3ATBA

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 39
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3atbA00
3SYAA 3VSQA 1P7BA 3SPJA 5KUMA 2WLLB 2WLNA 2WLIA 3ATFA 4LP8A 1XL6A 3SYCA 1N9PA 2QKSA 3ATBA 2WLKA 3AGWA 4KFMA 3ATAA 2X6AA 3SPHA 3SYQA 2X6CA 2X6BA 2GIXA 3SYPA 2WLJA 3AUWB 3SPGA 3JYCA 2WLIB 1XL4A 5KUKA 3SYOA 3ATDA 2WLMA 3AT8A 3SPCA 1U4FA 3AT9A 3ATEA 2WLLA 2WLHA 1U4EA 2E4FA 3K6NA 3ZRSA 3SPIA
chains in the Genus database with same CATH superfamily
4XX1G 1AS6A 3BISA 2VR9A 4L4TB 1MVFA 3RX7A 4ZUSB 3L9EA 1Y07A 3M1BB 4V1DE 4Y16D 4YHLL 1RVFH 1MCHA 1ECYA 4S2SA 3WTTA 4LPYA 1D6VH 3CXDH 3KPOA 5GGUA 3RY5A 1BREA 4EOWH 3QEHB 2ENPA 1AY1H 3UTQA 2EC9U 3DX7B 1QFHA 2HWZH 1S9XA 4UV7L 1JNJA 3KW8A 2CDEB 4FI6A 1YLBB 1G0DA 3RAJH 1KTLB 1UTDA 3JV5A 5HPMB 3PGDB 4IK6A 3L1OH 2ORBH 4P2YA 4HZAA 3CVHH 3EUUA 3PGFL 4FZEL 2E9IA 4HSQA 1OV8A 4UT9L 3IDNB 1YMHB 3PWPD 3GD1C 1ICTA 2WO4A 3C5JB 1V55B 3EGXA 5E5MA 1DQLL 4O2CA 3U1QA 4A7GA 3NIFB 3ZYOA 2YFOA 3FCTB 3EH4B 4A2EA 1XF5A 4K4KA 5JA8B 3ARUA 4QOKB 3QS2A 3QJHB 1KJMB 4YXKH 3VFNA 2E9JA 2HG5A 3NCYP 2WBJB 4GINA 1XGRA 1MFVA 1KCKA 4RFNB 4WJG3 3GK8L 4M6OH 3EJJX 5K9JL 3C8KB 2GT9A 5DC9B 1E5CA 4YHML 2C3GA 3MLTB 4U7SA 5EBMB 3DJ9A 4GO9A 1J05A 2J5LC 2V5SA 3DX4A 3ISYA 3KS0J 4ZW3A 2GKIA 4PJEF 2R2BA 3CMGA 1IM9B 4DP8X 5IF0B 1UA3A 4JFZH 5DD1H 2EYSB 3DTXB 4WZ9A 1X5YA 2NW2A 3RTLA 3ULAB 2IVFC 1V3JA 3K2IA 4XCCH 3VMNA 4B0MB 1Z9SA 1DDHA 4U3XA 1JHTA 4QRPD 1MHEA 4UCFA 1YMME 1GIGL 3GJEA 1PDKB 4GQRA 1E40A 1RQ5A 4ZTOL 1C5DA 3QJOA 4XN7A 4YHIB 1JV2A 2GCYB 2Z7YA 4JDVA 2IPKB 3S48A 1BYPA 3D34A 4GMTL 3MV9A 1L9TA 3HC3L 5LGKA 5E1AB 1NBVL 1OLLA 1XGPA 3C6SA 4NPYA 3VD4A 1VKXA 1ORSB 5B38G 2ZUTA 3VWJD 1IUZA 4QHLA 3SE9H 4PRID 1HEJC 2EUWA 3P4MB 4TQPA 1MHHB 3SDCA 4IBWA 2WAHA 1DANT 3CCHA 1DN0B 3AZUA 3N41B 2APTA 4PG2C 3R18A 5C0AB 1NSNH 1UXLA 5H37G 3ZK0A 3BKJL 1HXMA 3QXVA 2NR6D 1V27A 4NNYA 4NC1C 3VFMB 5DT1L 1KN4L 3MUGB 1B4JL 1R24B 5SWSA 4FA6A 1O5DT 3FQTB 4PS8A 3HRZB 5AL8A 3RWDA 2W92A 1DVTA 1ZVYA 1P4BH 2VLKB 4HWZB 2FBJL 1I3UA 4PJHE 5MEND 4ZYKA 3VE0A 4NIKB 1TTUA 5IHLB 1AMXA 3VNYA 4CSTA 4CGUB 2F1EA 1UXSA 2DW5A 2YMXH 4B3EA 1U8KA 4OLVL 2YEZB 3HE7D 2IEPA 2PXYC 4DGYH 4U05A 3D85B 4D9QD 3VD9A 2CLZB 4P23A 5IEHB 1DSYA 3Q1SH 4M43H 4MXQD 3RDJA 3S5ZA 3BJ91 4I7ZC 4Z78B 2CR6A 3TESA 4PRPB 2V3FA 4ZS6D 1JXJA 1YG9A 5I1LA 3O6FB 3M46A 5GSVA 3HZKA 4YK4B 2X05A 4NN6C 1DVXA 4TUOA 1T4KB 3QUXD 2J71A 3R4DA 1NFDE 1A2YA 1I7TB 2UVEA 1D6EB 1V3KA 3MV8A 4ZMWA 1UB6B 2DDQL 3SY0B 1WSST 1KZYA 4R2GC 4U1LA 2PPCA 4M62H 3AWEA 4WV1B 4PU2A 4P5MA 3U9UB 4X98B 4PJIB 4LLDA 4JEGB 1F3RB 5LGHH 3ARDA 3UTTA 4XVSL 1ZTXL 2VZSA 4MJID 3BWZA 3H8NA 1NKRA 4AVJA 3ARGC 2WWOA 1MUJB 1UJ3C 4HWBA 4M48L 2N59A 3UGEA 4U1NA 3BKYL 5IK3B 5C0GB 1ZS2A 2I26N 4BFKA 4KJWD 2OYLA 1MPAL 4DGIL 1BD2B 1MJUH 4B27A 4ANWA 4PJ9D 4Y19B 3F7YA 4X4MA 3A21A 3HI1A 1SM3H 3O3UN 4P04A 1YPZB 5KYWB 2V8MA 3TV3L 5DJYB 3WFHB 1Q4NX 4V33A 1ETZA 5AZEL 1FIEA 2D0FA 4K3EL 1YY9D 4RBPK 1SXNA 1X5HA 1OSZB 4MD5B 4TVUA 3GSQB 5BV7L 5DDHB 3PL6B 2X0UA 1IE5A 4DK6A 1T5KA 4G7YH 4YWGL 2QQNL 2W9EL 3EO1B 2H8PA 3RPKA 2Y9RT 1HL5A 1H3GA 2NUTA 2AJUL 4U3HA 3HG2A 3NFNA 3E3QE 1HAUA 4I3RH 1GS7A 1W0WB 2NDFA 1SHXA 3OB0H 4KVNH 2GAZA 5M7QA 2HN7A 3H7BA 3MLSH 4UWQB 5MEOA 5FM4A 3VXRE 4XCYB 1TPXC 4Z7OB 3D3VA 2R1XA 1M9WA 1QACA 1FL5A 2V3DA 5IR1B 3BZ4A 3QHZH 1E6OH 3UMTA 3ARXA 3B34A 4H8QA 1INDL 4K8RH 1CI5A 3P2TA 3B9KB 3O41A 4HIXL 1OF2A 4KKCC 4X6DE 5I0DA 2P42B 2IWKA 4JHAH 4P9HL 1DQQA 3F6IA 5CEZD 3CHQA 3HZMA 3QZPA 3K5SA 3QRGL 2N1TE 1KYOK 1SVBA 5C09B 3DX8A 4IBVA 5EN2A 1BZOA 1JWSA 4HIHB 1UACL 2G3XA 4JQIH 1V54B 3KBEA 5GZOC 5EFIB 4ZMYA 3QH3A 1HU8A 4Y1AB 1MIEL 3QARA 4NI3A 4JZOB 2QT6A 4KDTA 3UADA 3L3JA 4H2CA 4XCEB 5LGJB 3CN1A 1XSIA 3FSOA 4OZIA 1SHSA 1DL7L 1TQTA 1M2VB 4NKDA 1EXHA 1BBJA 4CJ1A 4DZ8A 3DNKA 1VZGA 4LKCA 1JWUA 3GJFK 4F1SA 1ZDSA 2XI9A 4NQCB 4XNUH 2WIIA 1KCRH 4N9GB 4F7EA 2HJFB 5D7KE 1RK0A 3L08A 2VDPH 1HYRC 3AT8A 3BH4A 5L4MA 1UC6A 1IV8A 5HY9A 5CP3H 5KW9L 3GSXA 2J72A 5I1DB 5I9QB 1CGXA 2A6IB 3DBXA 3KBPA 3O3EB 3WSQH 4AQ1B 2WAQA 3H7LA 4FQIL 4XMUA 1SUJA 1J1OL 4LCWA 3DC0A 4Y2DB 2H45A 4LDLB 1XR9B 2XV3A 5E6IB 3NPZB 3QJTB 3P3TA 4HD9A 4PVMA 4LNRB 2WZPA 3T6ZA 3BDYL 3L7FA 2P44B 4NUGL 4ONFH 3TH4T 2C9QA 2Y06L 1MCQA 2D0HA 2VAJA 2ADIA 1MEXH 3HOGA 4YBQC 3T5WA 2WQ8A 2RFXA 2W07B 3Q05A 3UTPE 2VW4A 4XVJL 3L7EA 1AHWA 3MR9B 4QXUL 5D70H 5FWRA 1T83A 5B39G 1I7ZA 4NQEB 4DEUA 4PG9B 1A6ZB 3U6RA 1Z3RA 1X3DA 4OCMC 1LEIB 3CSFA 1R5WB 2ADYA 5D1QD 3SOBH 2EH8L 1AGCB 4Q9CA 1DE4B 5D1ZC 4U6HA 2C3WA 4FN0A 2E47A 3L5WB 4NRZB 5D7SH 2RCSL 3ECUA 5HSFA 4JQIA 2YN3A 4MTMA 3SDXE 1JYVA 3K7UA 1OAXH 3P77B 4PS4L 2NXYB 4MNQD 1H6EA 1FZKA 3SKMA 4NT6B 1O7DE 1TFPA 3ZTJH 4ELMA 5E6UB 5AOMA 5KYYA 1U42A 2FJHB 5PCYA 5AVTB 4ZFFA 4NBZB 5CBEB 1KLUA 3BZ5A 1RFDH 4HJ0D 1PD1A 1XIWD 1J5DA 2NY5L 4LSQL 3PNWA 5DD3L 1LNUB 5I30L 1CFQB 2J4WH 4P2OB 5JPNA 1GCYA 2V17H 2B77A 5H94A 1TSHA 2CMRL 1P5UB 3S35L 2KLRA 3KM2A 4KV5E 1T20B 1FO0H 3TCLB 1EMTL 1D5RA 2WXNA 3LRMA 1S7VA 1ZHNB 3QDGA 3WE1A 2NMSA 2G0KA 5T5FA 3WS3B 2QKIC 