3ATBA

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3atbA00
1XL4A 3AGWA 3SYAA 3SYCA 2WLHA 1U4EA 1N9PA 2X6AA 3SPIA 3AT9A 1U4FA 3SPCA 3SPHA 3SYOA 2QKSA 2WLLA 3ATFA 2X6BA 3ZRSA 3AUWB 5KUKA 2X6CA 2WLIB 4LP8A 3AT8A 3K6NA 3ATBA 3SYQA 2E4FA 2GIXA 3SPGA 1XL6A 2WLNA 2WLMA 3ATEA 3JYCA 2WLKA 1P7BA 3SPJA 5KUMA 3SYPA 2WLLB 2WLJA 3ATAA 2WLIA 4KFMA 3VSQA 3ATDA
chains in the Genus database with same CATH superfamily
4EIZC 3PWPA 5AW7B 3TYGH 4JMXA 2WLHA 2WUCL 4KKQA 3BH8B 4GP4B 4ZJ9A 3T3MF 3HB3B 1QX1A 1UB6B 3T6QC 1A3LL 2WQXA 4MXVE 1FIEA 4EKJA 1E3ZA 5CR1A 3RKDD 2AQNA 2NY7H 4X5WB 3OHMB 1YEHL 3LZFL 2GJZA 2DMKA 3ET9F 5DGQA 2ALAA 4BK4A 4D8PA 3TBYB 2XX1A 2ZG1A 4AC2A 1ZLSL 3P4MA 4XTRD 4LCWB 1NLBH 1OLLA 5FHAH 1ORSB 3MBED 5PCYA 3RUGB 2LE9A 3BESR 3EHBB 4YPGA 3G6JA 3TLRA 2NX5D 2V8MA 2Q2EB 3KE0A 4HQQL 2V7HB 4NFBA 3T1FB 3IDYB 2VLLB 3HC4H 3STZA 4AIOA 1WS7A 4O9HL 3HUJE 2WUBH 2DTML 1RIUH 3IJYA 2D0GA 4K94C 1W9XA 3HNVH 2W5PA 4W1TA 3IFPB 5AYUH 5LQBL 3ZZSA 2C7UA 1ZKAA 5IHZA 3K6SA 1F58H 3SOBL 2ERJC 1A7QL 2N1TE 1N9PA 5EBWB 5GGRY 2X53A 5EV7A 1KBPA 1Z5YD 2Y6TE 4POZC 3EOAB 4P99A 2YUVA 1Q9OA 1PCSA 2EXWC 1FCGA 3F5WA 3NIGE 4KQ4H 1UCTA 3V10A 1RV6X 4I3GA 4V33A 3S37H 3V0VA 1E90A 2NY1C 3SDDB 5DSCB 2NY4D 4OIAA 5EC2A 1ADQA 2OL3H 1INDH 1BG9A 1QKZL 4JFFA 3QULA 5G4NA 1CF8H 2ZWYA 3RJDA 3A21A 2YGVA 2VDPH 1D6EB 2EABA 3O81A 4JPVL 5JMOC 3T3PE 1QSFB 3EYVA 1HHIB 5IUCA 3J07A 4AV4A 2N4IA 3E9TA 1DHKA 1X4ZA 3O8XB 1MY7A 3B5GA 4G8FA 2NCMA 4PRPE 1XXDC 2J55A 3MRGA 4HG4K 2CJUH 1R47A 4G43B 5DQDL 4CGUB 2YAMA 1YEDA 4XHQA 4DUWA 4KVNH 5KVEL 1TTUA 3I2CL 1BF2A 2CK0L 5ICUA 2EDWA 5KVFH 1IB5A 1XCQB 2BCKB 1NOAA 4NFDA 4XVUC 3SYCA 1BVLA 3GC3A 4J39A 5E2WH 4L8SB 1QRND 4FX5A 4I7ZC 3NFSH 2VLJB 4J6RH 2QVFB 3P2TA 1VAHA 4KROD 2HH0L 3IJ8A 4FQJL 3ZYIA 3MRKA 2FJHB 4D9RE 4NZRL 1FZMB 3JQOB 4K3DL 4LO9A 1F90H 1RZKC 2DIJA 2Y7NA 3MLRH 4JKPL 2XZAL 1IO4C 1BQHB 3B2MA 3ML8A 3PWPE 2FX9L 4KK6C 1MG3C 2IDQA 1W0YT 3T1FA 1TJXA 4P4KD 4PJFB 6CGTA 1DVFB 2A5UA 2G9HB 5E2UH 4C83B 4Z5RB 3A6BH 3WE6A 2CGRH 2DW5A 4HWBA 5E56A 4TOYL 4YFEA 5SV3A 4YHML 2MQCA 4Y9GA 1O9VA 3SIKA 3QRBA 5H37A 3IFPA 1V55B 4TXVB 1UACH 3D2TA 1CYGA 2NW2B 1F4YH 1NL0L 4Z7VA 1EAOA 4A2DA 4ABVA 2MQGA 3RVXC 3QYCA 1F6FB 5KJ4A 3HCVB 1DVTA 4WTXA 4JNXA 1OOAA 3FO1A 1N5AA 3DO7A 3ZDYF 3MDJA 4R97B 1UEYA 2B2XH 5GGQH 1K6QH 4EPSA 3CX5K 4BHUA 5J7CC 1BD2D 5C0AB 2XWXA 4B5EA 2E4TA 4HCRA 4NYLB 5F9AC 1WZ1L 3LQZA 4ZUSA 4WWOA 4AXWB 1MVUB 3I6LD 3G6JE 3MBWA 3EFFB 1KTDB 2AEPL 2BNRA 3HC3H 4KNTA 1F6AB 2ESVD 3CFIC 2FEEI 1TCRA 3S36X 4X8GA 2OMZA 2XTLA 1I1RA 2DM3A 4Y5XB 3RWEA 1PBYA 3CZSA 4PN6A 3KYMB 2ZOKA 3ZKQD 3S98A 1WICA 4RRPA 4WI0B 3DTDA 4KUZL 2R4SH 3D18B 4X8XA 1BCIA 3TJHC 3LRLA 3O6KL 1YECH 3WY2A 3FTGA 4HSCX 1MRDL 5C07A 5JZ7D 1FHGA 4Y5VB 4Z7QF 2BS8A 2CUMA 1VPOH 2LTQB 2F9BT 2P8PB 4M02A 3F04A 1NCAH 4DF9A 3D0LB 1MCOL 4J23A 1AH1A 2Q7NA 3L3GA 3MLWL 3AUVA 4LCWD 4M8QB 2Z0BA 4AL8H 4LCYA 1MAJA 3TBVB 3MHZA 4ZAKB 1QQDB 5BMFH 4JFFE 3GBLA 2G3MA 2Z3FA 4LHUA 5IQ9B 1EEZA 4KJPD 1QBLH 3EO9L 4HZ1A 4BRJA 5AKSA 3FQ1A 2YD2A 3BOVA 3AS2A 5CGBA 2XV6B 1EZVX 3IN2A 1FNLA 5FYKH 3SE6A 5JDSB 1TLMA 3T8MA 4A2FA 3D1MC 4OZ4A 4Z7OE 5ISZB 1CGXA 4P5TC 5IK3A 5HVHB 2GTZB 2J88L 1QLFA 1IZJA 2VDKB 3B7YA 1PG7L 1TETH 1U0QA 2JSFA 3GSUB 5CGTA 5DYFA 3PV6A 4HXBH 5CZRA 1CBJA 3WIIL 2P5WA 1MF2H 2CO7B 3BAYA 1R5IB 2R8SL 5I23A 1TQCB 2K45A 2J2ZA 1FSKC 4DW2H 1BZ8A 3GNML 3FQUB 3VXUA 5HYSB 4KFMA 3AG1B 2OL3A 3HCVA 1QTSA 1C5DB 4P5TA 5E2TH 2F68X 4ODVH 4WQOA 4EIBA 5IOPB 4LMQE 2D2OA 4IBQA 1ZTXH 3NEOA 1D5ZB 1QVOA 2CLRB 1N8OE 2G3ZA 1ANUA 3FYEB 1BIIB 3MRJB 4J3BA 4XN8A 4ANWA 3U25A 4X9GA 4NZDA 5HGGS 5IEHA 4UZGA 2IQ9L 1UVQB 2GJ6A 5I0DA 5DYOB 3V9CA 4M4RA 2BX5A 1C16B 4OB5H 4PWJA 1A7OL 5EOCJ 3LNEA 2AJUL 1T1WB 2HJKA 4NZUH 2CIIB 3INUL 1E5ZA 3FRUB 3N0PB 1MKFA 1U8IB 3EOTH 3IRCA 4LNVA 4XPGH 3UP6A 2AJ3A 5B39A 3RWCA 4R2GC 1JPFB 1NEZA 1O9ZA 1HFUA 4H1LG 3B56A 4MKTA 4UUJA 2R2CA 1UM4L 1AS8A 5DK2A 4GLRI 1IAKB 1KJ2B 5FM4A 1E42A 4LCIH 4EJ1C 4WF7A 3SDXF 4XMUA 1THCA 1S9VA 4HC1H 4DN4H 3WNNA 3OJMB 4ZODA 5C6TH 3W37A 4YUEH 3NJHA 2J44A 2VLJD 2PKDA 3QXVA 5DMKB 2DQUL 1A6TA 2O26U 3LKNA 1HWHB 3ATEA 5C0CB 3U1PA 1JXGA 1W0WA 4KMTL 3EUDA 1FWXA 3JWDL 3ROLA 1X5LA 1SN2A 4R7NA 5C3IA 3AZUA 2YGOA 3FU5A 2HMID 2A99A 4LIQL 3IRPX 3QJHB 4YBQD 3DYOA 4B9PA 1VIWA 3OAZK 1CD1B 5K39B 4HKBB 2AITA 1E9OB 3S9DB 3LEVL 5DHXB 1QSFE 2IBBA 4H25A 5IF0A 3Q05A 4Z7QB 3EYOA 5I76B 3QQ3B 2JI1A 2EC8A 4XN4A 2NY5L 3P54A 3CC5B 2GC7C 4MNHA 4TULH 5TF0A 3TBSA 5IROC 3IGAB 4U3SB 4A68A 5K9KA 1MQKL 5CEZD 1T3FB 2VH5L 4RFEA 5TGBA 1KCUL 5C07E 1TTCA 3CFDB 5KBMA 2ZF8A 2NSQA 2CXGA 4K2UH 2C9XA 3BAXA 1D9KB 4HWUA 1R3JB 4K8RD 4IRJD 3PS6A 2EYTA 3UZQA 3FQUA 5C0RL 3LEYL 2B14A 1J18A 3QPQC 1GOHA 4G6KH 5IROA 43CAB 3ZE0F 1SDDA 3L6FA 1DLHA 4P3DA 3IPFA 4MA1C 3GKWH 4HWEL 5CBAB 2XXFA 3TEWA 1GGIL 3WFCH 3VA2C 1IMHC 1OQXA 3V6FA 4UQBA 3GBEA 4XN9A 3T3ME 1ZHLB 4Y7MA 1NJ9B 2HVKA 2YD0A 2K4AA 4RA3A 2GITB 2ZKHL 3QQ4B 1Z32X 3AWEA 3D7PA 4XNMB 3H0TA 1RZGB 1ZS2A 1OM3H 3D0AA 4AL8C 2QMKA 2HRHA 3CHOA 4O5LH 1XV8A 3UACA 5C0ND 