1EAOA

The runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title The Runx1 Runt Domain at 1.25A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eaoA00
2BIMA 2J6WA 4QO1B 4AGNA 2BINA 3TS8A 4XR8C 3IGLA 2AHIA 3ZMEA 2BIPA 3D06A 4AGOA 3WTVA 3US1A 1UOLA 2IOOA 4MZRA 2X0WA 2X0UA 4IJTA 3D08A 4GUOA 2J1XA 1GZHC 3D0AA 3D09A 3US0A 2VUKA 1HJBC 2PCXA 1TSRA 4IBQA 2WGXA 3KZ8A 3KMDA 3WTXA 4IBSA 2BIQA 2MEJB 1EANA 4AGPA 1TUPA 2H1LM 4AGLA 4IBUA 1E50A 5AOLA 4G83A 3Q06A 3EXJA 4MZIA 3WTTA 3Q01A 2BIOA 3WTWA 4A63A 5LGYA 1GZHA 2P52A 2ADYA 4IBVA 4HJEA 3WTUA 5AOIA 2RMNA 2AC0A 4G82A 2OCJA 5ECGA 2YBGA 3WTYA 3Q05A 4IBYA 2FEJA 2GEQA 2J1WA 3QYNA 2IOIA 5AOMA 1CO1A 5BUAA 4L0ZA 4LOEA 5LAPA 2J1ZA 2ATAA 4IBTA 3IGKA 1CMOA 4L0YA 4LOFA 5KBDA 4GUQA 2X0VA 5AOJA 1T4WA 3QYMA 2J1YA 1H9DA 1IO4C 5AOKA 2IOMA 4AGQA 2J21A 1HU8A 3VD2A 3VD0A 3WU1A 5ABAA 1EAOA 4KVPA 3EXLA 4IBWA 3D05A 3D07A 5G4MA 1HJCA 5AB9A 5G4OA 5A7BA 1LJMA 2XWRA 3WTSA 5G4NA 2J20A 4L18A 4LO9A 4IBZA 3VD1A 1YCSA 4AGMA 2XWCA 1KZYA 1EAQA
chains in the Genus database with same CATH superfamily
1KENH 2MPAL 3C5SB 1ROCA 1CL7H 3QEUB 2YD4A 3DV6B 4IRSB 3TA3A 1KPRB 4PJCE 5EOCL 1DP0A 4PREB 3S36H 5GHWL 4KDWA 5DD1H 2WMPB 3P9LA 4MJ6B 5MERB 1YNKL 3JVGC 2WSPA 3KWUA 2NZ9C 4F5CE 1MJUL 1M2OA 2ZUQB 3SE4C 3NRQA 2XTJC 4M7JH 3GUTB 3UOAB 5IIEA 3QIUB 4LLVB 4IOFD 4CVZA 5I0XA 1K5NA 1MJ8L 1P84J 3FAXA 4PRNB 4P5TC 3QUKA 2NYKA 5JHDB 4L4TE 5ECJE 1WAEA 4UNUA 2JKTM 3BGMB 4RGNB 5T3XE 4A1RA 4DK5A 3NSFA 2B77A 3A5VA 4HXBL 4APXA 1UGNA 5IMMA 2ZKMX 3EG9B 4UV7L 1ZT7A 3ZJAA 3QQ4A 1WC7A 1MNUL 2XJLA 4FQ2L 4FQIH 3AS2A 3UTPE 2HT2C 1F41A 1MHPH 2UVFA 3DX1A 4WKZB 1R3HB 2G3ZA 1A7RH 2K6YA 4X80L 4Z7WE 4RA0C 1FH2A 4EEEA 1LE9B 1BZ7B 4UQ9A 4ZX4A 2NLJB 1YC7A 3Q2VA 1V54B 2ZUTA 3WEMA 2OI9B 3NVQA 1AQ8A 3ZTDC 2QVMA 2V5YA 3CFNA 4LNRA 4FYRA 2BHYA 5GGRY 4JM4H 2DWDB 5GGRA 4HK3J 4YR6A 5KYNA 3DTXA 2FR4B 3RFZB 2NY4B 4JHAL 1IGIL 4F27A 2DQGL 3CZFA 4H13C 5EIIB 4IOSD 3FT0A 2X4PB 1U3HA 3IDGA 4BH7A 3DMMB 4JDVB 5E0QA 1RZIB 3D4CA 5E5LA 3TJHC 1NCAH 4JFOB 1JYNA 2TSAA 1BG1A 2HRPH 1NUFA 3JVGA 1QACA 5KSAA 4YHLL 1JPST 3FTGB 2DJUA 5IB4A 2DQJH 3F3HA 3QDGD 4BSWB 3VRJB 3ISRA 1NWPA 3A6CH 3QA3A 5F7EL 5AOJA 3EGDB 3GS4A 1ZPLA 1CVRA 5KVDH 2FSEA 4L8CA 1INDL 4P5TA 1JV5A 4Z7UE 5E5MA 5IBLD 4BCXA 5E24E 4K8RD 1T1WB 1YY9D 1B0GB 2D8KA 1HE7A 1AR1B 3AB0B 1F2QA 2X4NA 5FIEA 3ZHNA 4NPKA 3BRFA 3QQ3B 4UM8B 5IROC 3OF6A 2NZIA 2R56H 3SKMB 2KKQA 2VR5A 1KWGA 2Q7AA 4YFLI 4UM9A 3KJ6L 3MUY1 4RQQB 3HHMA 4F24A 5EUKA 1F4XH 2NNXA 4CNIB 1TCRB 1NGXB 1IEBA 3O3EB 4QRRD 1KBVA 5L8JB 3FL7A 4P05A 4MMZC 3ZLQC 3TLRA 5E2UH 1RZPA 3RNQA 3S4SB 2X40A 3KDMB 3RTQB 4QKXB 4LKCB 3M17B 4P3CL 2C34A 3H7BA 2LT9A 3AREA 4JM2F 4EI5D 2AXFA 1UA3A 3KPRB 5DZ9A 4HC1A 4E9RA 1U95A 4RX4D 5JHAA 5T1JA 3WELA 3DTUB 2VDLB 1JERA 4WSKA 3CFKA 4NUPA 2P8PA 5EIQA 2PW1A 3O6KH 2MTPA 3I50L 4OZIF 5EBMB 3ULSA 3NJKA 2C1OA 5D7IF 3THML 2DLTA 5E7FA 4NZUH 4F80A 5BJTB 3VG9B 1CG9A 4I85A 1LYQA 4AEHL 1MI5B 2EDJA 1GGCL 3UTTA 4EQ2A 3VAEA 1WF5A 3LNIA 3KXFB 1OT2A 3FB8A 1TTRA 5MEQA 1UHVA 4Z3JA 1UG9A 2IFFH 1LP9A 4FTVB 1HWWA 2GJZB 5CKGA 1CD8A 2JLPA 1UC6A 4B9JA 1W6WA 1JD7A 4PJ8B 5MI0C 2YRLA 1B90A 1ZHNA 1D9KD 1JF1B 1N68A 1QA9A 4K3HA 5ID0A 3LSOA 2P52A 3WKMH 2VABA 3MRKA 4KMTH 3DUUB 1G84A 1UWEL 5ENWA 1FO0B 3ZE0F 4YEEA 3GHBH 3RIFK 4HWZA 1I85A 4PAZA 4FAAB 3B5HA 4OZFH 1R1CA 1EZSA 2R59A 4XMTA 1BA9A 2BZCA 3GTNA 1T03H 1OP5H 2A4EA 3BFWA 2IGTA 3G6AA 4M6AA 4MMZA 1ACXA 4N4YB 3VTTA 3RHWK 2CCVA 2JXMB 2CA3A 4NKDA 4JN2A 2G5BB 1FAIL 3ENEA 2LU5A 5DD0H 4ZFGH 5I6LA 5KVDE 3SKJL 3FZUC 1QW8A 4I3GA 5I1LA 1U6AL 3FT4A 5C0RH 1W9XA 4HULB 4I0PC 4MHHG 3ZE2E 4X6CF 1T7YA 3QG7H 4TSAH 4B7LA 3U36B 2DQUL 5KBPA 2GFBA 4UQCA 3ZU8A 1AR2A 2DWEB 3CFEB 4TTDD 4JGMA 2F74B 5JORA 2QMKA 4ELDA 5IMOB 1MJ7H 3F58H 4IIQB 5E2TH 1HXYB 4LARL 2HG5B 3S37H 3VCLB 5HYQB 1JGDA 5GSRB 4MX7A 3AY2A 3OKKA 2QQNL 4TNWF 4N5UA 1JUFA 2VZSA 3W5MA 3RNKB 2NRDA 1DJSA 3S5YA 4B9CA 3OLEA 2CGZA 4HBCL 5DO2C 3Q8BA 4NI3A 3DYMA 1HAUA 4NQTA 1EAQA 3FCUB 4EIBA 2ORBH 2G75B 5F7NC 5HGBA 2J6WA 1GVIA 4B5EA 1ERNA 1TZ8A 1URIA 4JPIA 2IDQA 1MH5A 1VGKB 4XNYL 4M00A 3FCSA 3QQXA 4KI5E 3UAEA 2RH0A 1PZ3A 2FIKA 4MA1C 1SMOA 4ANVA 4Z7QE 1HQ4B 3B6SB 5JZ7C 2B9AA 5I8CA 3CLEL 1AO7B 1GZHC 1L7IL 3BE1L 3FQ4A 5T3ZD 1VACA 2QELA 1GIGH 4DKTA 1M9SA 1YEFH 3H3BC 4LSTL 3AUVA 2APFA 5CINH 2OJEB 3ECBB 4TULH 4K23L 3T2NL 5ESAA 1KJVB 1WWAX 2VLLA 4OCWH 1WIPA 2VXQH 4OZIB 4O02L 1KC5H 1WWWX 4MWFB 4O2FB 4Y8DC 4EIZC 5ICXA 2I69A 3IFOA 5D7IB 2VYRE 1CLOH 1A3QA 2ZCZA 4WJKB 3UIZA 5F7DB 3OXSB 4M1DH 1JN6A 4ESKA 3F5WB 3NGBC 5C2BH 4F7PB 1ZTXL 4G3YL 3FCTB 3Q06A 2EIZA 1E2VA 4MAUH 3VXUE 1SFHA 5J1SC 5HSFA 2QZQA 3T2LA 4JDZB 2X41A 2IAAC 4KKZA 4BD4A 4IBVA 4FN0A 4MVBC 1QO3A 1JGIA 3T2PA 2NY3B 3ARRA 4Q9QL 2BVUA 1XAUA 4JFQB 3EBHA 3A67L 2VC2L 2Y06L 5IOPA 5JMOC 2HFGH 1XHHA 4WKXA 3ZE0B 1CFNB 5C0IA 1AANA 3H9SB 5SWSD 2CD0A 3NZUA 3QO1A 3PL6D 4U1JB 5CXPA 2QBWA 1E5YA 2WLYA 4F2ME 4C54A 3U6XS 1E27B 2E7BA 3GPEA 2Q5BA 3EJQA 5T5FH 3VI4F 1NC4D 4L0YA 1KBWA 4OTXL 3CN4A 4H1LB 3CNKA 4QIRA 4TLUA 2FECI 3LB6D 4HPOL 