1EAOA

The runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Runx1 Runt Domain at 1.25A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
total genus 24
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eaoA00
3D09A 3D0AA 1CO1A 3EXJA 2FEJA 1T4WA 1YCSA 3QYMA 4AGNA 3WTSA 4G82A 5LAPA 2RMNA 2WGXA 1GZHA 4MZIA 3QYNA 4LOEA 3Q06A 4L18A 1EANA 3VD0A 4L0ZA 3KMDA 3WTYA 2XWCA 1TUPA 3WTXA 1HJBC 4GUQA 2VUKA 2J1XA 4IBWA 2BIOA 5AB9A 2BIQA 5AOKA 3EXLA 3KZ8A 5AOLA 1IO4C 2XWRA 2PCXA 1UOLA 5BUAA 3D08A 4GUOA 4G83A 5ECGA 3D07A 4L0YA 4LOFA 5G4MA 4IBZA 2X0VA 2GEQA 3D05A 3WU1A 3WTUA 1E50A 4LO9A 4IJTA 5A7BA 4AGQA 5AOIA 3Q01A 2BIPA 5KBDA 5G4OA 5ABAA 2ADYA 4IBUA 2ATAA 2AC0A 3VD1A 2P52A 4A63A 2J1WA 2IOMA 1HJCA 5LGYA 2AHIA 3ZMEA 2X0UA 2J1ZA 4IBSA 4AGPA 4KVPA 1EAQA 5G4NA 2X0WA 4IBVA 2BINA 2J6WA 3VD2A 2IOOA 3WTWA 2BIMA 3D06A 2OCJA 1H9DA 2H1LM 2MEJB 4HJEA 4IBTA 1HU8A 1KZYA 2IOIA 3IGLA 5AOJA 1LJMA 1TSRA 2J20A 4AGLA 4QO1B 3US1A 3IGKA 2J1YA 5AOMA 3WTVA 3TS8A 3WTTA 4XR8C 1EAOA 2YBGA 3US0A 1GZHC 4MZRA 4IBYA 4IBQA 2J21A 3Q05A 4AGOA 1CMOA 4AGMA
chains in the Genus database with same CATH superfamily
5BOPA 3ILQC 1KJVA 4X6CF 4WHYH 3S5LA 1MI5D 4NENB 4QWWD 3EOBA 3EDDA 2R2EA 4OV5A 3O41A 1UJ3A 1SM3H 3IK2A 3WKNA 3RVVD 2IVFC 1DEEA 2EO1A 3SGJC 4AKQA 3P1VA 3DHMA 4P3CH 3T2NL 5I75C 1IC7H 1RZIA 3WTSA 5L88H 2N59A 2IH8A 2WYTA 4JFEB 3LRMA 5AAMA 1F3JA 2DOCA 4OQTA 5CKAA 3P9WB 2DQCL 2NCEA 4JANA 4M6AA 5KVFE 4HEME 1PJ9A 1T1WB 3ZDXE 4GS7B 2IIJA 2YJLA 2HH0L 1OW0A 1DSFH 1KT2A 2Q3AA 5BMFH 4PJIA 2NW2A 1JXFA 4NKIL 5IESH 4PSRA 2OK0L 4JG5A 4YPJA 4KKZA 3L4XA 1YEIL 1CFBA 1SXSA 5IVZA 1XCQA 1Y1DA 4JREB 2UZPA 2BVQB 4YGVB 5DJZB 3H2PA 4UDUA 4BE6A 3JVGA 3SBQA 4N5UA 5LNEA 3RTQC 1HEHC 2K6YA 2X2IA 2ZYSA 2YPVA 2C9QA 3FT9A 5E6YA 2XNAB 3IBOA 4Y2DD 4JO4H 4PRHE 2X6BA 4PWJA 5ALCH 2E9IA 5SX4I 4G6MH 1OWWA 5FGBC 5L0QC 4O2CA 5FO9A 3SDDD 4N3TA 1A14H 2OTWB 1OTTD 3MJ9L 4PTUA 4Z7WF 4HAFA 4ODTL 2CDFA 3KPSD 3ZQWA 2NTSP 4OM0H 1S5IH 1UZ8A 1YUHB 5ANME 4R4FH 2DWYA 3UTOA 1T1ZA 1TQBC 3D4ZA 4HBCL 1UWGL 3U6XS 3DSFL 4BXSV 1IBGL 4NAQA 3VFGH 1CURA 3QCVH 1CDYA 4LHUG 2CHNA 2X4TA 3JUZA 1TYEB 4QJ3B 3G6JF 3O0RL 4QHKI 2BCKB 3OC8A 2BSRA 2EE2A 5JW3H 2VLJA 3T8VA 4FCAA 4FA8A 4QGTA 3IDNA 4ZUTA 3HNSL 4L29B 1BEYH 1UT2A 4OCXH 1ZXQA 4AK2A 1KCKA 4CMHC 5I74B 3L5WA 1U8JB 1MLBA 1OGAE 3DBSA 3OQ3B 1EXGA 3F7YA 4GG6E 5AD0A 2AFNA 5FHAH 3D1MC 3HMWL 3JQOB 1Q9LA 2DL9A 1M7XA 2JJUA 3HZ3A 3F5WB 2FQGA 4JKMA 4RFOL 5DLLA 5HHNB 5KW9H 3JWOH 1FG9C 4Y5XA 3ZHLA 4I0CC 3NEOA 5K33A 3QISA 1AZZC 4FQIL 1JMXA 5D71H 3MXWL 3WAKA 1VACA 4ORZC 3MLPA 3LQAH 1ULVA 3A4DA 