4CSTA

Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PROTEIN FIMH
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cstA00
3ZL1A 4AVHA 4X5RA 3BWUF 2J2ZB 2JTYA 2JMRA 4XOAA 5ABZA 2XG5B 5AALA 4X5PA 3ME0B 2WMPB 4J3OG 2UY7B 4CSTA 4AVKA 2UY6B 5FWRA 4XOBA 2XG4B 5JQIB 4J3OF 5FX3A 5IQMA 4AUUA 3JWNE 1TR7A 1QUNB 1ZE3H 2VCOA 5FS5A 4XOEA 4XO8A 4AV0A 4XODA 1KIUB 4AUYA 4BUQA 5LNGA 3MCYA 4AV5A 5F3FA 5AAPA 1UWFA 4AVJA 1N0LB 3ZPDA 2W07B 4LOVA 3BFQG 4X5QA 3RFZA 4AV4A 4CA4A 5CGBA 3ZL2A 4X50A 5FLUA 3BFWA 4CSSA 5LNEA 5IQOA 5AB1A 3SQBB 4ATTA 5IQNA 4XO9A 5F2FA 1PDKB 1KLFB 4AVIA 4J3OH 1N12A 4XOCA 4AUJA 3JWNG 3JWNH
chains in the Genus database with same CATH superfamily
4ALAC 3UABA 4BWUA 3QUXB 3CX2A 4YXHH 5D2NC 5T1LD 1A3RH 1DUZA 2GAZA 3SD2A 3MRCB 4P49A 3WNIA 2XG4A 1BBJB 1I1FB 1IIKA 2DEYX 2GTZA 2NR6A 3ARUA 4Y5XA 4F8PA 3ZQ9A 1MJJB 3L4UA 3RZWA 1DLFL 4ZUUA 3US0A 1V3LA 43C9A 4HKJB 5J1TC 3N42F 4C83A 4IRJC 3BPNB 3V5KA 2NYYD 4MSWA 5HHOB 2XG5A 1KYOJ 2VJXA 4BV1A 4AE1A 4K8RD 4LT7A 4Q7DA 1SOKA 4DP8X 5BMFH 4H26A 3WBDA 5CD5D 3FBQA 2EYRA 1DO6A 4DGIL 2Q86B 5MEOA 3NTCL 4Z3TA 4QY8A 1RPQA 5CEXB 1KCRH 5F72S 2W91A 3KLHD 2L04A 1ACYH 4JBSA 4FXGA 2FJUB 2AK4D 3BE1H 5IQ9B 1QRND 4X80L 1U8IA 1K6QL 3MREA 2CGZA 2WZ5A 3JZ7A 3BSZH 2E27L 5EEWA 2NW2B 3QUZC 2VKXA 3CLEL 5DEFB 1SLXA 1XWVA 2M8XA 3S35H 5T1MB 5E8PB 4OAWA 3D18A 4I77H 2YRLA 3DV6B 4UM9A 1FV1B 2J25A 4EI6A 1Z5HA 4ZXBD 4UNIA 4M7LH 4DP5X 1DQJB 4YBLC 1PX8A 1VFUA 5TDNB 5IV2A 7FABL 1KWKA 1INEL 4G6JH 3VH8B 4WNQB 5T33H 5GGRY 5J5EA 3SDAA 1TJGL 3GD1C 1YN7A 3K5RA 1XGZA 4PGBA 3UC2A 5JW3L 4OI7A 3QDMA 1MWOA 4N22A 1FZOA 4C47A 5J57B 3IAPA 3OJVC 3N55A 1BD2B 7TAAA 3VQ2C 3VXUE 2ZQKA 3ECBB 3VFGL 1SXZA 1UD8A 3UPAA 1XB8A 5AB1A 4H8VA 3RWFB 1TZHB 1RL1A 1MY7A 2D0HA 3K91A 2DTMH 2VUKA 1O5PA 4FYQA 5DHVA 2A1WL 3JTSB 1J1XL 4JKWA 3UTZA 3BAEH 2LHAA 4D0BB 1RUPL 1U2CA 2X2JA 1JF5A 3CK0H 1JZGA 2R59A 5B7EA 5T3ZL 4KZ0A 4KQ0A 3VI4A 4A7VA 4Y4HD 3QP3A 2Q76A 5F1IB 5JA9A 2VDLH 2VLKE 1K2DA 2KZBA 2EDHA 3NZHH 1H15A 3VI3B 3DI3B 2UX7A 2NX5E 3Q1SH 3HJEA 2Y6TE 5C09E 4GQZA 1WBZA 4GQ9H 3UO1H 2WKOA 1SJVA 3DGDA 2KZKA 3EJPA 1D5XA 3BWUF 1GOFA 2HLFD 1G4MA 1Q94B 3ULVE 1HSBA 1NIDA 1CD9B 4WLCA 4HF5L 4GBXC 4KK5C 1R3IH 3TV8A 3EBGA 2R4RH 2WXKA 3IMRA 5DUBA 2N1KA 5E2UL 4ELMB 3EO0B 2CO7A 1FLTX 2XI9A 1MI5B 3N06B 1W0VA 1ASOA 4B7LA 1R3JB 1V7NL 1XH1A 3VNYA 3S3PA 3ZL4H 5HPMA 3DOHA 3I2CH 4H1LA 3RY6A 2EKSA 4NNPH 1P4IH 2YJQA 3ESNA 3BUYA 3IGAA 2AERT 4NRZA 4RRPA 4LIQL 4CDHA 5HGBB 3BWAB 4FDWA 4HPHA 2HKFH 2ADFL 5LBVA 1AXTL 4R96A 2DIBA 5DHMC 4RVBA 4K2UL 5FR3A 2ZP8A 1ES0A 2AZUA 1YY8A 2Z8WC 3VG0H 1FZMA 1C7TA 5KVEH 5L7XL 1RAMA 1E4XL 1EQWA 2HFFB 2ZX6A 3QQDB 2D2OA 4KXAA 3P54A 1IIIA 1EDQA 4U2YA 5H35B 3O6FC 1YAZA 4MZRA 3U0WL 3UMNA 5I1DB 2VC2B 2R0LL 1AO7E 1F6FB 4ODVH 1QBBA 4AEIH 1R5WA 5IB2A 4GIPD 5GGTA 4H20L 4ZUTB 2C7FA 4ETYA 3OHXA 2JB5H 4F91B 4HVBA 1VCAA 3Q8BA 3VWKD 1OIOA 3GMRA 5D2LB 1SXSA 3EOAB 4IS6A 3UO8B 1A4KB 3BWZA 1CD0A 1CICB 3S3JA 5ID1B 3BPCB 5IB1A 1OAZL 4HT1H 3BIKB 4NX0A 4HKXB 2IDSA 3QRGL 5L2JA 1OAKL 4UMSA 5KYUA 3VXNB 1YEEL 5BQ7B 4NQVA 4HJGA 1DN2A 4JFXA 4R7DA 4W9CC 3VXUA 4ZMNA 3EXJA 1DQQB 1A6UH 1I1YB 4KQ4L 2LVCA 1BQ5A 5I1EL 1BJ1J 1J0IA 4R4FL 1Y0LA 5EOTA 3QIWD 1JNHB 2YGOA 4W9KC 2XVLA 5JORA 1QSFD 3C6LD 2PF6A 2WHVA 3EFFA 3IJYB 1IBBA 3LVEA 4J8RA 2AFNA 3S6CA 3IDJB 1CR9H 3QT2A 2EDQA 4GW5B 2J8HA 1NM9A 2VN3A 4X0KB 4RWHA 5FAAA 3WUWB 3CFEB 4K9EH 2VLKA 3OAUH 4UOZA 1IQDB 4KKQA 1BAFL 1ZSDA 4JREB 4U3CA 2NX5A 5AQ0A 1RIHL 5C09A 3QEGH 3ZTNL 3MBEC 4PJ8D 4R0LA 2ZKXA 2CKBH 1F11B 1HIMH 3FNKA 1IGCL 4OZFB 4LPVA 4ALAL 4NOFA 3L4XA 3RNQA 5GRWA 1AS7A 1U8LA 2YXMA 3QJUB 3MPCA 4MX7A 3ZDZB 2BOBA 3S96B 4GI6A 4XTRD 2OJ1A 3FS9A 5H94A 1SVCP 1KV3A 1F56A 1FGNL 1G7JA 2Z35A 4P2AA 5LWYH 1J11A 1S7TB 2H8PA 2P8PB 1E6JL 3IJ9A 2MPAH 4TTGA 3EF7A 3IXTB 2FX9L 3QO1B 2E3VA 4PTUA 3WFEL 8FABA 1WLHA 4GQPH 5DJYA 2ZG2A 1A7NL 2R15A 4JANA 4NHUB 4F58H 1XSKA 2R0WL 1QSED 4WNSA 4KJYB 1RVFL 4IOSA 5DRZB 2IPKA 4OCNC 5KVGE 2YHGA 4JRWA 3CC5A 5BW7A 4JG1H 5C92A 5KBPA 2D7QA 4EO5A 2MQCA 1U8OB 1SEBB 3IDIA 3KH4A 2OV0A 1ZWIA 3UEQA 3AT8A 1OSZA 1QKZL 1HC1A 4DP7X 4XHQA 3SGJA 5KBNC 1E9PA 4GG8A 5ICYB 4MAYD 4LF3A 5EFIA 4K3EL 3N40P 3NCCB 4BFKA 3IFOA 3OKKA 4AH2A 5F7EH 5KSAB 1W9XA 3SOTA 3HE6A 4ZUSB 1HH6B 3IT8D 2H7WA 3PNWB 3FO9B 4O4YL 3T0EB 2UWEB 3BJLA 3KPPB 3LXCA 3VI4F 1AO7A 1I82A 2OYMA 1MVUB 2C1OB 3FT3B 1I1AD 2QGCA 2OL3B 4X50A 4LCYB 3KGSA 4YHNA 4QHPA 5DF0A 3UCRA 4IKLA 4OCMC 3ZMNA 4FA8A 3QR0A 3BD3A 1U91A 4FL4C 2WKOF 1D7BA 3TCLA 1QVOB 5DQJA 2BP3A 4TRPH 1PZAA 1PSKH 1WT5C 3JWOC 3P73A 1T20A 2FJGA 4HK3J 4KKPA 4JHZA 2YD9A 1T66D 3EYVB 4GSUA 4K07A 5IHZA 5IB4A 3V52L 2ITEA 1XL4A 2FR4A 1KGIA 4JFYA 1ILUA 4YR6A 4FLRA 4P2OA 1FP5A 2GITB 3ZJAA 1U42A 4NDMB 4F2MB 5HY9A 1JPGA 4KDVA 4I7ZC 4A63A 3OB8A 4BBWA 1OP9A 5EN2B 4LEBA 3L2NA 1JZ7A 5DFTA 3PCYA 4JNXA 2EIZA 2Q9OA 1AXSB 2ZXWB 1XF3B 2X7LA 1VKXA 5IKCB 3O4LB 1NEPA 2EDOA 3EKCA 4DEWA 1UM6H 4QHNA 5E5LA 2F58H 1XBDA 3AROA 1FFPA 1IGTA 5J6HA 1JDDA 5CFHA 2K7QA 1CU4L 3PL6A 3F58L 4XNZB 3WFCH 3WXWH 2XKUA 3QO0B 