4CSTA

Crystal structure of fimh in complex with 3'-chloro-4'-(alpha-d-mannopyranosyloxy)-biphenyl-4-carbonitrile
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
molecule tags Sugar binding protein
source organism Escherichia coli k-12
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cstA00
2W07B 2XG4B 4XO8A 2JTYA 4AV4A 2XG5B 1KIUB 4AVJA 5F3FA 1ZE3H 5FS5A 5IQNA 5CGBA 4XOBA 3ME0B 2UY7B 4XOCA 3ZL2A 3JWNE 3SQBB 3BWUF 3ZL1A 2UY6B 2VCOA 3JWNG 3MCYA 4X5QA 4X5PA 1N0LB 5F2FA 5FLUA 4J3OG 3BFWA 1KLFB 5AB1A 4AV5A 3ZPDA 4AUJA 4J3OF 4XO9A 4XODA 4X5RA 4AVHA 3JWNH 4AUUA 5FX3A 4ATTA 1N12A 3BFQG 4BUQA 4CA4A 5IQMA 2JMRA 1QUNB 3RFZA 5AALA 4AV0A 4AVIA 1UWFA 4X50A 4CSSA 4LOVA 5IQOA 5JQIB 5FWRA 2WMPB 1TR7A 4XOAA 5LNEA 4CSTA 5AAPA 5ABZA 1PDKB 2J2ZB 4AVKA 5LNGA 4AUYA 4XOEA 4J3OH
chains in the Genus database with same CATH superfamily
4V1DA 1ROCA 4ZOCA 1A1MA 3HAEG 1HXMB 3NCCB 2CKBA 2PP9A 4HJTA 2W5PA 4K7PH 3LN5B 2YGNA 3W0WB 1GVIA 3S8FB 5D7JC 4FQXC 4ZQKB 5D6CA 5EFIA 4X6EA 4MCZA 1T4WA 4K5PA 1ETB1 4B60A 3KZ8A 3SE8H 4I85A 4XPAL 1X7TA 3EFOB 2A4CA 2R0KL 1U6AL 2QDVA 2BSTA 4BUQA 4MX7A 3B9KC 1IBZA 4K7PY 1F13A 3BUYA 5E1AA 2F53D 2R0WL 2BNUA 4X9FA 2CDGB 3C6LB 2VE6A 3PP4H 1E28B 5E03A 2IFFH 4NDMA 2R2HA 4BA8A 3LDBB 3TVMC 5FS5A 2CDEB 5SWZB 1UACL 1BGXH 1FG9C 3AQXA 4Y2DA 5BRPA 3BH8A 1JGLH 5F7EL 3Q8CA 3JV4B 5GQBA 2EDJA 5KZCD 4FGMA 5F2FA 4JQVA 1XXDC 3ZKSD 1WZKA 3QIWB 5L2KA 3ILEA 1TU2B 4FTDA 4L37A 3H2QA 4BZ2L 4ZPTA 3NA9H 2X44D 2NDFA 4LPTA 3SKUD 4PTTA 1KULA 1TCMA 2OXGA 3N1MC 4M3JA 5D4JA 3UBXB 2WLLB 5E1QA 1FLRL 3V10A 1HVXA 4L29A 1OT2A 5DVMA 3IU4H 3S2AA 2RAMA 3M88A 4MD4A 4PW4A 5IMOB 3BDYH 4OJDH 1WD9A 3QCUL 3ME0A 3MUGB 2I32A 5ACLA 2JCCF 4GXUM 4JFDD 4KX9A 4WTWA 1AQKL 3QUXC 4QHUA 3TVMD 5CP7B 3L5IA 3FO1B 2P5ED 4MRBA 1R5IB 3R06B 3UTSA 4OJEH 1JHTA 1QTPA 4HPOL 2R15A 3WL9B 5ADOL 2D7QA 4LVHB 3TBYB 5MI0B 4CVZB 4K7FB 1OAZH 5EOCL 3MV7A 4FRWA 3ZHDA 2YEQA 4AGQA 4ELKB 2SEBB 5JQ6H 2BCKB 1NFIA 5FA4A 3VD4A 1YECL 4AL8C 3N0AA 4J5VA 4N9OB 3NRFA 4NYLB 1TR7A 1PKOA 3NCYS 4WI9A 3DIFA 1D9KD 1J8HA 3MA7A 4KKRA 2P5PA 4P04A 5DR5H 3WEOA 1RMFH 1IM9B 5F72S 4BQ9A 5CEZH 3KPNB 1F8TH 4GJTB 2X4NA 1PTZA 3CZNA 3BLPX 4Y1AA 2VERN 4UNUA 1I9RH 1EZVX 1HCZA 5A6LA 2FQGA 4WDIB 2IAMA 1DSWA 4A7UA 4JFHD 1Y7VA 2W0LA 1FH2A 4KROB 3C60A 5L8JB 3S3SA 3WE6A 4O4YL 5I15H 3I50L 3OSVA 4LLYA 1OAQH 3ENEA 4H8WH 2WWMC 4MYWB 4MA1C 4QRTB 1H15B 5I1DB 3SBPA 4ANKA 1UM6H 3BWAB 4OD3H 3F5WA 1S7WA 1IQWL 1Q90A 2W60B 5F93C 4EOWH 2FO8A 2FO4A 2RBLA 3C6SA 1F2QA 1ZS8B 2H1PH 2BZDA 4BELD 5CD5D 4EE2A 2ZT9C 2WMPB 4OFIA 4QRPE 1FN4A 3D3VA 4P9MH 3QIWC 3U0WH 1U92A 3WV0A 1I9JH 3V4VA 2NT1A 3WDHA 5T1MA 4ZMQA 4YOKA 3SGEI 5TDOA 4ABQA 3HG1B 2K9FB 3NDZE 4R0LB 4HU2A 5J9PB 4JFWA 4LSPL 1JUFA 1LWHA 5I0VA 3MRJA 4RGOH 4Z3GA 1NKOA 1S7QB 3NJFA 2IGLA 1N12A 1ZVSA 5EF3A 3KM2A 2HJFA 1JRHL 1OGTB 3H9ZA 1KZQA 3L7FA 3VXSB 5DQJA 1AZZC 2ADIB 2ZKYA 1XMEB 2Y7QB 1IKFH 5CFAA 1FO0B 4U6HA 4WWID 2WYTA 3KCPA 3MUJA 3DI3B 3NSCA 5CP3H 5D1XE 4A7QA 2MPAL 4TLKA 1OAUH 4LP8A 2AQ2A 1P69B 1U3HA 1GAFH 1Z3RA 4YGAB 4QRAA 5JOPE 3L08A 3O4LA 3KXFD 1N6QH 1U8HA 1UCTA 4JZJA 3RTQB 5L6YH 3TP4A 2H45A 3M1CA 1I9IL 4P3WA 2G4EA 4NDMB 4PJFA 3X14A 4HH8A 3WN5C 5AENA 2ICWA 3HBQA 4N2OA 4AT6B 4UTAL 5EBLA 5E9DD 2Q7NA 5B39B 2EDBA 2ZOLA 4PJ7E 4G42B 3VNYA 3T8VA 1YC7A 4DGIH 1LWJA 3WSQL 3ZR5A 1F4XH 1YMMD 3FH7A 1J8RA 1FFRA 3LKQB 2RJMA 2QDWA 3LRHA 3NFNB 1BXAA 3PWLA 3EOTL 3D0AA 4HWZA 3SDYL 4M3KB 2WO3B 1RUAL 5C0CE 4L3EE 1IGCL 2KZBA 3E8UL 1P7BA 4Y19A 5IF0A 4AM0Q 3LV3B 3QDGE 5KTEH 4XP4H 4HEME 2X6MA 2FDBP 1U3HC 3FT9A 4F9LC 5HGHA 2X4OA 2YQ2A 1WLHA 5IQ9A 1AAJA 4N87A 1KPRA 3U0TB 4R7NB 4UIMA 4M1CD 1L9PA 2HWZH 5AYTA 2YOCA 5KVFH 5T3ZE 4OLWH 3EGSB 3L9RB 3QFJE 3VFVB 5KG9A 4NN6C 4BH8A 3MRCA 2J20A 2YQ3A 1XH3A 1U8PA 2XXFA 2ZD0A 1BZ7A 1BMWA 4G9FE 1H9DA 3GMLA 3VWJD 3V6ZA 5AD0B 5F89A 3VFUA 3MRHB 1XGRB 4NCDA 3S36H 3V95A 1WFJA 2CGRL 4N26A 2VLRB 3FTXA 1PLGH 4NENB 4O00A 1T5WA 1B9ZA 2X4UA 1HWWA 1LNUB 4Y2LA 1WZAA 1N4XH 2K3TA 3EFDH 2NY6B 2VXUL 1PKQB 3C09B 3C5SA 4CW1B 2ITDA 2QZQA 2WJ7A 1N2RA 2HFGL 3PY9A 2NY1B 3QJZA 2BVEA 1KTRL 1M53A 2FT6A 5LXGL 4BFKA 5FYJD 3SDCA 3UJIH 3Q3GA 2R23A 2XWJA 1QP1A 4XPFH 1BQHG 3KPOB 2WTRB 4JRXD 1NLDH 3X12A 2BSTB 3H9SA 5B1AB 4OZ4A 5EIIA 2RCSH 4LPWA 5E9DE 1F4WL 3SPVB 5HYSB 5JQ6L 4TNWK 2TRYA 2HAZA 5D1ZD 4QAWA 2X1WL 5JW3H 3E6FA 5DMGD 5I1HL 3UTPE 1XBDA 1YEKH 4ZQKA 2AJVH 5HVFB 1BMZA 4UTCA 1ZT1A 3TIEA 4ZPVB 3QJFA 2XZQH 3DUSA 2QSQA 4Z3JA 5F88A 3GMOA 5JOPD 3QQ4B 4LT7A 1UOWA 1RZKC 3NIFF 2WCGA 4A39A 2XZZA 3K72B 4K8RC 4U1IA 5C0FB 2FO4B 2FYYB 4RDBA 4XBEH 4MGXA 4GRMA 1MCDA 3WAKA 1YLBB 2D7NA 1P7KB 4IU2B 3ZL2A 2CE6A 4MSWA 1XGPB 4HJJH 3MV01 2OK0H 1U0QA 3ET9F 3ISRA 4LVNC 5IBTH 4Z3EA 5E6YA 2XN1A 1D9KC 3IU3A 2PWGA 2NY0D 5CR8A 4OVVA 4UOW0 4POUB 2O61A 3IT8D 2OMWB 4MMYB 1C12B 4HFUH 4HJGA 1TZIA 3OMNB 3VRIB 4OZIF 1S7UA 2D2CC 4P2OB 3WHXA 5A2BA 3OPZL 3MRJB 4TXVB 3ZYIA 3ZTNL 2GTZB 4WW1B 4YSUA 5I6NA 1IAKA 1PIGA 2MMXA 1PD1A 2NTFB 1HCVA 2D9CA 4G5ZH 4KQ4H 1CB4A 1XGUA 2CO7A 2Y4SA 4FFYA 4LHUA 2IPKB 2YQGA 3ECBB 1TVBA 1AO7A 4ELMB 2XT1B 