5I82A 4KNUA 4ZMQA 1NBCA 1GAFL 4HT1L 4OD1H 1H3XA 1F6AA 5D7SH 4KNTA 4FTVE 5GQBA 5FOBB 1QSFA 5E2VH 2A6IA 2VR6A 4W70A 3UTTE 1NGXA 2X5PA 3RKDD 4RSVA 5B22A 3X1GA 5A40E 3Q06A 2FT8A 4GSQA 1JUFA 1BYOA 3VDCA 1TQTA 2CLZB 3IKCA 2QSQA 3B7SA 4YSEA 2VLKE 1IM9A 4F9LA 4ISVB 2VERA 2WLIB 4LBAA 4POUB 4MD5A 3OKEA 3FO0H 3SD5A 3SQBA 4N2GA 1BF5A 4PS7A 5DMIL 2QADB 3RVWD 2D3NA 1C5CH 4NYLB 2E9BA 2CDGA 2ADIA 2DWXA 1JF6A 2IWKA 5DQDL 3N41B 1PEWA 2C9VA 1ET5A 3S88H 3B5TA 3R19A 4XWOD 2X6VA 2JNZA 3L4UA 3EF7A 3EJZD 4IBZA 1S7QB 1TFPA 3AGWA 3KR3H 3MR9B 5IHBA 4C83B 1BFVH 3EKCA 4LOUD 5MENA 1ZLSH 5F7AA 2XC8A 3UPRA 2D9CA 1LP9B 4KX9A 4H26B 5D2NE 1GYCA 4BHUI 1TETH 5L4JA 5KSBA 1TFHA 3JV6B 1KENL 3UAJD 2BC4B 3DROA 5L88L 4Z3JA 2UZXA 3CVCA 2HPTA 1R3HB 4JGUA 2CMRL 5D5MA 1I8AA 2ADJA 3T3PE 4G7SB 5F96L 3PNRB 1D9KD 2HFEA 1B9KA 3T6VA 4G8EB 1TZ8A 1A6WH 2PCFA 3Q8EA 1USQA 2WUCL 3CSBA 5IROA 1RK7A 1GMEA 1YAIA 3ZDXF 4PH8A 1U91A 4PBVC 3P30H 4WHDA 4UT9A 2V7NA 2I9LB 3AG4B 4LOVA 2XIIA 2EADA 3F58L 3MMEA 3Q5YA 1DQML 3D3VE 2W9DL 4XMUA 1H6EA 3CU7A 1WFJA 2BOCA 2K4AA 3GSNB 1KXTB 3L3KB 5ETUA 5I30L 3P0YH 2COVD 1L6ZA 5C6WH 5ICYB 2B1HL 4GRLA 3TT3L 1QQDB 4DHLA 2HRLA 4MKMA 3U46B 5C0CA 3PGFH 4Q6IA 5DGQA 1KSRA 1FCCA 3HPJB 1GS6X 3ZYOA 4NAJA 5CM1A 3DURB 1E5UI 2WKLA 5AQ0A 2FK9A 4XN4A 5JOFA 3PDGA 5GGRY 2WW8A 3RY6C 4YFLF 2Z1PA 1UURA 1JGEA 2W0KA 4PB9H 4UM9A 5HYIA 4X7CC 3BQUC 5AW9B 1G0XA 1I8MB 1DJZA 2OQJB 2V7HA 2ITCB 2BX5A 5ERWB 1QTYT 1OK0A 1N5AB 3MQIA 5AYQA 4LCCB 5DMGD 2YRZA 1NIAA 2WIIB 1IGIL 4X6FB 4LOEA 3LEYH 1SHMA 3RDTC 1R19A 5D9SB 4NM8L 2XG5B 3KXFE 5GS0D 1QYGH 1BJMA 5E1HB 4FYRA 4GAYA 1AQDA 4GRMA 4XBEH 5DJ6B 1KB5L 3HZKB 4YHZL 3JT0A 4A68A 2VDPH 3QDGE 3ASWA 4IGBC 2I26N 3TZVD 2QVKA 4Q7DA 2FO1A 2PW2A 4F7PA 3TF7C 3SDAD 1MJ8L 1ZJBA 2QPSA 2OMNA 4NBXB 4G7YH 4LQFL 3CVHA 1UQSA 1MG3C 2XPGA 2Y23A 3ARFA 2CBMA 3DVGB 4KQ3L 2B3RA 5JIMA 1AD9A 3MLZL 2X3BA 1J8RA 4R2GC 2NZ9D 4ZZFA 1FBIL 3MRCB 5MEND 3QC6X 2XZAH 3IDGB 3VG0H 3E1ZA 2RACA 2EDOA 4LPUA 1BECA 4JPVH 4KJPD 2UX7A 1VJSA 4X4ZA 3QVAA 3VH8A 2WVUA 3RIAF 5DC9B 4FFYA 1SYSB 1TKWA 4M4RA 1DJHA 1NLDL 2FGWH 4OF3A 4RQQA 1XF3A 4Y2OB 2EIKB 4JHVA 2H0JA 5EH1A 2QPUA 1UD2A 1BAWA 5DQJA 3KPPB 2Q7YB 1BZDA 1NBYB 5IJKA 5DZ9A 3D9AH 2FSEB 2ZOLB 2DWEA 1HQ4A 2ED9A 1MH5A 1UASA 4N0YL 4FFZH 5EB9A 2VMFA 1L5GA 2R9HC 1LM8V 2VISA 3P11L 4H8WL 4BGLA 2XBZA 5LCVA 3JZYA 1TEGA 1AR1C 4GG8B 2F7RA 1SJMA 2OXGB 4FYQA 4QRAA 1QR1A 1J88A 4HALA 4MMXB 1M7IB 4AYSA 3DO7A 3K7UA 3GMLA 2YSSA 4KKAD 3TH3T 3VXSA 5D1QA 1KB3A 1TVHA 1JZ2A 1INQB 5HI5C 2JVUA 1P84K 5LBSA 2CGZA 4GEIA 4AK1A 2ZXQA 4S2SA 5AZUA 3VFWA 1WEJL 1WAEA 4AMWA 