2XPYA 3T1FB 4LVEA 1F90L 1YVLA 4R7NB 4UB0H 5D4JA 5DUJA 5KZCD 1JHTB 4LCVA 4RIRA 4X9BA 2BVPA 2W60A 2SEBA 1P4BL 3A4FA 2YPLD 3W37A 3IGFA 3T65B 2ZXAA 4ZFFB 1GTFA 4HLZG 5FOBA 1P0SE 5AVUB 1KN4H 2BK8A 4XCFL 3VFOB 3CVHB 5JZ7D 3KJ4C 3RTQB 4BXVA 1HYSC 4BFGA 1SN2A 4DCQA 4NP4L 3GMLB 3VD3A 2DD8L 4TTDC 3CJJA 3RLSA 3CFJB 1Q9WB 1F1GA 3AGWA 3GMNA 1CFVH 4LLQB 1O7DE 2NUTB 1U8CA 4EN3D 4LAQL 4M48H 1KIPA 4XNYH 1NCAL 5HGHA 4LCIL 1IUZA 3U48A 1DLFH 1GKEA 2I85A 4PQXA 4XMWA 3DO3A 3K5SA 1E5CA 4XPGH 4JPSA 5CUSL 1EXHA 4KH9A 1XMEB 4KTGA 1DANT 4JO2H 3HN8A 5EBGA 4JKLA 2VDPH 2DL2A 1F6LL 2WVVB 3JV0A 5AAPA 1QWUA 4LSVH 4OKVA 1U95B 4YSUA 1GY1A 2VIRB 3BZ4A 5TQ2H 4QRQB 4F57H 3FFCD 1JK8B 3QUML 1G9NC 3CFMA 1JFHA 1YG9A 2G3MA 2ZSVB 5FCUL 4KGLA 2PYEE 1RJZA 2VDOL 2DQEL 4Z78B 1K6QH 2JKSA 3IRPX 4IBZA 3D06A 4MA1C 3BDBA 3ZMRA 1W0WB 5FUZL 1LDSA 1AJ7L 3ABMB 4NGHH 4M7ZB 4WNJA 3SDXE 3O3UN 1JXKA 5EF0A 4J3UA 4U1KB 1TJIL 4WFFD 4WY7L 5C0NC 4TUJB 3W9EA 4MYWB 5EU5A 5AG9A 2PXYD 4AMKL 3SKUD 2H2PC 4ODSL 3CMOH 3U2JA 1A22B 3QCVL 3EYUH 4ZQKA 4KX7A 1V8HA 1XGYL 3U82B 1PPIA 1UZ8B 1KNOB 3BAJA 3LEXB 1YEIH 5ANHA 5EH1A 1QPKA 2NY0C 4IOIB 5CJQL 2VUOA 4AC4A 3TT1H 4BA8A 3N91A 4C58B 3MOBH 5G55A 4M5TA 3EOBB 2V2WA 3L5XL 5HYIA 1MHPL 3SGEI 2X1QA 1UTDA 3FB7B 3TH4T 2BIMA 2FZ3A 4KO6A 1B3IA 2J12B 2JIXA 1IM3B 3SCMC 5HHNA 5HHOE 4RNRB 1RH8A 4FQ1L 4PTTA 3BUPA 3GB7A 4WW2B 5AZ2H 2AEOA 3RGVB 3QG7H 4X98B 1U3JA 5H37G 4F80A 2QMJA 4KROD 1F4HA 3OKNA 5L2KB 2HT4C 5GPRA 1EA9C 3FO2A 4U1HA 1A4BA 1IKNA 4OZ4A 4G7QB 5F3HB 5I73B 4WV1A 2J55A 3CDGA 5FHAL 3UZEA 5JIQA 1T1XA 5I1LA 4LESA 3U7YL 5IVZA 5FECB 1FNGB 1KJ3L 3WIHL 2PWEA 4S1QH 4GSDH 2A6DB 4PJEB 2JCWA 1WWCA 1GH7A 5E5RB 1JPSL 2VAAA 3HUJB 1UD2A 3O3BA 4JFHD 3CDFA 1R34A 5HGDA 2IC2A 3K6IA 2LABA 4AXWA 5KVDH 1UJ3A 3BEVA 3U0TA 4K7PL 1OT4A 4OM0L 3GSNL 5GS0C 2DJSA 2K3HA 1LWRA 4P3CL 3G6JB 3BPNC 3CUPA 4WF7A 2W65B 3O0RL 4S1DD 3DJSA 2G4EA 4QF1A 2JI2A 1TF4A 3MNZB 5J56B 1HHKB 3BDXA 1ADQA 3K6OA 1QFUH 4LVHC 2CUAA 1U6AL 3S7GA 1VF5C 1JK9A 4NZDA 3RWGB 2O30A 2QLYA 2WGNB 4NBXB 4PJ5D 5F7DB 1QUNB 4Y4FA 1QLRB 4JM2A 4UV4H 2G9HB 2CR0A 3MRPB 2EH7H 3KD4A 4R4BB 2NOYA 2O6CA 5BVPH 5AW7B 3H9HA 2NY6D 1BD2E 4G7VL 2EH8L 1G7PA 1J1OH 3BEWB 5D1ZB 1CQKA 3TZVD 4GJTB 4DAGL 4MA8L 4HC1A 1RJCA 3M46A 3GEFA 5DJCA 3QPQC 4AV4A 4K7FB 2PMZA 2YAPA 3BCFA 1HCYA 1YPZE 2BP5M 3CZFB 1CB4A 3L1OH 2C26A 3NIDF 4OM1L 4QDGA 5DD5L 2DQIL 3IFPA 1VFMA 1WEJH 5IG7A 3MRRB 2FAUA 4DIXA 2PYEA 3UIYA 4WGVB 1R33A 3N41B 4NQDD 4G11A 5CCHE 4M6AA 3KL3A 3RWIA 3IBEA 3PAVA 4MRCA 4Z7VE 3BFWA 5DYFA 1XIWC 2LW3A 3RA7H 1Q9OB 5EWIH 3SDXA 2DYPD 2XA8H 4I0KA 4MQ7B 4JO3H 5F9DC 1DVFC 5DK0B 4LRIC 3ZQWA 2BCKB 2JJSC 3RDTA 3ZTDC 5CCGE 1F5WA 1IFRA 3QI9B 1F6AA 5E9DB 2H4EA 1DVZA 1WZ1L 2NZ9D 3JWOL 3QUXA 3TYFA 4F7TB 1NGPH 1TETH 1A4JB 4KVNH 3LKRB 1KCBA 4KX8A 4OJEH 5E2WH 4ELME 5I1KL 1MI5E 4OZHB 3M8OH 4YLBA 4ZT1A 4NHCL 4MKMA 5AB2A 3TF4A 5IFJB 1G9MC 2VMJA 1QAWA 2YA0A 1MJJA 4PLKD 4ZTOL 3LRMA 5FGBC 5C9JA 4HKJA 4HP5A 4KKLD 1OAJA 2YWZA 3VX0A 5HHOA 4PR5A 1ETA1 1J1PL 1TVBB 1PG7W 4P4KD 4HOZA 1FFNA 4H2CA 2GC7C 2UX6A 5A6MA 2GEQA 2BSRA 3Q2VA 4L8SB 3GO1H 1RK1B 3QXWA 2Q86A 2QFPA 1HJBC 5E8NB 1XF2A 4YXKL 4NIKB 5AYUH 3IE4A 5I0WA 5AKVA 5DMKB 1FJ1B 5CGMA 1AVAA 1FNSH 1EEUA 1BLNB 2NY1D 3NSDA 2VXSH 3QEHA 1A6ZB 3Q6GH 5DEFA 2A4EA 2FNWA 3S34H 5F7FA 4KUCF 4Y19B 5T1MA 1W8EA 2X38A 2QQQA 4KKNA 5TH2B 4KKCD 4HWNA 1Z32X 3DV6A 3WS6C 2XDHA 1KTBA 2JKWA 1IGCH 5I8KL 1XGQA 3CAFA 1G84A 1DQJA 4N2GA 4QKXB 4G3YH 4GS7B 1CLOL 4L0YA 1GZQB 5D2LE 4WNQA 3FT2B 3E1F1 4G2AA 3VH8A 2Z1PA 1FGNH 2X4NB 1NBZB 2D31B 3FC8A 4LPWA 4MXQC 4HCRA 4PV8B 2YWYA 3AS3A 5K1VA 3RFZB 2D3VA 4QRRB 2YD0A 5D70L 4BZ1L 1CDIA 4F27A 2O61B 2FX9H 3WFEH 4NEHB 2PETA 5C0AB 1IRAY 2PNDA 3MDJA 3S8WA 5LAXA 1BD2A 3N85H 1F18A 4X5QA 4KTDL 1K72A 3LD8B 4OQTA 4Z18A 2ZKMX 3TN0B 4XCCL 3E3QC 1FZKB 4WUUD 5MHSD 2VDQL 3VFNA 1YPZA 3WLWD 2K4WA 1G9NL 5DXWA 4D0BA 2NY2C 2XQYG 4Z3GA 4P2QB 3VFSB 2YD7A 2HTLD 5FO2A 2WC7A 1CICC 4J6RL 2Y22A 2V4LA 3FTUA 3PUCA 1FNAA 1OL0A 3QEUB 5IBLD 4Z7VA 2GSIA 1KEGH 1EX0A 5TQ0H 1JRHL 3P69A 1HTYA 1A6TA 2G4GA 2Y4SA 2VLRB 3PQYE 3T2NL 2YAFA 1FNEB 4FQLH 1UB6B 3NVQA 1LK2A 4G8IB 4OCXL 2A9BA 1OPGH 3FU0A 4CADB 3FO1B 1Q94A 1HN1A 3NZSA 2FWSA 4P4RB 3VW3L 4BHUA 1A47A 4ZFGL 5FUOH 4PG2C 3FKUS 1MPAH 3VFVB 4ELMA 1SOXA 1GC1C 1SMAA 1MI5A 1QNZL 3BAXA 4KBPA 1N8ZA 2L3BA 4LSRH 2MFNA 4NS0A 4PB0L 2F7OA 4IIQA 5F0JB 2CAKA 4N0UE 2A6IA 1NCIA 1I8IB 1AKJA 5DJZB 2BSTB 4JREC 4PRAB 4MKTA 3TPKA 3DIFB 1Y07A 5GGTH 5GZOA 1YEFH 3WD5L 2RACA 2R27A 1N67A 5IBTH 2XLLA 3SO5A 3P4OB 2E5EA 3H85A 2F08A 3ZX1A 1NC4A 1OCOB 4W9GC 4G5ZL 1OD9A 1VEOA 2ED9A 5HDBB 2BHUA 3G5YA 2YS4A 5HDOA 4E9SA 3Q0HA 4DEPC 3QORD 2NY5C 5PCYA 4P5TC 5H35A 1NCCH 5GS0L 3P0YL 4OZGE 3STZB 3P77A 3T0EE 3V10A 4G72B 1H19A 4MJ4A 2LTQB 1ED3A 3LN4A 1ETJA 2QPEB 4AW4A 5GGSB 2VM3A 1NCUA 2FJSA 1M7IB 1BXAA 2H41A 3MUHL 4TNVF 5D2LA 3ILQD 1M2VA 4L5FL 4KNSA 3EJZD 4NP4H 1A4KA 1RMFH 4B6ZA 5ID1A 2VWEC 3BPCA 4WK0B 5EF2A 1CTOA 4KK6C 3CXDL 1YNKL 2FSEB 4PUBL 1HEJC 2XWDA 3VXNA 1S7QB 1XAUA 4GAGH 4F2ME 4CA4A 4PLJD 1WFUA 1DQQA 