1EAOA

The runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Runx1 Runt Domain at 1.25A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
total genus 24
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eaoA00
1LJMA 5AOMA 2IOOA 5G4NA 4GUOA 1EANA 2J6WA 2J1WA 3D09A 3WTVA 1TUPA 4L0YA 2AHIA 4G82A 3Q06A 2J1ZA 1GZHC 2BIOA 2ATAA 2XWCA 4IBZA 2ADYA 4IBWA 4LOEA 4AGOA 1KZYA 1H9DA 4A63A 3D07A 2RMNA 2J1XA 2J1YA 4GUQA 3WTTA 3WTYA 4IBSA 1E50A 3VD1A 5G4MA 3QYMA 4QO1B 4MZRA 2GEQA 2VUKA 1HJCA 2BIQA 2J20A 1EAQA 2J21A 3WU1A 1EAOA 3WTSA 2WGXA 5AOJA 4IBYA 1HU8A 2YBGA 1YCSA 3QYNA 3KZ8A 3VD0A 3Q01A 1IO4C 3D0AA 2PCXA 3TS8A 5G4OA 4IJTA 3KMDA 1CO1A 4AGNA 3Q05A 4LOFA 5AOKA 2IOMA 4MZIA 4AGQA 3EXJA 1UOLA 4L0ZA 1GZHA 4AGLA 5A7BA 4IBTA 5BUAA 4LO9A 4L18A 2X0WA 1T4WA 3IGKA 2AC0A 2BIPA 2BINA 3US0A 4AGMA 4IBVA 5AB9A 2X0VA 5ABAA 1TSRA 3D05A 2P52A 2X0UA 3D08A 5AOIA 3ZMEA 3D06A 3IGLA 3EXLA 3WTWA 5AOLA 4AGPA 2BIMA 1CMOA 4G83A 3US1A 3VD2A 5LAPA 4KVPA 2IOIA 2OCJA 4XR8C 2FEJA 2H1LM 2XWRA 3WTXA 2MEJB 4IBQA 3WTUA 5ECGA 1HJBC 5KBDA 4IBUA 4HJEA 5LGYA
chains in the Genus database with same CATH superfamily
4OT1L 1TEFA 3ATDA 2CLVA 4K5LA 4ZDHA 1CDBA 5F88A 3L4UA 3WJMB 4L0YA 4ZUVB 3HBGA 4JFFB 5ALCL 2VXUH 4P4KC 1F56A 1BFOA 4PJFA 5MHSD 3ZQWA 3IDIB 4QT5B 1Z2KA 2SEBA 2YKKA 4WHTB 2HFGL 1ZJBA 2FX7L 3D0LA 5F1IB 3CLFH 4WEBH 3B3IB 1LP9E 1PJWA 1RH8A 1AGEA 2R9HD 2AVFA 4P2YA 4C55A 4PRBA 3NIFF 5F1SA 1X4YA 2Q5BA 1COBA 4I3GA 3LKOB 4BSWB 3A67H 1PLGL 3ARFA 2JJSC 1JYNA 5I73B 4CBPA 1KN2H 1YEGH 2ICCA 1J0ZA 4U1LA 1KEGL 5C09D 4KK9C 1I9RL 4OH2A 2YMXL 3CDYA 4O2EA 1HI6B 2A0LC 2DMBA 2YD0A 5CBAB 3SY6A 1MCCA 2HTLD 2W91A 2Y5EA 3NSJA 1CICC 4ANUA 4Y4KA 4J3SA 3B83A 2YOAA 1EAOA 1AY1H 4WW1B 4HLZG 5CSGA 4AEIL 4MLIA 1CFVL 3WJJC 1H0DB 2FBJL 3HE7B 2EDFA 3PABA 4HBCL 4K5PA 3RBSA 2PO6C 2YD9A 2UZIH 1YA5A 2WXPA 5AAMC 4KI5F 4OGYL 2HUHA 3D39B 4KWUA 4CRPA 4W93A 3EDDA 4IRZL 2YPLB 4GAGL 4JHZA 5HYFA 3KYMB 1W9XA 3PWUA 5I71B 1R3KB 1EEYB 4PRIE 1R46A 4NM4L 2QGBA 3QFGA 4AGLA 1RHHA 5A7BA 2Y22A 1AHMA 3C5ZD 4Z7NB 3G5VB 1BAGA 4JFOA 4K94H 4ZOEA 2GABA 4HIIA 3H2WA 5I2IA 4OW6A 2UY7A 3DUUB 3GXUB 4Q2ZB 1A7PL 2CJSA 3F12B 2G60H 3WG7B 2YD8A 4PWKA 5EPMB 3RWFA 1ED3A 5IB3A 4CVUA 4KU1A 3NEOA 3ESPA 4YAQA 3KXFB 1A7NL 4BV1A 1IQDB 2BRQA 1WUZA 5HYJE 1A6AB 1OPGL 4PJ6A 4CU6A 4AJ0A 3H42L 3RWEA 1KV7A 2E7DA 3KPQA 1ZGLP 2NDFA 4XBMA 3FFCE 5BW7C 1UH4A 3E3QE 4IBUA 2UVFA 4YJZL 1SOSA 1I9JL 1SOQA 3S37X 3DMMC 3HCVB 1A5FL 3BP5A 3G5WA 4ELMF 4KTGA 5DLML 3L8QA 1CF8H 2YD2A 1ZT1A 3Q2NA 4FMFA 5JORB 3JYCA 2Y1YA 1PKQA 5JQ6H 2COVD 4K9EL 5E5MB 4E9WA 3VX1A 4RLDA 4W6YB 2W95A 3PRZA 1S5HA 5E23A 1S7VB 4MNQE 1ADQL 4X5RA 2F5AH 4JANB 4NQXB 4LASL 4F58L 4RAUB 1EK3A 4D0BB 3KM1A 1QSFA 4LF3B 2EDNA 1TOXA 4WSGA 3D4CA 3DBXB 1BAWA 4HC1L 4M93C 3T1FB 1Z9NA 4XN1A 3ZJAA 5FV2A 3SYQA 2KZBA 4MQ7B 1J5DA 4NIYE 4UT6A 1L5GA 2OR9L 4B6ZA 2YIHA 4JM2A 1R4XA 5FO8A 3RL1A 3ML9A 2LVEA 3NQKA 4OM1L 5FYJD 3WHXA 3ZZ1A 3DDGA 2GJPA 5DS8B 2B9BA 2FWOA 5B38A 5IVOA 4CVXB 1Q9KA 5T33H 5B3NA 3W9DB 1OGTA 4XH2A 3OF6D 4XC1H 5GIRA 3WIHA 1SN2A 1SPDA 3NSCA 1D5BB 2WUBH 4JKNA 2PWGA 1H8SA 1S9XB 2VXVL 1QVOA 4KJQD 3CSBA 4KRPB 3EG9B 2CJUL 4RZCA 1S3RA 1TTGA 2C9SA 1IBYA 3BUYB 3NCXA 4RMTA 1KXVC 3EGSA 4AMXA 4X4MA 1G6RH 1TVDA 3ZTDC 2IDQA 1A6VH 1NDMA 1TTCA 3FCGA 4N2NA 1NGZA 3AMLA 4HSQA 1QFHA 4W6WB 1T4WA 3PP3H 1UB6A 3T0EE 1KYOK 3VM7A 3ZGHA 2OXGB 4QHPA 1A22B 1FO0H 1UWYA 2F7PA 5I30L 5I5MA 5B38G 1BD2E 4MWFA 3OAWA 1LK3H 5FYJU 4NQCA 4BJLA 1T7XA 3PWPA 3B9KD 2RA1A 4QLRA 2DMHA 5MP6L 5GGRA 3VB9A 1IMHC 5IBUB 5CINL 3ZL4L 3FC8A 3OC8A 3CZFA 4HKJB 4FQXB 2BX5A 4WRLA 1MLCA 2Q2EB 2OKMA 3OAZK 2XN9E 4YXKH 4NO5B 3ZMRA 4D0DB 4GUCA 5LAPA 5IQ7L 5GS2D 3WFCL 3K2UH 4MD5B 1SDDA 4HWZA 4DQOH 3SPIA 5D7IB 2ZAGA 4BA0A 1G6VK 2K8QA 5ISZA 2WLKA 4XCYB 3PE9A 2IH1B 1TLMA 1BX2B 1DSFH 3P54A 4DPRA 1SOXA 3Q8FA 3L9EA 1JWSB 1KIUA 2EEBA 3QUHA 3U0TA 4DVBA 4JG0L 2ATPB 3OR6A 1NAML 3V4VB 3L1OL 3DA0A 3RLSA 2H7WA 3DI3B 5IB4A 2F74A 5IBLD 2AQRA 5EU3B 1Z5YD 5ILTL 1EJOL 2HUEA 5AVVB 1TPXC 2HKFH 1CK0H 1MCNA 2I27N 5KS9E 3TVMD 4EZJA 1ZHNB 4X7CC 2QZ5A 3D2UB 1I85C 1JFHA 2GBVA 1EO8H 3D51A 4KY2A 2I25N 4B0MB 2YPLE 3SE4A 5K9QI 5J1AA 1O7SA 2HPTA 1NQBA 3C5ZC 5AALA 4RSVA 1FNGA 5AB2A 4HAGA 4L4TE 5IHHA 5I71C 4XPBH 2ITDB 4P2QB 2FO8A 3MREA 3NIGE 2CKBA 5IBLC 1OAKL 3TN0D 4WI2A 5CR1A 1LD9A 2UXFA 4AX3A 1ITBB 1M6OA 4X9IA 3KBPA 1TDQA 3CH8A 2QDVA 4P2RB 1PD0A 4H25A 5D93C 2EVJA 5M95B 2ENQA 2N59A 3CFEB 1K8DB 1XO8A 2F74B 5EZIH 1J8HB 1NC4B 5FYJH 3RL2B 4OJEH 1ZLSH 1LWJA 2AJ3A 1GGCL 4PRNB 4IRSA 3JQOB 1WAAF 3MX0B 1LDPL 1DBAH 3WEOA 5E2WL 3EOTH 3INUL 3ARUA 1CO1A 3UPCA 1E6OL 2X70B 1ZS2A 1UT1A 1P84K 4KO7A 2ARJQ 3F85A 5PCYA 4FX5A 4PJGA 2BPBA 3ZTCC 5SX4I 3GPEA 5IJVA 2A9AA 2CGZA 2FJFB 3WFHB 5KSAB 4WO4A 3VXTA 1W0YT 3IFLH 3CC5A 2KT6A 4RQQA 1ACXA 5J06A 5KYWA 4XX1E 4HV8A 1YEIL 2K9UA 2PN5A 4XNUL 1QQDB 3VW3H 5D4IA 5D1XE 3GKZA 2WLZA 2DYPB 1FV1A 3IJ7A 4LF3A 1S7SA 4R26H 4WO0A 4EBQL 4ZX3A 1CFBA 1ODUA 1DZBA 4LK4A 4R9HA 3KPPA 1U93A 1VPOL 2NNAA 4NUJA 4D8OA 5DMKB 4DP5X 5IJBC 2F7IA 5TDPA 1JWMA 2I7OA 