5L2KD

Crystal structure of gem42 tcr-cd1b-gmm complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
185
structure length
185
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVRNTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1b
publication title T cell receptor recognition of CD1b presenting a mycobacterial glycolipid.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kD02
3WS6A 3TFKC 2BVYA 3EJZC 1A6WH 4S0SD 4UIKL 2DRUA 5DVMA 3VXMD 3RY6A 5E8OA 3TESA 3HA0A 4P2OB 3FT4A 4TSBL 3DPBA 2DF3A 3L5HA 4S1RH 1WT5C 3QULB 5K9KA 1WUNT 2Y72A 2X4RA 4JVPA 5E6YA 2QQKH 3MRIB 5D2LF 2ILLA 1LQSR 2K9UA 4JN2B 3V5DA 1U3HC 5D7LA 5KTEH 5CP7A 2BSRB 4W68A 2R0KH 3T65A 3SO5A 3MCLL 3ULUL 4PJAE 3QJFA 3I3DA 1QOKA 4DKFH 3ME0A 3TBWB 3HB3C 4ETQA 1GGBL 5F7EL 1FYTA 5ALBH 5C0CD 5LXGL 1MCNA 4NM8L 5DJAA 5IWLC 4U6HA 5DQJA 4X5WA 4R8WH 4X99B 3BT2L 4G8GD 5D5MF 5F1KC 4GS7C 3MA9L 3MXWL 2V2TA 4PTUB 3VXSB 1NL0L 3IDMB 3L5WB 4ZODA 1UZ6F 3CXDL 3CUPB 4HUWA 4K3JH 3FRUB 3MLSH 4KMTL 1GPOL 4G6ML 1IAIL 1S3KH 2AXHA 2CMRL 4PJBF 2LU4A 2X4PB 5F9JA 1BFVH 2DMCA 4ZUWA 5FO7A 5CUSH 1L9MA 3TGXA 4OGXL 1CT8A 4ODVL 4NSKB 5C0AD 4XVJH 4NZTH 1RJLA 2CH8A 3HS0B 2ED9A 2KQMA 4XP1H 3CFDA 2A74B 1ACZA 3IKCB 3ULSA 4JQVC 1INEH 1CE6B 3DV6A 1QSFE 4DN3H 2JCCB 5DD3L 4MAYC 3BPOB 3HI5H 2X1PA 2PO6C 1J1OL 1MCHA 3SPVB 4NO0B 4PJCA 2WWMD 1OTSD 4JY6A 1R3HA 1A7PL 3HI6L 5DJYA 2NY2D 4ZPVA 1RK0B 3EDKA 1IC5H 2AI0H 3DGCR 5BV7H 4NNYA 5GHWH 1IAOB 2X41A 1NCAH 4F7EA 1SY6H 1VFMA 2BXZA 4CVXB 4YEFA 4EN3C 4Y4FC 1JZ8A 2HFGL 1UM6H 3IDXH 3DROB 1KCUH 1CDIA 2I60H 3NN8B 2D9QB 1JGLH 5FDWA 3OJDB 2CGRL 4WWKC 1MQ8A 3BP5B 4DZ8A 1AD9A 2AJ3B 2CXGA 1EAPB 1IEAA 2VZSA 5EFIB 4K3DH 3VXME 2J6EA 3RDTB 4AL8H 4F33B 1S7VB 5EBLB 3LEYL 2ZG3A 4MD5B 3WN5B 5BW7C 2FECI 2NY3C 3P0YL 1X6NA 1LK2B 2GSIB 1YUHB 4QRPB 1AI1H 3GO1L 1FYTD 4PLOB 4Z18A 3X13A 3HG1E 4MXWL 4PJXF 4WFED 2VAAA 3QEGH 2QHRL 4JFEB 1LDPL 5JZ7C 1RIVH 4LCWB 1OTTC 1DBMH 2F19H 2RGSA 4ZNEA 3ZKND 3A0OA 2V5MA 5D1QA 1HNFA 4U6YB 3IDMA 5C0CE 1ZHNB 5HGDA 3U7YH 4F7PB 2BDNH 3FRUA 4AT6A 1BJ1J 4KK6D 3HR5A 5HDLA 3TNNA 2C4FT 5KVGH 1H3UA 2W9DH 4JPVH 3RVTC 1KXQE 3MXVL 4CBPA 5I1IL 1A6TA 4MVBC 1I1AC 5FXCH 5FYKL 4PLNC 1UWXK 4JVUA 4QLRA 2WINA 1FCCA 3LKPA 4JM2A 4I2XB 1DBKL 4Z7NE 4NSKA 4GMSL 3L7EB 5DRZA 3BE1L 1RJCA 4Q9RH 1YECH 2ZWLT 4RFNB 1U3HA 2F5BL 3LKNB 4H0HB 4FFWD 5BXFA 2LU3A 5BVPL 1CE6A 1FRGH 2JJUA 3D69B 1UKSA 2JCCA 1UACH 4GMTH 2DQGH 1RPQA 2FX8L 4XWGL 1Q9WA 3SE9L 2V9QA 2XY1A 1EZVX 4IIQA 1OLLA 4G7YL 5IWLA 1IGCH 12E8H 1AR1C 3TJEL 4M7LH 3JWNC 5KANG 4PRAA 5GRYA 5I76B 1OPGL 2IPKB 4L9LB 2X1QA 4Z7VF 3RPKA 3MNVA 5CCKH 3C6SB 5GSRA 1RVFL 1UG9A 2UUDH 1T5XB 5TDPB 4CVXA 5L2KA 4Q6IB 2ADIB 3DHJA 4YXLL 3AS0A 5I30L 4QGTA 5L8JB 4WFFE 3IJYB 5HGGS 5DMJB 1PY4A 4XHJD 2DQUH 5D7KE 3BP5A 1MFDL 5AG8A 1YEIH 2AJ3A 2HN7A 4R2GC 1WWWX 5EFIA 1REIA 3RDTA 2ADFL 4BZYA 3C9NA 4RSVA 3WN5A 3K8LA 2ADGB 2AJSL 1P84J 3EDEA 1LO0L 1YMHA 4YUEL 1LK2A 3EIFA 3GMLB 4G6JL 2DD8L 5D7LE 4HS8L 1BEYL 1FN4B 1EX0A 4M3KB 4GKOA 2GJJA 4TSBH 3ARSA 1ZLVH 3VE0B 3L9RB 5D1QD 2ICCA 1FYTE 2BC4B 2XWTA 4OCLC 4MCZB 3MQIA 1KEMH 4X7TB 1OT1A 3P4LA 4X4YB 2WK2A 4H1LB 1ZHNA 4F7PA 1KULA 2LVEA 1RZFL 1ZT4A 2EEAA 2R69L 3K8KA 5H35B 4HIHB 1IEHA 4LVHB 4JM2D 3RWEA 3ULUH 3MCLH 1ZE3C 3NCYP 1WEJH 3QXUA 3QWQB 4LVOC 4FFZL 4CU7A 1FAIL 1GGBH 5F7EH 4LIQL 4OIBA 3V5KA 4AENB 3AS3A 4P9HL 5LXGH 1B4JL 1KLUB 1TZGH 4NM8H 3Q5TA 2IQAB 3L3HB 1H15B 1ADQA 3ARFC 5F1SA 3MA9H 3MXWH 3FN3A 4NJAL 5JW4R 4PJAF 5IB5B 1NL0H 1YNKL 1JF1A 5IKCA 1AGFB 1ZWIA 2YKLL 4MX7A 3CXDH 1I85C 1IAKA 4HIJA 3CMOL 4Y16C 3P0VL 5J3HC 3DNKA 4KMTH 3O0RL 3UPAA 1GPOH 5I1HH 4ZUUB 2APXA 2APTA 2OTUB 3PDGA 1HH9B 1JWUA 1UB6B 5DJXB 3BZ4B 4D0CA 4MA7L 4LK4A 5EC1A 5JHLL 4XT1C 1BBJB 3CC5A 3S97C 3QUYA 2W91A 4ODVH 3TN0C 4GFTB 2V17H 4EBQL 3PHOB 5I15L 5E7FA 4PJCE 5LVEA 1ES0A 1MY7A 4UUJB 3E2HC 5TDPA 3U30B 4JFPA 4XAWL 1F58H 4Q6IA 2X4UB 3TYFB 5DMKB 3M07A 4XCNB 5DD3H 1FGNL 4KTDL 3O9WA 5MEOA 1U92A 3MO1B 3HUJA 5EB9A 3DX7B 5TE7L 4YDLC 43CAB 1QNZH 5GJSL 4CVZA 3RDTD 2W1NA 5DO2C 5F7UA 4RAVB 1J1OH 5EU5A 3SKNB 1VESA 1B2WL 1A7PH 3HI6H 5F6HJ 2CO6B 3GMLA 1IGFH 4V1DB 2FJFB 4PIRF 5CJOL 1FFNA 2CDFB 3C60B 3VXQB 1MAML 4UINL 5F9OL 4FMFA 2NY4C 1W0WB 1FZMA 1HWGB 3PWPA 3BZDA 3LOWA 5H37H 1OSZB 2K7PA 4J4PA 1QFWL 3HRZB 4X4YA 4PTTB 1FFPB 4ZNEE 3RQ3A 3QRFM 3LEYH 1P6AB 3ALXA 5H35A 2R2EB 1NAMB 3P0YH 4HIHA 5JPMB 2FB4L 1TPXC 2I27N 3QIWA 3GO1H 3FOLB 2J7LA 3O6KL 3LKRB 4MXWH 2KDGA 3VXPA 2ARJA 1GH7A 4AENA 3QWRA 4XZUA 1LDPH 4TSAL 4P2YA 4JQIL 5DC0A 4HMCA 4JFDB 4LLVA 3CXHJ 4NUJA 1V5JA 5TQ2L 4E0RA 2EDQA 3DUSB 1AGFA 1C1EH 3ROLB 4NKDA 3L3GB 3WFHB 3GIVB 3QISA 1CI5A 3JUZA 1N8ZA 3DIFA 3QUYD 3Q5OA 4OF6A 3QSKB 5I1IH 2PW2B 2W0FA 5FYKH 1SQ2N 4UDUB 1BBJA 1VFAB 1DBKH 3ARGB 1KB9J 5EZOH 3HNSL 5KZCB 4GMSH 1U8NA 4PLKC 3BE1H 3ARBA 3CH1B 5CGTA 3CX5J 4UUJA 5ESVB 1CXHA 5E9DB 2F5BH 3VDCA 4JY5H 3BKCH 2EE3A 2X4UA 4BK5A 3O9WD 4GW1B 4M5YH 4MD4B 1W72L 32C2B 4Z7NF 4Y5VB 4HUUB 2FX8H 4XWGH 4LPTA 5L2KE 3GIZL 3SE9H 1X44A 1XF5A 4ZSOB 1FO0B 3JWDL 4NC1E 4ZQKA 4RAVA 3KPTA 4G7YH 4JFQB 1HWHB 4PJ9A 1KYOK 2D4DA 3CNKA 