4XNQA 5C0BE 1YN7B 3GZKA 4N86A 1X5ZA 1U41A 3WYRA 5KN5A 1YECL 4QRFA 4FTDA 2YXVA 3ESOA 4K8RC 1RMFL 1A6VH 2DQEH 3I02A 1N59A 4J3OF 3AWGA 4CVZA 2WIMA 3O8XD 2Q86B 3UJTL 5L2JA 5EG6C 1JHLH 2I07B 4G8IA 1N64H 3IDJB 3ZBMA 5EF3A 5EO1A 4E42A 2HKFH 3W82A 3BJLA 4AL8L 3HN8A 2E9WA 3KWWB 1TJHL 4PFEA 4MCZB 2XT1B 5HD8D 3SGEI 2ZONA 2Z9TA 4ES8A 2C26A 3ZE0E 3MZGB 1J0YA 4JFFD 4E2OA 3WFBL 2FATL 3PJSB 2CO7B 4G5AA 4TPRL 2VB5A 1CN4A 4R97B 4Q4IA 3NH7H 3T0VA 2XFXB 1BG9A 3ILQC 3NYKA 3ROOB 4HUMB 2JIXD 5HHPB 1HILB 3FUJA 3O2DL 1I3GH 3B8SA 2IXQB 4LHJB 4PLKD 3UEQA 4K3HA 3ZGIA 1DJZA 2VISA 2AFNA 2YD8A 4JRYD 3ZQ9A 4JRXB 2EXYC 4PV8A 3TTYA 3B5HA 4PWKA 4NLAA 1ID5I 3RVXD 1T22B 2OV0A 3RZCB 1TJGL 5J56B 1E9QB 1VEPA 1QW8A 2A5UA 3KL5A 5FFGA 1GC1L 3X11A 5AYQA 4M7ZB 3CFCL 3WLWC 2UY6B 3H42H 4M02A 5AVUB 3S34L 4FZ8L 4HCRH 3U9PL 5CJXA 1AXIB 3BAEH 5D5MA 1V7NL 3WIIL 3ZHNA 5B3JF 3PHOB 2GSGB 1MWAA 2WINB 3LY6A 1HDMB 4ZJ9A 1FLRH 4N85A 4Z9KB 2AZUA 1OCWL 5IVZB 3MLUL 3Q8AA 4RAVB 4NQTA 1MCKA 3G7TA 4GRWE 1UT2A 2H32A 4KI5D 2VXQH 2NXZD 2XG5B 3ETBJ 5IQOA 2VDKL 4AYSA 1T1XB 2DJUA 1MFEH 4G1MA 4KK9C 2Y25A 5JUEH 4LARH 3BD5A 5DJ8A 5IQ7L 4S0TD 3MRJB 1I8IB 3V0AC 4RISH 5ADPH 2KLSA 5TDPA 2UYLA 2BLFA 4MA7H 4GG6A 1QQDB 3J8F7 3WG7B 2M1KA 1KBPA 1NL0L 2OXGA 2WBXA 3MNWA 5BJTA 4E0RB 4D9RE 1U8CB 2NX5A 2IAMA 3LEVH 3OHXA 1WWAX 2BVOB 3KGSA 1OALA 5C6PB 5CO1A 3NJHA 4NRXB 5BRZE 1EEZA 3FOLA 1MRCL 2NY1B 5GS0L 1E5BA 3IAQA 3KPRD 4OZFB 5JW4M 3G08A 3ZKMD 4NO5A 1JBJA 5FDWA 4KK8D 1TVHB 2C1OB 4QRRE 1EFXD 1PEZA 3QO0B 4M9PA 1OP5H 2NSXA 3QIBA 4BZ2L 3TLRA 4GRLB 3KLQA 1NMAH 2AJVL 4TQ8A 1PLBA 1ZSDA 4FS0A 4G7VH 2PPFA 2XV0A 3U1PA 2BMKA 4XO9A 3EGDA 1CFNA 3DYOA 1CDYA 2HJLB 3PQYA 1ASOA 1XCWA 2AQSA 4G80A 4GAYB 4XO3A 2B59B 4W9IC 2EVHA 5DSCA 3CUPB 2YEQA 1AQKH 1U8HA 4HWEH 2D31B 3L5XL 3QDAA 4LL9A 2HH0L 3GXMA 2YGVA 43C9A 2VDLB 1JPGB 3FF7A 3HVNA 1EXUB 2PW1B 4U49A 3O0RH 3VRLF 5JIQA 5ILTL 3N9GH 3B2DC 3EOBB 1RZGA 1OAZH 3DA0A 4W4OC 1CG9A 5HDBE 4F33A 4G7RB 5JOPE 1FZMA 3O81A 5DJ0B 3CSGA 1C9SA 3ULUL 1T21A 1UB5A 2J3SA 2VWEE 3E1F1 2WQXA 3FZUC 1RUKL 2W95A 1H5BA 3IXAA 4HEME 5LAXA 1SXZA 2JI2A 4MA1C 4J3OH 1QLRB 4CA4A 4PP1D 3NIGB 5F3FA 3BIBX 1Q0XH 1YRKA 2BZ7A 2VXQA 4HX1B 4O2EA 5KVGE 1EEQA 4ABWA 3G6JE 3ZMRA 4JK0D 1JPEA 2R15A 4X9BA 1LP9F 3ZUNC 3DUSB 1M3IA 3EFFA 4Z3EA 2EKSB 3IFNH 3D69B 1DBKH 1RSFA 5I73B 3F2LA 4FYRA 1JK9B 2R39A 4W9GC 1YNTB 3LPPA 4MNGB 2IDCA 1NGZB 1RUAH 4PRHA 4QTHA 3VFOA 4BFRA 1FGNH 2F53A 3FU7A 2FO1A 4LASL 1BGXH 4JHVA 4AYFB 2FK9A 4XMLL 1WWWX 1JDCA 4PJBB 4Z5RA 3BVVA 3WNPA 2V37A 4YFLI 4R7DB 1M3JA 1OARH 4KK6C 4QOKE 5DUMH 2E7BA 3B2PA 4FFVD 1G7IA 1HNGA 3ABKB 4PJ5D 5FV1L 4CSPA 4H25B 3S36H 1NDGB 2VQ4A 1IX2A 3JVFC 1AR1B 7PCYA 4H20L 3QJQB 4WLCA 3N55A 5DHXB 5EPMA 4HJIA 3BPLB 4MASA 3QI9B 3ZDXB 1IBDA 1T03L 5GISL 4PJCE 1IT9L 5JDSA 4WWKC 4UT6H 1PD6A 1WZ1H 2YA0A 4QGTA 4W6WB 2WZ0A 4PJDE 3MXWH 5B38B 2RBLA 5ENWB 1TR7A 1RULH 4QXVA 3JV4B 1H0DB 2YOCA 4PJ7B 4HF5H 4UT7H 2GB2A 2A99A 3H9SB 1ACZA 2W0FA 2OQJB 5T3XL 1VRSA 5T5NG 1TZIB 3EYVB 4YSQA 1RZIA 5L88L 3Q44A 3JV6B 2PO6C 4DOHE 1AXTH 5E8OA 3PG2A 4O02H 1L9OA 4WFGD 3FB8A 4LDCA 5EBLB 1WCBA 5IQLA 5I1JL 1ZTMA 4U1SA 2PCPB 4BZ1L 4D9LL 5ID0B 2C9UA 3GWJA 4KU1A 4X7FC 5IHZA 5L9DH 3DVGB 3FQUA 2BOBB 2BRRH 2BSTB 4WU7B 3UH8A 1VIWA 4BDVB 2DM4A 4U1IB 3L9YA 2R2EA 2DQUH 3CLFL 4RSVA 3EH1A 1JZ4A 4ZFZA 3WGVB 5AEAA 3QZOA 1XD1A 5AAWC 2PMZA 5KVDL 4Q2ZB 1XSKA 2BHZA 2VLKE 4NO0D 4KMQA 2XWCA 3PWJA 3AAZA 4GW4A 4KX7A 4JO4L 5E2TH 5GRVL 3ARBC 2CRZA 3AS0A 4Q14A 1NGQL 4PS3A 3FJTA 5CLWA 4GQZA 3FOMB 3QJFA 4N0FB 4BYHA 2WYIA 1YYCA 3JVGA 3IMUA 3T6QC 2BP0A 5FPIA 3S3PA 4G42B 4MLSA 3EFOA 5IW6B 3IKCA 1MI5A 1T1ZB 3BFWA 5IZ7A 5EU3A 1GGBL 1XCQA 2IOOA 2NY0C 2QPEB 4LSVH 4M4RB 4OAWA 4QXGH 1QRND 3WFEL 2Q8BH 4NNXB 2R1WB 3CHRA 1S9VB 1T1YB 3JWDL 1CCZA 1FORH 3PU7A 4HAFA 4ANVA 4N2MA 1H19A 3REWB 1TTBA 1AGFA 1SLXA 3OQRA 4OZGA 4PW3A 1B88A 4LLUB 2B7DT 5E1GA 1MIMH 1IBZA 1NCWL 3MV7B 3P3SA 3O9WD 3SGJC 2EC9T 1BBDL 3IMWA 3QORB 4OM1H 3BP5A 4U6VL 3OXRA 1H3TA 1MG3C 2O4EA 3NJMA 5CZRA 3G5YA 1HYSC 1G9NH 1JZDC 5EO0A 2ZZUT 2ISDA 3WTUA 4HULB 1KJ2L 2FJFA 4XMKH 4BE6A 2AV1B 2WSKA 3N2JA 1RZKH 2NYYD 5I74B 4DUXA 5C9JA 1FFOB 1AZRA 4PMEA 4DN4L 2Z31D 1KCVL 1P5VA 2R2HB 4I0CC 3BVNA 4ZRGA 5KVFL 3HG5A 5C0CD 2BPBA 5E8DH 1SHWA 3CDZB 3NIDB 4W9EC 5FX3A 4KVPA 2AXWA 2DMCA 1YPZE 2N3JA 2Z6FA 3BAKA 3D2UA 3L3KB 5GHWL 2F7OA 1TZGH 3DPBB 3OKEA 1FL6A 1NFIB 3Q6FA 4X42A 2Y3NA 1PYWA 5AOKA 2UX6A 1W9XA 3T1FA 3U1SL 2I32A 5EUKB 4A6YB 4B9CA 4D0DA 4JQVC 2J7LA 2OI9C 1CGYA 4N5UA 5DXWA 5ESAB 1T3FB 4MS8C 2O93L 3ZTNL 3QZWA 2VZ3A 4JQXA 1M6OB 4ZXBD 3TGXA 1HE8A 1T2QL 1UZ8A 3FK3A 5BCAA 5IJVB 1SYSA 3U4BH 2XXMB 4B5EA 2BVYA 2HRHA 1N8ZA 3PV6B 1RPUA 5K5YA 4OTXH 3FT3B 4UTBH 4WTZG 2PWFA 4LLAA 4N90D 4QHUA 5BMFH 1EJOH 3LRGA 4JLRA 2C4FU 1SJHA 1AIFB 1OP3K 4AITA 5I76A 1NJ9B 2WNKA 3DX9B 3OXSA 3C6LC 4FFWD 2FT7A 2ZXGA 5K69A 4S0HA 1OHQA 1GAFH 1U6AL 5BS0D 4YHNA 1ONQB 5LVEA 3L4XA 3ZL4L 4P3CH 4XP1L 3MLYL 1PNDA 1XGQA 3R7QA 1CK0H 1GY1A 4G7SB 5IV2B 1BM7A 3E8VA 1JJUA 3BPNC 3DV4A 4K7PX 1S7RB 3QYNA 3VQ2C 3AQXA 2ITDA 