4OZHF 2XA8L 3WYRA 2OP4L 4FLRA 3QDJE 4CU8A 2HCZX 3GLEA 3WD5H 4HOMA 2IALA 4ZNCD 4HIEB 1CD8A 3ZKND 5J13B 2VDQL 3TIEB 1UCTA 5IFJB 2DM3A 1ZLVK 4LFHD 3G08B 1OAQH 2H32B 1L6XA 1JRHI 5LGYA 4LQFH 3L3JB 5BRZE 3FUNA 3AY4C 3MYJB 3OAZH 1TF4A 2O5ZL 3IAGC 5DDHB 5GIRB 3FQNA 1FH2A 4BSVB 5EU4B 3OBAA 5D1QB 3Q06A 5FO9B 1JMZA 4HH9A 4P49A 1PZCA 5E8EA 3SIKA 4PHZA 3KJ6H 5L4JA 3VI3F 4ZMZA 3FH7A 2VLKB 3M46A 15C8L 3TPUA 3W11C 4PJ7F 4RFOL 4N0YH 1TKWA 3I3DA 4E9LA 1RVFL 3PL6B 3OKYA 3SD5A 4YFDB 2X44D 2B1AH 2P7TA 1ZA3A 1O5DT 3FTZA 4ZFOA 1XB8A 4NHUB 1U3JA 2EO9A 4U1SA 3TNNB 1YLBB 3VFOA 1PZ5B 4PY8I 1NCOA 1XGZA 4RGMC 2XYCA 4OCLC 1KT2B 2XCMC 3MPCA 3SQBA 3U36B 4MCNA 3MYJA 3AU0A 3Q44A 1WZKA 1TMQA 1DFXA 3IDGB 3L95A 4CILA 3WNLA 3VFNB 1HL5A 5JNYA 1R3IL 2YRBA 1UJ3C 2AEOA 2CG9X 3QYNA 2PO6B 1SN0A 1CPUA 3L08A 3H2PA 1BV8A 3FT4B 5SX4H 3U82B 3MCKB 3W57A 5D7JB 2NW3B 3CSYA 4TVPH 1RKRA 5DD0L 1CFVH 3BAEH 1ZA3B 4GJTB 1BFTA 1CD9B 2K78A 3II1A 1QATA 2C4FU 2H6UA 3OPZH 4M8RA 2MIZA 5AZ2H 4HUVA 3MV9B 2F5AL 4OGYH 1P7KA 1C9SA 3HLAB 5FDYA 1KPUB 3HG5A 4HPOL 2BHFA 2X0WA 3VWJD 4NO2A 4XCEA 3EZ8A 1E9PA 2DKSA 2H9GA 3C09B 1T03L 4GKSA 2WXMA 4BCYA 2BMKB 1H8LA 3SPCA 1F86A 1AGEB 3HB3D 3D05A 4TS6A 1ACYL 1JGEA 5F7EL 2OL3B 4K5MA 4KBPA 1TJIH 1CYGA 3ULVL 4BINA 5IR1A 4N0RA 2P8LA 3COOA 2RD0A 1PFCA 1ZEAL 2P5EE 3IDIA 4QT5A 1TFPA 3Q1EA 1S5IH 3NJLA 4X98A 5CLTA 5IMOB 2WYZA 1MFAH 2AW2A 2BFGA 2F08A 4D7PA 3V8OA 4UM8B 5EO9A 1MHCA 2P5WA 2G0KA 2YN3A 1B0RB 3ZE0F 1XGYH 4MRBA 4YC2B 5DJXA 4YHZL 3WS3A 1FORH 1OOWA 1SDDB 1UGKA 1EANA 3K0WA 4WGWB 4Z7VE 1GGUA 3D09A 3D8MA 4XNXH 4CSSA 1FDLH 1E9QA 1C16B 2OQJB 3NSDA 2R4SH 2HFEA 4GXVH 4HUWA 3L7FB 4X6FA 3V4PH 4BRVA 1KWKA 4I18B 3WD5L 1OAZH 2ZUUA 3HHSA 4W9JC 4L1TA 1UUSA 2FNBA 4RMVA 3PP4L 5IEHB 5F9OL 2RAMA 5HHOA 3ULUC 2R2EB 3QQ4B 3SDDA 5J8OA 1M2OA 1R33A 5GGVY 1Y1UA 3N3EA 4A55A 5KVEE 2TAAA 3UO8B 3Q3GB 3CLEL 4ZJ9A 2TSBA 3CDCA 5CM1A 4KAQH 1EO7A 4LGRB 2Y3AA 4FQQB 1EA9C 1RMFH 1UCBH 3UYRH 3CPUA 2X2UA 3LH9A 3O81A 1MHPL 1U6AL 1MG3C 3UABA 2GBTA 5K59E 1U91A 5JHDA 4YSTA 4N2DA 1EXUA 3QJXA 5ICYA 1QFUH 1TU2B 4MB5A 1KYUA 3QEHB 5DHVH 1U95A 2AJYH 2X4RA 3KCWA 2C34A 3CBKB 4Y1SA 2I9LB 3GSQB 5JXED 1AIZA 5BPPA 2Z8WC 5EU6B 5IBTH 2R4RH 4XX1G 5AVXB 1IFGA 5DHDA 1KYDA 4DP0X 4Y1AE 1A7OL 3CU1A 2AJ3B 3S34H 1J9TA 4LPUA 1Q9KB 5GS3A 4JFEB 1WG3A 4K7PL 1MWAB 4WCYL 5HGGS 5DJ8B 5HHNB 2FQFA 2ZUQB 1C1EH 1FN4A 1G7LA 3G6JF 5I18L 1X5GA 2BRRL 1F8TH 4L5FE 1ZVHA 5DYOB 3BDYL 3BJ91 3RA7H 4XNYL 1GCFA 3JWDC 1TEYA 4AI7A 3BPNB 3VFSA 5HVGB 1R9FA 2ZIDA 2EE9A 3SYOA 3U1QA 4LLMB 1H6FA 1P4UA 2HKAA 2YXWA 4B9IA 1I7RA 1TZIB 4JS7A 3BLBA 4WO4C 3QXTA 3EOAB 3ZKMD 1CU4H 4BZ1H 3WIFA 5ITBL 2BERA 3IGFA 3GSNL 1XIWB 5FW7A 1CDIA 1OO2A 1GIGL 2HZHA 4XVUC 4GNKB 5E2UL 3ULUH 2R8SH 3FO2A 2ZKYA 3KVQA 3MQIA 1K4DA 3DMMB 4L3EA 5GRJH 4MMZA 4NWUH 3V8CA 3RZCA 1K6QL 1ZVNA 3IRPX 1E9QB 2OQJA 4HUWB 3WLBA 1MQKH 1F90H 1NAKH 2NW2A 1FC1A 1BF2A 1I9RH 4RVBA 2I07B 3D18B 4JL2A 4Y0GA 5D9SB 3MA7A 2QSCH 3KS0J 4KMTL 3GLDA 3EUUA 4ABQA 3MJ7B 1UXMA 3BKCL 3K6FA 3GDBA 3VCLA 4Z7IA 1UYWH 5EUOF 4R2GC 1TCRA 1WZ1H 2PCPA 2XU9A 1AFVL 3O0RL 5DURB 5I17A 4JREB 1HN1A 1UACL 3MV01 2VR7A 3ORJA 4IHOA 5D7JA 5FM4A 5CCKH 2R1WA 2N7BA 3A4FA 3CC1A 2DQEL 4PJAB 2P45B 4M6NH 1UTDA 2YPLD 3IMRA 35C8L 3CZFB 2R0ZH 3O9WD 4H8UA 2CR3A 2SODB 3EO0B 3MV7B 4QRQA 3IAQA 4JFFE 2VL5B 3KBHE 5D5MB 3T4AC 5EN2B 2AXWA 4PFEA 4XWOC 2WXFA 1SHSA 2NNFA 1QUPA 3APDA 2MMXA 3OHMB 4LHUB 4RGOH 3EYVB 3GLZA 2N4IA 1MY5A 2GYSA 4XH2B 2ORBL 4UYPA 4IKNA 4S1DC 3FT0A 4JFQB 3DX6A 5E94A 4HFUL 4PM1A 4XB7A 3SQOL 1NBCA 1P6WA 1JXJA 1M6OB 1KCVL 4UT7L 3FQUB 4UT6H 2PCFB 4J6RL 4ZMPA 4TVSa 2R23A 3O6FA 4CKQA 4Z7AA 3KZ8A 1USQA 3QUMB 1MCHA 3GXIA 2CRMA 2PTUA 3H6AA 4GI8A 4N25A 1H3PL 1NIFA 1CI5A 2HWZH 2BSEA 1ZCRA 2MCPH 2QTVA 3H9HB 3MLYL 2R1YB 3TBSB 2NXYB 3TBBA 4UV7H 1NC4D 3HC2A 5IZ7A 5FYKH 1IBFA 1GSKA 2VDLL 2JELH 1F3RB 4OZFA 2HN7B 1S5HB 3WNIA 1NOLA 4DZBB 3QI9A 3CZUB 5E5UB 3G7TA 1OIOA 5L2KA 1PDKA 1TZ8A 1G7MA 5IEHA 3QFDB 1IC5L 1U9KA 3MRGB 4B9CA 8FABB 4U2YA 3UJIL 1R5IA 1A14H 2IQ9H 4PJDF 3DBXA 1F0LA 4CAGA 5E95B 2A1WL 5HDOA 1T0MB 2GBUA 4QY8A 4NT6B 5TK4A 4A7UA 4YSSA 1J9RA 5EH1A 5BUPA 1DEDA 2AXGB 4ZPTB 1REIA 4QRRE 4JHAL 2Y7QA 1CFMA 1X5JA 3Q2LA 2G5BB 5CLXA 3KPPB 5DD1H 3VH8B 1YAZA 3KHQA 2FJHB 3NSYA 3QB7C 5IUSA 3GYRA 3P73A 4FRWA 3B43A 2NY4D 3O4LE 4R83A 5DUPH 2C3VA 2BHYA 1YQVL 2O72A 4JFPB 2J72A 4G8EA 4XXCC 3VDAA 1U3HD 2WAHA 3OF6A 5E4EB 4FNSA 3VH8G 4CU7A 2F8IA 1U4EA 4MZ3A 1TITA 2CHZA 5DTFB 1RZJC 1MI5B 1RIHL 2G75B 4O58H 2J1WA 2V37A 3TO4B 1T4KB 5IVNA 1KDJA 4AQEB 5LXGH 4QJ3B 3P30H 3VQMA 4ZTPH 2RJMA 4OIIH 3O6ML 4Z3GA 1RPUA 3FQXB 2JE8A 2Y5TA 1E5AA 3A47A 4X9FA 5FO8B 4GFTB 3QEUA 1YN6B 2WZPD 1T7VA 1OF2B 3LEYH 3MRQB 3OV6A 3QPQC 1KLFA 4XPGH 4YBQD 3OG4B 4F9LC 2WBJB 3V0DA 3BW9B 1DSWA 1OGTB 4PY8J 1E50A 4NJAH 5JOPD 4HEPG 3TFKD 4JN1L 4JM4L 1X5ZA 1ZJAA 3FQNB 2E56A 1XGTA 1A6PA 4XRCB 3MRLA 4WW1A 4DEWA 2ADFH 4G43A 1HYRC 2X4RB 3ZRSA 5BZDA 3WGVB 2BM3A 3P3SA 2C1PB 1ZY9A 2GPZA 3D87B 4NO3B 1U36A 4RETB 5FGBA 3R0MA 4WWPA 3TJEL 4HS3B 3P3RA 1HL8A 5F0MB 5AFAA 4FP8L 1AYOA 