4R7LA 1O75A 1W0WA 1QI4A 1SXSA 3ARBA 4AEIH 5INDB 4KVNL 4LCWB 4FL4B 2IAMC 1MCLA 4X6CB 1QZNA 3S5LA 4M6MH 3B34A 2DWXA 4PR5A 4OCNC 2VMEA 4OD2A 3BZ4A 3C87A 4ZTEA 3VI3F 3OKEB 1KN2L 1T5XB 4HKBB 4A2DA 4WO0A 2JJVA 1O9VA 1QD0A 2XV2A 1TETL 3K1KC 4NSKB 3ME0A 4PSPA 2X05A 5LDUA 4R5TA 3UAAA 4NQCA 4DP1X 5KZCB 1H6FA 2Y5TB 5FUCE 4YWGL 2ZAHA 3FQTA 1QRKA 2CA4A 3UBXA 1MELA 2AJYL 3PCYA 4YC2C 3TV8A 3PU7A 3VRLF 3CSFA 1AS7A 1IGYA 2W65A 2CIIA 3N1FC 4G6AD 4DN4L 3BQVA 5LXGH 2XNAA 2RFXA 1MLCA 1KT2B 4ILDA 2NNAB 3CCHB 3WBDA 1NM9A 2QHRH 5DRNA 1PG7L 3EYVB 1FA4A 1N26A 1GKEA 1SYSA 1NAKL 2DW5A 5FCUH 3V6OE 2GI0A 4AG4H 4WUKH 3F7YB 1W8NA 4QRQB 4D3CL 2EKSB 2R1XA 3BAJA 5PAZA 5TPWL 4DW2L 2QVIA 2H6PA 3QEHB 1OF0A 3TVMD 2XWEA 1MKFA 4FI8A 1LM8V 1Z5LA 3MRIA 4JHUA 4H0LC 3PAVA 3BPCA 3R06A 4L1BA 4E9YA 1JYWA 3MODL 3T6VA 4MZ3A 1WD8A 1AP2B 3SBWC 4BE6A 4X9YA 3JZ7A 2Q76A 4OIFA 3HIZA 1GC1C 3SDXE 4KUZL 3VD4A 4CBPA 3HRZC 1MCQA 2IQ9L 5CBAB 2HLAB 3LPWA 3RI5K 4YDMA 4HWUA 2VDRB 3CDGB 3RWFB 2RGSA 2XC8A 1BHGA 5EBLB 2WZAA 3FTXA 1JPFA 1JK8A 2WLLA 3PWUA 2XN9A 4JO4L 4F7EB 3ET9F 3QJHB 4Z7AA 4A55A 5L7XH 4WWNA 5FO9A 3UXFA 3VFTA 2DWSA 4XMLH 1CTMA 5C0ND 2PPEA 3UCQA 4X42A 5AKRA 4YSCA 3PABA 1S78C 3EO9H 4ZMTA 3UBGA 5JHLL 3BSZL 5K33A 4NO5B 3S97C 1X5AA 1DJHA 1WH0A 5IVNA 1JPGB 4YVNA 1X4ZA 4YZFE 5AB0A 2V17L 2XQYA 3PP3K 4LHUG 4NN6B 5ANMB 1IBYA 4JKNA 4XOBA 5KVGL 2PCPB 4A7GF 4UTBA 1I7TB 4XP1L 5C0CD 2A1WH 2V2WA 1RUKH 1ZJBA 2A9ML 3DECA 3VI4B 2LLLA 1BP3B 4CDHA 5D7LA 3NJLA 4RFEB 3NDYE 4JPVH 4MMYB 5KUMA 3VD0A 5GGVY 1OCWH 3E3QE 3QUMB 1J7VR 4OZGA 2RTTA 1B3JA 1BW8A 1MUJA 3UEZA 3MV7E 4YFLF 2BP0B 2W80C 4S10A 4WO4D 5E1HB 1J5HA 4PTTB 5CIPB 2X4SB 5BRZD 3KVQA 5MP6L 1RLBA 2XPGA 5IB2A 1CTNA 3L4TA 5LNEA 5CN3A 5KN5A 4EN3D 4I5BB 3VI3B 2ZCLH 2E5EA 1EHLL 4AYDC 1GMIA 5T1KA 4Q56A 1BBDL 2GTZA 4QRRB 4QNPE 5CZXC 4QRPE 5D4IA 3MV9A 2LU3A 2EE6A 4XN4A 3M7OA 1G0DA 1WHOA 4RAUA 1ZLEA 2Q9OA 1CLZH 1J87A 1YECH 2UZXB 1OSPL 4KK6C 5G5DA 5KSBE 1D5ZB 1KEMH 1NPUA 3ETTA 3HNSL 4I2XA 3DJTA 3SE8L 1Z2KA 3HR5A 1X3DA 4G8IA 5E8OA 4V33A 2FCBA 5FYKL 3QAZB 3T0WA 3UJJH 1J8HB 1CURA 5FYJL 3H53A 5KTEH 3CN0A 2CBMA 5ESQB 5E0FA 2MNUA 3VTMA 1AGFB 3C8KB 2FSDA 2OMXA 2O6DA 4N2EA 1MAMH 1NL0L 2KPWA 4KKAC 4UQDA 2UXTA 3MGOA 3T8XB 4PRHA 3WG7B 3BAEL 3NJXA 2Y07L 2Q86A 1M2VA 3KZ8A 4RZCA 2P5ED 2PR4H 4X7TA 2BLFA 3JV6A 3U0TB 2WXNA 4AQ1B 2QPSA 3MREA 4KRMB 4G83A 3ZTJH 4Q4IA 3L3KB 3ZE1F 1BQRA 4OI7A 2BW5A 1PY0A 3BEVA 3GSOB 4M6NH 2VR3A 1TZAA 4ABVA 4PLKD 1W72A 1EZUA 1S9YB 4ZTPL 5HYJD 5TE4H 4RSVA 2NY6B 3V0DA 1D7DA 4FXGA 3S3CB 2DQCH 3HUJA 1XR9B 4DPBX 4MAYB 2P48B 4DH2A 1MQ8A 3ZTEA 43CAA 3PY9A 5FECB 1IAIL 5JIMA 3CVDA 5DFVD 2M1KA 1QSFD 1NCDL 3VFWB 3NSCA 2Q0ZX 1LWJA 3L9EA 8FABA 2IVFC 1JNNH 4Y19E 5I15L 4LSVL 1JVLA 4WUUE 1UM4L 3WFBL 5DHMC 1Y0LB 2NDFA 3MRLA 3V7MA 3VFVA 3LXAA 4BDVB 1E67A 4N2GA 4ODHL 3WL9B 3QZWA 4IOFC 2UZPA 4YDJA 3NPSC 3F2LA 4OVVA 5LGJA 3BPLB 4M7LL 1YYLL 5HYSB 1R34A 4L3ED 5BQ7B 4L8BA 4EI6B 3IDXL 1WFUA 4HETA 4M29A 1GZQB 2JJSC 1DJGA 2PXYB 5IEHB 2VDLL 5I71C 2D7MA 3RZCD 3CXDL 5SX4H 3QDJE 1PLCA 1KB3A 4P06A 5FF6B 4JR9H 3W0WE 2J8HA 3BAXA 5AW5B 3ESMA 3VG0L 5D4JA 3S96B 1XF2A 3LXUX 5BW7A 3T8MA 2Y22A 4NHUB 4YHNB 3HZYB 5T1LB 3FPYA 5DK0A 2YIHA 3L9RB 1ID5I 1AC0A 4RISL 4OH2A 3RWCB 4JGNA 4PRID 3N85H 1UM5L 5JQ6L 4YFEA 3QJFA 2ZICA 3P0YH 4JFDD 4HK0A 1PLGL 3GS0A 1DN2A 2R4RH 4F7CA 3OAUL 3FSOA 2WCSA 4TNFA 3O4LE 1OZUA 4XOCA 4ANXA 4JRXA 4DTGL 4MJID 3WEBA 2PLTA 1FJ1B 4WWID 1OZTG 1HXKA 1T04B 3NIGE 3PWNB 1BLNB 4OQTL 1FGNH 1FO0L 1VGEH 4PYGA 2JIXA 4A7VA 3TIDB 4N1CA 1KFAH 3IPBA 3ARQA 4XVSH 5DVOA 5CD5D 4OKDA 1ONQB 4XAKE 4KJYB 3ARSA 5GRYA 3RPKA 3DSFH 4M9OA 4V2BA 4J8RB 2LTQB 5T5NF 2ODIA 2F54A 4EBQL 3PDOA 1S7WA 4EIGB 5JIQA 1SN0A 4Y4HB 5IBLC 1QEXA 4GAYB 5D1XC 3CFBB 1AS6A 1YY9C 1XGTA 1MFVA 1NGPH 1UEYA 2QFPA 3M1OA 4QAWA 5D7KE 5LGYA 1TJXA 2IEPA 2NY1D 2F19L 1BM3H 3ZE1B 3KL3A 3ARFD 4JZOB 3V0VB 5IW1A 1TQVA 4NNXB 4NHCH 4M7ZB 3HVDA 3OR6B 2DJSA 4UIMB 2EC9U 2AF2A 3H3KA 1TEGA 3PHOB 1W16A 4UU9A 3FRPA 1EJ8A 5ELIA 1QW9A 3IFNL 2R23B 5LB1A 1QFWL 5I6NA 5EMYA 1X5IA 1HDMA 1V05A 3PL6B 3B9KD 1A3RH 4MMXB 1F4AA 3U1SH 4EI5C 2OZ4A 1AXTH 2QSCH 4HUVA 2GSGA 2OSWA 4PV8A 1MPAH 3WXVH 2X4OB 2CGRL 4L8SC 4RGMB 5JIDA 4PGBA 2BSTB 1YY8A 1UB5B 2ENYA 3KPLB 1BVKA 4S1RL 1NCOA 3QJVB 5F7YC 1KTBA 5A6MA 4OT1L 1PCSA 1IILE 1I3GL 5A2JH 4PG2A 1DVQA 4KHTH 4WU7A 3NAAH 2CCWA 2GABA 3CX5J 5B1KA 2OW6A 2M26A 5DXWA 3ZTCC 1BF2A 1J05A 1Q9LB 2DM4A 4OFPA 3KLAB 3QJOA 5AKVA 3GB7B 3OBAA 4YHMH 4Z3IA 4UTAA 2JTDA 5J11B 2WKLA 5B1JA 4Q52A 4JKLA 3FH5A 4I88A 1WYJA 1KZYA 4X6DF 4XPTH 5D1XA 1EAPB 3FQXB 3OSVA 3VXSD 1NIAA 1QVOA 1UVQA 2E4FA 2EH8L 3I74A 3ZL1A 4M7KL 1D9KC 1PSKL 4WTZA 1H0DB 2JH2A 3I3EA 4PBWD 4OU3A 3ZW3A 4PRAB 1WP6A 2C9PA 5TF1L 2BK8A 4NJAH 1MCSA 4PB9L 4GT0A 4XXCC 1QFUH 1R33A 2H8PB 2IANB 2X6AA 2KZBA 2IADA 3T2OA 1JWUB 2JB5H 5K9OB 3C5ZA 4TYUA 3BUQA 1Q94A 4GB9A 3LDBB 4FLRA 1CD9B 4TVPL 1RSYA 2NX5E 3CDFA 3ARVA 3MRDB 4LGPB 4J3BA 5F7FA 1YN6A 3CIAA 5J57B 4WFHE 3TVMB 1ULVA 4CSZA 2AMUA 1KTDA 1MIEH 1O0VA 5C0JA 1YEJH 4NO2B 1YMME 3AROA 1O7SA 5LJYH 