3ATBA

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 39
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3atbA00
5KUKA 3AT9A 3ATFA 3AGWA 3SYAA 5KUMA 1N9PA 3SYPA 1XL6A 3AUWB 3VSQA 1XL4A 3SPGA 2WLKA 2X6BA 2WLNA 2WLHA 3AT8A 4KFMA 2X6CA 3ATAA 3ATDA 3JYCA 1U4FA 4LP8A 3SPIA 2GIXA 2QKSA 3SPCA 3SPHA 2WLMA 3SYCA 3ZRSA 2WLJA 1P7BA 2E4FA 2WLLA 3ATBA 3SPJA 2WLLB 3SYOA 3K6NA 2X6AA 2WLIA 1U4EA 2WLIB 3SYQA 3ATEA
chains in the Genus database with same CATH superfamily
4DPBX 1NFDA 1OPGL 4FLHA 1Z9SB 4HCGA 5GGVH 3U4AA 4JUTA 3HLAA 4ICXA 4TOYH 1KEGH 5H94B 3BQVA 4JAMA 3VTMA 4WEBL 5B1BB 3JWOH 3BAEL 3WUWB 1RUMH 4XCEA 1KGIA 2R29A 1A9BB 1TEYA 2EIJB 4O00A 1JYXA 1Z3RA 3DX1A 1M05A 1TZIA 3PLYA 3LKRA 1MJ7H 2Q86A 4R97B 4P2RA 4X9GA 4L3FA 1GYVA 2OQJA 2UY7B 1DVXA 2BDNH 1F3DJ 2BPBA 1P6FA 2Y22A 3D0VA 3QO1B 5DS1A 3VFNA 4QMEA 3GT6A 4EIUA 3VXNA 4R3SB 1FFTB 5JW4R 5ISZB 4WO4C 4GSQA 4LLDA 4TL5A 5I1GH 1T1YA 3A0OA 4LCCB 1J8SA 1NWOA 1BFVL 5ICXB 4ZNCD 4L8CA 1ZD6A 5D5ME 5AUMA 1TYEB 1L9RA 4M02A 1QBLH 4AEFA 4Z7OB 4NNPH 4AH2A 1O9WA 3EO1A 3ZHFA 3ZR6A 4GQRA 4CU6A 2HT2D 4G1EB 5AVSB 4LEEA 2LHAA 3LEXB 2F54E 5AAWA 4C4KO 2Y7QB 5CJOH 5FFGA 2DJUA 4A67A 2EYTB 5F7NC 2DQHH 3T77A 3LKQB 3T8MA 2QSCL 1RHHB 3VFGH 3MV8B 4O4YH 1ORQB 2QHLA 1QSEE 4HHWA 2ALAA 4J12A 1JNLL 4JM2A 3X14B 1BQLH 4WW1B 2P8LB 4LEOB 3CSTA 4QF1B 2F7RA 1L9OA 2CUAA 2H3XC 3SDXF 4O58H 3OJDA 2NY1C 1K5NB 1NUFA 2DD8H 2WNXA 1L0QA 2F18A 4OLWL 5C0RH 4QCIA 3D30A 4PAZA 4PP2A 4NP4L 4A04A 2WZ0A 1NBVL 4OI9A 4H88H 3L5XH 4XNYH 2CIKB 5C71A 1MCSA 1JXJA 4ODXB 1ZRUA 4NQEA 2Z31C 2MNUA 2J73A 4UM8A 3CWGA 5KSBA 3VCLA 2EC9T 4GRWE 1HYSC 3RWJA 4IU2A 5L6YH 4KKAC 4TTDC 1AD9B 5E4AA 4ZMZA 2H9GA 1A64A 1I4FA 2XY2A 1S9WB 4GAYA 1QR1A 1U8JB 4I3SH 4JO1H 2K9FB 1GKEA 3FHQA 1JVOA 4NO0D 1JHKH 2WTPA 2VL5B 4QRFA 4MAYC 4MAZA 3T08A 1CFSA 3V0EA 5D1QA 4FAAB 3MRFB 4YXKH 3NDZE 2CGRH 3B4NA 2NSMA 3QEHB 2QZQA 4IDLA 2CHDA 5D5MF 3SQBA 5AW2B 4CSPA 3MFFA 4NIKB 1QMUA 4XPFH 1R0AH 3FQTB 3VI3A 1GH7A 2VLLA 5EZJB 1E2WA 3TNMA 3AGVA 1BZ9A 1NA8A 2H0JA 3T1FA 2F54D 4GINA 5TFSH 1CDIA 2Z1KA 5HGBA 2YD1A 1IC4H 2P8MA 5CGYC 3LZRA 4JW3A 1NOAA 1QSED 3ARXA 1N0XL 3UTSB 1TVBB 3VGBA 2QSVA 4JG5A 1PD6A 3VD5A 5IVOA 1IGJA 2JMRA 3AVEA 4JZJA 3U4BH 5I71C 2L7QA 1EO8L 3OKKB 2IGTA 4IRSB 2DWEB 4JN2A 4EXKA 3MRQB 3BW9A 4P59L 3IDGB 4BSJA 4NFDA 1BOGB 2DLIA 2W1NA 3N1MC 1OHQA 4P06A 1UFGA 4PTUB 1RULL 1DJIA 2XG4A 5C9JA 3L6FB 3VJ6A 3ARFC 1Z9MA 2YD7A 5CCKH 5C0CA 4GIPD 4WCYL 1CBJA 4GRWF 4ORZC 3N55A 4PBVC 1G0DA 4I0PC 2CIIB 4TQPA 5DO2D 1UWEH 3ZRFC 4ZMPA 3QORC 4PEEA 2PYEE 3EH4B 1MVFA 1YNKH 3T4YA 3LPWA 2HX7A 3EOTL 3VFPA 2PCXA 3BOVA 4HDIA 1NH6A 4FFYH 4G6JL 1B3JA 2F53B 4FGMA 4TS6A 2GFBB 5TF0A 1BDYA 3QVAA 1GZHC 2YA2A 5ENWB 1AIFA 4BH7B 5DMKB 1WICA 4JFEB 4FEMA 4JL2A 1BCIA 4QRTB 1KJVB 3B1TA 1ZLUK 1MHEA 2DQFA 2BP5M 4DUWA 3IDYC 1U58A 4ABWA 2VMCA 1A4AA 5CP3H 5IHUL 2BVEA 3LKPB 1SDDB 2V5RA 3AACA 3SDXA 4X0KA 2XDHA 3WNPA 2QZ5A 1AY1L 2AV1A 2NNAB 4J3OG 5LHDA 5CLTA 3NCBB 3BDYL 3VW3L 3HZ3A 1BEYH 3KGTA 2VSDA 1QKZL 2WLZA 2XYBA 4OV6F 5IF0A 4G9DB 1YEGL 2KYIA 3JV0A 2Q5BA 4QLRA 1I8LA 3FFDA 2QELA 3Q1EA 2HFFB 2R0WL 3SPIA 1MREL 3QC5X 2H1PH 4DKTA 2X70B 2FEEL 3LHPH 3HHRB 1AHMA 1A3RL 4APQB 3QDGB 4ZMWA 4MA7H 1NL0L 3FQWA 1IKNA 1CFBA 3WFHB 3IFPB 3W38A 1YRKA 5A2JH 5E6UB 1LNUB 4HBCL 2V5MA 4PRHE 1ECYA 3O2WH 1IBHA 3HI6L 5AVUB 2DQ6A 1YN7A 3S37X 4DZBB 4MJ2A 3C5JB 3WIIL 4ZX4A 3CMOH 3U36B 5ITBH 2PYED 1W9XA 5JORA 5D5MA 5FKPB 4LIQE 1WWWX 3ML8A 3BSGA 5JW4M 2OS7A 3EOYG 2VDKH 4XN2A 2OMTB 5GRJH 2OPCA 1X9LA 2IXQB 5GGVL 3VXOA 2JB6A 3CZLA 2MOQA 1JVLA 4TOYL 3ZO9A 1KEGL 1U8LB 3L3OC 3NAAH 2RH0A 4Y2OA 4LVHC 3JWOL 3BESR 4IOSD 5H37G 4Z9KB 3MROB 5HGHA 4LPWA 2OYPA 5DJ8A 2FSEA 5IBLD 3AU1A 2QVIA 1QSEA 3WNIA 1S7SA 5C0DA 1NCOA 3CNKA 4JFDE 3HAEB 4DP6X 4QO1B 1MJ7L 4HSQA 4X5RA 4D0BA 4L18A 4KKZA 1AQMA 1MNUL 1U4FA 1WZ1H 2YFNA 2ZUWA 4C59B 4X8JB 3TGXA 1BMZA 1QLFA 4I4WA 2AJ3B 2XQYA 1QA9B 3BLKA 4PH8A 1J0JA 3PL6B 1VACB 5D7KE 1E5AA 1L3NA 5I1GL 5EZIH 5AVWB 4HW6A 2XA8H 4Z7QB 3BVXA 2EO7A 1DBMH 2VMEA 3K74B 4UM9D 1QBLL 4HMEA 4NNPL 3TA4D 2XPYA 3L4TA 1J0IA 1RZIB 4M61B 1XF5B 4N8UA 4NKDA 1SPDA 5GS3A 3H9YA 4A2DA 5KWYC 2L4OA 5D6DC 5C09E 5CJOL 4I88A 2G5BA 2DQHL 2E9BA 3MGOB 4FA8A 3M1OA 1S8DA 1UD6A 2CO6A 2HTLC 3BLPX 3IRCA 2XTSA 3VFGL 5CSBA 4O4YL 3WS6A 3FRUB 4PRHD 3CFJA 5ALBL 4UANA 1UJ3C 1BQLL 3T0XA 4PJXA 1UWXK 3BXNA 1TO4A 3HC4L 4UU9B 1I7RA 3UEQA 3HE7A 1C12A 3VM5A 1SLWA 4O58L 2LLNA 2YFOA 5E8NA 4Y0GA 5C0RL 2EUZA 2PW1B 2SEBA 4H88L 4OM1H 3L5XL 4XNYL 3UAEA 5B4MD 3V4PH 5KSAC 1GYAA 3HAEG 3QZOA 3AXHA 1KENH 1OT2A 3ULSA 3VXRA 3GMOA 3T6QC 3MLTB 2JWYA 3OGCA 3RG1C 4G3YH 2WCGA 1B4TA 1U33A 4PRAA 5L6YL 3C8KB 4JFDD 5FCSH 1F58H 1LP9E 5JXAL 5MERA 4L8SB 3N50A 1JN6B 3GBML 1MSPA 3BGMA 1CYWA 3O6LH 4UOZA 1IEHA 4R7NA 4B27A 4JCMA 4BFGA 2Z35B 4G8EB 4I3SL 3W5NA 2EINB 2KMWA 1IFHH 4JO1L 4R96A 4XNZC 4FA6A 3BVDB 1OF2A 3VFOA 1P84K 1JHKL 5D1ZB 5IV2B 5L7XH 1M3JA 1I1AD 1BQSA 2I9LB 2CGRL 4QWWC 4XP4H 4FLRA 4JK0D 4AKQA 4O2CA 1HSAA 2X87A 4NLHA 4XPFL 5HGAB 2Q7NA 2EXTA 1NKRA 1SF3A 5ANME 2PYEA 