2HRLA 3IFNL 4ANUA 4PJDF 4DJMA 1PL3A 4E2OA 2FHFA 1TJGH 3FRUA 2OV0A 2ORBH 1EXUB 1KTCA 4UAOC 4CJ0A 4XO9A 2YPVH 4X6EA 3P3RA 2OYPA 1QHOA 3CDFA 2HG5B 5DK0B 5E1GA 3GMMA 4MMYA 3VXUE 5LGKA 1WFNA 3AROA 2FCBA 4IU2A 4ENEC 1I8IB 4ZAKD 1TEFA 1I8AA 3WIHA 2AEQH 2GJJA 3FOMB 2UWEB 4YVNA 1ROWA 1QHPA 1JWUA 3OKKB 4KKCD 4Z6AT 4NX0A 2D31B 2XG4A 2J4WL 3LN9A 5C0AE 5EG6C 4H26B 1IC0A 3LRGA 4XH2A 4AQEB 3L9EA 3M88A 2GJ6E 1KCRL 1E27B 2X1OA 3L9RA 1ZEAH 4P2CG 3MA7B 4CVZB 5ISZD 2QVTA 3QB7C 5TJWK 3SDXB 4TQ8A 2V2XA 3AJ7A 3VGEA 1E9OA 2ZXAA 4NN7B 4JFXA 2F8OA 5K9JL 5I76A 5KVFE 2IWFA 1AQKH 2WVVB 2I60L 3O3UN 4ZPTB 3SBWC 3O2WH 1J0KA 4FULA 2RIKA 3CWGA 2JQMA 3VUAA 2WW8A 3F7YA 2B1HL 1KF9B 3PIQA 4B3EA 2G75A 4AYFA 2CDGA 4HIEA 1NC4B 1H8NA 5B21A 4P57A 2ID5A 1W8EA 3EFDL 1EVUA 1N5YL 4RWYH 1BJ1H 4X0KB 1CFMA 2NR6D 1WBYB 4OY9A 3VXNA 5J1SC 3L9BA 4WEBH 1SBBA 4R6UA 5D2NB 2OCJA 3SBWA 3L7FA 3MRFA 3OLGA 4XZUB 3T65B 4XOAA 5EIIG 1EJOH 2OK0L 4WWPA 3UTSA 1FL5A 2O5YH 4HWZB 3E3QC 1T0NB 2ZX6A 3X13B 1DEDA 1IGTA 4ORGB 3MJ7A 3Q6GH 1QW9A 1A2YB 3MOAL 1ACYH 1FUNA 1H3TA 3BWUF 1XGUA 3APMA 1E8ZA 2JIXA 5ESVB 4DAGH 4KOCA 3TN0C 1RUMH 1MWOA 4N2EA 4JQIH 3SD2A 4IBVA 5I74C 4ZYKB 3IDXH 5I1KL 2Q76B 4PWKA 3N1MC 4NO5A 3MUY1 2IVFC 1XQ4A 4HC1A 4G70B 4QXVA 5DMJB 3S4SG 3QR2A 1DO5A 1TZHB 2HLEB 4M1CD 4Z3GA 1RIVH 4ALAH 5C0CD 1JPSL 4FD0A 2I7SA 1NSNL 5KEZA 3NFPB 3JSSA 2X2JA 1IL1B 3I75A 4ZUWB 3U82B 3FOMA 1A3RL 4FZ8H 3OKKA 1I1AB 1UXWB 2GW5A 3NSCA 5F6IB 2R56L 4BFJA 4IBYA 5I75C 1L3WA 4H26A 2EYSA 4TQIA 3FB6B 4WO4B 2LQRA 2BVQA 3SDAD 3S36L 1I1CA 1DVXA 1IC5L 4R9HA 4YDVA 2XXCB 2JLPA 1MFEH 2H6UA 1H3GA 2QEJA 5HGDB 5HDBB 3ZDYE 4EI6B 3FN3A 4R4BB 2V7NA 3UX9B 3UJIH 4YSCA 3CH1A 1RZ8A 1MW3A 3V6OC 1MCPL 2X0UA 4YQXH 3H1ZA 2VOTA 3HN5A 4ZPTA 4HIXH 1ZWIB 1D9KD 4OFYA 4MAYD 2LLNA 1QWNA 3CDZA 3MRDB 4ONOA 3O0RH 5DS8A 5PAZA 1OF2A 3MNDA 2G5UA 3APDA 3OGOE 2C3WA 1KTRL 1FFPA 5AW9B 4M6ML 4N6RA 1NCOA 2OMXB 2A9CA 4HFWA 3BDYL 4L18A 4DZ8B 2QMJA 1NUDA 3V6OA 1V7MH 2DDQL 1WBYA 4XXWC 1BGXH 2HT4D 1WC7B 1Q9KB 3N1PC 2ICWB 5CD5C 3U30B 3GXTA 1X6LA 3L4YA 4PJCA 1H8OA 1IAIH 2V5MA 5IHBA 4FCHA 3LB6C 2CD0A 2BHZA 4PUBH 3BH9B 2HPOA 5JXEA 3GZQA 2OP4L 4Z7QE 2M83A 4EVNA 1MZZA 2IPTL 7FABL 3CVIL 3F6IA 3ARGD 4QRSA 1ZGLM 4XXWA 3KPPB 3DDFA 4O2EB 2EDDA 2Q76A 4JE0A 5I1EL 3BP7B 3N43B 2CKBB 3GSNH 4LLVA 2WWNA 4QRUA 3VGDA 4LVOB 3EBGA 3FH8A 3DX7B 1ZTXE 5D1QC 4LPXA 3BUQA 4DZBB 3KJ4C 5HHMB 1LO4H 1X7SA 2ZWKA 2VXQH 2ZSWA 3G5ZB 1FNGB 2LU5A 1DBAL 1P6FA 3BPLB 5DFVC 5LKNA 3F64A 5DJZB 4F8QA 1CLOL 1HEZA 3I6SA 1KGIA 3UTSE 1KBWA 1QP1A 4L3ED 4X4YA 1D3CA 4KK5C 1HHJA 4PJDA 3MJ8A 2FNWA 5FK9B 4M9PA 4H2CA 5D1QA 3GI8H 2H0JA 2VDOH 5B1KA 1CLYH 1MWAL 3AMLA 2GVYA 4L29A 1OSYA 4E41D 4PS7A 1ORQB 3C5SA 1XGQA 4JFWA 1JZ2A 1MHPH 3DPDA 4JR9H 4Z8FL 3E3QE 1EEUA 3PHAA 2VISA 1SQ2N 1XFPA 2HKHL 1KPVA 4WFGE 2O5ZL 3ZUCA 1FYTD 2VM3A 2DBLH 4HG4J 4ZMWA 5GS1B 2V3FA 2JCWA 1BVZA 1I7TB 2ZAIA 4NCC1 4NM8H 2WAHA 4Y2DB 4PW4A 1MW0A 2FWSA 3OKLA 3NGBC 1ZA3B 2YIHA 5AW3B 2VXTL 4XMXA 5HHQB 4JFVA 1ETZA 1ZHNB 5T3XL 4KI5D 3W3BA 4YR6B 2EKSB 4FFTA 2AK1L 2CO4A 3BKYH 2GIYA 4L1BA 1J0IA 3OPUA 4ZUUB 3TJPA 5KTEH 3MLSH 5D6DC 4DZ8A 2VL5B 3NIFB 2MTPA 1NFKA 4ALAC 1WVZA 3L5JA 1OAKL 4JQIA 1TYRA 4OAWA 1CXIA 1F5WA 2WUCH 4ENZA 2NTFB 3VFVA 1FG2B 1QO3A 1V05A 4YHZL 1N0LB 1CC3A 3U1QA 1A3LH 1XGYL 1RZIA 3SDXE 4NHUA 3QWOB 3RVVC 1HWWA 4GRWF 3BH9A 1P69B 1QLRB 2Q10A 1YMMB 3CIAA 3C60C 1AQHA 1YEHH 3MRRA 3EF4A 3CVHL 3FU7A 4JL2A 4LAQL 4ONFL 4Z7WA 3W0WD 1CXFA 2W65A 3ULSA 1WCQA 2H41A 1H6FA 4Z0BL 5DZNA 1WHPA 4XCNB 5DO2C 3RPKA 3MNWB 1ZLSH 4Z77A 4Y16B 3V4PL 4O2CB 3PL6B 3BAJA 1NGYA 1WD9A 4JPWH 1DUYA 2IANB 5EDSA 2X3BA 1I1AD 4FXGC 4GKZA 4FL4B 3QG6A 5FHBL 3V6OE 2BHUA 1IZKA 3CNKA 3CX5J 1M2VB 4JDTL 4PJAF 2IXQA 5D2NE 2XETA 1QSVA 2WTOA 3ATAA 3D25B 2A6IA 4WO4D 3VFGL 1TUPA 1E0OB 4Y1AD 1M42A 2Z6FA 3QUGA 4DKTA 2DTMH 5K93A 4BFIA 1JGDB 1IQDB 1CL7L 3BPNC 1FVEB 5LNDA 3GRWL 4UDUB 5JIDA 2X42A 4IBTA 4GRWH 4LLMA 2YOCA 2CO6B 1JL8A 4FXGA 4NENB 1OANA 1I8KA 2MKWA 1FJ1B 3QXDB 4MJ6B 3PNRB 1A7QH 3BFQG 4TTDC 1QNIA 1RL1A 4NQTA 3F6LA 4F92B 2H2SD 3F00A 3QWNA 1D7FA 1CMOA 3TESA 3ZE0E 4KK9C 3FS9A 3VGAC 1BOGA 2R27A 3GRGA 4NQVB 1S7QB 2YPKA 4WI7A 5CWSB 1YUHA 3SY6A 5I8EB 1OT1A 2FO4B 3L3KB 3OAUL 3DVIA 1KN4H 3KS0H 4NO3B 4NZTH 5HHQA 4Z7IA 6PCYA 4JPVH 2VABB 4CADA 1HYRC 4PJDE 2WWKT 5DJXB 1IJ9A 4IRSC 2ODIA 3HE7B 4Q9CA 2E6JA 4H20L 5D1QE 1CXHA 3DMMC 1P7HL 4YIQB 4NO0B 1MUJB 2Y4SA 5D5MF 2VDMH 1I9EA 3QRLA 4K5MA 4M8RA 2WXNA 2IGTA 25C8L 2NTFA 4GKLA 1XMEB 1FG2A 3I2CH 2CK0H 3EBAA 1YEKL 4JKLA 5FDYA 4ZXBC 2XQ0A 1AS7A 3RWGA 1GR7A 1YY8B 5IB4A 4IRSA 3BGFB 4R0LC 3RWFB 3MOBL 5J8OA 3HLKA 3P3UA 4UCFA 1LWHA 3D2UD 2B1AH 4JRXA 3BISA 3DMMA 3TN0B 5A2LH 4NN6B 3F8UB 15C8L 3NG5A 3QUZD 4N0FA 5FECB 2VXQA 5CJ5A 1YEWA 1OTSD 3C8DA 4JPKH 3RVUC 1U42A 1XF2B 4G5AA 1PZCA 2HH0H 3EJJX 2ZE0A 3MUZ1 5LAXA 2QKIC 1KZYA 4ZXBA 1KIRB 1JXFA 4AGLA 1UWYA 1E5BA 4R0LA 4FNTA 2XZAH 5DHMC 4GH7B 4RMRA 1L0PA 5EOTA 3JV5A 3MR9A 4JAMA 4OT1L 4ZOBA 5D7JC 2V2WA 2ZJSL 1UQSB 3TASA 4RFNC 4FQHA 1JF5A 5IQ7L 2XACC 4N1HB 4FQCL 1UYWL 