2XVKA 4GINA 5EBGA 4J6RH 1MRFL 3O11A 4HVBA 3RIAF 5FKAB 1G4RA 3H9HA 2O6EA 3C6SB 5I30H 4UILH 3PE9A 1U8QB 3GTVA 3OKYA 3HZ3A 4R90H 3VFGL 3MJ9A 4M5YL 4MJ4A 5JHDE 2FH8A 1WBXA 2HFFA 3D4ZA 1GYWA 4RGNE 5E2WL 3DVNA 1GW6A 1OKEA 3IJHA 5EU5A 5BO1H 4OBRA 1TQBC 3BW9A 3KYKH 2OZNA 4N8VB 4BFGA 5C8JA 1PF3A 4HKZB 2QLVB 3FU8A 3WO3B 4NUGH 3ROOB 3TTSA 4A04A 2Z4TA 3S88L 5KJRL 1SM3L 3BPNB 2PTTA 5DT1H 4L0PB 5HGAA 1AY1H 3NK4A 3SJVE 1HHIA 3EOBA 3QWQB 3ZR6A 5JPNA 1XCQA 5IEKA 5EEYA 2VW7A 1YEHH 4BGLA 3VFPA 4U1SA 5KJ4A 3TZVD 1YDPB 2Z7WA 3AWGA 1HILB 2BPBA 2QADD 4YHKL 5GGSY 5C0CB 4ZZKA 4PRPB 5GGSA 4LCYA 1U92A 3TFBA 1WJ3A 2FHBA 1WZ1L 3PV6A 4N0FA 4HX1B 5HPMA 4ZZFA 5B38G 2RCSL 2WVUA 3OLGA 1B88A 1OAQL 1LD9B 2NTFA 3LV3B 3OKNB 2AXWA 1G7IB 2OJZL 2X7LB 3IDYB 4D7PA 5IB1B 2WQUA 3CZUB 2NNCA 3O6ML 4UTBH 1ZHKB 3TM6A 3HG1E 3SBRA 3P0VL 2AERT 5E4OA 1XH2A 4N90D 4AMKL 4Q74A 4CSPA 5C86A 4LSSL 4X6DB 4PJHB 1AGBA 1Q0YL 4UBDC 5EN2A 1CFQA 1XGUA 4GP8B 4TQEL 5GGVH 4X99A 4HZ1A 5AWNH 3GC3A 5LBVA 1LO2H 3NSJA 1E4WH 1F6LL 2GBAA 1AFVL 5IB5B 3D0AA 2AEQL 3O81A 4C47A 3RWJA 1OGAA 4D8OA 3FO2B 4Z0XA 4L8DB 2V2XA 4E68A 2OJ1A 1NSNH 4BSVA 1JV2A 2P9RA 4WNQA 1IM3D 2N01B 4WU5B 3VMOA 2DL2A 1FGVH 4LL1A 2WXIA 3WIIL 1ZJAA 2GUYA 4NQSB 4NN7C 4DP2X 1MFUA 4ZQKA 2ZWKA 4BUGA 1E7VA 1KN4H 1LVEA 1WZAA 2J2ZB 2L0DA 4G5AA 4O5LL 4TPRH 2X1XR 2XJKA 3VH8A 5I8OL 1BFVL 5K5YA 3LZPA 5FO8B 1AZZC 3UBXI 1XSKA 1HZLA 4XPGH 2NSQA 3LB6C 3LS5H 4LVHC 1A14L 3B4NA 1ZHBB 3GXIA 4FHBD 4KNSA 1U0QA 3BH9A 3BAKA 2E8ZA 4FFWC 3NJGA 3DGDA 3KGRA 3GMNA 1DBJH 1EUTA 5ACMA 1CTOA 4JY6B 2EEBA 4AYEC 4BSJA 1L9NA 3HC0A 3UC0L 5HYJB 3K81A 4IGBA 3QUML 5DJZB 3ZRSA 4IRJD 2H6OA 4WFFE 4OCRH 2ZX5A 3GTTA 1VSCA 1VPOH 4JG0H 4XP5L 5SV3A 4URKA 1KBGH 1U8CB 1LO4H 4LVOB 2CUHA 2XN9E 1UUNA 1YEIH 5EU6A 5PCYA 2CXGA 1D5BB 3CU7A 1AQDB 3GMQA 4WWOA 5EWIH 3UG3A 3AG4B 1KCSH 1CK0L 3RVWC 2Z35A 1NCWL 3U30C 4G6AC 1W72H 3AW5A 2BP5M 2YD8A 5IFHH 5IVXA 4N3TA 4WIQA 5I0ZA 5KVMC 4IOIB 3KCPA 2VN7A 4ELMA 3TGXA 1PD6A 4M3KB 2BY3A 4N25A 1I3RA 4P2OB 5E8DH 4FNSA 2K45A 1ZVNA 1OP5K 1HS6A 3BN3B 4WAFA 1W2KT 3HMXL 4L3EB 3CPLA 4R2GD 4YDKL 2NXZD 3GIVB 5T1MB 3HJ0A 1T80A 3GSRB 3QHFH 4L18A 3ARYA 6FABH 7PAZA 4N0YL 3RZCB 4TLTA 2XZQH 3CFDB 1NMAH 5I76B 3FUEA 5TK4A 2VT0A 1DFBH 2G4GA 4XE5B 3VVWA 5TTRA 1U8KA 2FB4L 4HUKB 3EGXB 4XCNA 2GY5A 1A1OB 3C09C 3RAJL 1ZCRA 1PY9A 4PCSA 2P8MB 5DRZB 1ZA6B 3VE0A 1N70A 3F65A 5K9QG 3FFCE 35C8H 4BRVA 3FHAA 5D4QA 4CU8A 5A16A 4P5MA 3Q1SL 3VSUA 4JFDB 2OSXA 1OV8A 4UNIA 3L7EA 4LP8A 4FQCH 1RUPL 2B1HL 1IM9D 3QORA 1FZMA 1SUHA 4PS3A 3ZTNH 2DQIH 5C0NC 4XN2A 5L88H 2VJ0A 2YRZA 5KYXB 1Q9WA 3GD1C 4ODUB 4MJIB 1TJHL 1ZVSA 5FHBH 4ZUTB 1DQTA 4GKZA 4LNVA 1FNEB 1JYXA 4MJ2A 2OK0H 2EXTA 3TBSA 4MB3A 5IKCB 4KDVA 3ALXA 3P3RA 1RJYB 3LKOB 1CLYH 3HE7B 4NN5B 1MCFA 2C9QA 3MV8D 4HG4J 1LK2B 2WXRA 2YEQA 2Z34A 4MXQC 4P5KA 4Z5RB 1DDTA 5C7XH 5CD3B 1G87A 2XY2A 2YPLD 1E6OH 2WN3A 2ZUYA 5DJXA 5KVEL 1CYXA 1FN4A 3EUUA 5F96H 1N10A 3S35H 1EQWA 3EO0A 1MCOH 1D2PA 3P9LB 4F93B 5LG1A 1T7VA 1MWAA 3OJ2C 1D2OA 3HN3A 4PRHE 4JHBA 3SHSA 4DO4A 4IDJH 1G9MC 2KT6A 3V4PL 1I4FA 2G2PA 2I9LA 5IIEB 1ED3A 4CVZB 3L1GA 4Y1AD 2NY1B 1K5NB 4WO4C 1KCWA 5L4MA 3MKKA 2D7PA 2QT6A 2WLNA 1MCWM 2UX7A 2BSEA 2DQHL 4UF7C 1PG7W 5TK2A 4EN3C 1OAKL 4APXB 2Z91A 1F6FB 2PO6A 3K2UL 3MU3A 5IMMB 2UWEA 3ATFA 1ZT7B 4FLSA 4P2QE 3QQ4B 4DQAA 1WC7B 3FRUA 3NZHL 4FXKC 2OMUA 5DI8B 3SDAA 25C8L 1DL7L 5HHQB 3LOWA 1LP9F 4OGXL 1TCMA 1N67A 1S3KH 1THCA 2B59A 3FQRA 1QR1A 3OG4B 1UA6L 1NFKA 1OD7A 1P0SE 1IBZA 1S2EA 5FDWB 1MY5A 3Q44A 4MDIA 2DLFL 4Z7OF 3IXAA 5HJ3A 1IAIM 2MKWA 1Z3GL 2BSSA 3CLFH 2CALA 3LRHA 1SXAA 3WEAA 2XX0A 4YR6B 2VNCA 3DTXB 3ZE0E 5DD1L 5L8LB 3U6RB 3HS9A 1OP4A 3BZEA 1E0OB 4KPHH 4NQEA 3OKMA 5FGSA 3D4YA 2P8LB 4BKSC 4CADB 4ERSH 3QCVH 4BH7B 5ABZA 2VLRE 3Q2CA 1FZJA 4HIJA 1BOGA 3MLXH 4ZNEA 1SEBB 5KSAB 1KDJA 2A77H 5IB4B 3ZRCC 3Q5YA 3UH8A 1JZIA 1QBAA 1JZ3A 1A6PA 3L8QA 4X6BB 2FSEB 4LCWE 4WTXA 1EMTH 5F7WC 1JV5B 3FO1A 3NCYS 4KVCL 4H25A 4PI0A 5E5MB 3R8BB 5IQ7H 1T2XA 4ZBJA 1E6JH 3LCYA 1G9EA 4FQIL 3ARGD 3CTTA 2X4NB 1S7XA 2ITCA 1RZJH 4LVOC 1TVHA 1FHNA 2DQMA 1AGEA 4FKKA 1DQML 1HHKB 4UM9B 4CU7A 3BZFA 2MSPA 5CM1A 4XBPA 3NRPA 4NXKA 5F44A 1S5HA 1UXSA 3APNA 1IEBB 2FAUA 4P04A 4WTQA 3SGDH 4QDGA 5D1ZA 5GZNC 1CBVH 3RNQB 3MOAH 4RFOH 1HFUA 3WLWC 4X5RA 4Y5YA 1JXFA 3RGHA 5DR5H 3CD4A 4HJGB 3AREB 5D8JH 1GL4B 1ITBB 1NCAL 2HRPL 4Z6AT 4KHXL 3DBXA 2DQJL 3BI9X 3BSHA 3WYRA 1RSFA 3QWOA 1UJ3B 4ZS7H 3CFKB 2XPZA 2PW1B 4L2YA 4XPAL 1RZKC 2OCJA 1YYML 2MH4A 3BX7C 1KLGB 3V0AC 3ULSB 2C1OB 3IJYA 3U2SB 4YL4A 4DUWA 2X6BA 1CG9B 4ZO7A 3QI9D 1LWHA 2F6AA 3UTTB 2LVEA 3IPFA 3AG1B 1C7TA 3X17A 2ZYIA 5BMFH 1TDQA 2R56L 3FB8B 5IP4A 1CR9H 4WGKA 1P5UA 3DX8A 5IR1B 4KKCD 1LP9B 4BXSV 1XEDA 3N0PB 5LCVA 4NERA 1NANH 4G9FA 3V52L 4P46D 3TZVB 3LSOB 3EZJB 1YO4A 4LESA 4G11A 3MRKB 4Y5VA 1MCRA 5ENWB 3PWJA 5IBTH 3T3PF 2AJZA 4I0KA 4Z7OB 4Y0GA 5E2UL 4JRYA 4HWZB 3RLSA 1SXNA 4IBLT 5CD5C 2VDKH 4U1HA 1CD0A 1GZPA 1ZOXA 4YGVA 4NGHH 2R27A 2HAZA 3G6AB 3WKQA 3MLYH 5C09A 5GZNA 4HUMB 3DRTA 5D7SL 1TLKA 3Q2NA 3VFNA 4L1DA 4JN2B 