 3QZMA 4RA0C 1I3GH 1GA2A 4HZLA 2J8UB 2LU3A 2NY3B 2W59A 4R6UA 4G43A 4N1HB 4ODUA 4ODVH 5FV2A 4A1RA 3D69A 5JNYB 1WICA 3CSGA 3SDCC 5C08B 5HD8C 4FTVD 2EVFA 3NMEA 1BQHB 1NMBL 4UDUA 5GZOD 1F97A 5ICXA 3TBVA 4H1LH 4NSKA 1CE1H 3NBNA 1HWWA 3BO8A 3FU7A 4H25A 3P77A 1C16A 4QRPA 1MVFA 1NKRA 1RZ7H 4PCKA 4ATTA 1FCGA 3F8UB 3OZKA 2JKWA 3LXBA 2QJDA 1IKFH 3KPRB 1JWSA 5DEGB 1OOAA 4DHLA 2Q6WB 5AW9B 5ALCL 1MFBH 4JFEB 2BJML 4Y5YC 5CGMA 3TBTA 4GS7C 4Z7VB 3KBHE 5ISZB 3D33A 3FQRB 3GJFA 5HDBE 2WLIA 5F1IA 4ZW3A 2VXTL 2NR6A 3AJ7A 3O0RH 3DX6B 1ASPA 1BQUA 2P8MB 2UWEE 1TFPA 4TRPH 4FNQA 1QNZH 4QF1B 5D9SB 3UIYA 3W9DB 1CFQA 1Z66A 1OGTB 2OK0H 4M1GL 3MJ9L 4J1UA 5FO9A 2NR6D 3IJEB 3OAUH 4JGUA 4Y2DA 3G5ZA 3B2UD 1WGVA 5CZKA 2G3ZA 5DUMH 4G80A 3EOAA 4OQTH 4FEIA 5KYXB 5DU7A 2BDNL 4XPAH 2DJMA 4WHYG 3FOMB 3THMH 1I3RA 4Y2DD 5EU6B 1NLBH 4X7DC 3MCLH 4D2NA 5IW6A 3FSOA 2X0UA 4R96A 3SGDI 4F7EA 1JTOA 3US9A 3CHOA 4HK3N 4PLKC 5IB1B 3ORJA 3D39E 1CLZH 1GIGL 2Z0BA 5D7LB 3IVKA 1TTUA 1GW6A 1VZHA 4HCFA 4P05A 2PXYD 3QZNA 4YSSA 5ID0A 2BNUA 2E9BA 3K72B 4Y5XC 1HXKA 1DJYA 2QVKA 4LLDA 1GS6X 5EMYA 3GBEA 1EVTC 3CXHJ 4IKNA 1I8IA 1QO3B 1TTCA 2X1QA 1A9BB 1AP2A 1CGSL 4NZFA 3BAXA 2HKAA 2EIDA 25C8H 3T0EB 4BFOA 4LB8A 3DBSA 1KLGA 1ZS8A 2X9WA 3TJPA 3UBXG 5L2KD 3A0OA 4KMTL 1P4BH 4MB4A 2Q5BA 1SXSA 4OCXL 4XHJC 2VNCA 1ZVSA 3B9KA 4FXKC 4NCC1 4B60A 4BSVB 1NPUA 2PTTA 3QB7C 1GYVA 1BFOB 4TULL 1MFMA 1UURA 1W72A 2YUVA 2WLJA 3ZE1F 4IDJH 1XR8B 5D6DA 1FFQA 1NCNA 3AY2A 3H4HA 3V55A 1ODUA 4YHZL 2F5BL 1U8IB 3QIUD 4PJ8A 4KO9A 5I30L 3CUPB 4JDZB 2YKKA 5LG1A 3DETC 4M5TA 4KH2A 5A16B 1J87A 2WLHA 1KCKA 4EUPH 1QWUA 2GJ6B 3GINA 4GW4B 4MNGA 3FN9A 1P5UA 2HVKB 4KRMB 5KAQF 3H9SB 1EHKB 4KK5D 5DUJA 5JXAH 1AOHA 1Y1UA 3B8SA 3IDMA 5JIDA 2X4SB 3MV9E 3U6XS 3BUPA 4IJ3C 2WZPD 3S5LB 2J2ZA 3CSTA 4BE5A 2EUVA 3TBYA 3N44F 2PCPB 2P8LA 1K8IA 1T0OA 3HMWH 2VLKD 3UBXI 5EOTA 3VWKA 5IVXE 4M8QB 3QIWA 2VDMB 4LLAA 1M7IA 3WTUA 3L9RB 4Y19B 5JDSA 5GGSB 5I1DA 4K7PX 3EG9B 1JGUH 1UHVA 3NJJA 1CXEA 4P5MA 5ILTL 3HNTH 3QJZA 3ARDD 3LD8C 4P2RB 3RUGB 1VF5C 2X88A 1YPZA 2BS71 5DVOA 2FLBT 4ZNCD 4WO0A 3FONA 2VAAB 2K3TA 5AW0B 4LVNC 2Z1KA 4PJ5A 1MFDH 1UC6A 3X14A 4K2UL 5GRZA 2FJGB 3FT3A 4OH2A 3S36H 4PP1C 5I9QB 3HPLB 3ILEA 2FWOB 1PSKH 4HLZG 3S98A 1C8PA 4FZEL 4X6CB 2DMBA 6PCYA 2EUXA 4OW6A 4K5LA 5C0CB 3D4CA 4NKMB 3GBNL 3MV7A 4JJ5B 5C7XL 2WWOA 4X6BA 5IBTL 1CVRA 3Q9QA 1MJUH 3UX9B 3EYQC 5IV2A 1SEQL 2FEEL 2FK9A 3JV6A 2PWGA 3ARPA 1BQKA 1GY1A 4XVOA 3QRGH 3B9VA 2H2PC 4IBWA 3VI3F 2IXQA 4I3RL 2F7IA 1IBYA 4Y4KA 1KJVA 3QXWA 1J1PH 1WBYB 3ILDA 2F54E 3QUKA 1T0PB 2Z9TA 4ZYKA 1WFJA 2BSED 1VEMA 4WSGA 3B7SA 1ZAGA 1Y0LA 2WWMD 4Z0XB 3RKDC 3KPNB 1NGYA 4HUVB 4NAMA 3O4LA 5I1HL 1EXHA 1P7QB 3G08B 4M43L 4CJ1A 4GBXD 3QYNA 2CRIA 3QUXD 3VFTB 1BD2A 4WO4A 3KPSB 2V0AA 2WCSA 3E0GA 1T3FA 2BINA 3GSNH 2LVEA 4WU7B 3LQZB 4U6VH 3QUZD 3GRWA 1JGLH 3WO4C 4RGMC 1QBML 4WO4D 2YKLL 4GAYB 5KSAD 4OZIB 5C0BD 3U9WA 3ARFB 4Q97A 2CO6B 3OWEA 3L7FB 2WP3O 1ZANH 1KN4L 5GSRA 1AR1D 4MFHA 4E41B 1KLFB 4O5LL 5F7DB 1FI8C 5A7BA 4OGXL 3KXFA 4JB9H 3SKJH 1QLEH 3QDME 3ZHNA 5FO8A 4X8XA 3ROLA 2GSIB 2B4CH 3GB7A 3IRZA 3MRKA 4FQXD 4YHPA 3SKNB 4NIKB 5KVDH 1A4KB 1T20A 2WW8A 4HDIA 4B3VA 2HVJA 4W9LC 1KB5H 2LFGA 