5D55A 1KB5B 3B7TA 3PWVB 1J12A 3WN6A 3EJRA 1YEJL 3E1F1 3J27A 3P0YL 4KKNA 4A2EA 4K4KA 2EQDA 1F5WA 4EIUA 1DSFL 1FHGA 3DX8A 1CLYL 2OCCB 2COQA 4ZPVA 2DLEA 4UM9B 1ECYA 4ONGL 4PJAE 6FABL 1IL1B 1Z9LA 3FUKA 4KXZI 3K8KA 4AJVA 4WUKL 1CD1A 1DQLH 5KYXA 4HS8H 5IB1B 2EDXA 3FN9A 1ODAA 4LLVA 1Q9WB 4YHPB 1BJ8A 5IUCA 2KHAA 4JDTL 4C54A 2R9HC 3U4EB 2NYYD 5IB3B 4KPHH 3UZQB 4NENB 5DEGA 4FFZL 3ZMEA 5IROD 1KJ2L 4HK0B 1MPAL 2AJYL 2DICA 2YXMA 5DO2D 2EUZA 4MMZC 4F2ME 2FB4H 3F65A 3QDGA 1BIIA 3T9WA 3NT0A 3DJ9A 2A6IB 4GKNA 1HOEA 5SWZB 3WXWH 4YUEH 5ICZA 2PWHA 1CGSH 3O3AB 3AFLA 3MKKA 4H8WC 1AIFB 3B9EA 5HHME 4NRXA 1P7KB 2CRIA 4QOKB 3S4SG 3B5TA 3MNVA 3R7RA 5AZEL 4WUUA 2EXTA 1HOCB 4Y9EA 4MA1C 1OM3L 3OMNB 2F54A 4FFWC 4NIKB 4UDUA 1SEBB 1IFRA 1JTTA 4X9GA 3ZDXF 4GKSB 1G43A 3X3GH 4Y4FB 5KJRH 2PW1B 5EWIL 1DJGA 4YLBA 4OLEA 2CKBB 3QARA 5C8JA 3BP4A 1H3GA 5KVGE 1F4WH 4RQQB 1N8OE 2Z93B 4MS6A 4JDVA 2GW5A 2XNAB 2X1XR 4BFOA 1DBBL 3S3BB 4EAEA 2FO4A 5DEJA 3RVWD 1JGVL 4F37K 1XH2A 1GZPB 4DHLA 5CCKL 1TVHA 2BSCA 4G9FE 3X1GA 4B9ZA 4QTHB 3MR9B 2OA9A 2Q7YA 5E2UH 5C0AB 4NJ9L 2Q6WB 4QIRA 3MX0A 1JGLH 3NJKA 2ZXCA 4WWKD 1J0YA 1HL9A 5E08H 4QD2E 2NX5B 2BIHA 3VTAA 4EDXA 3ZRCC 2FNWA 3UTTA 4YQXH 4R26L 3TURA 2GITA 1VGEH 5I6PA 2V3DA 2E6QA 1GPOL 5FYKE 1QSFD 5JIHA 2CJ3A 4YZFF 5F9JA 2XN9D 3MMEB 5H2BB 3S5LB 3CSGA 4D0DA 3IFPA 5GZOC 4UMGA 3ZZLA 5FYLE 1E2WA 3BRFA 1DN0B 5J89A 3HBQA 3O9WA 4OQTL 4QTIH 3HZVA 3TWCL 2Z6FA 4CN6A 4ZX4A 2D4DA 5I5RA 1N67A 4X4XA 4FG4A 4TSAH 4D9QD 4P2OD 1QW8A 4QRPA 4P5TC 2WWMD 4HUUA 3GXPA 3RGVA 5E6IB 2XQBL 1MRFH 4N8CL 5IMOA 5F6IC 4MYWB 1DP0A 2WHVA 4KDTC 5CCJA 3IGKA 4HUNB 3H42H 3BPNC 2WKOA 2WMPA 4PJXF 4Z8FH 3ARGC 5DUJA 2H2SD 4OKVA 1XGUA 5CMAA 4LSTL 3UGXA 5I75B 4PJ7A 2YPVL 1VIWA 2G5BA 4L23A 1ZHNA 4XE5B 1OQXA 5BV7B 5GZNC 1E5CA 2VXQH 5D7HA 3J2PA 4N3UA 1IAIL 2VERN 3ETSA 5BS0A 2PTVA 3HE6A 3GMLB 3WKML 3HHSB 3ARXA 3D85A 4UUJB 4TUUA 5E1GA 5BJTB 2IV8A 3T0EB 3RZCB 1KTCA 1I3GL 3QFJB 1UC6A 1CG9B 1GIGH 4R2GD 1B0IA 1P5UC 2FGZA 3PHSA 3MUY1 3EJJX 5E2VH 1MI5D 2Y5QA 1BX2A 1MW1A 3A67L 3L16A 3QG7H 4OJAA 4CJ0A 5DRXB 3CXDL 3V5DA 1LTXA 3LEVH 4M7JL 3T8MA 3GK8H 3FSVA 1L7IH 3IJSB 3UBXG 4AYID 1U91B 5HDBF 2X05A 5L8LB 3KEDA 1RSFA 4JAMB 4UQIM 3O4LA 2VUYA 4CADB 5CJQH 5KYUA 2CD0A 3BP6B 2AJZA 4K9EH 4U6VL 3NPZB 3K2KA 3T3MB 1ZTXL 3LNHA 4JHAH 1QVOB 1NLBH 4MD4A 4YHPA 4ZMLA 3SHSA 2DJ4A 3WTYA 1CQKA 3RIFK 1DE4A 3KHOA 2GSIB 1DQDL 3QYMA 2H0FA 4ZOCA 3ZR5A 4Y4HB 4X9HA 4BUQA 4L9LC 5SWZD 4PSPA 1E67A 4JLRB 4O2FA 3CUPB 2R27A 3LD8C 2HMIC 3O3DB 4Q7DA 1FL5B 4EUPG 3DYMA 5A1AA 3FO9A 5I8EA 2EILB 3WL9B 3MUGA 1IC0A 4XBPB 4FL4C 3KEHA 1MHCB 1I3RB 1MH5A 5J56B 2B2XH 3VXSB 2EACA 1AO7A 4JAMA 5I1CH 5C92A 2LW3A 1BFOB 3EYSL 5EF3A 1YEFH 1TNMA 4CA4A 1MFAL 2WWNA 4OI9A 3DK2A 1M71B 1NCCH 1RZ8B 1V05A 3KYNA 4RWYL 2ZUWA 3QUKB 1JGIA 4FNQA 4XC1L 4FC3E 2OL3A 1D5ZA 4XMPH 3J8F7 3NGBC 3HJEA 4IDJH 4KZEL 4H8WL 4YVNA 2DKUA 3SGJC 1L9QA 4FQXC 4M5SA 1OT4A 2I5YL 3LQAC 2NW2B 3QHZL 4LO9A 5IK3B 3RAJH 4XVOA 1KTLA 4UUJA 2VAAA 2CIKA 4X6BB 1IAMA 4HF5H 1ZANH 4EUPH 2NMSA 2YAMA 4FFYL 3K6OA 5JQHC 4WI7A 3O2DH 2QV4A 3RG1C 3GNML 3AQYA 4P2OA 4YZWA 2YPKA 3M86A 3R4RA 4AW4A 3C08L 1EEUA 5KAQF 1AKJD 5J12C 3SDYH 1CGWA 5DF0A 2Z0UA 2V5YA 4B5EA 1ZIAA 2G4GA 3RVUC 4JGMA 1G7MB 3SD2A 3JV6B 4YXKL 5T3ZE 1DQMH 2HJLA 5I0XA 5EG6C 4JN2B 3W9EB 4AOFA 1Z9SA 4HZAA 1A0QH 4QJ5B 1A7QL 3RPKA 3BRDA 4MWFB 2DB8A 3GXMA 1AJ7H 4N8VB 3LS4H 3QI9C 4NC2B 4TV3A 5JR1L 1KB5L 4ZI8A 1RLWA 4PGDB 3VI4F 3PDGA 1S7RA 2PXYB 5B39A 2FAUA 5JO5B 1KYFA 4WTQA 1J8HA 2PYFB 2MOQA 2VW7A 4L8BA 2BW4A 3NTCH 4RAVB 4WHYG 1DZ0A 4LVHC 2X1QA 1XSJA 3J7HA 1CL7H 4WJ5B 3UAJD 3ZUCA 2OK0L 3I9AA 5DD5L 3D25B 4Q9RH 3P9LB 5A2FA 3BZ5A 5GISL 4IMLA 2HP4A 4TKWA 5C0IA 3B9KB 3IDYC 4ZG1A 2NY7H 2KZ1B 3QIBC 3RU8L 2AJXH 4M48H 3EFDL 5I8OL 2OCFD 3FW6A 3O45A 4X99B 4X6CE 1SF5A 1T6WA 3NCJH 4YDIL 1Z0MA 2ENJA 2MWCA 3Q5YA 2FLBT 1OM3H 4I9XA 3W2DH 1PMYA 4LLYB 1MW3A 4EDXB 5JXEA 1GYAA 1G7QA 1CDJA 1P53A 4ZFOL 2BY1A 4MCYA 1RAMA 1U41A 3IDJA 3TV3H 1KBGL 3B34A 1MHHA 5CD5D 5GPRA 2C26A 3PV6B 1E5ZA 1NANI 3M8OH 1WFMA 1H8OA 2AJVH 5B8CB 1XZ0A 4GG6E 4HKBB 5JUEL 3Q05A 1NBZB 3BIKB 2V17H 2LAAA 4KKBC 3V4LA 5C2BH 2Y36H 5KS9B 2HVKB 1OL0A 5DD6B 3IM1A 4QF1B 3UG5A 3RX9A 4I2XE 4XNQA 1PTZA 3QQ4A 4PR5B 3TH4T 1AMYA 1QI5A 5AOZA 3QNZB 4FI6A 1QWUA 1WFOA 4Y7OC 4JKWA 4DP4X 3E6FA 1SHXA 5C0ND 4BXSV 3TYGL 4AKPA 2XBDA 1Z7JA 1VJSA 4P5MA 5EU4A 3BVTA 3NFSH 3BVNB 3L3OA 5DJCA 3EJYC 2NQDA 4HUUB 2DWYA 5D7LA 5EBMB 2RQ8A 5LHDA 3FONB 4JPKL 5ABDE 3HE6C 4NENA 1KGXA 4OQTA 2X4QA 2QDWA 4IGBA 3H53A 4W4NA 3CVHH 2XIDA 4QOKD 4MNHB 1E3ZA 3KL5A 5IESL 3EH3B 4JJ5B 3JWOL 2EIZA 3BLKA 3W9DA 1MKFA 1CB4A 4ODXA 4X7SL 4AYEC 3FCUB 3QUMA 5DRZA 15C8H 1AQDB 2WXOA 2YJQA 4JG5A 4WW2B 3LVEA 1HQRA 5DRXA 5AWNH 3WFBH 1JDDA 1D6VL 2NTFB 4AC2A 5IHWA 4TTGA 1X4ZA 3C6LD 3UZEA 3BH8B 4OZ4B 4HHGA 3RDTD 4CNIB 5TF1H 4G5AA 4UINL 1OVZA 5I1GH 4OCSL 3CAFA 4LSRL 3AACA 2CK0H 1YYLL 4OGAC 3WEXA 3WIHL 3X17A 5GRYA 5FA3A 3H3BC 1CICB 4QYAA 5EZJA 4PLJD 2Q3XA 1QEWB 5EWIH 3UMNA 4LOEA 5DVLA 4KZDH 1DLHA 3PNWA 3CN1A 4PHXA 3OB0H 1HFUA 3BWUC 