5I5MA 4UTBL 5C0GB 2Y3AA 4N28A 2WO4A 3SZKC 4QT5B 3O9WC 1NCCH 4C56B 3RDTD 2Q8BL 2W60B 2CMRH 1PEZA 3OLIA 1G7IA 5I1AA 1AP2A 5I5RA 4YLQT 2WLJA 4KKPA 2YLKA 3LMJH 1XGRA 2ZAGA 3QC5X 4R6UA 5EF2A 4ELME 3AWFA 3NK4A 3DMMD 4L4VD 1UKTA 3LD8C 4JQIH 1OCWH 5IB5A 4KJYB 3LZFH 4M6NL 3VGEA 4JRYB 5GS2D 5KBLA 1SYVB 1VFUA 5CZVH 5I2IA 2XLLA 5AVYB 4PRDA 4L18A 3D0VB 1E2WA 5CP7A 1BCIA 3KPSA 2VMJA 5L6YH 4CN6A 4IOIA 1TQBB 2L7UA 2VR4A 4Y4HD 1HL8A 4MDIA 5CCKL 4HIXL 2XKNB 4JFVA 2AQSA 4HU8A 5K9OA 2G5BA 1WTLA 4PY7A 4NQEB 4K55A 3C8KA 4R7XA 1BLNB 2EXWD 1WFNA 5CGTA 3DUSA 1PG7X 5SWSD 1X44A 2XG4A 2NX5B 5I9QB 3F7QA 2IAMD 5D1ZB 5ENWB 1J9RA 3SPVB 1ZHBA 3VXUA 3H7BA 1K6QL 43C9A 5FO2A 4GIPD 5I0XA 5EU3A 1QFWH 1SHXA 2YEZA 3S35H 3AM8C 1IGYB 5GRYA 5FB8B 4NUJA 4UINL 3ULAB 1VFBA 1IAIM 3JVGC 4APQB 4QF1B 5F8RC 3H56A 4F93B 5F88B 4G71B 3FFCE 4WTXA 5LXGH 4IOSD 2IANE 1PZUB 3MFFA 2P24B 2Q8AH 1QUPA 3ZMEA 2XV3A 3CDZB 3MRDB 4G5ZL 5HDLA 5CZXD 1FP5A 3R8QA 4KBPA 3FUMA 2IG2L 4F24A 5D1XB 1MWAB 1M4KA 4LSQH 4ZXBA 4IBVA 1B88A 2IFFL 4PS3A 1ASPA 4N86A 1P7QB 2Q3ZA 4XHJC 4EN3A 3FU8A 5DRZA 4XZUB 2LU7A 3ZL2A 4N8CH 3VWJA 3F04A 4M03A 1FC2D 3PWPB 1IKFL 1F11B 2APSA 2F08A 1BZ9A 4YS4A 4OUUA 4QD2E 2CU9A 2CO6A 2WB7A 3DTXB 3INUL 3O2VH 4KQ3H 3PL6D 1Z2KA 1UHVA 1YEHH 4PYGA 5GJSH 4WJG3 3C2AL 2YZ1A 3Q6FB 4NJAH 1H3WM 5GHWL 2X7LA 4DSYA 1YECL 3MOBL 1NM9A 3OKOA 3LKRA 2GAZA 3AREC 4KJWD 4QY8B 5D70L 5KBMA 1G1YA 3DRTB 4Z7VB 3OKLB 4FNUA 3HBZA 1W0WA 4NRYA 2YRLA 4M8QA 4BSJA 5KVEL 2C1PB 4GIOA 3THMH 1OAKH 1KCWA 3FQ2A 3LSOB 1EVTC 4MWFB 3VDBA 2VSMB 3GQFA 3MU3A 1OHQA 1J0KA 1HQRB 4QHMA 2BJMH 1AAJA 4OCXL 1EX0A 2Y7QB 4F3FA 2XTSA 3WKYA 2GHZA 3O3BA 2E4TA 1JPSL 2F53E 5I0YA 3ARPA 4K9EL 1OARL 1V7MH 4PJCE 4B60A 4ELDA 5DK0B 3NIGB 2Q76B 4JM4H 2C5DC 2PP9A 2F1EA 2DLIA 4NKQB 2AEPH 2OJEA 5LKNA 3CN4A 1MCPL 4MJIA 4BH8B 5KOVC 4JFEA 4PG9B 3OR7A 2VIRA 1G7MA 1ZLVH 1IAOB 1RIHH 3EJPA 1F4WH 3FUJA 1XR8A 2FEDD 4GT0A 1QPKA 4LHQB 1HJBC 2YC1A 2DEYX 2VNCA 4WWKA 1F8TH 1T1WA 3ALWA 2ZXWB 1WIPA 1E5ZA 1RUMH 2WCSA 3U4BH 4U7MA 4P46D 3D85A 3VQMA 3VFTB 5DHDA 4PJIB 5CD3A 3EO0B 4NQCA 1YY9C 2KZBA 4H25A 4JFSA 2VO5A 4F7TA 1S7SB 1MJ7L 4YBQD 1BWMA 3KNBA 4H1LA 5DF0A 2ZQKA 3BZEB 1NCNA 4F7MA 4ETYA 4PBWD 5LNGA 4LNVA 1KGCD 3HMXA 2ZUTA 2VLJD 3LXCA 2FBRA 2GEQA 5TQ2H 1OTSC 3SCMC 3VFNA 1MPAH 1S7WA 1NKRA 5A7BA 4N8VG 3GUTA 1M9SA 4WW2C 1CE6A 2LGNA 5LWYH 1YMME 4NCDA 3O2WH 4H0LC 3LZFL 4WLCA 5DQDH 4HKZA 1XGUB 5GGSA 5CN3A 2BNQE 5D93C 2F5AH 3SDAB 1QA9B 5BUGA 1IGFH 5CLZA 4MBOA 2YD4A 4WW1B 1EV2E 3MNVA 3PHQA 3LZNA 1JK9B 4GBXC 5D7KD 2QGBA 3ZMNA 3MV8B 5LUMA 3HRZB 5HHOB 1MCNA 3FN0H 2X1XR 4UNUA 