4X7SL 3NTCL 3V4LA 1AXSA 2XQBL 3GTVA 2OAAA 5FHAH 3IU4H 1H0DA 1D3CA 4LF3A 1DJWA 5I2IB 1DBKH 2F5AL 4PBDA 1XZ0B 3TNNA 5B1CA 4U7KA 5F3FA 2P26A 1S46A 3LPPA 5HPOA 2AK1H 5BZDA 2HWZL 3C08L 1BVLB 3AQZA 3LZFL 2Y7LA 1XGQA 2XWEA 4LL1A 5IREA 1G7PA 2V17H 4JFFE 1T5XA 4WEEA 4WNQA 5TFSL 4U1JA 1YYCA 2DQFB 2NYKA 1MNUL 2DRUA 2VL4A 1NIDA 2MPVA 3KWVA 3UP6A 3MV8A 2EUWA 4QHPA 3BP6B 4XNAA 4EBQL 3HAEB 2XV3A 1TJGL 4JQIA 2KZWA 4K7PL 5E9AA 1JGVH 4CDHA 3MR9A 5DK2B 5MENE 5C6TH 2DOCA 3NYKA 1T5WB 1D5MA 3HE6D 3O6FC 4NHCL 4FFWC 3AAZA 2BFGA 1AZNA 1WDAA 3QK0A 1QBAA 2R1XB 2RFXB 4JRXE 4XZUB 3HE7A 5L88H 3S37H 2UZYA 5E5MA 2Y6SC 2ZOOA 1RULH 5I16A 2DLEA 6PAZA 3U4BL 4OV5B 5A6MA 1CLYH 1HDMB 2DQJL 2R23B 3PY9A 4Z7WB 2G2RA 1QHPA 3HE7D 5EC1B 2UYLB 4O5LH 5E8NB 4DZBB 5I6PA 5E6YA 3VI3A 3V4VA 4KQ3H 1GY2A 5CN3A 1RFDL 3QXAB 1T1XA 5DRXA 1N8OE 2VR7A 4KTEH 4ADGA 3OB0K 4Z77A 4KK9C 1IM3B 2KL6A 2Y3AA 3ZDYB 2FT6A 4GMSL 5D2LB 1RK0B 4HWUA 2EICA 5LWYH 3B9EA 1MAKA 5IHBA 2MCG1 4B97A 4ZBJA 5FYKH 3C5ZB 2BCKB 2PLTA 3GS4A 2E9GA 1A1OB 3FL7A 5GRWA 2ZX8A 5C0AB 2UXGA 1A2YA 4WU5A 1A6VH 1P4IH 1ETJA 2VDQH 4KDTC 2ZXDA 1FNLA 2GVYA 3T4AC 2FBRA 5IHWA 5MP6L 1ECZA 1QRND 4P48A 3S3JA 5EIIG 1HJCA 4R3SA 5TPWH 2ZUSA 1A21A 3RWJA 4H5SA 1KYOJ 5EIQA 1CGYA 4NRXB 1RP8A 5DMYA 2EXYC 2AK4E 3MLSH 2CE6A 4ZXBD 1NEZG 2FWSA 3OR7B 1G7LA 1VESA 2D8KA 3BISA 2WQVA 5KVEL 1T1YB 4QD2E 4RMVA 1DUZA 3HI6L 1EQWA 1LHZA 3ZDZF 5DTFB 3ULVE 5HPMA 2COQA 3ATAA 2ROXA 3D30A 1F1DA 3FXIC 2AQ2A 1SRDA 3L2NA 4WY7L 2WZAA 4X9HA 4EVNA 3WJMB 4F8QA 1JGDB 3S34H 2XI9A 2DTMH 1I9IL 2QQKH 3II3A 2HT2D 4O58L 3BZEA 1CIUA 1WH0A 4HAKA 4W6XB 4G43B 3JVFC 4ODUB 1NBVL 4B0MB 1O7VA 4HJ0D 2JV6A 3N41B 3ARTA 4WTQA 4QHKI 3A4FA 1C5DB 4OSUH 2O26U 3WD5L 1DQDL 3LMJL 4I3SH 4UDUB 4X4YB 5ICXB 3TBVB 1X5JA 2C3GA 7TAAA 1P7HL 4I4WB 4NSKB 4AQ8A 3BO8B 3FU7B 3P77B 3VXSD 1C16B 1BXXA 3BOVA 3QP3A 2AQ1A 3NPZB 4HIHA 3LHPL 4JVUA 4F5CA 2EDMA 3H0TA 5E2UH 4JHAL 2VLRE 3KBFA 5D4HA 3MJGX 4QTFA 1UEYA 5F7MC 1GPOH 3UIZA 5ES4B 1YEGL 3LSOA 1FV1A 1VLXA 3AG2B 4IRZH 1Z1WA 3TBTB 4G7VH 3GJFB 1GGIL 2WLIB 2Y5EA 4N2LA 1BM3L 4P5TA 4ZT1A 2M26A 1ASOA 4Y1AD 3KH4A 4NUGH 3QE5A 3ZE0B 5JW3L 35C8H 5J12C 1LYQA 4YEEA 1IBZA 2VSDA 4PJ6A 1Z3GH 1CFBA 4Y4FA 4P5TD 3F00A 4J1UB 1WT5C 1RJYA 3NACH 4PGDA 5FO9B 1JERA 4Y2DB 1T4WA 3G5ZB 5HI4C 4APQC 1BA9A 2DWXA 2A6IB 1LO4H 1RJCA 1PEWA 2ARWA 4G59C 4UMSA 4S10A 4Y4FD 4G80B 3DROA 5ADOH 4I2XB 1O6SA 4QRRA 1T66C 4AQAB 3VMOA 1ET5A 2VLLB 5C0RL 2J7LA 1ZLSL 3AT0A 5IW6B 4R0LA 1ZK9A 5LBSH 2KZKA 4R96B 5D93C 5GRVK 3W11D 4F7EB 5T1LA 2PXYB 3EBIA 3OL2A 2IAMA 4JRYD 5AWNL 5I1EL 4MNQA 4HH8A 2UVFA 4ODHL 1X5LA 2CA4A 1N0XL 2R59A 4M48H 1GGBL 3F62A 4BEIA 2X7LB 4PGJA 2XA3A 2OXGB 1D7DA 2CU9A 5KVMC 2IAMD 4YR6A 5T3ZH 1OSZA 3VI4A 3OC5A 2EC8A 3NJMA 1DDTA 4U1SB 3F7VA 2W60A 2PYFA 1R3HB 5C07D 4LLDB 4UTAA 2LU7A 1KCSH 1BZEA 2OJEB 4UV4L 1KPVB 3GTTA 1I8IB 1QASA 3NFNB 5L2KB 2FGZA 4HWBA 4R5TA 2E7CA 1FZMA 2CJTA 5FOBA 5E2WH 1KLGB 1ZS8B 4NN5B 4J2XA 3Q2CA 3EJZC 4GG6B 4ZMQA 5F6IB 4XP6L 3CBJB 3RGHA 1P4LA 3BVTA 1FVDB 2QKIB 2VLMD 1ZVSB 3B9KB 3O45A 3Q1SH 3TBSA 2DPKA 2PTTB 3QIUB 3DHMA 5FYJD 1N68A 4MAYA 5AW6B 5FXCH 5I74B 5HI5D 5KVFL 3JT0A 5DZAA 1NMAL 2CJUH 2NY6C 5ERWA 3ASWA 5AAWC 1B6UA 2X1PA 3HN3A 