5IOPB 4F20A 1W0YT 1AS8A 3F65A 4F7PA 5FM8A 1DQML 5KG9A 2YPVA 2NRDA 4PTTB 2X4RB 2IBZY 3WXVH 4QY8A 3STLB 5F7UA 4KTDH 3MRQA 3QUGA 4ORZC 1CWVA 2QZQA 5HXMA 1OIOA 2OR8A 3DOHA 3FO2B 1PZSA 3V0JA 3V95A 5LBVA 4Q52A 4NQXB 1GRWA 1ZGLP 1UCBH 4JDZA 2N0KA 5DJDA 4J3SA 2F2HA 2OCFD 3SB3A 1F6FB 4E9QA 5IJDC 3MROB 4UIMB 4XH2B 1MRDH 3V6OE 5BO1H 1S5HB 4POZD 3RWEA 4IEFA 2Z93B 4HJ1A 2YKLH 1J8SA 1AKJB 2H2SD 2BC4B 4IRJD 4MRBA 3V0VA 4Z1PA 3ZPDA 3CFBA 5E70A 5HVFB 4UINH 2P7TA 2TRHA 3DUHA 3KHOA 4WHDA 3BGMA 2OJZL 2NSQA 3TO4C 2HSIA 3T6VA 2O30A 2F54D 4PB0H 4R7VA 4Y4KD 5JHDD 2LAAA 2Y1VA 4EI5C 2H26B 1KGCD 2MNWA 3RB5A 4NC0B 3VFTB 3FDWA 1A6TB 4MAYB 3NEXA 4U1HA 2V2TA 3S97C 5B39B 5FHBL 3TZVA 4ZNEA 4LU5H 2J1KA 3DGGB 5BQDA 3GSNA 3QIUB 3TJHC 4CN6A 3S8WA 3C6EA 3QEQA 5F3HB 3D7PA 3VH8A 2VDRH 2X40A 4NQEE 3T3MF 3J27A 2EVFA 3MMEB 2CD0A 3HMXL 2Q6WA 2CO6B 1ZLUK 5MERA 1NGYA 5C97A 4JVPA 4WW2A 4PW9A 5CN1A 1KGUA 4ELME 4JREB 1NC2A 2WKOA 3KPQA 5DMKB 1DFXA 2ZT9C 2IPTH 4GQ9H 4BKTC 4D0CA 2YQ3A 3ARRA 5E56A 3L4CA 3H6AA 1QTSA 3GKWH 4W9FC 4YEFA 3TF7C 4P4KA 4BA0A 3OGCA 2VITB 1N3NB 5D7IE 1GHFH 4UTAL 1NPUA 3TPUA 3DSFH 4Q0XH 4WGWB 4YBLB 4FLRA 4WUKH 2OKMA 2AAVA 1F3JB 4N6RB 4M1CD 4OZHF 3P3RA 2VMEA 1RJLB 2AMGA 3VSUA 4Y2LA 1HZKA 1A7QH 1XL4A 1CFSB 1X4XA 2A9CA 1KTCA 3ECVA 5ABDE 1BFOB 4XPBL 4K7FA 4TNEA 1VEMA 4IQHA 4YBHA 4AMXA 1K5NB 4TVPE 5BZZA 4JNXA 5FO7A 1KFAH 4ZO9A 1ZV5A 2OMBA 3EHBD 3KJ6L 4AXWB 4DN3L 2I24N 1MFCL 2XX0A 4GOSA 3RNKA 4F57H 2VZ1A 5C0NC 4BRVA 4CBPA 3CFDA 1U3HB 4LVOB 4OJFL 5D1XA 3BC9A 4HWNA 3P0YH 4LOEA 3H9ZA 3VFSA 4FKEA 3RPBA 3B9VA 3FTUA 1C1EL 5GPRA 1L5GA 2XVBA 3SZKC 2X3AA 3GTTA 3II3A 2OZ4L 2AGJH 3P11H 3NMEA 5FYLL 4F5CE 1KY6A 4FJZA 2B9AA 4FQXB 5CP7A 3ZSTA 3LSOB 3K2KA 4KVCH 4KXZI 3IDXL 2ENSA 4FKHA 3UDWC 4DO6A 3MCKA 3BQUC 2KT6A 1YHPA 3GBMH 2A9DA 2GITA 3C75A 4P4RA 4UU9A 1D5ZB 1X9UA 4X4XB 3ZDZE 3N0AA 4OI7A 1KTRL 4Y16C 3AUWB 3NJJA 2QPUA 3L17A 1WT5C 2Y22A 1A1OA 1OQOA 2CBTA 5IIEB 2YPLD 4WUUD 3OZ9L 2FHCA 4GMSH 3PDOB 4IHBA 2PYEE 4WU5A 3RWHA 3C60D 4D94A 2XQBH 2NNXA 2VIRB 3O11B 3SYAA 4RAUB 3FUHA 3QS3A 4JRXE 4ZNCD 2X4SB 2ADFL 5T3ZH 5FGCB 4JDEA 3CD4A 4L4TD 1RU9H 2MEJB 1NCUA 5FS5A 2OCCB 3MJGX 4HQQL 2LQRA 2CBQA 3EOAA 5DJZA 1VFMA 4GP8B 2RD0A 3F04A 1GW6A 2R0WH 1WYJA 1X7TA 2DWDA 5DJCA 4CRPA 4HC1H 2K8QA 5DURB 4JGJA 5C3TA 3DMMA 1JUFB 3TXAA 5B1JA 2F8IA 4YXLL 2H6UA 3RBGA 3RBSA 4D3CL 1K8DA 3WL9B 3PXHA 4MD0A 3EBHA 2NDGA 1E28B 3V6ZA 3MYZA 3PXLA 1S5IH 2A1WH 5L8KB 2HCZX 4B60A 4G6FB 4KY1H 3WO4B 2ID5A 1Y18A 2OMXA 2I60L 5T1KD 3LZRA 4TNWK 1OWWA 1JRHH 2I25N 1R3HB 2APWA 2WBJD 5K1JA 3RFZB 4LBEB 4HUKB 2Y07H 2VQ1B 3OV6A 4J8QA 1MAKA 1WEJL 1U8PA 3WD5L 4ZFOA 5LDSA 3LH2H 5J11C 1NFKA 4UQAA 2H0PA 3ZHKA 3HG1D 4G1EB 3VWJC 3P0VH 4I18B 1HX0A 4HHGA 2HX9A 1IKNA 4J28A 4CADB 5GGTH 2DOCA 3UAEA 3V52L 3EG9B 2WOYA 1EIBA 4MQTB 5E6ZA 3VG9C 5FECB 3VXPA 5IMKB 1KEGH 2EDFA 2FGWL 3MOBL 5F0JB 2XWTA 2B4CL 1MSPA 3GSOB 3HNTH 2NR6C 3K2UL 3O6MH 5CEZH 2WLYA 2WYHA 2A77L 3OLGA 4PJ6A 4UMSA 4YSDA 1WWCA 5DC2A 3RGVB 3U30B 2CQVA 3LH8A 1RZJL 4AGLA 3LHAA 1CDHA 1T7WA 4A7VA 2XA8H 1DBAH 1WISA 5ADOL 1K4DA 4GB9A 4KKBD 4EDXA 4EF3A 1D5IL 2CM6A 3OKDA 2FWSA 4ORGA 5GS0D 5JLZB 4OCLC 3KYMB 2IOMA 4YSOA 4BV1A 1AZNA 2NW3A 3LB6C 1GTFA 4APQB 4HJEA 3RVTD 4LMQI 5C0AD 1JZGA 4P57A 4BFEA 4X5WA 3U82B 5I0YA 3HE7C 3FPYA 2LTQB 4ZMTA 4Y89A 2XWRA 3FN3A 3UL4A 1UM5L 1B0RB 2J88L 4ZMNA 1BAFL 4MXQC 1QR1B 2VLRE 5F7AA 2SEBA 2A9NL 4ZS6C 4D0BB 4O4YH 1N7MH 1G7LA 2VUYA 5AOIA 1LK3L 4HIPA 4MZ3A 4XX1E 3KWTA 3S0PA 1A4BA 4YN3A 3VB8A 1CXIA 5E95B 5BQ7A 2P48B 3ZTJG 3FTYA 3MREA 3QUXC 4G59C 3TT3H 4Y5XC 5EZOL 3QG7H 3KLAB 4QNPE 3IDIB 2BCMA 3K0WA 4KI5F 5FFOA 4UOQA 3ZX1A 5D72L 2XXGA 2XZQH 4PRHE 1E9PA 3D85D 1KXQE 3NIGE 4PJGE 4PHZA 5KS9A 4L18A 1MAML 1GGCL 4ISVA 2IDSA 4HKBB 4N2CA 2GBUA 3HVDA 4PRPD 3TYFA 2CA3A 2JSFA 4EZJA 4CMMB 2FTAA 4PH8A 3Q6GH 3ULUD 4YHPB 3INUH 3GLDA 5DZAA 1YYLL 1S9YB 1BJ1J 3WJJC 1N70A 1N0LB 1P6WA 3WNJA 2X4QB 4XP9H 2DWSA 4JO1H 4MNGE 3E8UL 4GUQA 3Q9QA 1TQCB 1A22B 1SY6L 1ZEAH 4JVWA 4KJWC 3M7OA 2B08A 3MRGA 1Q9LB 1JWMA 2VRQA 4KHXH 1KOAA 4PJ9C 4PJBE 1NA8A 4RMBA 1R0AL 1O5PA 3P3UA 5DUBB 1F1AA 5KBKA 4QHKI 5JA9A 4TSAH 5HJBA 3T2PA 5EZLA 1V7ML 2AJYL 4LSDA 3ETTA 3U2IA 1G7MB 5IFHL 3CNKA 1YY9C 5DVPA 2QHLA 1HH6A 4KHTH 1VADB 3WN5A 2XV6B 4L37A 4A6YL 1J9CT 4ODWA 1MF2H 1XF2A 1JD7A 4LAQL 4XN8A 5DRWB 2WXRA 5HDQL 5E9AA 3PS6A 5HHMD 5F3BB 2L7EA 3CBRA 2LV4A 1BD2D 1FFNB 3SDAA 4OJYA 3VI3A 4Y19D 4ERSH 5I6XC 5CR8A 4CUCA 1HSAB 1RP8A 1T0NA 1U30A 2WNWA 2H1XA 3ABLB 3LNFA 4LF3A 4BSVA 4EXKA 3MBXL 5E5RB 4FADA 5IB5B 3Q3GA 3L3IB 5FLUA 3VFGL 5GJSL 1UQSB 2BHYA 2BNQA 3BLBA 1BFTA 2MOGA 1OAYL 1U8QB 3UBXA 4IKNA 3CG8A 4X7DC 3VWKB 1HQRA 3HMWH 3X1NA 5I8OH 2YQ2A 1ZLVK 1FFQA 1INQA 1AACA 1MCEA 2X4UB 3PL6D 3VG0H 4CMHC 1JF1B 3VJ6B 1XAKA 3U2SA 3SDYH 2QFRA 1IIKA 4JFVA 4MB5A 1L0QA 3HFMH 1P0SE 4X8JB 2IGTA 1WWBX 3WTXA 5ABAA 2CXGA 1G6VK 1MCOL 2P5EA 4K2UH 2AEWA 2VLJD 3MACH 3UTQB 5B7FA 1A3ZA 2XZAH 1S9XB 5EOQL 3QYMA 5JORB 1K5WA 4IGBB 4PBDA 2BX5A 3WTYA 4QJ5B 5DRZA 1HQ4A 2GIMA 1GSKA 5JHLL 4I9WD 1ACYL 2KERA 4IW4C 