1OPGH 3G5XA 1JF5A 3JVGC 3BW9B 1PG7W 3PWUB 4YFLF 5DWUL 3BIAX 4HCRA 2IWGA 1I85A 4V1DA 1RVFH 1X5XA 5E00B 3C60A 2F53B 4WNQA 5E94B 4ONHB 3PWPD 4F8QA 4YXLH 5DYOB 4K8RC 3GMQB 4DQOL 1I7TB 1VFBA 3HAEB 4J4PD 1DEDA 3HRPA 4MDJA 4PJGA 1TQCB 1MFDH 3CIQA 3QPXL 4X5XB 1PKQB 3ULVC 4Y5XC 1FFPA 4G9DB 2ADFH 3N1FC 1OTUD 2G5BB 3FQXB 3QIWD 3BP4B 2AJSH 4ZDHB 1LO0H 4YUEH 1CFNB 4OGZA 4G6JH 3WIFA 3B2VH 1UKQA 2DD8H 3HFML 3L7FB 3MRQB 4RFEA 4S10A 1AXTH 1EAJA 4HS8H 3LKRA 1BEYH 3UTOA 1BAFH 3KYOB 3MFFB 1RV6X 4J23A 4LRNL 4N9OB 4MCYB 3GRWL 2FJGB 2WMPA 3L6FB 3NA9H 5EO9A 2R8SL 4JFDA 2XG4A 4S1SL 3GBMH 2ZOLA 5KSVB 2N7BA 3IETA 1GXEA 4KMLB 3W2DL 5IVZA 4BSJA 3DUSA 5DDHB 4HBCL 2WWKT 1TITA 3O3BB 1DBAL 1IC7L 1ZVSB 3L3GA 3WFHA 4FXKA 2R69H 2X7LB 1OY3B 1KB5B 3AMKA 3B9KB 4GUPA 4FHBD 1E4KA 2H3NA 4AEFA 1M71B 4LHUB 2EKSA 4ZMAT 3JV6A 4PJ7B 1VFAA 4FFZH 3ARBD 1FH5L 5DK0A 2R23B 4P9HH 3TPUA 4JKWA 3K4DA 1CF8L 2ZUSA 2AXJA 4UB0L 5E9DA 3KLAB 3KPNB 3W5MA 3U83A 4UNUA 1GRWA 5IP4A 1T04B 4WTWA 2APWA 4GW5B 1YNKH 1SJVA 3NFSL 2YKLH 32C2A 3B8YA 4Y5VA 5DK3A 1HEZB 3QCTL 5HJ3A 5T3ZD 2BNRB 4PJ9D 4WCYL 1XF1A 1G6RH 3PGFL 4GG8B 4MA7H 5JHLH 4DCQA 3HUJE 4AQ1B 1Y0LB 4PRDA 3BW9A 3ET9F 3PWUA 4V1DD 3VFOA 2PW1B 4YGAB 3KXFA 4EBQH 5C0DA 4LCCB 5I15H 1P4BH 5HBBA 3C60D 3PJSA 1AC6A 2YD6A 1J05A 2V7NB 2F53A 5E94A 3CLFH 4YHZL 1D5XB 3IGAA 1Q9LB 1UH2A 4BFGA 1X7QA 3MLYH 4WFHD 1FGNH 4WI6A 5TE7H 1A21A 2X4QB 4PJCF 5I71C 5GJSH 3EYOA 4Z76A 2DJ4A 2YZ8A 4NHUB 3S9DB 5CJBA 4MS8C 1TTFA 2IH1B 3NCEB 3PWPE 4G9DA 3QEQB 3B83A 1B2WH 2XWJA 1J18A 3QT2A 4WU7A 4ZDHA 3SY0B 5I8KL 4PUBL 3T4YB 2Y07L 2EYTA 3EFFB 5FIEA 1MFEL 1FE8L 4ZAKA 5CJOH 5BS0A 3LB6D 3PABB 2E9IA 3FN0L 3OKMB 1MAMH 4UINH 5F9OH 4OJFL 4JFDD 3QIUA 1VGKA 1RU9L 1L0QA 1XR9B 4MCYA 5IB4B 2WP3O 5FYJD 1FIGL 2A77H 4NBYB 3BKJL 1QFWH 1CDGA 1R5IB 5T1LB 2AK4B 4QRUB 3ORJA 4PR5B 3MRNB 3UTZB 4KK5C 2J8UB 2IFGA 4YBQC 2FB4H 1EEYA 3CDCA 1M71A 5T5NF 3O6KH 4GRWE 2B7DT 1CIUA 4KVCL 4MNQA 3ZTNL 5JQ6L 1ZS8B 4LU5H 5E9DD 4TSAH 3RWDA 4HC1H 4JQIH 5JIHA 5C8JA 3KLAA 1CCZA 2LU7A 2VQ1B 4HZLB 5SV3A 1T04A 4K94L 3RX8A 5TQ2H 4MJ4A 4RGNC 4G80A 4N0CC 1DZBA 3N1MC 4HGWB 1HEZA 5BJTA 4GT7A 4PJDB 1CD0A 1KLGB 2BNRA 1R3LA 3A6CL 4JM2F 5FECA 1PG7X 1U41A 1H8SA 4KRPC 2GSGA 3KXFD 4TNVF 1Y0LA 1F5WA 4KGJA 3UTTB 5C0FA 4N0RA 4PREB 3HNSH 5H94A 1PZUB 1HE7A 3HZMB 4LCCA 2F53D 5L2JB 1IAIM 2P5EE 4QXTB 3QI9B 2PF6A 3S37L 4PG9A 3KGRA 1HQRA 3MBEA 5MI0B 3QIBB 1EHAA 2VLLB 3RJQB 1CGSL 1Q9LA 1W72H 4KI1A 4V1DE 3QUXC 4HIIB 4I3GA 2ED8A 4JRYA 2P49B 3IXTA 3GIZH 4N5ED 1KIRA 3BKML 4JN1L 5FGSA 3JWDH 5CJXA 4RNRB 4D9LL 1Y18B 5DI8B 3QEQA 4DUWA 5CSBA 4ZUSB 4I5BA 5AUMA 4LSQL 4PJGE 5FYJU 5CGYD 4MDIB 1GHFL 2NYYD 5DWUH 2HKHL 4ZAKD 5BS0D 3SY0A 1JV5B 1ORQB 2CKBH 3EFFA 5JW5A 4Q7DA 4L3AA 3VJ6B 1JK8A 1NCNA 5JORA 5CP3H 3WNPA 1IAII 3QIUD 1X5JA 4M4PA 3O3EB 4R0LC 2DYPA 4DQOH 4IHOA 4M1DL 2AAVA 3ZYZA 4CMHB 4Y1AB 3C5JA 5FGBC 5EN2A 1K4DA 1VACB 5GGVL 4DOHE 4I0CC 1FZKB 1R5IA 4QRUA 4PR5A 1GGYA 5GS1A 1SM3L 3UTZA 1ZGLM 2J8UA 5HHXH 4HKJA 4MNQD 5EH1A 2ATPB 4ZXBB 3HFMH 1HYSD 1CGUA 1TENA 1KNOB 5F1OB 4MXVE 1T21A 4Y5YA 2H6PA 1A7OL 3MLPA 3QBTB 3BO8B 3OKLA 5SX4I 2HJFB 5KVMC 4FS0A 3RVXC 1WWBX 3KHQA 3GRWH 4GRLC 2R8SH 4HZLA 1O0VA 2VQ1A 4HUKB 3QQ9C 1VEOA 1S7TB 4R96A 3W2DH 3D18A 4HBCH 2UVEA 1CWVA 3W9DB 1LO4L 5E2WH 2BNRD 1OB1A 1DBAH 2YUWA 4I18B 1CS6A 3BXNA 1RZKL 5D1ZC 1OGAA 3ILQC 1AO7B 4R97C 5GGUB 4U4BA 3RHWK 1LEKB 2HJLA 2AP2A 3IFOA 4DVBB 2W60B 1HCVA 1FH5H 3VW3L 2ZJSL 3DUHA 3ZHLA 3O11A 1INQB 1CF8H 1T1WB 1U8HB 2XRAH 4UB0H 3ZSSA 1NDMA 3CFKA 3MBED 5HI4D 4FXLA 2AK1L 2GUOB 4PJFA 3H3PL 3KXFE 4OSUL 3UZEA 2BMKA 2X4NA 1N6QL 1M7IB 1BQLL 1MFCL 3QNXA 3QCTH 4RGOH 4N1EA 5IJKC 5GGSY 3QEQD 5AG9A 4WCYH 4LLQB 3OXSA 3HPJB 2V6HA 3PGFH 3QDAA 4KXZH 5KVEL 1PZ5B 1Y18A 2GY7B 1JGVL 3FQNB 1HXYB 4ZUSA 3NABL 4JB9L 1HSAA 4ZUTA 4YXKL 3S96A 4P5TC 3BPLB 3PV7A 4MDIA 4GBXC 1ZLWK 4F7CA 1T89C 4I0KA 3C09B 4XB8A 2C3HA 3TBVB 1U6AL 4LLMB 1JHKH 3DVNB 2DYPD 5D96B 2QQQA 4YHZH 3O3EA 2V2WB 2ZUQC 3HUJF 1GGIL 3RPIA 3E8UL 1JYNA 5BS0E 5F7YC 2G75B 3OQ3B 4N1CA 2E6PA 3DVGB 3T0WA 1FZKA 3QEHB 2I07B 1J1XL 3HMXL 2Y1VA 5IEHA 2MKWA 1KPRB 3HZYB 4OZFB 2ZSWB 4RWHA 1BFTA 2DDQL 4PUBH 1D9KA 5CGMA 2AV7B 1ND0B 1MFEH 2VABA 3T4AA 1KNOA 4N0FB 3BESR 2AQ3A 1G7QA 4ZPTB 3FN0H 4L29B 2RBLA 4QWWD 4XTRC 5ACMA 3DURA 3VFWB 3WIHL 5DUBB 2GITB 3BO8A 4OJFH 3G5VA 3FHAA 4J1UA 2FWOA 1WVZA 2VERN 4MNQE 4UU9A 2R2CA 1FIGH 4TULL 4BQ6A 4G8IB 1WICA 4KJYB 1MEXH 4DUVA 4RMRA 5C0EA 3HCVB 5JNYA 1OGAD 3LQZB 5FKAB 4LEOB 3FB5B 2Q7YA 2FLBT 4MA3A 5GGUA 1AO7A 1IFHL 4RBPK 2P7TB 2GK2A 2GY5A 4KVCH 5IM7B 3ZTNH 4ONOA 5JQ6H 5CZXC 4JO4L 4WENB 1YEGL 2IMNA 4NO2B 1KJVA 5HDQL 4WI5A 5BQ7A 2ICWB 4K94H 3WL9B 4OI8A 3IRZA 4LGSB 1MUJB 1BF2A 4GRWF 3VWKB 4G5ZL 1M7IA 2GEEA 5DMGD 1MHCA 1QTYT 5D6DC 2WUCL 5C3LD 5ERWB 5TGBB 4G3YH 5I74B 3O6FA 2CSPA 3A6CH 4Z9KB 1LE9B 1PZ5A 2NY7L 2BJML 3DVIA 4KPHH 1LWRA 1HXYA 4JRYE 2HKFL 5AAMA 3S88L 3C2SA 3D0VA 1C5CH 4HS3B 4WHTB 1GC1L 3NPSC 3GSXA 4S2SB 5I75B 3MX0A 2FLRT 1JRHL 3DVNA 3ZKSD 2LVCA 5GS0L 2YD8A 4NQUA 3S37H 1BZ7A 1YN6B 3P40A 3AS2A 1CGSH 5T5NG 5F1IB 3IAGC 5EZLA 