5MEQA 4WJ5A 2BS8A 1HNYA 5CP7B 5C09D 5TFSL 1OTUC 3VD9A 2P43B 5FF6A 5DJ2A 1OPOA 1ZY9A 5KS9E 1IC4L 1NWPA 4GI6A 1HEJC 1VFAB 2IAMA 4QHKJ 1DQQB 3ARTA 4FFVC 4WGWB 1VA9A 3JYCA 1Y0LA 2BOCB 4ZUUA 3H42H 5DK0A 5FC9A 4DP0X 3QH3A 4IOSA 3U4BL 2UYLB 1FNEA 3VXTA 1QTPA 4LQ1A 4PS3A 2NW2B 3IN0A 4AV5A 1OM3H 3VFWB 1NGWA 1JP5A 3LRSA 3S4SA 5DRXA 5A16A 4B0MB 2GEEA 4BZ2H 1DQTA 1IV8A 3ES6B 5JHDB 4K8RH 1B4LA 5MENE 1LEIA 3CDYA 1R4XA 4DGIL 3NYKA 1SEBB 5LGJA 2MHAA 3Q06A 1N64H 5CCKL 3BKJH 4Y5VB 2B5IC 2WWKT 4FCHA 2CD0A 5EO0B 5JNYA 4FI8A 3DUUB 1SVBA 4G82A 1LP9F 1UWEL 2CM6A 5C0AE 1N70A 3BAXA 4P9HC 4XC1H 3BRFA 2GJ6E 1W91A 3ARGA 4LCWB 4UM9A 1YNKL 1LO4H 4OD2B 1I1FB 4L9DA 5TTRA 3CCHA 4FFYL 3S35H 1EAJA 3ELAT 4MCNA 4R84A 1S3RA 3E9UA 2X4NB 4MVBC 4L0ZA 3DRQB 3FQXB 1LK3L 5J6GB 2HRPH 4X9BA 4KDTA 3MRGB 4NRYA 1CPUA 2XXMB 4ZMNA 1OW0A 3KWVA 1K4DA 4OQTH 4PRHA 4S1RH 5I0VA 5BV7H 1G9NC 3C2SA 4LCUA 1YJDH 1FPTH 4BHUA 4A7SA 3DRTB 1MN4A 1KTKE 3DHJA 1H3TA 4DKEH 5KS9F 1GPOH 1AO7E 4KJQC 5T1LD 1XCTB 4OLVH 4Y5XA 1U8QA 1BEYL 4MNQB 5DFTA 1A5FL 3PWLA 1UQSA 1B0GA 1AHWA 2PCFB 1NKGA 3VMOA 4JQIH 2O6CA 3IMSA 3MACH 2PW2A 1MRCL 4YHOH 5JOFB 2F58H 3H85A 4PBDA 3ZL2A 2H1PL 3BGAA 4WEUD 3LHPL 4BINA 3KXFE 3VYPA 3AWFA 1GJUA 4LSPH 3NCFB 1XMEB 4F7EB 1UOKA 1MHPH 2I9TA 1IKOP 1LEKA 2P5PA 4A2EA 1I3GH 3BZ4B 3O2WL 5EA0H 3SE6A 4TNEA 4XODA 1A6ZB 4BUGA 2MPVA 3I9GH 2BIMA 1I1AA 3NEOA 3NFNB 3SYAA 3T0EC 2YBRB 4H4NA 3HCVB 1W0VA 5C0AD 3CMOL 5ITBL 2XQBH 25C8H 3H8NA 2GJ6D 3QIUD 1I3RB 2R1WB 3TT3H 3FJTA 3CG8A 4UUJA 2VDKL 2HZHA 3UTTE 4GKZB 1O5DT 3EJYC 5GRJL 5CFHA 3DBXB 4KJYB 5FECA 5IUSA 3T2QA 4Z3FA 2B0SH 1JMZA 4JRWA 1G7LB 4ZFFA 2DW5A 3L5WA 1F4XH 3WN6A 5C09A 2MTAA 2IDFA 2AHIA 4M7JH 1E8WA 4AWJC 4EF3A 1BLNB 2E46A 3ZHLA 3MNVB 4G7QB 2V2TA 4ZQTA 4KPHL 5ID0B 4ACPA 5B8CA 2DZEA 2R0ZH 3P3UA 1MFMA 3ZKXC 2KHAA 1WZ1L 3S36X 3APFA 1SUHA 3CFEA 4KRNA 5B7FA 2OV0A 1R3HB 4KJPD 5DUBA 3WFZA 4HKBA 1AO7D 4U7MA 4U6HB 2E7LC 5IMLA 4JKWA 4RBPH 3S97C 1X4YA 2Y6TE 3U9UA 5EZIL 3DJZA 1FL6B 2XA8L 2CSPA 1E9OA 1DBML 4W9KC 5JIMA 2F19H 4X9HA 1VKXB 1O9ZA 1AQKH 1K8IA 3I6GB 1LP9A 3H4FA 1KWGA 1SJMA 4Y2DC 2AV7A 3E0GA 3KXFD 1PJ9A 1JGEA 1XB6A 3KPOA 1LLAA 5MI0C 3RWDB 3PWUA 2ZICA 3QNYB 2ZTBA 1EX0A 4ISVA 1G1YA 2P5EB 4HLZH 2Q8AH 3TCXA 4P2YA 3ZL1A 3CLEL 4WO4D 2ZWKA 3E2HB 5ABDE 3R19A 3RGHA 1RAMA 4M48H 3RAJH 3DPBA 2XVGA 3IMWA 4GXUM 1UM4H 4AVKA 2B14A 1K8DA 3BPLB 1PG7W 3EJUA 1MUJB 3V2AR 3EGSA 2WWOA 4AEHH 3IE4A 4GSDH 2AGJH 5CD5C 5HSFA 2RAMA 5E9DE 1L5GB 3UTTD 1TTBA 5ANMA 2Z91A 3QUGA 5I66A 1YSOA 4X8CA 3UEZA 1MY5A 3V4PL 5IWLC 1GY2A 4PV9B 1KENL 4YDVB 3QFJE 1N6VA 2IALB 3QR2A 4JL1A 5KS9A 5DJDA 4Q0XH 3S8FB 3BJLA 5T1LA 1KNOA 2OMUB 4M8QB 3G04B 4A38A 4G3YL 2BWIA 4ETYA 4OLEA 1F58L 3MUZ1 2ATAA 5F88B 2MIZA 3QSKB 4PJAB 3VG9C 3PWPA 1NZRA 2YMTA 2NY1D 3UL4A 4WFHE 2JXMA 4ODTL 1EFXD 3BSZH 4I18B 4LP4A 1IFHL 1N3NB 5E4EC 4LRNH 2PWHA 3JVFC 3D25B 4HWZA 2MJWA 4M62H 1OCOB 3SDCA 2UV3A 4OLZH 4Q97A 1RP9A 3S8GB 5L7XL 1CD9B 1YEFH 5MENA 4AVHA 4P5RA 1CDGA 1T0MA 1YEDA 3EO0A 4ZDHB 4XP4L 2Z31D 2IQ9L 2BM3A 3RE0A 3BZ5A 3RWIA 2WOYA 3KL0A 3US9A 5IB1B 4APXB 1CG9A 5I82A 5FKAB 4LLMA 2X7LA 3KYOA 1HYSD 4WI2A 1DEEB 2YO3A 4KKAD 4TTDD 3BPNC 5C0AA 4UZGA 2CXKA 4OLYH 2G2RA 2OMXA 2WC7A 2GJ6A 3ARBB 1T5XA 2WLIA 4HUMB 4MA3A 2VM3A 5EBGA 2OMYA 4WENB 4GPVA 2Z4TA 3G7TA 1R3LB 3Q0HA 2H0FA 4M3JA 4OZIE 1ET8A 4NZUL 3MRDA 4MAYD 1RZKH 4F3FA 3SKOA 3H42L 2N7BA 1PKOA 1BFOA 4OZHB 3FB5B 4X6DB 4PJ9B 4MA1C 4WEMB 1LE9B 2Q0ZX 4EOWH 1CXFA 3NIGE 1WC7B 1OM3L 3V6ZB 5D7IE 1COBA 1NDMA 5J8OA 1JZ4A 2Q3ZA 2SODB 7TAAA 4BZ2L 2FH6A 5E9DD 1BVNP 1D6EA 2HVJB 1OD7A 2WQAA 3M17A 4AM0A 3P4OA 3V4VA 4K8RL 3RVUC 2NCMA 3LD8B 3N5AA 5I1LA 4L9LC 1N64L 1AO7A 3QFJD 5CGYD 3BKJL 4UQCA 2W95A 4B3EA 1ZVYA 2RMNA 4M9OA 1M7DB 1KBVA 1LM8V 3LN5A 4PB9H 2JQMA 4EE2A 1CT8A 1ZV9A 4X8GA 3CIAA 4LDOB 4RX4D 3T8VA 3TWCH 4ZFOL 4XC1L 5DYFA 2OYLA 4HIIB 2Z7ZA 3OKLA 4WFHD 1LO4L 5EWIL 3S35L 1XH3A 3CVHA 4QRUB 5TPWH 3KXFA 5CKAA 3DTXA 4P46B 4J4PA 1FBIH 5I24A 2H47C 4RAUA 5CEXB 3QI9B 3ARFD 1KCRL 3GJFB 2N0KA 1R5WB 5C7ZA 2EEFA 2HRPL 2KQNA 3X11A 5I19L 1YMHB 3ZHKA 4OQTL 4S1RL 4KU1A 4I0PD 5BV7L 1KBKA 3H6JA 3BEVB 3ET9F 1YJDL 1FPTL 3QORD 4PHZA 3EYVA 4YL4A 3E9TA 4YSAA 4I0CC 4ZTEA 3DX0A 1SOSA 3ECQA 3NCMA 4TNWK 4FQHA 4DKEL 3TA3C 2Y5QA 2IDUA 3UTTA 2G3NA 4OZIF 4KK9C 4OLVL 4HJ0C 4P07A 3Q3GA 4K3DH 4IKNA 5E1HB 1A1OA 4Z7VE 1A3LH 2BSCA 1A66A 1D9KB 1RL1A 1ZVSA 4JQIL 3NIGF 4PY8J 4E0RA 4HHAB 5CSZA 4DK5A 3MACL 4OZGB 5D7IF 5DD3H 4F9PA 4YHOL 2F58L 4TSAH 2YK1H 2OR9H 2CO1A 4LSPL 1ZTXL 3ISYA 1CJYA 4LVNC 4H5SA 1EFXA 4WJKB 2RFXB 1G7PB 1E4XI 1HWHB 3V0VB 4GO6B 1I3GL 2I60H 2ZAHA 3EUDA 4XMUA 5EA0L 5FUCC 4MMXC 2AAVA 4YHPA 3I9GL 4BQ8A 3D52A 4GG8B 2OR7A 4WK4B 2ZT9C 3Q6GH 2Z31A 5BNXD 2IDQA 4N3UA 4Z7UB 2XQBL 25C8L 1K9TA 5ICYB 1P7QD 4HBQA 3DROB 3B9KA 4MNHA 3HZVB 3TT3L 3C75A 2NLJB 2YUZA 1YQVH 3KM1A 5D71H 2UZPA 3ZT5A 1B9KA 2HPTA 2B0SL 3F8UB 1ETZA 1F4XL 5PAZA 2FGWH 3D85B 2QVMA 1INQB 3NCJH 5BJTB 2VLKE 3LMJL 3MUUA 4LSVH 1HS6A 5DUMH 2ZUUA 4CMMB 2ZCZA 1NUGA 3GZQA 1UGNA 2I69A 2AQ2A 2YLHA 4I87A 4NAMA 4ZFZB 2R0ZL 