2BJMH 2VAAB 5A3ID 1FNGA 2B1AL 5E94A 5EBGA 4TQIA 5DTFA 4OKVB 2A74B 4OZGE 1Z9MA 3FQNB 1UM6L 1LDPH 2LFGA 2VNCA 3EJZD 3NCYS 2DQHL 4QAWA 2K9UA 5FGSA 3CDYA 5GJTH 5C09D 3V5HA 3VFNB 2HG5B 4DP9X 3Q9PA 3WN5B 1U21A 3DLQR 4Y1AD 3U4AA 5L6YH 1F45A 3BSGA 4HUXA 2AJXL 1A3RL 4LQ1A 4WI8A 5E0FA 4DK3A 5J7CC 1UM4L 4F58H 1MY7A 5CZVH 3T04D 1F4AA 1ZK9A 2FWOB 4GIOA 5E00A 2EP6A 1HHKB 1EAOA 4OB5L 4AI7A 2G4EA 2BY2A 5FW7A 3HB3B 4CW1B 2Y6TE 2R0ZH 1TJIL 4U6YB 2VR5A 4NQCD 2BP8A 3ULVE 2EEDA 1S7TA 1MQKL 1JHTB 1CL7L 5LQBL 5H4YA 1JZHA 4D2NA 3SKNB 4O51A 4UM9B 2YC1A 1JV2B 3BSHA 3F58H 4FLSA 4JDVB 3OMZA 3IWVA 5EU6A 1Y6KR 3C6SB 1XGPB 4E5XA 4IRZL 2Z7ZA 4YDNA 1WAAA 4QHLB 1BYOA 4Y2DD 4YXHH 1LWHA 4AUYA 1E4XL 3D48R 5E6ID 5EEUA 4Z7NB 4R96A 4K9JA 2H3NB 1Z7JA 4P46C 3SKOA 1IM3B 2K6ZA 2ICWB 5B1AB 4YFEA 1B0GA 3WIHL 4H8VA 3DVFA 3G5ZA 5D1QC 5C0RL 4NNYB 4KTEH 4J3XA 2E7HA 3G5WA 5SWSB 5JXAH 3GHBH 1M7IA 5DYFA 4KH9A 2CDGB 2APVA 3RWDB 1IAIM 5L2KA 3QQ4A 2CRMA 4JMXA 4J3OG 3ARGB 3P0GB 4ZI8A 1N10A 2HFGL 5CAYB 1UJ3B 4AT6B 2BNRE 2R8SL 1PKQA 1CUOA 1YNKL 1KCBA 1S9WA 3EYOA 4J3BA 5C6TH 4AW4A 2NY3C 3WFDH 2HVJA 1M4KA 2VR6A 1AO7A 2N0MA 1ZLEA 2EINB 2H1PH 4M61B 1U8KB 1FRGL 2GK0A 2FWUA 2X4PA 4OCRL 3T0BA 3PLYA 2B2XH 1EAJA 1WBZA 2OK0L 2RH0A 1NAMA 1QO3A 3FFCB 3CLEH 1NDTA 1YEFH 3CVIL 4HJ0C 3RWCA 3BHBB 1ULVA 2QSCL 1A25A 4UYPA 5MEPA 1ES0A 5GSVB 1KLGA 2Z0BA 4WTQA 3STZA 4BFIA 2WTRA 1F97A 1NBZA 1PQZA 3HS0B 4F7MA 3MDJA 4OLYL 2HTLD 3NK4A 3NT0A 4X99A 4L9DA 1FZJA 1JD9A 3UZEC 2K78A 2EADA 1EGJH 2NXYD 4EI6B 2VMDA 4AC2A 4CVXA 3MV8B 1WFIA 5EIIG 1U9KA 3LH9A 4GQPH 4U1LB 1P7QB 3QFJA 3IMSA 4IU2A 4MJJA 4TQEL 3QWRA 2FYYA 3O8XC 5DJ6B 5K9QG 3LZQA 1NC4B 1NCIA 3ZDYB 4PJ8A 3JBG7 3UTTB 1IEBB 1BJ8A 3NP3A 3O4OC 4LSTH 5EU5A 5M95B 4KK5D 1R5IA 4X6FA 3AU1A 4FJYA 2YQBA 5TE7H 1OTUD 3SEPA 3ARFB 5CIPA 3GPEA 4U1NB 4Y4HD 1A6WH 3O2VH 1IB5A 4Y1SA 3BCDA 4EUPH 4HH9A 4OZ4B 5HD8C 4YS4A 2IBZX 3OAZK 2NT0A 1JXGA 2DY2A 2DEYX 4PB9L 2NT1A 3TIEB 3HI1B 3F83A 1N18A 3PAYA 1KTBA 3O0LA 4I77L 4JE0A 2IQAA 4RA0C 3PP3H 5K1NA 4UANA 4XHJD 3O6LH 5LGYA 1JTTA 3T8VA 2C3XA 4PP2B 4PLKC 2Z91B 1YEGL 4G2AA 3S3SA 3M6DA 2QEJA 4HLEA 3US1A 3QAQA 1E43A 4YHLH 1A47A 3X3GL 1UG9A 2R83A 4GKNA 4HDIA 3RVXC 1K72A 3QAZC 4NSKB 2D7NA 2ZCZA 4M5SA 1JV5A 2P5WE 2H8PB 4UAOC 3QNYA 2EKJA 4UV7H 1PU0A 3QZWG 4DERA 1PIFA 4JM4H 2DICA 3FO1B 4ONOA 3ZE1F 3NFNB 2G3MA 2FX8L 1G94A 2J57A 3HAEH 5GZOA 1F6AA 2GAZB 5MEOB 2HN7B 4KZEL 1KIPA 2EE9A 4FZEH 1X5LA 3PGFH 4YMPA 5KJRL 2JE8A 4JS7A 3RVVD 1DCLA 5KWYC 3D3VB 4UT9H 4HALA 2JJSA 2JQMA 3SBQA 1FL5B 1H3PL 3BZ4B 1DQLH 1P1ZA 1PNCA 4WFED 1HI6A 3LXBA 2YBRA 3SCMB 4L3ED 2YD5A 2NXZC 5FUCC 3MA9L 2CE6A 3INOA 3T0EB 4GIPD 4YHZL 1CLZL 4AVIA 5K9JH 3GK8H 1OF2B 3RGBA 4I89A 4YHMH 2X4OA 2BRQA 1FVCA 3IS1X 4G8GD 4PLJC 2QADC 4Z6AT 4L8SC 3LKOB 1TJXA 2QLYA 3DX8B 4H44C 3QUYD 4HG4J 1JWSB 5ID1B 2X9YA 1JZ6A 4HHAA 3QH3B 5F44A 1JE6A 2CCVA 1JP5A 5BVJA 4NAJA 4Z3IA 4PGBA 3S3JA 1BOGB 3L3JB 4JMNA 4LAJH 3UYPA 1MCRA 1GIGH 5BOJA 4ZTOH 4NKDB 3I6KB 4KKZA 1BBJB 3TVMB 4IBQA 3TBSB 1ZV2A 3ZKMC 2VLMD 1NLBH 4KK8C 4GMTH 5EOTA 4AKPA 3HC3H 1NBVH 3V2AR 4U1JB 4YGVA 3UG3A 5FA3B 4F7EB 2IMNA 2K4AA 3KPLB 1U2HA 1RK0B 3QA3A 3U7AA 5JYLA 1AQMA 2X89A 4XNMA 3LVTA 5HY9B 3GSXB 3C2SA 4FRWA 2XN0A 3DBXB 3IDMA 3ZZ1A 5D1ZB 2VRKA 2Y1ZA 2X53A 1E50A 3BKJH 1OGTA 4LCWB 2AJSL 1R3KA 2NY1D 5E1QA 3NRPA 4WI6A 4OJAA 4Q74A 5DT1H 1KN4H 4P2QA 1B4JH 5JDJA 1PG7L 4QRTA 3JWNH 2KKQA 3OR7B 5FUOL 5EB9A 5JIMA 5INDA 3L7FB 5I1IL 3D05A 1TU2B 1U92B 2FBJH 2WKGA 3LNEA 3D0LA 3D1MC 3APFA 4L4VE 1MFMA 4X7TA 3ZKXB 1OTTD 2MH4A 1I3RA 4U1GB 4N3UA 4X5LA 4YL4A 3DROB 4GXFA 4WHYH 5F9AC 3U48A 1ILUA 2RFXB 4EIUA 2R29A 4PBXA 1TCRA 1XF4B 2YGOA 3V4VA 4J2XA 2D9QB 3QUZB 4PJEB 1AHWB 2IPUG 2QKIB 4YHYB 4EN3A 1WK0A 2L4OA 1B4TA 1F1GA 3B56A 4PP1C 2WSDA 3IJSA 1HCFX 3QUMA 5EORL 3D30A 1OM3L 5C7XL 3ATEA 5IY5B 4Q8BA 1QFPA 3L9RA 3RJQB 3PDDA 2WZ5A 4NQUA 1M7XA 2P52A 1VFOA 2WGNB 3QZNA 3R06A 3MU3A 3V9CA 2H0JA 1U58A 1E4WL 3B43A 5TE4L 2GUYA 2KDYA 4WENB 2V9UA 2P5PA 2ZSVB 1U8NB 3AM8C 2DKMA 1N2RB 5DJAA 5ERWA 4QJ3B 4NUJA 3SKMB 4XVSH 1SDDA 1VHPA 1ZTXH 3PGCA 3H2QA 4A67A 1CGVA 5AOZA 4BGDA 4M48H 3VXUD 4BWTA 4ZFFB 3BKYH 1T1WB 4MLIA 5T1LB 3ECQA 4GBXB 4U1MA 5F9WC 5JPNB 2AQ3A 3ZO9A 5I66B 3VI4A 4G83A 2Z65C 2E8ZA 4OLWL 3K1KC 2VDPB 1MPAH 4DGIH 3NN8A 1UOVA 3QDGB 1M7DA 1CDGA 3PF2A 4IMKC 5ACMA 2G2PA 1AE6L 4G6KL 3TV3H 4PGEA 4JFOA 5I2IA 5KN5B 3E6HB 5F21B 5AZEH 5DS2A 4K3EH 4U0RC 3I02B 2Q76A 3GS4A 1RK1A 5L2JB 1JPFA 3L1GA 4OM0L 5KSVB 1F3DH 3ALWA 1ZOXA 5BV7H 1WV7T 2VXSL 4R0LA 1WH0A 3VFPA 3O4LE 1N6QL 1I9EA 3GJFA 4PRNB 1MLBA 1Q90A 2BVEA 1PG7W 2X7LA 4B5ZA 3NCEB 4YWGH 2QQNH 1AR1D 2W9EH 3GSUB 2I9TA 4MMZB 4PCYA 1A8JH 3W0WD 5BPPA 3QI9D 3EIFA 4QLWA 2AJUH 1A7PL 4E9TA 3N44F 2EYRA 7TAAA 2G5RA 4FXGC 2LOEA 3GINA 5GGQL 4DP6X 1KT2A 1FDLL 3S98A 3E3QC 5F0PB 2YR3A 3RTQC 2YZ1A 4Y8AA 1DUYB 5J6GA 4HMEA 3H9SD 3KYOA 1S7XA 3DIDA 4YSEA 2VISB 1E8YA 2MNUA 1INDH 3AQDA 4EXPX 4Z7WF 4M6NL 4BWUA 4PV8B 4HIXH 2FO4A 4IBLT 5D7LD 1QSFA 3BP6A 4HKJA 3FU0A 4P9HH 4ZTEA 2LE9A 2H6PA 2X41A 2FR4A 1SLWA 3X11B 3QRGH 1PLAA 