5I0VA 5GJSH 1NUFA 2OMNA 2QKIA 3D69B 5DD1L 2Y7MA 1NL0H 1SLWA 4I3RH 4ABQA 5AWNL 1FJ1A 1NPJA 4B7IA 1E5AA 1I3GH 5D7JA 2NSMA 1AGBA 3G7TA 4XC3H 4CKQA 4F57H 3VXMA 3ULUD 3HZVB 2IH1A 1KLUA 2V33A 5HPMB 1FRGH 2R1WB 1YRKA 1X9QA 2FECI 1DQMH 1CZ8L 3ARDC 3VWKD 2ZONA 5K69A 2HTKD 4KXZH 2R7EB 3UGXA 3QXUA 5HHME 2AEPH 3KXFB 1HHKB 4O2FA 3TL5A 5ITBH 3QI9B 2DQGL 4NXSA 2FATL 1BZ7B 2EP6A 2G4EA 4I9XA 1GAFL 3IF1A 5AOMA 4NO3A 2FRGP 2UZYA 3MRIA 1NIEA 4QTIL 2PP8A 1B3IA 4HS3A 4BZYA 2PWHA 1Q72L 5JYMA 3LH2L 3KPTA 5JORB 1Y0LB 3ARDA 3UYRH 2QDVA 4KUZH 1T0MB 4LKXA 2QPDB 3ZVVA 3RBGA 4AQ8C 4NP9A 1A6AA 5ADOL 1EGJH 3T0EC 4A37A 4LRIC 2CWRA 4ELKA 3MTRA 4ZMZA 1T22B 1C5BL 1A6PA 1RK1A 4U1SA 3S3SA 1B0GA 2A0LD 5EU4A 4AEHH 4GUOA 5DJYB 1ZT1B 5LWYH 1I3UA 4OQTL 1I82A 5FFOA 4DQAA 3PAYA 1T4WA 1JWSB 3MXWL 1MFNA 5CUSL 2WV3A 4G6AC 4HS6A 5FECA 2O4EA 2G30A 3D8MA 3OKOB 3RWIB 5SWZA 3T0EA 5AB9A 1OTUC 4LRIA 1IBZA 1C8PA 1HK6A 2ZUQC 4OLWL 5F71A 4ORZC 4YHLL 3FONA 3HW7A 3DTXA 2WB1A 3LN4A 4UBDC 3EG9A 5T33L 4YE4L 1W8OA 3HHSB 4KUCD 3PXLA 1QEWB 1KWGA 5FYLE 4L4TB 1PG7H 3FUEA 5HVGB 1JPGA 2FJGB 3AW5A 3ESUF 1NAKL 3B7SA 1G7LB 1ZANH 4N0RA 4W81A 4H88L 3WIIH 3R18A 3HLAB 1JERA 2R8SH 4POUB 4OCRL 4XNUL 3OF6A 4X6FB 4BBWA 2IDTA 1IQWL 1UZGA 1YMME 4W4OA 1N59A 5I8KL 2Z1PA 2UV3A 4PLJC 3WAKA 2ZOWA 3BHBA 3FSOA 4IBUA 4PJAA 4FFVD 2BJML 3KPSA 3IJHB 3RFZB 3T2QA 2CHNA 1TJIL 3X11B 3HZVA 4X8CA 1A6UL 5HPMA 4PV9B 2R1WA 3ABLB 4QTFA 4BHUI 1DQJB 2IANE 2LR4A 2BOCB 2PF6A 3HE7D 4K55A 3FTZA 1RHHA 1MCNA 3OKNA 2P8LA 4PGEB 3UO1L 1ZRUA 1KLGB 4NO0D 4GT7A 3HZ3A 1A7OH 3V5DB 1AR1B 5AL8A 4Q8BA 1OM9A 4N6QA 2A9DA 4Y4HB 1Q38A 1QR4A 3R0MA 1I7ZB 4M43L 3T8VA 5I1JH 3K3QA 5BXFA 2F7QA 4URKA 2BVPB 1UM4H 3PWLA 1KYDA 2P52A 3TN0D 1R34A 4HA1A 4JKKA 3BE1L 2BLFA 2VLRD 1KEMH 4LVHC 1E50A 2LVCA 1XB3A 3TS8A 3K72B 4B9ZA 2J20A 3VXME 5KG9B 5I1DA 4FG0A 2WO4A 2Y69B 3D33A 3TCLB 4KMTH 2EIMB 4MQXD 5D7SL 5BZWA 3PHOA 4XNDA 5F9WC 2KC0A 1JDAA 4WHYG 3A5VA 3IXTA 5D4JA 3WO4B 3T0DA 1I1FA 4LIQH 5D5MA 4RH4A 3OKOA 3RWIA 1NGXB 3PP3H 2JJTC 3TTSA 2AJSL 2G0KA 4TQPA 4KTGA 1MFCH 1W16A 3LEVH 4Q56A 4U3XA 1FFNA 3GD1C 1QUNB 3UPAA 4Y19A 35C8H 4BFEA 2Z8RA 1AO7D 2NY5H 4X42A 5JW4N 1FLTX 3LMJL 2P44B 1WCBA 5ALCL 2VH5H 4P2AA 5DUJA 1KCUH 2DWEB 4JFDB 3RL1B 2J57A 1H6TA 1F86A 4OZHF 3QT2A 4UQ9A 1EAJA 3SGDH 1U8LA 3RL2B 1JWMA 3G08A 4KDWA 4WLCA 3P2BA 5CCHE 5F3HB 5C1MB 5B8CC 3F84A 5C0RH 1A6WL 1JN6A 2DV6A 1P5UC 3POHA 4NUJA 1PZAA 3FQRA 2XVBA 1DSFL 3VGHA 4HWEH 4UM8B 5G4OA 5SWZE 2ARJQ 3LNDA 1AI1H 1CYWA 3FTYA 3QUHA 5CZXC 4ZDHA 3T0EE 3K91A 1IBYA 4AV0A 1TU2A 2XHNA 4HEMA 3VM5A 1LE5B 2CKNA 1XH1A 2EIZA 5EIIA 1IAOA 2G2NA 3L5WA 3SY0B 4XC1L 4GRWE 2WYZA 3IMVA 1BSIA 3SKUD 5B8CA 1JV2A 4JGNA 3OLIA 4EQ3A 1EHXA 1UOVA 4TNEA 2IPUK 4XPAL 1P5UA 3IFNH 3DVNB 4LESA 3PQYA 2EDNA 1PY0A 1S7UA 1HN1A 1R0AH 1QFUH 4FNLL 4NN5B 5CU5A 2D7NA 1JBJA 4P5KA 4V2BA 3BP6B 3VYPA 2FL5B 2KPWA 4NQCB 3TT1H 2VXVH 2NY0C 1VRSA 1ET7A 2EDBA 3GS0A 3KM2A 2PYEA 3S4SA 3LD8B 3Q8FA 5CKAA 1NLDL 1H3PL 1AP2B 3P9LA 3KPSE 5J12B 2K0RA 3LN5A 1U2YA 2Y7QB 3CMGA 1HHHB 3KJ6H 5KG9A 2HWZL 2ZWNA 4FJ6A 3K4AA 2J4WH 5F1NB 5IB2B 1F3DH 2MCPL 2DQIL 3TCXA 4S1DC 4A7QA 2CA3A 2G3XA 4J1UB 3QZMA 3MO1B 3RURA 3HFML 1OP3H 5EHFA 4PCKA 3V5HB 4FKEA 5KVEE 1R3KB 2CRMA 3QZWG 3QEQA 3GFUA 4YO0A 1ZXQA 1ETJA 1PD6A 1YO4A 3EOBA 3L3IB 4IK7A 4L4TD 4MHHG 4C56B 5K9JH 1H0DB 1JNHB 4OV5B 4F7CA 5A2CA 2YLHA 4F9PC 1HZHL 3R06A 4Q74A 1IEBB 4OM1H 3G6DL 1IRAY 2ADGB 4HAFA 1AMXA 1OT4A 2I85A 2H9GA 4N8VB 1Q9LB 3A6CL 3E8UH 3VRJB 3TV8A 2I9LA 4JFDA 5DJ6A 4EE2A 1N12A 1O6VA 1YNLH 1WZKA 1FLRL 1KPRB 4ZMTA 2A6KA 5DEFA 3D0VA 1AD9A 1H3UA 2ZCKL 4WJ5A 2XWBA 4GY4A 4IHBA 2GTWA 1KB9K 3HI5L 4F9PA 1ZJBA 2B15A 2PP9A 5ECGA 4AWJC 1CXLA 5CSZA 5D5ME 2JCCF 1NMCB 5IG7B 2OK0H 1N8ZA 1JP5A 2JFCA 3G5YA 2JI3A 4L48A 4OZHB 3NH7L 1ZDSA 4PVNA 3MOAH 4PHZA 4Y4HD 2WVTA 1NFDF 4B95C 2DLEA 2VO5A 5FYJL 1K2DB 4Y19E 4OLUH 3F7PC 3S97C 2CHZA 4P4RB 4PTTA 1QYGL 1R24A 4F8PA 5I1KH 4RMSA 5ICXB 4ONHA 5IJVB 5HI5C 3FCBA 4M6AA 3WTSA 3WNPA 3FUMA 1RULH 3QUKA 4XN5A 1A21A 4LLWA 5F8QC 1ZSHA 5MI0B 4DPCX 2EDMA 3P2DA 1RJLB 1BFVL 2NY5C 4UV4H 1EX0A 3BEVA 1G6RB 2B0SL 1O7SA 3WKQA 2XPGA 1ML0A 4ICWA 4WV1C 1F02I 2OMWB 2R1XA 2DF3A 4XTRC 3KHOA 2KKQA 2YAPA 2C1PA 2UY7A 3MBEC 3HN8A 4L0PB 5C08A 4HEME 5MERB 3WELA 5IB2A 1CB4A 4UOQA 5DTFB 5IR1B 1LVEA 2AK4B 1O7DC 1TO5A 2DQEH 2N7BA 3WFDL 3MO1A 3S36H 4M93C 3ZIYA 3DA0A 1P1VA 4L37B 3L95B 1GY1A 3FB8A 2Z34A 5E70A 3QNYA 3LCYA 3PQYE 5T5FL 2WLLA 3V5HA 1K4DB 1HOCB 2FEJA 4JDVB 4Q0XL 2RALA 1LO2H 4C56A 1SJXA 3MBEA 2DKMA 3MROB 1IFGA 4EDWH 3M1OA 1MCPH 4M8UA 2NX5A 3M7OA 4G8IB 3QZBA 1NDGA 3T77B 3BSZL 5SWQA 1YN6B 3K81A 2PYEE 3E6FA 3IMSA 5A6MA 4IGBB 2CUIA 2XX0A 1A1MA 1SBSH 2R1YA 3LJ3A 3QIWC 3TPKA 2Z31B 5DMGD 5IMOB 4ZW6A 4QDGA 3BDYH 3PGDB 5A2JH 4QMEA 3ISWA 1A6ZA 1FN4A 2O72A 3OWEA 5TK4A 3BQUB 4N2IA 4LASL 2BO0A 5IG7A 4OJDH 4X99A 1IIIA 3CC1A 1QFWM 5C0IB 1DJWA 3RWDB 4HHWA 3QEQE 3QIWA 1BJMA 1DJYA 4OZHA 5JR1L 2BSTB 5DD0L 5L0QB 4Z7UB 2CBQA 2YKKA 4JDZB 1G7JB 1MHEA 2IPTH 1ETA1 3CVIH 3UTZB 5KBKA 5I24A 4NQCD 5MEOA 2WOYA 