3ATBA

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
196
Chain Sequence
b'IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
molecule tags Transport protein
source organism Mus musculus
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
total genus 39
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3atbA00
3SYAA 3AGWA 3SYQA 3AT9A 1XL6A 3ATAA 2WLJA 5KUMA 2WLKA 2WLMA 2WLLB 1XL4A 2QKSA 2X6CA 2WLIA 3ATDA 5KUKA 3SPHA 2WLIB 3SYPA 3ATEA 4KFMA 3AT8A 3JYCA 2E4FA 3ZRSA 3K6NA 1U4EA 3VSQA 2WLLA 2WLHA 2X6AA 1N9PA 3ATFA 3SYCA 2X6BA 3SPJA 1P7BA 2GIXA 4LP8A 3SPIA 3SPGA 3ATBA 3SPCA 3AUWB 3SYOA 1U4FA 2WLNA
chains in the Genus database with same CATH superfamily
5DDHB 5KWYC 4LLYB 4FHBD 4PRDB 5KS9B 4PB9H 5HHQB 1JPTL 4X9FA 5DEJA 5J1AA 2J55A 2ZTBA 2P80D 4MD4B 4JRXE 4F57L 1HYRC 1YEEL 1KN2L 3TEXA 5CS7A 4P3CH 4YXHL 2G5RA 1LO5A 3SDAC 4NO5A 3SDCD 2PMZA 4WW1A 5DGQA 1E50A 3QH3B 1BXXA 5E2JA 5AVQB 3ZN6A 1JGDA 3HB3D 2ZXEB 2QHRL 4YR6B 2FR4B 3UIZA 4R96A 1FL5A 4X4KA 4NQCD 1B90A 3AGWA 4Z7NF 4G42A 4LEOB 3IDNA 5MEOB 2EE9A 1IGCL 3N6YA 1PLAA 3L3DA 4IGBD 3UJTL 4OCRL 2P8MA 4M1CC 2YD7A 2C1PB 4LVHC 5C7XH 5F1NA 3C9NA 4FCAA 3HIZA 2COVD 4Y4FB 3ZTCC 4B96A 2H32A 1UVQB 1ZLWK 4JY4A 3OF6A 5J1TC 3G6JF 4F9LC 1SDAB 1M57B 4UT9H 3A6BL 3AT9A 2YEZB 3VXMA 4G8AC 1LP9E 3BWZA 4K5OA 3OKNB 2OBGA 4LSPL 5BNXD 4PI0A 2X3CA 3VFUA 5JHDE 4F7TA 4HU2A 1RFDL 1SBSH 2HT4C 1HX0A 4JS7A 2EXWD 4HPYH 3QG7L 4OF7A 4QNPE 1PAZA 5JIQA 1ZV2A 1ZPUA 3T1FB 2XN9A 1MFUA 3D3VE 2AQSA 5L2JA 1NGWA 3GMNA 1XGQA 3KYNB 1KTRL 3D05A 4UUJA 3LZQA 4UINL 4UT6H 4DGYL 5ISZE 4NN6B 4UM9B 1ZS8A 2NY5L 5I5MA 2IBGA 5TDOA 1S7QB 4JPKL 4ZTEA 4D8PB 2A74B 3B9DA 3EJTA 5KANG 1J5OL 1KBBA 2Y1ZA 4MVBC 3X1EA 4GBXC 4IRSD 4MJ6B 3I6LD 5DD3H 3HI1A 3VRIA 5EZLB 1KFAH 1L9QA 3CFTA 4GOSA 5D93B 5A2BA 3QJSB 1OTUC 4XAKE 1PZSA 1Y0LB 5HHOA 3VX0A 5IJDC 3TURA 1E9QB 3NJJA 5IB3B 2PPDA 3HRZC 3FT3A 2NY4C 1CGYA 3T65A 3ZDXF 3V4PL 4KI5F 1FZMA 4YC2C 5I1GH 3SO3C 1C8PA 1TCMA 1HJCA 1E28B 2FO1A 3JTSB 4PFEA 1ZS8B 5D7IB 4Q4IA 1BD2E 4NFDA 3HRZA 4LVOB 3VYOA 1FORL 4RRPG 1KV7A 4PJ9C 4PRPE 2HFTA 3D0VB 1H15A 4HFWB 1BW8A 5DYOB 3C5ZC 5IWLA 5FUOH 5I0XA 4TVPH 2A4EA 4X4ME 2VRAA 2FQDA 1AE6H 2L7QA 2Y5QA 4IMKC 1QZNA 4EN3D 4JM2B 3SPVA 4P23B 5IWLC 1WTLA 1GH7A 3US9A 4L29A 4NUJA 2AXGA 4G1MA 4KJWD 5DMKB 4JGUA 2HMID 1FVDA 5ESQB 5KJ4A 4M7JH 6FABH 2DJ4A 3QCUL 4MQXC 1W72L 4HSCX 4OD2B 3SDDB 2P5WE 3EJYD 5I1JL 1KIUB 3CSPA 5C9KA 5GGTL 4CW1A 2X7LB 4MQ7A 1PBYA 1OZTG 3QEHB 4WTZA 1G87A 1EPFA 4ABVA 3EJQA 3RDTC 4H1LG 1K5NB 3BSGA 3ECBA 1RIHH 5C08A 1PG7H 2WZ6A 5DJDA 4NZTH 3D3VA 4UQ3A 4YJZL 1U3YA 1BQLH 3EG9B 3JWDC 3NYKA 4PGZA 3WO3B 1CGVA 4RGNE 1XGRA 1KNOB 1KBGH 1LO2H 5DVOA 2F53D 4R2GB 1IQWH 1K2DA 2N3JA 1M42A 3VGBA 1KYOJ 2F7RA 3MJGX 4LKCB 4P4KA 2V8LA 4XP4H 5GS0C 3IDIB 2EDDA 2Z92B 1OAZH 3OWRA 3UCQA 1YZZA 1QTYT 4FLHA 1L5GB 1N0LA 4WNJA 2YMTA 3E38A 4OCSL 4ETQB 3L3IB 5DJ2B 4ZUVA 2J25A 4KKBD 1MPAH 2UZXB 2CJUH 2HRPL 5DRZA 5C0FA 5JA8B 4UIKH 3VGAB 5J1AB 1FNLA 3TGXA 3HCVB 4PRNB 5FUCE 3AXIA 3DVNA 2ADFL 4R90H 1RZGA 4KK8D 1X4YA 1K6QH 1JN6A 3CZJA 4QOKD 5FX3A 3VSTA 5AD0B 3SDCB 1YQ2A 1IM3A 4NIKB 4H1LA 4QHPA 5GGRA 5DJDB 3QEUA 3EUUA 4XBGA 3SBPA 2H3XC 4UQAA 2RQ8A 5IVXE 4X4XA 2PCYA 2OYKA 3TCLA 2NNFA 4M7JL 5I6XB 4J2QA 4PS7A 3DVGA 1Q9OA 4KZEL 3TBSB 1S7WA 2CIKA 4YDIL 4NC1C 1T1ZA 1OCCB 4OB5H 3E7JA 5JXED 4CVZA 3FO1A 3LKQB 4ZUWB 1UA6H 3T04D 3I02B 3D07A 4KK6D 3O2VL 5TQ2H 4RBPK 3S6CA 5ITFA 3K4AA 4KNSA 5IOPA 43CAA 3WKYA 3GMPB 3TBTA 1ZGLM 3DK0A 2F18A 1NKRA 5C6TL 1RUPH 3NUKA 2AXGB 3KNBA 3FPXA 3MFFA 3PWJA 2E47A 3ESOA 1F13A 5DLML 2BSBA 4I2XA 1J1PH 4AMXA 2GY7B 4QLWA 3B6SB 4YBLC 5DJZA 4U6VL 1GOGA 3MV8A 4HULB 5KBNC 3CCHB 1R5VB 5FM8A 1UD2A 2IH3B 1BDYA 2KQNA 3BPOC 4TOYL 5E8DL 1FA4A 2DWEA 2D73A 2GQHA 5DYOA 4R7LA 2G2NA 2Z31A 3GBNH 4I1NB 4MQTB 5FW8A 2XBTA 1S3KH 4I0PA 1QRND 5DC4B 4BWTA 1MAJA 2R29H 4MLSA 4XHQA 2YD8A 5JLZA 3C8KB 3O8XA 3EBIA 4NWUL 2XFGB 3OJVC 1GGCL 1JPEA 3BIAX 1WG3A 1S6NA 2HKFL 1FZMB 2NY1B 5AB2A 2I60H 1UUNA 1MZYA 2B4CL 5DJAA 1GL4B 1X44A 1KCLA 3BZFB 4G80A 5FW6A 3GIZH 3T65B 4EVNA 1AZBA 4O9HL 4G82A 4JHAL 4G8GB 2KZWA 2ZONA 3WSQH 4P05A 4U4IA 4W4OA 1YDPB 4J28A 4WGWB 5F7UA 1BIIB 2BK8A 1W0WB 5IQLA 3BPCA 4TSBL 5T3XH 3NOIA 2IOOA 5T3ZH 4UIMA 5C0JA 1RZIB 5E95B 3WNJA 1UH3A 3VXMD 1YNKH 4HC1L 4Z7QB 3WEBA 3HR6A 2MNUA 4HLJA 3I2CH 1X9QA 3W11C 4B97A 4WSKA 1J5IA 3EDEA 4G9FE 4QRFA 1AD9A 3VI3B 5DD6A 1S2EA 3VXSE 4KDTA 3V0DA 1BAFL 1NGWB 3GMNB 1IAOB 4N20A 3Q13A 5TQ0L 1T7XA 4P04A 3R1GL 4X5LA 3S4SB 3DVIA 5LVEA 1G7PB 3V0VB 3W1ZA 5LBSA 1B4JH 1FH5H 4I88A 4S11A 1M1XA 3WIIL 2EVIA 2R56H 4C4UA 1AD0B 3ZHNA 3DO4A 3AY2A 4ABQA 1J1OH 4W9ZA 1S7UA 3FCSA 1LGVA 1F90L 4KWUA 1S9KC 3CJJA 3LZPA 1SEQL 3HG1B 3DDGA 4LCWE 5G4OA 1E4KC 2KC0A 5CZRA 4BBWA 2BOCB 2VDLB 3EYFB 3HC0B 3LN5B 3QHFL 4YHPA 3WNLA 4ZS7L 1KELH 1MXGA 2VDNB 1RUQH 3GSXA 3HN5A 5DXWA 2DD8H 1G9ML 4BGLA 4XH2B 5ADPL 4NSKB 1AANA 3EFOA 5G5DB 1VGKB 4UTAH 4EQ2A 4L1DA 3ZJAA 4M62H 5JXEC 3RX8A 3II1A 5AVTB 3SE9L 2Y2YA 5ADPH 3QWQB 2ZAIA 2BIMA 1EZSA 4P9HH 4PHZA 1NIAA 3LKNB 2QQLL 1MRFH 4Q74A 4DZ8A 5FWRA 