4IOSA 5IP4A 4GQQA 3T65A 1AGEA 4OF5A 1IILE 1OCCB 1K4CA 1XF1A 3ZZ1A 4L05A 3WUWG 4R26H 5KVFH 3LRSB 4PTTB 1PCSA 4G7QB 2X4TB 2QQKL 4YPGA 3RX8A 4AM0B 4F8NA 4M48H 1F41A 1N0XH 2ZYIA 4WJ5B 3RE0A 5I6LA 1N8ZB 1A9EA 1PZ5A 3RIFK 2IAMA 4KZEH 3QO0A 2HUHA 5FS5A 3WHE1 5D6DC 1SGKA 3NCYP 1MLBB 4K94H 1D6EA 4DW2L 4FQJH 3VI3F 1ERNA 5KSVB 1IGTB 1OAYL 2OA9A 1SXBA 3MN8A 1FL3A 2R4SL 1E6OH 1L9SA 2EILB 4JCWA 4FQQA 3L3DA 3MVSA 1R6VA 1JV5B 3W56A 5T1KB 4M1DH 3MJGX 3UACA 5I30H 4KRNA 3FC8A 3DJRA 2BOBA 2FJFB 1Z9OA 1P1VA 3E1F1 2YD6A 2LU5A 3VX0A 3FRPG 3NA9L 2APBA 2O6FA 3RL2A 1KGCE 5E94B 3ULVD 3BE1H 1SJHA 1F4XH 1G5AA 2FD6L 3BEWB 4HIHB 5BVJB 1C16A 5HHOD 3WDHA 3KDPB 2WLLB 2APVA 4ONFH 1LK3L 3FRUA 5IEHB 4OAWA 4BKLB 4D8PB 4FXTA 1IO4C 5C0BB 3FN3A 4HJJH 1GCYA 5IF0B 4NYLA 4Q2ZA 3AT0A 2ADIB 4PRPD 3SB3A 1FZOA 4TSBH 2XY1A 1KB5H 1N7ML 3K2UL 1EGJH 4CSSA 3EH4B 3GRGA 4OIAA 5AOIA 4YR6B 3J27A 5K1NA 3K5SA 1JK8B 4JFHD 5E8PB 5IBTH 4M7LH 4U1KA 3KDMA 5ICZA 1NC4B 1CFSB 2BC4A 3DROB 3A6CH 4P46C 3BAKA 2X9WA 2FX9H 2GIMA 3BVUA 4HWNA 3TBTB 3O4LB 5CUSH 5EF3A 1QBLL 4DN3H 1RIHL 2XV6B 5CGYC 4P9HH 4BELD 5IM7A 1NTDA 3BLKA 3ZKXB 4TNVF 3FHAA 4X8JB 2WWKO 2V2WA 5E6ID 2FZ3B 1ZT7A 1D7BA 3BLPX 4OLWH 3ZY7A 1R5VB 4B50A 2XN9B 4X4XA 1QLRB 1MJUH 1UB6B 1SPDA 1Z9LA 2V7NB 3K6IA 5DWUH 3V2AR 3WUWA 4X6DE 5I8OH 2YK1L 3V0IA 4U6HB 5D1XD 5FAAA 4KFZC 1NAMH 2XZCH 2AJ3B 1XSJA 1NCJA 4J4PD 4Y5YA 3TX4A 1KG0B 1B0WA 3AY4A 3R0NA 3SE3C 1KCUL 4KTEL 1RHHA 2R27A 2EVHA 1Z0NA 4GW1A 5J9PA 1YNTA 3QJHA 4KK9D 1HHIB 3IJ8A 4Y7MA 1QBBA 3LRGA 1XZWA 3CVIL 1LYQA 2OULB 1W80A 4X7SL 4YSPA 5D1QD 3LS4H 2V2TA 3DXAE 3I2CL 4E9SA 2VDKH 3TXAA 4EMZA 1KTKE 4XPFH 1I82A 2F5AL 4MASA 5TJWK 1IFHH 2NDGA 3B9DA 3C6SA 4IOFC 3DOSA 3QJUB 1PLAA 4K7PL 2DYPB 1YZZA 4OFDA 2OQJA 2V7HB 3ECBB 2PP8A 4PJFF 5HP5A 2OP4L 2FJHA 5IQ9A 5DRWB 5DURB 4BIKA 1I85A 4I18A 4FF9A 5A2KH 3PAUA 2XKUA 3L48A 4N0UB 4Y19A 4DCQA 3OBAA 2XWJB 4L4JA 2NX5E 4ONOA 4XMPH 1RIVL 4QJ4B 2FQFA 3MRLB 5TPWH 4GAYB 4GRMB 3QRBA 4MSWA 2GTWA 4WKXA 3ES6A 5F72S 2YIHA 3EBAA 1FAIL 4ZSOE 2NZ1A 3RUGB 5IB3B 1MUJA 1HKLL 4ECNA 3QAZC 5EZPA 3ZDYB 2R15A 1GPOL 2FATH 4MJ6B 4TVPH 4CRPA 1BM3H 12E8L 4P2RB 1OCOB 3DVGA 2UVFA 5EBLA 4MYPA 4JO2H 1NFAA 5IW6A 4OKDA 4HKXB 1GYAA 1S9XA 2FRGP 2H3NA 4JE4B 4N2KA 3GZOA 3RIKA 3WNNA 4AH2A 1X7QA 2AJVH 4ZXBD 5IW1A 5C3TA 4LE8A 2XPZA 1WWWX 4XP1L 1SY6H 5ACMA 3V6OA 5ISZE 4UUJB 5T3ZH 4N24A 4AQ8A 1Z9NA 2YQ2A 1IBZA 1CLYL 4PCSA 4UMGA 5E6RB 3TIEA 4Z3IA 5K9QI 3B4NA 3S3CB 2A9BA 3DWTA 4G6ML 1FO0L 3GLAA 1OD9A 2DQTL 4DQAA 1K4DA 2CO4A 4IKKA 2GPZA 4XB8A 1F4XL 3QEQA 1JPGB 3F6IA 2XJKA 2ZUXA 5C0RL 1JGLL 1NCGA 3MRHA 