1C7TA 4H8HA 1NMAH 3BAKA 1JCVA 5E1HB 2WZPA 1SDAB 4ZFGL 4H8PA 4P4RB 3TASA 4J5VA 5FM8A 3VD9A 2NX5E 3GIZH 3CHQA 3CTTA 2X6CA 2O1AA 4E9QA 1CN4A 5JHLH 3TBCA 3QXDA 3FFDA 1NKOA 5IVZA 4KNSA 3LH2H 4XN7A 6PAZA 1HXKA 4OV5A 3SPJA 3CK0L 3WO4C 1BBJB 3EJPA 1VFBB 1SMAA 1CVRA 3BAJA 5JW4N 3OAYK 4BYHA 3SB3A 1ZGLA 2VDPH 2VR5A 2E7LA 1WBYA 2OZ4A 3TYFB 5IMLB 5JA9A 4JR9L 1V3LA 3MMEA 2PWFA 4KZ0A 3O3AA 1ROWA 2JKJA 2GUOB 4FI8A 5LKNA 4PCYA 3CN2A 3QUZD 3MACL 3CPLB 3DI2B 4JY5L 4UIKL 2VDLB 2QV2A 5E9DD 1LM8V 3CZSA 1PU0A 3D2UA 3BESR 4K9JA 1PY9A 2LFEA 5FYJE 3MRRA 5HGAB 3SPVA 4FERA 5E8NB 3UXFA 2HFFB 5I15H 2WWKT 4J27A 3U1SH 2IWKA 4AEEA 1EIBA 5TE6H 3N1FC 4W9GC 3JV5A 4AV0A 2AK4E 3ULSA 3ARGB 5CJOL 1RURL 4PJDB 2XQ0A 3WNPA 3R19A 4UILL 2VDPB 1BWWA 4NQXA 2NT1A 1YPZF 1IGIL 2GJ6B 5EIIG 4PJGF 5EO0B 4ZRGA 2UY7B 4UMSA 5GRVK 1KCUH 3VG0H 5K5YA 1EHKB 5BV7H 2XKNB 3L9BA 2BCKB 4PJFF 4QCIB 1IAKB 4MNQB 5KVDH 1GHFL 1WAAA 3RWDB 5DLLA 4LDLB 1A9BB 3OAUH 4KXDA 1RUPH 4XTRD 4IBQA 1W2KT 3SSGA 5IVXB 1MCLA 2Q2LA 4S0HA 2OJZL 3H9YA 4U0RC 2E6JA 1NEPA 1WEJL 4E9XA 2ERJB 2N0KA 5CUSL 5DJ0A 4HT1L 4I77H 1BIHA 5IIEA 2VABB 2X89D 2OBGA 4G82A 3WKNA 2BWDA 3JWOC 2FIKB 5KWYC 2ATAA 5D2NC 1KBWA 3JUZA 3RKDD 1IAII 2NY2D 1SUJA 1RV6X 6PCYA 1UADC 4TYUA 4NKMA 3SE9L 1GS8A 1PD1A 4DQOL 4AUJA 2Z8VC 3QJSB 3IEAA 3RB5A 1U2HA 2CDEA 1UJ3A 3R06B 3QHFH 4G6ML 5DJ8A 5HHNA 1Q94A 2BC4B 5EFIB 3QCTH 4U4BA 4DKEL 1JUFA 1OV8A 3TLRA 1J1OL 3D7PA 4KDTA 1KCRH 5J0BA 3W5NA 1QRNB 4J8RB 2HFEB 1LE5B 5CZVL 4EOWH 5DRWB 2FR4A 1D6EB 4MAUH 5HHMB 2BSDA 3BIBX 3PWUB 1I7ZA 4XGZB 5CR8A 5E03A 1RZPA 3HMWH 2I9TA 4W9DC 1D5XA 2AVGA 4KVNH 4N2GA 2CMRH 1MCPL 5EEVA 4F1ZA 1HHHA 2Y6SD 4CADA 2C9RA 1LEGA 3IFOA 4XNYH 4AT6A 5HDQL 2VRAA 5I1HH 2EVGA 1VFUA 4HH9B 4N8PA 5JZ7C 3BE1H 1SXNA 4ZMTA 1OP4A 3AITA 1ZOXA 3Q6FB 2DQGL 4ZO6A 1NAMB 2WVVB 2XPGA 4Y4FD 1ZEAH 3ARYA 5A16A 3B2MA 1CR9H 1T22B 5MI0C 2IOMA 1KTDA 1N6UA 2C8NA 4JVPA 5L0QB 2KZWA 1OCWL 4H0IA 1NCCL 5EZJB 4ZFQA 4KJYB 4O51B 5ANMA 1CG9A 3OJMB 5SWSD 1E90A 5H8DA 1L9TA 1OTTC 1BEYL 1CS6A 1UKSA 1GGCH 5DMGD 2WQWA 9PCYA 4CC4C 3KPSE 1SVZA 2HT2C 3LZRA 1PG7X 3MLRH 4NOFA 1T83C 2AJXL 3N9GL 1QABA 3FBKA 5C0AD 3GKWH 5IT2L 1DQQA 5INCB 4YDKH 3CIQA 1DYZA 4PP2B 5A2LH 3EJSA 32C2B 4YE0A 1YEKL 2WY3B 5KN5B 4M56A 1JL8A 1XF5B 3JTBA 2DM2A 4FD0A 2CSPA 1I7RB 4G8GA 2VT0A 12E8L 1CGXA 1MWAH 5K9KA 1EJFA 1ZT7B 2EIZB 3N50A 1QLFA 2WZ6A 3F6IA 3VFSB 5C86A 4WHDA 1XXDC 4YIQB 1CWVA 3X13A 4X8CA 3LPWA 3E1ZA 2XV3A 4LCCC 3AT9A 4BQ8A 4Z7OF 1KEGH 2L8AA 1UD5A 3QFJD 3RIAF 3FO9B 3WIFB 2LU3A 4MQTB 3QIWB 1IGYA 1S9YB 5G4NA 2ENPA 4UANA 3RWIB 3UCRA 5ANHA 1T0NA 2ORBH 2CKBL 2Q87A 1A7QH 1AR1B 4PS3A 5HJBA 4UM9A 3BMWA 5D70L 5A2IH 5I1AB 4XP9L 1MFNA 1M9SA 1DQTA 4PP2A 2W9LA 3UBGA 4Z18A 5A3IC 4R4FL 1HHJB 1CXKA 1DDTA 3JXAA 5FDWB 4JE4B 2OX5B 3Q8CA 1MLBA 4LCVA 4N0UB 2EIBA 4WTXA 3G04A 2JIXB 2D9CA 4KNTA 2FDBP 5K9OA 4Z0XB 4NCC2 4OUUB 4KHXL 4S1SH 3TT1H 4ZUVA 4K71B 2BVPB 3BDYH 3VVWA 3LNEA 3ARWA 3PG2A 3MRPB 3X11A 4DWHA 2PLTA 1MNUL 2J20A 3P2TA 2VSCA 1R1CA 3APCA 3BI9X 3WU1A 1WJ3A 4LCIH 4Q9QH 3QJQB 1TZOA 1TVBA 2R59A 3PPEA 4PU2A 5DQDL 2BNRB 2UWEA 4QXTB 1YCSA 4CMHC 1D9KD 5CILL 1KGIA 3MOAL 5K9JH 1LXMA 1ZTXE 4LVOB 3FU6A 3D3VD 1OB0A 2IBZX 2W92A 1P4IL 3FOMA 2RACA 4JO2H 5JXEC 5C0IB 5EOCL 1NGWA 3T1WA 2K7PA 4LESA 3S5ZA 4IU2B 5FDWA 3LDBB 5TFSH 3LZFH 4MB1A 2DY2A 2XIIA 2CGRL 2P47B 3EAKA 4FKHA 3ZPDA 3NEEA 4LAQL 2ZSVB 5LCVH 3D0LB 5F1IA 3BKYL 1M56B 4AKOA 1IM9A 4MA7L 3VI4E 1ZWIA 1IGFH 2H1XA 1XF4A 3D34A 5T5FA 2GI7A 2GB2A 3D39E 1NCWL 5IR1B 4MJHA 1BF5A 4MA3A 5C08E 4TQIA 4KQ3L 4L5FH 4HK0A 2ZKHH 3S9DB 3CN0A 3NZHL 4RIRB 4X9BA 1KLGB 1OB1A 4ETQA 1YDPB 2J6EH 5I6OA 4PLJC 3PFUA 3EG9A 2A7BA 3GZPA 3C60B 4C56B 1JZ4A 5L7XL 1I8IB 3GHEH 3RZWA 5IOPA 2IG2H 2ZXEB 1AR1C 1L0XA 2TSAA 4Z7NE 1NMCB 2L7UA 2ZONA 4U05A 4ZXBC 1AZRA 5JW4Q 4NPJA 1NGZB 2OJEB 4F8PA 4PJ5A 1FE8L 1MFBH 5F9JB 4HUKB 3QXUA 4PJ9B 1FAIH 1MJJA 4RGND 1OWWA 3ZTJH 2J44A 1IGJA 1UM5H 3O6FD 1VFAA 5HJ3A 5KG9B 2IJ0C 3KG5A 4Y89A 1AOZA 4AQ1B 4JDEA 1T3FA 1A1OB 2A6KB 1A6TA 4HQQH 5LQBH 1G87A 3H1ZA 1VCBC 3NEXA 5HYJA 4R4BB 2FSDA 1H3VA 4ZUTB 2FHCA 4XBGB 4FA6A 2HG0A 6TAAA 5E6ZA 4R7LA 5HYJD 4NQEB 3OXSB 4ANVA 1NCTA 4NRYA 3OKOA 1WZMA 3WNJA 3ZRFC 1QRND 2CO1A 1IJNA 4PBXA 5CINH 3ZL4H 2RIKA 3FF7A 5KSUB 4F7CB 4APQC 5D2NB 5FUZL 3CFMA 3V0EA 1IKFL 2ICWI 3JZYA 3PU7A 4UB0L 5FGSA 1N10A 3KXFD 5G4MA 5HPMB 4GRMA 2DMKA 4HZ1A 1P7QD 1JPSH 2X4NA 3EH2A 1GJIA 2H6PB 4HK3N 4NAJA 4Z7WA 2VLJB 4UQAA 3S3SA 2H3NB 5A2BA 5E0QA 2ADJB 5HJ3B 1UB5B 4OSUH 1I1AB 5G55A 1D5XB 3ULVE 3VCLB 2G60L 2XTSA 3DIFB 1GGYA 4QRPD 5LBVA 1ONQB 1VZGA 4IOIB 5FO2A 1UD4A 2YBGA 4M02A 3QQ3B 4DTGL 3QZWA 1OSZA 4PRIA 5H35A 3ZDYF 3F04A 4LDCA 4HS8L 4QWWD 3TYFA 4EOWL 4OFIA 5IMLA 5JLZA 1J5CA 4PIBA 3ARVA 4ZUWA 4XI5C 4MX7A 2OSXA 3VX0A 1IGYB 1S9YA 1RHFA 2B1HL 1MCJA 4AGNA 4DUVA 5IQ7H 2UX7A 1OE1A 2CLRA 1U8IB 3G6JB 4XMXA 3CDZA 1HS6A 4WKZB 5HDQH 1JNHA 2ZYSA 1HH9B 2CR0A 4OCXH 5HDBE 3WS6C 1RZKH 1JHKL 3K91A 2P28B 3AQZA 1VACB 3IGAB 1XF3B 5FFGA 1T89A 3IU4L 4JVUA 4Y1AD 1GKEA 4MTMA 5AB9A 4TLTA 4L8CB 3MNZB 4K3GA 1YO4A 4EN3C 4UI2A 1N0LB 