4XC3H 1I1YA 3CVIL 3EJQA 1LD9A 3B9EA 1YMMB 4PWKA 3ULVH 4EF3A 1ZA6B 2OYLA 1H3PL 4QI3A 2GG1A 32C2B 3N2JA 3RHWF 2JNZA 4NAMA 4JFEE 3A3YB 3NA9H 4XZ4A 3T3MF 4ZUWB 4PBWD 3O4LE 4GP5B 2ZT9C 4JZJB 2V2XB 4IU2B 5C0CE 4J27A 3NAAL 4GW5A 2DIEA 2GSGB 1JD7A 4X0KA 1T1WB 4FKHA 5IBUB 4B53A 3WUWA 5FK9B 5E08H 3CFEA 3MUGA 5EPMA 3L3OA 3PQYA 1S7WB 2DY2A 5FUZH 1UT9A 1OP3K 1A3QA 2R39A 1E27A 5BQDA 4BKTC 4GI8A 1KENH 1XR9B 1Z1WA 4DKDC 3QJVB 3SE6A 1XF5B 3PU7A 3WIAA 3MJ8A 1MCNA 3RZCD 4QNPE 5FA3B 5JDSB 5E8DH 1XGYH 4YDIH 4MBOA 4RGMB 2E59A 4GRLC 4D7PA 1MLCB 1G9ML 3WNOA 1S7TA 3SYOA 2P8PA 4TPRH 1AOHA 4XMPL 5B8CA 2A74B 3GMQA 3IWVA 4U6XB 5DVPA 1PIGA 4N0UA 4JG0H 3ZYZA 2QADD 1CK0L 5DWUL 1TVHB 4NHUA 4JY4B 4YSDA 4G6FB 4WI5A 4KJYA 4YDLC 1JZJA 5C1MB 1UD5A 1OHQA 4XO3A 2PPEA 2ZYRA 2Y2TA 1WO2A 3C87A 3LQAC 1XL6A 5T3ZD 1L7IL 3QYNA 2PCXA 3DTUB 4H2AA 4B95C 4ICWA 1ZTMA 3BVWA 4OLXL 3RVUD 4YL9A 3SPJA 3P11H 4ZG1A 1KJ3H 3D09A 1I8AA 5EC1B 1A7QH 5LCVA 1K9TA 3WO4B 3H9SE 1YPZF 5K9OA 1RZFL 1TXKA 5KSAA 5T1KB 3HG5A 3V0DA 4ZUSA 2GB2A 2BIHA 5JOFB 1HH6A 1KIQA 3BVDB 4OZGA 3PNWA 3FO9A 3T0EA 3KPPA 4M8VA 2OAAA 3QCUL 3DPDA 4Z7VF 3GSNH 2C1OA 2OMVB 5F3FA 2GIXA 3CZUB 3X1BA 4KJWC 2C4FT 4LCYA 1Q0YH 2JI1A 3IAQA 5I1JL 3FT4B 2MNWA 3EJTA 3JV4B 5HD8D 1NCBH 3BRFA 1U6AH 2V7NA 2DMKA 1S8DB 1WISA 1J8KA 1AYRA 5MEPB 3T4AA 3ARED 5M7QA 5D55A 1R4XA 1KPUB 1PLGL 4CKVX 3UROR 1WBXA 1PD1A 4ELMF 4NDMA 4F2MA 3PGFL 4PH8A 5CCJA 1KXHA 5KAQF 3TEYA 3KBHE 3GPEA 1CUOA 1A7PH 4M7LT 3B4NA 4YHZL 4ZBJA 3RJOA 2W0FB 3LTVA 1IEAB 4YHLH 4ODTH 3UAJA 5LGKA 1AXSA 2HRHA 3BCDA 5E99H 1CLZL 2NXYB 3SQBB 4LLWB 1H3GA 1T22A 2RQ8A 4JFEA 4KDTA 3O4LA 1W72B 2XBDA 5C0CA 1A1OA 4PWEA 1J0YA 3LV3A 4WSJA 5EORL 4OFYD 4CNIA 1J8SA 4HUVA 2FDBP 2EDXA 3DYPA 4I4WA 3QO0A 4L1BA 1JVLA 4PJEE 4HU2A 5J0BA 4NOBA 1MVFA 1HX0A 2X0VA 3NN8B 1JHTA 4WJ5A 3ZMEA 3QDAA 2VJ8A 2GJ6D 4R8WL 3T65A 3GBNH 1Q1JL 2ZF9A 4CILA 4ZFFA 4BFFA 2M2DA 4JEGB 1MAMH 3N1QC 1B4RA 2O5YH 1SRDA 3U4EB 5F7KC 4U1LB 2YO3A 3LNGA 5JHLL 3IDNA 3JWOH 4Y2OB 3AAZB 1GC1L 2R29H 2WTPA 3GMLA 3QZOA 2Z92B 1X7TA 1Z7JA 3CFJA 3DPBB 4JQXC 3TO4C 2JXMB 1Q9WA 3VFPB 4MB1A 5D2LF 4LLQA 4UV7H 2CXKA 1P2CB 1FBIL 2VLMD 5BNXD 1JZ2A 5IJCC 4X6FB 3WXVH 1N0XL 4P8QA 4L4TE 4PWGA 5AW1B 3QPKA 5DVOA 3LMJH 4F8LA 3CSBA 4HALA 3OHMB 2WVVA 4TSBH 2R23A 1T2QL 1AMYA 1MVYA 4PJHB 2ILLA 1U95A 2VIRA 5IQMA 4NO0D 2WZPD 3VXPB 4JFVA 1JNLH 1JERA 1L9MA 1JK8A 1ZGLB 3C8KA 1DBAL 3H9SA 1KUMA 5H4ZA 2NYKA 2ZSVA 3EDKA 3RKDC 4BUQA 2AXJA 3OLEA 2MNUA 2QHRL 2A99A 2NY5L 4MXVE 5CP3A 1E3FA 1IFHH 4FQXA 5C3TA 4Z78A 1G9EA 1CFTA 2W9DH 3TIEB 5L8JB 1HL8A 2WTRB 3ZO0A 1FO0A 2APWA 3BDYH 4YDVB 4U1KA 4I0PC 1JBJA 1BZEA 3ULUE 4NXKA 2DEXX 4NAJA 2CK0L 3VSTA 2E7HA 1ORQB 1R5IA 3NRPA 2Q8AH 1GYWA 3R1GH 5I71B 4U6YB 3T2LA 2XPGB 1AHMA 5C2BH 2X4RB 1LGVA 3ZYJA 1MCJA 4IKNA 4OFKA 1NFKA 4IRJD 1OZTG 1RUMH 1MW3A 2XZAH 3BT2H 4ZMVA 4IOIA 1T2XA 3JTTB 4JY5H 4C4BA 2O6DA 4D8OA 5JO5A 5IVNA 5LLIC 1CGTA 3C60C 3EOBA 4M29A 1XCWA 4D2NA 3S2CA 3WS3A 4JVPA 4YHOH 2NNRA 4GKOA 2XA3A 3QQ3A 4PHXA 2EKJA 2NQCA 1FRGL 1IM3A 1GW0A 4YSQA 2O5ZH 5E8OB 2CBOA 5CLTA 2DJUA 4RNRA 5D6CB 2BNQB 5D1QB 1VGEH 4JRYB 2P28B 2ED8A 1HQ4B 4FADA 4QRPD 4LSUH 1ADQH 4NNYB 1E8ZA 2FWOB 4ZTPH 4HFUL 4LP4A 3QUZD 4LVOB 1LK3H 2MPVA 5C0GA 1IO4C 4AM0B 4NC1C 1FNGA 4MLSA 2D4FA 3EHBD 3U6XA 3BXNB 1QLEH 4ENEC 1KEML 1UYWH 4PJEA 1I8LA 2AEIT 4FFWC 2LGNA 2QBWA 5C7XH 3WI9A 1I3GL 5IJKA 1KCVH 1U36A 2FIKB 3B7RL 4YUEH 5ISZB 1VPOL 3O9WB 3DVNA 4UIMB 3VE0B 2RD0A 4NLAA 1QQDB 4OZGF 3EJCA 1AHWB 2KT6A 1HHKA 3BP6A 3GSOB 3RWDB 3TTSA 3TWYA 4DP1X 3LDBC 1UXMA 5GRUH 4RGNB 4JE0A 1WP6A 4HYTB 1IB5A 2XZQL 3SE3C 1RIUL 2W1NA 2G9HA 3HN5A 2XQ0A 4QRRE 3T2PA 4XMKH 2NY7L 5L8KB 2DQGH 2W0LA 2Z7YA 3BQUD 4LHQB 3SPVA 3CFKA 1YEGL 1NCOA 4HKBB 2ADIB 3N1PC 5DJ6B 1OGAD 3WKQA 1RULH 4XP6H 3T3PB 1RD6A 4L4TA 1C5BH 2W81C 2E9JA 3SQOH 3BEWA 3AT9A 5D1ZA 4FABH 2HKAA 3LQAL 1P6WA 4IGBB 4CC0A 3FTVA 3QPXH 3BUIA 4LIQE 4K7FA 3FQUA 5D71L 4GUCA 4R7NA 3DKHA 4GS7C 1E0OB 3E8VA 4LDCA 3DX6A 2RA1A 4KRMB 3P30L 4P2QE 3WNLA 4HJJH 2DL9A 2ROYA 2D7PA 2I9LA 3MRRA 3VD2A 1PQZA 5D7KD 3FQ1A 4OUOA 3MV9B 3ZPDA 2WLIB 5IEKB 1EEZA 1KBPA 5C70A 3ARFC 3KXFD 5L9DL 2P42B 4UT7L 4GBXD 4S1SH 1Q9OA 4KK5D 4AJVA 3PREA 3TC9A 2ZX8A 3L4ZA 2VLRE 4M8QA 4MJJA 1MFAL 3HPLB 5B39G 5FF6A 3J8F7 3CG8A 1QMUA 2A6KB 4NZ8A 2XWEA 4DP4X 3LD8C 3QI9A 3MJ9H 3JUYA 4LKXA 1JZ6A 4DGVL 3GIVA 3O4OB 1WA1X 3ARBA 5KSUA 4Q9QH 5DZPA 2IXQB 1R3HB 1OM3H 3HR5A 2Z91A 4F7TA 5FUCC 1FL6A 1A4JA 5T5FL 3LKRA 4APQB 4PJXB 4BZ2L 3SEPA 2ZXQA 2OSLB 4QNPF 3KPOA 2ENSA 3APNA 3CX5J 1PVHA 3IM1A 1NDGA 1BAWA 5C0RL 3A67H 4V1DD 5B1BB 1SN0A 2C9XA 4ZAKB 5FYLL 3WE6A 4BE6A 4OCRH 4OUUA 1AGEB 3ZU8A 4E36A 3DGGB 4XPBL 2PABA 3ZTEA 4X7SH 5C7ZA 4OKDA 3EYSL 2BW4A 1HWWA 5KBMA 2JQZA 5DUMH 2OTPA 5KJRH 5C86A 4LFHD 3HFFA 3QCTH 2AI0L 4L8SA 1RK1A 4FMKA 1PF3A 3KWTA 2C3WA 3O6FD 1A4AA 3QNYB 5GISH 1JPTL 3RTLA 5E8NA 3S3BB 4EVNA 2ZZUT 1RHFA 3L81A 4HCRH 2RFXB 3Q2WA 1FJ1A 2AXFA 3TIDB 2C7UB 3LNEA 2B4CH 3QZMA 3ZYOA 3CBRA 4HJ1A 5HDBE 4HUKB 3L5IA 5F8RC 3R0MA 5ID0B 2IGFL 2R0ZL 3DA0A 5AALA 3S4SG 3DXAD 3B6SB 