3ZE1F 2HTLD 1SXNA 3VXUD 1EAPB 5G55A 1E7VA 3X14A 1RK1A 4Z5RA 2FX7H 3DKHA 4BZ1A 1F56A 4PRIA 3FAXA 1CLOL 2TRYA 3IDIA 4HXBH 4OY9A 5J13B 1RQ5A 2CXKA 1JBJA 5JW3L 3ESPA 1W8OA 2VLRB 1KIQB 3D39D 3RBSA 3WIFA 3V4PB 3MRKB 2JXMA 3S4SB 2Z91B 1INQA 15C8L 4L8BA 3UCRA 4X9IA 4OI7A 1G1KA 5LHDA 4QOKE 2BNRA 3LNIA 1BV8A 2HRPL 3QHTC 4JFQB 1T7WA 3MGOA 2VAAB 4FLHA 1CTNA 4FXGA 3KYMA 4JFED 4FFVD 3ZTJG 5FM8A 1THAA 4FQXA 3KPOA 5B7MA 1DBKL 2R2HA 5IJCC 3UYOD 2KMWA 3DIFA 3EG9A 4Q4EA 3UH8A 1U8CA 3K1KC 1AP2B 5CJXA 2OMYA 4LEXH 4QXTB 1BZQK 5J1TC 3CFJA 2H7WA 5BO0D 4OD1L 2EIDA 4M6ML 1A66A 5ESAB 3QJVB 4LEOB 2XWTB 4OJYA 1NAKH 4X5WB 4OLWL 2F1AA 1NGZB 1SYVA 3NZUA 1S3RA 3G6JE 3K81A 5JQHC 1EHLH 1TTGA 1CVRA 4JR9L 4JS7A 5AAWC 4OD3L 3OR6A 3WFHA 2MCMA 4XNXL 4U2YA 2XKNA 4FZ8H 4PS4H 5IROC 1JWSA 2E7BA 4IJ3C 2X4QA 3ROLB 4P3CL 4BH7B 2WTPA 5IMMA 5F3HB 1KDIA 2R2BB 1W91A 1XF4B 3NSCA 3BPCA 2FNBA 1B9ZA 1BZOA 2NRDA 5JW4R 4FRWA 4H1LG 4JG9A 3ZJAA 4BRVA 4MWFA 4DEPC 4XPGL 1HHHA 2O30A 1JL8A 1XSIA 1ZGLB 4F58L 1IEBB 5ELIA 1LTXA 4OGYH 5EZOH 1FZKB 4NUJB 5KZCB 3GEWB 4L1HA 3O11A 2XT1B 3ZUNC 1XVSA 2FECL 4MFHA 5FV1L 1JNNH 4YDKH 4XBGA 3ZYZA 3FDWA 2X6MA 4G42B 3S3DB 3X13A 4OSUH 1PX3A 2X0UA 2D7MA 3VI3A 3M86A 2DI9A 2R0ZH 4OZHF 3V5KB 5H37G 5JQ6L 4KROC 3HLAB 1AVAA 5C0EB 2NY0C 3TO4A 4R4BA 1GC1C 3U82B 1P7QA 1CD1A 4EN3B 4A7SA 1U8QB 3DNKA 3PAVA 4AC4A 2YGNA 4YBLB 3AY4C 4AMXA 2OSLA 1NIEA 4YK4B 1RLBA 5DD5H 2EUZA 1ZHNB 3GMMB 1F11A 4Q9QH 5HGAA 2ICWA 3MUGA 3C6EA 5KVGE 3AY2A 3FTGB 5I0VA 2DQHL 2WXJA 1UD4A 4R0LC 1L9MA 4X6EA 4UOQA 4B41A 5DLML 4F2FA 5EEVA 3Q6FA 4JHAL 1WFIA 1KJ2A 4KU1A 2GJZA 5I6KA 1UWGH 3NH7L 5T5NG 1DQQA 3VXMA 2XRAL 1FFPA 2FB4H 4G1EA 3ARFC 4NRYB 4JB9H 1JN6A 5E7BA 3X1NA 4FAAB 4LVOC 5JHBA 4G8FB 2QVIA 1ZA6B 2YPLB 1ZHLA 5KANG 5JIPA 4QHLB 3H9YA 5CCGE 2DQTH 1DEEB 4Y4KA 2YXFA 2ZJSL 4G59C 1RZFH 1T2XA 5EPMB 5FLVA 3ROOA 4I13B 4P46B 4G7RB 2EUVA 1BQ5A 4NQSB 1TEYA 5HGDB 5E95B 3CJJA 3HFFA 1HI6A 1E4XH 1OAYH 1DJYA 5KYYB 5DJAB 3VNYA 1OO2A 2VO8A 4MJIB 3UIYA 1RJLB 2L0DA 4Z7OB 1YJDL 4LMQE 3CXHJ 2DB8A 2L8AA 2JJTA 2P5EE 1QP1A 3MLUL 4BINA 4BK4A 4AEFA 5KVGH 5AB9A 3CZUB 5T3XD 2BW4A 5INCB 4ZNCD 1OF2B 4PJCF 5DEGB 5E2VL 3G6DH 3QQXA 3ESOA 3M6DA 4MD4B 2CKBA 5E6ZA 3EOAA 4N3UA 4EBQL 2FHCA 5EA0H 3BFQG 1UVQA 4TTGA 2KERA 2GK0A 1FYTE 2WOBA 4KX8A 3BZEA 3L95A 1H9VA 3MV7A 4N90D 4C57C 1NCOA 1JDDA 5SWSE 2WCGA 2BNUB 4R90H 3PV6A 1UYWH 4E5XA 3VG0L 2NYZA 2XWBA 8PAZA 1J12A 5I74C 1CGSH 3UJIH 1UM6H 1SEQL 4GKSA 2AZAA 1X5LA 4G70B 1HZKA 2NY4D 1CD8A 4OW6A 3GNMH 5FO9B 5JW5A 1U93B 1KB9K 3CQFA 2B1AH 1A47A 5D6CB 3N1FC 1EAQA 1NCAH 1WJ3A 1A6VH 1GGIL 2V8LA 