3U1SL 2NY3D 3UTSE 3PNWB 4G2AA 4UAOB 4F58H 4L9DA 5I0YA 1Y0LB 2QQLH 4ZTPL 3DGCR 1EBAA 3D18A 3C6SB 3JWNC 1VDGA 2CMRL 1IZJA 3ISWA 4PJBA 2BIMA 3TU6A 3ZL2A 3E8UL 3W38A 2HVJB 3T2PA 2MCAA 5F2FA 2ZPKL 4C8XA 5SWQB 1F4WL 2CNZA 3CVHA 2XN9B 3QH3B 2F15A 2OZ4L 3NP4A 2IIJA 3RWHB 1CU4L 3NCJL 4YDIH 1C5CH 2I9LA 1N5AB 5CEYA 2OMBA 2VRKA 1A65A 4CC1A 1BM7A 4M4RA 4OM1H 1IKOP 3FQ2A 4S0TD 4BZ2H 1MWAL 3GINA 4N68A 4QXWA 4R0LB 3BVUA 1USZA 5KANG 4OJFH 2GTWA 2AJUH 2NUTA 2A6IA 3WGUB 4W4OC 5ICZB 3T3PF 2FVNA 3BP7A 3OZ9L 5BQ7A 1A6WL 4AZUA 4LKXB 4ZTEA 2HT4C 1NCNA 3AG1B 4U1GC 3TJEH 5J9PB 4HJ1A 4PRBB 5HI3C 4YR6B 4ZMWA 2G2RA 2OS7A 3O9WB 2O61A 3DX6B 5AW7B 3ILPB 4WU5B 3DOSB 5I1AA 3GT6A 1BFSA 2YBRB 2TRYA 5DI8B 3D9AL 4AYMC 1GJWA 1V5JA 3RWCA 1Q0YL 4OI8A 4HUCA 2D3LA 2R23B 3W0WA 4AL8L 1LDSA 4TF4A 5JIIA 2BIQA 3B6SA 5T5NG 1WICA 5KS9A 2AANA 5EU5B 3FQYA 2N01B 3O2WL 1WS8A 2XPYA 4PTUA 4H88L 3P3YA 3PJLA 4YH6A 4WW2A 4GKZA 3C6LC 3GMPB 5IHUL 3CN3A 3VTTA 1EVTC 5INDA 4YC2C 2FGWL 2IGFH 2ZJSH 3BP7B 3C5SA 1KCBA 4P2QE 3KPLA 3KCPA 1KEML 1Z3GL 1VEMA 3AG2B 4KOBA 4L9LB 1F6FB 1FHNA 4N26A 4X6EB 3KMDA 3FUDA 2HMID 3N91A 4UQ2A 3OC5A 4LSSL 1P5VB 5DQJA 1X5FA 3HZMB 4I7ZC 5B21A 1OHQA 1V7NH 4OLWL 3TN0C 4A6YH 1DLHB 4OCMC 3ARTA 4HMEA 2AXGA 1TFHA 4ZPTA 1JPTH 4OLZL 4YXHL 1X7TA 4I1RA 2Z64C 4JQIA 2Z0BA 1XL6A 3RI5F 1MRDH 1V3KA 1E6JH 4I13B 4GQZA 1U8LA 2IQAA 2G9HB 1PZAA 4Q8BA 5DEFB 3WDJA 1E4WH 1VLXA 1NBVH 4YHLL 1X9UA 4Z78B 3FB7A 3S96B 5L6YH 3BH9A 4UIMB 1YNTA 1J5OL 4RFOH 4WDIA 1KTBA 3LHAA 1RZQA 5HY9A 3MRHA 5FUOL 3BZFA 3I02B 3IE4A 3R7QA 3L5HA 3V4PB 4P8QA 4D3CL 3ETBJ 1AC6A 1DQJB 4BUHA 1PF3A 4ZSOE 3OTTA 2FBRA 1BPLB 3O41B 1IM3B 1HL4A 1KG0A 4N2HA 3V0IA 4C83B 1IILE 2NYKA 2X5PA 3DHMA 3VACA 1ASQA 1CLZL 2R0KL 4JFXA 2E5EA 2DTSA 5CBEA 4PLNC 1UKTA 4P9HH 3W82A 1K2DB 5CBAA 2D31B 1U2CA 2A99A 2D8KA 1LE5A 2B0SL 3IWVA 2RFXA 3OLEA 5F21B 4KROC 2DH2A 1WITA 2DI9A 1TJXA 5IQNA 2DQMA 3FU3A 1PG7H 1SXSA 4F15C 4MA7H 4Y5YB 1PPIA 4E0RB 1FZKB 2QQNH 1B3IA 5DR5H 1VADA 1MFVA 4LSQL 3HC4H 3V6OA 1OTUC 3H0TA 4QAWA 1XR8B 1KIRB 4G1EB 4RESB 4M5ZL 2BJMH 1NPUA 3M88A 4U1JA 3CDGB 1SF3A 3QEQB 3VFUA 1QA9A 2XTJD 1GS6X 5T3ZD 4P23B 1BVOA 3V52L 4QLWA 2FSEB 2Q20A 3EH4B 2VMCA 2VUKA 5D1QA 1AP2A 3QDJD 3KPRB 3EGXB 2ICWA 1MG2C 4F1SA 3FN3A 3L17A 1RUML 5ESQB 1L7TL 3KNBB 4TTDD 5ESAA 1GMIA 1MIEH 3GSXB 3VXRB 1YEDB 1SMOA 1GAFL 2MHAA 4PBWD 2R0LL 4IRSB 3JT0A 3GTNA 4M1DH 3UAEA 5G2NA 3CIAA 3GXDA 3MLWH 2GY7B 4L4VA 1F4XL 4LEEA 4LIQE 4KV5F 2F54D 3QT2A 4P9HC 1V54B 5D1QD 5I1CL 3GSRB 4YDLC 1KIQB 5E6ID 1AZZC 3T4YB 3NDZE 1BDYA 5EO0A 3HZ3A 1HQRB 5L8KB 3N2JA 4XMKL 2ZCLL 3S98A 5DS2A 3D2UD 4A39A 2BSSB 2O6FA 4NQVA 5GQBA 4Z3IA 1S3KL 5JOFA 3HLKA 1QD0A 2WIIB 1XVSA 4K3EL 1IQDA 3IN0A 3QNYA 4OIFA 3WY2A 1F42A 5KAQG 5KVFL 2AKRB 2I32A 3GSOB 5GGSB 1BCIA 1KLGA 4NNYA 1FN4B 1G7LB 2X1WL 4P48A 1MVUA 1CXFA 3P9MB 4NKOA 3SOBH 5I76A 4XNDA 3PGDB 4GT7A 4PAZA 2CBPA 3SGDH 2OYLA 4LNRB 2IOIA 3QQDA 3CZGA 2AXJA 3L1OH 1I8MA 3T6QC 2MEJB 4ZNEA 5JDSA 1AE6L 1K85A 5DFVC 3HZYA 1CIDA 5EPMA 4XCYA 4OCNC 5T1JA 5D7JD 1XD0A 2EP6A 4ZQKA 2E7LC 5KVMC 4JO1L 4ZZKA 1RJYA 2ZXGA 1A64A 4CSPA 5CLWA 1IGTA 5A40E 4F7TA 1DVFA 1D5RA 2Q7YB 3DRQB 2YA2A 3S2AA 3S34L 4WLCA 1UOKA 5LVEA 3OKKB 3K6DA 5D4QA 4UF7C 1EUUA 1M9WA 4MXWL 2I7SA 5HPOA 1KENH 1QPXA 4F2EA 2X70A 2VDRB 5J6GB 2XTJE 3S37H 1FPTL 5C9JA 2GTZA 2AAVA 2QKIB 1NEZA 4HOWA 1LGVA 3GBEA 3GMQB 4GAYB 2DDQH 3ZDZF 1C16A 3MBXL 1A6TB 3OB8A 5CEZE 1K5WA 4JUTA 3NOIA 3BO8B 3GRBA 3AWFA 1RL1A 2PTTB 2QVMA 3H4HA 1S9XA 5GRZA 4PI0A 1NFIA 4M9PA 1JGVH 2J12B 2PYEB 4S2SB 1NIDA 3L48A 1SQ2N 2P8MA 4N0FB 4NNPL 5FHBH 5D7LD 1MW0A 2EDBA 1AIFA 4YDVB 5H35B 3CMOH 4TNGA 2FEDC 2ZT9C 4JJ5A 1ILUA 3IDMA 4P4KA 2J7LA 5E9DA 4HKJA 2X4TB 3L5JA 4LSUL 3AAZB 5DHXB 3V4VL 4CDHA 1KJ2A 2AEPH 2BSRA 2V9QA 2VLLB 2VQUA 1NA8A 2XWTB 3DV6B 3X3FH 4BQ9A 1RUQH 2BK8A 2V7HA 1VGEL 3C5JA 2UUDH 4BK8A 5JUEH 5IFJA 5CNHA 3TFKC 3HB3C 2DQFA 3LN5B 3LXUX 4JY6B 2J3SA 1QLFB 5E1QA 2OP4H 2OMYB 2HTKC 5LCVA 4XNZB 2BVEA 3KBEA 4MMXA 5GRVL 2HH0H 4L4JA 3BH4A 5T5FH 3SDXB 1URIA 2NNAB 4JCLA 1NBZA 2ADGA 2VDNB 3GMNA 3S97C 4PV8A 5HGHA 4PV1C 2WXQA 2EDQA 1V7ML 3AREB 2YO3A 5KTEH 1LP9A 2IALB 3AUVA 8FABA 2MQ3A 2JK5B 4Q89A 5DWUH 3LMJH 2Z92B 4MQXC 2CBMA 4C59B 3OLDA 5D1XA 1YPZE 1TQCB 4YSEA 5KSBF 1B3JA 1JVOA 4GG6B 1AD0A 1LJMA 3OWEA 3QS3A 2HLAB 3MRMA 3EYFA 4OZGE 3SDAA 1PL3A 3FULA 3LZPA 1DQVA 1QASA 4U1NB 3W39A 2C1OA 3QS2A 1IAIM 1TZGH 3STLB 5I1DA 5ID0B 1I1YA 4LSRH 5JHLL 3WKYA 5IVXE 2HJFB 2XZZA 5L4FA 3QZWG 2YD1A 3I3BA 2XWDA 2Z3FA 4IHBA 4I89A 5EC1A 1E2VA 5E2VL 3RWFB 5FFLA 1CGYA 4WFFD 1U8NB 3D07A 5CD3B 3UYPB 3CG8A 5CZXC 1U8IA 4KI5C 3PL6A 4OZGB 4LKCB 4O2FB 4X5WA 4KI5D 1FNSH 1QRKA 2H0PA 2XG4A 4E9SA 2WLLA 3HKZA 4AZ8A 2E75C 2HX9A 2QSCL 1FVEB 3G5XA 1MRCL 4OLYL 3SJVA 5HXMA 2JKWA 2ZXDA 2EYRA 1S7UA 1DL7L 3S35H 4M7KL 1U8QA 4KJQC 1IC7L 2G30A 1ZVYA 4FDWA 2F61A 2YAHA 1XH3A 5E5LA 2V2TB 3MV7A 2GQHA 2DLFL 4QRQB 4GUPB 2VDQB 3P0VH 4M6NL 2DEYX 3FPYA 3SY0B 3SDAC 3AGWA 4F24A 4RMSA 4WKXA 2JFCA 1M1SA 2EXYC 3KPLB 4PRDA 1UZGA 3V10A 4BM7A 1ZT7A 1DUZB 2F9BT 1IUZA 1GL4B 2IPKA 4OIIL 