2J8UB 1MCRA 3PHSA 1FGNL 4DGIL 4CU7A 2XXGA 4LL9A 2BVOB 5LCVH 4LAQL 3EYQD 2A77H 5E1GA 3HMWL 1KN2H 4YDIH 1S4IA 2QPDB 3OKYA 3VGEA 3QYNA 3MJ9A 2B1OA 3X14B 4I89A 1MFAL 2D3LA 4BA8A 1T6WA 3QH3A 3UTSD 2G4EA 2EIZB 2BNRE 4JKWA 1AXTH 5AAWA 4OFYD 5BS0E 2VDLH 3PIQB 5LB1A 1FNGA 1P7KA 4M4PA 4KK5D 3BCFA 2GHWB 3F7VB 4H25A 4M9PA 1S5HB 4YSPA 3DOIA 2HG5B 3IJSA 3MGTB 1RVFL 3PS6A 1OZUA 4POUB 4BSWB 6TAAA 5L0QB 5LBSL 1E4XL 3RURA 4YQXH 5A16A 4TULH 3MJ9H 1EHXA 4AVKA 1MCOL 5D1QD 1Z0NA 3BRDA 4FXGC 4OJCA 4KITB 4HWEH 1E40A 2P5WA 1T2JA 3ARBC 3QEQD 1XO8A 2G2PA 3CDGA 4W9KC 4KRPB 1SXNA 4MNHB 3VDBA 2P5WB 2VRKA 2X6CA 1WFUA 1BM3L 4YFLF 3K0WA 2OMYB 5PCYA 3TH2T 3WAKA 3ZUCA 3K5SA 4QOKB 1HNYA 4IOSA 3WENA 4L3EA 2PR9A 3LQAC 3T71A 1M53A 3DUUA 4U1GC 1R3JA 3TC9A 5HI4D 4FG6C 4PWEA 2EDTA 2HPTA 2VWEE 3ZKQD 4H25B 1A6ZA 2PXYA 3NABL 4KRMB 4PRHA 3PAYA 4HEMA 3U9WA 1XSJA 3MBWA 1ZT7B 2AZUA 4PLJD 4TUOB 4QXTB 2P48B 4P99A 1F2QA 5A2KH 4GMSH 5T33H 1KIQA 1J5DA 5SV4A 4DVBB 3AU1A 4Y1AB 1QEWB 3W81A 1USQA 2XTJD 3L4YA 3UBXB 3GSOA 1FC1A 1ORSA 2VW4A 1ULVA 2FDBP 4U33A 5GISL 5I73B 2H45A 4XCEA 2PNDA 4F20A 5CCKH 2NTSP 2PO6B 3ASOB 1A7PL 2DJSA 4HJSA 1CICC 4JREB 3DYMA 2AQPA 4IBVA 3G6DL 2VL5B 1NIBA 2QV2A 5E08L 5EO9B 1YUKB 3N85L 1QTPA 4FFWC 4QRQA 3WNKA 2EXSA 3C6LA 3FBQA 3JWDL 3IDJA 3HKZA 4I1RA 1NFDB 3I3EA 4I3SL 3QYMA 3GSXB 2F19L 2V0AA 3N44F 5EZJB 1AKJD 3MV9E 4NKMB 5IW6A 3TT1L 2P1YA 2SEBA 1DTUA 3DIFB 3FFCE 3L5XL 3QPKA 4KKCD 2RTTA 3DJRA 4DEPB 4LOFA 3HG4A 2GHZA 5I2IA 1S8DB 4IBSA 4XP9L 5I16A 4WFGE 5D6CB 1JAEA 3P40A 5SWSB 3VB9A 1F90H 2G0LA 2XVGA 3HI5L 4Z7QF 4LNVA 1DQDL 2PR4H 2DYRB 4OF6A 3MRHB 1Y07A 2C1OB 5EF1A 1MFMA 1JHLL 3ZDYB 5F88A 2FWOA 4L4JA 1WGVA 5F7EH 4H88H 3NCXA 5DR5L 5IMMB 1U93B 3VTMA 4MXVE 1ZSDA 2AJ3B 3BAXA 4ES8A 1G1CA 4PRAB 2FECL 3ZKSD 3EBGA 2FYVA 1F58L 2WIIB 2ZG1A 4HK0A 5L9DH 1GYAA 3SBWA 1QFWH 4HS8L 4LRIC 4RBPH 2ZX6A 3H42L 2AJVH 2CGRH 4FN0A 1DLFH 5MP6H 1MFBL 2IPKA 3QNXB 5J12C 1FVEB 5DEFA 4KHTL 3VFWB 3GPSA 4IDJL 2K3TA 1SOXA 4AYGA 5TGBB 2I85A 2H1PH 4EDXB 3D50A 2NOYA 2WLMA 3EO9L 5CLYA 3NP4A 1BIHA 1U8MA 4KO9A 2K4AA 1LQSR 2NPLX 3RWDB 1RVFH 3FN9A 5DJAB 5CJBA 4TSAH 4XN8A 4C55A 4KNTA 2P5PA 4YHKH 4DGVL 3GPEA 1DVQA 4YHMH 4X6FA 3SYCA 4FYSA 3DXAE 4XMVA 3BW9B 5HJGA 2D7MA 5CEZH 4AXWA 2R7EB 3HNVL 3J07A 3ARFD 2R29A 1N18A 3AWFA 4I0PB 3F6IA 3B9KC 1BZ7A 3LEVH 5AG8A 4Q9QH 3CH1A 4IIZA 1QHQA 1TNNA 2CALA 3HI5H 3UH8A 1VEOA 4QPEA 5FECA 2X1PA 1N3NB 1PFCA 1FVCB 4R26L 3FO2A 2O5NA 2K9FB 1HAUA 3HE6A 2H2PD 3IFLL 32C2B 3V8OA 5DGRA 1CO1A 1JWMB 3IMTA 1T1WA 4XZUA 2WQAA 4PBDA 2HJLB 1WE5A 5ANMB 3P0VH 1A9BA 4J3XA 4I1PA 3HMXA 4K2UL 4G6ML 2NYZA 4GW1A 1QR4A 5C0NC 1A7OL 3MV9A 5FF6A 3NSDA 5DRWA 4JQVA 4PV9A 4XO9A 4MYWB 3GNML 1CIDA 2DDQL 2VXQL 4HXBL 5A7BA 2B39A 3GRWL 1TT6A 3VG0L 1JZ6A 4JZNB 2WOYA 2YQBA 2UZYB 4JO2H 4K3JL 3T4YB 3NACH 1P0SE 3Q2NA 4IRZH 3MRIA 4N90D 4HIIA 1DE4A 5BO1L 1UXWB 2YAEA 5CIPB 1ZHLA 5BUPA 3HBGA 1Q9OB 1MCBA 3GXNA 3IF1B 3WJJA 4Q97A 3V6BR 4Z23A 3WXVH 4DEWA 4WTQA 1ZHKA 3V4PA 1KV3A 3AACA 1QRKA 3SIKA 3EJCA 3HEIB 1ECZA 5E94B 4POZD 3MI6A 4L4TA 3CHXA 2IMNA 3QHZL 1N0XH 3GKWL 1S7TB 2ENSA 1RZFL 1ZANH 2VO5A 1JFHA 4N85A 5DMGD 4BUQA 3DJTA 3PL6C 2EXYC 1EXGA 3HCVA 5T1MB 4PM1A 3QEQB 2ID5A 1CC3A 1UXSA 4ZAKB 1J9QA 2C4FT 1KLUA 1D2PA 2DI9A 1E5YA 1CLOH 4PJAB 4K71B 1UATA 3R19A 5J6SA 2WLIA 3TYFA 3POHA 1K9TA 4QRUB 3G9AB 4X7TB 4N0UA 3H9SE 3CPUA 5B8CC 3NTCH 4HDIB 3SY6A 2O5XH 3LH2H 4NKIH 2AS5M 2APTA 2HFEB 4LKCA 4XP4L 5TH2B 1CDCA 2QR0B 4WI5A 5H94A 3ZHLA 2VC2L 4XZ4A 1ZLSH 4QHUB 5KVGL 1XBRA 3D9AH 1E4WH 1JCVA 5AOMA 2GI7A 3DHMA 4F7CB 3FL7A 3UTOA 1MHHB 2C4XA 5HI3D 1A7RH 2F08A 2HKFH 2OMXA 3VD2A 2IDQA 3F7PC 2DL9A 5EBWB 5H94B 4P57A 3V4VA 3A22A 2N7AA 2VW7A 1KPRA 4KPHH 1Q9WB 4P2OC 3DGCR 2EDNA 2YKKA 5HXMA 5J3HD 4HDIA 3L3JA 4P5TD 2NX5D 3DWTA 3HFMH 2E7LA 5DMKA 1LILA 4G1MB 3ET9F 3DSFH 4XAWH 3T8MA 4NUJB 3SYQA 3MYJA 3Q8AA 4N90E 3V7AG 1I31A 3OHXB 3BIKA 4PIRF 4K5MA 4NQCA 4GQQA 1DLFL 2UWEB 3RWGA 2DWDB 1NCBH 1DBAL 5DJ6B 3EHBC 3GJFA 1SYVB 1FZOB 1GGIH 1ZV9A 1REIA 1QX1A 1OPOA 2XQBH 2ZKYA 5FCUL 4C59B 1XCQB 1A7NH 4N8UA 2LTQC 4W9LC 2EDKA 3RNKB 3QT2A 3ML9A 2Z8RA 4AC2A 4IJTA 4M3KB 4X4YA 2Z8WC 3T3PF 5D4HA 3GSUB 2OYMA 1WBZB 1NEPA 3FRPB 5F9AC 1KZQA 1DJWA 1PEWA 1L9NA 4JCLA 3FKUS 3I6GB 1TETL 2VXVH 2QV4A 5E2WL 5K1VA 1V10A 3T2QA 1FLTX 4O4YL 5D70L 4QWWD 5HHOB 3QJTB 1UJ3B 3KM2A 4KUCF 1CFBA 2ROXA 3VFRB 4XMZA 5EUOE 1OD7A 4R90L 1IBHA 3MV9B 2ZCHH 2PP7A 1OGTA 2VDOL 1N8ZA 1GGTA 1TF4A 1MUJB 3N41F 3UO1H 3FYIB 3UZQA 5EC1B 4MMXB 4TF4A 4F15C 3FO2B 4D8PA 2XBDA 1N3NA 2ARWA 2CO6B 1X5LA 1N19A 2C8NA 1ZHBB 4ERSH 1BX2B 4GUOA 2W0FA 3ZY7A 4P2QE 3AC0A 3PWNB 5GZND 4P5MB 1PZ2A 2J1ZA 2YAHA 4NWTH 1AFVL 4J3OD 1G7LB 4ZS7H 2OYPA 1HK6A 3NRQA 4CILA 3WFEL 3KPSD 2DYPD 4U3XA 5EU5B 1P5VA 5EUOA 1I8UA 5IK3B 4AI7A 2N1KA 3HFFA 4QEGA 1NAMB 1H19A 4XPAH 1X9UA 4WHCA 3WKNA 1QW8A 1MFCH 3GRGA 5B38A 1WIUA 6PCYA 1TVDA 1TYRA 1KENL 4JANA 4XPGH 3RX5A 3KEHA 2N0KA 4LPWA 2AJYL 3H3BC 5E70A 2ZF9A 3BVXA 2DTSA 1IT9H 1SDDA 4K23H 1YMMD 1JZFA 5B1JA 3HRPA 4GAGH 3KPMA 4XGZA 3MOAL 2LV4A 4X6DA 2WBJD 4DIXA 3L08A 1D2OA 4S1SL 