2G75A 1HH6B 3KPQA 2JK5B 4G6FD 3LKOA 2LAGB 4HUMB 5E6IC 2UZIH 3Q3GA 4JANB 1FVEB 4XBEH 2D9CA 3EO1B 1EUTA 4L8SA 1LP9A 4LSQH 5DMYA 4PG2C 1D9KD 3B9EA 4OZFA 2ZSWA 1GHFH 5CJ5A 2HKHH 2KL6A 1IGTA 1KT2B 4A6YL 4H25B 2X05A 3J7HA 3U46A 4ZPTA 2XKUA 2J8UE 3S34H 1WK0A 1P2CB 5HGBA 4E9LA 5A40E 4PJGF 5E5UB 3TZVB 4TSCH 2XZQL 3FAWA 4RRPA 3RNQB 3NA4A 4P2OC 2CK2A 4E41B 4P5TA 1L7IH 3BUYB 5B3JE 1P7KA 2NTFB 5GGVH 9CGTA 5ICZB 1JNJA 1U8PB 4IRSB 3MGTB 3WHXA 4LCUA 1AO7D 4GXUM 1SM3H 1X5LA 2FEEL 4LNRB 2C7UB 1J87A 1AHWA 3SGKC 4LARH 5DRNA 1QFWM 5IM7A 4IDJL 4OZHB 1FL5A 1OGAE 3SE8L 1A7OH 1JYWA 3O6ML 3PGCB 2X9YA 4P57B 5ESAB 2ZUUA 2YC1B 4JFHD 4F3FB 1LEIB 1SEBB 2YBRA 1OWRM 4KTEL 1A2YA 1I4FB 1LO4H 4MXVF 1BJMA 2CIKA 5E70A 5I17B 3O6FD 3LIZL 4PJFE 5ERWA 3W81A 1LE9A 2OL3A 2VDLL 3QQ9D 2V5SA 1WF5A 1YY9D 5J6GB 2VDML 2IH3A 1K85A 3VW3H 3JWOL 1KJ3L 2ZJSH 4HS3A 2VLMD 3EZJB 4PBWD 5AZEL 2AK1H 3BKYL 3THMH 2DM7A 2X2YA 2DI9A 2OI9B 5I1KH 2A6DB 5H8DA 1N6QH 1P6FA 1BQLH 5F1IA 2VH5L 2EDJA 3DSFL 1K8DA 5FO9B 2Q7NA 1HH6A 4ORZC 2JK5A 3VH8B 5FM4A 4HG4K 3CXHK 3RGHA 1JGVH 4QT5A 3NABH 1YJDL 2HT3C 4J3SA 4CRPA 1PX3A 4ZOAA 1GOGA 1RUKL 3UYPA 1EPFA 2FJHB 3MRKB 1JGDB 1IEBA 5TJWK 5I16A 1CBVL 1QHPA 2Q20A 3VFSB 4UAOB 2BVQA 3DV4A 1P2CA 2NY6B 4YE4L 3E8UH 4NO3B 1BQHA 4QOKA 3TYGL 2NXZB 1QUNA 5K93A 1I1YA 4XNUL 1XZ0A 4ZS6D 1Z9LA 2NTFA 4PGCA 1U8PA 3CU7A 4ODBD 1BWMA 5DSCB 2P8PB 2EE2A 1J1XH 3HMXH 3I75B 4JRWA 3RWIA 3BFOA 4HLJA 5CD3B 2DDQH 1MAKA 5HI3D 2C7UA 5H2BB 1QBLL 1R5WA 3PP3H 1Q9OB 4MWFB 3WIHH 5KAQF 5E6IA 5INDB 3OKKA 2A9NL 2GAZA 1QSEB 4JLRA 2G60L 4WU5A 1A64A 1LEIA 2GKIA 4GAJL 4KRLB 4XPAH 2J4WL 1UYWL 4ONFL 2MQ3A 3KNBB 4KK8C 3GSVA 4JFHE 3W9EB 5HYJA 1BVKA 3BPCA 2Z8RA 1RZJH 4HJ0D 3EJJX 1IFHH 5IB3B 1B3JA 3GI8H 1RI8A 2JE8A 4JO4H 1YEGH 1FNSL 3DX8B 2PTTA 5F7WC 5HDQH 4FQIH 5AWNL 3G6JA 3GDBA 2EC9T 3GMOA 3S6CA 1I7RB 4WEMB 4NRXA 3BIKA 4WHCA 2A83A 2DOCA 2VO5A 1I1FB 3FO1A 2A6DA 5GGVY 4G5ZH 4QO1A 1VERA 1JI2A 1YDPA 4YHPA 5FO9A 2VLME 3MCKB 2R0WL 1SYSB 2ZSVB 3VH8A 3WUWB 3U6RB 2VC2L 2P8LA 4UNVA 4X6EB 2EYRA 2DLGA 3IFNL 4NN7B 3VMNA 5C08A 2BJMH 1U2CA 1FBIL 1VKXB 1QRKA 3GMRB 5DHVB 2HKFH 2YD9A 2C3GA 3PQYB 3S88H 1OGTA 3KPPB 4RMTA 4X0KA 3CDGB 1DQML 4NO5B 3WD5H 2M26A 5L7XL 1GC1H 2BZDA 5F71A 2FJHA 3KYNA 2NY5C 4J8RA 1MVUB 1ED3B 1LP9E 3HE7A 3E3QC 3GK8L 4L9LC 1O7SA 4UBDC 4QOKD 5IQ9A 3ES6B 4MJIA 3WBDA 1MJJB 4NO3A 4I4WB 4PGDA 1U8MA 2MFNA 5CJ8A 3KPOA 1HHKB 3VCLA 4C54A 3EOAA 4EDXB 5DJ8B 1NGYB 4EVNB 1R5VA 3MLXL 3RZCB 3WO3B 3S4SA 3VD5A 3FONB 5C09B 4HPYL 2P8PA 4KKAD 4P23C 2XNAA 1D6EA 4L3EA 1KXVC 4IJ3C 3TO4A 4F9LC 3V8CA 4XNYL 3RFZC 1KPVA 1A7RL 1BVLA 4FQLL 5H2BA 3TV3L 3MV7A 2FD6L 1DVFB 4XVUD 3F58H 5E6ID 3LSOB 2ZUYA 3TIEA 4OQTA 3TH4T 1FNAA 5INDA 5E8EA 4X8JB 4X6FB 5TF0A 4R90L 4DFHA 2AJZA 2OK0L 1GSMA 3I6KB 5A2LH 3NIFE 5ICXB 1NFDA 4LLUA 3V6OA 2B39A 4ZO9A 5HYJD 4R4FL 1C5DA 3W9EA 2B8OT 5D1XA 4O51B 5FA4B 5FYLL 2QLVB 4CNIA 3U2SB 5IB3A 2P44B 2IG2L 5B3JF 1KGCE 4IDJH 4N90E 1ZLUK 1YNTB 4LVHC 1DLHB 5D7IA 3K81A 1XAUA 3SE8H 2X42A 4PJEB 1UQSB 3O6MH 4ODHL 1HILB 2X89A 1ZTXL 5ITBL 3ZT6A 1H5BC 4J3WA 3UP1A 3D85A 1W0YT 1IGML 4KTEH 3V7MA 4ORGB 2VIRA 1F00I 3BVNB 3LIZH 2AJVL 5C08D 1OW0A 4KROB 1WZKA 1CFBA 2AJXL 4O2CA 1IQDA 5E2VL 2VDMH 5EUOE 3PQYA 1DANU 1T7ZA 1DUYB 1T20B 3KPPA 1TXKA 4M7JH 3JWOH 4JRXB 1KJ3H 1U8OA 3HE7D 5T3XL 1BQUA 4PJFF 4U6VL 4IOFC 1MVUA 4HAGA 5AZEH 5LGHH 3BKYH 4MJID 4JZOB 3VD7A 3MYZA 2D7PA 5TPWL 4UTAL 3RL2B 4NBZB 4I4WA 3U30C 4QXUL 2VH5H 4OT1L 4LP5A 3O41B 1F11B 4HPOH 2XI9A 4EDXA 5ID1B 3HN3A 2CLVB 2KH2B 5B8CC 1OAYH 4L3ED 4L4VA 3TO4D 3RZCA 2A0LC 1OARH 5K9OB 3TBYB 4QOKE 5CJQH 4OF5A 1WCBB 2X5PA 1N0XL 3C6LB 3QNYA 3TA3B 3QDHA 5SX5K 1RUKH 3WFDL 4D0DB 1S9VA 5JPNB 4Y4HA 1TIUA 5B21A 3ARDB 4P3CL 2Y5TA 3PWVB 4YE4H 2D0GA 5FCUH 3IB4A 4X8JA 4X6FA 2WANA 1VFUA 5F97E 3TYGH 4FQXA 4F57L 3OAUH 4XNUH 3ESVF 3QXDA 3HZKB 4WW1B 4OM0L 1OF2B 4YZFE 2W59A 1CN4A 3P9LB 4WWID 2FH8A 5D1XD 2A73B 3LRGA 4QHUB 4WEBL 4NFCA 4HIXL 2D03H 1T83C 4O51A 1QBLH 2CQVA 1ORSB 5FA4A 2AQ1A 4DN4L 3LHPH 1A47A 1T22A 2H32H 3WLBB 3PF2A 4KRMB 1SY6A 2X89D 5HYJE 1DLHA 3PIQB 5HHNB 2A9NH 3MRRA 2JJTA 5JW4Q 2ZCHL 3D85D 4ZOCA 4P23A 1MCIA 4IMLA 4UDTB 4F9LA 1CLZL 4U1MB 3V5HA 3SGJC 3ZYOA 4DK6A 1OP5K 4NFDA 2J4WH 1UYWH 3G9VA 3MGAA 3G6JE 4ONFH 1MI5B 1OQOA 2FATL 5IMLB 4LASH 1NC2B 5EOTB 5I6XC 2YEZB 4NCC1 1N0LA 2H26A 3QUMB 3PQYD 2Y36L 3U9PL 1M6OA 3P11H 2QQNH 1CQYA 4PP1C 3Q6FB 3CPLA 1FNLA 1FNSH 5C08E 5AWNH 2HT2C 4YGVB 3FT3A 3ARGC 2UY6A 3BRFA 1BJ1H 1NCCL 3QHZL 4X4XB 3MV9B 3OAZK 5HHOB 2OP4L 3GZKA 1G7MB 3VXTA 5KAQG 3RZCD 1QPPA 5ID1A 2R0WH 4KVNL 4MJIE 1S9XA 1UEYA 3IFNH 1FBIH 1KIPB 3WXWL 4QY8A 1WCBA 4X6BB 3C6LA 2ORBL 4YLQT 4Y4HD 1DQMH 5L7XH 3BEVA 1C12B 4W6YB 1M05A 1QBBA 4CGTA 1Q1JL 5BZWA 1CTOA 4L3EE 2BCKB 2HMID 4R7DA 1K4CB 2B1AL 3GK8H 4K9EC 1W0VA 1XGTB 4FQXD 2VXUL 3MV7E 5T5FL 1SMAA 4HK0B 4ZFFA 1XGYL 2VSCA 4HX1A 5EC2B 1ZT7A 4K7PL 2MCPL 2HVKB 1LP9F 4YR6B 3RGVB 4LBEB 3MLXH 2VN7A 4R3SA 1OF2A 3OAYH 3SCMB 2C1OA 1NLDL 3BGMA 3V4UH 5DJ2B 2F58L 3QFDB 4BUHA 2A73A 5HI5D 3SDCA 1NFDE 2NNAA 1A7RH 3TNMB 3V6OE 3R8BB 1RZIA 4FQLH 3SDDB 1ZSDA 