1UQSA 4R8WH 5EBWA 5EOCL 2AP2A 3GSOA 4K7FA 2X9XA 1MCPL 2YBGA 3MRFB 4IOIA 2OL3L 4LNVA 5D1ZD 3AXLA 5BV7H 5CMAA 2AJZB 5HJ3A 1V3MA 3T1FA 4GY4A 4LSQH 5E5UB 4B0MM 4QI3A 3MGAA 4RX4D 4XP9L 3ZE2E 3IMSA 3RY6A 3IDMB 1X5FA 2VLKB 4JM2F 4ZMWA 3BD5A 3LEXA 4JFZH 4K0OA 2VRQA 3RHWF 5D7IF 1IZKA 1U8CB 3TBYB 4PRPD 5F9OH 1OPGL 1MCOH 2P8LB 5DR5H 3CPLA 3ARDB 1OAJA 4MZ2A 4KTDH 4ENZA 1KWKA 1M7IB 4JVWA 2A6KA 5JDSB 5I1DB 1AZVA 3I02B 3NH7H 4LPVA 4P5MB 3GNMH 4AK2A 5BJTA 4ONFL 5F3BA 5AKRA 5LKNA 2XXCB 1QTPA 4C57C 1PX3A 3FONB 5HXMA 3F7QA 2XHNA 5AVVB 3HG3A 2J56A 3X14B 4BA0A 5AG9A 1YQVL 1HAUA 3FT3B 3AREA 3I50H 4G6AC 1JL8A 3EJJX 4HJJL 2BNQD 4L29B 3NK3A 2DI7A 4JDEB 2J20A 3ZUNC 5KYWA 4TVPL 1NINA 3MUGA 1H3UA 3GXDA 1UB5B 1F3RB 5KUMA 2UY7B 2CHXA 4MRCA 2N1TE 5D2NA 3V52H 3S4SG 5J6SA 3JV6B 1BZ9A 2ENPA 1B2WH 5GHWL 3QDGD 1W15A 4GFXA 1V3KA 2ZOTA 4M5ZL 5EOCH 4WHCA 2IXQB 5CSZB 2APBA 2MWCA 3CHPA 4G5ZH 1RZQA 4RLDA 3VG9C 2VMEA 1VB9A 4C56E 2VDMH 4BSWA 1NOAA 2VSCA 3QORD 5SWZD 5F1NB 1BMZA 3BAYA 2K9FB 1YEIL 1EFQA 4GBXB 3RL2B 2DQEL 1Y0LB 3QUXB 1HKFA 4IBSA 4DWHA 1NGYB 2ICCA 2WM0A 4CC0A 2A9DA 1UJ3A 3L9BA 4Q6KA 4YBQD 3TO4A 5FK9A 3QH3A 5GQBA 3QUZB 4WO4B 4G6FD 2DQTH 3W9EA 2Z64C 5C0BB 4DKFH 4EDWH 5F89A 1T3FB 5TH2B 1NCOA 4UBDC 4PRNA 2B5IB 2QMJA 2X9YA 3PNWA 1AR1B 2W38A 2EE9A 4N0RA 3KYNA 1U33A 1UXLA 5C0ND 3VFRA 4LHUG 4RDQF 1KBKA 3VSVA 1T6WA 1ZHNA 4WTZA 3R4RA 5GSRB 3BLKA 4ZW6A 2A38A 3OMZA 2MSPA 5CKGA 5FM5M 3KXFB 3N9GH 4M9PA 3K4DA 4K4KA 2HJKA 4UT7L 1PNCA 3GB7B 2IWEA 4J8RA 2JI2A 3MRKB 1A3RL 2EO9A 2V33A 2HUHA 3ZUCA 2VB5A 1ZE3H 4HDIB 2HVJB 5KJ4A 3ZL4H 5AZ2H 3IE4A 3QEHA 1GJIA 4HWEL 1T03H 3C60D 1H0DB 3FYEB 1IJ9A 2E59A 2XXMB 2E47A 4LF3B 5JIMA 4IGBC 5FM4A 2VUKA 3DIFA 3TV3H 1P9MA 5FO7A 5BZDB 3WJJA 1T2JA 1NIBA 3F3HA 2G5BB 5D5MB 5LGHH 3V4UL 1G7PB 1T5XB 4CVXA 2XWDA 1F4YL 1RKRA 3RDTD 3WHXA 4ALAC 4YSCA 4JFXB 3NA9H 1SNRA 3MV8B 2ZP9A 5HGAA 4L8CA 3JV4A 2VXQL 1IAKA 1ERNA 1HZHL 1KBGH 3AADB 3SDDC 5CINH 2WQWA 2JJTA 4MS8D 4BRJA 1HINL 3HI5L 3MR9B 3U7YH 4X99A 1W8EA 3ZTCC 3ABMB 2Y07L 1QEXA 3SE9H 5G2NA 4A63A 3K1KC 1ZY9A 2H8PB 3FS9A 2J1KA 2TAAA 1ZT4B 4GW1A 4KK8C 4XBPA 3SD2A 3HE7B 2E74C 3RWDA 2UZYB 1XXDC 4XPBL 5E5MB 4Z0BL 2SODB 1MSPA 4XAKE 5I16B 2F8XC 1GW0A 4XMPL 2IJ0C 2G2RB 1MFCH 4A38A 1T6VN 3B5HA 5AAPA 2J8UF 5HHOA 1BGXL 1A7PH 1Z9SA 4QAMB 4RQQB 1UACL 4RCAA 1JFHA 3RVUD 1FUNA 4J27A 3VAEA 1T1XB 3GLDA 5HHOD 2JKRM 3GHEL 1Q38A 5T3XL 2L0DA 4Z77B 4WUKL 3PE9A 3ZPDA 3QQ9D 3OB8A 2ZXWB 1FN4A 1VERA 3X1GA 1OP5K 4U1HB 3FMGH 4J3OD 4NS0A 1WA2X 2QVTA 2VZOA 3UGUA 5I1CH 2YMXH 1VGEL 5BRZA 4HULB 3BSZH 4BKLA 1QRNB 2DM4A 4PIBA 4WU5B 1A2YB 2GPZA 2Q2EB 3CFNA 4YL4A 1F4YH 2ESVE 3T77A 2HG5A 3VTAA 2EYSB 1I7UB 3I6LE 4LDLB 4UM9D 4AE1A 3DURA 2ZUXA 3RWJB 3I85A 3POCA 3FQYA 3WIHH 4NC2B 1NA8A 4DKTA 4N2IA 2F18A 4G42A 3L95A 4WJKB 4WLCA 4EF3A 1G7LB 1S9WA 5FB8A 4PJCF 4K8RD 4PJ9A 1JZHA 1WGOA 5C7ZA 3BP4B 1O9VA 4AOFA 1TMCB 3RWCA 3UMTA 2KLTA 1SUJA 4WF7A 3EGDB 4IU2A 5HPMB 3ARYA 1PFOA 5JXEA 4AENA 3BAIA 2I9LA 5AYUL 5JZ7C 2KYIA 5TF0A 5A2FA 1N59A 1BVNT 4EKJA 1EAQA 1XGYH 2AI0H 3LQMA 3M86A 4AL8L 2X4UB 3U7WH 4HSAC 1KTDA 1ZTXL 5E1AA 3ARGC 3MNZA 1D9KC 1U6AL 2B0SH 3WUWA 2BZ7A 5DD1H 4ZDHA 3MBEC 1TITA 2XDHA 5CEXA 1RUKH 4YMPA 3EO0A 