1XGUA 5LBSL 5AALA 1YQ2A 1UACH 3O3AB 2PW2B 1MIEH 4OFDA 5T1MA 2EO7A 2DQFB 4UQ2A 3FH8A 4MDJA 3MO1B 4PSRA 5JR1L 1LO2L 3DOSB 5IM7B 1DL7H 1ID2A 1TYJA 3F5WA 3ME0A 5C07E 4PPTA 4S1DD 4KGJA 4QHMA 1QA9B 2ZXEB 1PZUB 4OFKA 3WFCL 4ABVA 3QJRB 1FO0B 1NGWA 3TL5A 2H32B 3JUZA 5HYQA 2ZKWA 3E0GA 3T71A 2EDTA 3F12A 3NIFF 5HJGA 4PTUA 5CCHE 5KW9H 5FUZL 3DGCR 4MYWB 1UWXK 5PAZA 4ONGL 4CNIB 4FG6D 3LRHA 3OKLA 3O9WC 5DJ8B 1RIHH 2NYKA 4FQIH 3ZHDA 1J1OH 2IFGA 2J8OA 4XPAL 2OMZA 2UYLB 2DQDH 1M05B 2O72A 4GG6B 2ESVA 3MNWB 2E59A 2OXGB 4KXAA 5BJTB 1J8HA 4EZKA 4G70B 4BXVA 5DFWH 4N1EA 1Y1DA 2P43B 3BDYH 1I8KA 1QSEE 4NUGH 1JZ5A 3G08B 3H56A 3ELQA 5LBGA 5HHOB 2Y06H 3FXIC 3B83A 3VI3E 5BW7C 3QIBB 1IAII 1ZVSA 3QORD 5IQMA 5DEFA 1YO4A 4KQ0A 2CUMA 4XVJH 4OCNC 5ESQA 2KPWA 4QXUH 4UI2A 2BZCA 1DN2A 4ZMPA 4ZMLA 4EDWL 3PABA 4Y5VC 4G80B 3IMRA 3VGHA 2WVSA 5DSCB 4ZXBC 2WTOA 1IC7L 2WXOA 3T08A 4JANB 2EE0A 3G04A 5DFVD 2VERA 2EH8H 2A7BA 4OY9A 3K2MC 3CV5A 2C3HA 3LJ3A 2LABA 2VT0A 2BWQA 1E8WA 4H88L 3MRHA 3CC1A 3I6GA 2RCSH 2ZCHL 3GHPA 4KC3B 3EO0A 4WO4A 3UO1L 5G5DB 3QFDB 1MY5A 4B53A 1CG9B 4I4WA 4GFTB 4F33B 2W0LA 2FB4L 4M3JA 5AW0B 1YN6A 3LTVA 5F7DA 3US9A 2WUBL 2DJMA 2XVLA 3B2VL 3EDKA 3MRCA 2L7JA 3L4VA 5IMOA 1AP2A 2NY5H 1I1FA 4LSQH 5DD3H 5I30H 2IGLA 4NOFA 4FQLL 1PZCA 1N5AA 2CMRH 1F41A 4O2EB 2F74A 3S35H 1EMTH 4U1KA 3EFFB 3TPKA 3Q8EA 4UUJB 4C4BA 3ULUF 5I8EB 3ZTCC 4BK5A 4NZJA 1YECH 2XWJB 1XCTA 2P9RA 1C12A 1D2OA 4LVNB 1RMFH 4GO6B 3UJTH 4CL7A 1MCPL 4YSPA 4RFEA 3P69A 4WWKA 3FU7B 1M71B 1R75A 2V0AA 1NEZA 3BIKB 4GSDL 1HCYA 5GS1C 5FR3A 3K74B 2H5UA 4AL8H 4TM9A 5FWQA 4PJIF 4FX5A 4XO4A 2C9PA 4ODVL 3C09C 1TJHH 1MXDA 4XBMA 3P9LA 3QCUL 2EIMB 3BQVA 1XT5A 4POZC 5CGMA 4GW1A 5HHVL 2H2SC 3D07A 4IRJC 3WFBH 1ETB1 1MH5A 2FATH 4MHHG 2WWKT 4TPRH 4YDJA 4JFDD 3WCYA 3BI9X 4KRNA 1K4CB 2PO6A 4HK0A 3TU6A 5JYMA 2E4TA 1COBA 1KCUL 3OHMB 3MAWA 4MXWL 3O2DH 5ICXB 3MFGB 1NCAL 2ITFA 1Y0LA 5K9OB 4JG1L 3VNZA 3RDTC 2Q2EB 2WXGA 1T89A 1QG3A 2W0FB 1TJGH 4KUCD 3IETB 3I74A 3QEUA 4JPIA 1GC1H 1ZHBB 1RZIB 3CFCH 4FCHA 3D4GA 2ZOUA 3NPSB 3I2CL 4FZ8H 3S34H 3U9PH 4BFBD 5E8OB 1LK2A 3FB8B 5KJ4A 3VTAA 4AYBA 2R0LL 3MX0B 5ISZB 1V7NH 2E5EA 3WIIH 1NUNB 1EA9C 4KNQA 1ET8A 3Q1EA 3N06B 2EO1A 1OCWH 5BXFA 1MJJA 2PP7A 2R2EB 5I16A 1M7UA 4OCYL 1UOKA 3MLUH 4MAYD 4WNQB 4ODBD 4G6ML 4ZFZB 1O0VA 1QFOA 3RUGA 1DYZA 4Z7OF 2DQMA 3BZEA 4Z7UA 1RHHB 4HOXA 1D5MA 1WO2A 2VDKH 4K07A 3EYSL 4DKFL 3CHXA 1TETL 5SX4I 2K8MA 3TOPA 3QB7C 3PWJB 4QHNB 1OXYA 3AAZB 4XTRD 4TS6A 1R9FA 3DRTA 3IJEB 3II2A 1Z9NA 3MGOB 2WLMA 3CVBA 3D5OF 4WKXA 5IQ7H 1BZ9A 4N68A 2EIZB 1XSOA 3I85A 3QJFB 3HBQA 5D4QA 1P7KB 3TIDA 1C7TA 2BP0B 2DWEA 2QV2A 2HUEA 1NL0H 2FCBA 4YZWA 3SPIA 5FYJU 2A6JA 4HEPA 4HBCL 5ITFA 1TZOA 1TTAA 3FSAA 3RILA 1UOLA 3BYTA 3EHBC 5AZ2L 2YUXA 4RMUA 1BQLL 4UQBA 2WWMD 1MRCH 5EIIB 5GS0H 2M8XA 3QHTC 1WC7A 4WQOA 2P47B 4JR9L 1ZD6A 4BZ2H 1H3UA 4XI5C 4HAKA 1SBSL 2AJVH 2P80A 4HIQA 3AACA 2NY5C 1E2VA 4R8WL 3RX8A 5C08A 2X88A 1IFHL 3OG4B 3CC5B 4FI8A 3O2DA 3WE6A 1XEDA 4LRIC 4MMXC 4RRPG 1ZT1A 1AG0A 2XN9A 1G9MH 4W81A 3OXRB 1EHLL 3UC2A 1G6RA 1E7UA 5J0BA 3L5XH 2HH0H 1OWRM 3TBTB 4GJTB 3H3PL 4PVLA 4LCCC 2VMCA 1U3HD 4OJEH 2WCGA 4PREB 4J4PD 3T3PB 2AZAA 4XO8A 3T77A 3ZO0A 6CGTA 1E5YA 2ROYA 5CGYD 5C2UB 7CGTA 5ILTH 3DHJA 4OD1L 4E5XG 4ALAL 4KGLA 5EEWA 3LMJH 4JDTL 4O02B 1TMCB 5GGRA 4ZUUB 2NZ9C 4ZX5A 1BW8A 3B5GA 4P2RE 3HHMA 4FQXD 4PUBL 3RIFK 1FQ9C 5CLXA 3ULUH 1FL6B 1PYWB 1QVOB 3QZMA 1IJNA 3IF1A 4W9JC 3KXFA 3AG2B 3C60C 1RUKH 3U0WL 4D0DB 2G75B 1LYQA 2YJQA 1J10A 1Q72L 5E9DB 2IH3A 4I0PD 3FRUA 3QZWB 3MBWA 2YAFA 4JFEE 3HPJA 4MCMA 2EE6A 1NCCL 3P54A 1XGZA 4OFYD 1SYSB 4OV6F 2C1PA 3KW7A 4AZ8A 4DETA 1D2PA 1N8ZB 3U36B 4CC4C 1KULA 3LPFA 3DYPA 2GYSA 2XICA 3FUEA 1DQJA 5AYTA 3UTPD 2W60A 2FSEB 4QHUB 5FA4A 3BVDB 4JLRB 3PHAA 5L4FA 1SJHB 5D2LA 1L9SA 2GHZA 4LASH 2R4SL 4CGTA 1UKSA 4XMLH 5ECGA 2IFFL 2ZWSA 1GC1C 3GXNA 1PZAA 5KSAD 3UAJC 2FH6A 2UZXB 1YUHB 3EJSA 2EE3A 1H8OA 5T5FL 1QMUA 4HS6B 5C0JA 5HI4D 4BUGA 2E8YA 1NCHA 4NKMA 1XGQB 2J44A 4FQJL 3ES6A 4NCC2 3VA2C 2G9HA 5DURD 4MSWA 1CL7I 2WBJC 3RWGB 4TVPL 4H20H 3NAAL 4Z0XA 4G8FB 4EI5B 35C8L 2YAPA 1I1RA 4C56B 4JFPB 4FFYA 4KJPD 1W91A 5KG9B 3DUUA 3SPHA 1MLCA 5F7EL 3BAWA 1T03H 5GISH 1IT9H 3KEHA 3U9WA 1ADQA 2WLJA 4QY8B 3ZR5A 1CQYA 1T5XA 1E9OA 3IPEA 3UTSB 4KRPD 1LMIA 4DPBX 4G6FD 3FU6A 4O2FB 4UQ9A 1A6AA 2CM5A 3W9EB 4FHJA 4JDZB 5T3XH 1LJMA 1P9MC 3PWLB 2AK4D 4UTCA 5J6SA 5L88H 3AREA 5AG8A 1LP9B 3Q8CA 4DKEL 3LDBB 2BSDA 3VDCA 4KKBC 5I1JH 1FAKT 3HZYB 2VRAA 3S88L 4BZ1H 2ICCA 4D9LH 1X4YA 1EJ8A 3CFBB 5GS0C 1EHAA 1BZ8A 2YO3A 2XOTA 2RMNA 3FQRA 1MG2C 4PRDB 1YVLA 4RDQF 1W0VB 1KYOJ 3RVTC 4WFFD 1NPJA 4G8EA 1I31A 3PY9A 3CLFH 4NAQA 2CO4A 5D2NB 3ZYIA 1DQDL 1FN4A 3KYNB 4K5PA 4PGZA 3KD4A 2F7RA 5IMMA 2EXTA 5KVDH 2J55A 1A0QL 3RGVD 2WWKO 4NQSA 4NNPL 4LOFA 1YA5A 3HRZC 4JO4H 5JMRA 1OGAD 3DARA 4NJAL 5DO2D 1G9MC 2V2TB 1NGQH 1XZWA 2DH2A 1S46A 2YUWA 4HPOL 1MWAL 3OLIA 1IGYA 3G6AA 4JN2A 3ZOAA 2FHFA 4APQD 3UTZB 3PUCA 2XFGB 3OVUB 1PKOA 1QYGL 4PD4K 3BO8B 3MJWA 1CTNA 4F8OA 3TC9A 2OW7A 3TFBA 3L5JA 