2DQMA 1RHHA 3E1ZA 3ARGC 5HHME 1QVOB 4N2NA 3TFBA 5HYJE 1T4KB 5CLXA 5IBUB 4H1LH 4YZFF 3AUWB 3UJTH 4LLWA 3SE4C 3UPCA 3VXUD 5L4MA 4XPFL 1DJZA 4NPJA 4U6VH 5BJTB 1A6PA 2CAKA 2FWOB 3V6ZB 4PLKC 3WEXA 3ZDXE 2FRGP 2G5BA 4LHUG 4CMMB 4D8OA 3N40F 2IXQA 4IIQC 4LPXA 4DK6A 2QHRH 3BWUC 2K7QA 1VKXA 2GEEA 4KVCL 4CGUB 2HWZL 5MENE 4X5QA 4UI2A 2FEEL 1TUPA 4BUHA 4LSRL 2XRAL 1R5WB 4U1LA 4Z8FL 2WUCH 4XNMB 3NCEB 5CUSH 4QHLB 3QDGB 5KSBA 4KH2A 3RVUC 3S5LA 1V7MH 4LT7A 4DP6X 5BJTA 3UAAA 1OOAA 3GSWB 2YHGA 4UOJA 4RX4A 4RDQF 2NY6D 2BX5A 2A7BA 5DUBA 4G3YL 1BG9A 4E9WA 8CGTA 3LS4H 3C8DA 4GEJA 3SKNA 3S2CA 2EKSA 1CLZH 5C3TA 3QRLA 3T6XA 2GJ6D 3L13A 3OKOB 4FTDA 4YDLC 2XPGB 2UXGA 1QI5A 4ZTOL 2JKWA 5J6GA 2CGZA 1R3IL 3C2AH 3HPJB 4WFHD 4PY8I 1KIQB 5FAAA 3DTUB 4M6ML 4TLTA 1CYWA 2WLKA 1CFVL 2WC7A 3FQWB 5KYYB 5A2CA 1G9MH 2VXUL 4L4TE 3WY2A 4JFFA 4OFQA 4H0HB 2IANA 4GXFA 2WP3T 1I3VA 5EF3A 3N42B 3OAYK 4Q52A 3QULB 4HJ0D 5KSAD 2ZOWA 1B0GA 5FYJH 1NAMA 2ZX9A 2H3NB 1TIUA 1J11A 1PVHA 4QMEA 5AKRA 5EUOB 1BYOA 1RK1B 4DGUA 5JHBA 1G7LA 2BDNH 5LGKA 4OIIH 5I66B 4X98A 2XZQL 2BNRD 3W9DA 2R1YA 4XN5A 3ZTNH 3CVBA 3MKKA 1MJ8H 5DUML 3S3BB 3U6RA 1HXYB 4KI5C 1NICA 3U0WL 1EBPA 3VWJA 5I18H 2HX9A 2JTDA 5BQDA 4CJ0A 1ZJAA 4AZUA 2LLLA 3MOQA 1EDQA 2WSKA 1JZ8A 1HWWA 3GWJA 1T0MA 2XG5B 2P44B 2Q8BH 5EZOH 1I8KB 2X9YA 1T22B 4DJMA 3NZUA 1FNGB 1P7KB 3EOBB 2DF3A 4Y2OB 4ENED 4YSAA 3O6LL 4BD4A 2H2SC 3T0EA 2B16A 3NJHA 1EZLA 2YUWA 3Q3GA 5T1KD 1RU9H 3VFGL 4F8PA 3IVKB 3ZKXB 2OP4L 5KUKA 2X4OB 3EBHA 1NGXB 3QC6X 4UBDD 1E8WA 3ZIMA 2VDLL 2KHAA 5EEYA 1H5BB 2WB1A 3AB0B 1QWHA 1BCIA 1GGCH 1R34A 4N2HA 3VD9A 1SLUA 4DZ8B 1K4DA 4LCWD 5JO5A 2NTFA 1YAZA 1Z2KA 3P11H 5TK4A 5C0RH 2EC9T 3WJMA 3DGDA 2J6EH 3M7OA 5AYUH 3NAAL 4HPHA 2E9JA 1SN2A 4WVRA 3NIFF 2DWDA 4BGDA 4ZX3A 3ARXA 2X4RB 2F61A 1TQTA 2EC9U 4XH2A 1NCWL 1T66C 4PJHA 4QTFA 4OCXH 5JIIA 5CINH 1T1XA 1LNUB 3HC0A 3LN5A 3US0A 3X11B 2YD1A 4NFBA 4G6KH 5DTFB 2NY6C 3PAVA 2VZUA 2R4RH 3FU5A 2ZCKH 1RIVH 3FN0L 1U8IA 4HZLB 3BT2H 3NFNA 4YGAB 4DK5A 1BQ5A 3BSZL 2EIEA 2ADYA 1G7JA 2DQFA 3NQKA 4PJIF 3BQUD 1L7TH 1OVZA 4LCCC 1JFQL 2ADIA 1KELL 2GBTA 3MAWA 3PJSB 1QQDB 1SF3A 4PCYA 1W80A 3LNDA 2EDWA 1T83C 2IDCA 3P4LA 3ECUA 3TYGL 5F6IB 1KEML 2VE6A 1NMCB 4QKTA 2OMWB 5KVFL 1BPLB 4Y5YB 3ABGA 5CXPA 3D48R 4LSPH 5GQBA 3U6XS 5KZCD 5BZZA 1DVTA 1PKOA 2A5UA 2EYSA 5D7LB 2ZX8A 3H53A 4DPAX 2PYEB 1F18A 2VQTA 2VDNH 3BYTA 1KBPA 2WYTA 5IB4B 3C6SB 1VACA 1N5AA 4FLRA 2D31B 4IRJB 4R5XA 4HT1H 2DQIL 1H8SA 1KYUA 5CBEA 1N2RA 3CAFA 4O2EB 5D2LF 2COQA 5E9AA 4WQOA 3DUSA 1YLBB 3RIFF 3T2PA 5CD5C 1YNKL 1QWNA 4G80B 3V5DB 3RNQA 3TJEH 3V6OE 2HJKB 1G6RH 1HHHA 1JTPA 2CO4A 4L4TB 5I6PA 5LGYA 3X1FA 2CBOA 3VM7A 4I85A 1N9PA 1BQUA 5FYJU 3O6FD 1EZUA 3CHRA 4LGPB 1AZVA 1J05A 5HGHB 4NN6C 2OK0L 4P3DA 3SJVB 4PVMA 4OLUL 5AW6B 2RALA 3MRMA 3QIBB 2A83A 1ZHLB 4OFDA 3OAUH 2ZXGA 2Z31B 1MH5A 1SJMA 1K72A 3DDFA 3FH5A 1HN1A 4U6YB 5A2AA 4HLZH 3UZEC 2Q3ZA 4S2SB 1IEBB 5AYQA 5CCGE 4MMZA 4UT7L 2GSIB 5CEYB 1NDTA 3GIVB 3MV8B 2CA3A 2PR4L 1D5MA 2ZYHA 3QGVA 2R9HC 4N2BA 5D8JL 2EDHA 4P46C 1NCDL 3HE7C 4W9FC 3O2DA 4A7TA 3MLYL 4GW1B 4P3WA 5JXEA 3R7RA 1QR1B 1P53A 4JRXA 1ADQL 1JPTH 2HLAA 4FKHA 1AFVH 1JWMA 1BBJA 3LV3B 5IGXH 1CL7I 5IFAL 5DZVA 5CD3A 4TUKH 5J06A 2NW3A 5MENB 3O6KL 5IOPB 1GIGH 4M6MH 1NCTA 2BJML 4WKZA 1A1OB 5ITFB 5EC2A 5E4IA 3FHQA 1IKFH 5GS1A 2FIKA 3PXLA 4OZIB 3FT4B 4OFVA 1X5ZA 4JDVA 3SKMA 4ZXBC 3QG6B 3W39B 4AENB 2XNAB 5LGJA 4X9BA 4Q6IA 3OZKA 4IOSD 5AD0A 1UA6L 3BO8A 4J3WA 2A9CA 1P84K 2WBWB 4FFZL 1JVOA 3O6ML 2OYLA 4TUJA 3MPCA 5IQ9A 4RGND 2Q8AL 2BSCA 2DQCH 4EJ1C 1QFUH 1ZK5A 2DB8A 3BZEA 2H6PA 3OGCB 1DN0B 3GSVA 3IEAA 4AITA 2BCKA 4EDXA 4YHIA 4GRLD 5CBAA 4AQEB 3QQ4B 3UYRL 3X2QB 5BXFB 5HYJA 2JKRM 2BHUA 3AXLB 2BFGA 2W07B 1A1NA 3F8UB 2IQAB 4AGNA 4Z7OF 4LEXL 2X4UB 3O3UN 4UM8A 2FD6L 4GIAA 4QRPE 3BRFA 4PJBF 5DMIH 4QF1B 1D6EA 3CPLA 4LLMA 5SWZA 4YL9A 1WBXA 3EOTL 4R4FH 2B7DT 3ECBB 1BZDA 4OIIL 4Z3JA 3HHSA 5IM7B 5T1KB 4LF3A 1M7DA 3WS3B 4OW6A 5HGGS 4JJ5B 2A4ZA 5T3ZD 5KYNA 4M5ZH 1OARH 4E41A 4FQCH 2BP3A 3ROLA 3UAJA 1S8DA 5I16B 5D72H 3D30A 2F8VA 3HMXH 1U8HB 1UC6A 2YLKA 3LIUA 3D39E 4OSUL 1LHZA 4HK3N 2YOAA 4HOZA 3NCWA 3P02A 1S5IH 4OZIE 2C3GA 4KRPC 5HDBB 3PFUA 1EWHA 3FHEA 4HS3B 1KENH 2VIRB 3QUMA 2P42B 1EEUA 1VGEH 2AK4B 3DGGA 2J44A 4LSTL 3WHE0 35C8L 5I6XC 1L0QA 1VZHA 1WFIA 4I5BA 4XAKD 3CSYA 4M4RB 5AOZA 4NQDB 1CFVH 2Y7LA 4I18C 1FZJA 4HFWA 3NQIA 1QNIA 4HUKB 3RL2A 4UILL 5KVEH 3KVQA 2VDKH 1GOHA 1HXMA 4X2UA 1ZLWH 5EIIB 2X10A 2D03H 4PJ7B 2E7CA 3C60B 3IMRA 3LQAH 1V3KA 5KVEE 2IANE 1M71B 3WUWG 5MERA 3LNHA 4ANUA 3BSZA 3KGRA 3FT3B 1KYOK 2ODHA 4AM0B 3WTTA 2GFBA 5CINL 1GMIA 2XRAH 3D3VD 2BY0A 1BLIA 4FQ1H 5T5FA 4WGKA 1NCWH 1QACA 2WWNA 3PABA 4YDKL 2O72A 3MLSL 1GSMA 1NCDH 4PB0H 2CQVA 3AG3B 4RRPM 2XN9E 1R0AL 5AZ2L 3II2A 4GAYA 3WNIA 1AYRA 4XP6L 2DQJH 2UXVA 1P7HL 1UT1A 1FJ1A 1QSFD 4L2LA 4APQD 2CHXA 1NWPA 5DWPA 4F58L 2BRQA 3FAXA 4KVCH 4MNHA 5INDB 2IO5A 1T0OA 2QKIC 2OCFD 3D39B 5DJYA 3CVHL 2OCCB 4FAAB 4YN3A 5DD0H 4F3FB 1L9OA 2DRUA 1KB5L 1KDJA 2Z35B 3CQQA 1OIOA 3L2LA 4L5FH 1FFNB 1ASPA 1MCPL 2IBZX 2AP2A 