3TV3H 2FD6H 3RWHB 1XFPA 3UTPD 2AEQH 2EDDA 3QQ4A 1FZJB 3MLUL 1HQ4A 2F54A 1DUZB 4R90H 5EU6B 1KCKA 2OK0H 2W65B 1TDQA 3K1KC 4U1MA 5D7IE 4C4KO 3V9FA 4WFGE 3EYQD 4OZGB 1FJ1A 1KTDB 5IFHL 1MLBA 1MI5A 4R4FH 1NC2A 1I9IL 4LSUL 5F7FA 5I1LB 2CDGB 2D4FA 3UBXB 2C3VB 5IHLB 3BH9B 3S36X 2XG5A 4OZ4A 3NACL 5D4QA 3NIFF 5FYLH 1ZGLP 2IANA 3B5HA 2IG2H 2XA8L 4MD0B 3V79C 1R24B 4KWUA 3B9KC 5HDOA 1YEFL 1I8KB 3EYVA 2ZCLL 3FFCA 2AXFB 1FFOB 1ZTXH 1QQDA 3GJEB 1BM3L 1H8NA 5ITBH 4JFFA 3U7WL 5IIEA 2NR6C 4WDIB 3I6GA 3TJHC 3GMNA 3MFGB 5HHOA 4BJLA 2APVA 2NLJA 4DW2H 5KSBB 4EXKA 1XGPB 2R2HB 3D39E 2GCYB 1G7MA 4U49A 2H45A 1MFBH 3UPRA 1WIOA 4QRRB 4ZOEA 4P5KB 2H2SC 3C6LD 4I0PC 4WI4A 1FCGA 3IF1B 2AJXH 3IJHB 5E2VH 3RKDC 3SE4C 3VGGA 1A4JA 4X6BA 2DM3A 2NXYD 4F7TA 3IDUA 5IF0B 1ONQA 4L4VE 4NQDA 5T3XH 5CAYB 4U6VH 1P5VA 2EDYA 2R4SL 1A6AB 3HTLX 4S11A 4U6XA 3IVKB 1CGXA 5IBUB 1J1PL 4YDIH 3VFMA 4UTAH 2DLIA 5FA3A 4Z7WB 1BECA 5EUOF 4QXUH 1FLTX 1JWSA 3WEXB 2FH6A 4ZD3L 2NZ9D 4G6AC 4YJZL 1MHEB 1X4XA 1UVQB 1K5NB 4YR6A 4LBEA 4N8VB 5ELIA 2J5LC 3SDCD 1WBXB 3T2PA 3QYCA 5F88B 1N0XH 5D9SB 4OI7A 3TNMA 3F12A 3WFDH 2YUZA 4IS6B 3SDDA 1LO5A 4OF3A 2F54D 2JJVA 3UJIH 1UCBL 1WBYB 3E3QE 3EOBB 4P3CH 3RWHA 1U3ZA 4NWTH 1DQJB 4NT6B 3VG0H 5DVKA 1ZT1B 1U91B 1DUZA 2DN7A 1UCTA 4WW2C 4L8DB 1G7PB 2LAAA 4F57H 2XXMB 4JO2L 3UTPE 5ACZA 1BFSA 1MI5D 3D0LA 1NC2D 3LN9A 1LD9A 1JRHI 2VISB 2XKNA 4WEBH 3LMJL 4OD1H 5FF6A 4HIXH 2IAND 5AD0A 3ARVA 1BWWA 4LOUC 4DN4H 4B0MM 1A1NB 3WO4B 4IOIB 2FEDC 3MUZ1 4MD0A 1R24A 3FFCD 4JAMB 3WHE0 2W0KA 3EBAA 4N9GA 1A9EA 3HNTL 3OKOB 4OCSL 4YZFF 1SHMA 4WUUB 1I9RL 4JFFD 1P53A 5IEKB 2ZCHH 4UT7H 3U4BH 1ZGLA 2XQYG 4LKXA 1CLZH 1QRNB 5HHOD 1XT5A 4L4JA 4N68A 3AY4A 4I13B 4G9FA 1S9YB 4NPYA 3QO1A 4P9HC 2EKJA 5KSBA 2FATH 3R1GH 3MTRA 2GCYA 3FB7B 3MLTB 2HT4D 3QEUB 4AM0A 5MENE 4QRRA 1BLNA 3ULUD 3MJ9L 3OHXB 3IF1A 2F8VA 2Y36H 2W0LA 3MRLB 3U9PH 4NQDD 1ZAGA 1H0DB 5SWZA 3G6JF 4MQSB 5IF0A 5IJVA 4P99A 1KPUA 1RZ7L 5IROA 1S7XB 4OV6F 4JHWL 3O4LB 1ZHKB 1SVZA 3KAAA 2E7HA 1UKTA 1NCCH 3QHZH 4XNMA 1JPGB 3WLWC 4YHLL 4RA3A 3QI9C 3HKFA 2OP4H 4PP1D 2E7LC 1KJ2B 3DTXB 3RGVD 5MI0C 3QIBC 3VFNA 4UQ3A 4KVNH 1EBAA 5MERB 3WJLA 1G7HA 3IFPB 1CR9L 1DFBL 3WXWH 3GSQB 3OGOE 3SDDD 4R7NA 1F6FB 1D3CA 3KPLA 5EPMA 4AIZA 4BZ2L 2XFXB 4IS6A 3QXAA 1Q1JH 1AGEB 4AEIL 1RZ8B 3EOBA 2B1AH 1DQJA 1EFQA 2H2PC 5ADPL 2QKIA 5FDYA 3VXOA 2VXUH 4I0PA 5T5FH 1XGYH 1CTNA 4L8DA 5CBAA 1JZ2A 3SE4A 1AGDB 4XXDA 1KELL 4K7PH 2F54E 2MCPH 5IFAL 1XGUA 4BQ9A 2J1KA 3NCYS 5IR1A 1G6RB 1NLDH 2F58H 1MF2L 5DJ6B 2IAMB 2RB8A 4YHKL 5GGTL 4TQEL 4DFIA 5SWSB 3S3PA 5DR5L 1NGPH 3QQ3A 4IOIA 4WI8A 1CFTB 3MLUH 2WSKA 1JYVA 5J56B 5JA9A 3BZFA 3KPSB 4NN5B 4ZXBC 5K59E 4WUUA 3VG9B 2IANE 4Z7UB 5F3BB 1NFDF 4Y0GA 5ITFA 5C2UB 3QA3B 4G9FD 4FQHA 4PB0L 4RAUB 4DVRL 2Z92A 4JKPL 5ICYB 5HGHB 3FFCE 4KAQL 3KDMB 1S9YA 4GG6B 5DJCB 4QRRD 2ENYA 3F7VB 4PP2A 4JFFE 3QEUA 1IRAY 3NH7L 3VFVA 2XKSA 2FCBA 3NACH 1DEEA 4WW2A 5DFTA 3T77B 3H8NA 4I18C 5D7IF 5SWZD 4MNHA 1LDSA 2JIXB 2XA8H 4RZCA 3JZ7A 1FG2B 1P4IL 4K8RL 2BSED 5DRXA 1YEFH 1IZKA 2B4CL 2ZCLH 2GW5A 3GMPA 4OZFG 5GRZA 1FZOB 5IQ7L 1AR2A 5D6CB 2VXTL 3ULUE 3RUGB 3ULVL 2PYEB 2BVOA 4WGWB 3U7WH 4NQDE 4LCIL 4M93B 3REWA 4DAGL 5GZOD 5EORL 1JPGA 5FUZL 1QBML 4U1KB 3NIGE 5J9PA 3DUUB 3EJYD 1I7ZA 1GJIA 4IM8A 4RRPG 2FBJL 5J4MA 4GRWH 5CHNB 5I0DA 1KV3A 5FYKD 3MBXL 2Q3AA 3GSQA 1X5AA 1B0RB 1DP0A 1C5BH 1I3GL 4XMPL 3RWGA 5C1MB 4WVRA 2XFXA 5EO0B 3JWDC 2R4SH 3AB0B 1AGEA 1TZIB 2R0LL 3BPLC 1ULVA 3R0MA 1J1PH 4QRQA 2R15A 2XQBH 1MWAL 1NUFA 2OSLA 1I8IB 1KF9B 5D96C 2ITCB 4IRZH 1OAXH 5ENWB 1AGCB 3BP7B 3U36B 3SDXB 1F4WL 1UZ8B 4PFEA 1G6RA 4FG6C 4FFVD 5I19L 4OF8A 1JMXA 2IAMA 3GJFK 3O2WH 4KJQC 4MA1B 4M8VA 2MMXA 3ZSTA 3D87B 4KKCC 4U2YA 1N2RB 3RX5A 1DLFH 2A9ML 4XPBL 4Y2DB 4HZAA 2E7LA 1UCBH 4WUUD 1KCSL 5DVOA 1ZOXA 1CFTA 4PV9B 3UTQA 2NY0D 2FO4B 5JUEH 1J9CT 2A6JA 1FNGA 5ANME 1QRND 2X44D 3EYFA 3G5ZB 5GRVL 3FL7A 1YN7B 4HWEL 4JO2H 1V3LA 1WZLA 4KUZL 2HTKD 3CU1A 5HGHA 3B2UD 4HLZH 3KDMA 4GG6A 3HZVB 5KBNC 4XP5L 5DK2A 4ALAL 3LMJH 5C2BL 1EZVY 4G9FE 2R1WB 1VPOL 1D6VL 2UY7A 3MA7A 1QSVA 3QDJB 2WIMA 2JIXA 4JKKA 1RUPL 2CKBB 1EERB 4OCSH 3DMMC 5IMOB 1OSPL 3OJ2C 1CZ8L 3MRPB 1I9RH 5FYKU 2FDBP 5D6CA 5ILTL 4QKXB 3L3JA 3RUGA 2HG5B 1TCRA 4LOUD 3Q2CA 5SWZE 1OL0A 2ICEB 1T0NA 4K7PY 2Z91A 1A4KB 1N7ML 3P4MA 5SV4A 2VLRB 3CFBA 3BDXA 3CVHL 3DXAB 2DAVA 3BH8B 5GGSA 3X14B 3VWKC 1EHLL 3VXNB 2P46B 2GJ6B 1JTPA 3MJ9H 5JLZA 4CMMB 2KUTA 1BOGA 1B0RA 3OB8A 5I74C 2X4OB 1T2QH 4X98B 1C16A 2R1XA 3QG6A 1RZ7H 4NKIH 4M03A 5CS7A 5SX5H 4HC1A 4JHWH 3INUL 2R39A 3CFEB 2E7BA 5FYKE 3IT8D 3K0WA 5TF1L 4OGAD 5CEZL 4NQCB 4H20L 2D31A 3VWJB 3MRGB 2ZUVA 3QZWA 5HGAB 4JCLA 4OKVB 4BSWA 5DF0A 4DGYL 5JOEA 5KSAA 5CIPB 2VNCA 4JM4H 2IAMD 4HWNA 1UZ8A 1TNMA 1UWGL 4DWHA 1CR9H 3U79A 2ZNXA 3PUCA 5TH2B 1FPTL 5T1MB 1JP5A 4BZ2H 5FGCE 2DIAA 4KGLA 4Y2DA 4AEIH 5KJRL 4LAJH 4HUVB 3DVFA 1JE6A 4HWZA 3VFRB 1T1YB 3LCYA 5KVDH 2R4RL 5ADPH 5GRUL 2JB6A 2FO4A 1CFQB 3I02A 4MAUL 3BWAA 1NGZA 4YDKL 1W72A 3MV8A 2X09A 1KELH 4NWUL 4KJPD 5D7JA 4ODXA 3G6AB 3F62A 3TZVC 1MRCL 3D3VB 4XNQA 1U58B 