3IFNH 2N7SA 4LMQE 2DLFL 3QJUB 4YFLF 4WI4A 3VXSB 1G6RA 3CMGA 1KGWA 4YBLC 1X5GA 2ZUVA 2G60H 1FVEB 2Q8AH 1JSYA 1D6VH 3MNVA 3MLTA 4MWFB 5E4AA 3UZVA 1NMCB 4ONOA 1U8KA 3EOTL 2A6JB 5B4MC 4G1MA 5EF1A 1N10A 1CJYA 1T5KA 3O9WA 4JFSA 4G6MH 4TL5A 2IDQA 4J39A 2EACA 1EH9A 1MQKL 4CMMB 1CURA 4WI6A 1QI3A 5I1JH 2IGLA 1BFTA 2CXKA 4M3KB 1U8HA 3NJVA 4BINA 5I15H 1RZ8A 5IVZA 3F04A 4HXAL 3I9AA 3O8XA 4NQEA 1UXMA 5J0BA 4P5TB 1OHQA 1KNOA 3QUGA 3K3QA 3Q43A 1GS7A 3P3UA 4GSXA 5C9JB 1NANH 1NIAA 2VGLM 4FXGA 1D5RA 2UZIH 2YK1L 4Y4FB 3IDUA 3UYRH 4NC1C 3V5HA 4PGDB 1RJYB 2MFNA 1EEYB 1TSRA 4Z9KB 3FHAA 5KVEE 1PJWA 1S78C 3L3DB 1OT2A 5C08E 4JM4H 3TFBA 2RR3A 3DROB 1TQSA 4JRYB 4QRRB 2ZSWB 2O5NA 1NFIA 1EJFA 3IGLA 3IDJA 4R0LB 3GIVA 2QR0A 1JDDA 3ILQC 3V4PH 2R0KH 5T1LB 4JAMA 1XCQA 2IAMB 4RMRA 4MNQB 3LXUX 3FCBA 3TZVC 3GMQA 2ERJC 3ZTDC 1CFSB 4R90L 4DFHA 2Z8RA 3RE0A 3WKML 4LCWA 3ULUD 5JR1H 2AV1A 4YR6B 1CR9H 4IRSA 3MV11 3VI4B 5H37A 2ITFA 4NYLA 4IMKA 2J1XA 4Z7VE 3QUYC 4M7KH 4G9FA 2W60B 5ISZE 1XZWA 1JZ4A 1FIGL 1JFQL 1MW0A 2YAMA 1P2CB 4Y16A 4YUEH 1I7RA 3WN5A 1W72L 4KV5F 3S3CB 1AQDA 2D3LA 5LAXA 3BQUA 3V0HA 1E5ZA 4RZKA 3W2DL 2FAUA 1FZMB 4LSUH 1TYJA 1DE4A 4PJCA 1BEXA 2GTQA 1TTFA 4HF5L 3SE3A 5KSUB 3ZKXC 1MQKH 5IW3A 1FZOA 1P4LB 1UCBH 3Q3GA 3NCWA 4UDTB 3TBSB 4HC1A 2WD0A 1MHCA 3P30L 4MAYB 4E5XA 4UILH 4LVHC 5IVOA 5FR3A 3JWOH 3MRJB 4PS4H 1OM3L 1D5XA 3WFEH 5D1ZB 1KC5H 1A1MB 1YNKH 5D7LE 3P0VL 5TGBA 4BELD 5EBWB 3AG3B 3P4NA 2VJ0A 5EF0A 2VDOH 2ATAA 3BRGC 3AXLB 4HW6A 5CMAB 2X1XR 5HJ3B 3T1FB 4B96A 4BZ2A 5LXVA 5CUSL 4PRPB 2AC0A 3A6BH 5E23A 4Q7DA 2WNGA 3PWVA 4RDBA 4CNIA 1RLBA 4P23C 3ZTNL 3M7OA 3EYSH 1GKEA 4KMLB 3DXAE 1BF5A 2OV0A 3CPLB 1WO2A 1G7QA 5BVJA 1X3DA 1VFAA 1ETB1 4IHOA 5BS0A 2A6KB 3BEWB 1KENL 1ORQB 5EA0H 5CP7A 3MRDA 4YGVA 1BIHA 1T04A 4B50A 4OZIF 4N24A 4F8LA 2RAMA 1WS8A 2N3JA 3F7PC 3TFKD 3EJPA 3KR3L 5E08L 4H44C 4DVBB 4CC4A 1NKGA 1UM5H 3CAFA 4ZOCA 1NWOA 2FQFA 1CICD 1D7BA 4MJ6A 1LE9A 4RISH 4UQDA 5KYWB 3HRZC 3L6FA 3OZLA 1CPUA 4HU2A 3HKZA 4KY1L 3PL6D 2CHZA 3H9SE 4FS0A 4XX1G 3WFHA 4V2BA 1YEDA 3O6ML 5KVFE 1UH3A 4YDNA 4LEXL 5D2NB 3DOSB 3P3SA 4DETA 3VFWA 3GHBL 3O3EA 3KBEA 5ESVA 1QHOA 1SJMA 1EHXA 5EUKA 5SWZB 1AACA 2A4EA 4LSTL 4MMZC 1N67A 4I77L 4OCRL 1OQOA 5EFIA 1W80A 2BIQA 4N90D 1E4WH 1SQ2N 4GKOA 2QHRL 1BECA 3GRWL 1BF8A 2OPCA 2CO4A 4P2RE 2YZ1A 5FO2A 3RUGE 5I71B 3VGBA 1HIMH 4Q4EA 4G6FB 4LOVA 4OCYH 1I75A 3APDA 1FYTA 1UJ3B 5GZNC 2ZUQB 4AVIA 1MWOA 3TO4B 1QUNA 1X5AA 4JRLA 1Y18A 1HESA 2PW2B 3CSFA 3WS3B 3W9EB 3I2CH 1AANA 2O5XL 4X6CE 4DCQB 3TPKA 5J9PA 5C0CE 1KENH 3C8DA 2DI8A 3O2WH 4ELKB 5D71H 1EJOH 4UU9A 5TE4L 1U2HA 3DPBA 1KELL 2CDEB 1ZHNB 1QFUL 1J18A 4ZUUB 4OLXL 3X11B 1RUAL 4B7IA 4X8GA 3VE0A 2CBQA 3HMXA 3D85A 4UOZA 5AOZA 2MQ3A 5CP3A 4X7EC 5MI0C 4PYGA 1DVSA 4PI0A 4TVPE 2IH9A 4A7QA 3C60B 3QG7H 5CR1A 3C6LC 2VXUL 3T71A 2WUCL 4AY0A 2NXZD 1Z9LA 1BQ5A 2JCCF 4R7DA 1QSEA 3BPNC 4Q6IC 3ESPA 2PYEE 4LDCA 3QQDA 3QEHB 2VOTA 4AK1A 3UZEA 4DVRH 1BEYL 3SODB 4JQIL 3ETBF 4OAWA 3H3PL 4UM8A 1T83C 4AKPA 1ACCA 1JMZA 3RDTB 4NP9A 2QFRA 2BXYA 1Y07A 4DT2A 3OM3B 1NSNL 3BDBA 1IGTA 1XIWC 5DCCA 1MRCL 5E95B 3VA6A 4PGZA 1BBJA 1HOEA 4XNDA 1L9OA 1BDYA 1XVSA 4CVXB 1H9DA 3FFOA 1YEJL 1NM9A 3WHXB 4JFHE 