3HN3A 3QIWB 4K5NA 3PL6A 1LWHA 1ZTXH 3HR5A 4O2FA 4UQ2B 2FE0A 4ZPVA 4U2ZA 5EUOA 1EHKB 1EGJA 3HG4A 1QO3B 2YHGA 3TESA 1RZQA 3JWOL 2D0GA 5C8JB 3KAAA 5CSGA 4E41B 2BSRB 2MEJB 2WN3A 1XBDA 4FJZA 1PW3A 4I85A 1WV7T 3JWDC 1MY5A 2NCMA 4EI6A 1NC4D 3P4OA 1BOYA 2A77L 4C4UA 1U21A 4JFFD 3L5WB 1QVOA 1A9EB 2BCMA 1GAFH 3K3QA 2HPOA 2GJ6A 4DTGL 1KIRB 4JFYA 3UTPD 4NNPH 3MC0A 3BCFA 3LV3A 1EDQA 2Z8RA 4WO4D 1S7RA 1ZPLA 3MLVH 1H3VA 3QA3A 4IOFD 3TN0D 4F2MA 3CPUA 3MLSH 3RGVD 5J13C 1V7NL 3IGAB 4WGKA 3X2QB 2FEEL 2N1KA 4PJ7A 3D18B 2W38A 5CLWA 2P8MA 3L9RB 5EO1A 5J8OA 4NUGH 3INOA 3MYZA 5DVNA 5CWSA 4EZMA 4RAUB 4AENA 4F8QA 3QQ4A 4PRHB 4F8PA 4JO1L 2X70A 3WE1A 5FOBA 1R3LB 1X5HA 2DIBA 5DSCA 5E8DL 1L3WA 1MW3A 3E3QE 3RWEB 4JAMA 3LMJL 4WK2B 4WTZG 3SDXA 3EDJA 5EFIB 2EDLA 1HCVA 3L4TA 4TQHA 4U1HB 4D8OA 3NGBB 1I8UA 2NZIA 1CPUA 2WLHA 1CL7I 5AVUB 4K3GA 1KELH 2YD2A 2V5TA 4K9EC 4QRTB 2OTUA 1CG9A 1AFVH 3FB6B 4KI5E 5IEKA 3KR3L 2ZKHH 1KPUB 1CICA 1DVFC 3QDJB 1ZV5A 2BRRL 3OB0K 5F6HI 1TJHL 2J5WA 3SDDC 4I4WB 4K7PH 4ZOBA 1K3ZA 5BCAA 4LP8A 3B9KA 1NPUA 1IFGA 3PXHA 4NQDB 4UQ3B 3SDCA 4XN2A 5HYSB 2G4GA 4XODA 3AQZA 3IYLW 2F54D 2X2UA 5DJ0A 4JG1L 3AG3B 3TFBA 4G6AC 2WN2A 4NM8H 1GJWA 2IH1A 4Z7IA 3U25A 3OGOE 4K7PX 2VDOB 3NPSC 3Q7JA 5GGTH 2GBUA 3BZDA 4Z76A 4H26A 2D2OA 5EN2B 4L8CA 3VM5A 1R47A 3Q01A 5HVHC 2VQ1B 2Q87A 2WBXA 1XGTB 2WZAA 3Q2WA 2OL3A 4IBUA 2VXQA 3QUXB 2WK2A 4NWTL 4LQFH 5ICZB 5D5MB 4ZTOH 5D1ZI 1IQWH 1BGXL 1MHCA 3AAZB 4HEPG 4LVNC 2L7JA 5KJRH 4TUOA 2BMKA 2D3LA 4JZJC 4Z3GA 1FIEA 4RZKA 4XNYH 1NGWB 2QQQA 3G5ZB 1Q72H 5EBGA 5GGVY 3MLUH 4Z7NF 1COBA 2A74B 3PXLA 3TH4T 2BIMA 3VE0A 2VM4A 4LIQE 5SWSA 3TT3H 1GGCL 4XN1A 2C8NA 1ZT1B 2F53D 3GD1C 2JQAA 2OM5A 3WN6A 3BYTA 2WJ5A 3GGWB 1AXTL 1GKOA 3MX0B 4MGXA 3V6ZA 1DQDH 4K3HA 4RGND 5IWLC 5I8CA 1HILA 4LCYA 4P48A 1CTMA 4RMUA 3W82A 4GRWH 1BA9A 2ZZUT 5EU5A 4F91B 3Q6GH 1YEHL 5GJSL 2IWEA 3QE5A 3C8DA 1L9RA 3CFCL 2VXQL 2YAMA 1EJ8A 4LCUA 4XMTA 4XVJL 5LDSA 3WI9A 3LZPA 4JDEB 5T3ZD 2B7DT 2PO6C 3G9AB 4KDWA 5AEAA 5I73C 1IZJA 3H7LA 5BRQA 2ZUWA 4R7DB 3BIAX 1IUZA 2FT7A 4XT1C 1WK0A 5DXWA 5C08B 3OB8A 1HFUA 1G7HB 4J7RA 4XNMA 5F70A 2AXFA 3QUXD 3ISWA 2HJFB 2L3BA 4WUUA 4MHHI 4G82A 3OX8A 1FF5A 4KY1H 1U3YA 3HUJF 5FIEA 1JMZA 2O26U 3GXIA 4JQIA 4XC1H 4B9YA 4Y19B 4DCQB 4QRPD 4KI5F 5LLIC 4B95C 2ZXAA 3CPLB 1A0QL 2XZAL 1TJGL 4ORGA 4DFHA 3OPZH 1LWRA 2BW5A 3U1QA 5T1LA 1V05A 4ANKA 3ILDA 3ZSTA 3UGXA 3V4VL 2V17L 2J55A 2VZVA 1E27B 4KK6D 4HSAC 4ONHB 3QORA 1AZVA 2GUOB 2DI8A 1UD3A 1VADB 2E27L 3FNKA 5I8EA 3U4EB 2ZSVB 1U95A 2YOCA 3ZGHA 4MJ6A 3MLXL 4R0LB 1BAFL 2CKBL 1HEJC 4FMFA 4LOFA 2IFGA 4PHXA 