5HD8D 4AGMA 5ICXA 2YMXH 5F7DA 5I1EH 4Z78B 3AITA 4PW9A 2X7LB 2J6EL 3QNZB 4JFDE 2EADA 1F45A 4OUOA 4Y8DC 5GGSY 3U7AA 1UURA 3BKML 4LPCA 4D9QE 5LGHL 2DBJA 4WUUD 3WKNA 4N2KA 4U1KA 2Y23A 4BXVA 1NFDB 4HZAA 4L1LA 2ZYSA 3BCFA 3JTSB 1BM3H 3KBFA 5D71L 1DBAH 3FO0L 4XP4L 4F33A 2R23A 1CLOH 2PN5A 4KROC 3L48A 2JJSC 2OMWA 3NIDB 2AKRA 4X5PA 1U4EA 3HHRB 1RJCA 4P48A 1S5HB 4FMFA 5BUGA 4K15A 1Q1JL 5BJTA 1MWAH 1PG7W 4ODUA 5C3LD 1EZUA 5AEAA 2CLVB 3NVQA 4P4KC 2X28A 3GTNA 2XV3A 4HAGA 4JLRA 1JDDA 2OJZH 4WI2A 1IBBA 3S2CA 4AE0A 3D08A 1U21A 1J9CT 1HOCA 5A2AA 2JJSA 5EF0A 2Y25A 4GXUN 3GT6A 2O5ZH 4AW4A 4FG4A 1WT5C 2A6JA 2WBJB 3ETSA 1F11B 4G8IA 2E8YA 2W94A 4WKXA 4APQC 4P4KA 2VXTH 4OCYL 5KSVA 5AVQB 4LIQE 1CDBA 3X3FH 5T3XH 4DP1X 2PR4H 3DGGB 5BOJA 3KM1A 3GDCA 2Y5TB 2AK1H 1G84A 5C08E 2B4CL 3QJUB 4HHGA 4HD5A 4OBSA 1IC1A 1WT5A 2K70A 3OJDB 2ADJA 1OAKH 1XR8A 3SN6N 5IMKB 2IOMA 5CEZH 5DMIL 1CWVA 4APQA 5IFAH 4LLQB 3U4KA 3DWTA 4YHZH 4U0RB 1U3YA 1XGYH 4X98A 5F7EL 5F3BA 1IE4A 4PB0H 5L7XH 4MVBD 3AG2B 1DQDH 1MHCA 3C6SA 4MJIA 4C56E 4FQ2H 1FIGH 4KC3B 3VXSD 2ATKB 4HIQA 4KGLA 4UINL 1CD8A 3TTYA 4WEEA 4LAQH 1J1XL 1O7DE 1AD0A 2VJ0A 5E8OB 2PPEA 3K1KC 4Z0BH 4MCZA 5JZ7C 1EUUA 4K07A 1XWVA 2TAAA 4W6YB 5I17B 2JCCA 3R7QA 3N9GL 3KPQB 5BUAA 2XZQL 3FAWA 3GB7B 2EDJA 5DRXB 3WYRA 2VQTA 2VZ1A 1OP5H 4J3OF 5FHBH 3KYKH 1NFDA 4YLQT 4EN2A 4BH7B 4KJPC 2R29L 3DX1A 4G7SB 1ADWA 3PP3K 3QXAA 1BJ1J 3VXPA 4FQXD 4AKPA 4RX4A 4WHYH 1A5FL 1CL7H 1WJ3A 4NAQA 4PW3A 4UWQB 3TBTB 1RJYA 2AAVA 3GRWH 5F9JA 3T4AB 1J05B 2GBAA 2GBTA 4OZHE 3TA3B 2EVFA 3AACA 4URTB 3GSOB 3GXFA 5JPNC 5JHDB 1ZHKA 4YGVB 2PO6D 4P2YA 1F4AA 5EPMB 2KLSA 3BUPA 4X6BA 3NUKA 3ZYZA 1RUKH 1BQLH 2NZIA 3CZJA 5IEKB 2KZ1B 1E7VA 3U6RA 3GSWB 1XIWB 2DM7A 2FGZA 4IGBD 2EE9A 4KVCH 4UZSA 2YPLB 2JKSA 3ME0A 3PJSB 4AEEA 2ISDA 4CBZA 5I1LA 4R3SB 1TZIA 4D94A 5JPNA 1DCLA 4J3OH 1OGSA 4PV8A 4B7LA 3WTXA 1ZHBA 3MTXA 1GYAA 4DWHA 2VN5A 3OAUH 1HAWA 4Z7AA 1BZEA 1KBBA 4P59L 3BQUD 3DVGB 3K5RA 2ENQA 1KT2A 1MLCB 4OZIF 3T04D 2F74B 2NSXA 2NYKA 4H20H 4ZW3A 4IW4C 3RIAK 7PCYA 2DLHA 2RJMA 3CZLA 3CZFA 3CVHB 2AK4E 4YK4B 3FK3A 3WTVA 3H6AA 2Q86B 2KHAA 4ODHH 2APSA 2FZ3A 3VTAA 3X3GL 5E9DD 2YXMA 2YARA 5F7UA 5EO9B 4IMLA 1YEKH 5C0DB 1LEIA 3SPGA 3V4PB 1KNOB 2J72A 3QAZC 5F3FA 1S9WA 4M00A 3PXHA 5HI4C 4OTXL 4TN9A 4RGNB 4I1RA 3W11D 4EZLA 3KH4A 2Y7SA 5T8IA 1CUOA 4N25A 2NQDA 4XMTA 4L8CB 4N0CD 4RMVA 4HUNB 1JGLL 4X6DA 2WO3B 4XCCL 5HDRA 3FT2A 4BE5A 5I17A 2DEWX 1OCCB 4ODSL 3RTQD 1KJVB 4WFFD 1E6OL 1MH5B 4PP2A 4RNRA 1Q9WB 3CX2A 3D87B 5ADPH 3I9PA 4IS6B 2HMIC 4GKSB 2DYRB 1MWAA 4MNGA 1OP3K 4U6YB 4F7EA 4OT1H 3KHQA 4YBQC 5F96H 3QQNA 2R51A 1LO0H 5EDXA 3FT3A 1UB5B 5BVJA 5IQ7H 4FQCH 2VQ1B 4G5ZL 4Y5YC 5GQBA 3W56A 3JXAA 1UZ8A 4LPYA 1C1EL 2IDSA 5DD1H 1UASA 4MJIE 4BDVB 2YD5A 2UUDH 3AWFA 1UZ6F 4HW6A 4ZPVB 1QBBA 4IJTA 5AWNH 4YGVA 1OCWL 3TNNB 2ED7A 5B1JC 2ITCB 3M1BB 5BQ7B 4K23L 5IZ7A 1C08A 3RDJA 4PP1C 1L9RA 4ZS7L 3PNWA 2H1PL 3ZR6A 2I69A 1M1XA 5KS9F 2JCCE 4GFTB 4Y5YA 5FM5M 1JUFB 4AEFA 3ZL2A 3NJNA 3L17A 1VKXB 4FNSA 1F3JB 1T2XA 3RGVB 4IRJC 4JFYA 5E8PB 1D5IL 3WKML 1NFDE 3HKZA 2DQGH 5GGTL 1OCRB 5B1JA 1A1OB 5KYXA 2FATH 5EF3A 1GAFH 5IESL 3ZSTA 4AQ1B 1GVIA 1BX2B 4QTIH 3K71B 3EYQD 1Q72H 4PH8A 4TV3A 4GIAA 4XVSL 2MPAL 3CZEA 4MSWB 5D1ZB 3LH2H 3PGCB 3N50A 1Q94A 1J1PL 2JE8A 4V1DD 4WCYH 4IRJA 4W9GC 1VA9A 5EBGA 3WNMA 1VFOA 3L3DA 5C0NC 1DN2A 2FWOA 4UYQA 5ADOH 3VU2A 1U8MB 1M53A 2UZPA 3QRGL 4HZLA 1EEYA 1C5BH 1WBXA 4OZFG 5AOIA 2AHIA 5FC9A 1F0LA 3QNFA 4YDLB 2RB8A 3WD5L 1OLZA 5DVMA 3ARXA 3O6FC 4GBXD 4JG0L 1IKFL 1XF1A 3ZZLA 3ABZA 3MXWH 3K2MC 2DIEA 5LGYA 1RZFL 1NZRA 3GSXA 1CVSC 3OKMA 4UAHA 2A4CA 3Q9QA 4YDKL 4MB1A 4NO2A 2I32A 3P4OA 4W9JC 5FWRA 3WE1A 1CPUA 2VWEC 4ZI8A 3F3HA 3PHQB 4KKCC 5HBBA 4ICXA 1HCZA 4K5OA 2WKOA 1QOKA 3GMPB 4YHLH 3GRWA 4Y4KD 1HEJC 5DD3L 4AJYV 3UBXI 3PWJA 3GEWB 4E36A 5IVNA 3O6FA 1D5XA 4QUOA 3MLZL 2YA2A 3DYMA 5JHDD 5I6NA 3B8SA 3L9YA 5IB3B 3WEOA 4Z76B 4YC2B 4PJ9C 3ZJAA 3WFEH 5GS0D 3CGTA 4ZG1A 2Z92A 1M6OA 4P05A 2JTDA 3OC8A 4NDMB 2HP4A 1LK2A 4NKDA 3GIVA 4XNUH 2C1OA 3HAEG 3LS5H 1IQWH 2YPLD 3AU0A 2F1AA 1DBML 3QQDB 4ABWA 5I8KH 1C12B 1WWWX 3CQFA 3EJZC 3ZY7A 4FF9A 2EACA 4ETQB 2XQYA 3VFNB 1HZLA 1Q8MA 2BJMH 2YZ1A 3DJZA 4RISL 1UC6A 4ADJA 2ZQKA 3NN8B 1TJIH 4PJ9A 3MCYA 5EC1A 3AQDA 5KYUB 3M17B 1G1OA 4XN2A 1OT2A 5HVFB 2XWZA 2ZOLB 3ZE1F 2BH0A 1JZ8A 4DUVA 3IGKA 4PRDB 1CT8B 4J3XA 1BPVA 4MNGE 3S96B 43C9A 4DVRL 1KV7A 3OPZH 3WOVA 3QUXD 3JVFC 1W6WA 5D7KE 3K71A 1BAWA 3DX2A 4LOFA 4PJ7F 5J6HB 5JOFB 1H6EA 5E94B 1AJ7L 1TITA 3BZ4A 1HQ4B 1G4RA 2BIOA 3W9DA 3WS3B 1OL0A 4HT1L 4WSGA 2IFGA 1HXKA 4JUTA 3RE0A 3BE1H 1C7TA 5CFHA 4IOIB 4TSBL 4J8RB 2WVSA 3DECA 4M48L 2H45A 4TM9A 5T3XE 4FXKC 5DI8A 5JIMA 1P7QB 4JO3L 1TQSA 1PQZB 4KXDA 1DE4B 4OZIA 4ODTL 2ZUVA 2Y07H 3F05A 5DC9B 3DX8B 1UT2A 4MWFA 3AGVA 3S5LG 5CEZE 2W9LA 2GYSA 4M5ZL 3WKYA 4N5UA 2DI8A 1M7XA 4F27A 4JZJC 4PR5B 4E42A 1KB9J 1UA6L 3FULA 4QXWA 4LZKA 3FXIC 3H2QA 3GMRB 4FXKA 3KS0J 3GMPA 3RX7A 3BMVA 3M8OH 3IFOB 4N2OA 5D7EA 3QZWA 2VTFA 4KQ3L 3SDAC 3UBGA 1M1SA 1S2EA 4OM0H 1N68A 