4X7EC 1SHMA 3PGDB 4HEME 5I1DB 3VWKC 3F5WA 1U8CA 4OCNC 3TYGH 1MQKH 1DO5A 2CR6A 5E9DA 3SHSA 2YPLB 3SPVA 1GJWA 2EE3A 2PPCA 5CKGA 1MLCA 4Z7VF 5KTEH 3GGWB 4OF6A 3QARA 4HAFA 3KBHE 4HFWA 5D8JH 3FPXA 1U9KA 4MDJA 3QFJA 4LXFA 5JQ6L 2DIBA 3B2PA 3QQNA 5KAQF 5FDYA 4L0YA 1S4IA 2F19L 1KCUH 1RUAL 1AQKL 2B59A 1SXAA 1I8KA 2DQJH 3KJ6L 3WY4A 4M43H 4WWID 1DVTA 1DQIA 4BUHA 1TIUA 4XPGH 2IIJA 4Y9CA 3FXIC 1JPST 2CCVA 2FJGA 4FTVE 4O2FA 5F7KC 2Q8AL 2Z8RA 4BGLA 3OLGA 5C2BH 1KG0B 4M48L 4EVNA 1WLHA 3ARFA 3RAJL 2EYSA 1UM4L 1UVQA 3M07A 4GYBA 1C8PA 2F2HA 1J88A 1J87A 4AEHL 4N0UB 4L2YA 3JVGC 1IC1A 2AGJL 3KDMA 4I0PA 3LHAA 4HULB 3HZMB 4XP5H 1BPVA 3QORA 4H0HB 4MFHA 1G7HA 4ALAH 3WKQA 3P11H 2J6EA 4GUCA 1WV7T 2FQFA 1PYWA 3CFQA 4KX9A 1VEPA 2H32H 5EUKB 1ED3B 3D34A 4P5KA 4UQEA 1LQSR 1DDHB 2GC7C 1F2QA 2HTLD 1RURH 2VLKD 1FHNA 4GBXC 4OZIA 3UZEC 3AXLB 4XC3H 5I76A 3A6CH 2FLRT 3GI9H 4DJMA 2QPSA 5KYUA 1PZ5B 3N04A 5K9OA 1DVZA 2H1XA 3BUBA 1Y7VA 7FABL 1MCNA 5D7IA 3BWAA 3BSZL 5ACZA 5EOTA 2WLLB 4LRNL 5LN8A 4M62L 5F9DC 3DXAE 2BVTA 4UDUA 4Y9FA 2DLFH 4OLZL 3GHEH 2X0VA 3I2CH 3WNMA 3ULUH 5KSAD 4RBPK 5BZWB 2PNDA 1XGTB 2EDDA 3KYAA 5JYLA 3U2SB 4DVBA 3O0LA 4U6YA 1Z6JT 5FB8B 4JGJA 3BPOC 1KCVH 2FJFB 4IBUA 5K1JA 3B7RL 2A73A 1XDTT 4GRLC 4LLWA 2YD2A 1FDLL 4OLYL 3PGFH 1P7QA 1Y07A 1YYLH 3FTYA 1D5MB 1BZEA 3HZYB 1IB5A 4FTVD 3EOBB 1SFHA 4L4VE 2WO3B 2R0KH 2P44B 1RZKL 3P9MA 2E7HA 1RFDH 1V27A 3AY2A 4PGJA 3DDFA 2EVHA 1LD9A 2APBA 4EOWL 4AYID 2H7WA 4OV5A 4A7VA 3AADB 4PJ7E 3OL2A 2APXA 3QRGH 3D05A 4WI9A 4Y4KC 3WFEL 4MMYB 3LCYA 3GKWH 3X12B 1X5HA 3O6FA 4CNIB 1JGLH 4JM0A 1OTUD 2MQ3A 1AKPA 1VFBB 2BC4B 3SBQA 4ZTOL 3U6XS 3VVWA 3GSNH 4XN9A 5CHNB 1AR1B 2N1KA 3QFDB 2X4RA 4FFVD 4PB9L 5IM7B 3ARWA 3L9EA 1QVOA 3L3OA 3PDOA 4G80A 5T5NG 4Z7VA 3TWCL 4XBPB 5DQJB 2DQDH 1AOHA 3I6KA 1UT9A 3G3LA 4HV8B 3QS3A 4BD4A 1P2CA 2BSBA 5I73B 2NT1A 5FS5A 4HEPG 1T4KB 3SJVE 2DM2A 3RP1A 3TESA 4I0KA 3UBHA 5EF2A 1QUNA 3MCYA 3DXAD 5TPWL 5BOZG 5CEYA 1H3XA 1FBIL 1X5LA 4MJIB 2ZSWA 4ICWA 1GS6X 5F6IC 5E99H 4UV4L 1I9RH 4BQBA 3CFIC 3MNZA 4XZUB 1QRKA 4KO5A 5SWSE 2FLBT 1WA1X 3KJ4B 4BZ1A 1X5YA 2BINA 3QDJB 3T0EE 4B9YA 1MAMH 3Q2LA 4JDVA 3MBEB 1T4WA 1H6UA 3S3SA 4WY7H 2LVCA 3FT3A 5EBMB 3FU9A 4AMWA 3GEWB 1L7TH 2MRYA 5FO7B 5F44A 3T4AB 3X3GH 3C6LD 1FYHB 5F6HI 5ADPH 2F0CA 3QWNA 4L4VD 2A6KB 5E6IA 1AS8A 5D6DA 1QLRA 5FGSA 4MVBD 2V8LA 1A3LL 1OE1A 2MNJB 2VLKA 4ZUVA 5IROC 3JXAA 1TG8A 4NYLB 5DD3L 4PJ7F 1XD0A 2BFGA 4KAQH 4YIQA 1NCIA 4TSAL 1XR8A 2VDRB 3GZOA 4JKNA 1A4BA 4LZKA 4Z77A 1QTSA 4HEMA 4NUJA 4ZD3H 3O8XA 5IB4B 1E28B 1TQTA 2MQ0A 4EZJA 5I6NA 4KJQD 3IGAA 1OTTC 4PCTA 4QD2E 3JWNH 3MYJA 2I60L 3MRPB 4I1RA 1JNHB 1AGEB 5C0EA 4G8GE 3VE0B 1ZT1B 3Q6GL 4WV1C 4F2MB 1BD2E 3QQ9C 4N0YH 5D7EA 3OQRA 4BFKA 4ZXBA 1HHJA 4ZODA 1PX8A 3WEXB 4KNTA 4BWTA 3SJVD 1YQVL 2OTPA 2Y5TA 3MR9B 5HDBE 2AK4B 5D71L 1OP5H 2DYPB 4UAOC 3MMEB 3EG9A 1O9VA 4OF7A 5I2IB 4L1HA 2FGWL 4AQ8A 3NCXA 4ELME 3RPIB 2BP0A 1E2VA 4C56A 3HPLA 3NCJL 3FOMA 3PJSB 2X05A 4FTVA 2JKIS 4NO2A 1TZ8A 4LSVL 5DUML 4F9LC 4HUNB 3QRLA 3WN5B 4BKTC 3ULVC 3WXVH 5SWSD 1DJHA 3T0ED 3DSFH 2VW7A 1LQBC 4JFTA 3DMMC 3SGJC 4AIEA 4J4PC 1D5BB 2R0LH 2VLJE 4PS8A 1U8MB 4N2AA 1IAOA 3TYGL 1HQRB 2ADYA 4QRRB 5IHBA 3EJYD 2H3NB 3FB6B 4HJIA 1AQ8A 4FQIH 3QUZC 3AT9A 1UD2A 3QW9A 1GR7A 1JXKA 1MW2A 5GGSB 3FMGH 2AXJA 3CLFL 3EYOA 4NFBA 4OCWH 1O7VA 4TUJA 5KTEL 1DTUA 4RCAA 1FVEB 5KVGH 4EN3C 3L8QA 4BK8A 4D9RE 1KCUL 1AQDA 3GHBL 1AKJB 3BISA 5DJXB 2DQJL 3OKYA 5FYKE 3HZKA 3PWVB 4M43L 3C12A 2FX8H 2AEQH 2WD0A 4G8FA 5FO9B 2YC1B 4HX1A 1EMTH 5EBLB 5JYMA 3OG6B 4RQQA 2XQYK 4IIQA 3RX7A 5C2BL 1NFDB 3T0DA 2IOMA 4KBPA 3HLAB 3QE5A 5I5MA 1JWUA 4JAMB 4G8GD 4HC1A 1BD2D 4JQXC 4A37A 4XCEB 1QSVA 3MO1A 5ETUA 2GUOB 4N24A 3B3IA 4Y1SA 1MFEL 4GRMA 1NCWH 4OJEH 5HDBF 4BQ9A 4XP5L 3II3A 2XN1A 1M05B 1TZIB 4Y2DD 3QPKA 4ALAL 3P11L 5I5RA 2BSED 1ID2A 3NQIA 4IKJA 4ELMF 4UQIM 4KKQA 1E7UA 2CHXA 2OQJB 3S8WA 5DRNA 1N4XH 3WS3A 3VFNB 1RURL 3KGUA 4AIZA 1G9MC 2JF1A 5SV4A 4L4VA 3VXNB 5D96B 4XC3L 1JE6A 4CGUB 1EVTC 3A6CL 4LLDB 3GI9L 1T1YB 1DSYA 2Z34A 4YSRA 3CXFA 5AOLA 4L8CB 2J1ZA 2VLJD 4WO0A 5AUMB 5I8CA 3CSYA 3TBBA 4OT1H 3EO1B 4AH2B 5IHHA 4ONHA 4IGBC 1WFNA 5E2VH 1ZV5A 2EDEA 3V0WH 2DLFL 3Q05A 4P05A 3GHEL 3ULUL 5TK4A 2NUTA 1NAMA 2AZAA 3US1A 4KRPB 2XX0A 3HE6B 4D9RD 3AGWA 1KCVL 3DNKA 5E51A 4JVPA 5DRWA 4JM2B 3VQ2C 3LIZH 1DQDH 4K23H 2WWMC 3J07A 1IQDA 4P9MH 5FYKD 4RFNB 4OKVA 3PGFL 3AB0B 2J44A 3BKMH 2G9HA 5TE6H 4JHWH 3OJDB 3SJVA 2PCYA 1E4XH 3ALWA 3OGOE 4FYSA 3RVVC 4QXUH 2R0KL 5ELIA 1MOEA 1T03H 5D9SA 1RFDL 3BQUA 3K6DA 3MKGA 3HR5B 2BNUA 4NQEB 2HJLA 4UM8B 4CN6A 3AZUA 4ODSH 5KSBB 3VCLB 1E2ZA 5CJBA 2Q2EB 4N20A 5SWSA 3QRGL 1GIGH 4BRVA 3RWJB 2XYCA 5EUOE 1PKQA 2AEIT 5C08E 3HG5A 3GKWL 4DUVA 3TL5A 1JGLL 2H9GB 1I4FB 4TM9A 1UEYA 4JCWA 3LN9A 4YPGA 1I8MA 4GAYB 3GSNL 1QR1B 3LRHA 2ZJSH 3I6SA 3BDBA 3A22A 4Z3TA 1K5WA 4QAMB 2HH0H 3F7QA 3WNJA 3GDBA 1CFSB 5D1QB 3G9AB 2CNYA 1WT5C 1ICTA 3W81A 3UXFA 5C86A 4H1LB 3SQBB 4UILH 3I9AA 2APTA 4LHQB 2PPEA 2VLLB 3TNMB 1KN4L 2AQRA 1SMOA 3RVUD 4WNQA 1BZ9B 3T1FB 2JKJA 