3O3EB 2Q2EB 4N1EA 5D1XB 3HAEB 3H9YA 2XYBA 3KW7A 4W9GC 4HJ1A 5ERWB 4BSWA 2J8HA 2HG5A 3FB7A 2OLDA 4YVUA 5ALCL 5EU6D 2CGRL 2XCMC 4X99B 4EIGB 2VDPH 2XA8L 2RAMA 2W38A 1KYDA 3KH3A 3NZ8A 4O02L 1U6AL 4FL4C 3G08B 4X8JA 5FGSA 3WSQL 1AAJA 3IU3B 5CJOL 2FSEA 3R4RA 4ODUB 1IKNA 3U1SL 1UZGA 3MLWL 4X7DC 3K91A 1UA7A 4P2RA 4PJDB 4YDVA 5HBBA 1OAQL 4JVUA 1J7VR 1JNNL 1YC8A 2F54A 4R4BA 4NNPH 4U1HA 5JHMA 1LJMA 2HZHA 4OIFA 1AC0A 5GGQL 1Y6NR 2EE2A 1NMCC 1FF5A 1A7QL 1PS3A 3VW3H 3B9EA 1TJHH 1A7RL 3AY4C 1DJXA 5AUMA 2NW2B 4DKDC 2R1WB 2D0FA 1TOXA 4YLBA 1ZE3C 5DSCA 3SEPA 4HAGA 2R51A 3CFIC 3ZDZF 5FB8B 2OXHB 1QFWL 4HS8H 4ZD3H 2O30A 3OC5A 1ORQB 4ZMQA 1C7SA 1NDMA 3QUYB 2OTUA 3B3IA 3HG1A 4UQBA 3TJHD 3OLEA 4LIQH 5J9PB 3AM8C 3D18B 1O7SA 1EAPA 3Q1SL 1K3IA 1BXAA 4H88L 5DR5H 4DN4H 3WUWB 1U8KA 3S96A 3R06A 4HHAB 4OVUA 2Y9RT 3QUXC 4PG9B 2Q7YB 3GO1L 4PCTA 3RI5F 1GTNA 4XNYL 2DWSA 5KS9A 4PRDA 3VM5A 4WFFD 4W1TA 5LDUA 4LSTH 1NFKA 4CSTA 1ROWA 5EH1A 1IAOA 3ARSA 1YEEH 2YA1A 2EVHA 4KJPC 3FH7A 1FCGA 5EU3A 4OKVB 5A2FA 3TO4C 3M46A 2DQGH 4HCRH 5FCUH 4BFGA 4G43B 1AY1H 3MMEB 2YXWA 1GW6A 2Y22A 4LSSL 1RD6A 5HD8D 3DXAA 3ZMNA 5HI3C 1OSZB 3ZHDA 4EUPB 1ZEAH 3L3OC 4HF5H 4TNVF 1PPIA 3PWPE 1UD4A 3MODL 2C9VA 1F45A 4OF8A 5EEVA 3G6DH 3BWSA 3VJ6B 1DBML 3F3HA 2CHNA 2VLKB 2YPKA 2Q6WB 2EH8H 3W82A 4FQ2L 2YBGA 1OAXH 4KZDL 2NQDA 3RHWK 4IEFB 2JQAA 2VLMD 3TIDB 5D2NC 4OGYL 2RFXA 4XMWA 3N42F 2C9AA 1IAKA 1TKWA 3ZO9A 4ATWA 2D7OA 3T4AC 1CQYA 5JLZB 4G6FD 4KO6A 5KJ7E 3OJMB 1XGPB 5DMYA 3SDAA 3BVNA 5D7IE 4L8SC 3SN6N 4E5XA 4RESB 2X42A 4XB7A 5F7YC 2I5YH 2IPTL 2Q5BA 5HHNA 3MTRA 4N5UA 1M7IA 3EJSA 4U6HA 4F24A 1AGDA 2ZOLA 3EF4A 2R4SL 3IFOB 1QA9A 4MX7A 1NOFA 2OL3H 4WW2C 2PYFA 5CNHA 1QAWA 4MSWA 2XHNA 4B7IA 4HIHB 4GRWB 3HC2A 4RMTA 1JZJA 1LO4L 4XPBH 3TJPA 3W2DH 4JR9L 4M5YL 1I8MA 3TIDA 1SGKA 5ID0A 2ZWKA 4X7CC 5F7DB 5B1KA 3QUML 2WXHA 2FB4L 2HSIA 4G11A 4E41E 2ODIA 4NM8H 3TH4T 5JPMA 3U36A 4GG6B 2A77L 4NN7B 1CK0H 1WAAF 3RA7L 4ZG1A 1CJYA 4N86A 1ZIAA 4FFYH 1I3RB 4BM7A 4GXUM 1SQMA 5JPMC 3QFDA 2JXMB 3V0WH 4P2OB 3HZMA 2V2WA 4NP4H 4AVJA 3GMLB 12E8L 1PX3A 2XTJB 3GD1C 1Y1UA 5DZ9A 4ZPTA 4RAVA 4UTAL 2OSLA 5LAXA 3MLUL 1IC4H 2F5AH 3KW8A 2CIIA 1RULL 1JNLL 1N12A 3FQNB 2MCMA 3GI9H 5JPNB 2Q7YA 5D7SL 5E8EB 1AXSA 1KJ2L 2OMBA 3C08H 2AQTA 2H0FA 1I1RA 3LKPB 5IQNA 1EAPB 1ZVNA 3WTWA 2K8MA 3UG3A 5DJ2A 3L3IA 2BHZA 4M7ZC 4ZUVB 5JW4R 1YRKA 2FNBA 1CGWA 1PLBA 1CT8B 3VMOA 1DBBL 2GIXA 4EXKA 5JIKA 2FWSA 2VSDA 2B3IA 4Z77A 2FZ3A 5AB0A 1EO7A 3TV3H 5HVWA 2F0CA 5DSCB 2Z7ZA 3QXAA 4JZOB 2R1WA 4KGLA 4ECNA 3MHZA 3S3SA 5ICXB 5IHLB 3E9TA 5KYWA 4QIRA 3KYOB 4I13B 4UQIM 3ARDA 4MJIB 3II3A 5EU6E 2EKJA 2E7LC 5BQ7A 1DUZA 4WWKB 4QR7A 3CZNA 4IHBA 4BDVA 1XZWA 4PJFB 5EMYA 2J5LB 1M6OB 1DO6A 2F54B 4NNPL 4NQQA 4R4BB 2XA3A 4U1HB 4Y5VC 1T7WA 4OD2A 1OM3H 5B1JC 5M94B 1ZWIA 4UV7H 5E51A 5T3XE 2A1WH 3ARED 3FTXA 3IMWA 3PYCA 5CILH 5ESQA 1OGAD 4B50A 4BE6A 1MVYA 3JTBA 1DVFA 2OTPA 1U6AH 4W9CC 3VQLA 1AIZA 3OLGA 1J9SA 1G6VK 2VDPL 3FULA 2I69A 1PSKL 1DR9A 3FB7B 5TQ0H 2BERA 1P5UB 1PDKB 3N41B 4UAHA 3TVMB 3GB7A 3MQIA 1AHMA 5IVOA 1CDGA 4XVUC 2W9DL 3L5WA 3O3AA 2C5DC 2XN9D 3MRDB 3OMIB 1M05B 3QI9C 3ROOB 3VXNA 4D0BA 2E0PA 3I9GL 5AW3B 2VDML 1AGCA 3WL9B 1GYVA 2L7UA 1FNAA 2ADGB 4WK0B 5I28A 3PDGA 4PCKA 2KI6A 4HS6A 1UWYA 3GEWB 3S97C 3VMNA 3FTZA 2WVVB 5D7LE 1MIEL 1RUKH 5JQ6H 1L7IL 3FUFA 4FQXA 5E8NA 2EDBA 3BAEH 3P2TA 3T3PB 2MQCA 5CFAA 2P5ED 3D2UA 3TM6A 1R3HB 3VI4A 3VNZA 2N0MA 4TVPD 5KYUB 3NEXA 3NK4A 1GZQB 5AZ2H 1YYLH 2R23B 4KKLC 2APSA 2D7TL 3WE6A 3VFMB 1IRAY 2RR3A 2BVQA 1EANA 2KLSA 1BM7A 2QADB 4I77L 4KTDH 5C0EA 5AEAA 4LE8A 2EVGA 3ZGHA 2C7UB 2ZF8A 4YHYB 1WAEA 4ELMA 2ZP9A 3S7GA 4WTWA 1JZ3A 3LDBC 3BD3A 4RX4D 2Y6SD 1BMWA 2OMVA 1SUJA 1YC7A 1HXMB 2XICA 3ZXAC 2YRBA 5I24A 1KXVA 2VKWA 3RL2B 3TT1H 4LEEA 1UJ3C 5L2JB 5CSBA 1AXIB 3ULUD 5DHEA 2FCBA 3T1FA 1MJ7L 1FUNA 5AW2B 3EJRA 5GJTL 2PP8A 5E2VL 2QELA 1DFBH 2JKLA 1WT5A 1Z9NA 3FUKA 1HDMA 3QIWB 5T3ZE 1NWOA 4QTHB 4F8LA 2YPVH 3GBMH 5FPIA 4JFZH 3QRBA 3QXWA 1PCSA 3B3BA 1AQDA 2VR5A 2KLRA 1URIA 3MXVL 3FC8A 3VI3F 4RH4A 5KOMC 1P4IH 2DIJA 2QGEA 4QRPD 4UTBH 1CXLA 5JW3L 3RFZB 2FX7L 4F1SA 1NKGA 4AL8H 3ROLB 2CZNA 2MQGA 1URZA 2MQ3A 1L9TA 2HTKD 3MCLH 5SX5K 5F1NB 4KQ4L 1IEHA 4LB8A 4M00A 1KC5L 2QQKL 4IOIB 3RIFK 1TZHB 2KL6A 1CGXA 2Y2WA 2WK2A 3D6GA 3QUZB 1JDCA 5FA4A 5B3SB 5HYQB 1MG3C 4AGQA 4I4WA 1AH1A 4QF1A 2BNQB 5DS2A 1OTTD 4GRWF 4LEBA 2A6JB 4EI5A 1AO7B 5ICYB 4WWNA 4OZ4A 5GSVA 5K1NA 3P0YH 3ESUF 2PWHA 3AY4A 3KDPB 3FZUD 3I2CL 1FFRA 1GHFH 3NCCB 5CWSA 3VXTA 1Z66A 2WXOA 3UTSB 2BHYA 2GK2A 3JWNC 1TYJA 2MNWA 5C2UB 5MP6L 2MTAA 2QSQA 4NCDA 1CIUA 5A2LH 4P2QB 1DDHA 1SM3H 2FSDA 1A3RL 4CGTA 4YHIB 1CBVL 1NEZG 1Y6KR 4HH8A 1BFOA 3QZPA 3CFJB 1AY1L 1NJ9A 2A1WL 5ABDE 1IM3D 4UTAA 4L5FL 2R0KH 4OCWL 4LLYA 5JR1H 2VABA 3MROB 3RRQA 1AGFB 2WXMA 2MQ0A 2NLJA 3Q05A 2AXFA 1FO0A 3TO4B 7CGTA 1IGYA 4AENA 2PYEE 3DIVA 1NC4B 1X9RA 1ET5A 1UCBH 2ILLA 3V4PH 3J27A 1BQRA 3FB8B 4Y2DB 1IM9B 1A2YA 2C9XA 2X1OA 1NANH 2JJVA 1T89A 3GGWA 2ZYSA 4P0DA 5MENA 3GF8A 5GGSB 1FAKT 1KLGA 2CLZA 3E3QE 4GEIA 3L5IA 3V10A 3ZHKA 2GTWA 4JM4H 