4LSTL 5TH2A 2IQAA 3CN4A 3DTXB 2TSAA 1NAMB 1ZVHA 3RWJA 1RSYA 3VD0A 4K3JH 4ZTEA 3MV7D 1N7ML 2E76C 4HEME 4P59H 1IGFH 3LKSA 4KV5E 4LZKA 3GSVA 4HW6A 1GZQA 1JV2A 5FFGA 4X83A 3RDJA 4FZ8H 2QV2A 1RJYB 4AQOA 1CLCA 4KY1L 3S5ZA 1MJ8L 1G5AA 1QBAA 4WFHE 2X12A 4QRRA 2JCCB 1MCIA 4ZZFA 1CC3A 2O61A 2KQNA 4HEPG 2DLHA 2PWFA 5KJ4A 4G42A 2FX7H 1ZLWK 4URKA 1OE2A 1CBVL 2DYSB 3N9GL 2ZX5A 4QGTA 4QXGH 12E8H 3TN0A 1N6QL 1YMME 1LNUB 1IT9H 1SOQA 4O51B 1F13A 5I1IL 5TGBA 3VVWA 1FZKA 3E38A 4DP6X 4OSUH 1G94A 3HC0B 1H3VA 5K9JL 1W91A 4P2QA 2NSQA 3TT3H 3VFSA 3MRGB 3MBED 2PCPA 1EZUA 2BZDA 2WLLB 4XVSH 3FSVA 1MWAB 2J6WA 4FQ2L 3KYNA 1RFDH 5FFLA 3QEUA 2VH5L 4NSKB 5L6YH 3IBOA 4GFXA 4MAZA 3WTSA 4L3CB 5BRZD 3FFDB 1M6OB 2VLRA 4PJEF 5F7NC 4XBEH 4Z0XB 2GK0A 4V2BA 2HCZX 3FT1A 4QYOA 1ND0B 1RZ7L 1M9SA 4CADA 4PS4H 5I1JH 3QQNA 2NTFB 3O45A 4P4RA 1PKQB 5KYYB 2Z1KA 4PJIA 2M26A 3MXWL 3WNMA 3VFVA 3A4DA 3NIFB 1VFBA 3L48A 4Z7NF 1TYRA 3BPOB 3UBHA 4XP9H 3CWGA 3RL1A 5CWSB 3HNSH 4PP1C 1O7VA 1OV8A 3L9BA 1EHAA 1QACA 3FU9A 5F9AC 4R90H 2XQBL 4YE0A 2PO6B 4JRXD 3UBXI 3VFUB 5DJZA 2BSTA 2VC2H 1TJXA 4PRAA 1GPOL 3DIFA 5I23A 4NUJA 3AM8A 2HVKA 5E6YA 3VQLA 5JXAH 4WI6A 4ACPA 1KSRA 4QHUA 3CFNA 3GHBL 3DURB 4XNXH 3P4OA 2W9EH 3QIUD 1JNNL 2IEPA 3KDMB 4OF8A 4KHTL 2Y06L 4U1GC 3K6NA 5HHMB 5ABZA 1F4WH 4ZPVB 1HHJB 3BP5B 3KL0A 4BFIA 2FT8A 1NCDL 3DMMB 5JPMC 2AABH 2P5WA 3GK8H 5A2IH 1FVCB 4Q6IC 4I87A 1WFMA 3STZA 2R83A 2QSQA 4YK4C 3BKMH 3HAEB 4Y4KC 4IRSB 3L1FA 4MTMA 2KDYA 5GGSA 3Q2CA 4HEMA 4DGYL 3IXAB 3AQDA 3WTTA 3MCKB 5IUSA 3X3FH 3HC4H 5JHLH 3ULUF 2YKLH 5IFAH 4JB9L 3NACL 3QXDA 3OLIA 3MRMB 1O6SB 3PXJA 3NJHA 5HHVH 5HGAA 4KRNA 2N56A 4BFNA 1JDCA 3M1OA 1S7QA 4YO0B 2UYLB 3I6KA 2ZCLL 1WS7A 2CDFA 3H3PH 5CINH 3F7KA 1BZQK 2R1YB 1L9OA 1XGTB 2CH8A 2XQYK 4Y5YC 5TFSL 1YMMA 3TO2A 3WLBB 3DSFH 2P5ED 2E75C 3H6JA 1EO8L 3C09C 4OGYL 4OZFH 1LE9A 5ANME 1KB5B 3GGWB 2P52A 1WWBX 1T2QH 32C2A 3KW7A 4U3XA 5DZOA 4ZFQA 4ERSH 4ZUWA 3H42H 5HDWA 2XJLA 3TFKC 4MZ3A 4ODUA 3K72A 2VKWA 4XRCA 3POHA 1YYML 4PJBB 2W38A 1XDTT 2O72A 1T1WA 4LO9A 5T1DL 2WINB 2X6UA 1XCQA 1B6DA 4XPHH 3IKCA 1R3LB 1DQDL 4UBDC 4Y7MA 1HYSD 5I16B 3KPRD 3D1MC 3BLPX 1UZ6E 5I30L 1AAJA 1F3RB 2AQSA 3MGTB 1FCCA 4PREB 5KYWB 1E42A 3SE4A 4TTDD 5I0YA 1OALA 1XR9A 3O6ML 3GRBA 1KG0B 4XC1L 3QJXA 4JHAL 2NXYC 1XF5A 2EO9A 4QO1B 2XRAH 2VMCA 3MKGA 3VCLB 3FN0L 5I1CL 1MLCA 4HISA 1H0DB 5KUMA 5LCVH 4A2MA 4H8WC 1FFOA 2A74A 4U6XA 3NFPB 5DVLA 1KPRA 2Z65C 3ATFA 3JWNG 1JJUA 2VZTA 4FLSA 4UTAA 1KMGA 4N2AA 3OSVA 4XBPB 1TVHA 1MHHA 1YY9C 4HMCA 4KH2A 4M7KH 1WA0X 2FNBA 2GJPA 3IMSA 3X2QB 4JMNA 4EI5C 5CBEB 3L3JB 1QHQA 4PJDE 2OL3H 2KQMA 2OK0H 2IBZX 5KS9B 3BH8B 2GEEA 3HB3C 3KPSD 4YSRA 1FZJB 2G2NA 5EO9B 1D2PA 2HSIA 4KJQC 5D7HA 3ZE1F 2CNYA 3UTPE 5AD0B 1VGKB 4WHYG 1ANUA 2DMGA 3Q5TA 4GG6B 1OP3H 3DO7B 4N5UA 4RDBA 2XQYA 5EC1A 1NC2B 1QO3B 3KAAA 2OSWA 4RRPM 2ZD0A 1E6OH 1JYXA 4F24A 2JELH 2H2PD 1SXCA 3LRLA 4YDKL 2NY3D 2IF7A 1I3GH 4ODHL 5JOFA 4U1MB 1IU1A 3TEXA 1CFQB 5E0QA 3TXAA 4TULL 1N9PA 5IROC 2NY0D 3MU3A 4PD4J 3ARYA 2WO2B 5C8JA 4OGAD 4U4BA 2HKHL 4OCWH 1NA8A 3QUKA 4XX1E 1S8DA 4KAQH 1ORSB 1KTJA 4IRZH 5MEPA 2FGWH 3IU3B 4DJMA 1NCNA 4PJIF 4LU5H 3IKKA 3F2LA 3FZUC 1A65A 2F8IA 3V0AC 3RDTD 3U2IA 2Q7YB 4MA7L 2P1YA 1HHIB 5I2IB 2VDMB 2Y25A 1G0DA 2CO1A 3U0PA 2DH2A 2W0FA 3EYQC 3LHPH 2OX5B 5ANMA 2BNQE 2P43B 5D1QE 3WG7B 4JRYE 4EE2A 2VXVH 3AMKA 5IMKA 5I6XB 2OI9B 2XN1A 3CVHH 3ZOAA 5I5JA 1W72A 5D71H 3X3GH 1BOYA 3ZKQD 2OJZH 4TUOB 3VNZA 5SWQB 1D6VL 4NFDA 4Q0XL 2HG0A 4R4NC 4ZOEA 4XNBA 1A14L 3OKLA 4X8JB 3J7HA 3T4YA 5IMOB 3NN8A 3CD4A 5D7IF 4HHWA 1T83A 3PABB 4G9FA 1DJGA 2Y9RT 1NZRA 4R83A 5I26A 5EEVA 2PWGA 4U1LA 2Y1VA 3DIDA 3PLYA 4WDIB 4Y2OA 3AAZA 1TLMA 5GGRB 2CO6B 4Z7UE 3HMWL 4BSWB 3LS4H 4RGNE 5KANI 2JXMA 5FKPA 3VFPA 5EZPA 2EACA 4HJ0C 3LRSB 5CP3H 2PWHA 3ARRA 3ETBF 3Q44A 4QRTB 3AWFA 4B9PA 3BGFB 1CF8L 3QPQD 4K73A 4X6FA 1IBZA 5L8LB 2VXQA 2I60L 3T3PE 5I82A 3E9TA 4PJDA 2X2YA 4ZO9A 3OXRA 3O9WC 4FAAB 2WXHA 3ATAA 4OLYH 4PWFA 3EZJB 3NJGA 4XP5L 4MJ5B 5AVWB 5MP6L 3VD7A 4E42B 2WXIA 5BZZA 5LGHH 1OVZA 5DA0B 3ZE0F 1AGBA 2DQFA 2VDRL 1B2WH 1JFQL 2UY6B 3VXPA 3W3BA 1QASA 2V7HA 4LOEA 1ZGLA 2FLMA 4L3EB 4U6VL 2NUPB 2WQAA 1BD2D 4ZOBA 2CHXA 5JXED 4WTQA 1FFTB 3VAEA 1A4CA 3IF1B 2PPAA 3MRKB 3MV9E 4L4JA 3LIZL 3GDBA 2LVEA 1GOGA 4AIEA 5AWNH 2WTRA 1NLBL 3VFWA 4CU7A 1Z6JT 5HHQA 3KBFA 3L9EA 1SY6L 5FS5A 1AXIB 1BYPA 4L0ZA 1JHKL 1N7MH 1ORQA 2CGRH 2XTJB 5IREA 1B6UA 2BVOA 2IFFL 1NGXB 3RP1A 2XPGA 3B7SA 2X4RA 2XX1A 3C5XA 3HMXA 2ZF8A 2OBGA 5AVVB 2BFVL 3L4VA 5EZLB 5SX4H 4QUOA 3BUTA 1OP5K 3JTTA 5CILL 2KS0A 2XBTA 4A7UA 1J10A 3ARGB 1NIEA 3K1DA 4M93C 4I9WD 3ULSB 5E8OA 3BKYL 3P40A 5D6CA 2XWCA 2BNQA 3HG1D 5D1QA 1QBML 1IC7H 4JRYA 3NH7L 1J5OH 4HG4K 1HQ4A 5ITBL 2VQ1A 5IJBC 5EUKB 2JB6B 1DSFH 1RK0B 5L4IA 5KSVB 3LH8A 1BZOA 1E3XA 4RESB 4EDWH 4O02L 2IH8A 4O58L 3IFNL 3ZIYA 2Q3XA 4JO8A 3RIAF 1M7XA 2WIMA 1N4XL 1REIA 2QHLA 3A5VA 5ADPH 4N8CL 1VFAA 2B3IA 2YQBA 2HYMA 2XVKA 5HYQB 2FIKA 5DQDL 2R2HA 5GHWL 1KLFB 2X87A 5IVXB 3EUDA 2WNKA 2ZTBA 3QK0A 3T8XB 3AG4B 2KI6A 3VE0A 1OB0A 