2ZZUT 2K7QA 1QSED 4FNQA 4XCFL 2FEDD 3QDGA 4XBGB 5ALCH 1D2PA 2PWDA 4Z3JA 1ZY9A 1WDAA 4IDJL 4R7XA 3QDJB 2OXGA 2N3JA 1K3IA 4U6XB 2WY3B 4JZJA 4AKQA 1F4HA 2IWEA 4EEEA 4ERSL 2PTUA 3QEUB 3Q8BA 2XV2A 3MGAA 4P5MB 4JFOA 3WCYA 4J8QA 4YH6A 3FKUS 3RX9A 4RGNE 4XAWL 3BYTA 4PM1A 4MAYC 3UGUA 1EZVY 1A6WH 3CFKB 4LSSH 4OR1A 3SDAA 3F65A 1S7TB 5MENA 2X44D 2UXGA 1DSFH 1FGVL 3AREC 5SWSA 3OG6B 2MJWA 1X3DA 4A2EA 4IKIA 2TRHA 2UZXA 1YJDL 3T2OA 3ZL4L 2XSKA 5DZLA 4AYBA 2QZ5A 2HT4C 2QR0A 4MAYA 4UOZA 4ZQKB 4XPAH 4Q52A 1FE8L 4LCCB 2AERT 2QGDA 1Y1DA 3AREA 4UMGA 2P46B 2X1QA 2MIZA 4Z9KB 2VWEE 1Y18B 4PRAA 1BZOA 4PD4K 3BVVA 1XF5B 1SMDA 4MS8D 4CILA 2A74B 2VW4A 3A4FA 1PDKA 3MV9D 5HPOA 5KS9A 3EYFB 5KVGH 5IJKC 3ARGC 1BIHA 1FFQA 4OQTA 5LVEA 1C9SA 3KCPB 1WIPA 3HZYA 2KYIA 4JB9L 1ZGLB 1NLDH 1H3PH 3CAFA 2JLLA 4MD4A 3NJKA 3PP4H 5C7XL 3ILEA 2D3VA 3FSWA 5CNHA 2I24N 1EDYA 2HWZH 1OP5K 4HAKA 1CF1A 4PJ7B 3EXLA 1NAML 4MNQD 3DXAA 2MCPH 5A40E 1PQZA 1LILA 5ID1B 3M1CA 5IJKA 3ARGA 4L0ZA 1IU1A 4LLYB 4OD2B 1XSKA 5EORH 3LRSA 4N87A 5EZOL 5INDB 4KFZC 3KR3H 3SE8L 2LAGB 4K3HA 3CSPA 2OPCA 3OKDA 4WVRA 4I9WD 5DDHB 3WSQL 2W60B 1HTYA 3VD4A 3BP5B 2SODB 3VW3L 1WFIA 1NCIA 2OYKA 4X5QA 3BX7C 5E5MA 1FL6A 3BI9X 3NCWA 5CCGE 3KLQA 4OJFL 3ISRA 3SBPA 4F80A 4HK0B 1HZHH 1FC1A 3D12B 4QHNA 1RZJC 2VXUL 5GSVA 8FABB 5FGRA 3ULUF 2VR8A 5F7YC 1TG8A 3FB7B 4JREC 3PF2A 5I5MA 5KZCB 2FAUA 3OR6A 4L3EA 1RKRA 3FU3A 3D4GA 1KACB 3N41F 4Z3EA 3IETA 2ZNWA 2ZCKH 3IDIB 1X9UA 1XGRA 1ZOXA 4XP5L 2H32B 1R33A 4OZIE 4UTCA 3HI5H 2XKNB 4LEOB 4B3VA 1ET5A 4E41A 3CFKA 3ORJA 1S7TA 4DGIL 4KXZI 2VZVA 3F7QA 2Z4QA 4KI5C 4JFEB 3AVEA 3HZKB 3JVGC 5BS0A 5C09A 4Q9RL 4D7PA 2CBMA 2CHWA 4XE0A 3TOPA 5C6PB 4U6VL 5IV2A 3NH7H 5TE4L 3E1ZA 5AG8A 1G87A 3VD0A 2NCEA 1FYTA 5F1SA 4PRBA 1G5GA 2XI9A 3LH9A 5FYJH 2CNZA 4QRTB 2DMHA 4P2QD 4QKTA 1S9YA 1I8MA 1U8JB 1J8HA 1XGPB 2G9KA 1YMHB 3QDGE 2IDFA 5GZND 3ULUH 1ZIAA 3OXSA 4QYAA 2F2HA 3TFKC 4F9LC 4BFOA 3JVGA 3QVAA 1JNJA 4BZ1L 1OD7A 3O2DH 2G0LA 2ZKXA 4QYOB 4B9JA 2B3RA 4XPFH 1Z5LB 1AZBA 2DQTL 4EN3B 5ACZA 3L13A 1ZVSA 3KG5A 4GUPA 2V9RA 2QPFA 4S1RL 1DBBH 4GPVA 1V7NL 5LGJA 3O0LA 2J1YA 2B0SH 2J43A 3S3BB 4JFSA 1P2CA 1O6SB 5MENE 3NJXA 2WXOA 5SWSE 4UIKL 4YSTA 4MXQD 4F9LA 3S88L 4JCMA 1SEBB 2YGNA 3FT4B 3IWVA 4U1MB 1JV5B 3W0WA 5BOPA 3SODB 4LSRH 3WFDH 5JPMC 2I25N 5DZVA 1UZ6E 2E4FA 2AF2A 5T5FH 2YEZB 3UG5A 2WD0A 3WGVB 5EEXA 2V2TB 4AQAA 4Q0XH 1MFUA 1E9PA 5ESAB 2HCZX 2UUDK 3F83A 3B9KB 4CNIB 5KS9E 5D7IB 2PPFA 3V5KA 3EDJA 3FT0A 3SKMA 4AENA 4MJ5A 4DK3A 1NBQA 5E8NA 3BSZH 2NXZB 5JPMA 1UGNA 4NNYB 2H2SC 4E9WA 1BJ8A 2K6YA 4I5BA 1T20B 3FB7A 3H2WA 3RU8H 4YLCA 1WHOA 4BYHA 4DGVL 1H15B 5FB8A 3HRZB 2VN4A 3O3EA 1J0JA 3AMKA 5IOKA 3LX9A 3DXAE 3H4HA 5EOCL 3UO8B 4A7VA 4HULB 4U3HA 1YVLA 5E1AB 1ZSDA 3W5MA 4F7PB 4DKEL 4LASH 4HGMA 5CEYB 2GUYA 3UAAA 3ES6A 4DERA 1R3HB 2ED8A 2C9SA 5JR1H 3KPNB 2OJEB 4JL1A 3VG9C 1MCKA 1R3IL 2CZNA 1NPNA 1QD0A 4QRTA 2Y5QA 2BOLA 4NBZB 1J8KA 4JANA 3TNMA 1YMHA 2YJQA 2BDNL 4OCXL 1RZ7H 4N2GA 2J6EH 3QEHA 2VUKA 4PWEA 4JRYB 4L3EE 1NWPA 5C9JA 1SXNA 1BEYL 4DPBX 5L9DL 5GSRB 4PJ8B 4GB9A 2EZ0D 3U4EB 4OZFH 2ZWZA 2AXFA 3KPRB 3QUZC 4EI5D 1BF8A 4FMKA 4EIUA 5F9DC 1CR9L 3KPMB 5D71H 4XP4H 3FO0H 3H9ZA 3P9WB 4DQOH 5K1JA 1O6SA 4WSJA 2VIRB 2WXHA 3BWZA 5BS0E 5C09E 3U0WL 3PABB 4R5VA 3QJTB 3WUWG 1N2RB 1G4MA 3GS7A 3E6HA 3CSYB 1Q1JH 4HPHA 3D2UA 4A6YL 1IGIL 2A9ML 3QUZA 2R0KH 5J6GA 3OAYH 1A9BB 4NQUA 3B2VL 4OF5A 1J8HE 2YUXA 4M1GL 4E9YA 2YK1L 4G6JL 4Z7NF 3SDCD 4GO9A 4ANKA 2X4QB 4EZJA 3S8GB 1SUHA 5GRZA 4RGMB 4HHAB 5KZCD 1PF3A 1E2ZA 1MHHA 1IC7L 3DRQA 4U1NB 1TFPA 3VXQB 4I18C 3BKJL 3ZT6A 4JM2F 2QZQA 4DNLA 1QABA 3ROOB 2Q3XA 5FFGA 1LDPL 3GJEB 4K71B 1EFXD 3HAEH 2AJVH 4OCYH 4DOHE 5FKPA 3WFHB 3N44F 4HJGB 3ULUC 5AUMB 2F0CA 1ZK9A 1S46A 1XXFC 4JFED 4PGDA 3VWKC 1ICTA 1M7DA 3LZRA 1MNNA 2EUWA 2HTKC 2YQ3A 4GEJA 4PJ7E 1CG9B 3MLUL 4I18A 2Z35B 3HE6C 3FSZA 3CCHA 1F3DJ 5DMIH 3COOA 5CM1A 1NGWB 2F6AA 3KYNA 1MFDL 2ZUUA 5HHNA 3TGXA 5T3ZD 1BVOA 4H5SA 4KRPC 4ZS6D 4M8VA 3GPEA 5F7EH 2JJVA 2H6PB 4G11A 3O4OC 3O2DA 1R3HA 2BSDA 4H44C 4PJXF 2BM3A 5AAPA 2OJEA 3VWKA 3BO8B 1T04A 2EDQA 2FH6A 4ZUVB 1DBKL 3TX4A 4EN3D 3NA9L 3HE6A 2NDGA 2P80D 4LF3B 2B8OT 2QPUA 3RQ3A 3QIUD 3U2SB 1GY2A 2AANA 1S4IA 3AS0A 4Q6IB 3N9GH 2YFOA 2E7DA 2V5SA 1CDHA 4G1EB 2XZQH 2Z93A 3N0AA 1MCBA 2F53D 2ARWA 3MLTA 4NGHL 5DLMH 1MW2A 2PPDA 5HHPA 2ZG3A 2R9HD 4WDIA 2R29H 1G1KA 1DQQA 3RAJL 1B4TA 2NYYC 5H94A 3FU0A 4YDZA 1YEFL 3TURA 3ESOA 2ZCHL 5KSUA 1FO0B 5T5FA 1AHMA 4RZCA 5KOVC 1K5NA 3CHRA 1MCDA 1DVYA 4LVNC 3UAEA 1LEGB 2PXYA 5DQJA 3WEXB 4N26A 3BH4A 5JUEL 4WW2F 1JOIA 4FG6C 3VYNA 4BK8A 5KVGE 2G5BB 3HNTL 3RIFK 4DP8X 3D6GA 3BSZA 3GGWA 4JQVC 3C5ZD 1E28B 4OLYH 2NXZD 4JPIA 4JJ5A 2DWTA 4IBZA 4J12A 2RD0A 5ID0A 1PS3A 2JB6A 2BP3A 2JKLA 2F8VA 4LSDA 1XF3B 2X4SB 5AW1B 1F4WL 1WE5A 2WIIA 2HVJB 4JHBA 4KTEL 3KVPA 4XMKL 3BVTA 5TDOA 3CZGA 3I6GB 3MVSA 4NZFA 4LRNL 2ZAGA 3C5JB 5BZDA 3GBNH 4FFVC 2DB8A 1PLCA 4P59H 2BWIA 4PJ5B 1BPLB 3O3AA 4O51A 4Q58C 2BVUA 4OFVA 3U36A 2KDYA 5EO0B 4B50A 3CN0A 4M6OH 2VZSA 4OCSL 4AG4H 