3NFSL 6CGTA 3RZCC 5HGAB 1GYWA 1YJDH 3JV4B 4ZUWA 3U30B 1IAKB 3DGCR 4EIUA 1M1XB 3EZ8A 1BVKB 1RUMH 3K0WA 3SIKA 3LRSA 3FTYA 2YARA 3APCA 4X99B 3QQXA 3HR6A 1EO7A 3V4VL 1OF0A 5AB1A 4L9DA 2W94A 1XX9C 5JPMA 2JKJA 3V0DA 4P59L 4GIPD 4F7MA 2H6PA 1EVUA 2R4SH 4WCYH 2YMOA 4XBPB 3ZGHA 1SN0A 3AITA 3TEZA 5BVPH 3P4OA 3WNOA 3LKOA 3EUDA 4PQXA 1ROWA 1FFRA 3GPEA 5IT2L 3T8XA 2AHIA 1AG0A 4IOSD 4WW2A 3PHSA 5HHOB 1K4DA 5F7YC 3WGUB 4QXGL 5JOPE 5TE6H 2VE6B 4K5OA 1Z9SB 5JHAA 3E2HB 3JQOB 3ARUA 4W9IC 2L4OA 4ZMOA 4FN0A 3VRLE 1FPTH 4ANUA 5L0QB 4JKMA 4NEHB 4H88H 2F1BA 2OW6A 4NGHL 4D7BA 4JE4B 4NRZB 1A1NA 4KMQA 2QVMA 3QDJD 1FN4B 2O1AA 3Q8CA 4JUSA 3V7AG 4CSZA 3QAZB 3QPQC 3UPRA 1ACZA 2BY0A 3WS6A 2HMIC 3AG4B 3DECA 5DQ9B 2D0FA 3TP4A 2GTWA 4H2AA 4O51A 3O2VH 4NAQA 3QFJA 4BKLB 1CFNA 1VKXA 2YSSA 2WNXA 4QOKA 3Q7JA 2VERA 5DD5L 4U4BA 5F1OB 3SGJA 3G04A 4U33A 3LNEA 1DVQA 2FR4B 4XC1H 3MZGB 2MEJB 5AOKA 3WAKA 3Q06A 1NH6A 4KNQA 3DURB 4FQCH 2AGJL 4XWOD 4Z7WE 5CILH 1HL9A 2F19L 1GMIA 4LLQA 1S9WB 5FB8B 3HG5A 5E99H 2F58H 5JHDA 3ARVA 4D0CB 1YNLL 2WSDA 1LEKB 3RVVD 3KWTA 1BZ8A 4FZ8H 4IU2B 4GI9A 1ZT7B 2B08A 1KEMH 3CHSA 3EYUH 3AT8A 2K3HA 1CN4A 3UTZA 3AS2A 1RH8A 3BIBX 1N5AA 2VN5A 3ZDYE 4AH2A 4CMHB 4DP4X 1N59B 4ZAKC 4MA1B 4NQDA 2Y69B 3MKKA 4BQ9A 4HOZA 1KTDB 1YY9D 1D5ZA 4ZDHB 5AW4B 5CEXB 3MV01 2PW1A 4QO1A 5E6IC 2JTYA 2DM2A 4DP5X 3DGGA 3VXNA 1T7WA 2C9PA 1OK0A 5T3XE 2LLNA 4NNPH 2BSTA 2E7BA 3O41A 2APVA 2OYPA 5F70A 3MNVB 3UZVB 2HH0H 1I7ZB 1UWXK 2VDLL 3MOBH 12E8L 4WGWB 1U8KB 8FABA 4XCNA 1OVZA 5JHLA 3ECBA 4XX5A 1PZBA 3O9WB 2J73A 3N5AA 3QWRD 1KGCD 4HUKB 3G6JF 3W0WA 3NGBC 5IIEA 1FGVL 1UGKA 5AZEH 5IUCA 1TZAA 1IEBA 4GG6F 5IK3A 1U8HB 4XCFH 4L8SC 1JRHH 3IAPA 5IVZB 1PD0A 3CFJA 2FJHA 2ZKHL 2DKUA 4FYQA 5GXBB 1PPIA 2UZPA 4G7SB 4NQEB 43CAB 1LO3H 2VDPL 1G1OA 4N0CD 4ILDA 1I9EA 2PMZA 3KJ4B 3EYVB 3GO1H 3V6FA 4BCYA 5CFHA 4BDVA 4FXGB 2ADIB 5D8JL 4AX3A 4PJBF 5I1LA 3AU1B 1XEUA 4FQPA 3NJKA 3W5MA 2CWRA 1XT5A 2R4RL 3UJIL 3E9UA 3MRGA 1SDYA 2ZX5A 4HCIA 3TJHC 2IQAA 2ORBH 4MSWB 4P9HH 2G3NA 2J55A 2HTLD 3AWEA 3P2BA 4M7LH 5ANMB 4UTAL 1NGPH 5LDSA 2HTKC 1NFIB 3IDJB 5EBLA 3GIVB 2Q1EA 4QRPE 2KI6A 1GZHC 2B14A 1N6QL 2IDFA 3GMMA 4HWBL 1HILA 1ZTXE 1DJXA 2ENJA 2EYRA 2KQNA 1PZ5B 4RBPH 5PAZA 2WCGA 3TC9A 4OBSA 4XNUL 5CEYB 3QJFB 4F8PA 2Y72A 4IJTA 1ZDSA 2MTPA 4PG2C 5FFOA 1AD0A 3N40F 4P5KA 1J0JA 4W9EC 4YN3A 3SEPA 4G9FB 5LGKA 2R27A 3DOIA 3JWNE 3ARRA 2ZG2A 4MQXD 2EVIA 4Y16B 3L3OC 5KJRL 1N26A 3QYCA 2BVYA 3WN5B 4TTGA 1EMTL 1A7RH 2IC2A 4Z7QF 4A2LA 1AQDB 4HIXL 3NIGE 3ZE0E 4ZTPH 1RU9L 1FNFA 2EIZB 4HBQA 3WDHA 3LZPA 2OCFD 3V0WH 1DE4B 5E0QA 5FW6A 3RYMA 4HKJA 1DFXA 1F4XH 3K6DA 4M6OL 3VX0A 1FZOB 1MZZA 3PV6B 2EO7A 3X1EA 1SBBA 1QI5A 2LE9A 3Q3GB 4AJYV 4X9IA 3DNKA 4PVBA 2D4FA 1J8RA 4A37A 5AKTA 3VXTB 4WWPA 1MHCB 4DFIA 4YHML 3TONA 1VEPA 1NGWA 5FA4A 1I3UA 2NQCA 1OY3B 2F8IA 3EHBD 3UBXA 5FPIA 3QQNA 4KGJA 4LSSH 1D5XB 1BVZA 3D52A 3NQKA 2OMUB 4G7YH 2DEWX 3FUKA 5TGBB 3SCMC 1MFAH 4KI5C 1A7QL 2WO3B 2DLHA 2XN9A 4PY8I 4TNVK 4Y8AA 4KROD 5IHLB 1G7JA 3PDDA 3ZO0A 4QT5A 5L4IA 4JHZA 1LDPL 2DYSB 4G8AC 4S1DD 1W91A 4Q89A 4DO6A 1VGKA 3RB5A 4Z5RB 3T3MB 3PWVB 3AVEA 5GRJH 3X1BA 2QSVA 3BKMH 2C7FA 3MTXA 4FXLA 3O2DH 3S37X 4D9QD 5ICUA 4ZRGA 