4M62L 4JY4A 5J0BA 1MF2H 3T0EB 4YHKH 4MQXC 4TNWF 2VYRE 4ZO7A 2JIXD 5GGTH 4TQEH 3M8OL 4IRSC 4YFDB 3UAJC 3VH8G 3CSYB 2Z31B 5DR5H 3EW3B 4P2RB 1UB5A 2CKBA 4WHYH 3EGSB 4WTZA 5L9DH 5CP3A 3E6HB 4R4NC 1JPFA 1P1ZA 4KV5E 4UV7L 3BYYA 1JPTL 4PB0H 3HC4L 5HHMD 1U8KB 3QDGB 4JKPH 1WIUA 4KAQH 4X6CA 1WFTA 3LH2H 1J10A 3OF6A 4P2QB 2ESVB 5EUKA 1IGJB 5E1AA 4TNVK 3T09A 5K59F 3NH7H 4YIQA 2X1XR 5AYUL 4B41A 2Z35A 5DXWA 4CMMA 4I9WD 5FKPA 4RA0C 3NCCB 2X10A 3S4SG 1XCTA 2BOBB 4K8RH 1P4IH 4PYGA 2X4OA 5K9JH 4S1DC 4HJJL 2WBWB 3F65A 3PL6C 3RWJB 4Z78B 4YBHA 3N1GC 5F7KC 5IQ7H 2ITDB 2VXTH 3ULVH 5J11C 4Q58C 3GRWA 1CFSB 1CVRA 1YYML 3V6FB 4DAGH 2VKWA 3NGBB 5EORH 3ZT5A 4GAYA 5FUZH 1QBMH 4NQCA 2VR5A 5F7MC 5KSAD 5HGAA 2VUOA 1I9JH 2OI9C 3ULUF 4PRNB 4QEGA 2BNUB 4NQXA 4YNYB 3FN9A 5D2LB 1JWMB 4EDWL 1I3GH 4XMPH 4Y2DD 2IJ0C 3HPLB 3NIGF 3O2VL 5B3NA 4FMKA 1X5KA 4JZNB 3U4AA 2R0LH 3VFRA 2IC2A 2FIKA 1FL6B 1PD6A 3QCUL 1F3JB 4QF1A 2YUXA 3JV4A 3MV8D 5DD6A 5D7JD 1MWAH 1N5AB 3WKML 2VDOL 43C9A 4TVPL 1HNGA 3C5ZB 1VCAA 2NY6C 2VDRL 5D5MB 3S35L 1HKLH 1H3WM 5D93C 3D3VA 1T3FB 3SBWA 2NXZC 3H9HA 5I19H 4OGYL 5IW1A 3C8KB 3LDBB 4YHIA 4ZFOL 4GG6E 3VRIA 2A9MH 3DI3B 4U1HB 1J7VR 4PJBB 4APQA 4XPBH 3RVWD 3QXWA 1JHLL 2Z0BA 3STLA 1KCSH 1X9QA 3S37X 1V7NH 4Y4KC 5FAAA 4YAQB 2E7CA 5GZNC 1RSFA 5IV2A 2ZOKA 5IESL 1YYLL 2FECL 4TYUA 4TVSa 4HWEH 1JYXA 3OF6D 4KUZH 5JDSA 5IMKB 2VLRD 3P77B 3PGDA 4PY8I 4WO4B 2W38A 1XF4B 4LLYA 4PBXA 2QSTA 4ALAH 4RISH 4Y2OA 1MHPL 5C2BH 3VGHA 1T1XA 1VPOH 1SYVB 5HHME 5DEGB 4CADA 3HE6A 1FG9C 3FT2A 1YA5A 1NFIB 2EIZA 3DX9B 1NEZB 5D70H 2BOBA 4U1NB 4MA8H 3LPWA 4F8TA 3FMGL 4PRPE 1OSPH 1RZKC 1CZ8H 1Y6MR 2COQA 4TOYL 1F4XH 5ILTH 3JTTA 4OUUB 4I9WE 1JNLL 3MRJA 2XPGB 4NQCD 4FA8A 3RTQC 2L7JA 3HC0B 1BD2A 1S7UA 1UJ3C 1YPZE 5A2KH 1N7MH 5EZJB 1Q0YL 3JTSA 5TDOB 1QFUL 3CVHH 3N50A 1EHLH 3NFNB 1RAMA 4JFOA 5I73C 1Z5LB 4ENEC 1BZ9A 3IDGA 1T66D 3HPLA 5B4MC 4NN7C 5EO1B 4BH7B 3NZHL 3E0GA 3VXRA 1CG9B 4XC3L 1AD0B 4U6TA 5JHDB 3INUH 2P24A 4GKNA 5JOFB 3UJTL 3LS4L 4TRPL 4PJXB 5TF1H 4G8FB 5CEZH 4FZEL 3MRFB 3Q1SL 4Z77A 3D3VD 1KG0B 1AXSA 2ICWJ 2XV6B 3LZFL 5CSZB 4EJ1C 1I1RA 4JPKL 1UWGH 5M94B 1JUFA 3MV8E 1AFVL 4HV8B 5T1DL 4APQD 3L3OA 2YD7A 2PXYB 1XIWA 1FVDB 1B6DA 4U1HA 4PJBA 3NPZB 4I1NB 4JREB 5KJRH 1A1MA 2R56L 5CWSB 2R4RH 5GRUH 3LKQA 1DVFC 1U9KA 5KW9L 4MAUH 1ETZA 4YDKH 4NWUH 2D7OA 4XP6L 4KK9C 1HHJB 3O45B 4E42B 2EDLA 3WE6A 4YHNA 2A6KB 1MRCH 3P77A 3ILPA 4M62H 1RUML 3HE6D 4QHLA 4P4KB 3P4NB 2FYYA 4PJ5B 4X6CE 4XI5D 3X11A 3L5XL 4BM7A 3M8OH 2D0FA 4OIAA 5KANI 1NH6A 3LEVH 3OSKA 2XTJB 1NEZA 3DX9A 3GSNL 2W0PA 5IBLD 1TVDA 3VFPA 4RMWA 1RD6A 3FQWA 4Z7VB 5IOPB 4UV7H 2ZPKL 1RUAL 4ISVB 4YO0B 3S3SA 1BD2D 3HC4H 2GTZB 2FL5B 2XPGA 2MQCA 5GGRB 5D72L 5I1DB 2RIKA 5EZJA 1JZ5A 4NBXB 1U42A 4WW2F 5TDOA 1EFXB 3RIFF 3RWFB 4KV5F 3NFNA 1CIDA 4QTIL 4TUKL 1TTUA 4FQPA 2ZUWA 1XR8B 3H9SB 1U93A 4GAFB 1U8LB 3ZZ1A 3VXRD 1NANH 1L0XA 3UTSA 4IMKC 4LL9A 4KROC 3CFJB 4ODWB 1TTGA 1K2DA 1UEMA 2EXWC 3NCMA 4J3OC 3MJ7B 2P47B 4YPGA 3WUZA 2N1KA 2BSTB 1YYMH 1HCFX 4LNVA 3BN9C 3QUZC 1WC7B 4WJ5B 1T0MB 2I25N 4OIIL 1KG0A 5CSZA 5DHYA 3TIDA 5GS0C 2B5IB 1FC2D 3FOMB 2EC8A 5CINL 1ZHLA 4JQXA 2OXGA 1XIWD 5IT2L 3CZFA 5LCVL 4EDWH 3EYUL 2PXYA 3O2VH 3RTQA 1FVDA 3STZB 3TA3C 5TE4H 5A3IC 1NMBL 3QCUH 3MRBB 5F21B 3TBTB 3FZUC 2GT9B 5DURB 3VMOA 3ARDC 5FO8A 3WKMH 2VDOH 2J88H 4TVPH 2XY2A 4LMQE 5E8PA 3NCJL 3VFTA 2XYCA 3ECBA 3S35H 2Y25A 4E42A 4LSRL 4MYWB 3TVMC 1CICB 4PJAB 4Z7OE 35C8L 4OGYH 2ZKHH 3ZE2E 1J88A 3P4NA 1CXKA 1DL7L 4U0QB 4M6OL 4KJWD 5EU4B 2UWEA 3V6BR 5GIRA 1D5ZB 2XA3A 1OAZH 1Q72L 3RI5F 2EH7H 5IOPA 5IESH 1YYLH 3OXRB 4YO0A 3OGCB 1NUGA 4MJ5B 1HHIA 2GTZA 4GG6F 2W07A 3BOVA 2BY1A 4JFYA 4F2MA 5HYIA 5I1DA 1KTLA 4H5SB 5CD5D 1Z0MA 4ZYKB 4UZGA 3AS1A 4DK3A 2NW3B 3HMXA 5EA0H 1BD2E 4LFHD 2VDPL 5CEXA 3MNZB 1DQLL 3BHBA 5F7LB 1QEWB 3H9SA 2BSSA 4HFUL 3DRTB 2OR9L 4OZIA 4P3DB 3MUJA 5T1KA 1S8DB 3H3KA 1QSFB 5C6TL 3WIHA 1KLFA 4OFPA 4TOYH 4ODWA 3O6LL 3MJ7A 5LWYH 1TZHB 3SGDI 1JNLH 2ADJB 3RVVC 3D2UA 3VXRE 1IL1B 1S7QB 1X5FA 1URLA 2IBZY 2EE9A 4WJ5A 4FQJL 4U1LB 1Q0YH 1QFUH 5EBWA 2IPTL 3QDMA 25C8L 5HHQB 2EECA 4HIEB 3FOMA 2RFXA 1KIQA 3SKMA 1IKNC 2PXYD 3RTQD 2XWBA 4H8WC 1YPZF 4YXHL 5CEYA 1HYRC 4X7SL 1NDGA 3NZHH 4A2LA 3GJFH 3UBXG 4GKZA 3P2TA 3FB8B 4XC3H 1C7TA 1CLOL 2RCSL 4F9PA 2DQIH 1YJDC 3UJTH 3LS4H 4TRPH 4MNGA 3U9UB 3VXMB 4Z5RB 3KLHC 1RZGB 4EIZC 1OM3L 2OZ4L 4MB3A 5DQDH 4FZEH 3Q1SH 4OQ1A 4XCEA 3B5TA 1KYOJ 3LZFH 1LK3L 4XP9H 1CICA 1JL8A 3NTCH 1JHTB 2O5YL 3K80A 4JPKH 4LLWB 4POZD 3T0VA 2C1PB 1MCWM 1AFVH 5H37G 3HG1B 5T1DH 1KC5H 5F72S 1OP3K 1CDJA 3QUZA 2R56H 4B50A 4OB5L 1K6QL 1ADQL 4D9QD 5DC9B 4HH8A 1NMAL 5C0CB 4IEFB 5KW9H 3BD4A 4S1QH 2F8XC 1L7TL 1ZEAL 5FB8A 2APBA 4K23H 4DZBA 1HOCA 4XP6H 2BRQA 4QXGL 4NDMB 1PX4A 2NX5A 3OG6B 4LLDB 2YRLA 4HS6A 1Z3GL 3MZGB 3PWLB 4HHAB 4LKCA 2DM2A 5C0IA 1RUMH 2NY5L 4K71B 1OAQL 3L5XH 4ODUA 3H9SD 5F89B 1A14L 1YEDB 3FO9A 5T1KD 3X3GL 4U3CA 2SEBA 3IU3B 4N8VG 5BVJB 2G5RA 1GOFA 5JXEA 1E6OH 1KCRL 5ESQB 1RHFA 1R3JB 3GSNH 4JZJB 3TVMA 1OHQA 5GSVB 3GGWB 3D2UD 2ZZUT 4X6CF 3G5YA 4PGJA 1GZPB 4JDVB 3UTSE 