3W39A 1KYOJ 2EACA 1WFOA 1L9NA 1CLZH 5HGBB 5E99L 4FJ6A 2P8MB 1I9RL 2E7LA 5FUCE 3KYNA 5EORH 5GSRA 1MAML 4HJJH 1UWFA 4QHLA 3D33A 1BD2A 3O41B 4WY7L 1IGJB 5I8EA 1DLHA 4JZJB 1L4IA 3KL3A 5AW1B 2VL4A 3CHQA 2H4EA 5CEZH 3C09C 1L7TL 2I7OA 1AIZA 4HXAH 4JN2B 15C8H 3BW9B 5SV3A 1G6RA 1UZGA 1LGVA 2ITDA 3H3PH 4Y2DA 1X5KA 3FU0A 4NRXA 3L45A 4I13B 2BSEA 3DECA 4J23A 4DN4H 2DL2A 1CFQA 4ELMA 5EDXA 2EUWA 2XG4B 5C9JB 5F3FA 3VJ6B 4TF4A 2BY0A 2YQ2A 5C0CB 1AYOA 1CYXA 4XOBA 5JIPA 5HJGA 4L4TE 1MCRA 3ARPA 4A66A 4KAQL 3UPAA 5EUOF 1UH3A 3O4LE 3P3SA 3Q2NA 5C08D 3IVKA 4EUPB 4YSDA 2VLJA 3ZDYE 2QFRA 3K5SA 3GBDA 3T4YB 3FO2A 3TA3D 1H8SA 3VFPB 4HDIB 1U91A 4KK9D 4HJ0D 4XP1H 5DD5H 2BHUA 3GMLA 4EDXA 5IWLA 4HCRA 1M1SA 1Q0YH 3JTSA 1AIFB 2WY3B 3PAYA 4TSBH 3ZE0E 4P8QA 1YZZA 1IBDA 2G3XA 1MCFA 5JIKA 3LQAC 3X1NA 3PJLA 1OGPA 2IO5A 3FQYA 3O3UN 4KKCC 5D93C 4XRCA 5HDQH 1MHEB 2DQFB 1E67A 2E7BA 1U58B 4JEGB 4Z7WA 4FFZA 3SDXB 1R6VA 4X0KB 4NZDA 1X6NA 1HU8A 2AV1B 3C60A 4WKZA 4MD5A 1JF1A 1ES0A 5AKRA 3IJ9A 3CJJA 4A68A 4FKEA 4XXDA 3BAIA 4JG1H 3H1ZA 5JLZA 4HPOL 2WCPA 3US0A 1JK9A 3OAYH 5H2BA 2FUQA 1CGXA 4U2YA 3TN0C 4DGVH 3MREA 2MH4A 2EDKA 4F7KA 4PJ8C 5CILH 3REWB 4HKZA 4OFYD 4J28A 1JTTA 3TTYA 1G1KA 4UQDA 2DBLH 3FMGL 3FQWB 2DM4A 4OCWL 1GSMA 4TVPE 4RMQA 4NUPA 2OCCB 1CE1L 5KVGL 1I3VA 5PCYA 1ZEAH 3KCPA 3ZUNC 3NPZB 5E2WL 4L4TD 3CH1A 3AY4C 4B6ZA 2FX8L 3O4LD 2AEQL 3OHMB 3VWKD 3S6CA 3ZDYF 1EMTL 4X83A 5JORB 5D5MB 1UXSA 1G7QA 2Q8BL 4YSTA 5KOVC 1V54B 3WO4C 5AW6B 4F27A 4TNGA 3VXOB 4NC0B 5LGKA 2JB6B 2F54B 2O93L 4IJ3B 4JCLA 4Y2OB 1S9KC 4WTWA 3ZE0F 3B6SB 2XFGB 3H3KA 4XHJC 5HGHB 2HT4C 5DJ8B 2FSEB 1DUYA 2ZXAA 3AU1B 1QSEB 4CN1A 1PJWA 1S7SB 1NCWL 5C0DB 4V33A 1MCQA 1HSBA 3BDXA 1BAWA 4EAEA 1TQWA 1T5KA 4JHZA 3SE9H 4L1SA 2G0LA 1T6VN 4M5YL 5F96H 5EN2A 1QLFB 1N4XL 4I4WB 3DV6A 2Y1ZA 2CUHA 1WO2A 1HZKA 1MFDH 4FYQA 1F00I 2C1OA 4Y16C 1KLFA 4A2GA 2HG0A 1KBBA 1DZBA 2DI9A 3LTVA 3D2TA 4PLKC 4F7TA 4GRWB 4OT1L 4ZO8A 1QTYT 3BYYA 5D4HA 2GEQA 5E2VL 3V0WL 4NKDB 4NSKA 5C08A 4AE1A 2EEAA 4X5QA 4NZRL 1NQBA 4RFEB 4XX5A 4OLXH 2G5BB 3V6OC 3TA3A 1BLIA 3FB7A 2W80C 1C7SA 1XCQA 4TVPD 2YN5A 3UACA 1Q38A 2JI3A 1S8DB 3DIDA 3VU2A 4GBXD 3HRZA 4QRPA 3CFJB 4R26H 3PJNA 5C7XH 3CZFA 5IJVA 2AQSA 3LIZL 1DQDL 4K23L 1IVTA 3BXNB 1I7RB 3HE7B 5J3HC 4Z1PA 5TE6L 4NKMA 4JHWL 1DQJA 1JV5A 3L9RA 5E8NB 3V5HA 3JTTA 1E4XL 3OC8A 1E9QA 2E9JA 2SEBB 3QUYA 4QXUL 5DFAA 2VITB 2X0UA 5HGGS 4UB0H 4WHYH 1J0YA 2ROYA 2XN0A 4CMHC 1UC6A 3LSOA 3QZPA 3ZDWA 5F0JB 3VXRB 4LU5H 3GMOB 3OX8A 3CMGA 2FCBA 4ODSL 1EWHA 4AL8L 4MMXA 4XVTH 2VAAB 4LSQH 4YDMA 1GIGL 1M9WA 1MW1A 3GRBA 4JFFE 4GRLD 4PRAB 4UI2A 4DKFL 5GIRA 2XQYG 2NY7H 5MERB 4G6AC 1OF0A 3IDIA 4MXWH 3BGMB 3DX2A 4R7NB 1O5PA 1X7TA 1EGJA 4JPVH 3H9HA 2ZJSL 4LKCA 5D7SH 4K7FA 4R96B 2IFFH 1SDAB 2QTVA 3UCQA 1OL0A 2A9MH 4OFYA 5IMMB 1OF2B 3VFOB 1DZ0A 1FNAA 3EYQC 1V10A 2HH0L 3E8VA 3GXMA 4HQQL 4N2DA 1B90A 4W68A 2RBLA 2BIIA 3WFBL 4DEPC 1JWMB 5I5IA 2ODHA 1J0HA 1YN6A 3CBKB 4O2CB 1HSAB 4XN5A 5EV7A 2ICES 4Y4KD 2XPZA 3O4LA 1X4XA 1UM5H 1ACYH 2X28A 2CMRH 5K9QI 2PYEB 5MEQB 4WJ5B 4AUYA 1T21A 5FF6B 2B1HH 1CLZL 4GT0A 1A22B 1MVYA 3IJEA 2IAMB 3OJMB 3FB8A 5EORL 2B39A 2HXAA 3GSRA 4MQ7A 5GRWA 1ZVNA 1Y0LB 4M6MH 4ZUUB 5DK0B 3ABKB 3FSVA 3L1FA 3QH3B 4L29B 4R7XA 1LYQA 5C70A 1SLVA 1FNEB 3VXTB 5HHQA 2ZP9A 1E0OB 3KPSE 4QTIH 1NPNA 1DQLL 1MCJA 1NGWB 3LRSB 15C8L 4HXAL 4WJG3 3S4SB 5DRXB 3OZ9L 4RIRA 4DN4L 2MNWA 1EZLA 5FUOL 1J5IA 2K0RA 1LEIB 3NN8A 5LCVL 4BJLA 2ZNWA 1V7NH 5LGJB 2MHAB 1D7CA 4YE4H 1EA9C 3ULVE 3FL7A 2WYZA 3ZPDA 2HPOA 5JNYB 1SBBA 3RX8A 1N5AA 2XBZA 4JFFD 2WXPA 4BA8A 4LDCA 2FJUB 2MQCA 3HN3A 3QO0A 3VDCA 3F7PC 5E00A 4J3OC 4NN6C 2YIHA 2DTMH 3ARGB 4POZD 3JVGA 4JPKL 3V5DA 4UM9B 2H41A 3ESUF 2V4LA 1X7QA 3NRPA 5J1SC 3CCHB 2OYKA 2VXVH 5DD5L 1ZV2A 5AZEL 6CGTA 4PI2A 1OGTA 5G2NA 1IIIA 3OSVA 5B1CA 5FM4A 3UJTL 1N7MH 1XVSA 1Q0YL 2PN5A 4TVSa 2VB5A 5IROD 5IW3A 4C4UA 4GBXA 4NRYB 1TJGH 4TSBL 3UZEA 3JV4A 4PRHB 1K4DB 4LNRA 4YX2H 2P7TA 1R5IA 4NPJA 4LCUB 4QXGH 4CBZA 2E59A 2R2CA 5HDQL 3QDME 4GKOA 3ZRCC 4O5LH 3DX8A 5IFHH 3GXIA 3KYMA 3KPRE 4GQZA 2JTDA 1OT4A 3CHOA 5LG1A 3HI1A 2W9EH 4ZMYA 1OTTD 1MWAH 1TTGA 2KDGA 2VERA 4JGNA 4Y5XB 5IMKA 1U8QB 5JW3H 3ESOA 3DJRA 4JG1L 3H3BC 3PWLB 1YPZE 2GCYA 1UQSB 3QQ9D 1B0GB 1AHWB 5IHWA 2X88A 1OLZA 5EU4A 2UXTA 2WN3A 4DGVL 3KPSD 4X5XA 3K80A 2PW2B 4U6VH 5CILL 4GRLA 2C1PA 4JFDB 2GI7A 2YMOA 1I7ZA 3NGBB 4YAQA 3MUHL 2WLJA 2DBLL 2NQDA 4FNPA 2VC2H 3B5GA 2FSDA 2G5RA 1DO6A 3F12A 3WEMA 3MJ6A 3ULVF 1LEKB 3PU7A 1ZEAL 3ULVD 5EOCL 2XZCH 2WANA 1YYCA 2VDLB 2JJUA 1I1AB 1E9PA 3DMMD 4YJZL 2R2EA 1W0VB 2XCMC 1A14H 3TFBA 2O72A 4M7LH 4F7PA 2AKRA 3P3YA 3NFPB 4L8BA 1KF9B 3QUZD 2BP8A 2YRZA 5ACLA 3BYTA 5IBUG 1QSFA 4ZFFB 1PBYA 3L5WB 5C09B 3VA2C 1VB9A 2IPUK 1TJXA 2DF3A 4K0OA 5I17B 4EN3D 3ZIYA 4PJ5A 5I0ZA 4CILA 1GS8A 2A6JA 2OAAA 4X99A 3KEDA 2V2TB 4XWOC 3CFTA 3PHOA 4NZFA 5B8CB 1I7TA 3QDMD 5CCGE 3BFQG 1BIHA 3KPRD 4DERA 3CFEB 2J56A 3RNQA 1S9YA 4AC4A 5DUBB 3AMLA 4Y1TA 5E8PB 4ZX5A 1DJGA 3QXUA 1MFDL 2NZ1A 3HKZA 5IMLB 3M7FB 3SDAC 5F9OL 1HDMA 3KZ8A 1NBZA 1RZ8A 