1T3FA 1AJ7L 4P0DA 1R6VA 4F8NA 4DGWC 1W16A 1QSEE 3F7YB 3HMXH 2EDYA 1FSKB 4KRNA 1PDKB 2P24A 3LSOB 3DVGA 1F4YH 2GJ6D 2CG9X 3OR6B 4JG1L 5IIEA 2PF6A 3UG5A 3MLSL 4UMGA 1P6AB 5GRYA 1SJHB 2WTOA 2JCCA 2NZIA 4AEEA 1AKJD 2IAMB 2ZWKA 2DQIH 4L1DA 2CJTA 1MVFA 2P5EE 3CD4A 1XV8A 4WEEA 2WWKO 1GOFA 4XBPA 4Q52A 3LZFL 1ZY9A 2QPUA 2YN3A 4MJIA 4DKEH 3ARWA 4DK6A 4YIQB 5E8DH 4L0PB 2CBMA 2P1YA 2Y5EA 1J1PL 4FG2A 2F54D 4FQPA 3U46B 1UD6A 5D2LB 4I13B 4PS7A 2EKSB 1KDIA 1U8KA 2EIKB 4P3DB 1XB3A 2JIXD 4IBSA 3HE7D 4OGAD 2WTPA 3K8KA 1CGVA 4X5WA 1E7UA 3K80A 1BVLB 3TFKD 1MY7A 3HRZC 4NO2A 3WHE1 1CE1H 3EH4B 3TYFB 4M1GL 4YQXL 4YHYB 3KYOB 4NQSA 5T5NF 1LD9A 1W72B 4HJEA 5LGKA 5CLZA 1G7MA 1VB9A 3IMWA 2Z4QB 4ODXA 1YEHH 4Z7IA 1H3WM 1EJ8A 2FLBT 1Q72H 1YYML 1I7UB 1P7QB 3TPUB 2YAHA 3TPKA 1QVOB 2LU5A 4JN2B 5AVYB 1CL7L 4G7VH 3X11A 2BHZA 2W59A 3WNKA 4Z76B 2WLHA 3BD4A 1A7NL 3HFMH 4MASA 5LBGA 2J12B 4J12A 4P4RB 1OT4A 1V7ML 3EF4A 5A16B 1IZKA 3VH8A 3MR9A 5JW3L 5IVXE 3C5SB 5E2UL 3VGAC 4HWUA 1IJ9A 2IQAA 3HJEA 5I5RA 4FL4B 1OQOA 2ADIA 2EYRB 1MF2L 3E3QC 5DUML 4CC4C 2RH0A 3IE4A 3VU1A 5FO8A 4WJ5A 5F7EH 3BIBX 1AG0A 4R6UA 4MJIE 1VFMA 2QPDB 4JY6B 3C8HA 3DROB 3LKRB 1QFWH 3TEUA 2LTQB 5I6XB 3FKUS 1UXSA 4MZ3A 1Z0NA 2AK4D 1ILUA 2JVUA 5KUKA 2ZXEB 3K3QA 3IN2A 1RERA 2LU7A 2NXYD 2J4WL 3L5XL 4H20L 3CFDA 5IOKA 4M43H 4PGBA 3SPIA 3DX0A 2VMDA 4JFYB 1AFVH 2XX1A 4XGZB 2P5WE 4OCXL 1VZIA 4NRYA 4HQQL 2Y9RT 5EBGA 2Q5BA 4PGCA 2RFXA 5KS9B 2Y6TE 4M5SA 5DZVA 1I1FB 3GLAA 3DHUA 4MDIA 4NFCA 3T2QA 5BPPA 3JBG7 4JVWA 3GKWL 2E7DA 4QMEA 1ETA1 2W65A 4PUBL 5HGBA 1CDBA 1EAOA 4RIRA 2AJYH 5T3XD 4XWGH 3V5HB 5AB1A 1AJ7H 4N0CC 5J4MA 4NIYE 4JFEA 1FH5L 2A4EA 2Q0ZX 2Y24A 4N4YB 4XRCA 5KBNC 1AD0A 2XV2A 3FQUB 2I7SA 2OS7A 1NSNL 1T5XA 2RIKA 3P11H 4PM1A 1IQDA 3TLRA 4AQZA 5GS1B 1DVFD 5J6GB 2OXGB 4HUUA 3T6WA 1H3UA 2WGXA 3S5LG 3D4ZA 1R3JA 2X9XA 4PGEA 3WJLC 1QLEH 4HGMA 4UINH 3MUGA 4CDHA 4OCSL 4KJQD 3L3OA 1V7NL 1NFDA 2YPLE 1OZUA 3I6GA 4M9PA 3TJEH 2FT7A 2QVMA 3QG6B 5CJ8A 2VQUA 3T3PB 4YSAA 3I3BA 1F6FB 3P02A 3H85A 4TNFA 5TE7H 4XVJH 3ZLQC 1CIDA 4U1LB 5HHOA 1SLWA 4A1RA 6CGTA 3A21A 2BCKA 3WCYA 4QO1A 3JZ7A 3SE9L 4P2CG 3GXDA 1Z3GL 5DD6A 4EN3D 4G83A 3GF8A 3S98A 3BD5A 3C5JA 3PL6D 1T83C 1X44A 4MNGB 3TA3B 1IEHA 3LZQA 3ROOB 2DQUL 5I82A 4KKCD 2BH0A 4KGJA 4XMWA 2GEQA 4XMKL 4JR9H 4UTBL 4ZXBC 1PZCA 5TTRA 1ZLDA 3RKPA 2LU4A 3HPJB 2YXWA 4X8JB 3BLKA 5I1JH 3EH5B 2ILLA 1CIUA 4PCYA 4X7SL 2FEEL 4UMSA 3KYKL 4OZIB 1FIGL 3LEVL 4UIKL 5IQNA 2E7HA 3L4UA 5JPMC 2WBXA 4FN0A 3LQZA 1UATA 4KXAA 4MMXC 2P47B 4NCC2 1UUSA 4ZDHB 1J1XH 3UO1H 3VJ6B 4ICWA 3H7BB 1I3VA 3CTTA 4H7VA 4MWFA 4YBLB 5FK9A 4XMXA 4YEFA 1K8DA 3BVXA 2DIEA 4TKWA 5KYXA 2GKIA 2V9RA 3BJLA 4XP6L 2ZXAA 5C0FA 4EI6B 2EDDA 1BQSA 4KWUA 5DFAA 1BOYA 3P4MA 4L1HA 2CALA 4LFHG 1CF8L 1L7IL 4NN7B 2Y07L 3KPPA 1S46A 4PP1C 4QCIB 4F33A 1SM3H 1A66A 3GB7B 3IJ7A 4JFSA 1Q9LB 1RZIA 4ETQA 4OI9A 4NUJB 3W9DB 4ZX4A 3LRGA 2ZPKL 1JPSH 1CE1L 1KN2L 3I6KB 1FSKC 3AFLA 2M83A 3KPRB 1SHXA 4N9GB 4FHBD 1DJXA 5C8JA 1ADQA 1NBCA 1OGAB 4MS8C 3G5WA 4NNXA 2HJFB 2IBZY 1XHHA 4PVLA 1MW0A 5B3SB 1U8CB 3AS3A 4Z1PA 5IIEB 4AEIH 3EYUH 3CBRA 3RWIA 1A7BA 1FDLH 4JB9H 2OW7A 1VJSA 2VQ1A 3GM8A 4FG4A 4HJ0C 4R0LA 1ZVHA 1GJUA 4M93B 5EN2A 1KCBA 2DYPB 1DQKA 1HNYA 3G5VA 2J1KA 5HHMD 2LQRA 5EBMB 5K9KA 3SCMC 4X0KB 4HV8B 3SZKC 1V3MA 2MCAA 1JRHI 1QNZH 1QFUL 2OMTA 2WZAA 5IB3A 4RZKA 5DQJB 4Z7OE 1W15A 2CIKB 3FL7A 2YD7A 1NCJA 2IJ0C 3PQYA 1L4IA 1QG3A 2ATKB 4P23D 1VENA 2PYED 4FYSA 1CE6B 3ZX1A 4JMXA 2ENJA 3EGDA 4YSTA 2OZ4L 4UDTA 1KB5H 4GAFB 1DQDH 1CQYA 3WO4B 2UXFA 4MCNA 5F8QC 5B39G 2V7NA 3NGBB 2YPKA 4UANA 2O5YL 2OR8A 3ZN6A 2ZG1A 4B41A 1AGFA 2B5IC 4XWOC 4FOMA 4Z7UE 1SOKA 2ID5A 3HHSB 4RDQG 2ROXA 3IEAA 1WBXA 3TT3H 4W6YB 4OF5A 2ADGA 3L13A 5GHWL 5JUEH 4M7LL 1N6QL 2DMHA 1AP2B 4PP1D 4G80A 1MQKL 4D8PA 1U8JA 1WCBA 5B4MC 1E9QB 1E6OL 4QD2E 5T1DH 1A1OB 4DP2X 4K94H 5D93B 4EI5C 4AE0A 4AMKL 2ZUWA 2E6JA 5B7FA 1SHWA 2OX5A 1JWUB 4JHVA 5DUPL 4XP5H 4JFZH 1GY2A 5JORB 2C34A 4YHOH 3Q05A 5IHZA 5IJKC 3ARBA 5GRUH 1YEKL 1TQWA 4K5MA 2B16A 5C08B 1CFNA 1REIA 1QSFA 3TASA 4N86A 1HEJC 3QXVA 3WN6A 5C97A 1G94A 1OY3B 4OVUA 4YLCA 2UZXB 4EXKA 3F7PC 3CVHH 4U3CA 3RVXD 1GKEA 1BD2A 3CFBA 1LEIA 4QYOA 1HKLL 5DA0B 1RVFH 4PJ8A 1KNOB 3H9HA 3RILA 5C0RL 1X5ZA 2V8LA 5DRXB 3BP4A 4Z7UF 5TQ0H 3QEQB 2AXHA 3LNFA 2K78A 4YFLI 1BIIB 2V2TB 2OTPA 3H9SD 5ICUA 5I8EA 3VGEA 1AS6A 4OZGB 3ZYOA 1E3ZA 2QQKL 2QMKA 1CZ8H 3QCTL 3CFJB 3W1ZA 5JYLA 5LGHL 3VYNA 4ZTOL 2UY6A 5C0EA 2PABA 5AAWC 4L4JA 5KSAB 1O75A 1A7RH 1XF3A 3B8YA 2D0GA 1DEEA 3A4AA 2A9MH 5HDBB 4PRNA 4R2GD 5ABZA 4HKZB 4WU7B 1PL3A 1U58B 3V8CA 3HZVA 3B2VH 4PJGA 4H1LA 5A7BA 4FQ2L 1NANH 1SMAA 4R90L 1P1VA 4RESB 3FQTA 1KYOJ 2G4GA 3UPRB 1A3LH 4I4WA 2JH2A 4IEFB 5M95B 2NNFA 1DN0B 3OAYH 4GXVH 3KG5A 3HCVA 1IKNC 2C26A 3GSXA 4LLMA 3L3KB 1B88A 1P84J 4L5FH 3V6FB 5KSUA 3RZCC 4L3CB 3EFFA 4HKXA 4B96A 2K70A 1A7QL 3IU3B 2AC0A 3RDJA 3RGVB 4MDJB 1KGCD 4JG9A 5HJBA 1F18A 2OMZB 3FSWA 3DTDA 3VVWA 4HJGB 3VRIA 3LEVH 3BN9D 2YAOA 2H3NA 2BOBA 1Q0XL 3GM0A 4NN5B 3ULSA 2W91A 1P9MC 4BUGA 2CHNA 2YARA 2IXQB 3ATDA 3MLWH 