3QWOB 2MWCA 4XCYB 4QYOB 5I8CA 2Y06L 3NVQA 5D72H 4P0DA 3NBNA 1NBQA 4JDZB 3QDMD 1RK1B 3RRQA 1CE1L 4P5MA 1WZMA 4NGHL 4XXCC 2QSVA 5EIVA 2Y7QA 4I3SH 4L8CA 4UIMB 3K74B 5HHQA 4BKLB 3HMWH 4QTIH 4TUKH 3BZEA 3U0TA 5GRWA 1JGEA 1A6VL 2H32B 1U3YA 2NY2B 3ZT7A 1OWWA 5L6YL 5M7QA 3SN6N 5E8OB 5E24E 3ZHDA 3T8XA 1HXMA 3FT4B 4NYLA 3U9UA 2YUVA 3LRSA 3IFLL 5C0NC 3KS0J 4LQ1A 4LRIA 4FQQA 1CICD 1JIBA 4OIIH 3RY5A 2A2QT 3AGVA 2X4RB 1NGXA 3GSOB 1IARB 1YZZA 3V5DB 1JHTA 2G2RA 4TPRL 4W4OC 5DZNA 5D7LB 3HG1A 5IT2H 3IU4H 5LCVH 5CP7B 3EYUH 4YPJA 3T65B 3CFCL 4PLJC 3QJFB 5F9WB 3D48R 4ETQB 3BMWA 2AABL 1FYTB 5E7BA 1EUUA 4KY1L 1NMBH 5DJAB 1Q0XH 4U6HB 5DQJB 3AREB 4X5WB 5DRWB 5ISZB 4WHDA 5A2IH 1EEUA 2HTLC 2UWEE 5F7HA 5K9QG 2V2TB 3NCJH 2NX5D 1FP5A 4LSRH 5EU7E 4HUWB 5C6PB 3SDAB 6CGTA 1RHHA 35C8H 3R06A 4XWOC 3V4PL 3WSQL 3LS5L 2R9HC 1FFQA 3SJVA 5KN5A 2BNQA 3GSWA 4OFDA 5IMMA 3LKSB 1DSFH 5F9JB 4HKXA 3QNZA 5JXED 4ZUWB 4ZOBA 4N0UE 5FO7B 3FQUA 4TUJA 1CDCA 2DMBA 3P4OA 2DQCL 3MACL 1RJLB 2YMXL 4Z7OF 3SE3A 3CFDB 3ZE2F 4UI2A 1Q72H 4X80L 3ULSB 1QR1A 1NCDL 2D0HA 3H2WA 4OZIE 3DV6B 4JDVA 4C83A 3QWOA 6FABL 4M5ZL 2YA1A 2FNBA 5EIQA 2AV1A 5T3ZL 5MEPA 4EI5C 3IDYC 4PJCB 2VDPH 1GYAA 4JY6B 1R3HB 1MRFL 4AIOA 5DJYB 4JG0L 5IK3A 4ZPVB 1T03L 5DFWH 4HFUH 1K8IA 2B1HL 2OR9H 2H32A 4NNYB 3QDME 5TDNA 4F7EB 5C6TH 4UT9L 3WFCL 3O6LH 5F93C 3VU2A 4U05A 3PDDA 2EIDA 3K1DA 3RU8L 5DGQA 4S0TD 4KKBD 2ATKA 5LQBL 5FDWB 4YBLB 4XH2A 4FQJH 4DZ8B 1AD9B 1F8TL 5B22A 1IEAB 2XQYK 4MNGE 2IPTH 1NUNB 3GSOA 25C8H 3HG1D 4BSVA 1NAML 5DS8A 3MOQA 4YFEA 4Z8FL 3CSGA 1IKFL 4YXHH 5C6WH 3X13B 3ZKXB 1IILE 3H7BA 1JPSL 3WYRA 1CLOH 2VAAB 2EZ0D 5KS9A 1OD7A 1F4AA 3AREA 5DRWA 3DYPA 1OM3H 2OZ4H 3MUGA 5ISZA 1A9BA 4BFBD 4N5UA 3TM6A 5E2UL 1EO5A 2QADD 5D1QB 5FYJL 1NANI 4EXPX 4HD9A 1FGVL 1LK3H 4NQSA 3SJVD 5HGDB 1S7RA 2BNQD 5KSUA 3SDAA 2O5YH 4AT6B 3HR5B 2CD0A 3TNNB 4HJGB 3X3FL 3LKSA 2YN3A 4KZDL 2NX5E 1A6TB 2OMBA 1YQ2A 4RCAA 1QFHA 2WINB 3OB0K 3LKPB 4JM2B 3WFEL 4BELD 1A3LL 4OB5H 1K6QH 5DRZB 2H1PL 5C0BA 3QO0A 1NMAH 3FHQA 4XBPA 1RURH 5HD8D 1U3HB 2X1OA 1L7TH 1ZEAH 5BXFB 3DBXA 4KQ3L 4QXGH 3VG9C 1FO0L 2H9GA 3S5LA 1A7NH 2N4IA 4YDVA 1Z3GH 3H9ZA 4OKDA 1Q9WB 3FO2B 1G7LB 4IIQB 2NY5H 3QZWG 4IRJA 1OAQH 1B0WA 2CUIA 4K9EL 4PRAB 1A14H 3X3GH 4ZS7H 5FM5O 5C0RL 5J1AA 1HSBA 1KCRH 4WFFD 3S36L 3I3BA 3MNVB 3OWEA 5GSRB 5D7KD 4BH8B 5L2KB 4QRTA 2P5WE 3OBAA 1PYWA 4G43B 1FSKB 4FTVA 4XBGB 1M7XA 2HRPL 3B3IA 2Y06H 4Y89A 2Q86A 1KSRA 1IQWL 1KUMA 4YDJA 4AK1A 4WV1C 1CE1H 3KJ6L 2HN7B 4NGHH 3DYMA 1MRDL 3TBSA 3VRJA 2DWEA 5D7LD 5C0GA 5TFSL 4JO1L 2YN5A 3C9NB 4UQ2A 4U3HA 1TQBB 5J89A 1A6VH 1E6JL 1MLCB 1YMHB 1IM9A 4M1CD 3DETD 4B53A 1GIGL 5L6YH 4FP8L 4W6WB 1UJTA 4XMKL 4GW4B 3GB7A 4MAYB 1DN0A 3ARED 5ISZD 1EJOL 2PO6B 2YWYA 3LPFA 3AB0C 4KDTC 4CKVX 1BBDL 4H1LH 2XWTB 2VWEE 4YFLI 1BF8A 3SDAD 3V7AG 4KI5C 1KB5L 5LG1A 1ZT4B 4TPRH 4G7VH 4UMGA 4Y4FB 4YK4C 4HJGA 3RWEB 1MJUL 3CFCH 1HHGA 2P1YA 5C0BD 4O2FA 2ZUTA 3SJVE 3UDWC 2AABH 2BY2A 2BNQE 4X9HA 2NTSP 3V5KB 1WT5A 1FNEB 4KY1H 5AYQA 1E0OB 2OTWB 3KVQA 5DD1L 2NY3B 3Q6GH 1DE4A 4I3RL 1JF1B 5IKCB 1ZWIB 3M17A 4MX7B 3PWNA 1IAKB 4HIJB 4NNXA 3HLAA 3V4PH 4IRJD 3LS5H 3FO2A 1C8PA 2JB5L 1G7LA 4ODTL 3UMTA 1JWUB 2V5RA 5LGKA 2NY1D 4D0CB 5EC1B 5JTWA 2UWEF 3CC5B 2FBOJ 3QUYB 4FABL 2DQCH 3MACH 3NIDE 3RNKA 2YMXH 1ES0B 4KUCD 1CGTA 3VRLE 2VLJE 4FTVD 4X80H 4BH8A 4JFPB 1NCDH 4R26L 4G43A 4K7PX 4KQ4H 4XBGA 3C08H 6FABH 4M5ZH 3O8XC 1X5IA 1N64L 2QJDA 1I1AB 1PSKL 2B2XH 5MEOB 3O9WB 2XIDA 5DEZA 1U92B 3HUJB 3SQBA 3TCXA 4CVZB 4UTBH 1HN1A 5EU5B 5DJDA 3IDIA 4OZIF 1MRFH 1IM9D 3U4EA 2KZWA 4JG0H 4JQVA 5FOBA 2CPCA 4Q2ZA 4PRHA 1T03H 3P30L 1MLCA 4QHKJ 4URTB 5CMAA 5E8NA 3EO9L 4UT9H 3WFCH 3CK0L 1FFNB 2VR4A 4GW4A 4UIKH 4D2NA 4MAYA 5D2NC 3LVEA 5B39A 3H0TA 3O3UN 2PO6A 4P9ML 3RU8H 5DMIL 1UXSA 5F7DA 1FZMB 3PWPB 2Q1EA 1ODAA 4CW1A 5LQBH 3TFKD 1T4KA 5KS9E 2OMNA 1F8TH 3EJZD 4MSWA 2PNDA 1NAMH 5ISZE 3VWJC 2P42B 4Z0BL 2CDEA 2XN9A 4EN3A 4Y4FA 4HULB 5GISL 2QSCL 1E28A 1IKFH 1I3RB 3QIWB 3F5WA 1GZQA 1F2QA 5T3XD 3TLRA 3WJJC 5ADOL 3BAEL 2XZAL 3VXPB 4WWKA 2ARJB 3CLEL 1FNEA 4R2GB 4XZUB 1U3HD 3O4OB 2V9RA 5EG6C 3ARQA 3BT2H 4HH9A 2OTWA 5JA8B 2V5YA 4CU8A 4LLVB 5BW7A 4NUJB 5E2UH 5FYJH 5GJTL 1NC4B 2BVPA 3PWJA 5C0BE 4E0RB 4BA8A 3WCYA 3HB3D 1YY8A 1FGVH 5HY9A 4NKDB 1XMWA 4GRWB 4G6MH 1IAIH 2CMRH 3X3FH 1N8ZB 3DIFB 2PN5A 4GAGL 4KZDH 2W0FB 1PEZA 3T0EC 4OGXH 3WFEH 1U8NB 3F7YA 3ARBB 5L2KD 2HWZL 5F96L 2Z31C 2Q76A 3CCHA 4CUCA 1QBAA 1MJ7L 3BEWB 4KQ3H 3MNWB 5CBEA 1FO0H 2C26A 1I1AA 1F6AB 2BXYA 1DTUA 1XF5B 3W11C 4ZQKB 4FTVE 2DBJA 5E95B 2E6QA 5JO5B 4J6RL 3K4AA 5SX4H 3W0WE 4K9EH 4PJ9B 2WIIA 2I9LA 2P5EB 5GXBB 3G5XB 2Y6SC 5C0RH 4O2EA 4XPFL 3GM8A 3S36H 4MAYD 2WBJC 3MJ6A 2PO6D 4WNQB 5FYLE 1WWCA 1MCWW 3JUYA 2HFGH 3HAEH 4XGZA 5JW4M 2HRPH 5IG7A 3DGGA 1EJ6A 1R0AL 2DLHA 4F7MA 2IPUG 1VFBB 3GHBL 1IQWH 3WNNA 4KKLC 4LEXL 4MDJB 2CGRH 4JCMA 4PJGB 3KJ6H 3ROOA 1MRDH 2D2OA 2XN9D 5LGJA 4EN3D 4Y4FD 4G8EB 2AVGA 3E2HB 4JO1H 3BSZL 1LE5B 1E6JH 1I3RA 3WIFB 1KACB 4WWKD 1GIGH 4RFEB 4C57C 4FP8H 3T2NL 4N8PA 3MODL 3UROR 2QHRH 1NEZG 4DOHB 3OR7A 2NY3D 4L4TA 