3FUMA 3LNFA 2NY3C 4H8VA 3V7AE 3MLUH 1E9OB 3NA4A 4YC2C 3OAYK 4XE0A 4OJDH 3MOBL 4PVBA 1XT5A 5J9PA 5E1GA 2DYSB 1K8IB 4JFFA 2WOBA 1MJJA 2ZSVA 4LEXH 1LP9B 4MASA 1M9SA 1VZHA 1JGEB 1Z9NA 3KPOB 3AWGA 3PWUB 4OLXL 4ISVB 4ZPVA 3ZTEA 5T1MA 1LDPL 2IDTA 2FR4A 1F4YH 1ZAGA 4R26L 5C7XL 3V7MA 4PGZA 3RIAK 4JKMA 4BSWA 4LOFA 3ZXAC 1FJ1A 5IROA 3Q8CA 1K8DB 3EGSB 4PPTA 2WGXA 1WCQA 2K4WA 3NCWA 4B7LA 4NT6A 1OAXH 2I07A 5ANMB 2Z91B 4UQ2A 3VFTA 5LUMA 3BKCH 4UB0L 1YYML 2TRHA 2QDWA 5KS9B 2GSGA 4LU5L 3FCBA 5T1LB 1KNOB 3QULA 2PO6C 3GXTA 4LSQL 1RQ5A 3F84A 4WV1A 1ZOXA 3QJVB 2WWMD 1HWWA 2G2NA 2NY7L 4X6EA 2D4FA 3PWPB 3JWNG 4JFXA 4MXWL 3KPSA 2OZ4L 2ZIDA 1T1ZA 2JXMB 2A1WL 4G9FE 4JPVL 3NFSH 5D7SL 2IFFL 4H8HA 3RVVD 2A9ML 3SDCB 2ZOTA 2WXGA 5EB9A 1VFOA 4YH6A 1L0XA 5MENB 4IS6A 1T0MB 1YEDB 1UT2A 2YPKA 1KJ2H 4PJIA 3RWIB 4F9LA 2P80D 4TLSA 4K9EH 4AI7A 1CG9B 2QADC 2QQLH 2F68X 2X7LB 4G6KL 5JPMC 3KYOB 3SYCA 1P84J 1TQBB 3DMMA 3SGJA 1PLCA 1UM5L 2EDLA 1ACYL 3DGGA 1FAKT 2CMRL 3CAFA 1TEGA 2G2RB 2OMXB 5C0AB 2GJ6B 4Q9CA 1R3JB 2WLIB 1T5XB 2VDQB 1HXMA 4MA3B 3SCMC 3P9LA 2B1HL 3HJEA 4MB3A 5JR1H 4GLRI 2OMYB 4ELDA 1U3HA 2O6EA 3U30B 1KXQE 4IU3A 1TMCB 1XO8A 3Q2WA 4N1HB 4F3FB 4MHHI 2ENYA 4MJHA 4M6ML 3SGDH 3SKOB 1BFOB 1FUNA 1G7MA 2BH0A 4DP5X 4U1IA 2XIDA 3V8OA 1CF8L 2AVGA 4QTIL 1Z7JA 1IC0A 2C4FU 2X3BA 2VDNB 3IETA 3LEVH 4NPYA 5I1EH 1NDMB 3T1WA 4CUCA 4LLUA 1JHLH 5F72S 4F33B 1D6EB 3QDMA 5I16A 3M17B 3LXBA 2WP3T 4AM0B 3P4OB 3V4VB 1C08A 3KPRA 3GMQA 2YKLH 2WZ6A 4WKXA 3UYPA 1V7NL 2AQPA 1AO7B 4YE4L 3K1DA 3S35X 2NXYB 3LN5B 4LQFH 1FO0A 1UM6H 5H35A 1CT8B 1WUZA 4YDLC 3QA3A 1JRHI 1P5UC 4I2XA 3L3GA 3IB4A 1Y1DA 2DTML 1MCHA 1IEAA 2YQGA 3DX9B 3H2WA 3OKLB 5HJBA 3GO1L 4G9FD 1R34A 4FG2A 1P7BA 4UZUA 2VXVL 3CVHB 4H8PA 3ZLQC 1UCTA 3KXFB 3Q8BA 3G9VA 3DTXB 2R56H 5EOCJ 3KHOA 4RAUB 1RZPA 2GUYA 1N7ML 1TFPA 2CA4A 3VH8A 1XCWA 1TJGL 4N6RB 4WO4B 1Q8MA 1JFQH 4TRPH 4YX2L 3SZKC 3TEZA 5CZXD 4W4OC 5IFHL 4O5LL 3EYVB 1BG1A 1OZTG 4M4PA 4LLVA 3TJPA 5J13C 1XV8A 3FCUB 4FQHB 4IGBA 1MWAL 1H8OA 4G43A 3UTTB 1ZSDA 4JHVA 3CXHK 3Q3GB 5JW3L 1GSKA 5TDPA 1HL4A 3GUTA 1A1OB 3A21A 1OSEA 4DQOH 1ZVSB 2GBVA 1RHFA 5CSZB 3TZVA 4KKBC 2Z4QA 4U6VL 1FGVL 1T20A 2R4RH 3PP3K 3TV8A 2YZ8A 4LDEB 4D0DA 1SNRA 3LEYH 2VC2L 5HHNB 2LFEA 1XF2A 4H5SB 4E9XA 1EFXB 3FSZA 1ZLDA 4L37A 1D7FA 3J2PA 3MCLH 2XSKA 3MA9H 1I9IH 2D31B 5FOBA 2B4CH 2JV6A 1IAIL 3ATBA 3ZKSD 2XZCL 4YHPB 1QLEB 2ERJC 4K15A 2K1MA 3GS0A 2Z31B 4NQCE 2P80A 4NB7A 1A14L 1YEEH 4PGCA 2DQCL 4M7LL 3TN0D 1IE5A 2W0KA 4MNHB 3CN1A 4PJ8D 3CQPA 1LO5A 4I9XA 4PVNA 4QJ4B 1F6FB 4HETA 4MCZA 1QPKA 3V0AC 1IEBA 1T5WA 5BZZA 4PR5A 3IRPX 1XIWC 4W70A 2NNRA 3ISRA 1ETZB 3G5ZA 3V6OE 4XCNA 2WQUA 4OFQA 4R0LC 2EADA 2JIXD 5DI8A 2OJEA 3VGDA 4F8LA 1D5IH 4KNSA 4YBLC 2A74C 3IBOA 4H0IA 1Q9LA 4EUPH 3L4VA 2MOGA 1AC6A 1XWVA 1FN4B 4H2CA 2DMGA 2VRQA 4Y19A 3C6EA 3F5WB 4GP5B 3A67H 3MNWB 5AKSA 2QGCA 3QXVA 5E9DB 3NEEA 1RY7B 2R39A 3QEUA 1BMGA 1MLCB 4HFWB 3MBWB 4MKMA 4Y9GA 3GM0A 1VF5C 2GIXA 3QFJB 3MLUL 4IQHA 4MDJB 4XHJD 3S3PA 2XIIA 2HT4D 4KQ0A 2VXSL 3HEIB 4KJWC 5LBSH 2B59B 1I8KB 1S7XA 4AENA 2GTZA 2XRAH 4LEXL 2FEDC 4UT9H 4PUBH 3KLQA 4A2MA 2DDQH 4S11A 2Q2LA 4G9FA 1SGKA 5FA3A 2FJGB 4O2FB 5DZJA 4YWGL 1Q4NX 2B77A 1HHIA 1F4YL 3HMXA 4Y16D 1BFTA 3NSCA 4EVNB 4HUXA 3ARFB 4NQCD 1KIRA 1UVQB 5FYJH 3O2DH 4PLKD 1HAUA 4L1TA 3KPLA 3KDMB 4I0PB 4AKPA 2R27A 3QIBC 4LF3A 1J0ZA 3QORB 2J6WA 1G7HB 4B9PA 2ZUTA 2CHNA 3BKCL 1KPVA 1PYWB 5I9QC 4LB8A 1YAIA 4P5KB 5BOPA 1UADC 2BY1A 1CGYA 4OZIB 2A2QT 5I76B 1RUPH 2YD4A 3TBVA 1PLBA 3ZYJA 3CVIH 5J3HD 5KYUB 2I85A 3IFLH 5K9OB 4J2XA 3NIGB 3QUMA 5T5FL 3OPZH 3FSAA 3WTXA 2A5UA 1BOYA 2NQ3A 3BWAB 2IPUG 4JUSA 5D7IB 5EOTB 3NFSL 3PABB 3ZTJH 1P0SE 4QY8A 1EVUA 2G60H 4UDUB 2K3HA 2Y2YA 5C92A 1P4IH 2AJZB 2CNZA 1EDQA 1OCRB 3BHBA 1WITA 3TYFA 2Z92A 3B7YA 5IEHA 4XPBL 4W9JC 1H3UA 2FQGA 4DVBB 4U6YB 3N0PB 4AYGA 3CFMA 1AGFA 1CDBA 1KIPA 1OTSC 4AEEA 2E9WA 2A73B 4NM4H 4N1EA 1EHLH 1R24A 5HJ3A 4G6AD 4LLWB 1OEZW 1PQZB 32C2A 3TN0A 3NSXA 3T3ME 1P7QB 2Q20A 3G5YA 3K2MC 4PJ8A 3MNMA 3UTZB 1E4KA 3UBGA 5JR1L 1J9SA 1H3VA 1OCCB 4R7LA 1D2OA 2NXZC 2ZYRA 3NABH 2PPFA 1SHXA 3EYQD 3QXWA 3OVUB 1HOCA 3RFZC 1U30A 3RVXC 1JWSA 2C9PA 3LQZA 3P9MB 3SZ6A 2EUXA 3UTQA 1XSKA 1LD9B 4LGRB 4XPTH 4DO5A 3K71A 3JWOC 5I1EL 4OV5B 3LEVL 2J12B 4ONOA 3VX1A 1JZ8A 5CBEA 4WTZA 1JHLL 2BVOA 3KNBA 2QTEA 2X9ZA 3AC0A 2XPGA 2NMSA 1AZCA 3LV3A 4LKXA 3L16A 4WI0B 1XGQA 3FT2A 4M1DH 2ZUXA 2YKLL 3A23A 4FI6A 1CBVH 4XVJH 1A02N 3EH3B 4CRPA 2EZ0D 5IJCC 4GAGH 1U6AH 2X4RB 2Z3FA 3UH8A 1GA2A 4LQFL 4P5MA 1UM6L 5CGTA 1QVOB 3L3OB 3IS0X 4Q14A 5KUKA 3VI4E 3PDOB 4G80B 2AQ3A 4Z7VB 4BQCA 2CAKA 3ZSSA 3A6OA 3I6KB 3K2UH 1KZQA 2F8IA 5BRZA 2VXUH 1P2CB 3F85A 4X6CE 1JAEA 1FL5A 1MEXH 3Q8EA 4FNQA 5LDUA 2VDMB 3ABMB 3LQMA 1QUNB 4Z76B 2KPWA 5CEYB 4M5SA 3T6XA 2R56L 5ESQA 4C4BA 2ZSWB 3KM2A 3VDBA 4FP8H 1EFQA 4O02H 2X2IA 4MQTB 5TE4H 5T1DH 4Y16A 1JFQL 4TRPL 3IM1A 4MS8C 4JDVB 4HJ1A 1CE6A 3E6HA 4J3OF 4NQCA 4Q6YA 4URTB 5D7JC 3F00A 4J3OD 3T3MF 3FT3B 2NY6B 4L5FH 1ILSA 3P69A 1NLBL 5AEAA 4QHUB 4XTRC 2JB5H 4P3WA 2EUVA 