5J5EA 4AH2A 5KAQF 2QL1A 3F64A 4AUJA 2RACA 2NNAA 4ZUUB 3BD4A 3VRJB 4PJCE 1AI1H 4I9WE 5EHFA 4HEPG 2O6CA 4MA1C 2Q1EA 3G04A 1GAFL 3OAZH 4CA4A 3MLZL 3GIVA 5HVHC 2D2OA 5KVMC 3K6DA 2F74A 1EUTA 4JFFD 4MD5B 5BUGA 5SWQA 3W0WE 4HVBA 3AITA 1DQQB 3CFCL 4NJAL 4YHLH 3IKCB 3VXOA 1CU4H 1JUFB 4PTTA 3CXHK 4GNKB 4K3DL 9PCYA 2FVNA 4E0RB 1E30A 3T4AA 4K8RC 1XX9C 1I7TB 1N4XL 2BOBA 4QXGH 3DO7A 2W92A 1DQKA 4HBCH 1TJMA 5FC9A 4YHML 5IB5A 2ADJA 3NJGA 2YXFA 3DV6A 1EJOL 3TIEA 3B2UC 3ATBA 3WO4B 2NQ3A 3RA7H 1UZ6E 3I3BA 1TCRA 4DH2A 2B9BA 2BM3A 3P9MB 1NGZA 4JJOA 1TPXB 4WU7A 4MNQA 2YMOA 4NRYA 4IRJA 4IS6B 4DCQA 4CN1A 2HT4D 1MJJA 3UC2A 2OV0A 4LU5L 4TLKA 1EFXB 5SWSD 1XMEB 3CDFA 4HG4K 2OTWB 5CAYB 3FFOA 5E8OB 3W0WA 5PAZA 3WLBB 1JWUB 4H8VA 3CN3A 3VE0B 5L88H 1KOAA 3DHJA 5F7FA 3RLSA 2WBJB 4FF9A 1KXTA 4HHGA 1TSRA 3F12B 4JFEA 3SODB 4HIEA 1E65A 4CC4C 4P07A 3VH8B 3KG5A 2DKUA 5F8QC 1KCVH 4NQUA 2NUTA 1JK8B 3MRQA 4MJ5B 1MCIA 2R2BA 5HY9A 2BSRA 3UPAA 1WHPA 3LQMA 1DBBH 4ZX4A 1JGLL 2BSEA 3MUJA 4YHNA 4F8TA 1C5CH 1JCKA 3BSZH 4XO8A 5KN5B 3TF4A 4L23A 3I74A 5G4NA 1T7VA 4GUPA 2XG4A 5DTFA 3TO2B 3T8XA 4KTGA 5DD1H 1BFVL 4PY7B 5D7IF 3AADB 3QJRB 4GRLC 4EKXA 4L1TA 3BH8A 1KPUA 3WUZA 1E5CA 1MCWM 4KV5E 3VXRA 4Z95H 3UMNA 3UBGA 1ZEAL 2DS4A 2GJZA 3C5XA 4HF5L 4HOXA 1SHXA 4NRXA 1JZEA 1U21A 4WWKC 2EVJA 3NJKA 5IVNA 1D5BA 4X8CA 3GSRB 1DZBA 1G9MC 1F11A 1MJUH 3LVTA 1M9SA 5JHAA 2NY6B 3SPJA 1RSFA 1CZ8L 3D8MA 1IU1A 3IN0A 3ZYJA 4PG2C 5F2FA 1TNMA 1Z0MA 3DPBB 3L9RB 5C07E 2IAAC 3QEGL 3EGDB 1ZTXL 4XBEL 3ETTA 1MN4A 4A39A 2EZ0D 5C07D 4XN9A 1OE3A 4WV1C 5CP3A 4GS7C 3FPYA 5I1LA 1LM8V 5JIHA 3LRSB 1XF5B 2YPLB 4PWKA 2G9HB 2Q3AA 4UT9A 2JKTM 1M56B 3BP7B 1MWAB 4L0ZA 5FYJD 4UMSA 3ZR5A 1J1OL 2GI0A 5KBMA 3P4OB 5J11B 5D7EA 4M5TA 5EN2B 5I76A 4ZD3L 3H8NA 2R2BB 5HGBA 1QG3A 5HY9B 3UGEA 5LN4A 3VWJB 1MCNA 3U0TA 1NBVH 1SYSA 1EHAA 4LDOB 5T1DH 2OXGB 3B2UD 3P54A 1QLEL 1DQLH 4FLOA 4IRJC 5EIQA 4NZJA 1XCTA 5TJWK 4XMPL 3VI4E 4X98B 2X3BA 1JTTA 1I3GH 4JFUA 3KCWA 1Q90A 1VFBB 4JRYB 4WFHE 3G6JB 1HESA 1MRDH 4CKVX 4E9RA 1E6JL 3A3YB 3O41A 2J8UF 4TXVB 4U2YA 4S1SH 1CFSA 3VVVA 4DCQB 1ILUA 2J71A 3CZFA 4P3CL 2X6MA 2XWTB 4MNQB 1SBSL 1HHIA 1SXAA 1X3DA 3WFZA 1F3DJ 4Z7WE 5FO7A 3EJZD 2IANB 1AZUA 3RKDD 1PSKH 4PJ9A 1AQKH 2VDQH 2YAOA 3PHQA 4PJBB 3U2IA 2E46A 4FZ8H 4RZKA 4YGVB 1Z9OA 3B9AA 3ULVF 4JFOB 1Q9LB 5E8PB 2BSSB 3L3KA 3U4KA 1W72H 1R3IH 3REVB 5ID1A 4KGJA 4PV8A 1P2CB 2LU5A 4M9OA 5SWSE 4WNQB 1B6UA 4OLZH 1DFBL 2WLHA 1NH6A 4HWZA 1THAA 4MDJB 4W6WB 2R0LL 2HT3C 5TPWH 3U30B 1QBMH 2EYRA 4Q0XL 3WD5H 1UKSA 4HUXB 3U7YH 1U58A 1K8IA 2AK1H 2PPAA 1RPUA 4JZJC 2JIXD 4AQ1B 4CKQA 1DJYA 3GKZA 1J5CA 5LNEA 5DFTA 3WE1A 2EQDA 2EIKB 2BO0A 4W9DC 1IGTB 3P1VA 3S5LB 2DMKA 5EU7E 1HSAB 4KROC 1DEDA 2B8OT 4JLRA 1HINH 1MI5E 3ZW3A 3CHOA 2VLRB 2QSTA 4P5TB 2NX5B 4WNSA 3VXUE 4ZUSA 5KSVB 1RP8A 4WHYG 4RIRB 1KLGB 2CLZB 3ZL2A 1PF3A 2GJ6A 4WJ5B 4Y5XB 2DLGA 4FXKC 4OZIF 4YFEA 1XGUB 3GGWB 3KCPA 2I07B 3V5HB 4JUTA 5C0BD 5I30L 3K74B 4JFFE 5HGAB 3ZE1F 4WGVB 3FSVA 4Q9RH 4WLCA 1UWEH 3V4LA 3JTTA 1GTFA 4GG6F 4AZ8B 3HNVH 1RY7B 3EH1A 4G8IB 1KXQE 3PV6A 4FDWA 4MRBA 2YK1L 5BOJA 4LCIL 2HH0H 1RZKH 2JCCA 2N7BA 2TSAA 4M1GL 3PFQA 3IMBA 4ZOAA 4N9GB 1YQVL 2NY2D 4KKPA 1X5HA 2VERN 3TA3D 4UB0L 4JFXA 1GGYA 4W70A 4DK3A 1CICA 1GVIA 1U91A 2DLHA 4LDEB 3KPSE 4J3VA 3MOAH 5H35B 3IS1X 3E2HB 3FOLA 1I8IA 2WTRB 4LQFH 5ISZA 1GJWA 1MCSA 4UANA 3BKYL 1AMYA 2PYED 2BSDA 4YK4B 5CU5A 4E42A 4FX5A 1N5YL 4H2AA 1LK3H 2VUYA 3LIZA 3W57A 2QQNL 1OGSA 3TJHC 4H13C 5F0JB 1RIUL 2LOEA 4QRRB 5GRWA 3QUZA 1TZHA 3L6FA 2Z31C 4ONGH 3MA9L 1OB0A 4F58H 2PTTA 5I19L 2CK2A 3QC5X 5CM1A 1I7RA 5CN2A 2EIJB 4ZO7A 3KDMA 3X12B 2UZIL 2I24N 3PU7A 2X1XR 4JFDA 2VDRL 2OPCA 1MCCA 1ETZB 1OTSC 2VL4A 4GSUA 4Y4HC 5T1DL 1ZT4A 4JAMB 3STZA 3QDAA 1XGZA 5E4AA 5C0AD 2A74C 2EDOA 5E5LA 3FQXA 1OGTB 3CDZB 3OD3A 4G1EB 4FYTA 4L3CB 5IHZA 1BOGA 4ISVA 2VISB 2WTPA 2QPFA 4HJGB 4FS0A 1TJIL 2ZKHH 4IHOA 2R2EA 4OH2A 4XC3H 4MA1B 4WI4A 1CFQA 1PZ5A 4NBYB 3BRGC 4PJIB 5IT2H 1WBZA 2NY4B 1ITBB 2X9ZA 1XL4A 3OXRA 4HGKC 2EADA 1U3ZA 3RZCA 3FTGB 3STLB 4Y4FD 3VWJC 3UPRB 3MV7D 1MELA 2LVEA 2MNJB 1RUML 2QVIA 2XV2A 1KUMA 2CHWA 4J8RA 5DC2A 1ZLUH 4IOFC 3ARFA 3NJVA 2IQ9L 4AKQA 3JV0A 5I1GL 3QRFM 4UAOC 3GJFB 2RMNA 4XO5A 3VH8G 4JY5L 1FZKA 1HEHC 2CKBL 4J1UB 4MBOA 5ETUA 2H1LM 2Z64C 2V17H 3QDME 1LK2A 1X5YA 2VB5A 3QDJE 1XZ0B 2JKIS 1INEH 1JL8A 1G7MB 1VB9A 2IH1A 4Q6YA 4ZT1A 5DJ8B 1OF2A 1GZQA 5EBLB 3ERXA 1HNGA 5HYSG 1ZA3A 3CVHB 3NFSL 1FBIH 3D2UB 5GGVL 3NSJA 4PJDF 1I9JH 3KJ4B 5JQ6L 2J1XA 3RAJL 1XF4B 1YVLA 2IWKA 3DKHA 1A8ZA 4N8VA 5IKCB 1ZMYA 1UZ8B 3Q9PA 3QO0A 1B2WL 3SYAA 4AQ8A 4ONGL 4JBSA 5C09B 4KBPA 1DVFC 1L3NA 1ETA1 1JF5A 1HXKA 4TULL 1CE6A 4PGEB 3LIZH 4QHUA 3CHQA 4TVPE 4L8CA 2RGSA 1RJZA 3P9LB 3IFPB 4GINA 3O11A 4R97B 2VQUA 3I9PA 3X17A 4JHUA 4NPYB 2H32H 2E7BA 5F1SA 3N1MC 2HFGH 3P73A 1IAIM 3QCTH 4FQJL 4GS7B 4K3HA 2XJLA 2ZUTA 1S9VB 3O3DB 1XIWA 2QLYA 1S46A 5EOTB 2GT9B 3CC5A 3TYFB 4XRCB 1ZWIB 1WLHA 1YN7B 4HT1L 4HKZA 4YX2H 1FFOA 2IGTA 1A4KA 2E3VA 2VN7A 5ALCH 2FYYB 2VLLB 1CBJA 1OPGH 4FJ6A 3OR7B 4YSDA 4BQ9A 1DUZB 4GRLA 3O8XC 