1U8JB 1GGBH 4NKOB 4QDGA 2Q6WB 4W6XB 1I8LC 4XVTL 3FYEB 1NGYB 2M2DA 4WW2B 3PE9A 3WFEH 2MCPL 4HUVB 3IMVA 1NC2B 5HGDA 1OE1A 1YEHL 4GG8A 4YK4C 4L48A 3JWDH 1E5UI 3BH8A 4D0CB 3RX5A 3DO7B 5DFAA 2XVKA 4M5TA 5IG7A 5J3HD 1Z3GL 3VA6A 3WNIA 1NCWH 4G43A 1OSPL 5DLLA 4OW6A 4M1DL 2X6VA 1MREL 1BBDH 3F6LA 4BIKA 1JMZA 2NUPA 4U6VH 4WV1C 3SJVD 4UQ3B 3CVCA 5CWSA 3KGTA 4F80A 3BPOB 2EH7L 4RNRB 1KJ2H 4K7FB 5KUMA 4TSCL 4EUPG 2VUKA 3VXSA 4PJFF 1WGVA 5DHYA 3RJDA 2IDUA 5ECJE 3MJ6A 4DN4H 1KCVH 3BQUA 5K9KA 5KVFH 4XXWA 1CPUA 3QPXL 4AUUA 3RNKB 3APMA 4M7KL 5EWIL 1YEWA 5I1AA 3W11D 1ROCA 1UXWA 1A4JA 2GBAA 3EW3B 4Y16A 3KLSA 4YDZA 1O6VA 2Y7QA 5GHWH 5IHUH 4ZK8A 3VFSB 4FOMA 2JVUA 3M1CA 1ADWA 4UMGA 3U1SH 4OLEA 1XXDC 5AYUL 3PFUA 4LCVA 2DLGA 3VSQA 4A7TA 4Q56A 2FEDD 5D7JA 1IQWL 4F7TA 3BZFA 5CP7B 2W81C 3BSZL 4P99A 3ZTNH 1KPUB 1BQ5A 4X6BA 1T2QH 2NNAB 1LO3L 4YUEL 3KPNA 2AHIA 4OI8A 5MP6L 1PTZA 5KYNA 3PL6C 1RJYB 3MCKB 4H1LH 4JCLA 1NGXA 4NQDE 2X42A 2GITB 4P4RB 1IMHC 2IV9A 1CB4A 2PTUA 4F91B 1KPRA 3DJZA 4OH2A 4XMXA 2WSPA 3HAEG 5HDRA 2O6DA 1TNNA 1QSFE 1J0IA 2H4EA 2VDRB 3D51A 5DVNA 4Y7MA 4OV5A 3VXNB 3NGBB 3UMNA 3TBBA 4Z7VA 3MRMA 4QRPB 3RIAK 4QGYA 3KL0A 1U6AH 4QT5A 1KYFA 2CXKA 2BY1A 4LGRB 3VWKD 3RWHB 3V9FA 4YSUA 2XXCB 5EULV 3GMLB 3ZL4H 5EUOA 4XP1H 1OE3A 1O75A 3VGAB 1NUGA 4PW4A 4G82A 1WIPA 1CFTA 4JO5A 4PRIB 3C8HA 3OG6B 2UUDK 2XA3A 2EUVA 1KGYE 4FYTA 4JKLA 1CQKA 5A3IC 1BWMA 3BZDA 3EOAB 3VXMA 1DQMH 2E56A 3UPRA 5DJCB 3SODB 1D9KA 4DZBA 4PVNA 1TQWA 3EJZC 1CDIA 3IBEA 3QJVB 4K3JL 3N85L 5B8CA 1D5XB 5FB8A 3DMMB 3GFUA 2R23B 1QTPA 3VWJA 3ZIYA 1C8PA 2A83A 3MLWL 3HR5A 5JXEC 2JJVA 4BFJA 3TV8A 1IBHA 2D9CA 5F89A 2ENJA 4PY8I 1MCJA 4Z0BL 3V6ZB 5KBNC 3FT1A 4TTGA 2IH1A 4IIZA 4ZW5A 3NOIA 2YAOA 5SWQA 2NR6A 5BRQA 4MJ5B 4FTVA 3HE7B 5CSZA 2VXVL 3TM6A 3MRBB 2ZSWA 4LOVA 3SOTA 3V6OC 1I85C 1RZPA 2OJZH 3B4NA 2ZKMX 1L7IL 1VGEL 2X6AA 5ETUA 4ZFOB 5MENA 5I9QC 1U8PB 3JWDC 1IGCL 4HV8B 4UOJA 4AQ1C 4QJ4B 4P06A 3GMPA 1PZDA 2EAEA 2DYPA 2ED7A 3JWNG 2R0KL 4Y2DC 3TN0A 5KTEL 1U93A 2EDYA 2CJ3A 2QHRL 5E6IC 3ZDXF 3D4ZA 2E46A 1OB1A 1S7WA 2Y2WA 3IFPB 2OW6A 2WMPA 5HHOE 2OMUB 2WJ5A 1JVOA 1DUZA 2NY2B 3QQDB 4X5RA 3V4PA 2XWTB 4YR6B 2JXMB 2VMFA 4PWGA 4UM9D 5FHBH 2ZCLL 4WHYG 2JCCA 5F1NB 1HCZA 4PJ7F 4FYSA 3CFTA 3MV9D 4HJJL 2OYMA 4XN1A 5J5EA 2GTQA 2A73B 3H9YA 4X6EB 5DMGD 3T65B 2GFBA 3QGVA 5EA0L 5LB1A 1GGTA 2ZP0T 5AENA 1CI3M 5E8PA 5MHSE 3HMXH 2C4XA 2GVYA 3PWVB 4YPGA 2QGDA 5H35A 4JO8A 1IM3D 2X3BA 4P57B 5DMJB 4X5WB 4XODA 2FIKA 2AANA 4GLRH 3EH3B 4MQ7A 3A4EA 4YQXL 2WPGA 1W8EA 2SEBB 4L9LA 4LGSB 5SWSD 1JZ2A 2DJ4A 4E41E 3V10A 1G7LB 2QVTA 4UTAH 5IHWA 4L29A 1H6FA 2KPNA 3CZUB 5KVEE 3WLBB 2ZUYA 1DJHA 4HETA 2OBGA 1F02I 2HTLC 2A2QT 3MREB 3FB6B 1CTOA 1K2DA 3F7RA 4UYQA 1QWHA 3G5XA 2NXYC 2GJ6A 2IAAC 4XPBH 1M1SA 3EZJB 2MTPA 4XPFL 5TK2A 3NSJA 1BZ7A 1DZBA 3MJ7B 5KS9B 4P23D 3QO1A 1XDTT 5I6XB 3FFCD 3KJ6H 4DN3H 4ISVB 1HWHB 4IBSA 4FXLA 3MLVL 1MFCH 4JY4A 3O2WL 5HHXL 3WELA 4P2OC 4XP5L 4KNTA 3PCYA 4KK5C 1P5UC 4R5VA 3FTVA 4OJFH 4ADJA 1YEEL 1XGYL 1OTUC 5BO0D 2BSRB 1C1EH 3EF7A 4LHUA 4P5RA 1MWOA 2ZOLA 2G2RB 3LHPL 2OZ4H 4DP5X 3FCSA 3MV8D 2F8OA 4NI6A 5FYLH 5IW1A 4LLVB 3V0IA 3CPLA 5HYJE 4JY6B 3UGXA 4Y9EA 3T3MB 4TRPL 3ULVL 3SBPA 3IDXH 4NDMB 3QVAA 4P5TA 3U4KA 4UOZA 1WBXB 5GGSA 3UTTD 2YFNA 3PAUA 2XSKA 4W9HC 5D6DC 3MCYA 3ATAA 5DRXA 5E7BA 5DHVA 3ARFD 4HIJA 1L9RA 4HPHA 3B2UD 5KSBF 4KO9A 4L37B 4ODWB 4XC1L 1XF2B 1E3XA 1ZT4A 2IGFL 5KOVC 1B0IA 3QDMA 2R9HD 1XR8A 4R97C 1YEDA 3OZ9H 4GP5B 2F7QA 4QHKJ 3NIDF 5HGAA 2C7UB 3SE8L 2IH9A 2YLHA 2ZP9A 2I7SA 4LF3B 1U36A 3FUNA 4RFOL 1D5BB 5AAMC 1FNEA 3BPCA 4GXVL 3G3LA 4GO8A 3UFIA 5DMIL 5DMYA 2ADFH 1JCVA 3HZVA 4BH8A 2OSLA 4WNSA 3LN9A 4D7BA 3CHPA 2QFPA 3RVVC 1X6LA 4M56A 4HQQH 2WXLA 1XV8A 5C3LD 3NTCL 3EDDA 4U6XA 5TGBA 5I6OA 1U8MA 4GAGL 3U2SB 4M7ZC 2E9GA 1OQXA 1AFVL 5ISZE 2EUZA 4OF7A 4OUUA 3JTTA 3QIWA 1SEQL 5DD5L 5EDXA 1B6DA 2E27L 5IROA 5FYJL 2QELA 1OL0A 2XPZA 5EC1A 4Z3GA 3P9MA 4D3CH 2OMWA 3QUYC 1QNZL 2QQKL 3CDCA 1J9TA 3D3VD 4FFTA 3T09A 1GS8A 3MKKA 2YIHA 4RZCA 2HMID 2OTWA 2YPVL 4AVHA 3SCMD 2I60H 3VUAA 1ZA3B 1DLHA 3T0ED 2X70B 4OF3A 3K6NA 4JFYA 5E94B 3WD5H 1URIA 1WEJH 2VLLA 2ATKA 5IBTL 1EO8L 2KS0A 4ZZFA 2YKKA 2G5BA 4DQOL 4J3WA 3V52H 2O26U 4JZJA 2OL3L 4HUXB 3D0VB 1KBBA 3EZ8A 3OSVA 2FGWH 3MOBH 3C5ZA 1ED3B 4XN4A 5I1EL 3GZPA 2B4CH 5TFSL 5CF3A 3QXDB 4JO2L 2NY1C 3K2UH 4P46A 2G2NA 5L0QB 2A77H 2JJUA 2N1KA 4XB7A 2KBGA 1EZSA 3TWCL 2Y5TA 3K46A 4MNHB 4MNQB 1RZJH 5AB1A 1CFBA 1EEUA 3MRFA 5D1QA 5ADOH 3U79A 2QZ5A 4GRLC 3A0OA 2AXJA 2QJDA 3BEWA 3O3DB 4O51B 2DI7A 3MN8A 4PJXA 1HHIA 2FLMA 2FAUA 3M17B 4OF0A 1XIWB 6FABL 3MRRB 5B3JE 4HK3J 3COOA 4KUCF 1KCSL 1D7DA 4E5XB 1BQUA 5IVXA 4AH2B 4LCWD 2W38A 2UVFA 1UM5H 2J88H 3FTXA 1BAFH 3OMIB 4IHOB 5LNDA 4JRWA 1PIGA 3GSNL 3UCRA 1KLFA 3H0TA 1F4HA 4R96B 4OIBA 2A9NH 1H8SA 1MCWM 2GBTA 2RA1A 1PZ5A 2BINA 3BEVA 1F58L 2WZPD 1LK3H 2WD0A 3FU3A 2DH3A 3T0AA 2WQAA 2NZ1A 2X2IA 3L3HA 3G5ZB 5CU5A 3O8XB 3WENA 3BMVA 3LKQA 3RWJB 4NQQA 5EZOH 1L9QA 4C83A 3L13A 1M7IB 3DSNA 5JHBA 2FQDA 1SLVA 1RP9A 4JHUA 1A1MA 5L2KB 