1F3JB 2AK4A 3GTVA 3TC9A 4XMLL 1QI4A 2CBOA 1K8IB 3UTSA 2DWXA 5MHSE 3KS0H 4X6CA 3BAYA 2QMKA 5DO2C 5I75C 3VO0A 1HESA 4IDLA 5B7FA 3VSUA 3A0OA 5SWSE 3BSZA 5CHNB 4ALAC 1IIIA 3MLWL 5I1LB 4PP1C 3X14A 2AQPA 5DC2A 3MTXA 4LPYA 4AG4H 3BXNB 4J3UA 1WGOA 2Y1ZA 1WO2A 3NJVA 1A3LL 4HLJA 4UILH 5FUCE 4NZTL 4OKVB 3WJLA 4I2XA 4X2UA 5AW2B 3I50H 4DN3H 3MGOB 2Z9TA 1CLOH 2KERA 2WSDA 1DBML 1BP3B 5C0RL 4CC0A 1M2VB 3GI9L 4FG6C 4YFLI 4LNRA 1A4KB 5E1AA 5L6YL 1OGAE 3QUXC 4DO6A 2VC2L 1ZT4B 2LU5A 3FRUB 3MJGX 4G1MB 3O4OB 5IJDC 3GBDA 4ANWA 4M6OL 2W0LA 3OAUL 3PHOB 3MBWA 4NX0A 4CW1B 3QUZB 5HBBA 1F11B 2Q76A 3L54A 4CDGC 1WBXB 1YY8B 3L3HB 1TXKA 3MRFA 4GXUN 4HALA 5DJZB 3HAEA 3IDMB 3GUTB 1L9PA 3EDKA 5L2JB 3MRKB 3VDCA 1YJDH 3BAXA 1WGVA 3SPGA 2EXSA 3RWJA 4TNWF 3GPSA 4AZ8B 3KWWA 3SPHA 2DKMA 2YUVA 2NY6B 2GK0A 1W8EA 1EJ8A 4M62L 1TSHA 5AKTA 3FJTA 5ESVB 4UTBA 4U1GB 4GG6F 3K71A 4P23D 4NRZB 1IBHA 4L0PB 1FP5A 1QWNA 3SE9H 4XP1H 4AXWB 3MUZ1 3C75A 3RTQA 4P23C 5HD8D 3ZE2B 4PJCB 5TJWK 3CFDB 5I1HL 2ED7A 5DR5L 2IFFH 1X7QB 5FLUA 3V4UL 3G3LA 3GMQA 2YQBA 1D2PA 3NGBB 1BSIA 3EGDA 3STBA 1TJGL 2FIKA 5DFAA 5I1EH 1T4KA 2GT9B 5FB8B 1OAUH 2WZ5A 1IARB 2DM7A 4P4KD 2A6DB 4N6RA 3U48A 5C2UB 3I6LE 4OF5A 2VNCA 4LEBA 4X6CB 4O5LL 1N2RB 4MA8L 1Q1JH 5I26A 4I18C 4HPYH 2FX9H 4IBYA 4PRHD 4YPGA 4NP4H 2GJ6E 2NY5H 4D9RD 5MENE 1OEZW 1CICA 4YBLB 4NUGH 1XGQA 5AKVA 3TS8A 2NY7L 5IP4A 1A1OA 2A6KA 3QJUB 2PYEA 2EEXA 3PXLA 3CHRA 4R5VA 4YHYB 2EE3A 4YDKL 3ZKQD 2Y1AA 1NINA 1G7JA 5E9AA 5FK9A 3GSUA 3T2OA 3C60C 5E4OA 3I6KA 4ONHA 5C07D 1II4E 2B5IB 1QFWL 2D2CC 2YBRA 4Y2DC 4F7CA 1UXSA 1S46A 1A2YB 4URTB 5TF0A 3H9ZA 4HD5A 2Y2YA 1GTNA 1MDTA 2O6DA 3OL2A 3AS2A 4NRYB 5HHMD 3VA6A 1DUYB 1U8CB 3E8VA 4DKFL 2G3NA 2JJWA 2EH8L 3QUYA 2AEQL 3X12A 1FLTX 4DZ8A 1P69B 1BQHG 3VFVA 4BFFA 3ES6B 2R2BA 2QKSA 2NY6C 4POUB 2PXYC 1JAEA 3MJ8A 2Y7LA 5JIPA 1F97A 2E9GA 4NJ9H 1HH6B 3LEXB 3E80A 2ZUYA 3HI6H 2MOGA 4KY1H 4Z7OB 1LEIA 1R0AL 1K3ZA 2UZXB 1IAOA 2JJUA 3VXMB 4YLCA 4IYKA 4DEPB 3O2WH 3T0EC 5IJKA 4UWQB 4JB9H 2WBXA 1T1XB 3GXNA 2PPEA 2JB6A 5ITFA 4Z7UA 5E94B 5DJYB 1F3JA 1UD2A 4F80A 2V3FA 3N04A 1QR1B 1CYWA 2E8YA 5DWUL 4L4TA 3D0VA 2BXZA 2ZUTA 5I76B 5J1TC 4FGMA 4OD2A 3II2A 4IBWA 5HVWA 5KYYB 3BD4A 1CURA 4PB9H 1KCLA 4Y4KB 2IBZY 2QZQA 4PYGA 2BOCB 5HHPA 5BRQA 3I75A 3M6DA 3MFFB 4XOEA 1IQWH 1FNEA 3HG4A 4Y19B 3ML8A 3Q1SL 4NQCD 3HEIB 2DQGH 4KNUA 4ISVB 3LVTA 3SJVB 1H0DA 3GJFB 3HE7A 1GGBL 1UM4L 3U2SB 5L4MA 4YDJA 1L4IA 3QEQD 3UC2A 4N0UA 1BMZA 3T3MF 5ITFB 3UTSD 5D2LA 3ZHKA 1EAQA 3K6IA 1BZ9A 4NKDA 5EBLB 3L4YA 4M5YL 4FFZH 2AJSH 1BEYH 2XXMB 3KJ6L 3EZJB 3KLAB 4PRAA 4M7JH 5F7DA 1RIUL 3QIUC 4DGIL 3TGXA 4K3JH 3UL4A 3ZVVA 2ZCKL 4BFKA 3F7YA 3VMNA 4NQQA 1ZE3C 3N06B 1ZAGA 3DTUB 1F02I 1YUHA 1AY1L 1G7QB 2CE6A 3BWUF 3LCYA 4AQZA 4DN4L 5IG7B 3WKMH 5HDLA 1W72L 4K7PX 2H3XC 1WBXA 3L3HA 3MRFB 1F4HA 5DCCA 5HHPB 3X1BA 4N2AA 1AXSB 4NERA 2OMWA 4X83A 4X5XB 5IMKB 4JO8A 1PSKH 3ASOB 1X5HA 5TE7L 3FH5A 3QRFM 5B7EA 5ETUA 1U21A 3ULAB 1HE7A 3CBRA 3DO4A 3V79C 1WH0A 3A23A 3GB7A 1T04A 4HEME 4OB5L 4WV1B 1X5MA 4M8UA 3VFUB 2APWA 3L3DB 3PL6D 1TVHB 1DBAL 4PY7B 5MEOB 2X0VA 2ZSVA 3VQLA 1Y0LA 5D7KD 4HXBH 3BKJH 5FCUL 2M8XA 4AWJC 5D6CB 4JRYE 3FFCA 3WUWG 1PZUB 1Z1WA 4Q14A 3HG1B 1ZV9A 3M17A 4X4YB 1Q4NX 3I9GH 1RIHH 2QLVB 4U33A 5CKAA 2DWEA 2XICA 2LTQC 5HJDA 3UTPD 5L7XH 4YHNA 5F89B 3HS9A 5BOJA 4GQ9H 4C47A 4G5ZL 2OLDA 3DLQR 1FH5L 1V7MH 4YHKL 4NQUA 1FLRL 4UDUB 3RIKA 5GRUH 4JVWA 5A16B 3GEWB 1LO2L 2FD6H 4LU5H 3WNKA 3KE0A 1DCEA 5CEXA 4Q0XH 1FAIL 3EJZC 2NY6D 3QVAA 5C0RH 1CL7I 3DURA 1BFVH 2XA8H 3WIAA 2AHIA 4IMKC 1NGXA 3LXCA 2KL6A 4K23L 4ODVH 2NYZA 4TNWK 4YDVA 2NUPA 2QTEA 5KBPA 3WO4B 1JPSL 5LQBL 2IAMA 5E00A 3S8FB 3RNQB 2P44B 1FNLA 1OGAA 2CXKA 3AT0A 4KX7A 4AGOA 1MXGA 3MNMA 1QYGL 2W59A 3O8XC 2K4WA 3MRIA 1U8JA 3GLAA 4UZUA 1YN6A 1OSPH 3T4AB 1EDQA 5CWSA 4YNYA 2EDEA 5LN4A 1OANA 2EIEA 2NY3B 4J6IA 2JTDA 4J4PC 4ZUSB 1CF1A 3MLVL 1U3HA 1KGUA 4FN0A 5DC0A 2WLLB 2QGDA 3O2VL 1FO0A 4FQXD 2ARWA 4BDVA 5J11C 4YSRA 4Z8FL 4QXUL 1E2ZA 1NGPH 4GXVL 4YWGL 4RMRA 1U58B 4YGVA 1BZOA 1UA6L 2WCSA 4U6XA 3OKOB 3SOTA 2WGXA 3LH8A 5LLIC 1GC1C 2ROXA 2G4EA 4OSUL 1NCWH 5I74B 1A3QA 2IFFL 4BK5C 2VJ8A 2XUWA 3JBG7 3LIZH 5FHAH 4G80A 3O11B 1YMHB 3BAWA 2KBGA 3TBVB 1EEZB 4O2CA 5E24E 3V5HA 3UO1L 1KBPA 4ODHL 4Z1PA 1SJHA 4KC3B 3DGGB 5FLVA 3MLSH 2XN0A 3APMA 4AYBA 2FJGB 3AW5A 4W9IC 5T3XD 4FL4B 1JE6A 2D2OA 3ILDA 4HWUA 4QXGH 3TBTB 5D5MF 1Q72H 5EUOB 5GS2H 3V0WL 2JK5A 4EN3D 4QHUB 3QQDB 2JIXA 2AABL 4ELME 1JNNL 4U1JB 1YHPA 1ZRUA 4AW7A 4NPYA 1IGCH 5CJQL 3VGHA 4KKZA 4RRPA 4FHBD 3R06A 4K8RD 2AMUA 5ISZE 4QRRB 2HFTA 4BH7B 1OARL 3T8VA 4OFPA 4HIXH 5IY5B 2FEEI 4F2FA 1HCFX 1OK8A 4PJ9D 1U8OB 4Y8AA 3IJEB 2DF3A 3RURA 2Y07H 4W9FC 5FYJL 1M2VA 2R56L 2ZYIA 3QUXB 1YG9A 7TAAA 4Q74A 4I4WA 4ZFZB 1U8KB 3CSFA 3QORA 5JNYB 4JFXB 4ONFL 1BG1A 5HHOE 3V5DB 1IKNA 5IHZA 2WN3A 5FGRA 4TTDC 2R4SL 2V0AA 4HWNA 3S3CB 2YKLH 3AU1B 3D4GA 4FCHA 1N8ZA 5DT1H 2X2JA 3S7GA 4DK6A 1JF1B 1ZA6B 3DHUA 3ECBB 4RRPM 4N5UA 2CQVA 2HVJA 4FQPA 2XYBA 4FQ1L 1TT6A 3QSKB 3I6SA 3VFTA 4DPCX 3MBEA 5T1KB 1H9DA 2MNWA 