4LSSH 4GXUN 2Z34A 1IGCH 3CD4A 3RGVC 2IMMA 4AQAA 4EMZA 3GM8A 4JM2D 3SE9H 3FTSA 2BJMH 1XH1A 3OKKA 1WAPA 5T3XD 3FFDB 4GUCA 4NQDD 1SXSA 5BMFL 3DC0A 4JVPA 4OQTH 1FFTB 3MRIB 4LSRH 3FONB 3CXHJ 4AW7A 3L7FB 2IWGA 1HCZA 2W80C 4KTYA 3AREA 4WW2F 2X38A 3PWVA 2VMJA 8PAZA 4A2LA 3J2PA 4KKCC 5SX4I 4TPRH 3KPQB 4PJ8B 1N6QH 4CC0A 1ZAGA 2C9SA 1WQVT 2LTQB 4U6XB 3TLRA 4DZBB 1A0QL 4Y9GA 1GS6X 3DXAD 4HV8B 4JPQA 5L4IA 2YOCA 4HX1A 4OKDA 1FLRH 4P4KD 4UOW1 4LMQE 5EDXA 1AS8A 1ES0A 3MRLB 4ANVA 2CIIB 2ZUVA 2MRYA 4U1MB 5FO2A 1S9XA 4J12A 1FV1B 5KBLA 4BSJA 2UYLB 3QQ3A 4Q58C 3RP1A 3QI9D 3FO9A 2HFFA 2CRIA 3AT8A 2H6UA 2WUBL 3PDDA 1YNLL 1Z3GL 3LPGA 3I6KB 2Y7NA 2B15A 3LHAA 3L5JA 4FA7B 3SDAD 3P3RA 5D1XD 4CSPA 3ZYZA 3M7FB 4HQQL 1U8MB 4GP5B 1VADB 5IR1A 5DRXA 1JYWA 1K8DA 5I1CL 5BZXA 5L6YH 5TGBA 1VFMA 4XPBL 1TITA 2X4PA 3I9AA 5IF0A 3VFWA 4RQQB 3EGXA 1FVEA 4XCNA 3GSNA 2AJXL 5EULV 1QKZL 2JWYA 1MFNA 3FUNA 3KAAA 4FQHA 4DERA 5JNYA 1YPZA 3A4AA 4MRCA 4HXAH 2B1HH 4NWTL 4IU3B 1F3RB 4K94C 1TFHA 2LGNA 2NSQA 1H9VA 3SKOA 4LRNL 2XXFA 4V2BA 2OMUB 3HG0A 4ABUA 1CF8H 4YHZH 3KPRB 5I15H 3IDMA 3QR2A 2VC2H 4K3EL 1SJHA 4XOCA 5C0IB 3RWHB 5JA9A 1TZIB 4KROB 5EV7A 4OR1A 4AE1A 4M8RA 1RIVL 3K7UA 1AR1D 3JSSA 1WEJH 2G2RB 3FNKA 4I0CC 4N2AA 2M1KA 4AYDC 1KYAA 3ZDWA 3M86A 3ZU8A 1T3FA 5FKAB 4R3SB 1B88A 5I8CA 1MCFA 4GRMA 2MIZA 2VLKA 1JZIA 2IPUK 2R0WH 4YSUA 5FO9A 5FFLA 3LXBA 3BWUF 5F9JB 3O2VH 4UQ2A 3BGMA 5F9DC 4K73A 2FQGA 2WBXA 2YBRB 3SE6A 1HHJB 2KDYA 3DX8B 5KUMA 3BPNC 2HPOA 5C6WH 5CJ5A 5JPNC 4LLDA 4OGAD 1Q0XL 3C2AL 2Y7MA 3NFPA 2OL3A 3BAIA 1AHWC 2VLME 4JZJA 2BNRA 4XC3L 1LO0L 1EEZB 3MX0A 1EHNA 2VNCA 4O2CB 5DHXB 3LXCA 4ZW8A 4JO1L 5IJVA 4OV5B 1ZGLB 4LHUB 2Z7YA 3ARGA 3WMSA 5BRZB 4Z7WF 5DEGB 5J89A 2VLJA 3WAJA 5H37A 3VFOB 1D5IL 1EO8L 2WYHA 5I1HL 2FJHA 1BD2A 3TBYA 2CLVB 3PWPD 3RVXC 3TU6A 2A6DA 4X6BA 3VWKC 4DVBA 1LP9A 4RZCB 1ESOA 2CH8A 4PUBH 1K4CB 5AVRB 4EQ3A 5GRYA 4S1QH 2FEEI 5E6YA 1GC1L 2WUCL 4QHMB 4ZMTA 5IHUL 2QZQA 1KCKA 2YO3A 3O4LD 4DW2L 5MI0C 2NR6D 3F2LA 3SGKC 1BEXA 3HZVA 7TAAA 1GXEA 2PP9A 2X53A 3BFQG 4CBZA 2HWZH 5J0BA 3QQ9C 4G6AC 2UY7B 1QO3A 3U9UA 1S7VA 3DTXB 3SE8H 3DUUB 4I18A 4N8PA 4N3UA 4LKXB 1T1YB 3SHSA 2NUPB 2UWEF 4LASH 2W60A 1QI3A 3OZ9L 1A9VA 1DSFL 1A8JH 1WCQA 2NY0B 3IXTA 3LSOB 4DP1X 4H20H 3U2SB 5EU4A 1IGML 1WZ1L 1A4AA 5T5NG 5I75C 5ITBH 4AQ8C 5BZWA 4EIZC 4G6FB 3UTSE 4ZI8A 3BKCH 2HP4A 1X5GA 4EI6A 4C4BA 2YAFA 2NZ9C 3K72B 1IKOP 4QY8B 3D25B 4NJ9H 4EI0A 2VXQA 1D5XA 2J1WA 5EOCL 1G4RA 4XX1G 4P5TC 4PJGE 2RJMA 2VR6A 2UZPA 1ROCA 3HUJF 4IM8A 1CLOL 3N55A 2HA1A 4OIBA 3TJEL 3QJOA 4DOHE 2HMIC 1MY5A 2EILB 2HG0A 2V6HA 3CC1A 5IG7B 3PIQA 2CKBH 5DRNB 1RK0B 1L4IA 3LJ3A 4KXZI 3NCJL 5ERWA 5F6IC 5L2KA 1XL6A 2P47B 4M61B 3T5WA 5MEPA 1SJEB 2K6ZA 5IOKA 3MRCA 3NN8B 1FFNA 3KLQA 2MOVA 5FUZL 2AI0L 3O6MH 5D7JA 4ZMLA 1LD9B 2DJMA 4L0PB 5F3HB 2W65A 2Q2LA 1N6QL 1YEFL 3VXPB 2W0LA 1KTJA 4BFRA 5F3FA 5DI8A 3PXHA 4IRZL 1SPDA 4J3OF 4P5SA 3GZKA 4PJAF 3O4OC 2X1QA 4PRPB 3GO1H 3U2SA 4BWWA 3L3HA 4Y7MA 2XTLA 5DFVD 4ORZC 5EUKB 1FJ1B 4RMQA 3KHQA 1QASA 2ITCB 3MCYA 4Y4KD 1IC7H 2PO6C 2LABA 1TQBB 3GNMH 3D51A 1S7VB 3DTXA 2R2HA 5JIMA 2NZIA 4CNIA 3QI9B 3PNWA 4OFIA 5E03A 3UC0L 3NGBC 3BFWA 4X9IA 2QBWA 4UF7C 1HOCA 4ZO8A 3ZE2F 5I1DA 1DQJA 2TRHA 4ZMWA 4KUCD 3FRUA 2ZKWA 5MERB 2PW2B 4RGOH 2QPSA 5KVDE 3N85H 4R0LA 5EIIA 1S7UB 3VDAA 1JHTB 2EINB 3ZE1E 4UT6L 4TTDC 5D6DC 4RA0C 1ZRUA 3PXJA 2VZ1A 1NCUA 3MGAA 4M7LL 2V2TA 1FNSL 4HH9A 4LCUB 3OAUL 1T5XA 1EAQA 4O2CA 1PYWB 3BVDB 5F7MC 3UG5A 3L48A 3L3GB 1GYUA 4AEFA 2VZTA 1Q9KA 3E9UA 2AJUL 4AYID 1XF3B 1J8SA 2QSVA 2YD2A 1E90A 4B7LA 4OI9A 4E9XA 1AC6A 1FG2B 2YBRA 3DOSB 1QLEB 2ARJQ 2FWUA 2V2XB 1KCRH 3LZFH 4HC1H 4AIZB 1IJNA 4J5VA 1H3PH 2RD0A 3G6AA 1RZIA 3HZKA 4F8NA 2CCLA 4MZ2A 1XF1A 2AGJH 4ODSL 4ZXBA 3EH4B 3H9SA 2ZSVB 2GK0B 3RAJH 4FGMA 3FF7A 4NQSA 1O6TA 4IKNA 1MF2H 1K5WA 3VD7A 3TP4A 5IREA 4QO1B 3D0LB 3GHPA 2ICES 3QPXH 4LHQB 2P24B 5IM7A 1NLBL 2AW2A 1MW3A 4KPHL 3LKRA 3EGSB 4M56A 4RVBA 4R4FL 3O8XB 2P7TA 5HJBA 3D39D 1JV2B 2Z91B 2VAJA 3LIZL 3ATDA 4K9EL 4NGHL 1BVKB 1MJ8L 4PLKD 5EU7C 4Y9EA 1SHMA 3IETA 2NXZD 1SOKA 2DIAA 2X09A 1E5ZA 3SKOB 5DS1A 1OKEA 2DWEB 3BOVA 2FH6A 1WWAX 2FJGA 5DC9B 2Q87A 3VXSA 1G6RA 3OKLA 2D3NA 2DQEH 5DHMC 4BCZA 1SQ2N 3QIUA 3TASA 1UZ6F 1S9YA 2V9TA 4PGJA 1TEYA 4JPVH 4XNZC 4XX5A 3NRFA 4JO8A 1YYML 4M8VA 3TCTA 3QQ4A 5EU6B 2D4FA 5DA4A 4URTB 3SGEH 5BXFA 3BPLC 4GSDH 4YBQC 3A21A 3H9HA 2APVA 2PABA 2OI9B 4N8VG 1N67A 3SPGA 4BFJA 2FGWH 4ADIA 4C4KO 4QOKE 1UOKA 4PB9L 3DETD 5I17B 3E80A 3GMPA 1OSEA 5AVYB 4PPTA 3TBTB 1JYXA 2X4SB 3RGVA 5FHAH 1THCA 4DP2X 3KHOA 1INQB 1X7TA 3OKDA 5I0DA 4IYKA 3MV7A 5CCKL 3ZRFC 1RZFH 1X6NA 1BSIA 1ZANL 2CDFB 3E8UH 5FHAL 5I1EL 2VWEC 2P46B 1U95B 3BH9B 4NO0B 3L45A 4GKSA 3VWKB 3FF8A 1J0ZA 1DQML 1EZVY 4OZIA 3FO9B 3O9WA 4PCSA 4U1SA 1FL3A 5IROA 5C86A 1DBAH 3LN9A 3R0MA 5IESL 4EZMA 5GGRB 3S37X 3QZWA 5FKPB 3GI8H 5E2UH 4KX7A 2J2ZB 2ESVA 3BEWA 4C57C 4CAGA 4XB3A 3MRNA 3RU8L 1I3UA 3FTVA 4LLVA 1NCCH 2VLRE 4NXSA 1JGEA 2HLAB 1I7ZA 5E6IC 4XBPA 3RY6C 1E9OB 2CG9X 1MRCL 3QJXA 1ODUA 5F7AA 2UZXA 4JFVA 4A1RA 2PXYC 