4A2HA 2XV3A 5E6IB 4KC3B 1QLRB 4P46C 3FO0H 1RPUA 3V6OA 2MFNA 4HFUL 5IEKB 2VQTA 1A4KA 3GSVA 4FMFA 3UAJC 2VLKB 4ZUVB 3SO3C 1Z0NA 4HU2A 4NLAA 5ID1B 5B39B 3VXUE 4JDTH 2R4RL 4OTXH 1UJ3B 1UCBH 4L4JA 4KZDH 3PG2A 2WXKA 1XR8B 4Z77B 1JZEA 3OSKA 4NUJB 5CN1A 1C5DB 3HOGA 3LEYL 1J9RA 2UZIH 3O6KH 1FYTE 2EAEA 3VQLA 1W0YT 3DJSA 2CWRA 3AT8A 2AK1L 1VADA 1AZZC 1XH1A 2CUMA 3IGAB 1I9IL 3MCLL 4JZOA 4PS7A 3MYZA 3VSTA 4ZW3A 2B4CL 3MYJB 4HK3J 1PLAA 1P7HL 4E41E 35C8H 3B7UX 4N2EA 5C0EB 2ZWNA 3QISA 2VWEC 1BVLA 3MGTA 1YEEL 5JIQA 2VLME 1W6WA 4X6CF 5DFWH 4ZXBB 1HHJB 2ZE0A 4JNXA 1PLGH 1HCZA 1ZHLA 4DWHA 1BF8A 2Y5TB 4P3CH 2Y36H 4MJ4A 1T22A 2CPUA 2X9XA 3SBPA 1DFXA 3EG9B 2HVKA 3MODH 4C57C 2BP0B 4FTDA 4B9CA 1D5IL 4NN5C 3FOMB 4PJEE 3D4YA 4FTVB 4XB8A 4NO2B 4XNZB 3WDJA 4YR6A 3EZJB 1TYRA 4EI5C 4JHBA 5DJAA 3GIZH 4K5OA 1BP3B 1FNLA 2O6DA 3IPEA 1AFVH 5I8KH 4QR7A 2RCSH 1DVYA 4MQXC 5F7UA 1IAOB 4WFEE 2WO4A 3OMAB 3A67L 4Y2NA 3FNKA 3M86A 2QQKH 1QFPA 2OI9C 2E27H 4P04A 3EKCA 4KX7A 4HMCA 3EYOB 4XO5A 3RZCC 2JFCA 4U0QB 4TUJB 2IDSA 1Y1UA 1HAWA 1QOKA 2C4FT 4M8RA 4XBGB 5B7MA 2P3YA 4NC1C 3BE1H 4FLQA 1XEUA 3X3FH 1TVHA 1U8NB 5LBSL 3MLSH 3VXUD 2FT7A 1AQDB 4QTFA 1CF1A 1FE8H 3C2AH 4YN3A 5FYLH 3HZKB 3MRLA 4A6YA 2AQTA 3ZKMC 4PUBL 4AMXA 5K69A 2DDQL 3U46A 4S1DC 4HX1B 3QT2A 3L7FB 1FYTD 2ICWA 3WIHH 2YD8A 4RQQB 4Y9BA 5LDSA 3ME0A 1QR4A 3DJ9A 4ODVH 5L4IA 3SDAD 3V0GA 4FHKA 4E41D 2ZG1A 4PQXA 1JWUB 1DE4A 3KH3A 2NY3D 2A4EA 5FUZH 2R51A 3F7VB 1ETB1 5FYJL 3ILDA 2B5IB 5IQOA 3MO1B 2VLMD 2AXWA 5C0JA 1PX4A 4F15C 3B3IB 2D8KA 4GXVH 2D73A 4GRMB 2ISDA 3VWJC 2XVKA 3KAAA 5AYTA 2L0DA 4MWFA 4PSPA 4PLOB 1OE3A 1BXVA 1CN4A 4PJEF 1W72A 1CIUA 5GRVL 5DRNB 1CFMA 1F02I 2VO8A 3PXJA 5K93A 3WS3B 3LKNB 1FCCA 2UUDK 1WH0A 2VDLH 3SN6N 4AIZB 3WAKA 2EVIA 3PL6D 4DUXA 4L4VB 4L3EE 1BMWA 3UJJH 3WDHA 1LVEA 1W6LA 3CZJA 1GW0A 3MLZH 5F0MB 1T1WA 5EFIA 2H6UA 3SOBH 3IFLL 3R0MA 4QRAA 1BZ7A 2CDGA 3OMIB 3OPZL 5I8CB 2RTTA 3CSYB 4WFED 2WO2B 4DAGH 4ONHB 4RZKA 2G60L 4X7CC 4Z78A 3KPPA 3UAFA 4ZMAT 2ICWI 2VO5A 2NUTB 1NAMB 4FQJH 4UQ9A 4JG0H 4YOKA 2PO6D 2JQAA 2Y06H 5FV1L 5AZ2L 2EDBA 3ECWA 5DRWB 3T65A 3S48A 4IRJC 4NM4L 1EHLL 4QUOA 1LE5A 3K6FA 3QR1A 1QWHA 1RZQA 4U3SA 4OKVB 2G9HB 1JMXA 1WHOA 3BUTA 3VG0H 2O26U 3SJVB 2WTRA 3NABL 4NI6A 4XCCH 1OK8A 1A1MA 2JJVA 5JQIB 1FLTX 5H37A 2YPVA 5JHDE 2MMXA 3LRGA 3CQFA 1DJYA 4MRBA 5D9SB 2HJFA 2LTQC 2C8NA 5IKCA 2BNUB 4TUUA 2QADD 2HJLB 1WF5A 4MMZC 2E75C 1KFGA 2E8ZA 3QEQA 5SWSB 3CUPA 6TAAA 1EBPA 3L7EA 1DBKH 2WLKA 2XV0A 4M1DL 4KH9A 4LCWE 4WHDA 4E36A 4YPGB 5DF0A 3SCMD 1I8MB 1CBVL 3CSFA 3JSSA 1DJWA 3FQRA 2OL3A 3L5HA 4ZOBA 1U6AL 4IMKC 4L3ED 1BW8A 5JO5A 5B3NA 1CZ8H 2J8UE 1MDAA 2GBUA 3K2UL 1B4JH 4YK4C 5F89A 3RVTC 2VXUL 5LBVA 1MEXL 3KVDD 3VXUA 4N9GB 4OCLC 3VQ1C 1OT1A 4PWEA 1RK0A 4X80H 1OCWH 4GY4A 1BAFL 4FERA 1JZDC 4WNQB 4BZYA 4PTTA 5DLMH 3ZKXB 3W39B 1FYTA 2BZ7A 4F92B 1QABA 2JKXA 4FP8L 1RSFA 3B5TA 5TE4L 3BD5A 5CR8A 3KYNB 3NOIA 4LL9A 3SDAA 4E41A 5GSRB 4P57A 1PVHA 2WSDA 5AW4B 5DC9B 4QHLB 1BD2B 2G30A 5CAYB 5I8EB 1TO5A 1DLHB 2ZXWB 2HT3C 4GMSH 1GOGA 4DH2A 1MXDA 2FWSA 3UG4A 3TEYA 1B9ZA 1TCRA 1NGPH 4YFLF 3VRIA 3V6FB 1G6RB 2ITDB 4PRBA 2JB5L 4Y2DB 5HDBB 1RZJL 2D7TH 4J6RH 4NRXB 2KC0A 3CDGA 4QYOA 4GKNA 3VD3A 5JHDD 5MI0B 5D7LA 4PI0A 3FO0L 1CFQB 2OMZA 4ELMB 4HJEA 2B2XH 3CGTA 4PJEA 4FC3E 3DYPA 4AOFA 1YNLH 4JDTL 4I48A 2R15A 4OTXL 1SEQH 4KZDL 3RWHB 1F97A 3MBEC 4CC4C 3IVKB 4P4KC 2VLJB 3O6KL 2HLFC 4IW4C 4L8DA 4LCWD 2HWZH 4MSWA 4MJJA 4ONFH 4ENEC 3FDWA 2YXFA 3FO2B 4M7ZC 1EDYA 4LBEB 1WTLA 1K2DA 1U91B 2E86A 5E7BA 3S88H 4P2OC 1U36A 4BFFA 3K72A 1I8AA 3ZYIA 35C8L 4EDXB 1V3LA 2J8UF 1NEZA 4J3TA 1NKOA 1JTPA 2N56A 2V2WA 3KEHA 1TQVA 3ETBF 1G1CA 3K8MA 3RGBA 1WYJA 1PLGL 5AALA 1YEJH 4U6XA 3MNDA 4P3CL 5D4JA 1CTNA 4XRCB 3VG9B 1OB1A 1PL3A 3JT0A 4JPWL 3LN4A 1J5HA 2F7IA 1Z5LA 3MODL 1PAZA 4OF0A 5E4EB 3BH4A 3QUXC 3MOAL 2XWBA 1JF1B 1ES0B 1ZHBA 4WKZB 4Z6AT 5M95B 2ENSA 3AITA 3MZTA 3GIZL 3L08A 4XXDB 2FHFA 1KV7A 5JLZB 2IANE 4UMSA 1JK9B 1CGSH 5H2BB 4S2SA 2RCSL 4FQPA 4MTMA 5JPMA 3A4DA 3J7HA 3MREB 3U48A 5HBBA 4G59C 4HKZB 2CKBA 3BPNB 1KEMH 1Q72L 5FLVA 5JQHC 3RYMA 1DQVA 1XIWD 2B1AH 2E27L 3C08H 3VFRA 2EH7H 5FV2A 2E9GA 1OP9A 4K8RC 5GGTA 3UBFA 5AVVB 2P5EE 3VU1A 1KYAA 3X3FL 3BE1L 2ZAGA 2OK0H 2BFVH 4ZQKA 5EHFA 4L3EA 3VB9A 3MLSL 3WN5C 3C2AL 3CH1B 4ZO7A 2KLSA 2H3KA 4MA1B 2Y9RT 1MPAH 4LIQL 2XZQH 3MJ9A 4JKLA 4XXWA 1JDDA 5J57B 3HFMH 3WIHL 3T8XA 1JZ7A 1OOWA 4JFQA 5GZNC 1EEZA 4ODVL 1ZWIA 5FLUA 3DVNB 3VFVA 3S0PA 1T3FA 4YSPA 5FUZL 2C3XA 4GSRA 4NQTA 1FZMA 3WHE1 1M56B 1KB9J 1MH5A 4KJWD 1DUYB 2JK5A 3BMVA 3AQDA 4GXVL 5BO0D 3FCTA 1P5UA 1HSBB 2FEDD 2CK2A 3WTYA 3F3HA 4TSCL 5F7EH 1GGCH 5BV7C 4POUB 3EUUA 4PJAE 4AGMA 1WFMA 1YJDC 4AUJA 1AXIB 1BYNA 3VFMA 1G4MA 2WINA 4B41A 3DV6B 2WYIA 1GAFH 2VDLL 2WVVA 1UG9A 3EO9L 3UJJL 1PS3A 2C1OB 4KQ3L 1KLFB 1P4UA 1YEHL 2DLTA 2IAND 3MLZL 4DF9A 3TOPA 5JHMA 3SOBL 5DK3A 3IAPA 4F7MA 4AQEA 2Y7MA 4FABH 4MDIA 3STZA 4DAGL 3QIBD 4U1SB 1HZHH 2X1QA 5CBAA 2D03L 4NSKB 5C08B 1GS7A 4OVVA 4UNVA 3VUAA 4FF9A 1XZ0A 4FQJL 3TA3B 3FB7B 4AGOA 4AY0A 1XCQB 