5T3XE 5EO9B 1BBDH 4U1IB 1IGYB 2ZOLB 4HG4J 3IETB 1NC4A 2BVUA 5F6IB 4KRNA 5IVZB 4AEHL 2UZYB 1MAJA 1KB5H 1J12A 1MVFA 3WS3A 4FXKB 3I2CL 5CSGA 5JZ7D 3C5ZC 2GJZA 1OTTD 2PTUA 4NOBA 4P46C 4GUPB 4PJIA 2H3NB 3MXVH 1MJUH 5KG9A 2EKSB 3JV6B 4XX1E 2DTML 3LDBC 2AKRA 5DK0B 3TPUB 3L3DA 3Q0HA 4LFHG 3EFDL 4NQEA 1Z0NA 3L3IB 4MJ6A 5DD1H 3RVTD 3BISA 2YR3A 3BEWA 5BVPH 4MVBD 1I1AD 3P73A 1G7IA 3MNWA 1A6UL 2LABA 5HPOA 4PY8J 4U1GB 1F6AA 3VD9A 1JNNL 2HLFC 5HJ3B 4ODTH 4X9FA 1I8MA 4WO4C 5JO5A 4D94A 3TJEH 3OPZL 3GEWB 4PJ8C 2P5EA 3IRPX 3ABZA 4DCQB 4PRDB 1CQKA 3ARFA 1Z2KA 4FABH 2E8ZA 3VFOB 3KXFB 5C0DB 4QHNA 3PJSB 2QQLL 4Y16A 1J05B 4R26H 4PRHE 1D5MA 3X12A 1AR1D 3IGAB 3ZKMC 1N64H 4JE4B 4LF3A 5I30H 2YOCA 1X7QB 4M8QA 1PSKH 2X4TA 2B4CC 3NIDF 5IHBA 3L95A 2P45B 3EYOB 3TN0A 4Z76B 1Z9OA 2DKSA 2YD5A 4MB5A 3VRLF 3SDYL 2CRZA 2XOTA 4G8EA 4D3CL 1TVHA 3GSRA 3LAFA 3BD5A 3JV5A 1NCBL 4M7ZB 5F8QC 5HYQA 2XWJB 1G9NC 4J3VA 1LE5A 4WU7B 4OAWA 1RJYA 4OCNC 1ZV5A 5IHZA 1G0YR 2EYTB 3VDBA 4QTHA 3EO9H 3QWRD 5I9QB 4R2GD 3CK0H 4ZAKB 2XN9E 5BS0B 1DDHA 2E9WA 3RBSA 2BFVL 4ACPA 1B9ZA 4L4TD 4LPUA 2OYPA 5DMIH 5J12B 1QACA 3QIUB 4CJ0A 1NC4D 5I2IA 4MHHG 1VGKB 3CFIC 3JXAA 4U1IA 1IGYA 3W39A 2I9TB 1UFUA 5D7SL 2QSQA 2PUQT 3LV3B 3W82A 1ZXQA 4H0GA 4Z0BH 3T1FA 3GMMA 1RZFH 1U8IA 3MJ9A 5GISH 2QSCH 5BZDA 1EEYB 3MV11 1N4XL 3RWCB 4R9HA 3OX8A 5ADOH 5KS9F 4MNQB 1FAIH 5DFVC 3TT1L 4LIQH 3CLEH 1F45A 1B4JH 4NQED 5A16A 3RWDB 4ZFZA 3IDJA 5C8JB 1P9MC 3MLRL 3L3IA 3STBA 1GCFA 5C07A 4Z95L 1G0DA 1AGBA 4NJAH 4HGKC 4G80B 2I5YL 4RAHA 3OKEA 3CMOH 3P0VH 5BJTB 3O0RH 4XVTL 3QPQC 2JJWA 3OZ9L 2Y23A 3WDHA 1R3LB 2P5ED 4GAGH 5FECB 3ARFD 2GSGB 5MHSD 2O5ZL 5C0FB 5HPMB 4P4KC 5H94B 3QR2A 4MZ2A 2AEPL 4Y16D 3LY6A 5J3HD 4OFYA 4OLVL 2HWZH 3AXLA 2K3TA 4RGMB 1J0KA 1NCWL 4CVWA 2XTJC 4XAWH 2VE6A 4PG9B 1HQRB 3MBEB 1TETL 3PXHA 1DQTA 3TN0D 2DQHL 4KTDH 4JRYB 2YZ1A 3IXTB 1KIRB 4GOSA 4JFXB 3D5OF 4J6RH 4I5BB 3BDBA 5AUMB 2V7HA 5GGTA 3QXTA 3B6SB 3EDFA 2EXYC 3VMPA 4W70A 4KUCF 5JW5B 3K7UA 1JK8B 2OBGA 5DO2D 3MYJA 3V95A 3WV0A 5JORB 4O58L 2FHBA 5BMFL 2DYPB 1R0AH 4NNPL 1UM5L 8FABA 1QA9A 3GHBH 4IHOB 5EOQL 4FQCL 3BQUC 4Z0XA 4LEXH 5CLWA 3C5JB 2DQJL 1AXIB 3JVGA 2I9TA 5EN2B 1K4DB 3LV3A 4AZ8A 2WWKO 4L4TE 3BP6A 5I1AB 5E6ZA 5GS1B 5C0JA 3BSZH 1RIUL 2NY4D 2VL4A 5EWIL 1XH3B 4HKJB 3RWCA 3OTTA 3T2NH 3MRHA 3MMEA 5D2NE 5JOPE 1T21B 5I71B 3MODH 4GSDL 4Y5YB 2H6PB 3LD8C 4PJIE 1JN6B 3OKLB 4Y5XA 2L7UA 4X6DA 2IADA 3MR9A 4KHTL 5E8DL 4NZUL 2JJSC 1YEKL 4KZEL 4MQTB 4OTXL 4R96B 2EE6A 3MGOB 3D18B 3ZDXE 5E03A 4AEHH 2YPLA 4OLZL 2B20A 5DUML 1W2KT 4NQEE 1OB1B 2YD1A 2ICES 2BHUA 5JIPA 3I2CH 2UUDK 1TMCB 1LNUA 3BXNB 3RKPA 2P4AB 1OGAB 2BOCA 2HJLB 2DI7A 3KYMB 4LDOB 3IFOB 4XPHL 1VA9A 1J8HA 4OFYD 2LTQC 3LN5A 4AH2A 4BQCA 5HPMA 4LCYB 3O11B 5EU3A 2IBGA 1GGTA 3EFDH 1NDMB 3CFKB 5ECJE 4PJFB 3QFJA 3HR6A 7CGTA 5MHSE 1MWAA 4FNLL 3WFBL 2HH0L 1A6UH 1NCUA 2BMKB 1WLHA 2X4NB 4WI9A 1CDBA 2XT1B 4PLKD 1JNNH 2DICA 3QNXB 4JFXA 3OXSB 2MTPA 3OPZH 3RVUC 1ZLVK 1DR9A 1H3PL 1VGEL 1HSAB 1Z6JT 4ZUTB 3VI4E 3B6SA 3S96B 5GPRA 1ITBB 4F7CB 1H9VA 5LAXB 1FFRA 3B5GA 3AVEA 3RPIB 2IBZX 1IAMA 4HEPG 1Q9KA 5C92A 5IVXA 5JXAL 3QPXH 1FNHA 4DTGL 4MXQC 5TQ0L 4L8BA 3SDYH 2QHLA 3MRCA 4G6FB 1DBBL 1CLCA 5I1AA 1NCBH 1OD9A 4NCDA 5HHVL 1C08A 3QUKA 5IEHB 4K8RD 1XH3A 3FQRA 3OKNA 3KPRA 1D9KB 2Q6WA 2IBBA 1B6UA 1MCPL 3R4DA 3O3AA 2VABB 3ULVD 3T4AB 3WHE1 1G7QB 2BFVH 2HA1A 4DGIL 2DLFL 5DD0L 3DURB 1JN6A 1UWXH 2EICA 3G5VB 2BHYA 4J1UB 2FWOB 4LRNH 1PQZA 4UU9B 2EDHA 2YPLD 4S1SH 5GQBA 3U82B 3MGOA 4CVUA 1CXFA 5D7SH 15C8L 5GGQL 5C0EB 2EO1A 3CVHA 5JNYB 3GI9L 5JR1L 1IC7H 2NMSA 1DN2A 2FHFA 4XC1L 5C07E 2Q7YB 4MA3B 2EH8L 5E5RB 2C4FU 1J8HD 3KYMA 4OCMC 4P4RA 1NBZA 4PYHA 3FB6A 3TT1H 2F15A 3TC9A 1OAKL 1XCQA 3SKOA 4LCYA 2VTFA 4LSTL 1KJVB 3QFJD 4YHOL 5BQ7B 3MLRH 5MEQA 2DQTL 4M6NL 4Z95H 1ZA6B 2M8XA 4OF7A 2QQKL 3NFSH 2QTEA 2I5YH 2OQJA 4JRYD 4DGVL 1MHCB 3UX9B 1QSZA 3CX2A 4JHAL 2R0KL 3O6FB 4XNZB 3VD3A 2YSSA 2O5ZH 4OCRL 2VL5A 2YWZA 2IALA 4R6UA 2AS5M 3P9WB 3D0VB 1VHPA 4K71C 3ARUA 1X4ZA 3GSXB 4OLVH 2EDOA 4R8WL 5C7XL 3S7GA 5LAXA 1ERNA 5FK9A 1BZ7B 2Z4QB 4PGBB 4JZJC 4FZ8L 3S35X 1SVCP 2DQHH 5EZLB 1XGQA 1MQKL 3KPQB 3LKOB 1MH5A 3Q3GB 1BFVL 3VGDA 4L8SB 3V8OA 1ZANL 1LP9B 2CK0L 3KPRD 2A6IB 3REVA 3U1SL 3EHBC 2DI8A 2DJSA 3P0GB 4XP1L 5I8KH 1IGTB 2Y07H 1TCMA 3QUXA 2PYFA 1FE8H 1IE5A 2WWMC 4MS8D 1OTSC 4O58H 3U46B 1AKJA 1A0QL 4PB9L 2NY2C 5HGBB 5BMFH 1LO3L 4NNPH 4ONGL 3CGTA 5EOQH 3G9AB 2EXYD 4FQCH 1RU9H 3RY6C 4P5TB 2NPLX 3S8WA 3BKJH 3ULVE 1NGWB 1P7KB 4LPCA 4X6DE 1WISA 3KLSA 1W8OA 3WHXB 3BUTA 4LCUB 5BCAA 2W9LA 5GS2H 5DVNA 1RIUH 5EWIH 3S5LG 5GHWL 4XRCA 2ERJB 2YPLE 4R0LA 1UENA 5HTSA 4UILL 1AHWB 5DRNB 1MCCA 4QHMA 5HVHB 4YHYB 1FL5B 4B5EA 5FGBA 2ID5A 4PJHE 4CN4A 5CEZD 1AP2A 4KK5D 1JGLL 4KHTH 3KWWA 4YBQD 1J8HE 2Y5EA 4NZUH 1YEKH 1ZA6A 4KZEH 4OTXH 2YBRB 2QR0A 1BX2A 3ZDZE 4AL8L 3Q48A 1A2YB 5DUMH 4KU1A 4DKDC 2CIKB 1ZK9A 2Z8WC 4JEGB 4PJIF 3QFJE 1I75A 4PRIA 4OCXL 3ZKNC 4LGPB 1IVLA 3U0WL 1AI1L 2OL3B 3QAZB 1A6ZB 2E9BA 4RGND 2Z8SA 1KFAL 4GRLA 4QXWA 3ZDXF 3P3YA 1F02I 2IH3B 4N0CD 4ZO6A 4HDIA 1IC4L 