5JMRA 3BKJH 1B9KA 2F8XC 2GTQA 3GXFA 5FGBA 2V5RA 2VW6A 4FQXD 5IFJB 1L5GA 1ZSHA 3RPIA 5DD3L 4QRPB 3MU3A 3PGCA 3FU7A 4X83A 3IB4A 3FFDA 3QIBA 1U8PB 3R1GH 2ZXQA 1SZNA 3CDCA 1E5BA 1KNOA 4LVEA 4MWFB 3STBA 2WQUA 1KMGA 1JV2A 3TTYA 5EPMA 4R7NA 1KCWA 1W0YT 2YRZA 4G5ZL 3MLRL 4RETB 2W9DH 3B9KB 2EH7L 4NKIL 4MJHA 1HHHB 2HJKA 5DK2A 2OA9A 3OR7A 3UTQB 1U8JB 5GHWL 4DHLA 4G7QB 4CADB 4RSVA 4O2EA 3F05A 2X4QB 1TEFA 4BK5C 4D2NA 4Q2ZA 2Y72A 4LPTA 2RBLA 3MUUA 2GK0A 4LCVA 4MCYA 4H26A 1I75A 4ZPVA 4ZXBB 3KYAA 1C16A 4QXGL 3C6SA 4XN1A 4PRPD 1QFUL 2FT6A 4L9DA 2J88H 4X4MA 3O3DA 3NGBB 2TRYA 1BD2D 3TESA 3F84A 5B21A 3B4NA 3P73B 4F92B 2F53B 3S8WA 2J73A 3IFPA 3K80A 3KLKA 4Y5YA 4JG0L 2J57A 1T20A 4C58B 3BN3B 2FO4B 1T5XB 2WVUA 2OSWA 4H44C 2OMTB 5E1QA 1QRNA 3IAPA 4NUMA 1FHGA 4KK5C 2QDVA 4CN6A 1DJSA 2MPAH 2XZAH 3MA7A 5E8DH 2HVBA 3S36H 1JK9A 2GB2A 4RSYA 1FORH 4DPRA 1UD8A 2VXQH 2WQ8A 1OWWA 4L4VA 2E27L 3JTSA 1GMEA 1E28A 4LL1A 3SZ6A 2ZSWA 1U8IB 4HZLA 4Y2DD 3TOPA 5C3LD 3B7YA 1U3HC 3P4NB 3PL6B 4J4PC 4ZODA 5F70A 1MEXL 4I48A 5ISZD 4J3SA 2XQYK 5CP7A 3D4ZA 4Z18A 2CDEB 3T6WA 3EKCA 5JW4Q 3EYSH 2XJKA 4K71C 4PREA 4PD4J 2JJUA 3EYOA 4KKAC 2IH9A 2YWYA 4G7SB 2CE6A 2WKOA 1XGTA 1KTDB 1P1ZB 1P4LA 2J4WH 5JHDD 3LQZB 4ZRGA 4N6QA 5J13B 2LE9A 1D9KA 2GITB 3Q2LA 4AE0A 1D7CA 2WOBA 1HH9B 1BAFH 1PKQB 5A6IA 1FNFA 4FLSA 1R3KA 4J8RB 4LIQE 3DROB 1J0HA 4NNYA 1N6VA 5I9QC 4UUJB 1XR8A 4GSRA 1LD9A 1XT5A 2GAZA 1AZRA 1QBML 4Q0XH 3BZ4A 3WD5L 3WY1A 2L7JA 5CJQL 3G5XB 3QFJA 1T21B 3FQ1A 1NEUA 4G5ZH 4C56D 2DQUL 2P52A 2I9TA 4NM8L 4HISA 3GLDA 3MRRA 4AG4L 4YHOL 3ETBJ 3OKNA 3WLWC 2NXZB 3PWUA 1GZPB 2F9BT 2E86A 5EO1A 3MNZA 1I1YA 1I53A 4U4BA 1CGSL 1BQHA 3VSVA 4GKZA 1DSFH 3G5YB 4H7VA 3NJLA 4EN3C 2G3ZA 1HKLH 1XAUA 3QRGL 4JFDB 1G94A 3TNMA 3UTPE 3C9NB 3IRCA 2E6QA 4QRAA 4FTVA 3PWLB 4HIJB 3U4BH 1CL7H 2AV1B 4BXVA 3D4CA 1I7RB 3CN0A 2YZ1A 5EOCJ 3MR9A 2JKXA 2QTEA 1XHHA 1YHPA 2DQTL 1OHQA 4IJ3B 1U8LB 3VA6A 1JBJA 4XI5D 1IL1A 1V27A 5IW1A 3WFBL 4RGOL 1GGBH 4RFOH 2MOQA 4XNQB 4ZOBA 1A7BA 3QA3A 3UL4A 1QO3B 3F7YB 2CKBB 2FR4A 4R2GC 2F5BH 2UWEE 4XMXA 3RPBA 1DBMH 1KGUA 1EJFA 2F19H 3GSQA 4LLQB 4BKLB 5C8JA 3EYVA 4PS4H 1RCYA 4U49A 2F58H 3FT0A 3IDYB 4U0RC 2XWBA 3NAAH 5EWIL 4TQPA 2A6DB 1L3WA 5C0RL 4YC2B 2I9LA 3CZGA 3VFOA 3KS0H 3ALWA 3ARFC 3SBQA 3DRTA 4PJCA 1T0NA 1ZY9A 3FUIA 1QFHA 4KDTC 2QZ5A 2O5ZH 3L9YA 3MLUH 3ULUF 4N3TA 4EOWL 3O4LE 1PY9A 3C5JB 1YEHH 3QUYC 4KTEL 3O9WC 5JDSA 4PJCB 4Z3TA 5CCJA 1O6VA 3SDYL 3QZWG 1HCYA 3OKEB 2WXJA 4NI6A 5IEKA 1SOQA 4NQEA 1QLFB 3UAJD 2XWBB 3K4ZA 4DUVA 5HYFA 4WI0B 4JQIH 2GJ6E 1W72A 3V5HA 2I07A 1AGEA 3KCPB 4MMYA 5GRXG 4TSCH 5DVNA 2O6FA 3KPLA 1BXUA 4RIRA 2CLRA 3WKMH 3OAWA 3B9KD 3OXSB 4GSQA 3EZ8A 3D06A 1D5ZA 4WEMB 1TLMA 3TA3A 2H5UA 2HXAA 2CKBA 5I18L 4FI8A 5L7XL 5FFGA 2JK5B 2DMCA 2JI1A 4F27A 4G8EA 1IGTA 1RUKL 2H2PC 3EH3B 4MXWH 3VXUB 1JD9A 1ETJA 1FL6A 3FB5B 4PP2B 3WN6A 2EEAA 3KVDD 3SPCA 3ZZLA 1U58B 4IBZA 3G5VA 2APXA 5E5MA 5AVUB 3A23A 3ILEA 3U1PA 2FX9H 3RGVD 1RHHB 4NP9A 3B1UA 4G7RB 2E9WA 4LVHB 3MLWH 3VXRD 5LBSH 4JM2C 1DANU 1XIWC 3REVA 4X6DB 2J8OA 5LWYH 3GRWA 3EDFA 4XGZB 5DQDL 5KAQG 1Q9LA 4DW2H 1I1YB 5DZJA 1IT9L 3NIDE 4U1IA 4A6YB 5GHWH 4ZTPH 2VYRE 5AAMC 2K1MA 1CR9L 2Z4QA 2YSSA 5AW5B 3N04A 2BIQA 3BUTA 3P4MA 5DUJA 2FLBT 4KRPD 2BNQE 2HVKB 2DQUH 1NCGA 2OSYA 2H0JA 3QNYB 2Z0BA 3KH4A 3L3OB 1QSFA 4APQA 4M6NH 3OAZK 5C7XL 4FG4A 4DFIA 4APXB 1QFOA 3PL6D 3TEUA 3PCYA 4WHYH 4CJ1A 3CVIL 3G6JA 3QDGE 3RUGF 3AABA 4PJ5B 1BGXH 1XR8B 3WKML 2AQNA 3LZOA 4WDIB 3NDZE 3KXFD 1WFNA 4ERSL 1BX2A 2QPEB 3L7EA 1ZHBA 3EW3B 4RISH 4PYGA 2J4WL 2NNXA 3LQZA 3F00A 1KIRA 5INCA 2EYTB 4BZ1H 2B20A 4OM1L 3CN1A 1CFNB 4GO6B 5FOBA 5JYMA 3W11D 1I85A 3BAKA 3CUPA 4H5SA 2R0WL 4OY9A 2GUYA 5DVKA 4MZIA 5KSAB 3AT0A 3JWOL 1OAKL 1P7QA 1X6LA 3QZMA 4HOMA 1HINL 4P2QD 4AEIH 1Y18B 3FCTA 4GKNB 1XTLA 1JTOA 3L95B 3I6GA 4N1HB 4OQTA 5C07A 1V7NH 1G7IB 3IDGB 5L4FA 1VEPA 5C6TH 1KJVB 3EGDA 1IGFL 3F7KA 2MSPA 4DSYA 4QKXB 1CD1B 3M45A 3QCVL 4ZFOA 2VDOB 3GYRA 1MCKA 1XCQA 1AKJB 1N26A 4QNPF 3LEVL 1U8NA 4Z3IA 5AZEL 1NC4D 2QLVB 3AS3A 2X6VA 2JKNA 1T20B 4OCLC 3LMJL 1CGUA 5GZOD 3QORD 2WNKA 3FO0L 4C47A 5CEZL 2NYYD 1WHOA 2WSPA 3MUY1 4QRTB 4LNRA 4RAUA 5AYTA 4ZFGH 4PBVC 4QWWC 5DQDH 3BH8B 5ESAB 3MYJB 3RBGA 1D7DA 4XRCA 4HQQH 1TFPA 2EABA 1GPOL 2D9QB 3JV6A 1IGIH 4H26B 4WY7L 4GP4B 1DUYA 3GEFA 4QCIA 1KPVB 2QKSA 3B7SA 4JG5A 3FT2B 3O11B 5C1MB 2Q8BL 3HUJA 1CD9B 2H26B 3Q01A 4UAOB 2RHEA 4X9HA 2BFVL 2YFNA 3QISA 3IWVA 1XIWD 4AYFB 4OGYH 3DMMD 5DURD 1JNHA 1G0XA 1FBIL 4ODWA 4EKJA 5H4YA 2QQQA 2NX5E 4ILDA 4NI3A 5C3IA 3BQUA 2XFXB 4K4KA 2G3MA 1PLGH 3B8SA 1H3PL 1TMQA 1JWUA 2IJ0C 1ONQA 4LQ1A 3VXQA 4PLOB 3T08A 3ATEA 5DWUH 4PJFF 3H7BB 3H2QA 3UTZA 4OI7A 3GMRB 3B56A 5GZNC 4QRSB 4JDEA 2QKIA 3MO1A 4WU7B 4JM0A 3WS6C 1O6SA 3MLVL 1EX0A 4P4RB 5DK3A 2GBAA 1UM5H 2AABL 1JDAA 2CBMA 2DI7A 3L5XH 5F21B 4KK6C 2PWDA 3VXQB 2XBZA 3R8BB 2EUXA 1HILA 2AABH 1UM5L 1WUZA 4OBRA 1IMHC 1TTUA 3T09A 4MS8D 3P3YA 2FLRT 4X6CE 1ED3A 4KX8A 3DTDA 3V4VH 3EXJA 1NUFA 1I7UB 1KN4H 3N0PB 4OCMC 4R83A 1WAAE 5KZCB 4EDWH 3IF1A 3IGLA 4GKSB 1AE6L 3ML8A 4FFYL 1GS8A 