4N0CD 4W4OA 1Q9KA 1YEJH 2Z7YA 3U4EA 2IFFL 5D7EA 3P77A 4A2LA 2X2HA 5JOEA 5BVPL 5F7FA 2AEOA 2RD0A 1HQRB 4NQDB 2P4AB 1E4WH 4RMUA 4FQQB 3N43F 2KLTA 2OMWA 4KKBC 3S4SB 3B1UA 3CDGA 3ASOB 5TE4L 1AKJB 2QFPA 2ESVE 4J7RA 3TWYA 4E41B 2O26U 3JV0A 2N7AA 1AQHA 1HHHB 1NCWH 1NUNB 2CK0L 1EERB 1I1YA 1IGJA 1KYAA 3Q9QA 4NM4H 2IDFA 4WFFD 3TBVA 1JWMA 2XETA 3GDBA 5KAQF 3DIDA 1OCZB 4ACTA 5JDJA 3MRNA 3DDFA 2VAJA 2XQ0A 4F3FB 1UEMA 4HOZA 3FUHA 5AOJA 2TSAA 2VWEC 3OB8A 4JFPB 4LSSH 3H2PA 5B3NA 2XN9D 4MJIB 3VFWA 2YGVA 4Z7WB 5DC0A 3OR6A 2J2ZB 3HKFA 5C3LD 5AW8B 1TEGA 3GSNL 4Q0XL 1RJZA 1GOGA 2FWOA 2VZTA 2NW3B 5CAYB 1CLVA 3VXNA 2DD8H 3QWNA 2EIZB 2WSDA 4YDKH 3FRUB 1BVOA 3TEYA 3TJHC 3U6RB 1KPUA 3C9NA 2IH9A 3F01A 2X87A 1WRFA 3QDME 3STLA 5J6HB 3TA3C 3T2LA 1J0KA 1MG2C 3SOBH 3PAUA 3BEWB 2BDNH 3GNML 4TVPD 1YRKA 4QHPA 4C56D 3T6VA 2JJTA 4JVUA 5BV7H 3RWDB 1KZYA 1U8NB 1QKZH 2CRIA 2P80D 2RB8A 5JPNC 1A6PA 3P69A 3QZBA 5F96H 4WQOA 1L7TL 4WHYG 3DGGA 4X9BA 1P4IL 4KK8C 5PAZA 1UKSA 2VERA 2B0SL 2XV6B 5IW1A 2EECA 4N8VA 1M3JA 3CFBB 3O0RL 5DC2A 4OGAC 1TZGL 3K6FA 2Z4QA 5CKAA 2YKLH 4JO5A 1GH7A 2EDXA 2IPUG 1QUNA 2RTTA 2VN4A 3AS2A 1YY8B 4JFDA 2GQHA 4G72B 5EO1B 3TF4A 3U1SH 2OSYA 3ARBD 4E42B 4O5LH 3B7UX 1LP9B 1MHPH 2Y1ZA 5LLIC 5EEUA 1KBBA 4U7KA 2F5AL 3LCYA 2LV4A 4OCYL 4BYHA 1S9KC 4EQ3A 3IRCA 4HUWB 2JNZA 3FFCA 1NPJA 1LEGA 3MUZ1 1VERA 2CKBB 5I6MA 4X6FB 4UOZA 1UZ8A 4G6FD 1OAXL 4Y9BA 2OMVA 1D9KA 1L9NA 3AQZA 3T0EC 4DZBA 2YAQA 1YYCA 3SBRA 2EVGA 3EOBB 1RURL 4AMXA 4DN3L 3CFDB 2VR7A 3JWDC 4KV5F 5DDHA 3EGDB 1AANA 5IVOA 1GZHC 4ABWA 3UCQA 4XPTH 4QXTB 1HQ4A 5C0DB 4PB9H 5GRWA 4JQVC 1UQSB 2VLME 1RQ5A 2F5BL 4I89A 4YZWA 1VFOA 4LK4A 1T04A 3NQIA 1NIEA 4AVJA 4NSKA 3FN3A 4LBEB 1F0LA 5L2KB 1AS8A 1K2DB 2EIMB 3I6SA 3L5WA 3JWNE 1JYXA 5E2WH 4XCYA 1E4WL 3PNWA 2XN9A 4FXTA 1NPUA 1XIWC 2LTQC 2ZAHA 1FFOA 3ABZA 4LFHD 5SWZA 5FV2A 3WFHB 1FZJA 1HN1A 3RIAF 1D5XB 2D3NA 3P73A 4K3HA 5I0XA 2BLFA 2A74C 3IDMB 4LSUL 3V79C 3FQUA 3KPMA 3DSFL 2IH3B 4XMPH 4RGMC 1MRFH 1A8JH 1PZ2A 4MBRA 3QUMA 2D8KA 5FYLD 2QHLA 3HLAB 5HD8C 3BQUA 4CKQA 3FNKA 5KYYA 1YA5A 4KTEL 3F12A 3VM7A 4HMCA 4HEPA 3N04A 3EXLA 1D5ZA 3RLSA 4AK2A 5DJDA 5FB8B 3OJDB 1H3GA 1IM9A 1UURA 2WQVA 3GJFA 1DQLH 4FFZH 4KY1H 1GC1H 2VXVH 2PW1B 1ZSDB 2QVIA 5GGSA 1TVHB 5I6XC 3CVIH 1AXTL 1A6UH 1V27A 3PAYA 3TJHD 4ALAH 5EZPA 5I8EB 4LCIL 3ETBJ 1HYRC 5GGQL 4HHAA 3A6OA 1DBBL 4KZDL 1IGFL 2I85A 3N41B 3OGOE 2VLMD 2PKDA 4J3SA 4FNRA 5ITFA 4OJAA 3LS5L 4UT6H 1KLFB 4UZUA 4JY4A 3FUJA 3KJ6L 4DCQB 3O2DH 1N0LA 1OVZA 3MC0A 4YSQA 3WTYA 4JKPH 4HIHB 4P49A 4B27A 2VZSA 3UADA 3DOSB 3AU1B 4OV5B 1H6TA 1N7MH 2BP0B 4N8PA 3BUDA 4U1MB 1NBZB 4YSDA 1TNMA 1NCWL 2FNBA 4HETA 5CJBA 4QTHB 4KO6A 4W6WB 4LNRA 4N2GA 2WJ5A 2F2HA 5DGRA 2Q3ZA 2C3GA 4GT7A 5AKTA 1TKWB 3IDIB 4JEGB 1X6LA 2YBRA 3CC1A 1MNUL 2P7TB 3DX6A 4GIOA 2UY7A 3HC3L 5E5RB 4OFYA 2VRKA 2MSPA 5C0AE 5ENWB 5SV3A 2APSA 1UXMA 1NCAL 4U0RB 5JHDB 4I18C 4DUWA 2V5MA 4JFTA 4KUZL 3SQRA 4DESA 4UNVA 3WYRA 1OP3H 3ZU8A 3KVPA 2PP7A 2K8QA 4KKQA 3QXAA 4FD0A 1NCDH 3INUH 5C08E 3TN0C 4PJIE 3I85A 1OGTA 5DRZB 1DQJB 3MLRL 2NTSP 2P46B 1Y18A 1HL9A 3BAWA 3DPDA 2IPUK 3S5ZA 3W9DA 2DJUA 4KKLC 1NGPL 3IKKA 4C56E 4XT1C 4KRPD 3SPJA 1E5YA 5A3ID 5IMKB 2FECI 1X9UA 4LL4A 4Y4HC 4I18B 2O5YH 4E41A 5BW7A 1EFQA 3MRGB 4ZSOA 5LBSA 3VA6A 3TXAA 1X4ZA 3UMTA 5IJBC 1IGJB 3OF6D 4MAUL 3GXTA 1AVAA 2B3IA 2DY2A 4AYID 3BWZA 1L7IH 5D7IE 3N44B 1D9KB 3Q8EA 4DZBB 2Q7AA 3O3BB 1ADQH 3M8OH 4FE9A 4LIQL 1A1NB 3ARGD 3IDJA 3TO4B 4NZFA 1KGUA 4Y16A 1N5AB 3F6LA 3JV6A 4QY8A 1OCOB 3B5GA 2J1WA 2CPUA 2MTPA 4P23A 4PY7A 3BEVB 1SVZA 1T0MB 4OZIE 4ZUUA 2R29L 1O6SA 5G2NA 3QXTA 1GYWA 1MSPA 2CIKA 4JFZL 1X5IA 4PJIF 5LCVL 4AL8L 4NGHH 3MLYL 1ICTA 2DQTL 3K71A 5GJSL 2B77A 3PNWB 3DTXB 4QOKB 4XR8C 3CG8A 5EULV 2VOTA 1C5DA 4NERA 5JW4Q 3F7QA 2LHAA 3U6RA 1MCEA 1ZANL 1CL7H 1XAUA 4G7VL 3RWFB 4PGDA 3TVMB 2HLAB 3TBSA 3G5XB 4QRRA 2YGPA 5AW7B 2KL6A 4O02B 5EBWB 1XH2A 3WD5L 3VGGA 3ZHLA 2WUBL 2W92A 3MACL 4Y1AB 3QUMB 5IHBA 3ZGHA 4BCZA 3SE3A 1I8UA 3QNZB 5LBSL 3B3IA 1HFUA 4GLRI 3JTBA 2FB4L 4UAOB 4UM8B 5I5JA 2EAEA 3CHXA 3AT9A 4E9TA 3WLBB 1L3NA 1WCBB 1OTTD 2B8OT 4BSJA 4TQPA 4WK4B 5BOJA 5KSBB 5E8OA 2A2QT 3UYPB 4OT1L 3WEAA 5JIIA 2VLRA 1JV5B 5HYQA 5FA3B 3IPBA 1M1XB 4XCCL 2ADGB 5HDOA 1GJWA 3B9VA 1G0YR 3OMAB 4U1GB 2CXGA 4EDXB 2WWKT 3F3HA 3A67H 3LRSB 1ANUA 4NJ9H 1O6TA 1XH3B 5DFTA 4ES8A 5HVHC 1M6OB 4IJTA 4U1NB 2YIHA 3ARVA 1BVNT 4NRZB 3A24A 4D8PB 5IHWA 3CN0A 1YEEH 1E4XI 1N3NB 3DHJA 2ZXGA 2QV2A 1CGSH 3O11B 3QFDA 5DJZA 1SRDA 3GYRA 1CVRA 3QISA 4NP9A 4PS8A 1E2VA 1KCUL 2PNDA 2XV0A 3LQAC 4C4KT 3WEXB 2WB1A 1U95B 1KC5L 4P5TA 4AYEC 5ALBH 4PCSA 1HOCA 5EO0A 2WLMA 4Y1TA 3PWVA 1A7QH 4IOIB 1AY1H 3FU5A 3AWGA 5B8CA 2VDQB 2DN7A 3F04A 2FL5B 2YMXL 1XZ0A 3RZCA 4OLVH 2DWSA 1FV1A 1IE5A 1EO8L 4DPRA 3F00A 4IOSA 3M6DA 2DZEA 4WTQA 2JTDA 2P7TA 4LCIH 4XNAA 4ZFFB 1PNDA 4DP4X 2J7LA 3DX7B 1ACZA 1FNLA 3CZKA 4IOFD 4RBPK 4POZD 1DQML 3CV5A 3IPFA 3RVVD 5IWLA 2XVLA 3KJ6H 4M62H 3FU3A 3NSYA 4AQOA 1X5HA 3BAEH 1NCCH 1O9VA 4NNYB 2CCWA 1MFAH 4CVWA 5BZXA 2FNWA 4TL4A 5CGMA 4BINA 43C9A 1P7KA 5H35A 1UYWL 