3F6JA 4UT9H 4X50A 1ODUA 1G7HB 5JQIB 3BSHA 4Y1SA 2WBKA 1P7KA 4JM2B 2CALA 4F20A 2WCSA 4YAQB 1BFTA 4EUPB 4Z95H 3O3BB 3RBSA 4PJHB 1G7IB 2J6EA 5E95B 4Q9QL 2PWEA 2H6PA 1IBHA 4DKFL 3EFOA 4OTXH 4P04A 3BO8A 4LL1A 4OZFA 1UM6L 4Z3FA 5TF1L 3O4LB 4AUYA 3VI3F 1A7RL 3GHBL 3N91A 5DMYA 2WNWA 3DLQR 4GRLD 3BIKA 4MDJB 1JGLH 3PAUA 4O02B 5A1AA 2C4FT 4XCCH 4Q6IA 4L8DB 2BW4A 4ODSH 4ZFGH 4MQXC 1E6OH 4RRPM 4KKBC 3FCTA 4FQ1H 3GKZA 5FOBA 3U0TA 1AQ8A 4HOZA 1BWMA 4X7TB 1M4KA 4PJXB 5FYJE 1T6VN 2GSIB 3FT9A 2AABH 2ZXEB 4XRCB 2VLRA 1URIA 4M7ZC 2PPAA 4L9LC 4G5ZH 3ULUE 1IBFA 4XNYH 4ZTEA 4N4YB 1UFUA 1C1EH 4LARH 4U7SA 1VEMA 5EBLA 4PRID 5IUSA 5AKVA 4TUJB 1KCVH 3BVNB 4HDIB 4WKZA 3SYQA 2W0FA 4LAJH 1UH4A 5G2NA 3ARWA 3B1TA 1RFDL 4ZS7H 3HAEA 3CVCA 4L23A 1PY4A 2OJ1A 2XN9D 4L9LA 4QGTA 1F2QA 1L5GA 5DJCA 3MX0A 4YZWA 1XF3A 1U8OB 1YYML 3BUDA 1YNTB 1A65A 2HVJA 1AO7A 3D39B 4ZX5A 3KPRE 5L8LB 1BREA 4WW2B 2MEJB 5GGTH 2X4NA 1R5VA 1TSRA 5JW3L 4TVPL 1CDJA 1GS6X 2OMYA 2DQ6A 2APBA 3KEDA 5I6OA 2CDFB 1BAFL 2H3NA 1AGEB 4PMFA 1KIPA 1P1ZB 4XVSH 2CR3A 2MPAH 2VR3A 4PBWD 2Q7YA 1LP9F 1XX9C 4IBSA 1QLEB 4BA0A 1MEXL 1NC2A 2NW3B 3Q1SL 5ESQB 2NXYD 3HPJA 4GI8A 4JM2A 5HJDA 5LO7A 1A8JH 1AQDB 1YN7B 3AB0B 3VH8B 1P4IL 3KYOB 3QRGH 4OUUA 4LSPL 5CGYD 3JTTB 3AXIA 3GZOA 1TZGH 1MJUH 3ARBD 4ZNCD 3C5XA 4AQZA 4BGLA 1YZZA 3WD5H 1IKFH 5CBEA 3V4LA 1TNNA 3V6BR 5J5EA 3O4LA 3KPLB 2R29A 1RZFH 4D0CA 4XO5A 1JGEB 2HFFA 1G9NL 1OALA 4X4MA 1X5FA 2BWDA 4I0KA 4PI2A 5EBMB 4A1RA 1HYSD 4N90D 4BWUA 4L8DA 4HX1A 4F58L 3ULVL 3KVDD 3S5LA 2OX5B 3I02B 2QPSA 2D7TL 2ARJB 2VSKB 3QHZL 4PJXA 1FAIL 3NAAH 3PRZA 1E4KC 4XWOD 4LNRB 3AUWB 1JCKA 3P30L 3Q48A 5HGHA 3W82A 4GO6B 3H9SB 3ZHNA 1U3HB 1KGJA 2Z7WA 3ESPA 4QF1B 4FTVB 3ALWA 4IIQB 3RP1A 4MMZB 3LZLA 1RCYA 3V0JA 4H0GA 1AIFA 1KG0A 1IC4L 1EAPA 3BVNA 5CJ8A 4D0BA 1Q1PA 3WEAA 1HH6A 4UT6L 1LL1A 4GAJL 3QH3B 1E4KA 4GSRA 3LNFA 4NEHB 4Q4IA 2F5BL 4RISH 3WI9A 5C0BB 4W9ZA 5B4MD 1JPTH 3BD3A 1QTPA 4NKIL 1KGYE 1KIQB 3GTVA 4OF7A 4PJ5D 1XH2A 1RIHL 3H53A 2FD6L 1D7DA 3PHSA 4HUUA 1RLBA 2NUTB 4NJAH 5C8JB 2F5AL 1XL6A 4UT9A 5FA4B 3RTLA 4P9HH 1S9XB 1T1ZA 4YBLC 3BJLA 2FIRT 1AC6A 3TT3L 4NRYB 3ULAB 3D4CA 4WU7A 4S0TD 1SY6L 2YXWA 3MLXL 5DJAA 1KELL 1P1ZA 4WI6A 4PSPA 3II1A 3U1SL 3C6EA 2ICEC 3DOSB 3K0WA 5AAMA 5KSBB 2V5RA 1BBDL 5ESQA 3L4XA 4E9XA 1FF5A 5HJBA 1Y6KR 4G59C 1AQDA 3NZ8A 5I1CH 4TSBH 3T0XA 4AH2A 4CU8A 3IDUA 2ZWLT 4M48H 3Q3GB 1E5UI 2A38A 1P6AB 2CM6A 2NLJB 2GUOB 3SE4C 3C12A 2FIKB 3U46A 4Q2ZB 4JFHD 4JO3H 2C3HA 3LPOA 4LSVL 5FYKU 4GIPD 1NQBA 2ICEA 1JZ4A 4G9FB 4FYTA 3THML 1IILE 5B7EA 5L4MA 1FPTL 3BMWA 1V5JA 1G7QB 3PJLA 3CK0H 4LE8A 4M5ZH 1NMAL 2OMVB 3SKNB 3GWJA 3DV4B 3BKCL 3QIBB 1CD0A 4HH9A 2VT0A 1UA6H 1L9NA 4Z7NE 1CDIA 4BRVA 1E6JL 2BIPA 3GSQB 4MZ2A 3PFQA 3OAYK 4P8QA 5ECJE 3BLPX 1IGJA 4QLWA 4YFLI 1LM8V 2GB2A 4WI5A 4XCFH 2C4FU 1R3LB 2CQVA 2LV4A 3CUPA 3I6KA 2L8AA 3OX8B 5FO7B 2ENJA 5KUMA 3VI3A 4IDJH 2FJFA 3CHSA 2CO2A 4K7FA 4MJHA 4MQ7B 4ERSH 4MAUL 4EMZA 2AVGA 2X70B 5F93C 4AUUA 1YPZB 4IJ3C 1ZVNA 5I6XB 2FK9A 2VCOA 4AITA 4GS7C 1HILB 2F18A 4R96B 5BVPL 3G5VA 2ZXWB 3O4LE 4KBPA 5GGTA 1FC2D 3NCEB 1D5MB 1LMKA 2DMGA 3K6NA 4P23C 2EE2A 3X1BA 3VXTB 4X4ME 1BAGA 3ZQXA 2OTUB 3CFCH 4QO1A 2WINB 5DMGC 5I71C 3Q5OA 1JMZA 2HKFH 3VE0B 1WBZB 3VFUA 4R7LA 1OE2A 3MYZA 1TQVA 4D9LL 3QZOA 2QT6A 4G6FD 4PJXE 1SM3L 3BN9C 1II4E 3B6SA 3VX0A 1DBJL 3ZQ9A 5MEQB 5IVOA 4I0CC 4KNUA 4MB3A 4YHIB 4P23A 4QT5A 2HX9A 2DQDL 3DIDA 3DO3A 2PYFA 2WP3O 3MRPA 3QUYC 3RPIA 1YQVL 1SXZA 1NGZA 3OLEA 2X1WL 2GT9B 2XKUA 1T89C 5FCUH 1U8NA 4FLHA 3MRMB 3WHXB 2XNAA 3ZIMA 4JB9H 1XGTA 2AJYL 2BIMA 4TNWF 4ABUA 2FECL 2XPZA 1GYWA 3KH3A 5ERWA 1HXMB 5TQ2H 2NNXA 3RWHA 3FFCB 2A2QT 3J27A 1YAZA 5M7QA 4PJGF 4YHNA 1JYXA 3QUYA 3ZHKA 5DFAA 1ADQL 3L1GA 1T5XB 3EH3B 1S78D 2IALB 3KGSA 4PJEF 1T89A 2CHDA 2BP8B 1LP9A 3SE8H 1CICD 1J5OL 3DJ9A 5CXPA 3WSQH 4PU2A 2SEBA 1CDCA 1WUZA 5E99H 1U8KB 5EULV 5EZLB 2P5EB 5EA0L 3WFBL 2B20A 3WY4A 2QGEA 4LXFA 5C3TA 5IB1A 3H9SD 3SJVA 4WUUA 4OJFH 2GCYA 2P49B 1U3HD 1W72L 1E4WH 3E80A 3MGOA 4P9HC 2VXUH 5AENA 1KEGL 1R3LA 3LRMA 4AM0A 2ALWA 4HIIB 2P8MB 3T4YA 1E5CA 1PYWB 4OFQA 4KZCA 2CCLA 3ARQA 5L4JA 3L3HB 3T6XA 3OQRA 3RB5A 4OGXH 2DLFH 4YN3A 4XP5H 3QFDA 1QMUA 4NI3A 4N0UA 1PFOA 3DX0A 1HILA 3OB0H 4GMSL 3QZNA 4OFPA 1UCBL 2A6DA 3KNBB 2Q5BA 4DCQB 2CIKA 1E4XI 2H3XC 4I4WB 1RUAH 3O9WB 1XH3B 2Q6WA 4Q9RH 2D0FA 3HR5B 2OTWA 1SVCP 1AIZA 5E7BA 3AU1B 3B2XA 4U6VH 4YSDA 1FNEB 1ND0A 1XF4A 4KPHL 3H55A 5G4MA 1ODAA 4RDBA 3REWB 3RHWF 1S8DB 2VLME 3IS0X 5L2KB 1NCHA 2A83B 3MRCA 5I8CB 2CUAA 3IFLL 4NC2B 1A3ZA 3RLSA 4QRQA 4FFYL 3D05A 1UENA 3VI3E 7CGTA 2WXJA 4JGJA 4BZ1H 3ZKXC 1KYFA 2FT7A 2DQTH 3MRNB 1OZTG 1RZKL 3OMNB 3PPEA 1NAMB 3U0PB 4WNQA 1QI3A 4OLXL 2QV4A 3GHPA 1V7NH 3TBCA 2WXRA 2VL4A 1C8QA 4KKLD 4N8UA 4OD1H 4UV7L 5DHYA 5FO8B 3P40A 4ELMF 4G9FD 1DLFH 5IHLB 5IFHL 4FQIL 3QJXA 1IVLA 4G8GD 2DQCL 5B3JF 3S88H 5IBUG 5AD0B 1CFNB 4NQED 3MRBB 3NP4A 3FCSA 4L5FH 4HS8L 4L4VB 3VXSA 4WU5B 4LSQL 2CBOA 3BIAX 1AYRA 3L2MA 4QJ3B 1GXEA 1SJVA 3TYGL 3WUWA 3MCG1 3L5HA 4XNZC 2QADB 1KGUA 2KDGA 