3UG3A 4EIGB 1WBZA 3P4LA 2D0GA 1HX0A 2HRPH 5SWZE 2JKSA 3LAFA 4M8QA 2VJXA 3OHXC 1VPOH 3U30B 1KB5A 2NX5D 3PWVA 4MVBD 4I0PC 4ECNA 2X89A 4F8TA 1CYXA 2HRHA 3K2MC 4WV1C 1DANU 2CBTA 3QDME 3U9PH 3VU2A 1NWPA 2WWMC 3GJFA 4B7IA 1BYNA 3LQAL 4XC3L 1X7QA 2VR8A 5F1OB 3DV4B 4WFHD 1DBKL 4HS3A 2EIMB 3R8BB 5DMIH 5L0QC 3V7AG 1OSYA 1EJ6A 1RZJH 4Y4FC 5D96B 5MEND 5CN2A 4ZX5A 4A6YL 3UOAB 3S5YA 4EO5A 3WTSA 1N59B 3KYAA 1HKFA 3ULUE 1A3RH 7PCYA 2IBBA 2YSSB 4JKMA 4ELKB 4LQFL 4ZODA 3ZO9A 3E2HC 5DGQA 4K7PH 4EVNA 1ZLWH 3FTWA 4MHHI 1ETB1 5CSZB 1UWGL 4K7FB 1AQKH 4LNVA 5DJDA 5DUBA 5KVDE 4JFSA 4MAYD 1P4LA 2E27H 4PW9A 3TONA 3CFDA 3RB7A 2QQLL 5FAAA 4GKZB 3QJHB 1HKLL 1JF6A 3UTTE 1VGKA 4I3RH 5DURD 5IB2A 5KVGL 1EV2E 4JCWA 3D25A 3EOBB 2OW6A 3PHOA 4O02L 2NY5C 2P5WB 1GY1A 3L3GA 2ZG1A 1RI8A 3MNVB 4RAVA 3ZE0B 4HFUH 4XNMA 2B5IC 3UJJL 4PJXA 3GO1H 4LXFA 3VYPA 1UB6B 3RWJB 4WV1A 2RB8A 1U8OA 4FS0A 1N9PA 1FUNA 5DVNA 4JPQA 1KV3A 1G7IA 4P2QD 4YNYB 5EO1B 2G2NA 5C07B 2A74C 3QUZA 3C5ZB 1QBMH 3RGBA 3VFRA 3S8GB 4GG6A 3RPIB 1TSRA 2JLLA 2WKLA 3OKKA 2OMVB 2QQKL 2UXGA 4G8EB 4GIPD 3GXTA 3DJTA 3VD2A 3ASWA 2VXSL 3NJHA 4LLUA 2OCJA 4XVSH 1J0KA 2WYIA 3GS0A 1M7XA 2H1LM 2XX1A 3OB0K 2A9NH 5EBWB 5IQOA 3WTUA 2Y6TE 5EU6A 5ENWA 2JJTC 2JTYA 2Q8BH 5DD0H 1EZUA 2F8XC 4DGVL 2MPAH 4P5RA 1L0PA 2VJ0A 1FGNH 1XCTB 1KFGA 3WI9A 4Z3EA 1NMBL 1S7SB 2IOOA 2QHRL 2QPEB 1TUPA 4RGNB 3M1CA 2HB0A 3B9AA 3BPCA 2IC2A 5EC2B 2MHAB 5I1LA 5KBKA 4E68A 4JPKH 1NFKA 1M7DB 4YHKH 1BXUA 4X7TB 3IJ8A 4U7SA 1AS7A 2NYYC 3W56A 4A63A 4APXA 4WI9A 1KSRA 2XWTA 3VGFA 4MSWA 4MMXB 2Y7OA 3SDCD 4C4KO 4OY9A 4LCWB 3HN5A 5E8PA 2HT4D 3QNXA 4QRRD 1QW9A 1UH3A 2KPWA 3FCTB 3SKJH 1H5BC 3P77B 4NQVB 1QAWA 3QIUA 1THAA 5KSAC 3JV4B 3LV3A 1NEUA 35C8H 3ZDWA 3OKNA 1P84J 3VFMA 1SLUA 3HE7C 1MCOH 2Z31A 3ZHFA 3V9EA 1DANT 1NFIB 2Z34A 4K73A 2ZZUT 4IIQA 3RIAK 3BGFC 4D9LH 2XQYA 1IBGL 2FX8H 1A3LH 2DQUH 3UG4A 4WK2B 3ZU8A 4OCWL 3ZYZA 4Q56A 1HDMA 3ABZA 4D9QE 1AANA 5C0CE 5LDUA 1AQDA 3QIWC 4P5KB 1JNLL 5LAXA 4F7KA 3IDJB 1RK0A 2F5BL 1U8HB 3DVGA 1HSBA 1L3NA 3BVVA 2WNXA 3H56A 4PJXE 2O5XL 5DZ9A 4GSDH 1O6SA 2BSTA 3KDMB 5HYIA 1RK1A 4ZOAA 3V95A 2TRHA 2YAQA 4RDQG 2LR4A 4GAJL 4KTDL 4JGJA 5FHAL 3PLYA 4PJIB 5J9PA 1JGEB 4JM4H 3MLZH 1XX9C 4KK9D 4V1DE 2EDTA 4XP4L 3KWXA 4HW6A 5EC1B 5H37A 2YGQA 4HZLB 4JKPL 2ITEA 4TVPL 4EN2A 4NBZB 1W8NA 2ZP8A 5E1AB 4LVEA 1BJ1J 1MQ8A 1IM9B 1B4TA 1MHPH 3DKHA 2VR6A 3KPOA 4POZD 2Z35B 5DD1L 1PSKL 2EVHA 4JRYB 3QORC 4F15B 4ZNEE 5AB1A 4BRJA 3LQZB 1QFUL 2EDHA 2WTPA 5IHLB 4GRLB 3HNTH 1NFDB 4GRWF 5IW1A 1ACZA 1PCSA 2Z8RA 3EW3B 1IC5H 4Z7VA 2HSIA 4GAFB 1ZSDB 5JMOC 5HGBB 1JG9A 5GZOD 3RHWK 1Q9LA 3ZQXA 4CVXA 2W94A 3MC0A 5HVFB 3SDDD 3QZMA 3LOWA 2WQUA 2P46B 1RLBA 2WM0A 3G9AB 2X9XA 1YECL 1JPFA 2E74C 2QGCA 4NN5C 4OFQA 3V52H 4AUYA 1KY7A 1L9SA 1DBJH 5C3LD 2EDYA 5BS0D 5BMFH 1P6AB 5D2LF 1UOVA 1V3JA 2YWYA 4KKCC 3S3DB 3DC0A 3N40F 2DWTA 1E8WA 3U6RB 3BN3B 4U0QB 5K9KB 2DQDL 2H2PD 3ZYJA 5E4AA 4Z0BL 4ZSOA 4FTDA 1DJXA 2HFFA 2XRAL 3NCCB 2ALAA 5JPMA 1LO4H 5KSBE 5HYEA 1PZ3A 2ZWLT 4P46B 4D0CB 3ZE1E 5L9DL 3MGAA 1YN7B 3P9WB 1FA4A 3EJYD 2VM3A 2F2HA 4KFZC 5KJ4A 1EX0A 1EHXA 1X6LA 1RZIA 4BE6A 2J1YA 4BZ2L 3FUJA 3Q43A 3QYCA 4KTEL 4KTYA 4I9WD 1ZV2A 5E8DH 5C7XL 1JZJA 2R1XA 4N9GB 5F70A 1JYVA 1LHZA 3GZKA 3ZKSD 3B2PA 4H26B 1UATA 4LE8A 3ZN6A 1XCQA 3PAUA 1QHPA 4U1HA 1HCVA 1ORQB 5CIPA 4P46C 2AZUA 3MODH 4CJ1A 3CHXA 4P2CG 1RUQL 4ENEC 4BFGA 5D1QC 3VFPB 2ZG3A 3H9SE 2H3NA 2DIJA 4RMWA 5F8RC 4HJ0C 5K59F 1KCUL 3FRUA 3D39A 1TQBB 4KKAD 3VWKB 4K5OA 1DUZA 2IPKB 3C6LB 4LPVA 1TZHA 4YVUA 3TJPA 4P3DA 5FECA 4ZS7L 3OR6B 2I24N 2WJ5A 1LO3L 3D3VA 2XY1A 1R0AH 4ZFFA 2YXVA 3STZA 3ISRA 4XGZA 3KPSD 2Z8SA 2NQ3A 5CUSH 1SJXA 5CLYA 5FGCB 1U8LB 1W6LA 2IQAB 4I88A 3QAZB 2NNCA 1S7QA 3OZLA 5F9WB 4RGOL 4NP9A 5TDNB 4X42A 4Z7VB 3TNNA 4HCFA 1YZZA 4WTZA 1FZMA 4PJCA 4XWOD 5GS0L 2Y7MA 3C9NA 3NPSB 5F6HI 1MUJA 4YO0B 1EO8L 1T89C 4XO8A 4KXCA 2E4FA 3WENA 1WC7A 1XGPB 2ZUVA 1G6RB 1NAMA 2WVVA 2OV0A 4W68A 2APTA 4Y2LA 5AVQB 3EXLA 3DGGA 4BKLA 1KF9B 4GBXB 2XFXA 3EYOA 2VUOA 1MFEL 3RVVC 3NSFA 1GGBH 1UM4H 1CTNA 3PHQB 4DGYL 3UIYA 1K8DA 3RL2A 4ZO8A 4CW1A 4E5XG 1F4YH 2H6OA 4AJWA 5KOVC 4XTRC 4U6XB 3DUUA 1F90L 1NAKL 2ZWZA 4U1IB 4G6FD 1KDIA 2ZYRA 3SKUD 1X6NA 2C3VB 2Z92A 1A47A 4H1LA 4N0CD 3PAZA 4U1KB 4XN2A 4DN4H 1CFNB 1JK9B 1YMMA 2VXTH 3I6KB 2GKIA 4N2FA 3NK3A 4AJYV 2OR7A 1ONQA 2BNQD 3HI1A 4QHMB 3VXNB 4NNPH 1BM3H 2DD8H 2ZXQA 3VXUE 3EFOA 3GM0A 1S7XB 2XG5A 3GMMB 4MNGB 2RALA 4JUSA 3FCTA 3TIDB 3DUHA 5AYQA 5CHNA 3FNKA 3BKYH 4MJ4A 3ET9F 3GSXA 2XY2A 3Q8BA 4LP8A 3VXRA 4LCWA 3KVDD 3CDZB 2Z31C 1JP5A 2XVLA 2E9BA 1PKOA 2QQNL 3CVIH 4AV4A 2AXHA 1WYJA 4LMQI 2Y72A 5EEXA 2WB1A 4TRPL 3HS0A 4L5FL 5DHMC 2I85A 5D7JC 2EYRB 3OKMA 4KHTL 1ZK5A 4MJID 4FMKA 1RZJL 1U3HC 4X5PA 4Z7QE 3A4DA 1HSBB 4Z3HA 4PTTA 1H15A 1NLBL 3FT9A 2K0RA 3BRGC 2XKNA 4QCIA 1EZLA 3BUQA 1TQCC 4MBOA 4NWTL 1WRFA 1SY6H 2ATKB 1C12B 4G7VH 4IEFA 2OYKA 3VGAB 1HHJA 2XTLA 2ADJA 3OWRA 4GYBA 3VI3E 3L2MA 4XMLH 3S3PA 4EI5B 4Z3TA 1GW6A 1AD9B 5DRZB 4S10A 3C09C 3ZW3A 3WEMA 5AW1B 1HIML 1UXSB 4TULH 1SN5A 3FT2B 2VLKD 3ECBA 