5L8LB 5A2CA 1G7QB 5BVJB 4ELMB 5KBPA 1VFAB 3RGVC 3W5NA 3LKNA 1CI5A 5BS0B 3RX7A 1M05B 2FB4L 3LN9A 5FYJH 4F3FA 4XN5A 5CP7B 1OGSA 3MRDB 4YGVB 1KMGA 3N42B 1LK2A 1T04B 5JLZB 2XVBA 4P2AA 2FX8H 5LHDA 4HGWA 1DTUA 2EKSA 2RCSH 4OCMC 3QWOA 4DN4H 3RDJA 3HBGA 4S1RH 4AQ1A 1DQQA 3CX5K 2L04A 4NNXA 2MPAH 4U6XA 2WKOF 1E43A 3PL6B 4D94A 3VWKC 1LE9B 4AYMC 2MHAA 2XRAH 3MLYL 4MNGE 2GTZA 3L6FB 3BKYL 4NHUB 5MHSE 1KTRL 3BAEL 2HFTA 2I60L 3BZDA 3QCTL 2BHUA 4LU5L 4G3YL 3LQAL 1YEDB 1R3LA 1VHPA 2KMWA 1W9XA 2G4EA 1JF1B 4F58H 2OR9H 3TXAA 2AEOA 4U7SA 3VFWB 3GUTA 4I18C 2CIIA 2CNZA 3O3EB 4JO4L 4NUJB 4XCCH 2JELH 3CJJA 5EUKB 1CTOA 2P49B 1AXIB 2CG9X 3QVAA 4KXCA 2GABA 3H42L 1SF5A 5TJWK 3RL1B 5ID1A 1E2VA 2WNKA 1MHPL 3F12A 1DBBL 4KKLC 2JXMB 4H8VA 1T1ZA 3MNWA 4YHIA 1M6OA 1HL8A 3FO1B 2FRGP 5H8DA 4NOFA 3DHPA 1HNFA 1QQDA 5F7AA 3QHTC 1YPZE 1MIMH 1H3XA 1U42A 4U2YA 4YE4L 1I1AC 1O7DE 3MACL 5D1QD 2ZX7A 1K5WA 1FYTB 4PJ5E 2CJ3A 5LCVA 1QUNB 3OKMA 1I8KB 1RIUH 1Y18B 2NY5L 4XTRC 1AXTH 4X2UA 1X5KA 3ET9F 4R2GC 2FWLB 1X5IA 2MKLC 4PLJD 3BUQA 4JFPA 4NQCA 4OF6A 3MV7E 2XZZA 4RGND 4OUOA 1IKNA 5GGTH 4BHUI 4IS6A 5JQ6H 2V2TA 1HI6B 3DPBB 2K7PA 3MRNA 3NZ8A 4ZD3L 3VACA 3O3AA 4KK6C 3A67L 3IF1B 4XXWC 1NPNA 1XF5A 3M1OA 4XP5L 4PBWD 4C58B 2VZTA 3VE0B 5E2TL 4UQAA 4X0KA 3D85B 2NXZB 5DMGC 1OT4A 3DTXB 4H4NA 4BSJA 2A83A 5E5LA 4F57L 3X12A 2P43B 2AJVH 3CDFA 4OGAD 4YSEA 4KHTL 5KSBF 4R7DB 3A23A 1JWUA 3U2SA 4TUKH 3QQDB 1YHPA 4YSRA 1TLKA 1DO6A 4MDJB 3RJDA 3DJTA 1CGXA 5DA4A 3RTQC 4BQ6A 3GI8L 5T1DL 5IQ9B 3QG6A 1K72A 1ET8A 2XCMC 3FYIB 1TZOA 3O4LE 1IAIM 2CHNA 4OAWB 3NIFF 4UM8B 4AUUA 1BYOA 5TQ0L 1N8ZA 4U0RB 3EO9H 1KGUA 2FO1A 5IMKB 1BD2E 3D12B 3QNYA 4K94L 3UO1H 3DX9B 1IGTB 4KXZI 4PGCB 1BBJB 4EKXA 2C4FU 3G9AB 2FX9H 3NN8B 4UQ2A 1DBBH 4NJAL 4AGPA 3D9AL 4DGYL 1U3JA 5IHHA 3DWTA 1F6FB 2EEXA 2VDRL 2ZQKA 4XPHL 4DEWA 4NB7A 2PO6D 4ZUWB 3D18A 1EXGA 1DO5A 2Q3ZA 3ZL2A 4QUOA 4GNKB 1YEHH 2JB5H 2MQCA 3LRSB 2IG2H 3KXFE 3UYOD 3DRTA 3VYPA 1IC4H 4TLUA 3OKNA 2QLYA 3CU7A 4AI7A 3C5SB 2Q8BL 4AYSA 4HUWB 3DMMC 7PCYA 2OSWA 3MRHA 4XI5D 4F7MB 1S9YA 2VMFA 3P4OB 5ESAB 2P80A 4MKMA 1V27A 2BVQB 3GIZL 3S35H 3ZT5A 3CWGA 4ONGH 3E80A 5IMMA 3FQ1A 5H4ZA 1KIRA 3F7RA 3T8XB 3UAAA 3QI9D 2EDHA 4WW2B 4S2SA 1MCKA 4RMUA 4JKNA 1RURL 1L9NA 3I9PA 3OJDA 4OLWL 2BHYA 4X5WB 4DPAX 1E9OA 1ZIAA 2ZWZA 3MO1A 1T7ZA 4ZX3A 3MV8E 2DN7A 1JOIA 2PR4L 4J4PC 3B6SA 3EDJA 1A1NB 5BRQA 1MCHA 2JQMA 2ZAIA 2ZCKL 1DUYA 4BFBD 1H5BB 4UZGA 5IQ7L 2XZAH 4DW2L 1DEDA 1IGFL 4OJFL 3UPRB 4WFFE 3OAZK 3M17B 1IBFA 1DSWA 5AL0A 4XP1H 2UV3A 3TA3C 4R7LA 4PM1A 1MUJB 1B6DA 1HU8A 3K6OA 2GCYA 1KXHA 2YUXA 4WKXA 2ZPKL 3WUZA 1D7CA 3QQ3A 4L0YA 3L5JA 1CYGA 1Q0YL 4IK6A 4LLQB 1LK3H 3QCUL 5AW2B 4JN1L 3UCQA 3VI3E 3HVDA 3GWJA 1G6RL 5AOJA 1UM6H 4PIRF 3GK8H 1WAAF 2X2IA 1NEZA 4J3OH 3UTZB 1XFPA 4AH2B 1N5AB 1YEFH 2VWEE 3BVUA 5CLZA 4OLYH 1VENA 2QFPA 1V10A 2WWKO 2X38A 4ZUSB 2M8XA 4POZD 3SO3C 3V6ZA 2NDFA 4DZ8B 1IBHA 1R3KA 2I25N 3CZNA 2XETA 5DGQA 2PW1B 5TE7H 1WYJA 4M6NH 2E27L 4LGRB 4K71B 3M8OL 3DGGB 3VXNB 2FO4A 5E8PB 4FG6D 3BH8B 3KHOA 4R97C 3WGVB 1MJ8L 1NIEA 2ZIDA 2BSTB 2I26N 4ZQTA 4YSUA 4TNWK 3DK0A 3ULSA 4X98A 4M6ML 1MCIA 4TS6A 4XCNB 3AXIA 5E9DD 1ZJAA 2G9KA 3L5IA 4K8RH 1G43A 4LGPB 4WVRA 