4FQXC 3ECBB 2OMTA 4MD5B 4MX7A 1I7UB 1OCZB 1OGTA 4C4BA 3EGSA 1UXSA 4HKJB 5E0QA 2X4OB 4GLRH 1SMOA 5EFIA 2WIMA 2NY7L 2BY1A 2E74C 3CSFA 4BSVA 2PO6C 3MV8B 4DH2A 5EEZA 1PZDA 1T7YA 3REVB 5I66B 2P7TB 1ZXKA 2O61B 2AGJL 5C0FB 1IM3B 1VADB 1M2OA 4FQXA 3VX1A 1DDTA 1SYVA 1PYWA 3EJCA 2IAMD 3BWAB 3OJVC 4XXCA 4YHYB 3IGLA 2NZ9C 3UFIA 5A2IH 1NLBL 2WCPA 4S2SA 4XE5B 3DV6B 3MRLA 4L2YA 1FQ9C 1T2QL 1JHTA 5EOCH 1IM9B 1W8NA 2DYPB 1CD9B 2PO6A 4XP9H 5E23A 2D7OA 1LP9E 4PCTA 1VZHA 4FAAB 3FQWB 3HC4L 4NQDD 3Q44A 2MRYA 2R2HA 5GS0H 4ZSOA 3O9WA 3HR5A 1HQRA 2IH3B 1OARL 3B2UC 4GXVL 3X12B 5C0JB 1B6UA 2NY6D 1T03H 1CGYA 4G9DB 3M6DA 4XAKE 4BKLB 1OP4A 3SJVE 2K3TA 5IT2L 2K6ZA 4WUUE 1R3IH 3S35L 3BCDA 1F58L 5E6IB 1MFAL 1CO1A 4DSYA 4Y2OA 1SUJA 4PBDA 2BNQB 2BDNH 2QFRA 3OZ9H 3RX5A 2BPBA 1JFQH 5IB5A 5F70A 2WTRA 1DFBH 4NQQA 4OZGB 3IMUA 2W81C 5MP6L 4KDVA 4Y9FA 2XYBA 1KIUB 2IMNA 4XMLH 1SN0A 4WFHE 3L81A 4N0UE 2OL3L 5AVRB 4N0CC 3NSYA 4PTUA 4W4NA 1OZUA 3Q01A 4W9KC 4CVXA 1U8PA 2HFEB 3DIFA 3ARZA 3U0WH 4TTGA 3RTQC 5GGVY 4HCIA 1ED3B 4ZO9A 3SPVB 3D48R 5DHVH 2XU9A 4WW1B 3GS4A 4N20A 3LIZL 4A6YH 5F6HJ 4WU5A 4KQ0A 2A9MH 3G6AB 3O6ML 2HYMA 2R2BA 5LBSL 3QFJB 4TLTA 4UM9A 3IMRA 4D0DB 2YK1H 3DHUA 2IAAC 5DUBB 4G6JH 4KVNL 3GTTA 2Y24A 1U8HA 1HSBA 4HP5A 1DANT 3RTQA 1WWAX 2Q8BL 4KHXL 1IC7H 2IQAB 3DJSA 3K4DA 1XO8A 2EVIA 4ACTA 4PJGA 3PWNA 4WWKD 1S9KC 5LNGA 2ICCA 5DU7A 1D5RA 2IGLA 4FA7B 4BELD 4PJEA 4PJBF 1JTPA 1K8DA 3WN6A 5JW5B 4U7KA 2E27L 4ONGH 1TFHA 1A0QH 2DAVA 3QNXB 3FFCE 2ICWJ 4R5TA 3EBIA 3K46A 1F90L 2EC9U 4BSJA 5F6HI 3JWOC 3VXSE 3MLUH 1UH3A 2VC2B 4I88A 5MEPB 5L2KD 2OM5A 5E2UL 1S7VB 3DRTB 3A6BL 3VXRB 2P5EE 4M3HA 3UTTB 4BZ1A 5D1XD 4PG9B 1UACL 1JXDA 3GI9L 3RB7A 2AJZB 3MCKB 5DUMH 5T1KB 1QRKA 5JLZA 5EN2B 3NA9H 3TCTA 3GUTB 2KH2B 2X6AA 4L3CA 2EICA 2DD8H 2UY6B 4NIYE 4QY8A 1JGIA 4NPJA 4Q97A 4UTAL 3C2SA 1IAIM 2B2XL 4XMZA 2YA0A 3KPOA 4BE6A 3I74A 3Q6FA 1EV2E 2ICWI 1T1XB 3HFFA 1GPOL 4GBXC 4JZNB 1GRWA 5E9NA 4NGHH 4V1DA 3MFGB 3Q2CA 2PCXA 4LOEA 3GO1L 2KLRA 3HC3L 6TAAA 4X4XA 1JF6A 4IKKA 2QGBA 1ZT4A 4KJWD 3D5OF 4I85A 4PV1C 4X4ZA 3P3TA 4FQQA 1B0RB 2QADD 3VJ6B 4P46D 1AKJB 3BFOA 4Y4KC 3MNZA 1IFHL 1MLBB 4KZEH 4OCLC 1N4XL 5JUEH 2AS5M 1A66A 2MH4A 3MV7B 2DQHL 1OGAB 2AV1A 1YECL 1KFGA 1VESA 2F54B 3MV8D 1PLAA 1ZLVH 4P2OD 4D0DA 2FR4A 5GS0C 1X4XA 2VDLB 2OXHB 1UA7A 2BVOA 3LKOB 4GW5B 1IM3D 2JWYA 4ELMA 2KL6A 4FNUA 1T7XA 1P4LA 4QHUA 2GY5A 5DJDB 3QO1B 4Y4KA 1CFTB 1BM7A 1CXKA 1A4KA 3RRQA 1F4WH 5GRYA 2ZX7A 1CLVA 2BC4B 3AQXA 2DYPD 1A1NA 3E38A 3CN2A 3GBMH 1QBLL 4QPEA 3GMQB 2XN1A 4ANXA 3DROA 5DJ2B 4ZUTB 2R69L 2F19L 3FU9A 4XI5C 2CJ3A 5CD3A 1GW6A 4JGUA 4AT6B 5FYKL 2BS9A 2OQJB 3F7VB 5FEBA 2VERN 2G60L 3FQ4A 5FA3A 3CZKA 1KDIA 2OTPA 2V3DA 3QUXC 5E4EC 2B59A 5E6ZA 5BQDA 4LHQB 4RAUA 2W91A 5MEPA 1TETL 4NWUH 4HXBL 1IX2A 4Q9QH 4DP5X 1MF2L 4WJKB 4DKFH 5KYYA 3IMTA 4DW2L 2AJZA 4PJGE 2L4OA 1UM6H 3Q8AA 1UWEH 3GUTA 2X9XA 5FUCE 5IIEB 4PJEE 1A7RH 3K4ZA 1BP3B 2VE6A 5J11C 1KGCD 3QORB 2NUPA 2DTSA 2NOYA 1U33A 3C09B 4FLSA 1LD9B 5E4IA 4HJIA 3MGTB 4MJ2A 5FS5A 3V8OA 2J7LA 3B3IA 1TMCB 2E47A 1DEEB 1OB1A 1XDTT 5DHVA 1QBAA 2KQMA 3SO3C 4OGYL 3ZHLA 4JZNA 3QDMD 5FGCB 2ZNXA 4A6YA 4U6HB 4I2XA 4GQ9H 4BQCA 1CQKA 1QFOA 1S7SA 5ANHA 2MTAA 4ZFZB 1T83C 3OJ2C 1U2CA 4NZUL 3MKKA 4Z0XB 3C6LB 1BVKA 2X6MA 4QOKB 5FM8A 1EHNA 4JK0D 2Q3ZA 2WLKA 4AYGA 1G0XA 2OMUB 4ZOAA 1U2HA 4ZMYA 2FEDC 1OGAA 1F41A 1NUGA 4IBLT 4TNWK 2BNQE 3TO4D 3LKPB 3LHAA 4DN4L 1PZ2A 1W0VB 1X7QB 2VDNB 5FGSA 5K5YA 4IEFA 2X0WA 3QPXH 2QV2A 1J0ZA 1QA9A 2C9UA 5L2JA 3CFMA 4OI8A 4XBPB 1T1YA 3GMOA 4GFXA 3OB0K 1ET8A 1GZPB 2OSLB 3CN1A 4J27A 4V1DE 3ZMRA 2ZYRA 3ILPA 5ENWB 3SQRA 4DGWC 5HHOB 3FB5B 1DJIA 1LE9B 2GKIA 5CIPB 4JZOB 4TVPH 3GMQA 3HBPA 1VACA 3OAWA 1ONQA 1BAFH 4B9KC 3ULVF 4M7KH 1UKSA 3BZEB 3F12B 4WI9A 5K59F 3N06B 5JO5B 3ABGA 3VXRD 1UFGA 4HIJB 3GXIA 3UTTD 1T21B 2PUQT 4A55A 1WFMA 5C9KA 5JW4Q 4UQ3A 2KZWA 3BDXA 5CINH 3QFJE 1KFAL 1OHQA 3KDMB 4R4FH 1AC0A 1P4IH 1YEIH 3MC0A 4PJBA 5HI3C 2V6HA 2O1AA 4FFWC 1KXQA 3UYPA 4MS8C 3S5ZA 4ELME 1JI1A 1JF1A 5IW6B 3GLEA 2VLKB 1U91A 4V2CB 3UJJL 5D9SB 1BZQK 3SE9H 1UJ3B 3LVEA 1AZVA 5H2BB 5B3JE 3WO3B 2HJLA 1AACA 3RNKB 5CMAB 4CSPA 3MMEA 1G0YR 1G9NH 2EEXA 1G94A 2Z91B 4JO8A 3ZTJG 2XDHA 4L4JA 1LD9A 1FV1A 2IBZX 2COQA 1OAQH 2J8UB 3MV9A 4QHLB 2D0HA 2D7TH 1I9RL 4MGXA 3TVMD 3QHZH 1OM3L 1FAIH 3S3PA 4GQRA 4L8BB 3H2PA 2GABA 5CLTA 1DJXA 4NCC2 3RWJA 4PIRF 3ZOAA 4LQFL 3G5XA 5JW4M 4IQHA 5D7LA 4Z0XA 2C8NA 5KVMC 2YPVL 1TKWA 4P07A 2IADB 4MNQA 1BQSA 5DVLA 2AV7A 1INQB 1KB5H 3PWUB 5HGAB 1LEKA 1YEEL 1IC4H 2B5IC 4WGVB 1LQBC 4UT6H 1IUZA 1CE6B 4GAJH 5HGBA 4K0OA 4QWWC 2F5BH 3MFFA 2AEQL 2E6PA 4U1GC 1W0VA 2H1XA 3NEEA 3DSNB 4RAVB 2N56A 1LJMA 4NKIH 4X6CA 4F8NA 2NY2B 1RIHH 2IPKA 4DPAX 2GJPA 3NCYP 4NNPH 1SQMA 2AQ3A 2F5AH 3MV11 3CDGA 1QI5A 1NBCA 2QLVB 5EU6B 5I9QB 1H9DA 1LE9A 5D93B 4M6NL 2XFGB 3TIDA 3TT3H 3VSTA 1I7RA 5JXAL 4M03A 5F7AA 5FF6B 4CKVX 4YX2H 1SY6H 2XN2A 4Y4FD 5E7FA 3HG1A 4ANVA 3U1SH 1AQKL 1PD0A 3IMWA 2YAEA 3LSOB 1XT5A 3MAWA 3QJOA 4AOFA 2QQLL 2MHAB 3EDKA 2H0FA 1BBDH 3CFTA 1CDUA 