5EOQL 1HNGA 3S88L 1TJIL 3QXWA 5AW6B 4NGHH 5HYQA 3HVNA 5GS0D 3BT2L 3G6AA 1KJ3L 1F3DH 5DO8A 1CFTB 5C09B 4QTIL 4XHJC 3TN0A 4QI3A 5DFTA 4A7GF 4LSDA 4YXLL 2CLRB 3HW7A 4P59L 4JN2A 2J8UB 3QQNA 1QBLL 5I66B 4N0CC 4AMKL 4AK2A 4AKQA 4NO2B 4AQ8C 4L8DA 1FYTE 3QCUH 4P5MB 2A74A 2L04A 4NI6A 4OZHE 4CUCA 2B4CC 3BZFB 1BOGA 4KROB 3GI9H 5JZ7D 2QPSA 3WLWD 1FFPA 1T1XA 1JZFA 1S9VA 1B2YA 1E8YA 3D39D 3K81A 4FFYA 4FI7A 1KACB 3NYKA 4NKDB 3LPOA 1JHTA 3N85L 4QOKA 3BCFA 1NGWB 1G9MC 4O02A 4LIQL 1RK7A 2EKSA 2XZCL 3RI5K 4NSKB 5DUBB 2X28A 1KCRL 4GQQA 3L4CA 5IOPB 1TYEB 2J6EL 2LTQB 3PYCA 3U46A 1T5WA 4FJ6A 1MZYA 2LOEA 1E8XA 4I48B 2YK1H 5F96H 2AV7B 2WWKO 4DW2L 1N59A 1YECH 3I75B 3ZKXB 3B2XA 3OR7B 1YDPA 2AFNA 3FO1B 1NGYB 2J71A 2AI0H 5SV3A 3TPKA 1J1PH 1HINH 2BP0B 2XNAA 4X50A 1KJ2H 1FFOB 5F8QC 4O2CB 1T7YA 2AABH 1QKZL 5KVFE 1FGVL 1I7UB 1C7SA 4N0FA 2BSED 5BQDA 1HEHC 5EOTA 1YRKA 3VWKD 4HUVB 2EIDA 1ES0A 3L3GB 2J2ZA 3JT2A 4HMCA 1J7VR 2Y06L 4W1TA 4HS6B 5B8CA 4DFIA 3HVDA 2NTSP 4X6DA 5I6MA 3P4MB 3T0VA 2A38A 2VLRE 1ML0A 2N1TE 1NICA 2PYFA 3NCFB 1FPTH 4OF6A 2WIMA 5IW6B 1IM3D 4M03A 4F91B 5I1DB 1FZJA 4IIQC 3ABLB 2VZVA 1HZKA 4BK5A 1DQDH 3DURB 2BOLA 5GGVH 3GSQA 5F7AA 3ARQA 1FVCB 4M48L 3VXUD 4YS4A 3G08A 4M6MH 4XRCA 2DEXX 2V4LA 1Y6MR 4GSDL 1FL6A 3I6LD 2FLRT 2F7QA 3M1BA 5IV2B 5B3JF 3QUXA 1YEHH 1BQLL 4MDRA 5LXVA 2G3MA 3L9RB 1AH1A 4XNZC 3X1EA 1OWRM 1HYSD 4KAQL 1KBGH 2IADA 4Y5XC 1DJYA 1YC7A 3M8OL 3ZE2E 1KJMA 2NXZC 3B2VH 4G3YH 2XLLA 3BQUA 3DWTA 4UAHA 4MD5A 4WJKB 5ERWA 1FL3B 3MXWL 1WIUA 3F7VA 3WJLC 5F93C 3ZT7A 3RJOA 1BMWA 1NCDH 2WO3B 2N0MA 5IEKB 4LSPH 1DUYA 4HA1A 2DS4A 4NZJA 1E42A 1WAEA 2EUXA 1IC1A 3RUGF 3V4UH 3NFSL 3QZBA 3RVUD 3P0GB 3ZKNC 5D1ZA 3X11B 5B1CA 3RDTA 2J56A 3C08H 3L9RA 2JQZA 2Z31D 3H7BA 2A6JA 2LLLA 4DGYH 4JFVA 1NCJA 4XP5H 1KYOJ 1OCOB 4Z7QB 1WUNT 2YD3A 3F7YB 3QDGB 1KPRB 5L8JB 3X3GL 5KJRL 2D7MA 5C0EB 5GISH 1M05A 5KUMA 2X4QB 2WW8A 4I3RL 4Q6YA 5CWSB 1MFCH 3MFGB 1OAYL 2WVTA 4JZOB 4PJIA 4PJHA 4KKQA 1VB9A 3NRQA 4POZC 3K1DA 5IVZB 3FU7A 3ZK0A 4FNLL 2VAAB 2W0FA 2WANA 1CLCA 3LXAA 2BVYA 5HPMA 5EUKA 2R2HA 4QHUA 1DFBL 1E28A 5FO9A 3V6BR 3LNFA 1DHKA 4OCSH 1G9ML 5DEZA 4JZJC 2VDNL 2XV2A 3IJYA 3TO2B 5LBSH 1NM9A 1QZ1A 1NH6A 5DUMH 1LWRA 3VJ6A 4G7QB 5C9KA 3TM6A 2APSA 5AOJA 3UAAA 2E86A 1F45A 1BAFL 3JV6A 2LVCA 2EDWA 3DPBA 4QRSB 1Q1PA 2QSQA 4P23A 3K4ZA 3PIQA 2FJSA 4Z95H 3THMH 3L1GA 1XBDA 4QTHA 5ID1A 1E27B 4ZQTA 4GS7B 4X5QA 3FQUA 5DVKA 3CCHB 2Q7AA 3HE7D 1OAXH 4Y5XB 3SQRA 2NXZD 3B6SB 4I87A 4MZIA 2JLPA 3T2LA 4GQRA 1ORQA 1J8SA 1PLAA 4CGTA 2C3HA 4FE9A 3DYOA 3OHXA 4JFZL 4XN9A 5DZAA 5D71L 4NLAA 5B22A 4UQCA 3TWCH 2ITDA 4P2QA 5BJTA 4LBEA 2AC0A 5TDNA 3K5SA 4GQ9L 4PJEB 3DXAA 1JHLL 1FRGH 1T3FB 2VMDA 2WJ7A 1NLDH 3QZPA 4WO4B 1NUFA 3QRGL 3VXTB 4XMUA 1GZQB 5IMKA 3LRSB 4DZBA 2QHLA 1RD6A 1T0OA 2GY5A 4ICXA 1YN7A 2R29L 3TN0B 4ZMYA 1DVUA 2D03L 4PGJA 3HZMA 5CFAA 4L8SA 3IGLA 4PW3A 3CFJB 5KBMA 4W9EC 1M6UA 2Q10A 3KYOB 2NR6C 4AY0A 3NZUA 3TP4A 1KTRL 3H7BB 4KOCA 3SKJL 3RY5A 1T0NB 4A38A 4AMWA 4OIAA 1EAPA 3D48R 3UTQB 1KN4L 3KYKL 3O6FB 3MRCB 5FYKU 4QWWC 3RGVB 2J8UA 1Y6KR 2GIXA 4QRUB 5A2AA 2D7OA 4NZUH 2V2TA 1FBIH 1NIAA 1QRNE 1E4JA 3QCVL 2VLMD 1K9TA 1FLRH 3WCYA 1FF5A 3QCUL 4BGLA 2A77H 1BD2A 4WZ9A 3DXAB 3BSHA 4L3CB 4LU5L 1S7TB 1NL0H 1O9ZA 2LQRA 3QIUB 5HDBB 1OE3A 4PCTA 1F18A 3ATEA 1FJ1A 4FTVA 1SJVA 2VDLH 3H6JA 4P2RE 3UBXA 3LYRA 2O4EA 4KXZH 4UZGA 1DLFL 3V0HA 1AZCA 5KVDL 1QFPA 1U93B 2G2RB 4DKAA 4ZMNA 2F19L 1FSKC 1E7VA 3GSVB 4U49A 1D6VH 1U8NA 1WHOA 2AP2A 1OTTD 5JHBA 2AERT 4JPVL 4P3DB 5FECB 5EF1A 4S0SD 4OLUH 2HA1A 4X7EC 3CV5A 3PWNB 3DPBB 4P5SA 4QRSA 3S5LG 5IQMA 4P3CH 3D3VE 1C8PA 1AS8A 1BZDA 4WEMB 2GSMB 3QC6X 3OKEB 1OF2A 5TE7H 4R6UA 6CGTA 3O2DA 1NBVL 4YHLH 4GLRH 4HPOH 4NN7C 3SKOB 4HLZH 4KRLB 1CE1H 2H1PH 4B3EA 5DMJB 3EFFB 4RGNC 1VA9A 3WMQA 1A4AA 4BK4A 3WLWC 4D3CH 3MZTA 1ZDQA 1U3HB 2IXQB 1QA9B 1QLEH 3LKNB 4ICWA 2FHBA 1K2DA 4WWID 4GSRA 4ODTH 5DHVA 1JZHA 1DJHA 3DRTA 2E47A 3UO1H 3I9GL 5JDJA 4OCRL 5F0JB 4CSTA 3B7YA 3BUBA 4BFBD 1BZ7A 3IU3B 4GSUA 2NOYA 4P46A 1HE8A 4WGVB 5GHWL 1HILA 5DD5H 2VR4A 4YL4A 4Q9RL 2K7QA 4RH4A 1PJ9A 2H26B 4H44C 4NWTH 5HI4C 2YWZA 5JPNC 3BZEA 3WY3A 1HZLA 3O6MH 4R97C 1OCZB 1R5VB 3NACL 2FD6L 4TLUA 4AGMA 4DQAA 5KUKA 3Q2CA 1FL6B 5DTFA 1FGVH 2VZUA 4U1IA 2Z7ZA 1KMGA 2VW4A 3ARDA 4APXB 1H3UA 2OSWA 3T4YA 4K94L 2CLZA 1PKQB 3F8UB 3KLLA 5KVEL 1KJ3H 4MXWH 2F8OA 4R90H 1AQ8A 1DQJA 3BQVA 3QJRB 3CH1A 1BGXL 2HKHH 4HD9A 2EC8A 3ETTA 2H32H 1NCHA 3Q0HA 1JWMB 1XSKA 5DJXB 3QPXL 1J8KA 3MSPA 4PWFA 1MN4A 5E8OB 5AG8A 2PUQT 4BCXA 3ZDXB 4OLVH 5DJAA 3QDGD 3PGCA 4JM2F 3GSRA 3BPLB 2D0FA 4V33A 4GRLC 1PZSA 2FTAA 2ZX7A 4MQ7A 3WXVL 3H7LA 3E3QC 1WLHA 2IGLA 3C8DA 3R1GL 1V3MA 3VA2C 4FQXA 2QVFB 3D4YA 5I73C 1DEEA 5TDOA 4KJPD 4H1LH 3W5MA 2DL2A 2R7EB 1NCAH 3EF4A 4IK6A 2LV4A 2YAPA 2FT8A 5DZVA 1SYVB 4WO4D 3T0XA 4EUPB 3UPRB 1NGYA 2ZWKA 2YUZA 1BVKA 3U4EA 3TEXA 4PIRF 4HXAL 4MX7B 4PJ5E 1XB3A 1QEXA 4LLWB 4LEXH 4PH8A 1DJSA 3FU9A 1MAKA 5AVWB 1PEWA 4C4BA 4ZUTA 1FC2D 4W4OA 3L4WA 3QUGA 4PJXB 1OSZB 4R97B 3Q8EA 1KEMH 3L2LA 3VXPA 4GOSA 4WKZA 4NHUA