2P5ED 5KVMC 4JG0L 4MXQD 1HCVA 3HRZB 3HBZA 2Y06L 4GIAA 3EHBB 1CU4H 4QRPB 3BKYH 4RISH 1PD0A 5J89A 4IBSA 3CZFB 1FIGL 5IJVB 3GXFA 2J8UA 3QXTA 2WHVA 1N2RA 4HOWA 4K7PH 5DHYA 5KYWB 2UZYB 4NKMB 4BSVA 1DQJB 1JV5B 4LCYA 2X89D 3L9RB 2V9TA 1IGCH 5CMAA 3TVMA 3V5HB 4YDJA 3VG0L 2GW5A 4NWTH 3D39E 2CJTA 1YUHB 3OWRA 1BJ8A 5GZOC 2G75A 3QUYB 43CAA 4LVNB 1LEGA 4NIYE 3HS9A 3LSOB 5IBTH 1F56A 2ZWLT 4N8VG 2EC8A 1KB5A 1TTRA 2W8CA 4NQDE 5IVNA 1BJ1J 1NM9A 4MMXB 1OTSD 4RZCA 4EZKA 5LN4A 1M6OA 2JVUA 4PJAF 1QO3A 3IDIB 4U31A 3TBTA 3C8HA 1G4RA 3HNSH 4IIZA 1CXIA 4OLUH 4DP4X 4XVOA 2NXZD 2L04A 3WAJA 3H9HB 4LKCB 3LH9A 4K7FB 3W9EB 3ZQWA 4BK5C 4DN3H 4OI7A 1XIWA 3RVXD 4X98A 4R0LA 3CTTA 2AS5M 1CZ8L 3KLKA 4F2FA 2A74A 3FRPG 3UGEA 4GO8A 4WI5A 1B4JL 4AE0A 3MV11 3GSXA 1YN6B 5E9NA 4X80L 1OCWL 5CIPA 1E6JH 3N1PC 3O4LB 2ADIA 1G94A 5DLML 3NG5A 3SB3A 3QHFL 3ZDYB 1T21B 1ZHKA 2YRPA 3KGRA 4PCKA 4D8PA 4GW5A 1RV6X 1PMYA 4XMWA 1YG9A 3IJEB 4K94H 5K9QG 2KQMA 3MX0A 4DHLA 4MQ7B 2VZVA 2VWEE 3K81A 4UIKH 3D50A 2BJML 2WZPD 1NMCC 4PVMA 4GMSL 3JUYA 4CU7A 3ZE0B 5HHQB 2DBJA 5J1AA 2X41A 1AZUA 1DL7H 3GXNA 4KXBA 1VFMA 1JPGB 1NGPL 1SY6H 2AANA 4RIRB 2WWNA 4MB4A 3UBXA 1Z66A 3D39D 3Q2CA 3BVVA 3IS1X 4ZMXA 3K6SA 3NN8B 2CRIA 12E8H 2B2XL 5GGUA 2X4TA 3TEWA 2F74A 8CGTA 1AS6A 4NQDD 3TIEA 4E42A 1JGUH 1YNLL 1N5AB 1SEQL 4KY1H 4MS8D 2IANA 1T0OA 2F7OA 2R69H 5D7JD 3QAZC 3SPHA 3QO0B 4E5XA 4Z7UE 4JRXE 5E00B 2H2SC 2EKSA 2HWZL 4ONFL 2XWTA 3V5DB 3DI3B 2LVEA 5F21B 4F8PA 3QIBA 1HK6A 4U1MA 1X7QB 2CCLA 3S88L 1JYWA 4QYAA 3OKMA 1JL8A 1OGTB 4PRNB 4XX1G 4OUOA 1S46A 4P46D 2BLFA 1DN0A 1N19A 4XP6H 4IKIA 1ILUA 3UAJD 2GSIB 1U8HA 4DPCX 2E6JA 2Y1VA 4FQQA 4NC1E 3INUL 4OUUA 4GBXB 5E7FA 2NZIA 2WBKA 5C0GA 1ZGLM 4LNRB 2P7TB 4KVPA 3NZ8A 1R5IB 2VZUA 3G6AA 2WUBH 3DX8B 4DFHA 3KYMB 3EYFA 3AU0A 2HTKC 2HVBA 3EW3B 1WBXA 4HZAA 1VSCA 1CFVH 3HI1B 2EVGA 1KBGL 3KWXA 2K6ZA 2OULB 3VXQA 1MCLA 3GPSA 1NCTA 4KMQA 1MFUA 2F61A 2GCYB 4LSUH 3ZTJG 1CGSL 1D9KD 2XXGA 3SBWC 1RLWA 2FH8A 2ZXBA 1IRAY 4U33A 5EU4B 3CX5K 2GJPA 5DR5H 4X5XB 2XT1B 3CFCL 4FQLH 1G9HA 2V2XA 4GH7B 4GRLB 2C1PB 3QWOA 2DEXX 1KEML 2B1AL 4ZS6C 3C08L 1I7ZB 2EH7L 4YAQB 4WQOA 4QHKI 1W72H 2VYRE 2WV3A 5GRYA 1EERB 3F12B 1W0WA 2MCG1 1KJ3H 1IAKA 2ICCA 3NSDA 2HKHH 3FQNA 3MKKA 3RFZA 4EI5D 2BFVL 2OK0L 5LG6A 1XXFC 3EJQA 3OB0H 5TQ0H 1E9PB 4YL9A 2R2EB 4Z7UF 1MPAL 2XZQL 2CJSA 4I89A 4JRXD 2FLMA 4F7PB 4MQXD 1N10A 2AKRB 5GRZA 2RHEA 3SGKA 1ONQA 4F8OA 4L8BB 1EO5A 1XBDA 3QZLA 4Y4KB 1RK1B 2QHRH 1HILA 3ABGA 2BP8B 5DSCA 4AEIH 6FABL 3T2PA 3RZCD 1M53A 4FZ8H 2CXGA 1IKNC 5DHDA 1LO0H 1TOXA 3KWWA 5C6TH 4PJ5B 5FYJU 2FEEI 4JS7A 4M7KL 2CBQA 1A7PL 2Q3AA 1TJHL 1UA7A 2A6JB 1SBSH 2DWDA 3AW5A 4X99B 4B9IA 1IFRA 3PHOB 5F7EL 3ZKMD 1DCEA 1GGCL 1I7TB 4N2FA 2WZPA 1SQ2N 3TV3H 4S1DD 4U2ZA 5CGBA 2PKDA 3MJ7A 1J9QA 2CKNA 3RNQB 1S9YB 1AANA 1BQHG 2F15A 2QGEA 1GAFL 3BJ91 2YPLD 3E7JA 1OSPL 3D39A 2VGLM 2NR6C 1HDMB 3CFDA 1E8XA 1NBZB 5F6IB 1JZFA 3ZX1A 1A0QH 2PR4H 3E38A 3E80A 3FHAA 1IE4A 4NQDA 3GYRA 1AXTH 3R7RA 1N12A 3U1QA 1N6QH 5J9PB 4RSYA 3PDDA 3VWJD 5J12C 3V8CA 1HZHL 1JOIA 3NACH 4JFFB 2ZSVB 4HS6A 5D7JA 1AMYA 3VSQA 4AQ1C 1JI1A 3O3AA 4HUUA 2NPLX 1SXCA 1DUZA 2GQHA 1A4JA 1MCKA 4ZPVB 3S5LB 5T1MB 2FR4B 1CU4L 4RISL 3BKYL 1DVSA 1OAKH 1BWMA 1QBMH 4PREA 3TO2A 4JJ5A 3D07A 4BSWB 3UAJA 4RMRA 1UD8A 4ZFGH 1FJ1B 1FWXA 4HCIA 4K7PL 5AVTB 5I1KH 1IGCL 3ZZLA 4GOSA 5DCCA 4Q9QH 2ZUQB 2PR9A 2VDPH 4NWTL 4NT6B 4XVUC 5INDA 3THMH 4AV0A 2I07B 1I31A 1NIFA 3EJPA 5KOMC 3VFTB 4UQ2B 3G5VA 4HVBA 5IBTL 4LHUG 1X3DA 2GSGB 3NSYA 4M7LT 3Q2VA 3QCVL 4MAUH 5DUJA 1UD5A 3QULB 3M8OH 3H9SE 3B43A 4IRJD 4WV1B 4QXWA 4X6EB 1A21A 1ADQH 4E2OA 4JFXB 1PZSA 2V3DA 3HNSL 3HE7C 2VSCA 3KPSB 1T1ZB 5T5NF 4CKQA 5DQ9B 4UAOB 4DN3L 3IWVA 4CVZA 4GW1A 3BP5A 1WJ3A 1A7OH 2EE2A 2VAJA 2NYKA 4HOZA 4IS6B 2YPKB 1NSNH 5L88H 4JHAH 5CLYA 2E9IA 4EI5A 1CXLA 1Q9KA 4MCMA 4YHMH 3MLVH 2J6EL 4N0FA 2EDYA 2F1BA 3DMMB 3FUFA 4WVRA 3GLAA 5LWYH 2FIRT 3DGGB 2Y23A 4FULA 5T1JA 4JRXA 4AYDC 2MTPA 3GSUA 4N2CA 1HXMB 1TTAA 1H8NA 3P9LB 4FDWA 3NDYE 5JIDA 4LPUA 1EXUA 4IU3B 3RZCA 1MCCA 3ARRA 2VLRE 4YSOA 4UIKL 5J5EA 2P8PA 3BEWA 1G7MB 1F8TL 4ADIA 2G4GA 3RVTD 4U1IB 1TQSA 5F9WC 5IVXE 1EUUA 3IETB 1UH2A 1X5FA 4NPYB 4MHHG 1SY6L 4LLUB 1DLFH 2JJTA 5L0QB 1SN0A 4LFHG 4ZMVA 1WPCA 5ICZA 3QDMB 5I16B 1Z32X 1C08B 2DQUH 3GMQB 3KPRB 5EF3A 12E8L 4XN4A 3UYPB 3NIDE 4CW1A 4EBQH 4DZ8A 3UZVA 1KLGA 2FYVA 2BSRA 1JGUL 3IT8D 5DA0B 4FFYA 1FO0B 5H35B 3H9SD 4JDEA 4KY1L 4JBSA 3QA3B 4NWUL 3RILA 4I2XB 2R69L 3ARSA 4YNYA 3L3GB 2R2HA 2HT3D 2DTSA 2V17H 4XO3A 3T9WA 1OQXA 1IEAB 2IGLA 3VWJA 3WTTA 4TLTA 4PJFE 1H5BC 1JZIA 1TQCC 2WGNB 3IFOA 4HIHA 2ESVE 5T1KD 3CC5A 3L4CA 4HJSA 4UTBH 5CP3A 1BECA 5TH2B 4XP6L 4XN1A 3WV0A 3VH8B 5DHVA 4UQBA 2VR4A 5GS0H 3D5OF 2ITEA 3VXSE 2WUBL 3KPMA 3MBED 2IH9A 2XVBA 1IIKA 3QNZA 4P4KD 5I30H 3BAEH 4N28A 1UXMA 2HLFD 5M7QA 4ENED 4LLVB 3IGUA 1RJZA 1CFVL 2D0GA 2Q87A 1SJXA 4IGBB 3ESVF 4QRRE 4G43B 5LGYA 5HYQA 1YY8B 1OSYA 1AI1H 4FG6C 2P28B 3T5WA 3ASNB 1TTCA 5TDPB 4XMTA 3I84A 3GUTB 2OTUB 2VLRD 4LSUL 5A40E 3FN0H 5A2CA 5IVXF 2DPKA 