4YPJA 4XRCB 4MS8D 1MREH 3CZUB 2VZ3A 1JN6A 1M2VB 1VKXA 2NCEA 3FCUB 3KLKA 2GBUA 1JGUH 3S34H 1SBSL 1HCFX 2R59A 3T08A 4B3EA 3GSNB 4DK3A 4JQXC 3COOA 3TT1L 1QBML 3ULSB 2Z1PA 3MNZA 4YHNA 5TPWH 1ZHKA 3NFNA 4WWOA 4N6RB 3R7RA 3HG1D 2EXWD 2QL1A 5FCUH 2CHZA 3QJHA 1EAQA 2AK1L 1Q8MA 3QEQE 4X4MA 2OAAA 4F20A 3IMTA 1FVDB 2AEQH 4PREA 5IHHA 3S3JA 3KNBB 3SDAA 1U8OA 4ZS6D 1RJYA 4PJHB 3TBWA 4LDOB 4DP1X 4Q8BA 2G2RB 6PCYA 1YEFL 1N5AA 4YC2C 5HGHB 1BQHB 2BNRA 4JANB 3LPWA 2CO3A 4UNTA 5IB1A 1MQ8A 1GGIH 4QHUB 4P2QB 2X4UB 5HGDB 3FB5A 3VNZA 3QJQB 1T20A 4WO4D 4XCEA 4QRFA 2WUBH 1QD0A 4F9PA 3TA4D 5LN8A 2KDYA 1HINL 3VRLE 3GMLB 5L9DL 1J5OL 1QW8A 1V7NH 2CBOA 3G08B 2DM7A 2HN7B 4X5WB 5FUCE 4YAQA 1N9PA 4IHOA 4JPWL 4M93C 1JE6A 1FRGL 5K69A 2DL9A 2IVFC 2EO7A 1G4MA 5C6PB 3C5ZC 1XEDA 1MHHA 5C0JA 3UP6A 3KWVA 1T0OA 4FA8A 1LO3H 1DBJH 2ZNXA 3DOSA 1I7UA 5FKPA 2TRHA 4XBGA 1MJ7H 4Z3IA 2CKBL 1B0RB 3GSUB 5ICZB 2ZF8A 1KN2H 4JO4H 1M9SA 4PRBB 4LNRB 1G0DA 2DH3A 4PB0H 3SPVA 2FBJL 3NZ8B 3UYRL 3HN5A 2EYTA 5D6DA 3KWUA 3EJJX 2AJZB 4X4ME 5C0ND 1UB5B 1Z9SA 1MCJA 2FGWH 4E9RA 1J12A 3ZSTA 4PW9A 1YAZA 1J0JA 4GINA 4TVUA 5ALBL 3VH8B 5KAQG 3LXBA 1JZ8A 2MCG1 3VG9B 3NABH 4AEIL 2ED9A 3EW3B 1NFAA 4ZFOA 4F8OA 3FQWA 1RZGA 5C07B 1UD4A 4LVOB 3QXDB 3ARFC 3FN9A 3QDJE 1ZJAA 5B7EA 2XQBH 3QIBA 4UINL 3QFJB 1J9QA 2XIBA 3WJLA 3R8BB 5IESL 1G87A 1ODAA 1BFTA 1R9FA 2D7TH 4MMXB 4CILA 1UXSB 3OKKB 2OQJB 4O58L 3U36B 5I0ZA 4GAAA 4HWBL 4Z7UB 4ODTL 5IMKA 5D6DC 1ZLWK 3AXLA 1Z3GH 5DZLA 5F7AA 4LSUH 5KZCB 3BRFA 4JFED 5GGVY 5I15L 4Z0BH 1AXSB 5T3ZL 3DVNA 2YZ1A 2DQEL 1X5YA 3LX9A 4FLHA 2I07B 4HXAH 3G04A 5AW2B 5CEZE 3NAAH 5DK2B 3VE0B 2IPTL 4MRCA 5KSVA 3O6LH 4OY9A 4L4VD 2BNQB 4LGPB 4HWEL 4H88L 1TVBB 4I0KA 1MDAA 1UWXK 4PGBB 3MREB 3SPCA 4EF3A 2BJML 5KVMC 4WCYH 3TT1H 3TONA 1SEQL 5G5DB 2V0AA 1MVUB 5T1LD 3LB6C 2VT0A 3H9SE 5DJ8A 5BRZA 4QRRB 1FDLL 1KJ2B 4YDJA 4IMLB 2NNXA 4GSDH 4X5PA 4L8DB 4AIEA 5I1HH 5IJCC 3E3QE 3O9WC 5C2UB 1N64H 5ABAA 1MI5A 2GEEA 5LWYL 1MCOH 3HW7A 4JK0D 3W0WD 2X4RA 3FO2B 1NDMB 2V7HA 3NZHL 4JGMA 1L9MA 2YD1A 1MFDL 3T4AC 4YHKH 5F0JB 3M1OA 1D5XA 4GP8B 4G80B 3HE6C 2LW3A 3APFA 3QAQA 4XBEL 4TM9A 3AY2A 3HZMB 4N8UA 3QA3A 4B9PA 1I3RB 3SGEH 1ORQB 2JB6A 2W94A 4C57C 5HYFA 4HHGA 1G7MB 4ODXB 2XACC 4QXVA 2CK2A 2YD2A 2NY0B 1HI6B 4QWWD 4F7MA 2QGDA 3TEZA 1TJGL 4H44C 1KOAA 3WFCH 5F97E 1AE6L 4R7XA 4YHPA 5JO5B 2XY1A 2OSXA 4PR5B 2QQKH 3N1PC 43CAA 4M29A 1TTFA 2ZPKH 5DWUL 4UIMB 2WOYA 2AI0L 1HH6A 1KCRL 5DVLA 2AAAA 3GTNA 4DH2A 1LD9B 1W72A 2JXMB 3IWUA 1Q9WA 4KQ4L 3Q9PA 3KEDA 2Z91A 1QLEB 3TFKC 5D1XA 1OSZA 1JVLA 1EZSA 1K5NA 4XMPL 2FX8L 3K4ZA 1RZFH 1FZOB 4NKIH 3U30C 5J3HD 4MCZB 4KVCL 4YLQT 5DVPA 2BVQA 5T1DL 4UT7L 1KN4H 1JNJA 4HCGA 2CKBH 1M4KA 1OHZA 3GK8L 3QB7C 4N8VG 2BOCB 1O5PA 1MCWW 4IRZH 2A6IA 5J1AA 3IXTA 2XTJC 3Q13A 1OGPA 2AJUL 4YMPA 5GRUL 2J21A 3WEXA 2PXYB 1BQLH 2ZKMX 4FADA 1O7DC 3MMEB 1NLBH 3MR9B 2WWMD 1I9JL 4XE0A 1BOGB 1PZAA 3L1GA 3EOTH 3MN8A 1MDTA 4XAKE 1R5VB 4QXGL 4WHCA 3UO8B 5F7NC 2IH1A 4KY1L 5AUMB 3SJVA 1GGIL 4XNYH 5DVNA 3X13A 4M3HA 1JMZA 2OTWA 1ZVYA 4EAEA 2YLKA 5D5MF 2X42A 3MJ8B 5FW7A 1J87A 5L88L 1OV8A 3AVEA 4O9HH 5EEVA 3KBHE 1GSKA 1I7RB 5FUZL 1W0YT 5TK2A 3V55A 5EOCJ 1H8LA 1EDQA 1Z9MA 2ZSVB 4K8RH 5C71A 4GOSA 4ENEC 4YDNA 5T1LA 5E5LA 3RAJH 1ZV2A 4PJ5D 2R4SL 3QHFH 1Y1UA 3QEHB 4JFYA 4OR1A 1TIUA 3GUTA 2XG5B 5KYXB 4PP2A 1YJDL 2GIMA 3IM1A 4JHUA 2B7DT 3R8QA 2ZCZA 1OSPL 1CGWA 2B2XL 4OZHB 5F9DC 1IAOB 4PSRA 5HI5C 3KJ4C 3J27A 1WVZA 2QMJA 4Y9CA 3BDXA 1A4JA 2KERA 1CDIA 4H26B 4NQEE 3I2CH 4XMLH 2WGNB 4PJHA 2HFFB 3QWQB 2VMCA 2Y2YA 3GSNA 4L29B 4XMZA 1W72L 1FL6B 3WSQH 2NY7H 2GY5A 3NACH 4H25B 3MRGA 4ZSOB 3ZUCA 3EJUA 4DGUA 4MBOA 4X80H 4YDLC 1N5YL 4JDEA 5F7YC 5GGUB 4RX4A 3QHZL 5EMYA 5EU3A 5BOPA 1MIEL 2NY2B 5E5MB 1QQDB 1L9OA 1OTUC 2W80C 1AQ8A 5IFJB 1N64L 4K8RD 1HEZB 5LBSH 1NICA 5LWYH 5GGRB 5BUPA 1OQXA 4X83A 2XQBL 3IDJB 3TO4A 2EUWA 1YEWA 4FI7A 3D85A 3MBEB 5K9JL 3UOAB 2JV6A 4AIZA 5C0CA 3LYRA 1T0MA 1TVDA 5K9KB 4YAQB 5DZJA 2Y2WA 1S78D 5FC9A 5DLLA 3NCWA 3NIFB 2GT9A 2AV1B 4LLDA 4F7PB 4OCWH 4HU8A 1CFSA 4U1LA 4ZMWA 5F9JA 1R33A 2YD3A 3QUYA 2GJZA 2FHBA 5I1AA 1TPXC 4OCLC 5HJGA 2N7SA 2WYZA 1CTMA 2CNYA 2X4RB 5ESAB 1KB3A 3WHE0 4YHZL 5MP6H 1AFVL 1M05A 4JFFD 3FSZA 4NP4H 4P2QD 2Z4TA 3EJTA 1MHCB 3L1EA 3NQKA 3VFGL 1I9EA 2EVHA 1DBKH 2D31A 3EYOA 1AHKA 5F6HI 3K1DA 4JHWL 1MFMA 5IOPA 5EHFA 1S5HA 1IC7H 4S1RH 2AVFA 2VDOL 3RGVC 4MVBD 3BAKA 2YPLD 1R1CA 4QHLA 2LLNA 3UZQA 1U8MB 2FD6L 1FO0L 1UJ3A 3NCJL 4WK0B 1XGTA 5IKCB 5AWNH 2E3VA 4U1KA 2JQAA 3HG1E 5C0AB 2F58H 4DPBX 4QWWC 4I77L 3GDCA 2XXCB 5DJ6B 1CLZH 3HG1A 3QXDA 3FU7B 4NLAA 1JZ4A 5FO9B 2VXQA 2XZCL 4HLZH 4R96B 1JFHA 2OX5B 1G7HB 3FOMB 4PCTA 1SFHA 4WEUD 5BO1H 4LOVA 3UTTE 4CSZA 2EYSA 1S6NA 1OSZB 3QBTB 4BSWA 4OCRH 4JN1H 4CC1A 5KVFL 3HZ3A 5D71L 4QKXB 4H2CA 4NPYB 4PBDA 5LAXB 1BZ9B 5T3XE 4OCSH 3HR6A 2YXVA 5AKSA 2YUXA 2A74A 2XZAL 2EJ1A 3PG2A 5I75C 1R4XA 5ADPH 2C4XA 2Z93B 4F33B 1TJGH 4FP8H 5BZWA 3AGVA 3GPEA 3ZE0B 4PV9B 4AUJA 4KDWA 2AMGA 2OYKA 3P3TA 3SQBA 3BVTA 3P54A 2Y7OA 2VLKA 3EOBA 2VLKE 2F6AA 3E6HB 1KTLB 3MLUH 2IBBA 2WLYA 3ASNB 