2P4AB 3EH2A 4MXQD 4WWID 1QQDA 3ZKMD 2WXFA 3MX0A 5C6TH 4NP9A 4XP1H 2X42A 3PDGA 5DEGB 2L4OA 4AYFB 2R8SH 4HLJA 3GSOA 4BK5A 3RWDA 2B0SL 4Z7UA 5DUPH 2OSYA 4G8GB 5DZJA 3ZT5A 3MXWH 2EO1A 4K94C 2EABA 4H8WL 3A22A 3QJFA 4MMXC 4FCHA 1MREL 2YEZB 4HWEH 3SKMA 4J3WA 1VRSA 4WEEA 3MJWA 3INUH 4K4KA 4RISH 4HKBA 2ADIA 3T5WA 5I18H 3TBVA 4DPBX 3SKNA 1BJMA 3NJJA 2NY2D 5DRXA 4C4UA 3ULUH 1CICD 1OW0A 3O8XC 3ZR6A 1RZ8B 2RALA 1E2VA 2CBMA 2P8LB 2YEQA 3HRZB 5I1GL 4N68A 1GGIH 1JNNH 2ZNXA 2OMUB 5H2BB 5INDB 5EEYA 1U41A 3GHEH 3VMNA 4JM0A 1U3HB 4OLUH 1TO5A 5TE4L 1EXUB 3EF4A 3MRQA 3RBSA 3FOMB 2BY2A 3HS8A 3MV9A 2WLIA 1S7SB 4UT6L 1U8JB 3VXQB 2O5XL 4K23H 1OO2A 4X42A 4KTEL 3O2WH 4NM4H 4NN6B 5IQLA 5MI0C 2GCYB 5JLZB 3CX5K 3V4VB 1EHLH 2ZCHH 2A9DA 5DD0H 4MMZC 4ILDA 2OMYA 5F88B 4DPCX 3F7YB 4MZ2A 1TQBB 1YEKH 3D69B 3KZ8A 1PKQE 2IXQA 1R3HA 5D72L 5AUMA 2LU7A 3ZRFC 2VNCA 3SE9L 4UANA 2WOYA 3CZNA 4NKDB 1JPST 4X8XA 3SPGA 4E5XB 2DF3A 4APQA 5I17B 5CGYC 3NIFE 2UZIL 1TOXA 3ZL2A 3FUNA 4EZMA 4ZAKA 4BZ1A 2APVA 3MOQA 3S3CB 4L4VD 4UTBH 3DGGA 2GIMA 4UOW0 4AM0Q 5DLMH 5L4MA 1NWOA 4IIZA 3ARSA 3K74B 4MDJB 4P46C 4BSVB 5DHYB 5F7BA 2UXVA 2GUOB 4HIEB 1AGCB 1CGUA 1FL3B 4YFLF 1NCJA 4PJDF 4OFVA 3IRCA 5ESVA 1CO1A 3EW3B 3QNYA 5FYKU 4CW1B 2BP0B 4L1DA 4PWHA 4U3SB 3U7WL 4K5PA 2RFXA 2QDVA 4YGAB 2B2XL 2NNAB 2DYRB 2KYIA 2QGEA 1EGJH 3SODB 5IT2H 2FQDA 2A9CA 5ID0A 2PPFA 4W9EC 3H8NA 3OB0K 4GMSL 3S48A 2EIKB 5E00A 3L7FB 1BFOB 1AQDB 2VM9A 3DTXA 4NPJA 4BA0A 1NAMA 1MRFH 2IPTL 5B1JA 1SHXA 1XV8A 1DE4B 2EXYC 2X40A 2VO8A 2PTUA 2XN0A 1TIUA 6FABH 1U2YA 4RBPK 2COQA 5KSAD 3GTVA 1OY3B 2AEWA 4OV6F 1SYSB 1NANI 1PFCA 2K78A 3UG4A 4X9FA 5D7SL 5KVFL 4DOHE 1NSNL 1JF1B 1SJMA 1V54B 5F0PB 3MRDB 4A2FA 1KWGA 2FATL 2J8OA 3MBWB 1AR1C 1ID2A 4PCTA 2EEFA 4Q4IA 5LG1A 3NFSL 3DX1A 5FYKL 1IAOB 4X6DF 5EU7E 4IW4C 3SCMA 2FBOJ 1PIFA 4PB9L 3WTXA 1VZIA 2K8MA 1NAKL 3CDYA 3TV3L 1QFHA 3GSRA 5D5ME 4FF9A 4TLKA 3AQXA 2WBJA 2DMCA 1HJCA 4JHWL 5I19L 2J21A 2WLYA 4QLWA 3FUFA 1R9FA 3I02B 3MV8B 4RFNB 1MWAA 2OFQA 2A38A 1E50A 4Z3JA 2H9GB 2AEPL 2R1WB 3UAJD 1JZ5A 2YJLA 4NSKA 2EDNA 3ZVVA 4L3CA 3KLDA 3FFDA 3WEMA 1M6OA 5DZVA 2D7OA 4P2CG 3CIQA 4GRLD 3WEAA 3UJJH 3HBPA 3N43B 1UM4L 3DUSB 3WCYA 1S7RB 3NYKA 3F83A 2NTFA 1KBKA 2WLZA 3Q01A 4BCYA 4N8VB 2XC8A 1BM3H 1TITA 1U21A 1PKQA 5KYYA 1ZLWH 1Y1UA 2HT3C 4XVUC 4IHOB 2QQKL 3PNRB 4K5MA 5CN1A 3O11B 5AVQB 4AJYV 1X5AA 2N0KA 4M5ZL 4DN3L 1R5VA 5A2KH 3WNJA 3V6FA 1C5DB 4M62H 4Z7UF 3QG6B 1F86A 1BP3B 2ZWZA 3MGOB 3D12B 2VW4A 2DJMA 4WZ9A 3W39B 3P3YA 2AGJH 3O81A 3FB5B 4PU2A 2PO6A 3VFUA 1CQYA 2V5TA 3VYPA 1EJ6A 1C16B 3RTQD 4XR8C 3UFIA 1MIEL 1T1ZA 4QHMB 3AB0C 4N9GA 5BRQA 3T3PF 4E0RB 1M56B 2JV6A 1QR1B 1TQCC 1DQIA 3KDMA 2B59B 5JIPA 4CBPA 4Z23A 5ICXB 4IQHA 3RY5A 4GG6E 2ZUSA 3KYOA 4LSSL 3BP5A 4KJWD 4DGUA 1T5XB 3DMMA 4AGPA 5TK2A 2ADJB 1RZJH 2ZKYA 1FVCA 4HGWB 4UOW1 1CTMA 2XJKA 1LEGA 4E2OA 1MCWM 1XIWA 4X5RA 5HDQL 3HAEA 2YFNA 1IGIH 3QYCA 4N90D 4IRSA 4BM7A 1HZHL 3HPJB 5B39A 2CUHA 1EMTL 3IXAA 3WFBH 5JQ6L 2DMBA 4ZNEE 3PIQB 4K94L 4OFQA 1ZLSL 2DMHA 5F9OL 2DS4A 1WIOA 2E46A 1WBYA 1UADC 1KT2B 4GRMB 4JDEA 2KLTA 2VDKL 2YA1A 3B2VH 4HZ1A 5J11B 3F5WB 1C5CH 3EJSA 1BQLH 1GRWA 1U33A 2RCSH 2UYLA 5TE6H 4CL7A 1LP9B 4PCSA 1IC0A 2BVEA 1K85A 3NZUA 2R1YA 4BH7A 3GI9L 1WAAF 3VQ1C 1TLKA 4X5LA 4FX5A 1QA9A 2BPBA 2XXGA 5D5MA 2HG5B 2VCOA 1S7XA 1H3TA 3AADB 3QUYC 2DWEB 3WN5B 3MLTB 4M6OL 2E47A 1UXLA 1YN6B 3SDCA 4L18A 3O2DL 5DT1L 4D9QE 4QXTB 3L8QA 4LASL 2UZYB 3PAUA 1BMGA 3BW9A 3LH2L 4K5LA 4N8PA 2IG2H 3CSYB 1CXKA 3MLSL 3WKML 4ZMWA 5IGXL 2WINA 4WTZA 5KBDA 2MHAB 2AEQH 4UTAH 3RGVD 5L2KD 4HJUA 4ELDA 4G6KH 4OD2B 2P80A 4HIXL 5DZ9A 5FGCE 1F58H 4XAWL 4CC4A 5KYWA 2GJZA 5J8OA 4DFHA 1YEWA 3S4SA 4JFOB 2J88H 5D6DA 1DQKA 1DVTA 2YPVL 1PW3A 3HI6L 2F74A 1KG0A 4LE8A 5BV7L 3QUHA 4Z7OE 2G3ZA 3RILA 4JFFB 5IZ7A 1MH5A 3NQKA 2WK2A 3COOA 3ZXAC 1X6LA 3FUJA 5ICUA 1QSZA 1NM4A 4N4YB 3VVVA 5CILH 1IM9B 1U8KB 1ROCA 2MCPH 4OLZH 4KFMA 5A16B 1KGCE 4L9LB 1UH3A 2ZAGA 4PJAF 4R26L 1AZNA 4XBPA 3I85A 4H88L 3VWJC 3MRIB 4HEPA 4BGLA 1YEDB 4KZEH 5JPNC 5F0MB 1HXYB 4QXUL 4U1NB 3L3JA 5B21A 2DM2A 1I3UA 1DYZA 3HHMA 5MERB 3BH8A 2YGVA 4OJFH 4U6TA 3KE0A 1PD0A 3BGMA 3NH7H 3GMOA 4HOMA 2X10A 4KI5C 3DJRA 2G3NA 4EZJA 1MLBB 2F19H 2OMTB 1KCUL 5IY5B 5AD0A 1VGKA 4IDJH 3CSPA 4GG6A 1ZCRA 3DO7A 2K9FB 1J9QA 3OC5A 4L3EE 1QO3A 4PD4K 1P5UB 1KJ2B 1P7KB 1YYLH 5D1ZD 4EBQL 1N4XH 2WCPA 3SB3A 4KNTA 5FW7A 2XVGA 3C9NB 5HBBA 3MLRL 4QHLA 2I5YH 3RPKA 1JF6A 3EYFB 4U1MA 1CFQA 5D9SB 3WFDH 3IJEB 1BAGA 3NIGF 5TPWH 2FECI 2IV9A 1ACXA 2Y5TB 3PY9A 4JFDB 3CDZB 3SOBL 3VACA 4ZNEA 3C60D 1W72H 1WPCA 5BRPA 3CPLA 5KW9H 5LN8A 4GYBA 1SNRA 2FX8L 3HZYA 1SF3A 1YA5A 4IM8A 2AJYL 5FWRA 3BSHA 4MNQB 3UG3A 4EOWL 1W8OA 5LKNA 3IU3A 1T4WA 5MENE 4G7YL 3D4CA 4GKSB 1M4KA 1NCGA 2ZYSA 1FGVL 2Q7YA 3MR9A 2X41A 5DTFB 4FXLA 5J6SA 3QI9D 4AENB 1SDDB 5E9DD 3JWNE 1C9SA 3WTVA 4KKAC 2F7QA 1MXGA 2VW7A 2YGNA 4PRBA 4GUPB 3HHSA 3U1SH 2OX5A 3GJFB 2CM5A 4LARH 3HLAB 4JM4L 4RA3A 2XU9A 3KCPB 4ZX4A 3CDCA 2XTJC 4FFWD 3W0WB 2WSKA 5HDRA 2ZOWA 1M53A 3TJEH 1BA9A 4TUOA 1CMOA 