4KK6C 2F19L 3ARTA 1QKZL 2EDWA 4JPIA 5DUPL 3V0AC 5DEFA 4WI3A 5D1ZA 2Z4QA 4KRPD 4FNLH 4PGBA 3KPMA 8CGTA 5IB2A 2HH0H 4NKMA 3U7YL 3RIFK 2BDNL 4HWUA 3C5SA 3UC0L 1K8DB 2YA0A 5L8LB 3BKMH 4JN1H 5EUOB 4ELMA 4WIQA 4FFWC 4H26A 5J13B 4Q6YA 5ID0A 2AW2A 4D9LH 4H88L 4QT5B 5IVXE 2PTVA 1AIFA 1VGEH 4A2MA 4ZFOA 2A6IA 1WWAX 3PDOA 3QUXD 2OJEA 1YECL 1IEBB 1AKJD 4K3GA 5I16B 3O2DL 1U8QA 2BVQB 3DV4B 5IJKA 3KPRE 1UACL 3IDNA 2MHAA 3VI4F 2HFEA 3T3PE 3KG5A 1BQHB 4M1DH 4QOKB 4NCC2 4D9RD 5JXAH 1P4LA 1SJEB 1I1YB 1XZ0B 4DTGH 1NGWA 4GBXA 5TQ0H 1IGCL 4PGCB 1T89A 2ZCKL 3NPSB 1DBBH 2IF7A 5EIIB 4YBLC 1NBYA 5HHVH 5I8EA 3L3KA 3RWIB 4ZTPL 1XF2A 4HBQA 4XHJC 3MRMA 1R5WB 2DLEA 5J6HA 3FKUS 2X40A 3AAZA 1H3VA 1WBZA 2VDKL 4DGIH 4Q0XL 2DLFH 4NFBA 1F3DJ 5E6IB 3OKKB 1EO8L 2CR3A 2GAZB 5LKNA 4JLRB 4WU5B 2BHZA 5KOVC 5DQ9A 5ALCL 1YEIL 3WDIA 2J3SA 3AMLA 4MB4A 4LP4A 1KTKE 15C8H 5GGQH 1WAAA 4PRID 3U48A 3GI9H 5JR1H 5D1QC 3QUML 5CEZE 3GSVB 1RZKH 3FCTA 2EH8H 3RVXD 5HYJB 1BVKB 1CVSC 3BPCB 4XB7A 2X1WL 4GRLD 1TVBB 1YNLL 1A6ZA 1TLKA 3RI5K 2WW8A 2OS7A 3GJFA 1U3JA 4LVEA 1OAKH 4KTYA 2LFGA 2VZUA 5DJ0A 4HUXA 3E1F1 4I8DA 3N9GL 2PTTB 4LSTH 5D1ZD 2ZG2A 4JM2C 4YHOH 1PJ9A 3G6JB 3N85L 3ILQD 1FV1A 3FRPA 4TVPD 2DQTH 3GMOB 1KEML 3H3PH 4M6NH 4NRXB 3BIKB 4RGNE 4Y19A 1KJMA 2A83B 4OSUH 5B39G 3FO1B 1QFOA 2CLRA 4UT6L 2VZTA 4H8WL 4PRBA 1MFCH 4Y7MA 4DGVH 2HFFB 1CLYL 1YDPB 3DRQA 4YHPB 5DJZB 5EUOA 1MCSA 4JHAH 5DHVH 1WZ1L 2P8LB 3TCLA 3S98A 2EYRB 4YC2B 5KVEH 1WEJL 5C08B 1MOEA 2ENSA 3AU1A 3BPOC 4JB9H 4OCRH 1OGTB 4IIQC 4YXKH 4X0KB 1TZGL 2O26U 3KYNB 1YMMA 5BRZA 4J8RB 1U6AH 2H8PA 5D6DA 3HE7B 5C7XH 4NZRL 1MREL 1N59A 5IQ9B 1X5HA 4MJIB 1GGIH 4FZ8H 4U3XA 4P5TD 3UXFA 4PGDB 1U8MB 4GBXD 5I1HL 4C56E 2QV2A 1MQKH 1A7QL 3KPOB 1FSKC 4NC1C 1AY1L 3EOAB 1SJEA 3VCLB 4PV8B 2WUBL 2AJYL 1R5VB 1XGRA 3S4SB 5HYSA 5EIIA 4QRSA 4OV5A 1ZANH 4HWBL 2XNAB 1D6EB 2CK0H 4L3EB 4WUKL 3TO4B 3U1SH 2V17L 4FQ2L 1KPVB 1JNHA 3RDTC 4OLUL 1BVLB 4D9RE 3MV7B 3W5NA 1L4IA 2J8HA 3GSNA 1TQBC 3WN5C 1F58L 1E27B 3UYRL 2OX5A 3TIEB 1A0QH 4PB9H 5E8EB 2UYLB 1LO3H 1MY5A 1JPST 2AJZB 4ONGH 3D9AL 3MOAL 3EHBD 1QNZL 4PG2A 1G1CA 4TULH 3MREA 1TJHL 1E4XL 1NFDB 4LLUB 2VLKA 1KGCD 3GFUA 4N90D 4XTRD 4Q97A 4GXUN 4Z6AT 1C5DB 1JZ7A 1B90A 1IGFL 3PE9A 5D1XB 1TVBA 4UILH 4CNIB 3KS0H 2AEWA 3ULVF 2D3VA 4PRIE 4P2OA 4X6DF 5D7IB 4RWYL 3FJTA 2VXSL 5EULV 1T7VA 4Y19D 1ZHBB 3QULA 2YXMA 4U1SB 1F4HA 3D85B 3MRIA 4JN2A 4RFNC 2VIRB 3SGKA 3OMZA 5CZXD 2HFFA 2WUCH 3SHSA 3ZTJG 1TJGL 2BSRA 2N56A 5DJZA 4ODSL 4OCXH 4PJHF 4P3WA 3AC0A 4TVPE 3U0WH 3SGEI 3WKNA 3R8QA 3E6FB 2XZCL 2NY7H 4M00A 3TBWA 4CAGA 4O2CB 1IQDB 1KFAH 1T7WA 3ZDZF 1YMMD 5BRZD 4ELME 1IC4H 1U8OB 1CK0L 4X99A 1QKZH 4C55A 3QUYC 5DUPH 1AH1A 1JRHH 4PTUA 5GS0H 3D39B 3VXSA 3A6BL 3L5WA 1C1EL 3ARWA 3CUPA 3CZJA 5GRJL 5J7CC 3UC0H 3NOIA 4Q6IC 1F13A 3QCVL 1C7SA 4G8GE 4PV8A 2ICWI 5E2JA 2I26N 1DBJL 2X4PA 5JDJA 4L4VB 4H88H 3O9WC 1G7JB 3QNYB 5EZOL 5IBTL 4RMVA 1VFOA 3HS0A 1PKOA 1YC8A 2A74A 4A6YH 1S9VB 3IKCA 4Y4HB 1E27A 3BKCL 4JY5L 3O2DH 4XHQA 2Y5TB 4LPWA 4HXBL 4M5YL 5A43C 5C0AE 2UYLA 5IVXF 1EBPA 1KCVL 1T2XA 2XZQH 4ZO8A 3WFZA 3HHRB 4FQXB 4TN9A 5FHBL 1BFOB 2MJWA 3AROA 2VLKD 3DOSA 3QXDB 3SPVA 4NO0A 2ZCKH 1FDLL 4RQQB 4QNPE 5J1SC 1RK0A 4J4PC 2APFA 4ZTPH 1X6LA 3T3PF 1IAOA 1WAAE 4P2OD 4XVSL 1U2HA 5BV7B 1T22B 4IDLA 2EDRA 1AJ7L 4GQ9L 2VDKH 1OTUC 3DROA 4Q0XH 3QIWC 1Y6KR 5DA4A 1EO8H 1JTTA 3NN8A 3GBNL 3MRRB 3OJDA 4P23B 4IMLB 5ALCH 3DO3A 1ZHBA 4IJ3B 4PD4K 3V5HB 1WGOA 1EAPA 3KYAA 4U1SA 3O4OC 1KENL 4F80A 4F33A 1S7VA 1UGNA 5EBLA 1ZVYA 4TTDC 5CKGA 4MD5A 1FHGA 4Z7QE 3QUMH 3TH2T 3VGAB 4Y19E 2Y4SA 2GSIA 1YUHA 4QRPA 2H41A 4HLZG 5DZOA 2H26B 3B2VL 2VDLH 3E6FA 1XEDA 1AXTL 1YNLH 1A3RL 1EA9C 1BAFL 1AQKL 1M6OB 1OQXA 4JFEA 3CPLB 4LCWA 1GOHA 3N9GH 3VXSD 3NA9L 4EEEA 3FT3B 4HKBB 3GBML 3N85H 5B38B 3BJLA 3D39A 1OVZA 1EHNA 1M1SA 1L9NA 2OZ4A 4U6YA 3N1QC 4WFEE 3ARBC 5MENB 1KJ2L 1YMME 5BRZE 5D71L 4UT6H 4H8WH 4JHBA 1CLYH 4NZDA 3DSFH 3VXTB 3OG4B 1HDMB 4EI6B 1A1OB 1WZ1H 1S9XB 1HINL 2VOTA 4JFZL 4I2XA 1G7JA 1YJDH 4QY8B 4UOW0 1H5BB 3L7EA 3MV7D 4EOWL 3EO0B 3BEVB 2NXYB 4PJ9C 1M05B 3N06B 5BZWB 1KEGL 2DLTA 3LKNA 2GTWB 1CBVH 1UH4A 4R7DB 4F37F 4NZRH 5F3HB 1W0VB 1MREH 3D69A 2EEDA 2HT3D 4ZFFB 4HX1B 3C60C 1ZT7B 4NO0D 1BFOA 1A7QH 4HEME 1AY1H 1G6RL 2KZ1B 2WUBH 2WQ8A 2AJYH 4R3SB 4RQQA 2C1OB 2FGWL 3WNKA 3BGMB 1WV7T 5I76A 4HWBH 4WUKH 4Y8DC 1QLEL 2IPKA 3MPCA 1WCQA 4L9LA 3SDCB 4FQ2H 1P4BL 2NNAB 3PNWB 3RIAF 1RZIB 2VLKE 3C6SA 4OLUH 1ZSDB 1T5XA 4WFGD 3UYRH 3QQ4B 3CLFL 2ADIA 4LGRB 1HQ4B 2F54B 5B8CB 3ZMRA 1A3QA 3MLYL 3IJYA 3D9AH 3MOAH 2G60H 3DSNA 2R1YB 1TJHH 1E4XH 3NCFB 4GAJH 2GHWB 3LB6C 3PHQB 1FJ1B 1MCRA 1MLBB 4TTGA 4QRPD 2ADGA 2IPUK 5F6IC 4OZ4B 4JFED 2IANB 4N0YL 4LCWD 4U1JB 1FN4A 2Z93B 1E4KC 4HAFA 4RWYH 2VXSH 3EYVB 3L9RA 4JGUA 3VE0A 3FFCB 4KK8D 3D39D 5HYEA 1QQDB 5JIKA 2BC4A 4BK4A 4HKBA 5B38A 2DIJA 4MCZA 4WHYG 1TFHA 1EXUB 2A77L 4OFIA 4JFFB 1ZLWH 4X7TA 5IIEB 3SO3B 4H1LA 1EGJL 3I6GB 5MENA 3GMNB 2DTSA 2NLJB 1UADC 2UVFA 1IT9L 1TJGH 4L4VD 3VXSE 4ODSH 3UPRB 1HDMA 2VC2H 4EI6A 1A1OA 4Y5VC 4U1GC 1UC6A 2XZCH 4O4YL 2C4XA 4K07A