3MYJA 3O8XC 1IC4H 1Q4NX 1U95A 5CHNA 1MCKA 3P1VA 3ZDYF 4AOFA 3B5HA 5DJXA 5CN1A 2HX7A 1JSYA 4E9XA 1MI5B 3MCLL 4TLUA 5C86A 5CM1A 3K2UH 3QNXA 4PJAE 4BWTA 2E9JA 1SY6L 1NMCC 3B5TA 4I4WB 4BJLA 4ZUSA 2WSKA 2X4QA 4PVBA 2HB0A 2YMXH 4ZUVA 5CILH 3EYSL 4NQEB 5GJTL 3PXHA 3UJJH 4IMKC 3RUGE 1YSOA 3KPMB 4G9FD 1ZK5A 2VIRA 1RJCA 3M1BB 2VNCA 1I3UA 3BUBA 4PTTB 3FQRB 2PYEA 3MRFB 1VFBA 1B4RA 1T1YA 2ESVA 4MA7H 1HU8A 3BQUB 5E9DB 3F64A 1I8IA 1WZLA 5K9JH 2M26A 3C60D 3QIWD 2X4OB 4PLJD 3BAEL 4BFIB 2QKSA 4JDEB 4XMTA 2AFNA 3KAAA 3ESOA 2VXQH 2OZ4A 3WIIH 4JRYA 1QFWL 3GO1H 3HZYB 2W07B 2ZJSH 3DMMC 1JWMB 4MA3B 2A6JA 1FZOA 4LQFL 1XGRA 5EC2A 2HTLD 4XVSL 3BVWA 4K2UL 3MA7B 3QT2A 2LAAA 4M7LH 3HFFA 1MHEB 3BFOA 3KPOA 4J3OG 5EF0A 1KGXA 5ITFB 4ATTA 4U3SB 4G82A 4PJ8B 1JI2A 4QLWA 3R4RA 4GRWE 4H5SB 5JORA 2AJ3B 3EZJB 5C07D 2UWEA 1FNEA 1U8OB 3IBOA 1OTSD 1YNLL 3R1GL 5GZNC 1NGWB 4H0IA 3KPSA 4XP5L 4F24A 2QPFA 2FK9A 2BP0A 3QHZH 4OU3A 3BIKB 3PGCA 3T09A 3TO4D 2Q86A 2WBJD 4XHJD 4AX3A 1XF4B 1U4FA 2FJFA 3X3GL 3EYVB 1KJVB 2EILB 4DQOH 1IRAY 1PEZA 5D7IF 5HY9A 4FXGC 4PLKD 4XODA 5K1VA 3W0WA 4OQTA 4BKSC 3VXNB 1GYUA 3CU1A 3KH3A 4N0FB 3P3SA 4GNKB 4AVIA 5IB5B 5ESQA 1QYGH 4K3JL 1FC2D 2J1ZA 3CZEA 3QH3A 4PRBA 4LLYB 1QLEL 3ILPA 1RULH 1VGEL 4F2FA 1S7XA 2F8OA 3SJVE 2WSPA 3W81A 4QKTA 2P42B 4JL2A 2DTMH 3E8VA 3IJHA 1RZJL 1BLNA 4HUKB 4OQ1A 3LQZB 2IANE 1BAGA 3FPYA 4EUPA 3CHRA 5CEXB 2ZSVA 4JDTL 5K9OB 5JUEL 1LVEA 2NX5A 3SYOA 3VH8G 3WFDH 1E8XA 1K72A 25C8H 2VW4A 4NIKB 4KK9D 4PJGF 4CNIA 1WBYA 1Y18B 4CADA 2OMZA 1A0QL 1H3PL 4YH6A 4A2EA 3QWOA 1IQWH 4YDLB 4Z18A 5JIKA 1JGVL 2PR4L 3F65A 2ZCKH 1YHPA 2NXZC 3GBNH 4OLUL 4TSAL 2KHAA 4YBQC 2OCCB 5AW0B 3BAYA 3FB6B 4M1DL 3VI4F 3FZUD 5DHVA 2VLLB 4DN4L 1NQBA 3ML8A 3PFUA 1KFAH 3U36A 4A04A 5CBEB 2YAPA 4L2YA 1NCDL 3INUL 3EH1A 1INDH 2N0KA 3PJSB 2OZNA 4RFNB 4IS6A 1S4IA 1DBAL 3DX8A 4J1UA 4YXLL 1K6QL 1ZANH 3N43B 5AW5B 1UZ6F 3O6ML 1NDTA 1HHHA 4HC1H 4JFHE 4QJ3B 2ROYA 4AW4A 1NIFA 4NSKB 1JHTB 3WL9A 5J57B 1KDJA 4NS0A 3PWNA 1EEYB 1D5IL 3B9KD 3QFJD 4FG0A 4PJ8C 2I5YH 1N59B 3KPRD 2JCCB 4P46D 4CRPA 1PJ9A 3VWJA 3S35X 1TZAA 2FCBA 1ECZA 2CZNA 1NPNA 2BPBA 5FKAB 2Y7NA 3J2PA 1YEDA 4YVUA 5MEOA 3QYNA 1MOEA 3B7TA 3GS4A 4YDJB 5L2JB 1JXFA 1UT1A 3EYOB 4G6AC 2AEWA 3NIGF 4DF9A 4JHZA 2ZONA 1WG3A 2PTUA 4Y5YB 2EDQA 3QQDB 2H32H 4PJFB 4UDTB 3X14B 2X70B 5BUGA 4XH2B 1FAIL 4XX1G 1URZA 3C60B 4XNBA 3RX7A 1NMAL 1QEWB 1R75A 3GGWA 4OZHE 1P7QD 1U3NA 3SOTA 3IJEA 1ZEAL 4LL1A 2YK1L 1AGDA 3EH2A 4I48B 1G7LA 5DFVC 4DUVA 5C9JB 4J39A 1TFPA 4KI1A 1KGWA 1KFGA 3BVNA 3BXNB 4U49A 5IROD 1ORQA 4ODVH 1BBJB 5I17A 5T3ZD 4P4RA 1OCCB 3RWEA 1ZSDA 4HSAC 4LEXH 1F4WH 4GUCA 3OAZH 3LRSA 2Z7UA 4IRJD 5AVSB 2PN5A 3CJJA 3RB7A 1WA1X 1H5BA 1SLXA 4K9EH 1AI1L 1D5ZB 1OGAD 3FCSA 2EDFA 1CGXA 2XXMB 4GEJA 3SN6N 4BGDA 4KNSA 3ARDB 2BOLA 4U3SA 2J8HA 4F7EA 1KIQB 1ERNA 4KTDL 3ZE1F 5KJ4A 1CFNB 4RWHA 4X5XA 4I0PB 4XCNB 2C3VA 4DNLA 3WTVA 1T1ZB 3RI5F 5EEXA 2TSBA 3PWPA 2JJWA 3DKHA 3P0YH 2Q2EB 3S35H 4HA1A 1NCOA 2H8PB 2WXMA 1JVOA 3PQYE 1NOFA 3ISWA 4TVSa 1KG0B 3UAAA 1DQVA 4IBZA 5EPMB 5D7JB 4U31A 3V6OC 4PJFF 2NQCA 1E65A 4NQCD 1M1SA 4DJMA 4M8RA 4XOCA 5HYJD 2ADJA 2YD6A 3RIAK 1GPOL 3DHPA 4JPQA 3WNMA 3KPSD 3D25B 3LS4H 2BSSA 4TNGA 4U6VH 3AMLA 4WUUA 5F1KC 3NJNA 4X8GA 3VXRA 3P3UA 2BVTA 3IAGC 4XPAH 3MLXH 3A4EA 1BOGA 1AD0B 4FTVA 2NY5L 4PV8B 4UYQA 2XKNA 2YD9A 2XYCA 4NT6B 2V9UA 5T1LB 1FIGH 4UIKH 3DHMA 4OAWA 4WGKA 1NLBL 4ZMNA 2A4ZA 2ZP8A 3CC5B 5KANI 4JG1H 1C16B 3THMH 1GS8A 4QNPE 3X17A 3GHPA 3ZUNC 4YXLH 1U6AH 4DN3H 4ZUVB 3G5ZB 1C08B 1E42A 2X89A 3IDGA 3L3JB 2IAAC 2GC7C 4PJIB 1E67A 4AQAA 4CC4A 2OK0L 1FNSL 4ODBD 5I19L 2YA0A 3T9WA 1M7DB 2J6EL 4OKVA 5AYUH 4ZNEA 5IF0B 3OKMA 2EH8L 1AZNA 1RIUL 3LEXB 3BVVA 4HUVA 5MENB 4OFPA 3EYFA 5EUKB 3IDMA 1GGUA 5AKVA 5I0DA 4X7TA 2C5DC 3FUFA 4MNGA 2ZX5A 3LN4A 4WW1A 1UZGA 1DCLA 2GUOB 1I8LA 3I6GB 3NTCH 3QCVL 2CUIA 4G6MH 2FUTA 4M7KL 3REVB 3AG3B 3C5XA 4GAYA 3T3ME 4ORZC 2GPZA 2VLJD 4MA1B 4MJ5A 3LRMA 1LDPL 1PG7W 4BQ8A 4FNPA 3DO4A 1KYFA 1DJWA 2YEVB 4PVMA 3ZQ9A 2ARWA 3B9EA 3MNVA 5F3BB 4HK3N 4DOHE 2BWDA 4RSYA 4KZEH 1TTBA 4JFDE 1ETZA 4WI6A 3CMOH 3VWKD 3HRZB 4ISVB 5HI4C 1KPVB 1GIGL 3RWFA 1JPTH 4F1SA 3KW7A 3BEVA 3K6NA 5F6IB 3UTSD 3UACA 1I1YB 2E76C 2C9AA 4HIQA 4J6RL 3K5SA 3U0WL 1DBMH 3GXIA 1SY6A 3QQ9C 4N0UA 5IVXF 2P3YA 4PJDA 1NTDA 1D6VL 1T22B 4JLRA 3GKZA 3UAJA 4XXDA 1OLLA 3K71B 2I7OA 3M86A 3VTMA 4MXQC 3H2WA 1HT6A 2QBWA 5I18L 5KEZA 1VZHA 4XBGB 2VITA 3VFRA 2OMYA 4P5MA 5ALCL 5IV2A 2B1HH 4B9GA 1IGFH 4Y1AD 1HWHB 3HUJF 1MEXH 2AJZA 3AG4B 1U3ZA 5TF1L 3QORB 1CBVL 4F58L 2YSSA 3QPXL 3H8NA 3V0HA 1UB6B 2XDHA 4LSVH 4H8WL 4P59L 2PXYC 2BS71 4AGMA 3PAVA 3UG3A 1RZIB 5MERA 3AABA 4LGRB 4MWFB 5EZOL 5FK9B 4EEEA 1A7RL 2XVBA 4WO0A 4YGVB 5TE4H 2XV3A 4P4KB 2F8XC 1XL6A 5CN3A 1IE4A 2GHWB 1L6XA 1YMHA 4P05A 3IN0A 1KXQE 2J1XA 5F7LB 2MOGA 4M6MH 2BXYA 1U8NA 3BSZH 2C7UB 4TYUA 2AKRA 3MOAH 4Y19D 2IBGA 3DX9A 1TYRA 4BUHA 3SEPA 1MCPH 2WLIB 4U1KB 5C0AA 3QDJB 1T6VN 4I3SL 3B9AA 3BP6A 5FCSH 3CPUA 4Q4IA 3O3DA 5BNXD 4JY6A 1E4KC 2V5SA 3ARRA 2FWUA 2WIIA 3OC5A 2CA4A 4FQ1L 1TLKA 2VSKB 1Z7JA 