3UZEA 5D72H 3A6BL 2GJRA 3NJLA 1PKQB 1MAMH 1DDTA 1GGCH 3FB5B 4ZW8A 2WO3B 1O9VA 1JZFA 2K3HA 1QFWL 3HIZA 1FYTE 2D7QA 5CFAA 5E24E 4WEEA 5B3SB 2GTWB 1JGVL 3NABH 1YYLH 3DIFB 1ET5A 1K9TA 2CO1A 2NQ3A 4IMLA 3RWCB 2EDNA 2ZNWA 2F8VA 3E8UH 4N2FA 2JIXB 1SY6H 1CXLA 5MEPB 1ES0B 1YEKL 5I73C 1EUTA 1XTMA 4ZPVA 5DZVA 1NPNA 4BFIB 2DYRB 4F7MB 1PQZB 2XQYG 5E6SB 2GSMB 4MS6A 1XCXA 3HC2A 4X99B 4HEPG 4E9RA 1FZJB 1R0AH 2DIJA 1S8DA 3FQ4A 1ZANL 1KB5A 1J5OL 4F3FA 2VGLM 2VDNL 1V7MH 2AJYH 4PAZA 2UWEA 3MGTB 1TOXA 1ZHKB 4JUSA 3DXAA 3QFJB 5IFHH 2BSEA 4IU2B 2FYYB 2WVVB 3WMSA 2X87A 3VRLE 4A6YH 1SXAA 4GBXD 4LAQH 5HDQH 3HBZA 4G9FA 8FABB 4JGNA 3DVNA 1R5IB 4X6FB 4X6CF 3AU0A 4C56E 2IANE 3D39A 3HG0A 1AR1C 4KKRA 2CNZA 1NICA 2IALA 3QDGD 1A5FL 1DO5A 4MWFA 1KCLA 3N91A 1R3LA 3MBXH 3UTSE 4YE0A 4A38A 3BPLC 5FYKU 3QI9C 3THML 4V1DA 4J1UA 5A2BA 1S6NA 4JG5A 3VFGH 5GJSH 5D9SA 4HS8L 4BCXA 1UUNA 2VDQL 1IILE 3U0TA 1OAYH 4JHWL 3FMGL 3MLXL 4XP4L 1X5AA 2UXGA 2VSDA 4U7KA 2OSXA 3TT1L 3GXIA 2FHBA 1MVUA 1LP9E 5GZND 5DR5L 3SYQA 2KZBA 3KS0H 3TA3B 5K59F 3X12A 4AK2A 2B9BA 1GKOA 4MX7A 1C5BL 3VFRA 1F4WL 3H9HA 3BH9A 3HR6A 3T4YB 1MCOH 2BWIA 4GKNB 2LVCA 4HDIB 5D2NE 1IC0A 4NN5B 1RKRA 1SJVA 1JV5B 2VZVA 2D03L 2Z92A 3ESVF 3RL2A 1IL1B 3QNYB 3ZTEA 3KPRB 4AGQA 2J1ZA 5EOQH 2CO3A 3K5RA 2XQ0A 5AKVA 3CN0A 1OCZB 3PAVA 3NSCA 4L8SA 3L81A 1AQ8A 3VXQB 4NUQA 4I85A 2PPDA 2JKTM 2B1HL 1KIPB 3ROLA 3GYRA 5JHLH 1AYRA 1TVBA 1ACYH 2NQCA 3RY4A 1E2WA 1RAMA 4S1DC 4PJAA 4HPYL 4DEPC 2B1AH 3NK3A 3ZGHA 2XNAB 4IOSA 1JS4A 1O9ZA 5CILL 1NCDL 1XH1A 1UM6H 4AEFA 3VM7A 3DV6B 5KANG 4B9GA 2DQHH 2FNWA 1BX2A 3IT8D 3TZVD 2MQ0A 1ILSA 1MFNA 1RIVL 4ELKA 9CGTA 4FG6C 2R27A 2AJXH 1A3RH 1FVCB 4ZO7A 1M56B 1HL9A 1UM4H 2BK8A 2V2WA 2YXWA 2Z4TA 3LKPA 1ZJBA 3QHFL 4L8BA 3D25A 2XTSA 4NENA 5IQ9B 1IBGL 2Y2YA 4OB5H 4PRAB 3BRFA 3FO0L 4ES9A 3PNRB 1ZIBA 3SGDH 3B2XA 4HHAB 1OF0A 4KQ3L 2H2PD 4NCC1 5TDNA 1KIRA 1TJIH 4ZFOL 5EZIL 5BVJB 1ZJAA 2Y1AA 2I85A 4PGBB 1MQKH 2WXHA 4A2DA 1O6SA 3UYPB 1CL7H 5LQBH 4HH8A 4EUPB 1QR4A 3AXHA 3LAFA 3OWEA 2IO5A 4K15A 2CHZA 4GUPA 5F8QC 3ML9A 5EOTB 4GRMA 4UBDD 5I17A 1SOQA 4HP5A 3QORC 4IRZH 4OLUL 4P48A 3ISRA 5HDOA 1JNHB 2FEEL 4HMDA 4MA3A 2YAEA 2XZCL 2XTLA 1E4XH 3GBNL 4PJHA 4XNMB 4YC2B 3ZQWA 4NERA 4ZMZA 5I74C 2NX5D 2IAMD 3IDMB 3BKCL 4MRCA 3WIHH 2YJLA 5CGBA 2X0VA 2P3YA 5FK9B 1OGTB 5C70A 4ZS7L 1SJEA 3OKMB 4BKLA 2HLEB 5C0RH 1CFMA 1TZAA 4UV4L 3CFUA 4P2QB 2YD0A 3HHSA 3DWTA 2VL5A 3PWPE 5DVMA 3S96A 4ETQA 3ZDWA 3QIBD 3UBGA 5INDB 5LDUA 3ZMEA 2E7DA 2HFGH 2WLKA 2CCWA 3DDFA 2IWFA 1NH6A 2QDVA 3EYUL 1YNKH 3VTMA 4ABUA 2R8SH 4A2MA 3D0LB 4JCWA 3GGWA 4LSSH 4Z7VE 2HB0A 1QLEL 2VR8A 4X7TB 5F9WB 3PQYD 5LXVA 1NFDA 3VD2A 1I3RB 3HAEB 4L8DA 4K55A 4WKZB 1G7JA 4BFOA 4PJ5B 1FRGH 3AM8A 4OCRH 1CBJA 4KTGA 1BVKA 2OK0H 3JTSB 4JPWL 5H2BA 4AY0A 3LKNA 5EUOE 2YD7A 3CVIH 4FNPA 5HDWA 4WWNA 2QSCH 4EN3B 1TLKA 3CSPA 1RIUL 2ZPKL 1ACCA 1CGTA 3FQWB 4JKKA 2XN1A 5DJ2A 5FOBA 2IH8A 5D4HA 4OLYH 1BMZA 1DBBL 1KIUA 5F1KC 2VR4A 3R06B 2OLDA 3HTLX 4ICWA 1U58B 4OJDH 1N0XL 3VFWA 4HOMA 3TYGL 3U0PA 4IMKA 4TQEH 4FABL 3MRNA 4BQ9A 1Q9WA 4PRIE 1FCGA 4M8QA 3U6XS 1J1PL 4NZRL 4RZKA 1YJDL 5DJAB 3MJ8B 1R5VA 1SDDB 1E90A 3K4AA 3PGCB 5GIRA 3QQ3A 3DX6B 2NY7L 2AEQL 3S8GB 3IE4A 3NDYE 4UDUA 3WI9A 3ORJA 2XWBA 1QUNA 3GS0A 3HE6A 4ZUTA 3FHQA 3I9IA 4IRZA 2E74C 3MTRA 3WMQA 2H9GB 4NYLA 2MIZA 2NCMA 2R51A 4MMYB 2EDJA 3BAIA 3NN8B 1UKQA 4YLCA 1IKFL 4PB9H 5HYSG 5MENE 1N5YL 4ODUB 2F53D 2VUOA 4I77H 2FL5B 1TCMA 2VE6A 3WIHA 4Y7OC 1XH3A 2YA2A 1YEGH 3RTQA 1CLVA 4D9QE 2Q76B 3OGOE 4GW5B 4OGAD 1JGDA 4GT0A 4LDOB 3VXRA 5F1IA 4R0LB 4TNVF 3X3GH 4X9HA 5IKCA 1GCFA 4HSAC 1G9HA 4QF1B 3N0PB 1MLBB 1SDAB 2X7LB 4PR5A 3WNOA 2JKLA 3T4AA 1QW9A 4LSRL 3HUJA 1TITA 2PP9A 4PVBA 1C16B 3ZT6A 1P69B 3SIKA 4W1TA 3S3CB 3SBWC 1H9VA 1EZUA 3P30L 4WHCA 4HGWB 4X6DA 5SWZB 2FX8H 3ZXAC 2XDHA 5C2BH 4QCIB 4KZEH 2E76C 2WLNA 3WDIA 1R3JA 5KJRH 3MRIA 1KT2B 3KJ4B 3L4TA 2H3XC 1AVAA 3P73A 2ICEA 4MAYC 1H3PH 2Q5BA 3W9DA 4LP4A 3PP4L 3KYOB 3H85A 4FKKA 1ROWA 1S7XB 4MJIE 1QRNA 3T0XA 3C5SB 3MA9H 4N5EC 3RI5F 3QIUC 4YHZH 1CLZH 5JW4Q 4XMWA 4XTRC 4GAAA 2FO4B 3NJXA 4L2LA 2AF2A 2AXFB 2BVQA 3CX5K 4RMVA 4ZODA 5I19L 1SXBA 2Z31B 4IYKA 1BVLA 1HHGA 2OYKA 2WZ6A 3NCFB 1LMKA 5C0CB 4J3OD 1N67A 5FFLA 4O58L 2C3VA 1HT6A 3HS9A 2ADJA 3OAWA 3VD1A 3GXFA 3EO9L 1JERA 1NOFA 1OW0C 2FECL 1CYGA 2O5XL 4WI3A 3VO0A 2NYZA 2KQNA 1QFWM 1NEPA 4MDJB 2Y36L 2Z4QA 5D71L 2WWMC 3ME0B 4IOFC 2ZXQA 2XBZA 5E8NB 3LV3A 5JHMA 3KDMB 3PYCA 2ZAIA 3FTWA 2CDFB 4B41A 3B5TA 4OFVA 4FG4A 4NCDA 1EUUA 3GSVB 3EJCA 1G84A 1IC4L 3IDGA 4A7GF 3F12B 4PTUB 2LGNA 1V05A 4F9PA 3TNNA 1F5WA 1MI5D 5EO9A 2V5TA 4H0GA 2AXGB 2HA1A 5D4JA 1IGJA 1L9NA 4N2EA 2E7CA 3ZE1B 3VXTA 4LZKA 3JV0A 2AJSH 4LO9A 3K6IA 2Z35A 4Q6IA 4Y5VA 3WIFA 5BV7B 2IDQA 1NM4A 2ESVB 3N5AA 4JFHD 1TKWB 2J5WA 4UQEA 1DQIA 1U3HC 2WLZA 1PG7H 4AYMC 5FUOH 3ILEA 4J4PC 3CFQA 5I1IH 1T2JA 1YQVL 5CGYC 5A6LA 1GOHA 4TLUA 4QRSB 2DQCL 1DCEA 3A6CL 5IGXL 2WYTA 2WXIA 4G6AD 3X1GA 3MA7A 5E2UL 4FQXC 5F70A 2VCOA 4H1LG 3FQ2A 1J7VR 4QR7A 5CEZE 1JZ3A 3R8QA 5ESQB 4IKKA 3SDXA 