5IHZA 2WNGA 1BMZA 4U7SA 5ANME 2Y7QB 1R75A 3QDGE 1UJTA 2H6UA 1B4JH 3IRPX 3O6KL 4PD4J 1Q9OA 2W59A 5I1LB 5JLZA 3L13A 2H0JA 4H5SA 4IJTA 4V1DA 5E6ID 3RWHA 3ARFC 3Q8AA 5EDSA 4GUOA 3FQNA 4ISVB 1SYVA 1ESOA 1WCBB 1BVNT 4CC1A 5JORB 5I28A 2ZCKH 1O7DE 3FN0H 3K6NA 4CN6A 4ZSOB 1QBML 2YMTA 2IFFL 2FWUA 3OKKB 1JUFB 2J3SA 5AAMC 4M62H 4LQ1A 4JJHA 4NNYA 5HHVH 3B9KC 5HVFB 3NESA 2A9NL 3WKML 1N8OE 1SJEB 4IHOB 2P80A 1S9XA 3ILPB 5D55A 1SQMA 4GQ9H 4QRRE 4WK0B 1AQMA 2A38A 3MCYA 4LKXA 1FL3A 3GHBL 2EH7H 2E8YA 3L3IA 1MH5B 1IVLA 3BYYA 4U1NA 3FCSB 5I19H 1MFDH 4DEUA 2FIKB 2R2BA 2Z0UA 3FT2A 3GBNH 3VNZA 4FA6A 1MFCH 2M8XA 3MXWH 1UOKA 1P7BA 1QFOA 2FECL 3VWJA 1A7OH 2FQGA 1VACB 4HEPG 2OL3A 3DA0A 3O2DA 4UB0L 5C0RL 3I84A 2DPKA 4IRJB 1BEXA 3PHQA 5T3ZH 4TSAL 2DN7A 5ESAB 1KCKA 3DVIA 2VLLB 2OV0A 3IM1A 2PF6A 2CH8A 4JPWH 5CEZD 4NQDA 4DQOH 1MJ7L 3F58L 3IFOB 5ICXB 2KQMA 5E2TL 5HTSA 1FCCA 1NLDL 3S37L 3MRFA 2VLMD 1I53A 3SGKC 1PEWA 4NUQA 2XN0A 1JN6B 2YGVA 2YAHA 1SJMA 1HESA 1HL8A 3QBTB 3FUNA 3OC8A 2ZUXA 2EIZB 2VDQB 4BWWA 5FEBA 3AADB 4PUBH 3US9A 5CLZA 4MNHA 2YAOA 1EAOA 2EDDA 2ZUSA 4LMQE 4BA8A 5IFJA 5D4HA 1BQLL 1UD3A 4U6VH 2X89A 1NANI 1QLEH 2E0PA 5B8CB 2HRLA 4QWWD 3ZN6A 2NUTB 4M1CD 4J3XA 2IH8A 2CQVA 4E36A 2NXZB 3T3PB 5IOPB 5IREA 1BOYA 1SOQA 2KC0A 1QSVA 4AT6A 2P46B 4GS7B 3QO1B 4DEWA 5E56A 3POCA 4LMQI 4TSCH 4I8DA 3V10A 3UAJC 1TQCC 3O2WH 3RJOA 1GIGL 1QRNA 1YEFL 2OS7A 3FU5A 4LF3A 1DR9A 3MZGB 4Q9BA 4Y7OC 5AW2B 3WXWH 1CDCA 4A6YA 5A3ID 1EEZB 2VXQL 4LLMB 1R3LA 4OCWL 3MBED 3MMEB 3MZTA 1IKNC 3ARBB 4OZGF 5CWSA 3DSNA 4N8UA 4H2CA 4NOBA 5TQ2L 2XV6B 3D0LA 4B0MB 1C7SA 2HJKA 4OUUA 5C2BL 4F57H 1MG3C 4NLHA 4HKJB 4PR5B 3Q8EA 4MYWB 4MAUL 4N2AA 3P2BA 4OD2B 3VJ6A 1SUJA 1ETA1 3WN5C 4TN9A 2NPLX 3W39A 1AGDB 3ME0B 4TSBL 4DGYL 4XP9H 4Y4KA 3MV8B 1DVZA 1T4KA 2OMTA 4LPXA 3BT2H 4NQCB 4X0KB 3SB3A 2AQRA 5GRXG 1DUZB 5MENA 3UBXB 3X13A 3QUXD 4OKVA 2QADC 2HFGL 3ZT7A 1IGYB 1H6EA 1XH0A 2XNAB 2RFXB 1MLCB 1DSWA 4O2EA 2R2HA 1BAWA 4CDGC 2A9CA 3ZUNC 1BZ8A 4UV4H 1UH4A 3QXUA 5DRNB 2Y5EA 3CVIH 5T5FL 5T3ZE 1KACB 9PCYA 3GSVA 1MHCA 2DQTH 5EIIG 5JW3H 4BH8A 5T1DH 1JDAA 3QEGL 1JDDA 2WOBA 3UAJA 3NCEB 2K8QA 3G5ZA 2R1XB 3NFSH 3CVHA 5GGQH 3MOBH 2B2XH 3O8XD 2VZVA 4YSQA 1NZRA 4ALAC 1Z5LB 3MRIB 2AQ2A 1MWAH 3BPCB 1QSZA 3SYPA 1CMOA 5E4AA 2BVOA 5CGTA 5IMKA 3U7AA 1IKNA 1A47A 4Z77B 2Q76B 3GWJA 1M71B 3KYMA 5DO8A 4Y1TA 1OTUC 2N4IA 2SEBA 1YQVH 3FMGH 5HD8C 4NKOA 3QZNA 4KZEH 5B3JE 1L0PA 3HUJF 1JPFB 2CHNA 2WLLB 2K78A 4MZ2A 2Z8WC 2Q3XA 1KJ2A 2FHCA 1AYRA 3OKOB 4PWHA 5FO9B 3NCFB 1DVFC 4Z76A 7FABH 2MQCA 2AP2A 1TKWA 4HAGA 4XWGL 4PP1D 5LXGL 2O61A 3VWKD 3PABB 2FIRT 5SWSE 2ARJB 4WGWB 2ZQKA 4JFXA 1EVUA 4OVUA 3J8F7 4UAHA 5C07D 2QHRL 3EHBD 3OJMB 4L4VD 1SEQH 3KJ4B 2WKGA 3S4SG 2BWQA 3AACA 5FCUL 1K8DA 4WUKL 5D5ME 5J13B 3HLAA 1X5GA 5I1JH 5AG9A 2K7PA 2XBTA 2NY2D 3B9DA 5EH1A 2PTVA 2WXJA 4G7VH 4XN9A 1QNZH 3P0GB 5CGYD 4OZGB 1ORQA 4Z0BH 2A3TA 1BX2A 4G6ML 3K0YA 3ARGB 1MUJB 4WI0B 5F88B 5HI4C 1OM3H 2XWJA 3WHXA 5CU5A 1PVHA 2BWDA 2PCXA 4OD1H 5DUPH 5HGHA 3ZGHA 2QSVA 1G9MH 4BQ8A 4DGIH 1I8IA 2XPGB 1F1AA 4XCYB 3S3PA 5ID1B 5IB2B 5ALBH 5DQ9A 1CQKA 4LCCA 3FQYA 4JAMA 1CPUA 5EZOH 3JTSB 1E8WA 4U0QB 1DE4A 1ZT1B 1WA2X 5L0QC 5T1KB 1GCFA 3QWRA 2GTZB 3QPQD 4PJAA 3IB4A 5I1AA 2HTKD 3T1WA 3FTYA 1I7UB 4NWTL 2ICWJ 2XOTA 1GYAA 3BP6B 5HDQL 1UXMA 3TNMA 1EJOL 4M6OL 3EO9L 1AJ7H 2WN2A 2WANA 2XVGA 1DVFA 3BMWA 4R2GC 3INOA 4K5LA 5EF0A 2A9BA 2NXZC 4LVNC 1DDHB 2PWDA 3HR5B 2OPCA 4G8IB 2DZEA 4IMKC 3KEHA 5C0GA 5DJYA 3VGDA 3OKLB 2WAQA 1ZHLA 2VZUA 2A1WL 5EOTA 2W9EL 2CLZA 3RWIA 4JPVL 1SDDB 2ICWA 4YZWA 3EFOA 4C57C 1OCWL 2NY7H 2MJWA 2Q86B 4DFHA 4RZCB 4HWEH 2WP3O 4X7TB 3VGAB 3GJEA 3NN8B 3GBEA 3CGTA 4YO0A 3OZ9L 4AUUA 2ALWA 4NNPL 5JIPA 3BVUA 1FNSH 1NINA 4BXVA 3PREA 5KSUA 4RRPM 4Z9KB 2ZCLL 4QT5A 1ZWIA 3AWEA 2FJHA 3H4HA 4FXGB 3EDDA 3HUJB 2PABA 4BZ2H 3VX0A 2EDRA 1ETZA 2W0FA 3FFDA 43CAB 5EU3A 3T65A 4GG6F 3N1PC 1UD6A 4U3SA 1JJUA 2F53A 1CLZL 1NUDA 1SRDA 4QAMB 2B1AL 4Y2NA 4WW1A 1KEML 2DI8A 3F7RA 3VNYA 5LCVH 1FH5L 8FABB 1NC2D 2D2CC 4NKMA 5GRUH 2APSA 3UJJL 2E9BA 1HH6A 3CQQA 4G8GD 7PCYA 5F7KC 1AHWA 1LK3L 1OTSD 3VFVB 5JDSA 2BY1A 3N43F 1GJWA 3JUYA 1NIEA 2X0UA 2NR6D 1MAML 3CXHJ 3JQOB 5HGDA 5C0CE 2A6KA 1R19A 1ZXKA 2J1XA 3RIKA 3QUYA 5FYJU 2DWTA 5LGJB 2BSRA 1Z9LA 3CFUA 5E6IB 4P23D 2BZDA 2PR4L 4L8BB 5JOFA 3IDIA 4HC1L 4OF7A 1ML0A 1XF5A 4U6TA 2VXVH 43C9A 3DIFA 3ZDYF 3BKJH 2V5TA 1MF2H 5BRZE 1DZBA 5L2JA 4M6NL 2BNUA 3B83A 4HJTA 2VDNH 4PJFA 1XF2B 5DCCA 4X7SL 2AQNA 2K0RA 3NJJA 2OYKA 2P3YA 5DK0B 2DQDH 2SODB 2Z6FA 4PJHE 5C3LD 1RZKH 4WF7A 4GP4B 1F6AB 4P99A 3WJJA 2H0FA 3J27A 2ZYRA 4ZUVA 3WNOA 4NZDA 4KWUA 3EOTH 3HCVA 3OM3B 5C0DB 3NACL 5CJQH 4F7CB 3UG5A 1S9KC 4OSUH 3WUWA 5AOIA 3P4NA 3R1GL 3MLSL 5E51A 3TNNA 2GC4C 3H2QA 3MCLH 3UPAA 3WCYA 4Q7DA 4F58H 4HHWA 3LKRA 3S34H 2YGOA 4XVUD 3H9ZA 4P4KC 2FLRT 1A1NB 3KR3L 1OSZA 2ESVD 3BXNA 4JHZA 3IGKA 2P5EE 1N6VA 1N8ZA 4H1LG 5D1ZI 1A02N 1F86A 4UQAA 3RILA 2F54B 1RK1A 3DURB 3PDOB 2G30A 3M45A 1ETJA 2OL3H 2P7TA 3O2DH 4I48A 4MKMA 3IBOA 4RMUA 1XGTB 3MUGA 3DKHA 2XWXA 4HPHA 