1IGIL 3DO7A 4NC1C 2R0ZH 1CR9H 4R2GB 4HCIA 2FHCA 4LPXA 3OQ3B 4AMWA 3NG5A 5KSAD 3WKML 3QK0A 3L7EB 4GW1B 2FECL 1S7RB 4WO4C 1W0WA 5DK0B 2Y69B 2X7LB 4NNYA 2EVJA 3G6AB 5INCA 2H9GB 4PJBA 4ELDA 2CLZA 4PJBE 3WO3B 4EVNB 1FVEA 5AOMA 2BVUA 2EIEA 4UBDD 2IC2A 5FO7B 2UV3A 1Q1JL 5DD3H 3HI5L 1E9PA 4LLWB 3TJEL 4P2OD 3CFEA 3TTSA 3RWGB 1HTYA 5JTWA 2N4IA 1MWAB 1KELH 5ICYA 3MOBH 2BIHA 1CFVH 4ZS7H 2BP8B 1J0IA 4UTAH 1ORSA 4OJCA 4P9HH 5L4MA 4Q6YA 1BDYA 2WXGA 3BT0A 4MNQA 5CN2A 5C6TH 1I3RA 4L1SA 4BHUI 4DGVL 1K4DA 2NOYA 1SMDA 3OZ9H 3V5DB 4AJ0A 1OIOA 5LVEA 3QW9A 3AB0C 1OARL 3CHQA 2GJ6B 4UT7H 2AQQA 3EH3B 2VDRH 4AGOA 2VQ4A 1JL8A 2PO6A 3C8DA 4F15B 3WXWL 3KYOA 3Q1EA 4JJHA 2HTKC 3FB5B 4B9FA 1RUQL 2B08A 3FO1A 1AQDB 2BX5A 2F53A 4ZW7A 1WDAA 4PJBF 4HGKC 4TTDC 4EDXA 2PW2B 3ARBB 3UJJL 3QDMB 1GRWA 4PAZA 3KYKH 1GZQB 1ZHLA 4Y5XA 4FTVE 4AY0A 1LQSR 1U30A 3D2UA 1MJ8L 1WFNA 3O45B 3M45A 2ATPA 1BQKA 3KWTA 2MWCA 3DOIA 5E2TH 5HGAA 4CN6A 4MAYB 3DV6A 3RIFF 3VFTA 4IGBB 2UXGA 3O4LE 3EO0B 3QO1A 4PJ9A 4M03A 3WJMB 4GS7B 4YUEH 4KXDA 4UAOC 4MTMA 2CK0H 1IIKA 1NGZA 4QO1B 3ESNA 1RZJC 2VXUH 3E7JA 1OD9A 1TJHL 3AC0A 5KANG 2XXGA 5CLXA 2P8MB 4N2NA 1CLOL 3X13B 4AIXA 3VQ1C 5D8JL 4OB5H 2UY6B 1TZHA 1YPZE 3LKPA 2WXLA 3L17A 4OZIA 5AZEH 1KF9B 2IIJA 2R1YB 4NKIL 1KLGB 4R3SB 4ZFFA 1MFBL 4PRNB 1MJUL 1RI8A 3V7AG 3OB0H 4Y19E 3GT6A 4B5EA 1KYDA 4DN4H 3SY0B 2V2XB 2VMFA 4XPBH 1A5FL 1T7WA 4OAWB 5K59E 1YC8A 1XCWA 1TF4A 2CH8A 5FYJU 5MERB 5I1IH 5BZDA 1U9KA 3W5NA 2JKJA 2J88H 1MI5D 2XZQL 3HCVB 2BFVH 4URKA 1CD1A 4BE6A 1PZ3A 3KD4A 3KPPB 4QXGH 5EA0L 4NUGL 3W82A 4YFDB 1I8MB 1FZMA 1CR9L 4LVNB 4GRLC 2CUHA 4AUUA 4OD2B 4UT9H 3Q5YA 2CLVB 2BDNL 5EU4A 3TBCA 4U2YA 3WFZA 2OR9L 1NAMH 4A2HA 1FNHA 1MFEH 3BN9C 2R56H 2WP3T 3CQPA 4H26A 1F8TL 5KBKA 1C16A 2XTLA 1HSAB 1H8SA 4XP1H 2Z7ZA 2AJXH 3CX5K 4NN7C 4OKDA 4Y1AE 4ZMLA 5FHAL 5IW6A 3ZHKA 1GMIA 4N0YH 1NBVH 1YYLH 4H8WC 3PUCA 3GIZL 5LGJB 1BPVA 4KX7A 1NEZG 3MRPA 1RSYA 1NC2A 4G6KL 2NZ9D 2J73A 4OCWL 1LO5B 2BMKA 2AEPL 8FABB 1R3JB 2BNQA 2OFQA 2YKLL 1M3IA 5GRJL 3V0GA 5K59F 5DGQA 2YEZB 1D7DA 4XVUD 3DJRA 2D7PA 3MODL 5DK0A 3TOPA 5IR1B 1JGDB 1PGRB 3TBTB 5HYIA 2OL3H 1O7VA 4Q6IB 5C9KA 4OZFB 2H6PB 1MCPL 2WXNA 1CTOA 3NEXA 2W81C 3FQ1A 3U7WH 4G1EB 4RLDA 2C1PA 3QVAA 5A2CA 2UX6A 1JPGA 5E08H 3MV8A 6PAZA 3VG0H 5DD6B 1ZWIB 2G2RA 3MREA 1EO8H 4DEPB 3NSDA 3MV7E 3FFCD 3FT2A 1KCLA 1KPVA 4ZOAA 4D0BA 2B59A 4I77H 4AEFA 1IBYA 4FMFA 4TL5A 5JLZB 3PRZA 2WO2B 3MLTB 2WAQA 3RGHA 5IB3B 4KTDH 4YBHA 4UUJB 1EEQA 1ACCA 3BKCL 4IMKA 3MGTA 2EDLA 5KVGL 3FUIA 4WV1A 5FDYA 5C0RH 4QYAA 1R3HB 1RIVH 4N20A 3IJEB 3QZOA 3TBSB 1AGFB 3I50H 1JV2B 4V33A 5TDPA 2IBZX 3NZ8A 1QATA 5DQ9A 4E9VA 3HI5H 4QJ5B 2XI9A 4HYTB 1HH6B 3CSPA 2YHGA 5I17B 5IMMB 4TPRL 4F7TA 4HWBA 1FF5A 3IJ8A 4L4TA 2CU9A 5TD4A 5DEGB 1J88A 3SYCA 4BFBD 2YSSB 4U7SA 4Q89A 3ABMB 5JHDE 3NCBB 4KVNL 4YQXH 4AYMC 1M6UA 2R2CA 2H26A 2QKIA 1A6AB 3MO1A 4BFRA 5FO2A 5EWIH 5AVZB 4P9HL 2O5ZL 1EXHA 4NZRL 5CD3A 4YSRA 1FAIH 4KRLB 3BXNA 2FSDA 2NY7L 1T2QL 1PZBA 3MXWH 4EBQL 2VN7A 1MFUA 4XB7A 3HB3C 3QEQA 2B1AH 1V10A 7FABL 3LQAH 5G4MA 3RDTD 3MRMB 3B2MA 2G3MA 5F7DA 5F7KC 5AAWA 3PWPB 2DBLH 4D94A 3U4KA 4PRAB 5DDHB 4OF7A 2CMRL 2H3XC 4JM2F 1ZLSH 1U2HA 2BCMA 3GI9H 2ZP9A 3MLZL 3M17B 1RK0A 3MLVL 3BPCB 4UV7L 5CUSL 5KSAA 2H2SC 5HYSA 4G2AA 3V9EA 4Q2ZA 2GC4C 3H42H 4LF3A 3TCLB 1JWSA 3HMXA 4RFOL 1QBAA 4LCWA 2QTVA 4RGNB 5F21B 5TQ0L 4WW2C 3HZVB 2FX9H 1KBVA 3QJXA 1AACA 1TQBC 2WD0A 1YN6B 5AVWB 2NCMA 3FQXA 1FO0A 1G5GA 2WN2A 2DOCA 4HJ0D 2OTWB 3MZTA 1CLYL 1EO5A 3ZXAC 2ZUVA 4ACPA 4X8XA 3L6FA 1ONQA 2X12A 4G1MB 3SKMB 4MJID 4TRPH 2F15A 1FLTX 2XLLA 2FUQA 2WNKA 3NIDF 4OQTH 2VWEE 4NQEA 2CDGA 3C6LA 5CGYD 3T4AB 1U8QB 3TX4A 1I8KB 4G6KH 5FO7A 3QRFM 5L8LB 4X4YB 2ATKA 2J44A 4XN2A 3J07A 3L4XA 5EU5B 2X6BA 4S1RL 2PYEB 2CDEA 1IGML 4HZLA 2ZP0T 1FFOB 3HNSL 5AZEL 4FQLL 4M8UA 2YPKB 3ZZLA 1L9RA 4Z5RA 4AVKA 2OJEB 4PHZA 4UQIM 4KU1A 2ZZUT 4C4BA 5B3JF 3NJXA 1NAMB 2B15A 3RTQD 3NFSH 1PQZB 2UZYA 3K74B 4XWGL 4NC0B 3MRDA 3IDYC 1IAKB 4X9GA 5DF0A 3P4OA 4J3WA 2XQYA 3SDYH 1AQDA 1KTKE 2F53B 1MLBA 2GW5A 2W0FA 1OP5K 1KXVA 4Y19B 1CU4H 1IFRA 3U9PH 3G5YA 4YE0A 2Z92A 3O6FA 2BFVL 3P11L 3CDGB 4LHUB 3ATEA 1GC1C 5K9QI 3I75B 2VC2H 3ETSA 4Y4HB 2ERJB 2KC0A 2X0UA 4UBDC 3TGXA 2EVIA 1MCLA 3NZHH 1QRKA 3S3DB 3ZDXB 1R17A 3P77B 1U91B 1OW0A 1HYSD 4YLBA 1KWKA 1NIAA 3WY3A 5BVPH 3RWHB 2BSED 5E99H 4RX4D 1EVTC 1LDSA 1QSFB 3FUKA 3KWXA 4R4ND 3VDCA 3SY6A 1FPTH 2YFNA 3GIZH 1JF5A 1L0QA 4QXUH 1BJ1J 4S0TD 5I1CL 4WI0B 3QWRA 3SO3C 5HBBA 3AAZB 3F8UB 4NHCL 3QUZA 4P99A 1X9LA 5F96L 1A22B 3WUWG 2ZJSL 3EHBB 2XHNA 5IUSA 1IFGA 2FSEB 2FQFA 2IAMC 2VLJE 3MLTA 1EMTL 4LARH 3QUHA 2NW3A 2PP8A 2VSMB 3M07A 1JAEA 1EEZB 1WITA 2IH1B 5AUMA 1UWFA 3VXUE 4F57L 1WPCA 3CUPA 3QULB 2XG4A 1P6WA 5AW1B 1C7TA 3U1QA 1CBJA 3ZDZE 1SJEA 2FIRT 4FQCH 3OPUA 4MMZB 4L8CB 4HAKA 5DQ9B 1RU9L 2CO2A 1XDTT 2IV9A 1MHHB 3KPRE 3OKLA 3VI3F 3CCHB 3GBLA 1J86A 1MCOL 4GRWF 2P43B 4KK8D 5EU7E 5HHNB 5I8OL 1VFAA 3D0LA 1K5WA 4WI7A 4RQQA 4KV5E 4JKKA 4Y89A 5I74B 3C5ZB 2RQ8A 3MFGB 2EIBA 2DB8A 5C09D 4D0CA 3ULVC 1VRSA 2YPLA 1NGYA 1SYVB 