4P3CL 3ECBB 2PCFB 3AM8A 3DX0A 3X3GH 1PNDA 4LLUA 2Y5QA 3W0WB 3ZKQD 4PJHA 4DP1X 2PNDA 5IHZA 1GZPA 1WWBX 5EU3A 4Y0GA 2ADYA 4P06A 2F08A 3BVVA 4XOAA 1FZJA 4URTB 3AROA 5DXWA 4PS8A 4PUBL 3BN9C 3CFJB 3BWZA 4W9GC 1DQLL 5D96C 5GJTL 3VFVB 5B3JF 3BVWA 1CD1A 4ZUVA 4PGEB 4UUJA 3OBAA 5IGXH 1BAFL 3V6FB 4GSUA 4ZTOH 4BDVB 4NZUH 4BFKA 5BW7C 1L7IH 1KT2A 4JRFA 4ECNA 3UTTA 5HYJD 3PWPD 4WKZB 1DBAL 5F0JB 1RZFH 1S3RA 3TTSA 4B27A 3LDBB 2CCLA 1XHHA 1DDHA 4C54A 1MWAB 4M1DL 2AXJA 5J06A 1J5CA 5D72H 3CFBB 2XY1A 4TSAH 4B9CA 4GO6B 3GMMB 2CJSA 2KPNA 4F5CE 4I0PD 4O02B 3BT0A 2X4TA 1SFDA 1OAKL 4XCYA 1G1YA 4O2EA 1K6QH 1XSKA 2DV6A 4HUUA 3T2NH 1IL1B 1AD0B 4P5KB 4N28A 2DB8A 2JIXA 3ARBA 3OB0H 1U92A 5K9OB 1YA5A 1JCKA 4HC1L 2PN5A 3NFPA 4YIQA 4JO3H 1BXVA 2AJXL 4JZJA 5E70A 3VFNB 5IWLC 2I27N 1JBJA 4TUOB 3LXAA 3WN6A 1WITA 3IWUA 3RNQB 2WTRB 3K2UL 3PWUA 4M5YL 4P2QA 5K9KB 1U8QA 1WEJL 4HKJB 4ADJA 1QWNA 3VXPA 1SUHA 5D55A 3EHBB 3L7EB 4Y4HC 4Z7OB 2LGNA 4HK3J 5F8RC 3HNVL 5I1GH 4MXQD 1MHHA 3IMVA 3MLVH 3HC3L 4QRRE 4BZ2L 2ZUWA 1NGWB 3LRGA 1S6NA 3UBXB 1GL4B 2FO8A 1R6VA 4ZMYA 1RJLA 1FAIH 4KROB 2H41A 2OULB 2BP0A 4FCHA 4KFZC 1FL6A 4MNQE 4ZFOB 1JK8B 2ISDA 3T0XA 3DSNA 5BMFL 1S7VA 1FNEA 2D7TL 5EU7E 4XH2A 3NABL 4X80H 3HG2A 2NW2A 2XN9B 4X7CC 3VI4E 1FFOB 5I19L 4IIQA 5T1KD 4JREB 4OM1L 4KFMA 3BESR 5DSCA 3ZZLA 1DQML 3IYLW 1RZGA 5GRVL 3MUUA 3OX8A 1UZGA 3CFCH 1MW1A 5EBMA 3CZSA 2NY2D 4P9MH 3KPMA 4NQVA 4R7XA 1KACB 4X9BA 2MCPL 1V55B 2YOCA 3KPLA 1HXMA 2EE2A 3FHEA 1GS8A 4KJYA 4LZKA 7FABH 3WTSA 4GSQA 4F3FB 2PPDA 3FFDA 1YMMA 3TBCA 3K2MC 3BGMB 2H32H 4Y9CA 3WHE0 5C0JA 5GS2D 4AVJA 5DZVA 3KL5A 3FFCD 3QWOB 1CFTA 1KZQA 4U6HA 3DVNA 4R26H 1WG3A 4UT6A 4DTGL 4YXKH 1IBGH 3K8KA 4HUXA 3UAJD 1J86A 1DQVA 4NNXB 4QCIA 3LKSA 4WTWA 1S9KC 4B9IA 4BV1A 2GT9A 2IDUA 3LPGA 2GTZB 1UKQA 2RHEA 2YN5A 3ZT7A 2JKXA 4W4NA 4CVZA 3ZTEA 2O5ZL 1F6AB 2C9VA 1OAUL 5EUOA 2ZD0A 2Q10A 4Z7UB 1IAIH 5J5EA 4JW3A 2DWDA 1ONQA 2UY6A 5D1XC 3GUTB 2XQ0A 2AW2A 2CIIB 2EIJB 1WAEA 4GXVL 2J44A 4JE0A 4BFJA 4BXVA 3AB0B 3FRPA 5I8CA 3TCLA 1KJ2H 1PF3A 3AREC 4G8EA 3EYFA 4OLVL 3ESUF 1NCWH 4X4ZA 1SHMA 3WIIH 1AOZA 2X4PA 4MA8L 5IESL 4XWGL 4KJPC 2ICWI 1FSKB 2GFBB 3MNWB 3OMNB 5D1QB 3VVWA 2QADC 1BLNA 1YDPA 4M8UA 2ZCHL 4P2OA 5EG6C 4HHWA 4S1QH 4UT9H 3AY4C 5JORA 1YO4A 2QEJA 1EHLL 2EECA 4QXTA 3BKJL 3O11B 3TU6A 2J43A 1ZLUK 2CLVA 4OJEH 1RHFA 4ES8A 3HMXL 1KTLA 3EDKA 5KUKA 4RGNB 4P99A 1UH4A 3QXTA 2VTFA 1UD5A 2WQSA 4JFPB 3S2AA 1J5OH 1ZEAL 2OR7A 4LNRA 4PRID 1TEFA 4TNEA 4IS6B 2V2TB 2EZ0C 3WFBL 3O3AB 1F4HA 3MC0A 3R1GL 5D2NE 4FQJL 1XF5B 4WV1C 2OTWA 1X9RA 3CV5A 3ZIMA 2X4OA 3OPZL 5SX4I 2CMRL 4BRVA 3FTXA 4KHXH 2VABA 5EZLB 2AQSA 5M95B 1GMEA 3F5WA 3X12B 1SHXA 5C0DA 3BGFB 3S88H 2YD1A 4FJZA 4RRPM 1MI5D 1X7SA 5JW4N 4LHUD 2GBUA 3U2SB 4A39A 2BVOB 2FVNA 2Y3NA 2VXSH 5DMIH 2DBLL 4PB0L 2A3TA 5EOCJ 3ZHDA 4JN2B 4N4YB 1CGWA 1LD9B 4N5ED 1MRFH 1WJ3A 2NY5C 2B4CC 3FB5A 3KCWA 3UJTL 2JQZA 2HSIA 3MRLA 3QNYB 2PO6B 3CVHA 4OBRA 4ZFFA 1W6LA 4AKOA 2X6VA 3VCLB 4UQ2B 3OMAB 4WEUD 4YE0A 5JQIB 2GJPA 3VO0A 2J88H 3GUFA 1E2WA 2VL5A 1KYUA 3D18B 4HXBL 2E4TA 2V5SA 5IJKC 3LJ3A 2NY0D 4JM2C 1V7ML 5DFTA 4WFHE 1JPFB 3C8KA 5B8CC 3VD1A 1KF9B 4XNMA 1P9MC 1NL0H 1B0WA 1C5BH 3KL3A 3CLFL 2ED7A 