2BOLA 1KCSL 1UD4A 4NBZB 4I1RA 1BCIA 2N7SA 1THAA 3MLUL 2F8VA 5IMOA 4HX1B 4PJCE 3R7QA 4LBEB 2A2QT 2VXQH 3D30A 2IDFA 4P5TA 3QRLA 4HAGA 1HVXA 5IVXE 1E4KA 3PABA 3E6FB 4I88A 3LSOB 4S2SA 1TQWA 2CIKB 3RWHB 3VYNA 1KB5L 1E5YA 5C6PB 3NPSC 1BQHG 4C57C 4L8DB 2CWRA 3ROOB 3GBEA 2QKSA 2Z6FA 1NFAA 1LO4L 1BREA 1X5HA 2CO6A 3ASOB 3GS4A 4PI2A 4BSWA 2DQCH 3SBWA 5ALCL 3II3A 4Y19D 3LN5A 5D1XC 3LRSA 3WY3A 2APBA 4U3HA 4WWKB 4QRTA 3EGXB 4HLEA 5I6KA 2R69A 1UGNA 4G6AC 3WSQH 4HIHA 1TYJA 2DQHH 4XGZB 2AJUL 4LDLB 3IDMA 3AXIA 3PRZA 3F7VB 4ZO7A 2QEJA 4UQEA 4E42A 1QW9A 3E80A 1Z2KA 3G08B 2EXWC 4BKLB 1G6RB 5C0AD 2VRKA 1JN6B 4MBRA 3HMXH 1K5WA 5D5MF 2Z93A 4L3EA 2NUPA 3M88A 1SYVA 1KTCA 2FH6A 2Z7ZA 5SWSB 3IF1A 3TN0D 1CE1H 4Y2DC 3AU1A 5FW8A 2FO4A 4NQEE 4AOFA 1MFDL 1N5AA 1JGDB 3BKCH 3MRJB 4PRDA 4GXUM 2A4CA 4PIRF 2IPTH 4Q4EA 3VRIB 2CMRL 5IESL 1SBSH 1YUHB 4JKKA 5G2NA 2R7EB 3D3VE 4WEBL 3L3IA 1CFSB 4D9RE 5L4JA 5E0FA 1OEZW 3D39D 5D93B 5EU3A 3ARWA 1Z9OA 4P9MH 2G2RB 2X4SA 5MENA 4PJ9C 1B0GB 5I0DA 1UHVA 1AZZC 2EEDA 2CO2A 5C0BE 4XPTH 1JZ8A 3WTYA 5IB5B 2FATH 1GSKA 3FQ2A 3APCA 1DFBL 4YHKL 2QTEA 3RBGA 4HULB 1OAUH 1X9RA 2NYYC 3SDYL 1EJFA 4NO2B 3QB7C 1I9IH 2XFXA 5I75C 4C56D 2DLFH 2ZUXA 1OSPH 1TZGL 4LOVA 5EUKA 1RK0A 3FT0A 2X4TA 3REVA 4I13B 1C1EL 3KLHC 2X4UB 3FPYA 3QISA 5BS0E 5KBKA 1CL7H 1RPKA 4XPFL 1J8HB 4KRPB 3EH4B 4Z1PA 1N6VA 4PJCA 4LNRA 2OR8A 3V5DB 4O9HH 2AXGA 2BNRB 4BCZA 4DTGL 5HYQA 5IVXA 2OQJB 5J12C 4Z0BH 4DO4A 2L0DA 5E6ZA 4FG0A 2XOTA 1B2YA 3CH1B 5BOPA 3NOIA 1OP5H 1IBGH 1CPUA 1PU0A 5DEGA 1ZVSB 4DZ8B 5KSBE 3QUGA 4KTYA 2NSMA 4XP4H 3UTSD 4DKFL 1IAKB 2D73A 1KBGL 3FOLB 4ORZC 4OCSH 1GCFA 1AD0A 4AK1A 3C2AH 5BOJA 1U8QB 3KYKH 2QQNH 3WNKA 4I3SH 2VXUH 2YEZA 4GP4B 4ZMZA 2IAMC 5T5FA 2QVMA 1RUQH 5E56A 4BZ2A 3SHSA 1JGUH 5F71A 3QFDB 3OGCB 2ERJB 4F15C 4UIKL 5DJAB 1JAEA 2LLNA 2AQQA 1G7QB 1A9VA 1B4JH 3MTRA 4FNQA 1I75A 1OE1A 2EVFA 1RZ8A 3APMA 4EIGB 4NCC2 3HRZA 4ZOAA 3UCQA 5C08D 5GJSH 3BH9B 4FFZA 1TT6A 2PN5A 2BSDA 2D7NA 5H2BA 4X8CA 1NL0H 3KEDA 1AP2B 1FHNA 4A7TA 4FFYL 4L1SA 2XXCB 3QEQD 3HS0B 1Y1DA 3MV8E 4ANKA 5EZJB 2Y5QA 1RXLA 2BMKB 2E9WA 1U8JA 3Q8CA 2M83A 2F5AH 4NQEA 2WMPA 3VXQA 5AVZB 2UY7A 3U4BH 3OM3B 4A04A 1VJSA 5CLXA 1MJ7H 3BVNA 4G71B 5KYXB 2GCYA 5JLZA 3V4VA 1I9RH 1NMCC 1FPTH 1JL8A 2HLFC 4M6MH 4KHXH 5DHDA 3D0VA 5IW1B 2WVTA 1IGML 1DANU 5F88A 4I3RL 4FQCL 3C12A 3F7YA 4PP1D 3D69A 4OVUA 3D3VA 1AQKH 2EINB 2JJWA 5ABDE 4WUKL 2FVNA 2FHFA 4M5SA 4OCLC 3K6SB 1GIGH 4Z7OF 3B5TA 2ZYHA 4D0DB 3W2DL 2OCCB 1T4KB 1N3NA 2K45A 2KPNA 5C0BA 1G7HB 4MASA 4AG4L 1X5JA 1JGLL 2OJEA 3QWRD 3H4HA 3E0GA 4P57B 3K2UL 2OLDA 3R19A 2HMID 3KHQA 3EUUA 2WQVA 3SKJH 1R17A 5F7MC 3S9DB 1OF2A 1NAMH 2EXTA 4Q9CA 5ENWB 1C7SA 4FTVB 4Z7AA 1X5ZA 1FL3A 3Q2NA 4JDTL 3RAJL 5FEBA 3VTMA 3D8MA 1F42A 5EZIL 1OCWH 2AK1H 1L3NA 2BP0A 3MGAA 5CEZH 5K39B 3IPEA 4U3SA 4PBVC 3QWQB 5BS0A 3EO1B 2WYTA 3PHQB 3T6VA 2NNAA 2IPUK 3IPFA 1KCLA 2FJHA 5GRXG 4C54A 3P3UA 4P5KB 2W0PA 5JMOC 3STLB 3JWDC 5FO9A 3WN6A 3NK4A 1W6LA 2YGPA 1U3ZA 3L7FA 4OH2A 4KO7A 2Z31B 2VLJD 1BFOA 1AQDA 1F4XL 2X1OA 4FKEA 4MJIB 1I85C 2W92A 4I0PA 2GQHA 3AWGA 4J3XA 1DE4A 2D3NA 5KSBA 4N2MA 3RWEB 1DL7H 3UP1A 5T1KD 1ZEAL 2LU3A 3DJTA 1H6FA 2QKIA 3CLWA 4NKMB 2OTWA 4ONFH 3L4CA 4N85A 3GEWB 4HIIB 5DYOB 3QBTB 1Y6NR 1MWAH 1XFPA 1JF1A 3MRDA 3HKZA 1ET8A 4GB9A 2IANA 4FLOA 4R26H 2IMMA 2DBLH 1LP9E 2GBVA 5E7BA 2J2ZB 1A7OH 4K3DL 3TFKD 2A6JB 3RL2B 1MEXH 3EGSB 4K15A 4NQCE 4UT9A 3MLWL 5LVEA 2HA1A 4JJ5A 1GHFH 4UBDD 1RK7A 4HUXB 4UWQB 3EFOA 1LJMA 2JJTC 4QCIA 3BZDA 3I02A 3MV8A 4XVOA 5DJXA 5MEQB 4X4XA 2FEEI 5LG6A 1I3RA 2NXYD 4J3OC 4LHUB 3MLRH 4WFED 4BK8A 2DDQH 4KUZH 5F6IC 5HYSG 4O5LH 1FYTB 4U05A 4PJCF 1ZHKB 3DUSA 2MNJB 2QSCL 1S7RA 1UXSB 1HE7A 3CLFL 4RMQA 4OCYL 1CJYA 4F37K 3ZO9A 1FNHA 1P5VA 3F01A 4KITB 1NMAH 3V7MA 5E23A 1HAUA 1YSOA 4NNXA 5ACLA 5AZEH 3VXRD 4PGEB 4IHOA 1UA6H 2J57A 1BFVH 3O11A 3QJRB 3DV4A 4FOMA 1YY9D 1KGJA 4LMQE 1BOGB 2GY7B 3DJZA 3P9MB 1A3LL 4AMXA 1PX3A 3QNXB 1C5DA 3GSXB 4BZYA 3HB3D 3QG6A 2W07B 5GSRB 1CFNB 1FGVH 4Y2NA 3VJ6A 5AW2B 3UDWC 3W39A 3FB5A 5IQ7L 4KJQD 3TASA 1N0LA 2VDNL 3GBLA 3HAEH 4OJCA 1WHPA 4L29B 4NN5C 4PJ7F 2EDTA 2K0RA 2NW3A 5KG9B 1OOWA 4MNGB 3NJFA 2ZP0T 4JM4H 4E0RA 4FERA 2VQ4A 4NCC1 3QXAB 3H2QA 4HV8B 3HE7B 5ICXA 3NPZB 4BE5A 3L6FB 4MAYC 1TQVA 3NFNA 4F7CA 4JS7A 4N0CD 3EBAA 4PRIB 4LDEB 1OOAA 1FI8C 4QXVA 3DVGB 1T5XA 2Q8BL 3PV6A 5GGSY 5IROD 1S5IL 1YJDC 3MOAL 5IQNA 4LVNB 2ADJA 1JV5B 3ARFA 1UA7A 3BJ91 1T0OA 4K7PX 4KVCL 2WLNA 4D7BA 5HTSA 5FHBL 3MSPA 4XVJH 3UTPD 2CM6A 4XE0A 2J6EA 3UPRB 3HPJA 3L3HB 2AJSH 4JFDE 3K2IA 4F9PA 3D2UA 3GXMA 1LO3H 3AABA 3FZUD 3LVTA 3LPPA 1R0AL 3PIQA 4F8NA 2D8KA 1XBRA 1TDQA 1RZKH 4GRMA 4YIQB 3B2XA 3HG2A 4IHBA 3EYQD 3RB7A 3F5WA 4GW4A 1S7UB 2N7AA 3W82A 1BXVA 3LPFA 1OANA 4MD0B 1CTNA 1LP9A 1F3JB 5HJ3A 4NKOB 1A7RL 2DWSA 4BD4A 1UCBL 3FHQA 1EDYA 5I6PA 1WZAA 2J4WL 2BHFA 4NQCA 3NJLA 4P2RB 4R4ND 4XN9A 4EIBA 3CVDA 4NJAL 4XCEB 2HG5A 4B9KC 2I07B 1SPDA 1J88A 3GIZL 3FDWA 3W0WE 3WN5A 5I5MA 1DBMH 1UCTA 5GS3A 1EJ8A 2MIZA 3OLDA 2G5RA 4QXTA 4HETA 2UZYA 2XKNB 4GXVH 1P7QA 