1PFOA 4OUOA 4P4KA 4EN2A 4L4VB 4NQQA 3U0PA 3ZDXF 2NLJB 3NJGA 4QRTA 1AGCA 3TA3D 1YEIH 5C0AD 3JSSA 1XBRA 2C7UA 1B6UA 3C12A 1U36A 4DVRH 2BVPA 4W9DC 2Z8RA 4JZNA 3IDYB 3PP4L 5E4AA 1D7BA 2EO1A 1A1NA 1W6LA 1HSBA 1XD0A 3PU7A 3ATAA 3T8XA 1S9XB 4H0LC 2DQGL 3CZGA 3EO1A 3L16A 5H37A 4OFQA 2DM4A 1ACYH 2G60L 3IGAB 3WFDL 3UBFA 1TXKA 2ICES 2CGYA 2R7EA 3K2MC 3P40A 3BPOB 3S34L 4MD0B 2OSWA 4F9PC 5KVGE 5D7KD 1YY8A 4JFDB 3IMBA 3PWNB 3A6BL 5C2BH 1H8NA 4F91B 4M6ML 1Z32X 5AVQB 1YN6A 3RG1C 4NWUL 1DVFB 3C87A 5LBVA 4YXKL 4M5ZH 5FF6A 4A38A 3LIUA 3T5WA 2W9LA 1P5VA 4GKNA 4HKBB 2CLZB 4A37A 1T03H 5JLZA 1UJTA 4CAGA 1TETL 3ULVH 3EJYD 4ONGL 4XNZB 3SZ6A 3VI4E 1IBDA 4KKBD 4AJWA 4LCWD 3P0VL 4GW1A 1AZRA 1QWNA 1U8KB 1WICA 3FMGL 3NJKA 5C0BE 2NY6C 3IGLA 3KLAA 1OGAE 3B7YA 4FYTA 3I84A 4PRIB 2H0EA 4GY4A 2Y3NA 2F5BH 5GSVA 5HI3C 3RPIA 4ELME 1UH4A 1QFWI 3KCWA 3VAEA 4TS6A 3SHSA 3JWNG 4MNQB 3ERXA 4N90E 5FA3A 3VGAB 2ED8A 1BBJA 1QFUH 2CO1A 4BSVA 1UGNA 3AROA 1UA7A 2HLFD 4IBYA 3SQOH 3S7GA 1L9TA 2BC4A 2NY3C 4LCCB 5IK3A 3V4PA 1FAKT 1MWAA 1FZJB 4ANWA 3NIFE 3OD3A 3ZHNA 4LLVB 5IEKA 2ZUQB 2F8VA 2IH3A 4HWZB 3AREA 5I5MA 1UFUA 1M2OA 3FQ4A 4ANXA 4X6BA 2B4CC 1JXJA 1IAMA 5C09A 4AQEB 1MH5B 5CIPA 2VJXA 3FTZA 1HC1A 4MQSB 1P5UB 5F0PB 5IB2A 3BZEA 3VVVA 1UM5H 3K6IA 5IBUB 1MNUH 2VXTL 1OM3L 4CBPA 4Y9FA 1ZXQA 3KBEA 4KJPC 1GPOH 1KIPA 5DLML 3NJHA 1EBPA 2E6QA 4MB4A 4WCYL 2EINB 3EO0A 3QO1B 3VSTA 3GJFB 2FGZA 4CSPA 4N8CL 2JTYA 3WN5B 5IGXH 1NC4A 2C9XA 4GUPB 2DLIA 2ZUTA 4ZMPA 2KDGA 1EXGA 3N06B 3MJ6A 4AEHH 5F7DB 4FNTA 5B8CB 3CIAA 2E7BA 4WAFA 4PRDB 1NBZA 4J4PC 4JM2C 2QSCL 1IBFA 2PCPA 3JVGC 3II1A 2WTRA 1F45A 1HNFA 5D7LB 1FNGA 3MTXA 5EF2A 1SQMA 5LGHH 2DTSA 4Y8DC 2VRAA 3MTRA 5H35B 3CZJA 2WW8A 2P48B 1MCWM 4R7VA 4TQIA 3TZVD 3LRLA 4GQ9H 3GIVA 4KUCD 3B2XA 4ADGA 3ZE2E 2CRZA 3FQXB 2QV4A 4M7JL 1PZDA 1BZDA 2VM3A 1ZA3B 4YVNA 1JPFA 1GHFL 3DXAA 3KLQA 4IHBA 1Q1PA 5F1NB 5IROC 2O6EA 4HXBH 3TYGL 2RFXB 5KS9A 1BF8A 1CK0L 1W2KT 4P9HC 4UI2A 3VXME 4EUPB 1E3FA 2X1PA 2HCZX 3D39B 4LESA 3ML9A 5DUBB 3JYBA 1OE2A 1D7CA 5DTFA 3WJJA 4J3UA 1F3DJ 3HZKB 3OXSA 1IUZA 1Q9OA 2LT9A 1E9OB 4E9WA 1THAA 4PJAA 4YSPA 4OW6A 3NGBC 2QR0B 3TZVB 1FFPA 3DETC 3U9UA 4XWOD 1S8DA 3BVUA 2OKMA 4LDCA 4ZMYA 4BQCA 3RDTA 1U8CA 3EYQD 5DHVB 4AQ1C 3GINA 1ID2A 2DWDB 2GUYA 1XGUB 2CO7B 5FM4A 3VX0A 3KNBA 1YUHA 4P23C 3CN2A 4LU5L 4DOHB 5EU7C 4TULH 2NDGA 4I9WE 3UP1A 2BW5A 1L0YA 4QXWA 5B1KA 4ZMXA 3Q8AA 4XXWC 3E0GA 5CBAB 5ESVB 3SD2A 2PYFB 2ICEA 3QUZB 4L9LB 4QHMA 5E6ID 3S96A 3ZTJH 3ZOAA 5CO1A 4WWKB 3ECWA 1SN2A 2DKSA 3LHPH 2VDPB 3T2NL 3FFDB 4WNQA 4TOYH 3VSUA 2DQGH 2WBWB 4FABH 1RZ7H 4XCCH 2AAVA 1JGEB 3IJYB 5CLWA 4FG6C 4JQIH 2FX7L 4ANVA 1PDKA 4JFFE 5ILTH 1I7ZA 5KBLA 2BJMH 4DCQA 3A4FA 2BVYA 1I7TA 8PAZA 3QG7L 1QSEB 5K33A 1A4KB 5A6IA 4DP8X 5HXMA 1SJHA 2QGEA 3D5OF 2V5TA 2AQTA 4NQED 1EV2E 2UVEA 2FJGB 5GJSH 4LASL 4B0MB 3M7OA 3B1TA 5DO8A 4DTGH 3HN3A 3M7FB 3GXMA 3H55A 3JUYA 2JK5B 4PPTA 5DZAA 1S9WB 4HIPA 4QTHA 3RB5A 1R3KB 2AJUH 2CMRH 1U8JB 3CSGA 1W72H 2VZ1A 1RPKA 3C2AL 3TNMA 1FUNA 5I28A 1MFNA 5DZOA 2DQJL 3ARDA 1N10A 2IDTA 3O2VH 4FEMA 3IFPB 3QJTB 3AUWB 1G9ML 3NEEA 5GRVK 2NX5B 3UGUA 1C5CL 2GITA 4MXQD 4KY2A 2XTSA 3ASWA 3KGSA 3BVDB 4PB9L 2KI6A 4YDIL 1S7XB 2X10A 1ETJA 1H3VA 3D69A 2X40A 4ZODA 2AQPA 1JXDA 3SQOL 2BERA 3QZPA 1OGAA 1CD8A 1SUHA 3IJSA 3VFMB 4TNVK 1MJJB 3RY4A 5K9OA 3WTTA 5FR3A 2GABA 2QKIB 5JA9A 4KHXL 4MJJA 3BQUD 2DI9A 4X6CF 1P4BL 4MXWH 4FLQA 4MCMA 4PRAA 2W9EL 4OZGA 4XVSH 1A9EB 3PP3H 1OCWL 2WAHA 4XN7A 4ZNCD 1QMUA 2B1OA 1FNGB 1HX0A 2R0LH 3HI6L 4G8AC 3ULUH 3TCLA 1AIZA 3KDMA 3MOAL 2XJKA 4EO5A 5FPIA 1UCBH 4PJBB 1H6EA 1UM5L 1OM3H 1AGEA 4PWJA 4AZ8A 4NFDA 1N6UA 4XMLL 5E7BA 3FAXA 3V6OA 3MBWB 2VISA 3JXAA 4G5ZL 4X6EB 1X5XA 2NY4B 4Z7NB 4Y0GA 5KVEE 2Z0UA 3PDDA 3BX7C 2C3HA 2DQCL 4X4XB 3ZDYB 2R1XA 4PBWD 4FERA 3BCDA 3JZYA 3ZRFC 5EZLA 2WZPA 4BFNA 2ZG3A 2MFNA 4APQD 1C08A 4RBPH 1EX0A 3BKJH 4LQ1A 3KLHD 2AABH 3HBZA 1DUZB 4XOBA 3KW8A 4EN3B 1ZV9A 1A9VA 3TTYA 3IMUA 2O4EA 2A9CA 2XWZA 3NCXA 3SYPA 5B1JC 3O6MH 2YGOA 2G9HA 3O6KL 4IIZA 4FZEL 4JDZA 4ANUA 4K3DH 1AP2A 3ARQA 5DD0H 3U82B 1RCYA 4NUMA 2NRDA 1IM3D 3ALXA 3FYEB 3L5HA 4LSTL 3CNKA 1BGXL 2Y72A 3P4OB 4AQAB 4JDTH 1R5IA 4NX0A 4ONHB 3MRFA 2NUTA 1RHHB 1QFOA 3LVTA 2X89D 4GMSH 5F9OH 5A2JH 4I1PA 1I1AD 3NP3A 1QEXA 3KLSA 2VDMB 2SEBA 3I75A 4GQRA 4OTXL 3P9LB 4Z5RB 4Z78A 4KJYA 1MRDL 2H2PC 1KACB 3QP3A 4ADJA 1MQKH 3HRZA 3FT4A 4M61B 1ZT7A 2CDFB 2I9TA 1NIBA 4I1NB 1ASPA 3MOQA 4FQLH 2ZKXA 1M7IB 3W56A 2HMID 2M2DA 4F7EB 3SKJH 2AQ1A 1PPIA 3IMSA 1WWBX 4OFVA 4DKDC 2DIBA 4TQEL 5IP4A 1G7PB 1RJYB 3KPQB 4IJ3C 1NZRA 1UWEL 3U79A 2FWLB 1DQLL 4FFZL 3GFUA 2UZIH 1P4UA 4HDIA 3L4YA 4QGYA 2EE9A 3QI9C 3WXWH 5A2FA 3TCXA 3VU2A 1K6QH 2OULB 2R23B 5HHMB 1F86A 2XWJB 1M71B 1Z5LA 2KLRA 5I74C 1LEIB 1J8KA 1T20B 2K7QA 5E23A 4HJIA 2UWEB 2NW2A 4BQ6A 5EPMA 3W0WE 2I60H 4GUPA 4NUGH 1NGPH 4R84A 5HDBE 4F5CE 3O2DL 4WDIA 3MLWL 5FLVA 4QRBA 1I1CA 1VCAA 5GISH 3HG3A 3UAJD 5DHMC 3RKDD 3NBNA 1UWGL 3HVNA 2IOOA 3AAZA 3PF2A 1JPFB 4HMDA 1Z2KA 3CVHB 4DEPC 1KG0A 1UB5A 2BS9A 4FABL 5L0QC 1ET5A 3TV3L 4LVHC 4Z7OF 4GP4B 