3QEQD 3EJSA 2KDYA 2CR0A 5HYJE 3GRGA 4NQVA 4LLUB 1DFXA 4FMFA 4JFZL 5IW1B 1QPXA 2MCMA 2XKNB 3W9DA 4MNQA 3N85L 2VSKB 3UADA 4H88H 4K7FA 2ZWZA 1XB6A 2Y7LA 1QEWA 1DEEB 1SF5A 4J1UB 4L3CB 2R4RL 4HFWA 2ZX9A 3BO8A 4JFFA 1QSFE 1DHKA 5FM5O 1V55B 4GG6B 1GXEA 1GYCA 1HDMB 2O1AA 1U9KA 1R0AH 2XIBA 2WB7A 4EMZA 3MAWA 1O5PA 3REVA 4QHLA 1IAKA 4N2MA 1HX0A 1FGNL 1BZ9A 3KNBA 4HUVB 2GSGB 4OZHA 4F7TB 3T3ME 4XVSL 2W5PA 4I1RA 3BKYH 1B9KA 1YY8B 4S1SL 1BVKB 3N43B 1MEXH 3MBEB 1DBBH 4JJ5A 4L3EE 4TRPL 4D7BA 2CR3A 3DSFL 4P4KA 1VCAA 1S5IH 4WU7B 4JQIH 1NFIA 7TAAA 4CC4A 4X5XA 1TJGH 1J05B 1G7HB 3PAYA 3B43A 4FD0A 3L4UA 1L0YA 4R4FL 5IW6B 4W6YB 3DO7A 1P4BH 2A73A 3P40A 4UT6A 5DVKA 3QI9C 2XETA 2CO2A 3BP4B 5FM4A 3ZDYB 1FFRA 2ADGA 4ONHB 1BM3L 4PLOB 5D96C 1TZHB 3MTRA 4HISA 3B9VA 3G5WA 1CCZA 4NB7A 3O2VH 5DRXA 4HUUA 5AAPA 3J2PA 5DMIH 1JGEA 1QVOB 1TVBB 1UVQB 3CVCA 4PRIE 5DFTA 1XGZA 4P46C 1V5JA 1A4KB 1RJCA 2NMSA 3NJMA 4JFDE 4Y16D 2HCZX 2R0WH 3QUXB 1YJDC 5EOCJ 1OL0A 1XMWA 2VDQL 2X4UA 4HU2A 1EEQA 3ZZ1A 4H0GA 4G5ZL 3HMWH 4FJZA 4P3WA 1A3RL 2FL5A 1UOWA 2EDYA 4MJIE 2IADB 3TH3T 2DMKA 3KBEA 4QKTA 3C5ZB 1OIOA 2IPTH 2OTWA 1DO5A 1Q94B 2QSCL 2WXMA 4ZXBD 1R6VA 1MPAL 3U4AA 3WXVL 2EXWC 3ECQA 3V7AE 2VDMB 3LEVH 1VDGA 4D9LH 4WW2A 2OMVA 1YN6B 1JNHA 4TMPA 4ZUUA 3WY4A 4K5PA 1ZVHA 2YAPA 2HKFL 4GW4A 4P4RA 4KHTL 2J1ZA 4NEHB 4XPBL 3S2AA 1KTDB 3VVVA 3W11D 4Z7NF 2AGJL 4KKQA 1G7QA 1AZVA 5FYLH 4MD5A 1XGYH 4UUJA 2OSLB 4LEBA 4HT1H 5DJ8B 4MQSB 4HW6A 2IH9A 4DCQA 5LQBL 3A47A 3H9HB 4QLRA 1QKZL 5SV4A 4NQDE 3MRMA 1HHHA 1CFSB 5DD3H 2Y25A 2HVJB 4GAGL 2EDHA 2WQAA 4XPTL 3MJWA 1Y6MR 3GXMA 4EI0A 1WBXB 1QYGH 5ADPH 4HHAA 1A25A 2XN2A 4GPVA 3UGXA 2A0LD 3BQUA 2A9DA 3IJHB 3KWXA 1BJ1H 2BFGA 1XGQB 5EU5B 3FB5A 4MQXD 5DLMH 5IWLC 3BW9B 4HU8A 3QP3A 1OARH 5ALCL 2W0LA 5JW4Q 2B39A 3VD1A 5C8JB 2MWCA 5ICZA 3UTSA 1J12A 4XCFL 4AK2A 1IC4L 2VSDA 1K5WA 5JDJA 1F58L 1JPTH 2WKOA 4UINH 4I87A 5DJ2A 2JB5L 2DH2A 4WI7A 4OCXL 4ELMF 1HWGB 1U8PA 4UT9H 4GI8A 5JPNB 1KJ2H 1NAMA 3VFPB 1SHWA 4NKQB 4PJBE 3GJFH 1KOAA 5FDYA 4BWTA 5F1OB 1I1YA 4LU5L 2Q87A 3VD9A 4UWQB 1X7SA 1YEJL 2G0KA 3PV6B 5HPMB 4U3CA 2KH2B 5B7FA 4BGDA 1KGYE 5E99H 1J86A 2FBJL 8CGTA 2JTYA 1JXJA 1P5VB 1U93B 2R0KH 1ND0A 2A99A 3MV11 3UO1H 3X1GA 5I30L 4UILL 1UACH 4QXUH 4XN1A 2UY7A 1D6VH 2WUBH 1HEZA 1L6PA 2XYBA 3EO1B 4GOSA 4NFDA 5AW3B 4XNAA 1HC1A 4G6JL 1YC8A 3VXSE 3QIBA 4K5MA 4BKLA 4YSAA 4LP4A 4IKIA 4Z78B 1AGBB 1XGUB 3UZEC 1CXEA 4X99B 4ZOBA 4AJVA 1DQJB 4NUGL 3MTXA 4OB5H 4G1EA 1E5ZA 4WI8A 5FM5M 5EF1A 4WLCA 4QWWC 1HH9B 4M1CC 1SHXA 5CJXC 1OGAB 3VFMA 2BOBA 4Z0XB 1AY1L 4BSVB 2EYRB 1AOHA 3QGVA 4WDIA 4DVBA 4GMSL 3VYPA 1YEHL 2XLLA 3U46B 5ITBH 2R2CA 4LLYB 3QYNA 1YHPA 4M8UA 2GC7C 5CO1A 3TOPA 1RIVL 3SKOB 1H15A 3AGWA 2AQSA 5LAPA 3F7LA 1EEUA 5AOZA 3U83A 1ZLVH 2Q7YB 3TYFA 3RBGA 4ORGA 3FQUB 4E41A 1MZZA 5AENA 4J6IA 5J12B 5A3IC 2HJFA 5A7EA 4FQXD 4Z7NB 3UTZA 2OX5A 1N19A 4MLSA 4FF9A 5HYSG 2CJSA 3BH9B 4B9PA 4HUWA 4UTBL 4RRPG 3WU1A 2VRQA 3AQXA 3GMNB 3MUUA 3QHZL 3ZZQA 4Z7VA 4XC3H 1VJSA 4M5SA 3BAWA 1IC0A 3BYTA 1IC5L 4Z3EA 3HC0B 1J11A 3KDPB 1A64A 3ZDZE 3OZKA 1UQSA 4IGBB 3T4YA 1TPXB 2UWEF 4M43H 3BDYH 4AIZA 2OXGB 3WKNA 1EIBA 4GEJA 2MQGA 4PSRA 3WSQH 1K3IA 2FD6H 4ODWA 2X6UA 5DUJA 3UTQA 5KG9A 4L2LA 2J8UE 5EU6B 3CZNA 2E59A 3GMQB 2ATPA 3LHPH 3QUXC 4GO6B 4U31A 1NSNL 4PJ6A 3FHEA 4XMPL 4ZPVA 4ZS6D 5IHLB 1GPOH 4QY8B 4A2MA 3KL5A 4BK8A 1FGVL 4G8GB 5DJ6A 4OIAA 4GBXC 1B9ZA 3QFJD 3TT1L 3KCPB 1HHJA 4DN3H 4ELMB 1KN4L 2HTLD 1AOZA 1I3RB 4I0CC 1PPIA 2EDTA 3NCMA 3T0ED 1E5AA 1IBBA 5AVTB 1NJ9A 2OSYA 4Z7OE 5C0FA 1YYCA 3TV3L 3BUPA 5A43C 3I75A 5EUOA 3O8XC 1YAIA 4K5OA 1G5GA 2WTRA 1IEAA 3PWPD 2AK4A 3LAFA 5E08H 2CK2A 4DSYA 1XSIA 1F02I 1DBJL 5KYUB 2L8AA 4QOKD 3PV7A 4E5XB 3Q8FA 4GQQA 5I1GH 1ETB1 1X4XA 1U8KB 1KYOJ 4KROB 4N90E 4XCNB 4LHUD 4YDLC 1TNMA 3K46A 3RY6A 3BWUF 5GZOD 2WXOA 3OHMB 3PPEA 2QVFB 4G7SB 1AZUA 4OCRL 3ARUA 4CMHB 5BS0A 3V79C 3RJDA 2GBVA 1VPOL 2K8MA 4JG0L 1HOEA 5A16B 1KBGL 1LO4L 3A6BH 4N0UE 1YEIL 3QG6B 3RA7L 3WFDH 2VO8A 3L7EB 4LIQE 1PNCA 4HOXA 1KCSL 3QORB 4ZSOE 1FZMB 2ENSA 4AE1A 2CSPA 1W72L 4PP1C 2XBDA 3VWKC 2ZYSA 3RKDD 2FNWA 5BV7B 4GKZB 5DS1A 4PB0H 2IG2H 1RIHH 3INUH 5B1BB 2YC1B 4GRLD 3EHBC 3VQ1C 1CO1A 1DSFH 4S0SD 4P5KB 4GBXA 2PPAA 5DJDA 1K4CA 1KIRA 4K94C 3EJZC 5DJXB 1BZOA 2WXFA 3HR6A 2R0LH 4BZ1H 1MVYA 2F5BH 4NRXA 1I8MB 2NY2C 3HOGA 3QJSB 4OCSH 3EO0B 2YQ2A 4U4BA 5IFAL 5IJVA 2XZQL 1NMAL 1MWAB 3TF4A 1F3RB 2I9TB 1CICA 1DFBL 1I3VA 5CGYC 3WFHA 5J0BA 2OP4L 3WUZA 5I82A 1I4FB 2QGBA 2I9LB 4EJ1C 1ED3B 4N2OA 2D7NA 2ZSWB 1G6RA 2X1WL 2XQBH 4GRWH 2HFEB 3UC2A 4F2FA 1JZ8A 3M88A 1JMXA 2XPYA 3CFMA 4J7RA 4RBPH 2AQQA 3E8UH 5J6SA 3IGFA 2X4RA 35C8L 4OBSA 2D3LA 1CIUA 2FJGA 4O02A 2JJTC 1AKJD 1E5UI 2F1EA 2FYYB 1U58A 2A6DA 4PY7A 2Z91B 3BESR 2ICWI 2PO6B 2B0SH 2ARJQ 1RUML 2UWEB 3QJXA 5F1KC 4F3FA 4FQCL 5CFHA 1M53A 5I1HH 3QPQC 3FTSA 4L05A 3SDAB 3ZTNL 2DQIL 4OM1L 2BNRD 2AHIA 3EJYD 3CUPB 1SQ2N 2B59B 2I5YH 5SWZA 1J1OH 1IGJA 3L95B 3QNFA 2OK0L 3CH8A 1MFBH 2VXTH 4YXKL 1CLYL 2CO7A 2HMIC 1E3XA 2W07B 3GNMH 5I23A 2L3BA 3IXAB 4IMLA 2IIJA 