3BMVA 4XO4A 3FN3A 2JELH 1I9RL 2EDXA 1J48A 3RTQA 3QDJD 1AS6A 4V1DA 3MV7B 5GRUH 3PP3H 5GISH 2XY1A 2JV6A 5AKSA 2EDFA 1YCSA 2H26A 3H0TA 4XAWL 2OQJB 3DJZA 2NZ1A 5KSBE 3ZVVA 3HLAA 5J6HB 2NNAB 2CPUA 4LHJB 3VRJA 1CXIA 1ET8A 5A7EA 4L3CA 5IHZB 3L5HA 1KWKA 2FJUB 5E9DB 5KG9A 4RMWA 5HTSA 5GZOA 1TG8A 4JQVC 5JIDA 1FNHA 5ANMA 1DJGA 3OKMA 3NVQA 4IU2A 4D9RD 3SPHA 1AHKA 5I0VA 1FVCA 4WHTA 3T0EC 1YYLL 3OMNB 4ZZFA 1MHCA 2YN3A 4MA7H 3L9EA 1CFMA 3NESA 1R4XA 2QGBA 5FECB 2VR3A 1OARL 2BP0B 4UDUA 1IBDA 5GGUB 4A7UA 1AOZA 3FB8A 3C6LD 4A7GF 5IEHA 4KU1A 4ZAKD 3LNFA 4GQRA 4KQ0A 2PTTB 1IIIA 1RMFL 1MCEA 1S7SA 1AKJA 1J0IA 4RMBA 4JHBA 1FO0B 3TO4A 2IF7A 4JRLA 4UINH 3DX9A 5I1JH 5CZXD 1YNLH 1DFXA 4DQOL 4ZFFA 6FABL 1KJVA 1G1YA 2VDMH 4XCYA 4W4NA 3VFSA 1KJ2B 2P26A 5C07B 4AMKH 4WU5A 1E4XH 1R3LA 2DQIH 3H2WA 1WT5C 2ZXAA 3CZSA 1X5JA 4Q6IC 5DJXA 4P59H 4NZUL 2AJXH 5I26A 4KKRA 1E6OL 4AYSA 2PKDA 4AKPA 1KCRL 3LZFL 2Y07H 4X8XA 2AKRB 4AIZA 3H42H 5KBDA 4MKMA 1KXHA 1VERA 2Y5TA 1NGYB 3MRJA 3V6FB 3QUHA 1TZGL 2FBOJ 4XMLH 5DZAA 4HK0B 3K0YA 4NHUB 5FOBB 5LQBH 3QZOA 4R97C 3RWFA 2VAAA 4ZW5A 3L3GA 5F6HI 3KL0A 3UG4A 2O5YL 1OAKH 4AJVA 4I4WB 3JYCA 1QWUA 4Z0XA 4UOZA 5IMMA 1LL1A 2X6BA 4FXLA 3A47A 1MVUB 2YGPA 3MLTA 3PPEA 4FQ1L 4M6OL 2VM3A 4JREC 3TBWA 2VLKE 3HKFA 2ORBL 1ZLUK 1EXUB 4C54A 8FABB 1VFAA 4WHTB 5ALBH 3GJEB 2GJPA 3ARVA 1NZRA 2ICWI 1CDHA 4JQIA 3X1NA 4MNQD 4WKXA 5IGXL 1L0YA 1YJDL 2OW6A 3GHEL 4U6TA 2YSSB 1OL0A 4P5TA 3QORB 4HUMB 3IFLH 1FYTE 4X7FC 4YWGH 2YEQA 4PJ8D 3OC8A 5JHDA 5HYEA 3BI9X 5IIEB 2KZKA 1C5DB 1ZTMA 3L1GA 1J8HB 1NSNH 1HZKA 1LLAA 1UCTA 1WS7A 4L1SA 1MCLA 2VSCA 4U7KA 2XV3A 3IGUA 1DZ0A 3NCMA 4PBWD 3KGSA 3VXPA 2IC2A 1XXFC 4DKAA 2XC8A 3MV9D 5JR1L 4LOUC 4Z3EA 3SDXE 5I1IH 1EZVX 1PGRB 2BSED 4LARL 4DN3L 2Z7WA 3QIUD 1HH6A 1UM6H 1HILB 3UBXI 2IPTH 4GJTB 3TEZA 4M61A 1SMAA 5CLTA 4MS6A 3WFCH 5I71B 5B22A 3NIFB 1M9WA 3LXUX 2NY3D 3T0EE 3QIBC 5IG7A 4P4RA 5JHLA 1D5ZB 1ZXKA 1T04B 3WEOA 4K5NA 4OLXH 5DD5L 2ZWYA 5F1IB 3WE6B 4PRBA 4ZAKC 1HHGA 1QLEH 4K3EH 2XTJE 2IADA 5IUSA 4OCSH 2OMYA 5ES4B 4PJ6A 4PQXA 3B5GA 3EO1B 1EIBA 3EF7A 4JRYA 4ANKA 1T66D 4G8FB 5GRJH 1XCTB 4LP4A 5JQHC 2YK1H 4ZYKB 4X0KA 1W0VA 1UQSB 2PCXA 3MYZA 1PG7W 2IOIA 1JOIA 2P9RA 1E5AA 1LO2L 5D1ZA 4C83A 1C7TA 4KI1A 1I4FB 4NUGH 1SYSB 2XQYA 4MKTA 3DNKA 3BVWA 2AZAA 1J1XL 5JORB 3KPRD 5HGBB 2I9LB 4LSQL 5AWNL 3D9AL 3ECQA 2KKQA 3WMQA 3HUJB 4JKMA 1G7QA 1YEDB 4YDKH 5HDQL 3CBRA 3CMGA 5J7CC 4FFZH 4KKLD 1EJ6A 3PDOA 1OLZA 2KH2B 2AMUA 5GRUL 1NOAA 5C8JB 5IT2L 4OAWA 3QEQE 1W91A 3WHXA 4LDCA 5D1ZI 4J6RH 3IJ8A 3W5MA 1LP9B 3EJJX 3WO4C 4GMTH 3F7YA 1CD0A 3LY6A 2B0SL 3L4XA 4NO2B 3MODH 2FJHB 5GSRB 4GUQA 4Y5VA 2R69A 4YWGL 2WYIA 5D9SB 1ML0A 5E4OA 3BDBA 1BFSA 1RSYA 5FHBH 5FYJE 4KZEH 4J7RA 3SE3C 5JHLL 3ARDB 1EEZA 2GW5A 3MX0B 4YXLL 2BIIA 1CN4A 2X4NB 5DHVB 3PWLA 1PIFA 2N59A 1WGOA 3RY6A 4YFDB 4JN2A 5CD5D 3OVUB 3TNMB 1HQRB 2VJ0A 5CUSL 3GMQB 1RUQL 2ICEC 1DVXA 1ITCA 5ICZB 3LRKA 4JHVA 3WNOA 4Z7QE 2ZUXA 1WZMA 2Q7NA 5JZ7C 1S78C 2WTOA 2JTYA 4EUPG 5D93C 2YGQA 3DRQA 2AANA 3RVVC 4CN4A 3T0AA 5B38G 5KN5A 2BZ7A 4ODHL 4R3SA 2Z93A 3D52A 2DLFH 1M7XA 5BZDB 3MRBA 4IRSB 3H9ZA 2X4TB 2RH0A 4LOUD 3SO3B 2NXYB 4B0MM 1A6TB 5BV7L 1TZIA 4LP8A 4MJ5A 3GS0A 1G6RL 3IK2A 1GY2A 3QXTA 3RWHA 5C0IA 2YAMA 3OZLA 1RUAH 1UM4H 2LAAA 3ARBA 2YGOA 2VDRH 2OMUA 4FERA 2NY0D 4FQPA 4KVNL 4R84A 1R3KB 3MXWL 4UB0H 1X5KA 4HXAL 3BUYB 4X50A 3VE0A 4JG1L 3CFKA 2A6IA 4ALAC 3Q43A 4DQOH 1P6AB 5I1IL 4APXA 4JB9L 5E0QA 1EEQA 1EJOH 1GKOA 1GA2A 2J56A 3BWAA 3FZUC 3MJ7B 1NUNB 2YD9A 4PGCA 2DICA 4TSBH 1JSYA 1IGIL 1TJGH 3HG3A 3RIAK 4OIAA 1OALA 2K70A 3O6FB 1JF1A 4QT5A 3TNNB 2JVUA 1OP3K 4ALAL 5FYKH 3PNRB 5FYLH 3IM1A 1MQKH 2VTFA 3VXSD 4Z7NB 4AJ0A 1BYNA 4A6YA 3IBEA 3PL6A 3D2UD 4XPAL 3ISWA 3MJ7A 3IKKA 4PJ5E 2KT6A 5FWQA 1MDAA 3MLZH 4Y88A 1W8EA 4FNLL 4OD1L 3VXME 5CSZA 3MRKA 4NC2B 4Z3HA 3MGOA 4UZUA 5IHUH 2P3YA 2Q76B 1WC7B 1H3UA 4NQXB 3VFNB 5E5MB 2EP6A 4BFIB 1S9XB 3K2IA 5J11C 2XTSA 3FFCB 3S35L 5SWQB 3LH8A 1ZGLP 1EA9C 2F74B 1OXYA 5E5UB 3LKOA 4MXVF 3ZYIA 2ED8A 4OM0H 2R1XB 3T6ZA 1ZT1A 2CJSA 2KERA 3IXAB 4M6OH 2RFXB 2XT1B 1FC2D 4YPGB 2F53A 3WBDA 2HX7A 3TT3L 1WZLA 3NEOA 1MQ8A 5FDWB 4CC1A 3HS0C 4U6XA 4DZBA 3ARGD 1UXMA 4JW3A 5I71C 3BJLA 4FOMA 3ZT5A 3T2NL 1DL7H 1CE1L 3X13A 3S3PA 1T2QH 1D9KC 1MFEL 2F6AA 2Z4TA 1A22B 5CN3A 2K9UA 3W0WD 3HS0A 3GI9L 2Y06L 4FP8L 3G5WA 3EHBB 4ORGB 3FO1B 2LHAA 3FU6A 3GMQA 4ADGA 4AV4A 4G9FA 3ENEA 5IEKB 4MJJA 3DVGB 3P0GB 2M83A 1OM9A 1NC4A 3IRZA 3BUPA 2AEWA 1UB6B 2X4NA 2NY1C 1HQ4B 2HVJB 4FFVD 1ADQA 1B0RA 2R2CA 4HKBB 4K9EC 1AIFB 4S0TD 1PIGA 4GRLB 2OP4H 1U8PA 4MWFA 5FA3A 1UD5A 5FIEA 2M2DA 5TE7L 4JL2A 5BVJA 3UROR 4F7EB 2OX5B 3OL2A 1R75A 4WW2B 1BFOB 4TNWK 1IILE 1WPCA 2LU3A 2LU7A 5KVDL 1JJUA 4JY6B 1JHKH 1JXJA 4QRBA 4EPSA 4B9FA 2OTUB 1MREL 4NZFA 3ATAA 3GIZL 4G8GE 3C87A 5I0WA 2CUAA 1JGEB 3FOMB 4ANXA 4P4KB 4P2OD 5J3HC 3V55A 2E76C 4HLEA 4PWIA 3BEWB 2ESVB 1HI6B 2FUTA 2WO3B 3M88A 1BVLB 3QUXA 4L3FA 2KYIA 4L3EE 4OF5A 4XOEA 1FYHB 2V7NA 1HKLL 2CXKA 5HYQA 1CU4L 4N28A 4GBXB 2F7IA 4ONOA 3WXWL 4YSEA 1XB8A 2FX7H 3MV11 3UYPB 3V5KA 1KT2B 5IV2A