2H32A 5JHLL 1CLZL 1I75A 3FUEA 4X9BA 4FQXD 3N0AA 4HKXA 1NIBA 4KO9A 4UTBA 3FB8B 4NENA 3PFQA 4LSVL 2G9HA 3O41B 3K2IA 4FOMA 4X80L 5E8DH 1M7DA 3LIZA 4AM0Q 3RFZC 1B4JL 1TJMA 5C71A 4OCWL 3US9A 1DANT 1GOFA 3HFMH 5JDJA 3U2JA 5GRXG 3DBXB 3I6KA 1XCTB 5C7XH 4IRSD 1QRNB 1A21A 3MRPA 4UZSA 4EDXB 4FLQA 4ZFOA 1TCRA 4X7FC 5C0IA 3RZCB 4EVNA 3ZYJA 4CMHB 2PF6A 3UBFA 3OSKA 3RZCC 3EH2A 1ZDSA 2VDQH 4KRPD 1ITBB 3SKJH 3VWJD 1BD2D 4HF5H 1T5KA 5IQ7L 4IBTA 2IXQA 2VW6A 5E2UH 4OZFG 4Y5VC 3I6LD 3QEQD 3ECVA 1W2KT 3FSVA 4M48L 1Y7VA 3CVDA 4GSRA 4PWHA 5GIRB 1I8KA 1Q0YH 4S2SB 4HAKA 3QUMH 3HEIB 4M61A 3ZRFC 5L9DL 2YMXL 5DJZA 3GRWA 2X41A 4BK8A 5EORH 1BZ7B 1UG9A 5J11B 3AS3A 5CZVL 2MKLC 2DTML 1SDAB 3NCMA 2P49B 2WBJB 5HHME 3LNDA 2ITDB 3EW3B 4JY6A 3T4AB 5BRZE 4HUVA 4CNIA 3ENEA 4IRJB 1KPVB 1IQWL 1BGXH 3L3IA 4FYSA 4OF6A 4LSTH 4PJ9B 5TTRA 5TE6L 4BDVA 2Y1ZA 2R1XA 4XO4A 4YHNB 1XGRB 2E9WA 2FEJA 5J6SA 4LIQH 4XNAA 4QPEA 3NYKA 4HKJA 1YCSA 3ARED 4KJWC 3HAEG 5B1JC 3WMSA 1MI5E 4XN5A 1HOCA 2WHVA 4G8IA 1RULL 3RILA 3PQYD 5KBPA 4N1EA 3HE6A 3IXAA 4PRDB 2XRAH 4H8UA 5H94A 2R29H 1KCRL 5HD8C 2WLNA 1TZHA 4L0ZA 4Y19D 4WWKD 3SOBL 2PTUA 3BAJA 2FSDA 2NY7L 4RZCB 3G7TA 5IBUB 3EJCA 1CI5A 1GZPB 3B1UA 5DD6B 1VFAA 5LXGL 2WXKA 4KPHH 1FG2B 2A9MH 3HG1B 2E7MA 2QPEB 4CBZA 5DD3L 3ZLQC 3BH9A 1E67A 1D2PA 4X6BA 3BPCB 4PU2A 3TWCL 1MQKH 3MYJB 1FGNL 3OMZA 3VD3A 3O0RH 4Y5XB 4N20A 4GBXA 5T1LD 1EFXA 2IEPA 2E46A 3DETD 1N6UA 3MV8D 4GMTH 3T8XA 4J3TA 5CEXB 2AMGA 3BGMB 3U1SL 1X5MA 3QHZH 5DJCA 5JPMC 4FQ2L 4TVUA 2Z9TA 1FFRA 2MIZA 1TVBB 3VGFA 3UYRH 2APFA 1HTYA 1KJ2L 2WNXA 5F1OB 1EK3A 3KCWA 4WUUD 1Y18A 3X13B 2Y2TA 2IAMC 3QFJE 4GXVL 5ISZA 1VDGA 3SJVD 3W39B 2H47C 4FQIH 1A0QH 1ESOA 1FH5L 3QDMD 1FVEA 2R83A 4FFVC 4GW5B 3S9DB 1PZ2A 3IKCB 5KS9B 1KYOJ 1ZRUA 3NBNA 4OFVA 1IAMA 2DM7A 2IF7A 1AIFB 4M7KH 3DTXA 1NGYA 4ZX6A 4JZJB 3NCWA 3KGTA 1CD0A 2JIXD 2JKWA 1A6UH 5AW7B 3UL4A 3O6FB 1V5JA 5FUZH 4M5YH 1FGVL 2Z7UA 1VLXA 1PKQE 2GTQA 3UYPB 5IMOB 1CGWA 4NP9A 1CXFA 4M1GH 3TURA 2UX6A 4XGZB 1QEWA 1WH0A 5ITBL 2PYED 2JB5L 3OV6A 5DTFA 2VRAA 4JFPA 4Y19E 4AI7A 4F15B 4U6VH 2JLLA 3G08A 2A77H 3V9EA 4LL1A 1FZMB 1JXDA 4MDRA 4PRPA 3EOYG 2ZUSA 3PUUA 1KYOK 1IFHL 5DK0A 2FWOA 3SO3C 3K8KA 1I9EA 4LPTA 2J6EA 1XGZA 4MAYC 1SN0A 3HJEA 3QXVA 5DI8A 5LAPA 4TOYH 2NXZB 5EOQH 2FJUB 4X6CB 5JHDE 1LEKB 2LV4A 2PPDA 2XWEA 1CDBA 4CVWA 3ZTCC 1OHZA 4W9FC 2CWRA 2EH8H 4AYBA 2CO7A 3IU4L 5F7WC 3A23A 1O0VA 1JAEA 3SBWC 2BP0A 3SKOA 2P47B 4XVTH 2OMTA 4I5BB 3SBRA 3X1EA 3LN4A 2WSKA 4NQDD 1FAIH 3TJEL 4M7JH 4H1LB 5EC1B 4YXKH 5MEPA 1U8MA 4Q9BA 2EDWA 2AJYH 4IRJD 1A4BA 4GAJL 5KVDE 3U46A 3H9ZA 