2VUKA 2J5LB 4KZ0A 2BSSB 4BRJA 1KXHA 3IJSB 4QF1A 5F96L 4K9JA 5EZLA 3HFMH 3GSNB 3RX7A 3S35L 4FG4A 5F1NA 5ACLA 4JB9L 3QS3A 5LGKA 4PJDA 3VXMA 1AD0A 3R0MA 3BZEB 4NQEB 2G5RA 4FEMA 1R5VA 2YJLA 1FZJB 4XTRD 1BOGB 3LKNA 4L3FA 3ES6B 4YVUA 2XFGB 3L7FA 1KG0A 4KXZH 1MCNA 5FOBA 5T5NG 5KOVC 5HDRA 3R8QA 3QDAA 3HHRB 1E4KA 4RESB 3NSDA 3CK0L 2ADYA 1NFDA 5KW9H 1QTPA 4J3SA 2X53A 4HJEA 1AAJA 3I85A 1TPXC 5E8EB 5B4MD 4UT6H 2E6JA 1OP3H 3RL2A 4UQ2A 2JJTA 1FSKB 2ITCB 2OR9H 4U1IA 3D3VA 1TVHB 4N8VG 2FUTA 3O3DA 5AKTA 2EE0A 2WLIB 3NIDE 1D3CA 2NNRA 5EG6C 1FFPA 3BZFB 3B5GA 3SDYH 3WI9A 4AY0A 3MV8E 1HCYA 3QUZA 2IDUA 5TQ0L 1OTSC 1S5HB 3CLFL 3MBXH 2YPLE 2AZUA 2XSKA 4XH2A 2NR6C 3D39D 4KX8A 4R0LA 1G0XA 1OO2A 1MHHA 3KPSD 1OEZW 2DYPD 4HCRH 2XWTA 3SD5A 4AQAA 4Y5YB 2OZ4L 4P23C 4ERSL 3QCVL 4AEEA 2EP6A 5EIVA 1JXDA 4K3EH 3MLXL 2ZXBA 4RVBA 2A77L 3Q8CA 2DMCA 3DBXB 4W9CC 4Y1AE 4FNLH 4G9DB 2H32B 2D4FA 4JEGB 5IVZB 5FGCB 4FADA 5JW4M 1UT2A 2BRQA 2Y24A 5J89A 4D9RD 1IGTA 3GBDA 2DY2A 1F3JA 3QJRB 1NDMB 3F05A 3T4AC 4UTAL 4Y1SA 1AMYA 1ACYH 2E7DA 4JO3L 4JKKA 4PRDA 2ADFL 3X3GH 1U3YA 1RZJL 2XXGA 1J9SA 1OAUH 5C0BD 1P5UB 1MJJA 1UOLA 3FOLA 3DX8B 2V7HA 2OLDA 4Y7MA 6PCYA 4ZW5A 3LRMA 2VGLM 5MEOA 4JQXC 1CF1A 2IH3A 2VWEC 4FCHA 1WA1X 4NRYA 3US0A 4WK4B 4Y5VB 2WVSA 3UX9B 4HWBA 4XVUC 2AJZB 1ZANH 1CBVL 2C9AA 3MOAL 3CSTA 3JWDC 1YJDH 3ZVVA 3TYGH 4YLCA 2YXFA 3BSZA 1SY6H 2UZIH 1SXCA 4IQHA 5AL8A 3LNDA 2VQ1A 4ZUSB 5D8JL 5K39A 4IU3A 3WLBA 2VDML 3DRTB 3VFNB 4PV9A 5FHAH 5DA0B 1UM6H 4ZS7L 1PAZA 5GRJH 1JFHA 3P4MB 3TBTA 4BFJA 1GMEA 5BUGA 1Q9OB 2BOCA 3JYBA 5LN8A 1R5IB 4NIKB 1HVXA 4ZK8A 1UENA 4V1DB 5LGHH 4KXZI 3GIZH 2FATH 3RWHB 2WUCH 2ZUUA 3FQNB 1TZGH 5EB9A 1SYVB 3A4DA 4G8AC 1KELL 1A9BB 3L4CA 1CR9L 3LHAA 2Z31D 2AV1A 2WBJD 2GEQA 3ZQWA 5D7EA 4NNYB 3B2MA 1I1CA 2K6WA 3MRBA 4NKIL 3HKZA 2FH6A 4WHTA 2UZYB 5BXFA 1BJMA 1KB5B 1S9XB 4N28A 1MFNA 5IBTL 3VA2C 5BPPA 4LKXB 1FL3B 3NA9L 4JG5A 3S3JA 3CIQA 2VDKL 3SDDA 4R97B 2QKIC 4MD0A 2VLJA 4YDNA 3MLYL 5F0LB 5AZEH 5C0AD 4AMXA 2D31B 1C5BH 1FRGL 4XMZA 5D7JD 3AU1B 5AB9A 5E1QA 3TEXA 1NMBH 1OW0C 3VWJB 4YHOL 3LKQA 3ABMB 3QRGH 2OL3B 2JMRA 4KO6A 3F7PC 5DD6A 2LR4A 4WJ5A 1NMCC 1CE1H 2GJ6A 2X4TA 4NZTH 3WFCL 4AGMA 4AKOA 4MA7H 4OCLC 3SCMA 3JXAA 5CLYA 2EIJB 4KUCF 2I24N 2IXQB 3UYPB 2X38A 2ZCKL 2G5UA 4NZFA 3FN0L 4R84A 3MRFB 4PW3A 4Y16C 5F21B 3BWAA 4KY1L 5I6KA 5CEZH 3QO0A 2KI6A 1NEZG 3D30A 4M62L 1CE6A 5TF0A 4U3HA 4KNTA 4V2CB 1RZGB 1XF1A 3QFJB 4MXVE 2CM5A 1A7QH 2G3NA 2V3EA 3WJLC 3ULUD 1SBBA 4KBPA 3IU4H 4ZXBC 5IFJB 2GJJA 1GY2A 4XB8A 2FO1A 2RIKA 2ZXDA 4PGEA 4IKJA 3TEUA 3FUIA 1OD9A 3CSYB 1HNFA 3EOAA 4X98B 5E94A 2NY0D 4CGUB 4E0RA 1R3KA 4ZO8A 5H37H 1MFDL 1HN1A 1LGVA 2WIIB 1MFCL 3MXWL 3NFNA 3PWPB 3W11C 4AH2B 5DC9B 5AB1A 4YFDB 2JI3A 1WT5A 4HJUA 1A7OL 4PLJD 4TVUA 5CJ5A 4OIIH 3WGVB 4AL8L 4OJAA 5D2NB 3TASA 4HF5H 1QRNB 2ERJB 4RAHA 4G2AA 4I4WB 1DQQA 2DYRB 3P3YA 4LSDA 4LF3B 1OW0A 2BHFA 3RPIA 5GS0C 5GSVB 2YWYA 4A6YB 4WI4A 3V0JA 2W9DH 5F6HI 5CWSB 4WJG3 4DQOL 5AVRB 3VSVA 1XIWA 3DSNB 2A0LC 2YEZA 4IM8A 4S1QL 1Q90A 3UERA 4MQXC 3D0LB 4Y2DC 4BK5C 1GS6X 2HJKB 4OUUB 2FBRA 4QXWA 2CMRL 4LP5A 5HHXH 3C6LC 4JDTH 4NFCA 1LHZA 5E6RB 4PUBL 1F4HA 2GHZA 3VJ6B 3KYOB 2H41A 3QCTH 2FJSA 4TQIA 2FX9L 4PJAF 5L2KA 1P6FA 1ZT4A 3FTZA 4U6XB 2OMTB 1T4KB 1T21B 3R0NA 4HCFA 1QLEL 4U6VL 4X6FA 1OB1B 5F9WB 4EN2A 3GLEA 3A22A 4PV1C 3X13B 4OY9A 5MENB 4OKVB 3P77A 5IQ9A 4TQ8A 4HS3A 2BSDA 4FFVC 3ESVF 1FFNA 3ARDD 3GXUB 3HS0B 4O2EB 2Q8AH 3OVUB 3LZLA 2R2HB 4TSCL 5C6TH 1XCTA 5LVEA 2BHZA 3O2WL 2OMZA 3IJ7A 2JKXA 1E8XA 3GSVB 1MHCB 1ET5A 2I60L 1PCXA 4BH8B 2RBLA 4O9HH 3HG0A 1LTXA 4U6YA 2ZP8A 3G5ZB 3CVHB 2BIHA 1DBMH 1AKJB 2VMJA 5CEZE 2A83A 3K74B 5IQLA 4X7EC 3RGVD 4GH7B 5KANI 3KPPB 1AQHA 3O0LA 4Z3HA 1BQ5A 5IMKB 2VLME 5J4MA 4KZDH 3FUDA 4PHZA 2PYEA 2YPKA 4HLJA 4NC0B 2BNRB 1G6RH 4KTDH 5I8EA 3KYMB 2VIRA 4KX9A 5EPMA 1S7QA 3TTYA 4Y2DA 2SEBB 4BK5A 2P4AB 4U49A 5E6UB 4FLHA 3HB3D 4LEXH 1EFXD 4DGVH 4XP9L 3D2UA 1WBZA 3C6LA 1NBQA 3CHQA 3C12A 5EC1A 1KXVC 3BT2L 4EKXA 4DUVA 4CU6A 2FJFB 1U4EA 1NGZA 1KJ2B 2V37A 2VAJA 3BUIA 2BERA 2WGNB 2ZOOA 2ICEC 5BV7L 2O61B 1CGVA 4GG6E 4X4XA 2GT9A 2K4WA 4JCWA 1KJ3L 2J56A 2KQNA 2ZKHH 4RMSA 4FQXC 4MQTB 4R97C 1E50A 2CHZA 3C2AH 2Y1VA 2ZOKA 4OJFH 4H26B 2DQTL 2QDVA 3L5IA 1IFGA 5T1DL 1K8DB 4B96A 2IMMA 3AXLA 5F7LB 3VDBA 5C08D 3A4FA 5GGQL 3CHPA 3MOBL 4R26L 4N9GA 3IDJB 1MWAL 4K94H 2HUEA 5IHHA 3GXPA 4JZJA 3BWSA 4G82A 3G3LA 2B5IB 5I1KH 4HS8H 1ORQB 4ZFOL 3FAWA 1JVKA 4ZRGA 2XWJB 4PJFF 3QDMD 2I7SA 1EHNA 1YQVL 3FMGL 4GAFB 3ZDYE 1A9VA 1PX8A 1HT6A 3KPNA 3EYOA 4KZEL 4PJ7A 1VERA 4L9LC 5D6CA 2CPUA 2WNKA 1WZMA 3E1F1 4LCCB 1IFHH 3WMSA 2YK1L 3LMJH 4GSXA 3K2KA 1I1AA 1DE4B 5CZVH 5KVFH 2ZWNA 4HSQA 4N2LA 5GRVK 4PJAB 7FABL 2TSBA 2HTLC 3HC3H 5I1AB 2H0EA 3C08H 1A8ZA 2BVQA 3T0EC 2DYPB 1NGYA 3TNMB 5ISZA 1WFJA 1JSYA 4QRUA 4UANA 3TBVA 2EE9A 4P5SA 4A2HA 2IWEA 4DVRH 4BBWA 2ICEA 2J6EA 1SEQL 5BZDA 2D3JA 2Y6SD 5E8PA 2P24A 5DJYB 4GRWF 1YEDA 1BZDA 4XMWA 1KV3A 4U7KA 3VTAA 4KTGA 3NCBB 3TEYA 5D1QD 5EOTB 1OXYA 2CLZB 2NT1A 3RWIB 2ICWB 4G7VL 1QNZL 5GZOC 