2CLRA 1MPAL 4LEOB 4AQEA 5BUPA 1CUOA 2EADA 5A1AA 2WIIA 3OC8A 5EPMA 5F21B 3KDPB 1UWGH 4PV1C 3RTLA 1CDIA 1UZ8B 1XGPA 3PQYA 5JW4M 3MJ8A 3QI9B 3KVQA 5DHYB 5EEYA 2D9CA 2R2EB 3OZ9H 4D9RE 1S7WA 1WWCA 1U93B 1KIRB 4H7VA 2K8MA 4S2SB 3FZUC 1D5IH 2QQLH 3LNHA 43C9A 5K9JL 5LNDA 2PABA 2BK8A 3OJDB 1G0YR 2CAKA 3DI2B 1M9SA 5BQDA 5JW4Q 2NLJA 5GIRA 1E9OB 2JKIS 3MO1B 5CZRA 5DI8A 3VQLA 4PW4A 1H3GA 4M62H 1QFWM 2F7RA 2IQ9L 2KQMA 4XCEB 4OFIA 2ZP0T 5F8QC 5IEKA 4FLQA 1GTFA 5SWSA 3RI5K 2R29A 2E7MA 3UAEA 1JXGA 4UWQB 3WTYA 1S3KH 2A9ML 4JG9A 4GRWH 3T6VA 1HWHB 3DVFA 4PFEA 5A2KH 2IPKA 4KITB 3OF6D 4NO5A 1A4AA 1J9QA 4LCCB 3VGAC 3B2PA 4Y5VC 4AYEC 3V0FA 4AGMA 4FL4B 3WFCL 2DQHH 3NZHL 2EDLA 2X1OA 3SDCD 4JG1H 3JWDH 2CUHA 2UUDH 4GSDL 3TEXA 5EEZA 2CGRH 3T6ZA 2BZCA 2PPFA 5CBEA 2YZ8A 2NUTB 1IVTA 1DLFH 3AQYA 3Q5OA 3MOAL 5HHOE 3UOAB 2NNCA 3WHE1 5B1KA 2FIRT 2F7OA 4JZOA 4Y5YA 5EIIB 3MJ7A 4AV4A 4EI5D 3MVSA 4OF5A 3S8GB 4JY5L 3U48A 4XPTH 3NJHA 3WFZA 1NEZB 1O9ZA 4I48A 5A3IC 1ETZA 4EEEA 4DESA 5DWUH 3ULUF 2K1MA 2KLSA 3EOYG 3MBXH 3JWNG 1A6WH 2B2XL 2ARJB 4UQEA 3AQXA 5I18L 5JHLL 1CIDA 3V6ZB 2JB6A 1C7SA 1R3KB 3TT1H 1E4XL 4OIIL 4J6IA 5BRZE 1GHFH 2P28B 4B9JA 4MZRA 5IFHH 3D39D 1KCUL 3MLRH 2WB7A 1OSPL 5FCUL 1KYFA 4Z23A 2O61A 3BIAX 2DQGL 4ODSL 1Q1JH 3MREA 5FLUA 3DUUA 5T5FA 1W0VA 3CCHB 4OFYD 4M5SA 4OZ4A 2DQ6A 5JUEL 4ZZKA 4GQ9H 4X98B 1F4AA 3ULSB 1F6LL 3QDHA 1H3WM 2Q2LA 3DJSA 2WN3A 5H4YA 1B4JL 4D3CL 1YYMH 1IGCL 1FQ9C 1U3HC 1K2DA 4XPFL 5F1KC 3U25A 1CZ8H 3FW6A 2X2UA 5IHZB 1F56A 4PLKD 1GZPB 4Y5XA 2XN2A 5EZJA 5GS1B 5HI3C 3ZR5A 1JTPA 4FNLL 4G8GA 5HDQH 2BSRA 1DANU 1E5UI 4ZSOA 5DJ0A 1QW9A 4LO9A 3VDAA 4CN6A 2GEQA 4ZUVB 5HYJB 5IB3A 4J12A 1ZVYA 4RAVA 1XDTT 2C9XA 4KUZL 4UUJB 4Y7MA 2J1WA 3OJVC 2NNFA 3EOBB 4ZOEA 3DO7A 1FBIH 1JMXA 2FGWH 3HC0A 1NOFA 4AXWA 2G30A 4YHYC 1NCUA 3WJLC 1DDHB 3AZUA 3MA9H 4FXKA 4MNHA 3TYGL 2X6UA 5F0MB 1AR2A 3GSVA 4PJXF 1QNIA 3IM1A 5EEUA 2HLFC 5E2VH 1TXKA 3ZVVA 3FSVA 2W9DH 4HPHA 5EIVA 2IPTH 3S3DB 3ETBJ 2QPSA 4I5BA 1GH7A 1CXKA 1PG7H 4HFUH 4XCYB 1TCRB 3MV9D 3A4DA 3FUHA 3PIQA 4KJWC 5I8KL 5IVXA 1N64H 4O2EB 3SGEH 3KM2A 1WCBA 3DETD 4HUUB 3L48A 1PKQB 2JIXB 2V3DA 3ARBB 5J3HC 4DO4A 2ZNWA 3SPCA 4U0QB 4NQEE 1BWWA 2DQGH 3UCRA 4YIQB 2Z8WC 4JZJB 4FFVD 1BBDH 3BPOC 4J7RA 4HJSA 4JPVL 4AV0A 2VUYA 3Q6GH 1JVLA 3TJEL 4WEBH 2E6JA 4IQHA 1IGJA 4WEMB 1YAIA 3FBKA 3PWUB 3ELAT 3IFLH 1B4LA 4P2QB 2ZWLT 1U8QB 4GAJH 2CBOA 4MA3B 1QVOA 5KYUB 1V3LA 2ZXAA 3MAWA 3AUWB 5T5NF 1NFKA 1MWAH 3LV3A 2BSCA 4FA7B 1PJ9A 2GAZB 3QIBD 4GW5A 2BP0B 1AGCB 4NI3A 3KPQA 1IC7H 5T1KB 2L7QA 3DSNB 1Q9LA 1S7VB 1FNEB 4O02H 1U8JA 2AEIT 3C6EA 1SOKA 2R8SH 2CXGA 3KWXA 2ADGA 4LCWE 1SVCP 2LR4A 5D70L 2E6PA 4AM0A 4G9FE 1KDJA 3D4YA 4ZQKA 4FYSA 3MRCA 3OX8B 2DQCH 1NBYA 4QRAA 4M02A 2ZCLH 2F54D 3VW3L 4E9RA 3GGWB 1JZ6A 3ZDXB 4ES9A 5C92A 8PAZA 3KPMB 1VFUA 2ARJQ 4PJCE 4N87A 1TMQA 4QRQB 3VD7A 3IJHB 3KPLB 5BV7C 4XP4L 1FNAA 1RSFA 2HCZX 4HFWA 1QYGL 2MOGA 1ZT1A 5CZXC 1YMMB 3CMOL 3OXRB 3LIZH 2FSEA 5CD5D 1WFNA 1XF2B 1HE8A 3CLEH 3WSQL 3C2AH 4IYKA 4KOBA 5C0JB 4ICWA 4NRYA 4QRFA 3GEFA 4JJOA 5I8OL 5KJ7E 3PRZA 2AQTA 4GEJA 4PJIA 4YDKH 3T3PB 4U6HB 3DVNB 1IAOA 4L4TA 1IGYB 4DUWA 5CZVL 4YWGH 3TEUA 2OJZL 1DQJB 1U9KA 3G6DL 1RY7B 2V7HA