3TNNB 4P9HH 1I7UB 3A4EA 5LBSH 2Q2LA 4ZPTA 3PJSB 1A5FH 4RMWA 3GXPA 2CLRB 3KGRA 4L48A 1Z66A 3OG6B 4RX4A 4CMHB 3BSGA 5E2TL 2BCMA 1E65A 4OD2A 4LK4A 1IZJA 2AQ1A 1RU9L 1PGRB 5FW6A 2L7UA 5I8EB 2YAOA 1JCVA 5E4IA 5JHDB 3ZT7A 2ESVD 3GRWH 1UUSA 4AGOA 5K9KA 1RZIB 4JQVC 1NDMB 3CBKB 4ZFZB 3L3GA 2ZKHL 3MXVL 3CFQA 2I25N 3NJKA 2X3CA 4N3TA 1Q72L 3LKQB 3VQMA 5KSBF 3GJFK 1EZVX 5IOKA 5ISZD 2WVSA 2ZE0A 3O9WD 5FYKD 1IM9A 3MLVH 4HXAL 3U25A 1QBLL 5A16A 1MCBA 2HLAB 4MS8D 1TO4A 5FO7B 3OBAA 1D9KB 2C9QA 2FB4H 4HIJB 4W4OA 2NTSP 1YEDA 4HD9A 2PP9A 1MG3C 1PJWA 2ORBH 3KGTA 4L9DA 3ZY7A 1SGKA 2FJFB 5MERA 2YQ2A 4Y1AB 3EAKA 1E9QB 1EBPA 3FO0H 2XN9E 1MNUH 3ZE2F 3MQIA 2ICCA 3H1ZA 2DWDB 3RNKA 3G7TA 3L9YA 4TSAL 5TF1H 3WEXA 5GQBA 5IJVB 1EO7A 3L3DB 1IC4L 1QFOA 1MCDA 3WFHB 4J28A 3AY4C 3VYOA 1KJ2A 1P7KA 4G80B 1YNLH 4K0OA 1NCTA 5JMRA 5SWSE 3JWDL 3HNTL 4MAUL 4IGBD 2C9PA 5AKRA 3IVKA 1LHZA 5BXFB 1B0WA 4PSRA 2WOBA 2VDMH 3EO9L 4GW1B 5D9SA 3IJEA 2GAZB 2PXYC 1PDKA 2Y5TA 3KM2A 1UJTA 4JFDA 3CDZA 3IWUA 3HA0A 2VLLB 3CHPA 4ZUUB 4OFPA 3NABL 5GIRB 4DKFH 2DN7A 2EDYA 1EFXB 1KBGH 4MSWB 3TBTB 4L05A 4X9GA 2XG5B 3P0VL 5JW4Q 1D7DA 4DEUA 1D5RA 2ZCKL 4HXBL 3BP4A 4AITA 2AJVH 3G3LA 4GKSA 5EIQA 2Y36H 1BF2A 2W80C 4BXSV 4ZO6A 3O3DA 3B2PA 3GHPA 3S5LG 4AENA 4Y5VC 1SDDA 5F7WC 5MEOB 3HBZA 5EHFA 4D8PB 3P2BA 2OZ4L 3S37L 3LX9A 3UX9B 5EO1A 2RBLA 4X6CF 4NN7C 1VB9A 4G7SB 4GUPA 4DP0X 1UT1A 3QFJD 3GJFA 4XT1C 3ZGIA 4KROC 1U8IB 3HLAA 4RZKA 3RVVC 3V4PL 3KCPA 5AZUA 5E4OA 3BESR 3W0WA 1LEKB 5ADOL 3OR7B 5E6IB 3RVTC 1HEZB 3HC3L 4HH9A 3EGDA 5L88H 2XUWA 4OAWB 4B9CA 2FWLB 2NLJB 4X0NA 5IB3B 4LLUB 4EI6B 1T6VN 4I48B 2IQ9H 1L6ZA 2QQLH 1SEQH 3O2VL 4RSVA 2OR7A 1J8HE 1NUNB 4LSQL 4POZC 1AY1H 3KLLA 2R69H 4LBEA 2CALA 5EU6E 1UH4A 2BNRE 3SDAB 4NUQA 3LIZA 2PP8A 3E6FA 4FQJL 3TVMA 2Y7LA 2TRYA 3LSOA 3B5GA 2IWFA 4S1DC 1I31A 2CIKA 4M9OA 3HTLX 4Y4KA 1SLUA 1P1VA 3H4FA 3RWHA 1IAIH 1S9WA 4PGBB 4CSPA 5B1CA 1NTDA 4FEIA 1MG2C 1SY6A 3FBKA 4L8DA 3ROOA 1KFAL 2EC8A 5CGBA 3EBHA 3FK3A 5F89A 4X4ME 3ZSTA 4F1SA 3PP4L 4BYHA 2ZG3A 2X70A 3EJRA 2J5LB 1GY2A 4AQ1C 3K2MC 4WWKA 5DHVB 4NM8H 1IEHA 4YC2C 1JHLL 4CVWA 3TBBA 2BERA 2NY6C 4OB5H 1WCQA 3I50L 5DJ2B 3TZVC 3B9KB 2AW2A 5CEZD 1JGVL 4E41B 2XN9A 2Q76B 5L0QB 2Y0SA 4XPAL 3ARDA 3G08A 1XD1A 4BKLA 3HNVH 2GI7A 5HYFA 2B1HH 3X11B 1G6RA 3V0WH 1JN6A 3TS8A 2LV4A 4M4RA 2CE6A 4JG9A 1KCKA 4OLVH 3QHFH 2ODIA 3D25A 2QGDA 1D5ZB 2EP6A 4R97C 1L9TA 5SWSA 4WCYL 4O02A 5CJBA 4MGXA 5DC2A 4P23C 4EJ1C 2ENPA 4WJKB 3JWNH 2VXTH 3GLZA 5DUBB 5F7LB 4LRNH 2ERJC 1ZT4A 4A55A 2DOCA 3LNHA 4FQIH 4OVVA 4GOSA 3MRJA 3LRGA 2F8OA 3ZW3A 1OCZB 5CGYD 3GBMH 5JOEA 2CGYA 1YUHA 4H1LB 2R7EA 5EG6C 1T89C 1CFSA 1T3FA 2E8YA 2MQ0A 1CDBA 3SYQA 1ZEAH 2ZUQC 3IGAB 3S36H 4NRZB 3S5YA 3BAIA 3PXHA 4YPGB 4LL4A 5JOPE 1NKRA 1FQ9C 3N40F 1QNIA 4JKMA 4IKIA 3PF2A 4FEMA 3SDDB 2BWQA 5IB5A 3H55A 1ULVA 1YZZA 5A6LA 2XZCL 1P84J 1H3WM 1L7TL 1X6NA 1EEQA 3FUEA 3BN9D 3T0WA 1FZMB 4P4KC 4EI5A 2YMXH 3DYMA 4Y16B 4NUGL 4NZRH 4FTVE 1QP1A 1XGRB 1ZE3H 1QFWH 2OP4H 1E2ZA 4Q9RH 4K9EC 8PAZA 1SBBA 3DJ9A 3LPOA 4HPOH 5LNGA 4CVZB 3WIIL 1FDLL 2WZAA 5J13C 4OF3A 2X4UA 3JV6A 5FKAB 3TA4D 2NXZB 5IB2B 5K9QI 2NY1C 1J8HA 1UWEH 3EIFA 4ZX6A 2EXYD 1DQTA 4JE4B 3J07A 4F9LC 4YXHL 3GMRB 5TDOA 3V5DA 5EU6A 1PD6A 5HSFA 4B97A 4IS6B 1E9OB 1A3RL 3ARPA 3C5SB 4UT6A 3ZBMA 3VA2C 4KKCC 3FAWA 3KPTA 2K7PA 5IB1B 1H6TA 4MJIE 3CH1A 3FQNA 5HHMD 5L2JB 4OD3H 4Z7WE 4NQVB 4K55A 2AC0A 5HPOA 4JFXB 4QTHA 3KPLA 4ZD3H 1QOKA 3QFGA 4FFZH 1AR1D 1PY9A 2X4OA 2IGLA 4X4MA 5IWLC 1T21A 4LGRB 1QYGH 4YDZA 4HUNB 1TYEB 1UA3A 4ZMTA 3PDDA 1SDYA 4WKZA 1S9VB 5BMFL 3EFFB 3BVXA 2X6AA 3LRHA 4FJZA 4JHUA 3LNFA 3P02A 5DJAA 1XZ0B 2P7TA 1KCRL 5IR1A 2MJWA 1G7QA 4J7RA 3US9A 3V4VH 1ACYL 1CDUA 3BE1L 4GIAA 1CG9B 4OD1H 4B50A 3BSZL 2H0EA 4JGMA 5AEAA 2WQUA 4XOCA 4F8TA 5C97A 1EUUA 1CD8A 4H25B 2NX5B 3BH9A 5C09B 2F5BH 3S35L 1EIBA 4OR1A 4JPKL 3B7YA 3QDJD 4I77L 2VUYA 2LAGB 4UQ9A 4AQ8C 1LILA 1BMZA 1D3CA 3HS0A 4U0RB 3QULA 5CZKA 2JF1A 2N3JA 1U8LB 2IBGA 4M7LL 1BVZA 4MX7B 5CMAA 2BOBB 1DDHB 2H0PA 1XH3A 4G6JL 4HKZA 1ECYA 5T33L 2Z35B 4XVUD 3MUY1 4PS8A 4GPVA 4XMLL 4CN6A 2BSED 1NBYA 4LCCC 3UACA 1ZGLM 1J0ZA 4ZW7A 1ZV2A 3UTOA 4ZNCD 4PTUB 2X2IA 4J4PC 5SWZB 8FABB 2BINA 4CSTA 1BGXH 1BQHA 3HJ0A 4JANB 4PLNC 4A6YB 4UQBA 3F64A 1J9RA 3MNWA 3QE5A 1TQTA 2Y2YA 1FN4B 4D0DA 2GPZA 4N2IA 2DQUH 3CC5B 1M7UA 1C08A 2YRZA 2DTML 1G7HA 4NB7A 4WEMB 3WMSA 4P07A 4XO5A 3BAEL 2JK5B 3OJDB 1GMIA 4P57A 1ZWIB 1AACA 1OSZB 3CK0L 5LB1A 4LF3B 1CGVA 1ITCA 2EDMA 4TVPE 4ZUVB 1W80A 3C5ZA 1PYWB 1ETB1 3IFOB 4MNGE 3OKKB 4FTVA 2VDLL 3PWVA 2LOEA 1I7ZA 3HE6B 4N0YH 5DJ8A 3QIBB 1FHGA 4XBMA 3NZHL 3GIZH 1UWFA 2NNXA 4QIRA 4WW1A 4UAHA 4W4NA 3Q1SL 3ATDA 1AO7B 2RQEA 4FJ6A 4JAMA 4GQ9L 1NLDH 5K39A 3UO1L 2CA3A 4PRIE 1WJ3A 3PHQA 3LEVH 1O9VA 4YHNB 1JI2A 3A4AA 1U91B 4P5KA 1R3IL 2HJLB 3TCLB 4B9GA 3WY1A 4E9YA 2R4RL 2EC9T 3STLA 4KRLB 4GI9A 5FCSH 2FJGB 3QNZB 1EBAA 3GFUA 4R7XA 2AV7B 3F05A 2Z31A 5AW6B 4M1CC 1CCZA 4MJIA 4JFYB 4YR6B 2AQ2A 4RDQG 4P2OB 4UT9H 3ZL4L 3FYEB 4B5ZA 1NC2D 4Z7WA 1S7VA 5HY9B 3QXTA 3I2CL 2WUCH 4N9OB 