2WP3T 2EDBA 3PABB 2VOTA 1D7BA 1OM3H 5IP4A 3BT2L 5EORH 5C7XH 5EDSA 1UH4A 4Z7NF 2Y1YA 3UABA 1UKTA 1Q1JL 4OUOA 3IU4L 1QEWA 3G04B 1SYVA 3KPSB 4LCUA 1QOKA 3OR6A 4OZHE 4ZO6A 4DCQB 2A9AA 1P4LA 5GS1B 1E4WH 2HKHL 3D2UD 3IJHB 1Z5LB 5TE4H 3N1FC 5T1JA 3RRQA 1DLFL 1JCKA 4AK1A 4F2MB 4NS0A 1W80A 1NAML 2KMWA 5HVHB 3EO0B 2OJ1A 4WO4B 3FFOA 1E67A 3EJYD 4WDIA 3CDGA 2Q7YB 1NCBL 2EDMA 4X8GA 5E9DD 5C0BA 4MJ6A 1HKLL 4FXTA 4UZGA 3TBVB 4OVUA 1YN6B 5DK2A 5F0MB 2P46B 1G7QA 1CGWA 2EECA 5F7DB 3D0AA 4GY4A 4TNVK 4H8HA 1SQMA 5CUSL 4A7SA 4OQTA 1AP2B 5IMOB 4ZT1A 5E7FA 2H6OA 3CVHL 5LCVA 3NZ8A 3UPAA 1R3IL 1S7SA 2F54B 3NEOA 4Y4KB 1N5AB 1OY3B 4OLWH 4P9ML 4KMTL 5E4IA 4FFZA 3V5KB 4JFUA 4PGCB 3S5LG 3FHAA 1QUPA 4LOUD 1G7PB 5CKAA 4WGVB 3BYYA 1X7SA 3FSWA 4XZUA 4ZAKA 1FFPA 1AE6H 4G6KH 2BSSA 2W91A 1XCTB 4PQXA 1WZAA 3O3BB 3CIQA 1LD9A 1UWGL 1ZCRA 3CFKB 1EHKB 1JK8B 4OM0H 3Q43A 3WO4C 1EQWA 2VXSH 4OGXL 4LHUG 1RPQA 2DJSA 1O7VA 5FYJD 5DD1L 1N6QH 3GLEA 1UENA 5KYXA 2RQEA 5C3IA 4OCXL 4KKQA 2HLFD 4XCCL 3RDTA 3J07A 3ZDYF 5ACZA 4TKWA 4Q9BA 4R3SB 3P9LB 3C12A 5D1QE 3TEYA 2BNUB 3FH5A 4EO5A 2OSYA 4ZQTA 3E38A 4TLTA 1A7PH 1SEBB 4FDWA 4I18C 4QYAA 4YDJB 1MH5B 4ANKA 1PZ3A 1G7HA 5T33L 4HK0B 4Y5YA 3GQFA 4N2KA 2CG9X 3TFKD 2NSMA 1A7BA 3VYPA 4LEXL 5GGQH 4S1SL 5LG1A 1FDLH 3TNMA 1WAEA 1XFPA 4J2QA 5JZ7D 4V2CB 2F7IA 4MNQE 2QGCA 4OCSL 3AT0A 4BELD 2MMXA 2D3JA 2HRPL 5ICYA 3J2PA 2XPYA 4K94C 3U30C 3RGVC 4M6NH 4QO1A 1S7QA 4DGVL 1QBAA 1ZV9A 5GGVL 5JTWA 2TAAA 1KWGA 5DRNA 4HJSA 5DO2C 5DK0A 5I6MA 2J2ZB 1KB9K 4JKWA 4JPIB 3FW6A 3BLKA 1B4RA 4APQC 4MFHA 3UACA 3SDDB 1P6AB 2EXSA 2LTQC 3I84A 1TLMA 3SGKA 5JR1H 5GQBA 4XB8A 1LO2H 4A7UA 3TBYB 1WG3A 3SD5A 4P3DB 4AW7A 4CKQA 2P28B 5GRZA 1DSWA 1MJJB 1SOXA 5BXFB 5I16B 3QJSB 2DYSB 1ZLWK 1N19A 1L4IA 4X4YB 1MCFA 3MRLA 4W9ZA 1L0YA 3IB4A 5FC9A 2ILLA 3RUGB 4GS7B 1CVRA 4Z7UB 5DZJA 3BZEB 4EIBA 3AT9A 3BT0A 2HLAB 2IIJA 4UM8A 3QEQD 4LLQB 5J3HC 5ALCL 3BAXA 3T8XA 4PV9A 5FUZH 1I8UA 4PWIA 3DRTB 4ONGH 1ZRUA 4QRRA 5IWLC 4JFFE 5CLTA 2FIRT 2N4IA 2ZJSL 4XPAH 4ZQKA 2DWEB 3EDFA 3QT2A 1NC2D 4PY7B 2YPLB 3GRWA 1FL3A 3CFJA 5TQ0L 2HG0A 1R34A 5DQ9A 4YSAA 5JIPA 4JFSA 1TQCC 3CZLA 3KNBA 4P4KD 4JRYE 1XGTA 2Y0SA 1WC7B 5E23A 5FIEA 4Z3TA 4Y2OB 3W11C 1C08A 4OZIF 5FYKL 3VCLA 5DA4A 4WJ5A 1XD0A 3VSVA 4A1RA 1UATA 1JZIA 2WO2B 3FU9A 3IXTA 3DRQA 2LFEA 4WRLA 4KDVA 5I1CL 2VC2L 5GRYA 1MJUL 3PWNA 4WUUA 5C08B 2APFA 1M1XA 5EBWB 1YY8B 4EDWH 2FEDC 4H26A 1KEML 3VYOA 1BP3B 2UZPA 1TF4A 3GRBA 2NTSP 3L6FA 3C60A 1MZYA 4BA8A 1CTMA 2CLRA 2XN9B 4WFHD 3KR3L 2ZKHL 4UOW1 1IC7H 1G6RB 2R69A 3CSYA 3LQZA 4BQ8A 3LIZA 1U0QA 4M93C 3GI8L 1GSMA 4Q6KA 4HEMA 5D1XD 4ZX4A 2EIDA 1LEKB 2R29L 4H88H 2I7OA 3QXUA 5LBSA 2ZCHH 4H2AA 3G6JA 3V4VL 1NTDA 5FUCE 4MJ2A 3UC0L 2ALAA 3GMRB 3RKPA 3UO1H 1O7SA 5GGRB 1EANA 5IFJB 4F7KA 1JHKL 1MCLA 3QUML 3LEXA 5T1KB 2CDEA 2FB4H 2WZAA 3F7VB 1KTLA 2R2CA 2WUBH 1I7UA 3PGDA 3B2VH 3VWKC 3IF1B 4JCMA 4TLKA 3D4YA 2YSTA 1I8AA 3PHSA 1GJWA 2VN6A 4QLRA 4XNXL 4FQLH 3UAJA 5DS1A 3HG1B 4FULA 1ZWIA 3IDNA 1YMHA 1HS6A 2FJGB 3OJDA 2VDKB 4GAJL 4ZSOB 4PJAE 4LLWB 1H8NA 3QK0A 4JM2A 3KPRE 4QOKA 4WSGA 4KFMA 2WBJA 2KLTA 1BDYA 4XN9A 2WP3O 1J8KA 1FNHA 1WUZA 4HWBH 3B1TA 4UOW0 5EBMA 3MLTA 2Q7AA 4RWYL 1MCPH 5FHAL 4IGBC 4JY5L 1IM9A 5IF0A 4GSDH 4XCNA 1JF5A 3DTXA 3VGBA 4LSPL 2ZWKA 1ZPLA 3P40A 4PJCA 4ODVH 3WEXB 3QCUH 2P8MB 4R7NB 4M7JL 5JW5B 4ELMF 5C0JB 4N4YB 1GPOH 1FGVL 4PJDA 1P9MA 2WC7A 3O45B 4UNVA 4NKMB 5J6HB 2A74C 3ES6B 5T1DL 2C9VA 1T6VN 2GCYA 5HHVH 5LN4A 1OD7A 1PY4A 2IPKA 5DC4B 1SXCA 4BEIA 1GYUA 2G9HB 4P49A 3FC8A 4Z76B 3WN5C 5FXCH 1EH9A 1ORSA 3DMMD 4Z0XB 4TF4A 5BVPL 1IEHA 1KCUH 4TNFA 1SFHA 3NJVA 4MXWH 1MHHA 1BQHG 4LRNL 3D9AL 1AZCA 1DN0A 2P8LA 3B6SB 1E9OB 2VO8A 1MFAL 1NCAH 1JZJA 3HB3C 4N28A 4JG1H 4OR1A 4XMVA 4NHCL 4H13C 2OYPA 1G1YA 2H41A 3D18B 3V0DA 3WJMB 1R24A 3HRZA 4QYOB 3GBDA 3GO1L 1RHFA 3CIAA 2XKNA 2F58L 3AREB 4FQHB 2VLKA 4HWZA 4J5VA 3I2CH 4KUZL 2J6WA 5FDYA 4Y4FB 2R0LH 4QRAA 4XE5B 2YEZA 1THAA 1HK6A 2PWEA 1LO4L 2CLZA 1CT8A 2HT4C 3ALXA 4G8EB 4OCYH 1Q9KA 2FD6L 4OD2A 5FLVA 2NY2D 4G6MH 4HU8A 1I8LA 1QFWI 3MCLL 1M9SA 2DEWX 3O6FA 4I1RA 2L7UA 1E7VA 2FEJA 2VABA 2AAAA 3EYSH 1JYWA 2PTTB 1TETH 4NQSB 5ANMB 1VA9A 1ECZA 4XMPL 2ZWYA 1ZA6A 2CHDA 3KPPB 1T4KA 3CFEA 1KBVA 1LGVA 4XWOC 1EV2E 4RQQA 4U33A 3DJRA 1AG6A 1J0KA 1NBCA 3ZDZF 4X5XB 1I7TA 2WB7A 4PJ5E 1D6EA 1HJBC 1IGYB 3G6AB 1UB6A 3WOVA 1WRFA 3AQYA 2EDXA 5IESL 4WV1A 5HHMB 5T3ZD 2C5DC 2MTAA 3HBPA 2A9BA 3ILPB 4HBCH 4X98A 1U8LB 4WW1A 3BGFB 3VU1A 5KSUB 3ULSB 1BZQK 3FQXB 3AXLB 5AZ2H 4FP8L 3ARVA 3FONA 1BQLH 3IU3B 2YBGA 5I71B 4Z8FL 4X7EC 1A21A 1MUJA 2LU4A 5D5MF 3ZL2A 5HGDB 1I1YB 4I8DA 4JR9H 4PIRF 4HHWA 1MFDL 4AENB 5CN3A 4FNTA 5JIKA 3HS0C 3P4NA 1EHXA 1IAOA 1SBSH 2IF7A 3LS4L 4R8WH 3WY4A 1PMYA 1IFHH 3OLDA 4Y19A 2BIPA 2JI3A 1MRFL 3WDJA 1WD9A 4PI2A 2NUPB 4IBYA 3OB0K 1YPZA 2BFVL 1EHLH 4H7VA 3DI2B 5DJYA 2AS5M 2VMJA 4B7LA 4MD5A 2VLJB 5HYSB 3VXSB 1S2EA 5JPMA 5DHYB 4GG6F 1DBML 4HW6A 1FIGL 3ARFC 5DDHA 2BH0A 4GKSA 5B1CA 3V6FB 4DUWA 3B2UC 2XX1A 4OD1H 3LN5B 2B8OT 4K9EL 4ALAH 5JNYA 2AQ1A 4LVEA 4IKLA