1ASPA 3PQYA 2P5WA 1TYJA 4G6KH 2XHNA 3WY1A 5CZRA 3GJEB 5IJCC 3FF7A 2D03L 4JFPB 4PJ9A 1OM3L 4YO0B 5DUPL 1FCGA 4OD1L 4OD3H 1JHLH 4DGIL 1K6QH 1TQUA 5KSUB 1GGUA 1YMHA 5ALBL 1RURH 2FJUB 1E43A 1NKOA 4GP5B 4H40A 4HIXL 1A4JA 3E2HC 3GRWA 3CAFA 2DIAA 5EZOL 3RPBA 3RKDC 4QT5B 12E8H 4LSRH 3T5WA 3F6IA 3DI2B 3BP5A 3NYKA 4YDIH 4K7PY 1YPZB 4LK4A 4W6XB 2J8OA 3CU1A 4GRLC 1XX9C 1KCRH 3RUGB 4YUEH 3FFDB 2W0FB 2Z8VC 4PJ5A 4XNQA 4CVUA 4UQBA 4QD2E 1RI8A 5EU3B 3T65B 5CCKH 1QWNA 3LZNA 1ZS8B 4U3SB 1AJ7L 4ATTA 1JZ5A 2F53B 5C07E 5DDHA 2DEXX 3MRCA 1JZ2A 3GJFK 3HLKA 4KU1A 2JQZA 4YHYC 2H4EA 4L4VE 4DESA 5EEVA 1E9QA 1HH6B 4OZHF 1MHEA 3TJPA 1AHWB 2D9QB 1JDCA 3D12B 1UASA 4JG1H 2GEEA 3PJSB 5HGDB 4A7TA 4JNXA 4YLBA 1EGJA 3QUYB 1N12A 2BSRB 2EDWA 3MFFA 3Q3GA 5IB3A 4YDVA 1TLMA 4HWEL 1TTBA 4KH2A 1LO0H 3MRHA 3DOHA 5JOFB 1XF5B 5K9KA 1Z0MA 2ZP0T 2ZX7A 4EUPA 2KZKA 3L3OA 5CMAB 3DIFB 2E75C 2WXQA 3L9YA 2X88A 3FC8A 2BNUB 3OHXA 5KVFE 4PJFB 1JPEA 3LTVA 3SE6A 3EJYC 1CIDA 2CJUH 3UZVA 4G8FA 4DZBA 4DAGH 3CFTA 4JY4B 3VMNA 1D5MB 4BZ2L 4PW9A 3O45A 4NPJA 4ZUVB 1RFDH 5DQJB 3LD8B 3HCVB 3FTVA 4GMTH 3N5AA 1ACZA 2W94A 3WAKA 1P7QD 3V4VA 4KNQA 1NDGA 4AC2A 1QUNA 2R4SH 1JVOA 4OLUH 2WAHA 4YBLB 5LCVL 1NCIA 3BRGC 3WUWB 3JWNG 3V4UH 1ZLVK 2D7TH 1EWHA 4HJIA 2Y5QA 4WW2F 4AZ8A 1RZ7L 3HVNA 1UTDA 1KTKE 2PMZA 1UXWA 4QYAA 1ORSA 2BNQD 4XTRC 4PJGE 2QLYA 1XSJA 1OSZB 4YDLB 4J3UA 3BXNB 3P3SA 5DEGA 2VDOB 5CP7A 1N8ZB 2IH1A 2VXVL 3JWDH 1PQZA 4W9HC 4FQHB 1RK1B 3V8OA 1LO5A 3DGGB 1SLVA 4I9WD 5B4MC 1U2CA 4GI9A 4I48B 2P7TB 4KAQH 4KK8D 5D93B 2QPEB 3MUGB 4HD5A 3GXNA 2ADJA 4OV6F 5E9DD 3S5LG 2EAEA 4KXBA 2QQLL 4OW6A 2NXYD 4FQJH 1X5ZA 2Y4SA 2LVCA 2E9JA 2DQDL 4FQQA 5HPOA 3W37A 1RZKL 4NQVB 1SOKA 1U30A 3F6LA 1HYSD 4E2OA 1KYAA 3W9DB 2V4LA 3IFLH 3RJQB 2R29A 3QNXA 4K7FB 2EC9T 1NGWA 3SYQA 1QEWB 4GSDH 1XEUA 3H56A 3GI9L 2WKOF 4HFWB 5CJQL 4JFFB 3BO8B 2AABL 2N7BA 1ZKAA 5KS9A 4HWNA 1T2JA 3CH1A 1ZLSH 1T20A 3UBXG 3F12A 4A7UA 4G8GE 4NWUH 4F58L 2CK0L 2Z7YA 4QHLB 3WENA 5IZ7A 4LRNL 1GHFH 1KGIA 1BZ9B 3KNBB 1DCLA 1YN7B 4MCYA 3S34L 3G6JA 5E8NA 1A5FH 3DI3B 3EADA 4I77H 3V0EA 1XGRB 3JTTB 4Z8FH 3C5XA 1DBAL 5D6DA 5ERWA 1KCUH 1YNLL 3VXNA 4JJ5B 4RMWA 3UYRH 3T71A 3PGCA 1NFIB 3I9GL 2XG5A 4LASH 4QYOB 4ENED 4X5XB 2JI1A 3UL4A 2UUDH 5BNXD 2RAMA 4DPAX 4PJCA 4XVTH 5IJKC 4LVEA 2OL3L 5DGQA 3O2DL 4ZAKD 3DO7B 2A73B 2GG1A 1F5WA 4F5CA 2WV3A 3X2QB 2FT6A 3V55A 2HYMA 3EKCA 5C70A 2A74A 4J3OD 3BEWA 4NUMA 2ED7A 2VMDA 2Q1EA 3AABA 4MGXA 5DRXB 4L4TA 3VUAA 1JGEB 1NDTA 4AGQA 5JXEC 3P2TA 4DO6A 1XDTT 5AW9B 5I18H 5TDOB 2FDBP 4BK4A 3JV4B 3NTCL 1NGQH 1K8IA 3V6ZA 2VERN 1NPNA 2X4UB 5I2IA 1VEMA 2MMXA 2ROYA 3O6FC 3MOQA 3VMPA 1R0AL 3MRQA 2FL5B 2FEEI 1FI8C 5C71A 1BVOA 1T1ZA 2OTWB 4Z7WA 2J57A 3P9WB 4ZMZA 2BH0A 3WV0A 3DX4A 3P02A 1JRHH 4HA1A 3TN0A 5J6GA 2OMVB 1MEXL 1JNHB 2ESVE 1PLAA 1DBBL 4YPGB 4ZUUB 2GIYA 4GW4B 4P4RB 2XQYG 4R96A 4Q0XH 3RGVB 3NCJH 1N3NA 3CFCH 4R3SA 1G7QB 4RBPK 4MD5B 3R18A 2ZF8A 3DHPA 2O5XL 2FZ3B 4FABL 1Z9NA 3QQNA 3V5KB 3EYUH 4Z7VF 4XHJD 1EFQA 4JANA 5J1AA 3HAEA 1X7QB 3OX8A 1CZ8H 2DTSA 1HHHB 4MBOA 4A6YL 3QEQE 2IJ0C 2Z31C 2O5YL 4JFED 4MS8D 5FS5A 3O2VL 4TF4A 3KLDA 4JG9A 3KYAA 2WBJC 1M05A 4HHAB 2WQ8A 4FI6A 5J7CC 5GS0H 5ICYA 3BQUB 3PPSA 3L1EA 4JZNA 4HIPA 2ZNWA 4LFHG 3AAZB 4ZYKB 2R0WL 2OTUA 1W91A 4P2RD 1PU0A 4GO8A 4Z7UA 3RWEA 3T1FA 3UTSB 3MLZH 1FORL 1A6ZA 2DQFB 4TUJA 3KBPA 4L29B 5JXEA 5J3HD 5JHMA 1OGTB 4JCLA 4JK0D 3MLWH 2IWKA 3MJ6A 2IF7A 3DXAD 1HCVA 4AENA 3RDTC 3RWGA 2ZKYA 2V2TA 1PYWA 1F8TH 3MJ8A 3O6FA 4ODSH 1U8PB 5I1EH 3PWVB 1ET8A 4HS6A 5D7JC 1BD2D 3LIZA 1NAMB 4HUCA 4FG2A 1PS3A 1A65A 2C3WA 2RJMA 5C08B 1KZQA 2FE0A 3BOVA 3G5YA 4Y9EA 3F04A 3KLHC 1I1YB 1SOXA 1BXUA 3ROLA 5EUOF 3BAYA 5FYLL 1NCBL 1WPCA 3IN2A 4CW1A 1XGYL 3PNWA 1AYOA 4ORZC 1G6VK 5M95B 4ZPTA 2NW3A 1ANUA 1L6XA 3BPOB 3SD2A 3IS0X 5DD3L 3T08A 2KHAA 2UY7B 3CVHL 2DF3A 4IRSD 4ANKA 1QYGL 5ADPL 1BQUA 4OAWB 5TD4A 4M03A 3QIBB 2DKSA 4BKLB 3RBSA 2LGNA 5I6PA 1IIKA 2DBLH 3V5HB 5A2LH 1TU2B 1OARL 4XMVA 4IIZA 3ULUC 1CU4H 3Q9QA 5CR8A 3HI6H 3CX2A 4G1EB 2AKRA 3VGHA 4UINL 1XF4A 4HP5A 4MLIA 3VFMB 4F9PA 2NY0C 3IDMA 5JHBA 2GITA 2NCEA 5LNGA 3DJZA 2J4WH 1KJ2L 4XO3A 4EIUA 2N1KA 4G70B 4PLJC 5C3IA 3RDTA 3APDA 3IU3B 3AQZA 1CT8B 2VMCA 3ZZLA 5D1QB 2ICCA 1H15B 4Z3TA 1I9RH 1MDTA 3DO4A 1DJWA 1YNTA 2CIKA 4ORGB 4E41B 1JRHI 3DGCR 3VD5A 3AZUA 2HJFB 5E99L 3QZWG 1NIFA 4WWPA 3UTZB 4HOZA 2GB2A 4IJ3B 5E1AB 2OX5B 4OLZH 4PJIE 3UO1L 5CEXA 1VFAB 2HPTA 1UACL 4QXUL 4HUWB 1Z32X 5FYJD 5H35A 4PVLA 3M86A 1D6VL 1ZA3A 3ZMRA 3HI5L 4YHIA 2NY4D 4GKNB 5FGCE 4XB3A 3PIQA 1GGTA 5MEPB 5IMLA 2YSTA 3SZKC 2YLKA 1UQSB 1HCZA 1LQBC 5F8RC 4AIZB 3DMMD 4QLWA 3GLAA 2E4TA 3QT2A 5JIIA 2RB8A 2GK2A 2WWMD 2LFGA 4ODWB 2YOCA 3POHA 1TUPA 3UTQB 5KG9B 3ZKMD 3L5XL 2BVEA 4OM0L 4KXDA 3RDJA 4Y4FA 2C26A 4DHLA 3GRWH 3WTTA 4EVNA 4UIKH 2HWZL 3ZZSA 2MFNA 1E4XI 3FSWA 2WOYA 3ARDC 2DD8H 3E6FA 4K7PH 4LRIC 1HHJB 3TIEA 4EAEA 3GHPA 4JMNA 4ZUWB 2NOYA 4PJXF 1AR1D 3MRRA 1WG3A 4PMEA 3LZRA 1QABA 4J3WA 3DPDA 2YBGA 5IQMA 4KKRA 3I75B 3D52A 4PJDF 1FVCB 4GJTB 5AUMA 1S9VA 2XU9A 2ZYHA 3HBPA 