1DUZB 3RDTC 1ZS8A 3MV7E 5GZNC 4I48A 1OGAE 1AHWB 32C2A 4MRBA 5DC2A 2BERA 4L1SA 2AW2A 4N8PA 1VFBB 4JM4L 4Z3HA 3VXOB 2AZUA 3QORD 1OVZA 2O93L 3I9GL 4R7DA 5GGRA 4IM8A 2BW5A 4LSVH 4RWYL 5C0GB 4U1HB 5B1BB 5GZOD 3P77A 3SQBA 3B7TA 3NPSC 3V9EA 1FPTH 5FDWB 1CI5A 3RDTA 1DDHB 3FO9A 4PMEA 4XHJD 5E2VH 3HG2A 3UTPE 1L9TA 1NMAH 3HC0B 3BKCH 3CFJB 5IKCA 4MXQC 5KYWB 1NEPA 2F58H 4H8HA 4XNQB 1E6JH 3GSVB 1ACYL 3C6LD 4OVUA 1WEJH 1XZ0A 1SVBA 3TBWB 4DAGL 2WLJA 5I2IB 1F2XK 2XV0A 1RUML 1BFOB 1MIMH 1DN0B 4KK8D 3Q8CA 1N18A 3IDXL 2PMZA 3SYAA 1BMGA 4CU7A 5L4FA 3WL9A 2ADYA 4L9DA 3TM6A 3QQXA 3QW9A 2QBWA 1IE5A 4F15B 2JELH 2XWJB 4PJBE 2J56A 3NIGB 5E0FA 3SCMD 5IY5B 1KXQE 4HGWA 2GK0A 2IADA 3UAFA 1GHFL 1RI8A 2JKIS 3PE9A 4S10A 5HGAA 4ALAL 2JK5A 5BVPH 1DCEA 4MBOA 3RG1C 2G2PA 1GKOA 4PFEA 4R8WL 2CPCA 3GRBA 4GW1A 4UDTB 2O30A 1S7RA 3T3PB 4FZ8L 3UGEA 4K73A 4XR8C 1HL9A 2VO8A 5DJ0B 5EEYA 3MV9E 3VWJC 5E8EB 4X83A 3DBXB 5GRWA 2YN3A 3WAJA 3ELQA 3TYFA 3U4AA 4NC1E 5EU6A 1DBJH 1VERA 1KCSL 2YHGA 5AW2B 1MCHA 1KC5H 1MFEL 1MAML 5D7LE 1X5ZA 4LKCB 5TPWH 4MQTB 1H5BB 2D7QA 3UJIL 1Y7VA 3LPGA 1YQVH 1HX0A 1SRDA 4G3YH 2P24A 3VWJA 1KJMA 3NSXA 4AIZB 1K3ZA 5J3HD 1DUZA 1EAQA 4GRMA 3NZSA 3HVNA 2LGNA 5FKAA 3UP1A 2BIHA 3DOHA 3O0RL 5EOQL 5D70L 4QTHA 5FO9A 1V3LA 2XTJB 3RZCB 3OR7B 1MFBH 3VXOA 4MCYA 3TWCH 3O45B 4GW4A 2EZ0C 4HJ0D 1MFVA 2W80C 3L3OC 4EI5C 1G43A 2J1XA 4XBEH 3NK4A 2Z4TA 3GPSA 4U1HA 2Y1ZA 4DHLA 5HHOE 5DEGA 3H3KA 2X12A 4PCYA 5AQ0A 1J5OH 4PEEA 1UM5L 3HC0A 1YG9A 3FTWA 5HYEA 3CFJA 3VSVA 4GG8A 5F0PB 5EA0H 5BRZD 2FSEA 3WFBH 4LK4A 4D2NA 3AXHA 3HG1E 3CIQA 1W72H 3PDOA 4CN6A 2GJZB 3L3OA 5FWQA 3E8VA 4E9QA 2X6BA 4EI5A 1KB5A 1ZLVK 3WDJA 1K4CA 2XYCA 3AQZA 5HYQA 5I1HH 5MHSD 3JZ7A 2VGLM 4D8PB 1HDMB 1TJMA 3MACL 4UT6A 5JMRA 3SDCC 1UD5A 3GSNL 4ODXA 1UJTA 2XWJA 3P4MB 1MAKA 4DVBA 4F37F 3VFOA 4PGCA 1FZKA 2J6WA 2YN5A 3FT1A 4Z7VF 4YPGB 3G6JB 2QFPA 4HU2A 4U3CA 4GI6A 5F88A 3STLB 5DC4B 3I3BA 4BSWA 1MCEA 2VXQL 3U83A 3QA3A 4GMSH 4YBHA 3STZB 1UCBH 5JOPE 2MNWA 3VA6A 3SDCA 4QXTA 5BV7H 3IJYB 4UZUA 2VR4A 3LKSA 4YDIL 1SY6A 1T5WA 4KPHH 3WDHA 1GTFA 4XCEA 3RA7H 3TA4D 5IHZB 3ABKB 3K6SB 5IMMA 1WIOA 3PU7A 1NKOA 3IFLH 4CW1A 2CRZA 1EFXA 2JB5H 4JR9L 1WZAA 2KS0A 2VSDA 1FNAA 1Q9OB 3MA9H 2HRPL 1HINL 3V0VB 3OZKA 1PX3A 3LV3A 4U2YA 3WLBB 1U6AL 1KN2L 3LKQA 2LABA 1RQ5A 4OLXH 4XX5A 3F01A 5EC2B 5ILTH 1WLHA 4JFFB 2ERJB 3B5HA 5LXGH 3VFSA 4R84A 3X14A 1BYPA 4PLKD 3TZVD 1UGKA 1WV7T 3QIUC 2XTSA 4O58H 1GMIA 4TVPE 4G72B 1PX4A 2H26A 3EYVB 4X5XA 2WXFA 3BKYL 5KTEL 3DURA 1XTMA 3A24A 2BVEA 3ZYJA 2MSPA 2NY1B 3OZLA 4G8FB 4Z7OB 2X2YA 2R9HC 4DUXA 1FZJB 2ITEA 3MNMA 3CSBA 3MRGB 4H7VA 4MRCA 5EU6E 5JYLA 1YEDB 2GAZB 5I5JA 3UOAB 3LZPA 3VD1A 3SE3C 4W9HC 1MPAL 2HX7A 2F15A 2Z64C 1KPUA 4BCXA 2LU3A 1SJEA 4WY7H 2F53A 4KY1L 1OOWA 3U9UA 5I73C 3MYJA 1BVLB 3UABA 5CLZA 2N7AA 3HG5A 4APXA 1AY1L 1HDMA 2AGJH 3C5ZC 3L1EA 4DK5A 2NXZC 3RNQB 2RR3A 5F1IA 4AK2A 2WZPD 3SE3A 2DRUA 3BGAA 3MRKB 2YAQA 4DGUA 1G6VK 3FL7A 4JPWL 4W9EC 3ULVE 1EFQA 1T2QH 3HRZC 4KJYA 5K59E 4OV6F 3STLA 4K5PA 2W92A 1ZE3H 2WNKA 2X6CA 4AGNA 4CVUA 4FKHA 4QXGH 4B27A 4FA6A 4PRPD 3C5ZA 1RUPL 3B9EA 1BXUA 3WE6B 1QR1A 4CMMB 4ES9A 1NDMA 5FPIA 2YD4A 1OARH 1M05A 3F7LA 4GXVH 4U1LA 5MEOB 3NZHL 1NFIA 4N2HA 3V6ZA 4PGZA 2EO9A 4LU5L 3ECUA 2X88A 5IT2H 3S35H 2ENPA 1WITA 4Z7VB 2F1EA 3W9EB 3FQXA 1PKQA 4PBVC 1MFAH 3FO1B 1N5AB 5K9OA 4R90H 2JQAA 3DO7B 1U41A 4JKMA 2R0WH 4F2MA 1TQBC 1NCCL 3HTLX 5F7LB 1E2VA 4BQ6A 2BFVL 2RA1A 4KKZA 4LSUH 2ITDA 5MP6H 4ISVA 3OXRA 3WLBA 3LQZB 1JD7A 3QCVH 4ZUSB 2C34A 4QAWA 3MBWB 2CPUA 4D9RD 3P73A 2BNRB 5JDJA 4JY4A 3WNIA 3LQAL 1KENH 5J13C 1TCRB 3PWPD 4GRLC 1KN4L 4HV8A 2OMZB 5T1LD 4NZTL 3OGCA 5I0XA 5KBDA 1GOFA 4JY6A 3RWEB 4KZDH 1MI5A 1IVTA 2ZOKB 3FFOA 5G55A 2BCMA 4TQEH 4MASA 1KTKE 3FQTA 1ETB1 2FDBP 5CSGA 3LIZH 3ZTJH 4XOCA 2WSPA 4JG9A 1W72A 2VDML 3O6MH 5A6IA 1L0QA 3O2VL 5LBSH 1FZJA 4Y0GA 1ZA6A 3FTGB 2H8PA 2Y2TA 3H56A 4GRLA 5C07B 2GAZA 1IGML 1YUKB 3BEWB 5BV7C 1TLKA 4G1MA 4N2FA 4GAAA 2XICA 4KO9A 5FX3A 1TR7A 2BNUA 2Q8BH 1OSPH 1U92A 3JUZA 4KHXH 5E1QA 5IQNA 3L3GB 3ATDA 2B1AL 4DEPC 3JV6A 4LCYB 3IWUA 2Z7ZA 1AGCA 4LHUB 1EEZB 4QRPB 4NRXA 4JPKL 3EUUA 3RNQA 3T3MB 3P9MA 2XTJE 2E27H 5F0LB 1VEPA 4NPYA 2WSDA 5CJQL 1EIBA 2HN7A 3QXWA 1SZNA 4L1TA 5DURB 4CA4A 4OLEA 4I0PD 2WJ5A 3ZKND 4PRIA 3GIZH 3T8XB 2OBGA 4OZ4B 4AZ8A 3FJTA 5IK3B 1P53A 5KSAD 2YRBA 3ARPA 4QAMB 5CP3H 1ID5I 3MZGB 4A63A 1QLFB 3DPBB 2BHYA 4FFYA 2ILLA 3NCFB 4LLUA 2XIBA 3PV6B 4CMMA 1JYWA 2XN9A 2P5WB 5GJSL 1MCRA 1SJMA 3GI9H 3UL4A 2J2ZB 4M3KB 4I3RL 1OW0C 3VXUB 3MUHL 2NXYC 2QSTA 2C5DC 3JYBA 2OL3B 3W9EA 4P5TB 3LZQA 4ZZFA 1I3GL 1LGVA 4UTAH 4JFFD 3EH5B 3IJSA 3FC8A 2VDPB 4LDCA 3BAEL 1NCJA 3JYCA 5CGYC 4XC3L 4F57L 3NFNA 3ARBC 1QVOB 2JJUA 4POZD 1TTGA 1FRGL 4G7YH 1DQML 1GPOH 5A7BA 5IEHB 3LPFA 3PUUA 1FSKB 2GJ6B 3U7WH 4LOUD 1JZDC 1OW0A 3GO1H 4M4RB 5ITBL 4XX1G 3K74B 5H35A 3VACA 1Y6NR 2HJKB 1OK0A 1SHWA 4IRZL 1YA5A 5LHDA 4EF3A 2X38A 5KVDH 3HB3D 3ARBA 4NNXA 3BT2L 1JK9A 2AJ3B 1IFHH 5B39B 3RWCB 1NEZB 3ZKMC 1N4XH 1FNSH 3UYRL 4UUJB 1RSYA 2XJKA