3RWEA 3FN3A 2ZOTA 3FUDA 4NNPL 1P4IL 4GKNA 3VFTA 1F1AA 1CVSC 3SE8H 1PLBA 2EIZB 2HVJB 5DYOA 2ZONA 3NIDB 3RY4A 2HKFL 1IGJA 4JGUA 1VKXB 4ZFOB 2J1ZA 3NSFA 1Z3GH 4PLJC 2ZPKH 1KLGA 1RY7B 5ESAB 4Z9KB 4LVNC 4WU5B 1R75A 4G6MH 4ICXA 2G60H 5J6HB 4B7IA 2A6JA 3PL6B 2YD8A 3RL2A 3VG0L 2F54A 3EGSA 5KVEL 5AB9A 1VA9A 5GJTH 3T0DA 1VCBC 1ONQB 2IIJA 3E1ZA 2YXFA 2G30A 2BVPB 4HUXA 4TSAH 3UC0L 4FXKC 4ODVL 4AX3A 1QLFB 3DHJA 4AEIL 2DQTH 2EIMB 2LLGA 2W88A 3NCJH 4NT6A 2CBPA 4MD5A 5FOBB 4LCUA 2AK4B 5MEQA 1BMWA 3F3HA 2JB5L 5DC0A 4J3OG 1U2HA 4UAOC 2OXGA 4LHUA 1JTPA 4X6BB 3AACA 4DCQB 2FECL 2LT9A 1QZ1A 4QEGA 3VG9B 1SQMA 1E7UA 5GZNC 1L0QA 4HT1L 4NWUH 4JCMA 4JR9H 3BKJH 3N5AA 5JYMA 2W0KA 1UXSA 4ZXBB 1WTLA 2FT7A 1KIPB 4FG6C 3RVWD 3CSTA 4CU6A 3MBXH 3RZCC 4ZMOA 4PGEA 4PRPB 1A6UL 3VWJD 1UACL 1B9KA 3MC0A 4PCKA 1AKPA 1H8LA 3QNXA 3GSXA 1C12A 2BIQA 1CGWA 2ZCKH 3W38A 3BLKA 3AVEA 4OKVB 2ICEB 1TENA 4KI5D 3B7TA 1CR9L 3AY2A 3U9PH 2J6EH 1CF1A 1D5MA 1RJZB 1V7MH 3L5HA 1FUNA 4MNGA 2B5IC 4F1ZA 4K9EL 4GSRA 3OAUL 2R4SH 1E43A 3VSQA 2D0GA 3QXAA 1RUAH 3QEGL 4HV8A 3HE7A 2CKBL 4PRIA 1HIML 2CO3A 4KPHH 3W9EB 4K5OA 1DHKA 3DVGA 4Y2LA 4Y4HB 1YUKB 2HH0H 4J5VA 4ZW3A 5D7LB 4L2LA 1YQVH 4X2UA 1JIBA 5LWYL 2AKRA 1KBBA 2JTDA 3UPRA 4LLAA 2JKTM 2MPAL 4YNYB 4O2EB 2WYIA 1AZBA 4Z7IA 1MW2A 2V2WB 4TOYH 5F7HA 4FYRA 4P5MA 4HHGA 2FZ3B 1DBJH 4GAAA 3GM0A 5GRYA 5BPPA 3FUMA 4KKAD 3QC5X 1KN2H 3AJ7A 4YIQA 4EZKA 5IHWA 4PTTB 3UTQA 4JG1L 4YSSA 2CDEA 4DF9A 1S7UA 3U6RA 3TA3C 3FO2B 4OZ4B 2XTJD 4MD0A 4HZLB 4WV1B 5ES4B 4BHUI 2XWTB 4FLQA 5E03A 1T1XB 5B1KA 3S88H 2AS5M 3FMGH 4UI2A 3DDFA 3CHXA 3I6LD 4J23A 4P46A 5F7EL 3MACH 2VAAB 3ATEA 4YE4H 2NR6C 2I07A 3O3BB 4Y5XC 2Y07H 1DZ0A 5HYJD 3U0TB 4F5CE 4G8EA 3QZWB 3ARGD 3MCLH 1E7VA 1EVTC 5TDPB 3OKEA 1YJDH 2UVEA 1KYFA 1NPUA 1OQOA 1I7UA 2YN5A 4BWTA 1XZWA 2HLEB 2ZUWA 3PJSA 1JWSA 4PVMA 4E9XA 3AUVA 3VX1A 4TRPL 3V0EA 4I18A 1N5YH 1PSKL 1MCPH 5AOZA 3GZQA 2UXTA 4GKZA 5I8EA 2F53D 1VAHA 2FRGP 3BPLB 1Z5YD 3RIKA 3OAWA 1VACA 1MCRA 1G9HA 1EEYB 1M1XA 2ZOUA 4FXGC 5LBGA 5AFAA 1Z0MA 3TWCH 4G6AD 3V5HA 2KC0A 1G7PB 2J7LA 4Z7WF 3V6ZA 3X13B 4NZTH 3T0AA 1KJ2H 5EN3A 3ZTCC 1UFGA 1A1NA 5DJCB 2HLAA 3GBDA 1UM6L 2F58L 3CGTA 4HIJA 2EXWD 3KBPA 3U9WA 1Z9NA 2I26N 2CLVB 5GRVK 5A6IA 4R2GC 2E7LA 4L8CB 4G8GD 4IEFB 4JPWH 1UWXK 4FQHA 3UJTH 3WXWL 1ZVYA 2CR3A 2ICWJ 3RU8H 3UP6A 3RWIB 4QT5B 4OV5B 1DQLH 2V9QA 4E41E 4UB0L 5I8OH 1QSFB 4AYID 4Y2DD 2DWDA 3IYLW 5C2UB 4LOFA 5IJVA 3L3DA 2CBQA 1YO4A 3OF6A 1R24B 2ODHA 2AF2A 3PWPD 4XB7A 4ZMAT 4YHYB 4KXZH 1KN4L 1ZT1A 2J5LC 5IHLB 2XXFA 3TYFB 1S6NA 5BXFA 1FLRL 4M43H 4GW1A 1X5XA 4PJ8B 2BIOA 4FFVC 2D3JA 1CFVL 3GJFH 4ANXA 3P3RA 4PJ9D 4M48L 2VLLA 4XNYL 1U3HD 4R9HA 3E2HB 1PY0A 4XPGL 5GIRA 5C9JB 1JGEA 3NBNA 3MLPA 3GKWH 4N2DA 3ARTA 4AIZB 1N12A 2EDKA 1EFXA 2Y6SC 3TBTA 1V27A 3T3MB 4JO2L 5FLVA 4PR5B 2VDPL 1FFNB 4GQQA 3IJHA 4FLHA 4LSVL 5DHXB 3F04A 3VRLF 2BSRB 5HVHC 1CZ8L 1WUNT 5TQ2L 1WF5A 3DUHA 4HBQA 4F57L 4D8PA 2OCJA 2GHZA 2YN3A 1XF2B 5EU4B 1TTAA 2C3VA 1CS6A 3EH5B 3FQ4A 3OWEA 1KJVB 2ICWB 3LZFH 2EIBA 1CIDA 3QEHB 5EMYA 1F97A 1OLZA 1LEKA 1R6VA 2CDGB 3OR7A 5E6IA 1HEZA 4NGHL 4F5CA 2Q3AA 3CVBA 4G8AC 1HINH 3RY6C 3HZMA 3EHBC 1JDAA 4YBHA 4JPKH 5FDYA 2NLJA 5IB3A 4LLUA 4I48A 3ILPB 4G9DA 3VU2A 1XGQB 5I76A 3WNNA 1IFGA 3CMOL 2WO3B 2CXGA 5T8IA 2AV1B 3EYUL 1EHNA 3JQOB 2WXLA 3WIFB 4IBTA 1B0RB 1L5GA 2IWGA 4XMLH 3X3FL 5I0XA 1I1AB 1YEIL 5CIPA 3HN3A 3OPUA 2AQPA 4PJGE 3TT1L 3CN1A 3MOBL 1ZDSA 1A2YA 2B1AL 4UDTB 4TLUA 2IAMD 3MRFA 1AS8A 1OTTC 4J3TA 3BVVA 1ZOXA 5LAXB 1G6RH 3B2UD 3MA9H 3CHOA 3KLQA 4R7LA 2CLZA 3DVFA 2Y2WA 5AZ2L 3QG7L 4UILH 3BQUC 5F9WB 4E9RA 2E4TA 1IC1A 3MMEB 4PI0A 3SJVD 1TFHA 1AFVL 3VFNB 3OHXC 1PFOA 1YPZB 3QVAA 1P1ZB 1XO8A 3KPQB 5DURD 1RURH 3FSOA 3OQ3B 3RUGE 1G1KA 5DJ2A 3DK0A 1IQWH 3QZNA 1T04B 3B9KA 4MD4B 4S1QL 3NSYA 4GSDL 4E41A 3SO3B 3EOTH 1S3KH 4CSZA 4Z7VB 1JYVA 2GSIB 5EOQH 5DD6B 5H4YA 5KVDL 3FPXA 1TMQA 1A6TB 1ZV5A 3X11A 2VYRE 4KKBC 2CCLA 4XNAA 2HPTA 1LK2B 4OLWH 4YBQC 1H8SA 1D5ZA 2I32A 1X7QA 1Z0NA 1ZTXE 2KL6A 1QFUL 4N2HA 4QHKJ 2BS9A 3NEXA 5KZCB 4UYQA 4NQXB 3SD5A 1EAJA 1N8ZB 5IM7A 2P49B 1YLBB 4UV4L 1NKGA 2ISDA 4ATWA 3PAZA 4AVIA 2AANA 1KXTB 2EH7L 5BVPL 4ZS7H 1MZZA 4HPYH 1U4EA 4IIQB 2Z9TA 1P84K 2NYZA 3ERXA 5SWZE 3UZQA 4JQIH 5EIIG 1YEJH 2A6IB 1AKJB 4Y9EA 2G5BA 2QPFA 1J1OL 5EULV 4XMZA 4U1SB 5CHNA 5BUGA 4R0LC 4YPGA 1DBBH 4N2BA 5BUPA 1UFUA 3QHZH 3CN0A 3O6LH 3SDDA 3ZT6A 1FG9C 1MQKH 2N59A 4U0RC 3HZVB 5D1XE 3ULVC 1HHHB 3L1OL 3BOVA 4O2CB 3ET9F 1NC4B 1WEJL 1CXFA 1DN0A 5CBAB 1FVDA 1DUYB 2PTTB 1QRKA 3TBCA 4Y16A 3G5YB 5D4IA 4ELKA 1XGRA 1IGYB 4IJ3C 3RA7L 1VLXA 5ALBH 5EWIL 1TJHH 1L0XA 2XA8L 3P77B 3UC0H 4W6XB 4CVZA 4JO3L 4NKIH 1I4FA 1YNTA 4HSCX 5FKAA 3T6QC 1ED3B 1G1YA 3C08H 3LN4B 4S1RH 3LXAA 2FEEL 3ASNB 2GTQA 3D08A 2BC4B 5CJOH 3GT6A 3GS7A 5BW7C 1OTUC 3CCHA 2WUBL 1MCEA 5AL8A 5CJXA 1M2VB 2HWZH 1NGPL 1E9OA 1TETL 3C5SA 5BZDB 4KVNL 4YHPB 5E2WL 3GMMB 2OYKA 2VN5A 1H5BC 4PJGA 3D0LA 3M8OL 3SGJC 3ISRA 4CDGC 4E9QA 3LEYH 2IALA 1U30A 3VXMD 4NENA 3PHSA 3Q3GA 4FP8H 4F7KA 3ALPA 4NXSA 1UACH 1E28A 1LD9B