3MGTA 4RFNC 4WK2B 1A1MA 5FGBA 2PP9A 4UAOB 2AK4B 5ILTH 3ZHKA 4PGJA 3CFJA 1QR4A 4XWOD 3KWVA 4J3OF 4RETB 4CGTA 2C3XA 2QL1A 5AYUH 5KYYA 4XC3L 1JXGA 4KY2A 4OR1A 1EGJH 4DEPB 1JF6A 2PW2A 5AOKA 5C9JA 3RTQD 1NFDF 3OL2A 5J5EA 5AB2A 4M43L 1LO3H 3FONA 4W9FC 3HB3C 3GMMA 3KPRD 3WSQL 1M7UA 4LOUD 4MB5A 5T33L 4BELD 1QSED 3UJIL 4QRBA 2YD0A 2AV7A 3WNPA 4N22A 1VFBA 2CLVA 4BFIA 5F2FA 3I6LD 1EZVY 2W60B 1O7VA 1DUYA 1J1PH 4JJOA 2GJPA 1MNNA 1CBJA 3GFUA 4FFZH 2YWZA 3VXUA 2OMWA 1H5BC 1KXQE 3NJNA 3DUHA 1MI5D 3L6FB 3JUZA 3BVXA 2BNQB 4DWHA 1V3JA 3KXFD 3V0IA 4XZUA 2V9UA 5DJDB 1WEJH 2VLKD 3WMPA 4DFIA 3BRDA 2VH5H 1M1SA 1KIRB 3F01A 3PXJA 4FTVD 4OZFA 5JMRA 5EZIH 1U8HA 1ZSDA 2X44D 4PJ8D 4AQ8A 3SY0A 4NRXB 3FN9A 2X1PA 3I6SA 1JZ4A 1RZFL 5E08L 3TO4A 3Q7JA 5IJVB 4XBEH 3L54A 4KKBD 5GQBA 4KO9A 1XO8A 1CICB 2E6PA 3VGFA 5I1GL 1C5DA 1JWSA 1GAFH 4F2MA 5E9DB 1MCPH 1G6RB 3K1DA 3QH3B 2NXYB 1M3JA 2BS8A 4O4YH 3BDBA 3HRPA 3QPKA 5DUBB 2B4CH 3HHSA 5I6XB 1WBYA 3CSGA 1H8SA 2BXZA 4O02B 2NYYD 4LCUA 2A6DB 4PY7B 3A6BL 1U8MB 3HN5A 5I1CH 3IBEA 5HDWA 2F7RA 4R8WL 5TDPB 1YVLA 3HPJB 3SE3A 1XL4A 4J3VA 1B2WL 4WTZG 2Q6WB 1AG0A 1H3UA 4TV3A 5JOEA 1YEEH 2XCMC 2Y1ZA 4MQ7B 5SWZB 1T22A 1IGJB 4FQ1H 4NAMA 3ZKQD 3QFJE 4HJ0C 2E9GA 1P69B 2CO7B 2R29H 2IQAB 1IAMA 4ZTOH 3X12B 2Y6SC 3KGUA 5EV7A 5HI3D 2VZ3A 3T0EE 4IMLB 4PBVC 2VC2B 4PJXB 5EZJB 3DWTA 3LNEA 3SQRA 3WTYA 2F5BL 4A2LA 4QF1B 5HHOD 4G8EB 5EZLB 1KYUA 4QJ5B 4OCSL 1KTRL 3U4BL 2DLHA 3PWPE 3NJIA 4G7QB 4U05A 5F1SA 1F4YL 1OK0A 2VR9A 4RAVB 3VXMB 1AD0B 2WWOA 2EYTA 1EZVX 4PVMA 4ZAKB 1HKFA 4E9WA 4N2FA 4QOKE 2YD7A 1C08A 4G43B 3EFFA 2ZKWA 5D2NE 4CA4A 1R5VB 3QDHA 2Y9RT 4RGOH 5I8KL 2VDOL 3O9WA 3E8UL 3GF8A 1G94A 5DZVA 3RFRA 4A7QA 1JZFA 2J43A 1TZOA 3F84A 3KWTA 3V6OA 4F9LC 5FOBB 1ID2A 4Y5XC 1M1XB 1USQA 1I7RB 2F8XC 1NFDB 1AO7D 2B0SL 3AG2B 3DK0A 4N26A 3ZDXE 2EVGA 2C3VB 3QJZA 3FOMB 4JM2D 5E03A 3RL2B 3OPZH 1U21A 1NFAA 4UQ2B 2V9RA 4R6UA 5GS1A 1WIUA 3N9GH 1PFCA 1FVEA 3I9AA 5DMKA 5I1DA 5AW1B 2I5YL 4U1IB 3D3VB 1MFBL 3O3DB 2E7MA 4UI2A 1XGPA 3TWCL 3WJMA 5EF2A 1UH3A 3CE1A 1B4LA 1P4IL 1N64L 3FSVA 2KYIA 4ZW6A 3QUZB 4GXFA 3OMIB 5HHNB 3VGBA 3WNLA 2QPDB 3QIWA 4GXVL 4LAQH 4ZOCA 4R0LB 1L7TH 3IAGC 3RIFF 2AJXH 1IGFH 1ILSA 4NYLA 4AQAB 1WAAE 4OGYH 2ID5A 3VFSA 1N5YH 2HVKA 5DTFB 1BEYH 4ZI8A 4TVPD 3GZQA 1MCBA 4PP2A 3RHWF 3A23A 2R0ZL 1QX1A 3NJFA 4TLSA 4XC1H 2MOGA 4FA7B 3GEWB 5DK2A 4P59H 4P9HC 4PS7A 4OLVH 1S8DA 1VRSA 5GISL 4CN4A 3H9SD 5LAXA 2CRIA 5AEAA 5KW9L 4HSAC 4N8CH 1F3JB 4Q2ZA 4NO3A 4YX2H 4UT6L 1H3PL 2BFVH 2CKBA 4P2RB 5EFIB 4Y5XA 2EIKB 1JHKL 2GI7A 4PRDB 4XPHH 5FA3B 3HAEH 2BNRE 2OR9L 4MJ5A 3UGEA 1NBZA 3BUYA 4X5LA 3SGJA 2FWOB 4ABUA 2ZOLA 3WY3A 3B8SA 3D7PA 1MJJB 3CFIC 3DXAB 3MV7A 3ZKXC 2V7HB 4NOFA 1L9SA 5MEOB 5FO7A 3SDYL 4ONGH 1Q72H 2YD3A 5B1CA 4JRLA 1MCIA 2NY5C 3I2CH 1MCEA 4H4NA 4NRYB 3MBXL 4IKNA 1RERA 4HH9A 5CILH 4AQOA 3GK8L 4QUOA 5ES4B 4OQ1A 2J1WA 4QRPA 5AYQA 5C92A 4NO0A 2CGYA 3HZVA 3VH8G 2APTA 3KBHE 3ZDWA 3KLKA 4UT7H 3FU6A 2VQ1B 4POYA 2ZXWB 3DVGA 4IU3B 1S7VA 3ZGIA 5KAQF 4K3EL 3WLBB 1R24B 1XF3B 2IPUK 1FFTB 1FE8H 5KSBA 3LIZH 4I3RH 4AVKA 4F33A 5KBDA 1XXFC 4PV9B 2DQ6A 1IQDA 4UDTB 5D71H 2AEIT 3DX9A 1D6EA 3LH2H 1MCCA 2QDWA 2BOCB 4KK8C 4L5FE 2AANA 1MWOA 4YPJA 3O3AA 4MCZB 1YEKH 1RQ5A 2QFRA 1HL9A 4LCIH 2GSIA 1JNLL 2IPKA 5DA4A 1HYSC 3BGAA 2CDEA 3IFPA 3CZKA 1A2YA 1KYDA 4LHQB 1B4TA 3UGUA 1OAUL 4RSYA 4NQUA 5T8IA 3OTTA 5F70A 3GKWL 3FO0H 2AV1B 2QTVA 1C5CL 1IT9H 4GUPB 4LLDB 2MRYA 4L1TA 5I73B 3MRBB 4WCYH 1OLLA 1FG9C 2AITA 4G7RB 3VYNA 4WHTB 3IGLA 5BXFB 1GOFA 1KGWA 3I6GA 4K3DL 4NM4H 1X7TA 3AMKA 1DVUA 1IE4A 1L5GA 4FTDA 3D39E 3PHSA 2PPCA 4N1EA 4QXGL 5DWUH 2AXGA 1YJDL 1RJLA 3KPSE 4KOCA 4OF5A 4YS4A 2UZIL 5SX5H 3SDDB 3TO2B 4G72B 4QTFA 3SE9H 3CFQA 4IS6B 5C6WH 3GKZA 2VLJB 1XB3A 1L4IA 4KDTA 1NAML 4RMRA 4U6HB 4ENEC 2AS5M 2WJ5A 1SBSL 5FHAL 5JYLA 5TH2A 1UM6L 4Y19A 4YSPA 4WUUA 4KRNA 4APQA 3LKQB 1WV7T 4LXFA 2AK1H 5DD6B 4HXAH 5ACZA 5BUPA 4WJ5B 2X4TB 4D9RE 5D2LE 4E5XG 3GIZL 2FATL 2WUCL 3TCLB 1TZGL 1MY7A 4IK6A 3SCMB 1SVZA 4Q9RL 4WHCA 5IOKA 1TJIL 3T77A 4G1MB 3GBMH 3NABL 4FZ8H 3SE4A 5EEZA 5C0BE 3HNTL 2EINB 3QO0B 4N6RA 5ITFB 1AC6A 2COQA 2NT0A 4YNYB 1Z9SB 3QDJA 5E2JA 4WENB 3IE4A 2XYCA 3W0WA 1JOIA 2QV2A 4RWYL 3B7UX 3VXRD 2HKHL 1PKOA 3FUHA 1NBCA 1YPZE 3FT3A 3ULVF 1WZKA 5ECGA 4AV4A 4FZEH 3MLVH 3RUGE 1EK3A 4PGEB 4TQHA 5BZXA 1I8AA 2DMHA 2W0KA 5FXCH 1JS4A 5HHMD 2XA3A 3EOAB 2IGFL 5E94B 3ULUH 4E0RB 4AIEA 5CJ8A 1R3KB 1Q9KA 4R83A 1DCEA 2PCFB 3P73A 4LPVA 5AZEL 3SKNA 4QJ3B 5IT2H 1SDAB 1FV1B 3O4LA 4JREB 2EZ0D 2R69A 2YRBA 3L3DA 4RWHA 4A37A 4HK3N 3AM8C 4XHJC 5CHNA 5FA4A 1QOKA 1DQQB 1CE1L 4NZTL 3EUDA 2KERA 1QI3A 4ETYA 2EYSA 1CDGA 4MA7L 1CL7I 2V5RA 4MS8C 4EPSA 2ZXCA 3B9EA 4ZO9A 2PUQT 2HLFD 4JO2H 1R5WA 3MRGA 4HPYL 4Q6IC 1J8HD 1XIWB 1QSEB 1VB9A 3UO8B 4F15B 5CEZL 5CCHE 1AVAA 1P1VA 3S3SA 1PTZA 15C8H 3SY6A 4PJ7F 1TNNA 1EXUB 2ZWYA 1BXVA 1Q8MA 4NPYA 3HPLA 3GLDA 5CJBA 5J3HC 5F93C 4QJ4B 2XWBA 1FNFA 4KZCA 5F89B 3RI5F 1A7QL 2AJVL 3N40F 3KHOA 2WLZA 5L6YH 1LDPL 5EN3A 4YQXH 1BQHA 3IU4L 5L2KB 1ZT4B 1K3ZA 5I6MA 3CSPA