2YXMA 3TZVB 2Z4QB 5DR5L 5AKVA 2LE9A 4FQLL 1T20B 4IRJA 2Z9TA 3R1GH 4A63A 4NCC1 5A2BA 1QG3A 3LDBC 3KLSA 4XN8A 2LR4A 1UUNA 3QEGH 4D0DB 3OBAA 5A6LA 1E5ZA 2XETA 2FUTA 4TNWF 1XF2B 2DMCA 3NIDF 4BYHA 2PUQT 3FZUC 1KJ3L 4L37B 3QUXD 5LQBH 2FWOA 4HT1H 3AAZA 5SX5H 2X6MA 5FOBB 1G87A 4DNLA 1ZPUA 4AT6A 1H6EA 4HEPA 5TQ0L 5TD4A 3N1FC 3F04A 5B3JE 4IYKA 4PGCB 1LO5B 2QHRL 4MCZB 4PJFF 1JNLH 4AEIL 4PN6A 1JYVA 4PR5B 4BKSC 4E9VA 2ESVD 4P2RE 2XJLA 3CBJB 3G5ZB 4FZ8L 4K8RD 1KTLA 4WHCA 4X8XA 4XCNB 5DI8B 2OJEB 3UJIH 1JPFA 4H26A 5BZDA 1LO0L 4Z0BH 2X2JA 5C6TL 4IMKA 4OLWH 1MCPH 3GLZA 2I5YH 4IKLA 1NC2A 2C9XA 3FO1A 3VXSD 5IW6A 3TV3L 4A7UA 1FNSH 4GFXA 1MI5E 4XMVA 1NFIB 3IGLA 2UY6A 1I53A 1A6WH 3BSHA 2YARA 4YQXL 9CGTA 2D3VA 4QRRD 1A6UH 5GZND 3QEUB 4ODHH 3C8DA 4W9IC 4WRLA 1K4CA 4JFPA 4AUUA 3D4CA 1MLBA 1Q90A 3V5KA 4KKLC 4PCYA 3EBAA 1A0QL 2PR4L 4B97A 4NBYB 2HX9A 4XHQA 1AXTL 1KPRA 7PAZA 1N6QL 3H9SA 3NACL 4LMQE 4AENB 1S7XB 4Y4FC 1DVFC 1JD9A 2GTZB 2HFGH 3SYQA 3U7YH 2JELH 3LIUA 1UXWA 3F64A 4PWFA 1TJMA 4FJYA 3C09B 3LRLA 2FEJA 4G9FB 1ANUA 5FA3B 1A65A 5SX4H 1HHIB 2QVFB 1AC0A 1NBQA 4PY8I 5T1KA 4XN7A 1OAKL 3JWNC 4FMVA 4KOBA 4NUGH 1QBML 5FW6A 4HUXB 2EO9A 4IJTA 5E2JA 3V4PA 5D6CB 5B3JF 4ZFGL 5ADOH 3E8UH 3BFOA 3DX4A 4WEEA 3L9YA 5FIEA 5I1KL 1TTFA 3SYOA 3KPLB 4Q9QL 4XGZA 1C16A 1JF5A 2VDPL 5KVEH 3PHQA 3COOA 3THML 1HJCA 4P4KA 1ULVA 1IMHC 2YN3A 2ZKXA 3S98A 5FGRA 4P2RD 4XNBA 1HT6A 4P59H 3DSNA 4MAUL 4P2OA 3MAWA 3KBFA 3M8OL 4HWBH 3LPOA 1IM9D 1CVSC 3U4EA 2VLRA 1BBJA 2VR3A 3TBVB 5FGBC 4ERSH 2E7DA 5LGHH 4NS0A 5T3ZD 2PPAA 4AGQA 5FM8A 5IVXA 3ENEA 1MI5D 3QUMB 5EF0A 4WCYH 1JZ5A 4AITA 5D93B 4QY8B 3VI3E 3ESNA 1WIPA 2QBWA 3MBXH 2MCAA 4YSUA 5GZOD 1KULA 1FV1A 4OD1L 5K1VA 2MSPA 1F4AA 3BHBB 3DVGA 4N87A 4B3VA 4Q8BA 3TYFB 2Z92B 5IEHB 3QUXA 5L88L 1HJBC 4HHGA 4JHAL 3MRRA 4Q6IC 1AGFB 4P9HL 4BE6A 2NY5C 1KIPB 4YHML 3MLVL 3QHZL 5B21A 3WJMA 3S9DB 5LWYL 3QZWA 1R24B 1WAEA 5HJ3B 3B2DC 2W9LA 2V9QA 3CFUA 3UAAA 3G5WA 32C2B 3TN0B 1YNTF 1UEMA 4F8NA 1A47A 3G5YB 4PJ8B 4PMFA 1HTYA 2FE0A 4AW7A 2YS4A 3APNA 5LLIC 4PJFA 1WAPA 2DJMA 4BZ2A 1HOCB 3OAUH 2V9RA 2BS9A 2ESVA 1JWSB 3SDCC 3LQZB 1JGVH 2VZOA 5IHUH 2WQRA 2JIXB 4XMZA 1AYRA 2NX5E 2X1XR 3UTQB 1L3WA 3K71B 1U93A 4CVZB 5C0CE 5EC1A 2E4TA 3REVA 1DLFL 2BVOB 3VXSA 1TQBC 1F4HA 2XPGB 3GTNA 4LKXB 3FH7A 3LV3B 2A7BA 4ZFOA 1XGQB 2ENQA 3FT2B 5DVOA 1FC1A 2EDOA 1XGRA 4N2NA 1IVLA 1MREH 3N1GC 3WO4B 4EBQL 4ZZKA 3IPBA 2JKWA 3OD3A 3IMVA 1R5VA 1U3ZA 1ZA6A 2CR0A 3HG0A 3U30C 4P5MB 5EEXA 2ZUYA 5ABAA 2IWKA 2TRYA 2NW3A 4M9PA 5KUMA 1AGBA 3Q8FA 4LRIC 1Z9LA 3PRZA 4X4KA 5BRZB 1OARH 2X3CA 1FL5B 3MVSA 5LO7A 3HI6H 4JE0A 4OQTA 3VI3F 3AUVA 3KLHC 4LNVA 1EXGA 1HINH 5LNGA 1E50A 3HHMA 1SYSA 4RDQF 3Q13A 4UTBL 4UYPA 2A3TA 2P24A 1ESOA 4PB0H 4Q74A 3V79C 1X5GA 5A2LH 4Y16B 2NXYC 3MXVH 3RWEA 5GS0L 3WYRA 4YDZA 3DARA 2C7UB 5E1AA 1CE6B 1NOLA 3E6HB 4NQCB 5I30L 1XR9B 2H2SD 1RMFL 4R4NC 4JQIA 3C5SA 5CWSA 3Q8AA 4GI8A 5EO1A 2AITA 4HIJA 4HLEA 3TBSA 2Y3NA 1AI1L 4HG4K 2QSTA 4KK5C 3U25A 2J20A 3P73A 3W3BA 1G1OA 1MNUH 2X2YA 4YSCA 4WTZG 3FN0L 1I7UA 1PY0A 1A4KB 1F2XK 2NX5D 1PD1A 3D09A 2ITFA 3GSVB 2OZNA 3PIQA 3DOIA 5C0CD 1IM9A 3QNXA 1J5OH 4X6FA 4QXTA 2Y25A 3R1GL 3RL2A 1O7SA 1UATA 1TDQA 3QEGL 2HTKD 1IU1A 1MI5A 3GC3A 3DLQR 5CCJA 1CCZA 1IAMA 5LQBL 4ZT1A 4K3GA 5EOQH 1VADB 4HT1L 4JZOB 4GJTB 5GZOA 2ZYSA 1F18A 1T6WA 2IPTH 2IWGA 4NKOB 3HMWH 4CMHB 5BQ7A 5GS1A 1ZDQA 1RZFL 5E5MA 1QEXA 3A47A 3TASA 1G7IA 1BVLB 3MGTB 3SKUD 3OC5A 3N41F 3PPSA 1AZBA 4LPTA 5ALBH 4TUOA 4ABQA 1ZHLB 4F9PC 4R5XA 1ZLSH 4IMLA 1IBGH 1AQHA 1J8KA 4HIEA 4ZS6D 3HC4H 1T22B 2OXHA 4WNSA 2HVKB 1XL4A 1YNTA 1E4WH 3D12B 5I15L 4WDIB 3HI5L 5E6SB 2ZZUT 4WZ9A 3UJIL 3VQMA 3FN3A 4BK5A 4Z0BL 3LKOA 3RQ3A 4YR6B 1UWGH 4J8RA 1MCPL 4LVEA 4O51A 2I5YL 4HLJA 2VR7A 4UIMA 5DJAB 3NTCL 4CBPA 3N6YA 4JPIA 3RIFF 2DQTH 1BXAA 5CGMA 1FNSL 4DEPB 2XG5A 2YAOA 5DEFA 1CDUA 2OYMA 2GHZA 1A6WL 1KDIA 3B9KC 5GGSY 1A6UL 5B7EA 1B88A 1LDSA 3CBRA 5JXAH 2V3FA 4ODHL 1CDHA 1TNMA 3GBMH 1L9TA 3MV9A 3MJ8A 1FP5A 5FYKL 1TVHB 2CO4A 2ADGA 3WKPA 1C1EH 2HFGL 4FFZL 3U7YL 4A6YB 3MRLB 2JELL 4H0LC 4PJXE 3K6IA 2CCWA 3OQ3B 4WWPA 3U46B 2V7NA 3K6NA 2BERA 3HPJA 2EDQA 3X1BA 1N59A 1DR9A 4HGWA 3ME0B 1P6WA 5DJZA 2TAAA 1CYGA 3KWUA 4U1KA 2NR6D 4NUGL 3BUPA 1DE4B 5T8IA 1HWGB 1MCOL 3VXRE 5ADOL 3E8UL 4GKLA 1CTMA 5E95B 3OG4B 4HAGA 5CZKA 5C0JB 3H55A 2YEZA 4BDVA 4RRPG 2JKRM 3V52H 5KVEL 4JFZH 3VFUB 3RPKA 4MWFB 1A8ZA 4NN6B 4M8UA 4LO9A 1YC8A 1T1XA 3T3MB 5JPNC 3QB7C 3B7SA 5E70A 2VKXA 5EEWA 4WSKA 1CFNA 3BSZA 3L4WA 4HWBL 5H94A 2GJZA 4RMTA 2D0FA 1AD0A 1BGXH 1BV8A 4DGIH 4ERSL 4DTGH 1A9BA 1P5VA 2NX5A 5LGHL 4C55A 3PP4H 1BZ7B 4OCXL 3T0WA 2GY5A 4W9ZA 3TURA 1PU0A 4GKSA 4XVUD 1TZHA 2MKLC 3MBXL 1WCBA 3PUUA 4PWKA 4H25A 4RH4A 1T66C 2BVUA 5DC2A 3KPPB 3FT9A 3JV5A 4YFDB 3QO1A 4UYQA 1SLXA 4JKPL 5ISZA 3VA6A 1HC1A 4IM8A 4KGJA 3IJYA 2GITB 1NMBH 4GIOA 1MFAH 2IADA 4LCCA 1EJFA 3T65B 1JBJA 3MQIA 4FXGC 4PJXF 3SBWA 1LE5B 1II4E 5E6YA 2DEYX 4U3SB 3J27A 1LK3H 3HE7D 3ILQC 4M5TA 3ZOAA 3P40A 3QZBA 4X6CB 2ZOLA 3CN4A 3QXDA 4N2OA 2WTRB 4G1EA 1PG7H 3P2TA