5AB0A 1RZPA 2AITA 2BWIA 4PN6A 4E5XB 3RY6A 4B9CA 4C4UA 4HG4J 1CXHA 2CLRB 2MNWA 3CFCL 5AEAA 1ILSA 3ZTEA 3ZKMD 3D25A 1A3LL 2PPEA 1FO0H 3NCJH 1ZT4A 4LASH 4J3XA 5EU6B 1L3WA 3ZGIA 3HC0A 1HHIA 4M5TA 1IBGH 1UM4H 4MNHA 2YQBA 1TTAA 2WKLA 3DWTA 3HE7C 4FEIA 1U92B 4G7YL 4RQQB 5CZRA 5IW3A 2F7PA 4TMPA 5F6IC 5JQHC 4LCVA 3KBFA 4HBCH 2ALWA 2WLIA 4X6DE 1F6LL 2ORBL 5EO1A 2HKHH 4KGLA 2IALA 3EYFB 1KTBA 5INDB 4XNXH 3VXOB 2X7LA 3E80A 2ADFL 3NRQA 4P2OC 1VACA 1VEOA 5DMIL 4GIAA 4U4BA 4NNXB 1XCTB 4AIZB 1B9KA 3K8LA 4AV0A 4H8UA 4PWIA 1MUJA 4IKNA 3LSOA 4R83A 1BQRA 1KIUB 4JZJB 3A6CL 5FFOA 3VE0A 5CSZA 2BIPA 5F9JB 4WNQB 4OIIH 3MV9E 2L3BA 1IT9L 3MNVB 2VDKL 1EHKB 4X5QA 4X7CC 5MENA 4KK5D 5TFSL 4HZ1A 3GMMB 4EJ1C 4L0ZA 4K3JH 1HZHL 4JAMB 2CGRH 3PCYA 2GUOA 2VDQL 3RY6C 2NXZD 1T04B 1T7VA 3RVTD 3LKQA 2WNXA 1EGJH 1EEYA 4JO2L 2ZYIA 1CFSB 3RA7H 2XTJE 3SYAA 5FIEA 2X2UA 4W6XB 3QCVH 4DSYA 5I2IA 2LLLA 1E5UI 3HI6H 2BY3A 2VKWA 4NI6A 1FYHB 3Q48A 2X1OA 4NKDB 1LWRA 3DJSA 2OL3L 1W8NA 5HI5D 5I1EH 5F3HA 1IU1A 3VYPA 4WLCA 1JPEA 4GKNB 4HKBA 1H19A 4H40A 1XFPA 2G5BB 2FJHA 2ZUUA 5FYKL 2PO6B 1DDTA 4QRSA 1GYAA 3RY5A 1LILA 1G7HA 3FOMA 4ZYKB 3QRLA 2VTFA 2XTJB 3HG0A 1WAAF 2EC8A 4DVBA 3VMOA 5HHOD 1JHKH 3MCKB 3R19A 4F2EA 3O4OC 3TFBA 4XN4A 4YPGA 3OHXB 3WMSA 3C6SB 5IV2B 1A6TB 2Q76B 3FQNA 1YDPB 2FB4H 3RUGF 2VO5A 4UOQA 1WWWX 5FHAH 3G6JF 5BXFB 1WBXB 2AQNA 5KVGH 4R96A 2CO4A 4AKQA 1DQQA 1T4KA 4WHDA 1P2CB 5D7IA 4AV5A 5DYOA 2O5XL 2Z91B 3WD5H 3WIHA 2XWRA 2IANB 2EUXA 3C8KB 4O9HL 5CCHE 4HGWB 1G1KA 1NIDA 1T21B 3VXMD 5HHXH 4X42A 4XCFL 1ZSHA 2HUEA 3G7TA 1G6VK 1X5JA 2NXYB 3L8QA 5JNYB 4JRYD 3NT0A 1UEYA 2V5RA 3BZ4A 3KM1A 4V1DE 4OCMC 4Q6KA 3ZKQD 3OJMB 5IHZB 2OP4H 4X5LA 1VIWA 2R1YA 1A65A 1M7UA 3MV8E 3QRGH 4K55A 5IB4B 3ARDC 1PZ5A 1NGZB 4GO9A 3O0LA 2VM4A 4U3HA 2B9AA 1SYSA 3NA9L 3DMMD 2GIXA 3E2HC 3SE8L 4DAGL 1TTCA 2AV7B 3TWCL 2E56A 3S37L 1D6EA 3JTTA 1JPSL 1BA9A 4IRJB 4LLAA 1Q0YL 2FT8A 1U93A 5FUCC 3T77B 4A66A 2NX5E 1UQSA 2VXTH 3W37A 1CDHA 5I76A 3LJ3A 2EEDA 2R2BB 4AW7A 4I3SH 3AM8A 4ABVA 4GMTH 3TO2B 1CL7I 3CXHK 4LAQH 3O2WH 3RVUD 1IBGL 1UM4L 5EFIB 3OAYK 3ZTCC 2O6PA 3ZKXB 5F1IA 2A9BA 4FQJL 2Y1VA 1DVQA 4U1GC 3IDNA 4ZTEA 2BNQD 2XPZA 2J5WA 3FB7A 4DIXA 3GMOB 4MS6A 2WBKA 3UEZA 2W65B 5HGBB 1JDDA 1F90L 5C0DA 3DXAB 4AVHA 1TZIB 3RUGB 4DZ8B 2CR3A 3WNLA 1RIVL 2YLHA 5DK3A 1OAJA 4JFEB 3WY1A 2FX9L 3AB0B 3CBJB 4L5FE 1IAOA 3T2NH 5E1GA 1PG7H 2VSCA 1IAIH 3W9EB 1RZJH 3MDJA 4NQVA 5T33H 5A2IH 4BRJA 1EJ6A 2Z31D 2HFFA 3UYOD 1NUGA 4AT6A 9PCYA 4IBVA 1UENA 4OIBA 3JV4A 5JW4M 1CF8H 4O2EB 32C2A 3HPLB 5GSRA 4M7LT 3RFZB 2FX7H 2WYHA 5ANME 4XMVA 3W39A 1ADWA 1QLRB 3ZBMA 5CZKA 4UCFA 2Q7YA 2GHZA 1CICC 4BFIA 2P45B 2F54E 4HX1A 4CVXA 1OP3K 2Z9TA 5J1TC 1TVHA 1NC2D 2F54B 1ITCA 5JIQA 2E7LA 4LMQE 1FP5A 4X6DB 4RAVB 2YD8A 3QORD 4K5NA 4NC1E 3LAFA 4NM8H 1P1ZB 1B0IA 4KUCF 1UT9A 4BWWA 1IM3A 3KS0H 4MQTB 3HJ0A 5DJDB 1X7QA 5B3JE 1CDGA 2VDNB 2APXA 2C9VA 4PIBA 1N0LB 2ITCB 4XN5A 3KL0A 3TBYA 1J1OL 3PPSA 3N2JA 4OZFG 3ATFA 5AZ2H 1GC1L 2V17L 3WNJA 5ITBL 2EC9T 2WINA 3EZ8A 3ZK0A 1PKQE 1SXCA 4NNPL 5ES4B 1ZHBB 1S9VB 2F74B 3VFOA 1WZ1H 4ZAKB 4HHAB 4ZUWA 4OGXL 1IAIM 1F11A 4XXWA 4APQA 2YC1B 2WVVB 1DO6A 1JV2A 3NCMA 5HVWA 2PXYA 3UEQA 3LKOA 5IOPB 3QUKA 3MRBA 2BRRL 1BWMA 4GPVA 3WNNA 5HY9B 1TCRA 4L9LC 3HVDA 3KYNB 4NZ8A 1U8MA 3BPLC 1AH1A 1CXEA 4N5ED 3WE6B 1E8WA 5IHUH 4MKMA 2ZXDA 4NPKA 3MUHL 5BZDB 1DJGA 3BSGA 1WFOA 2I9LA 2Z35A 1OCWH 3V7MA 1V54B 4LIQH 2VL5B 1CLOH 3P4MB 3ZDYE 4KPHL 4FG6D 1MWAL 2B4CH 3PWPE 3WGUB 4B9JA 4DGVH 1ZGLB 3KWWA 2W8CA 5IT2H 5DRZA 2CLVA 5EU4B 3L1OH 2PUQT 2VDRB 1ZV5A 2X1XR 1IC4L 4CMMA 1JF1A 2QHRH 5CU9A 4FNLL 4HGWA 2DYPD 4NQXB 2IV8A 4IKLA 5EIIG 3Q44A 5FYKH 1BQ5A 5GGTH 1MJ7L 2H1PL 5IROA 3RPBA 3GHEL 3APMA 4FLOA 2XA8L 4MSWB 3ZDZF 3CWGA 5I8OH 2F19H 3QARA 5AFAA 1DBML 5HHQA 3AS0A 3INOA 4MD0A 3AREC 3FT3A 8FABA 4OM0H 1P0SE 4JRXE 5TDOB 5JW5A 5L8KB 3QAZB 2JKXA 4PV1C 2F68X 2K6ZA 2A6DB 4N0UE 4P48A 5KS9F 5BS0A 1PY9A 2FEDD 2QT6A 3CSTA 3GRWL 3D8MA 3K6DA 4Q2ZB 3U83A 2BO0A 4MA8L 1LEGB 4NZUL 3ULAB 3OLEA 3VXUD 4G8GA 2F08A 2JJSA 5CJQH 2YR3A 1QABA 1O6SB 5LG6A 4GUQA 1LO4H 2X4SB 2YRBA 5TE7L 1INEL 1DLHA 1OF2B 5BVJA 1JJUA 3ULUF 4MJ6A 2VLKB 1LP9A 5A43C 1CT8A 3X1BA 2G3ZA 5SX4I 2GK2A 4UQCA 2CRMA 2DYSB 1YUKB 2VJ8A 5GZOA 4PJ7A 3L9BA 2JFCA 2QVFB 3FFCB 4KTGA 4Z77B 4PS3A 5GRJH 2NNCA 1M9WA 4EN3A 4MNQE 1R3IL 3BVNB 1MIML 4DK5A 5T1KD 1CYWA 1ZIBA 3C6EA 5I8CA 1EVUA 3MLXL 2EKSA 5CINH 4AYFA 3BGMB 2APBA 5TH2A 1KCVH 2BWQA 1NCGA 1RL1A 5C0BB 2I24N 4DGIL 5D1QA 3LIZH 2B59B 1BJ8A 4N5EC 5LXGH 1VADB 1TTRA 2Z64C 2CPCA 1NFKA 3VG0L 4FDWA 2VZOA 4L3ED 2LAGB 3LOWA 1YQVL 1KJ3L 2EACA 1E40A 3F7VA 4Q0XH 4ZFZA 4AQEA 3HG2A 1AG6A 4GUOA 4RRPG 3RVVC 3EUDA 4Y2OB 2IADA 1XSOA 1FNSH 4QNPF 1KY6A 2CM5A 4KJYB 1XF5A 3MJ9H 1QBBA 2DLHA 4RNRA 4D3CH 1Z5YD 4YDKL 4XPHL 1MCBA 3UYPA 5EZIH 4E41E 1OPGH 2FEJA 1T4KB 2GFBB 4C4KO 4BA0A 4PLKC 3KXFE 3FH5A 5DXWA 4B9IA 2VC2B 2YAFA 5D7SL 1QFHA 1T21A 4J3VA 1BIIA 2V2TA 4TPRH 4BKLB 3MJWA 1MREL 4FFZA 1JYWA 4JX0A 3HUJA 3GXPA 2QZ5A 1DJIA 3EOAB 4PS4H 4KAQL 1LMKA 2B0SH 1T5KA 1RJLA 1UG9A 2CGZA 2BIIA