1S7TA 1P84J 3DURA 1PAMA 1P7HL 1T03H 4JY5H 3ZL1A 1RU9H 3CZEA 5T3XH 3EO1B 3VTAA 3OGCB 1USZA 4HAGA 2PCPB 1BBJB 5AKTA 3CK0H 2P5WD 2FLBT 2VABB 3KPNB 4YIQA 5HHPB 3UEZA 1Q94B 2AJUH 3QGVA 3IN0A 5HVFB 1P4IH 3REWB 4IIQC 3PS6A 3JUYA 3IM1A 4ZQKB 4Z3EA 5HHXH 3G5YA 3MBEC 2ATKA 1CFNA 1FV1B 3R8BB 2A83A 1HE8A 2BNQB 1NOLA 2Z4QB 3ECQA 1KBWA 3M7FB 4D9LL 1XXFC 4FFTA 3IDYB 4QI3A 5HJ3A 3MSPA 4J3OG 1K4CB 1KCVL 4NHCH 3F7LA 4I3RH 3DOIA 4HK0B 1ACYH 1RZ7L 3VRJB 3HZKA 4JQXC 3SPGA 4LGSB 4YDLC 5CEZH 3JTBA 1NDGB 1HL5A 4XMLH 5F7DB 1G4MA 2LOEA 2VITB 3DETC 3A6CL 5GSVB 3Q3GA 5DQ9B 1T1XB 2GCYA 2WQ8A 1IARB 1PJWA 1SFDA 3DTUB 1MAKA 3EFFA 3P4LA 4Y1AA 1H6UA 5D6DA 1T66D 2WZ6A 4YXHL 3TBWB 5JDSB 3BC9A 5FA3A 5GS0L 4Y2NA 1XAUA 1Q38A 3KGSA 1GGCH 3QSKB 4RH4A 2VDPL 3IDGA 4UM8B 3BQUD 1QHOA 2WCPA 4TL4A 1FL3B 3CFEB 1OL0A 4HH9A 1NDMA 3WAJA 1B2WL 4HHAA 5IZ7A 3AWEA 3KS0J 1MI5A 4RSYA 4U1LA 3BKYL 5CMAB 5B39B 1FNEB 4AGNA 5I23A 2CUAA 2OKMA 3U6XA 4ES8A 1E28B 3FO0L 3QNXA 3LNGA 3VA2C 4NO3B 3OKYA 3ESMA 1B90A 5BRZA 5E94A 5GISH 2NYYD 1H15B 4LBEB 4GG8A 3GZQA 5T5NF 4QXWA 3CSFA 3I85A 3U7WH 1EHLL 1EGJL 3DHJA 4ZFQA 5HYJE 1BWWA 3V52H 1MLCA 3D9AL 3BN9C 1EFXD 4L5FH 1T0OA 1IGCH 2E5EA 1GYUA 3DO7B 2PWDA 3MRQB 3QCUL 1CYXA 4U1NB 4EOWL 3WNMA 5EUKA 4ZMLA 2VN6A 4M4PA 1NCWH 2AP2A 3FCBA 2ODIA 3GSUA 1VPOL 1CE1H 4QRBA 4JEGB 1U41A 4JFTA 3VFWB 5E5MA 5G4MA 2ESVE 3M17A 5E6IB 1OSYA 1MRCL 5KWYC 3E8UL 4FG6D 1DSYA 1QW8A 4OLVL 3ULVC 4QTHB 4G3YL 4A55A 4LDOB 3EYSL 4PJEF 3BH4A 2X1OA 1ML0A 1LNUB 1NMCB 5CEYB 5E5RB 2R0WH 2AMUA 3TL5A 3UTSD 1YEWA 3FQNA 5HYQB 4FXKB 1NC4A 3RLSA 4G80A 4A6YB 4Q56A 2FT6A 3QUXA 5H35A 2ZWSA 2C9PA 2R69L 4NFDA 5KG9B 4PJBB 4N0FA 1U8OB 3OKNA 5FHBL 4F92B 5KN5A 4Y4KC 3G5ZA 5FXCH 1BQHA 3ZUCA 1DJGA 2CR6A 1CL7L 3RY6A 5MEQB 4U4IA 1KXVA 2VXUH 4D3CH 2B1HH 5LO7A 1UWFA 5I1EL 5KYXA 4HC1A 1BW8A 4LAJH 3G5XB 1FFQA 1Z66A 1EZVY 4XOCA 1E4KA 4OCWH 3WELA 4Y1AD 1OTTC 3C8KB 2EDEA 4JRXB 5C7XL 2W91A 4WSJA 1J5OL 5DFVD 3RTLA 4QHNA 1ZS8A 1KY7A 4PB9L 3ZDXB 4RMQA 5CCKH 1ZLSL 4HHWA 1RU9L 2BM3A 43C9B 4JO5A 1E5BA 3QBTB 3BDYL 3WIHH 2YA0A 1J10A 3FTYA 4ZMPA 5FYJD 3DI2B 3WXVL 2EC8A 2V2TB 2AGJL 3DHUA 1UA6H 3HCVB 4K5MA 4AYEC 1Z3GH 1XH0A 2EC9T 3BAEH 4OGZA 3T1WA 4RMWA 4QTFA 4XCEA 2ZG1A 4WUUE 1JFQH 3QH3B 1IRAY 3KH3A 4X98B 2EICA 1ETZA 1KBBA 4L48A 2VC2H 3I50L 1U4FA 5F7BA 2Q9OA 5C08A 1RZFL 3WFDH 1G94A 1LL1A 3RAJH 3WGVB 4F7EB 1LMIA 4PGBB 3ZDYF 4JFXB 1J9TA 4U1JA 4UINH 4KC3B 1YMMB 1XTMA 2D3VA 5DS1A 2XVBA 5DS8A 3V7MA 4IRZL 4UOJA 5B7FA 3I6GB 4N2IA 3TGXA 4ALAL 1CFVH 3H6JA 5EN3A 1YMHA 1OTSD 4MD0B 1UZ6E 3MLZH 1JZEA 2HT3D 4GLRI 4Z3FA 2ATPB 3WNKA 3WJJC 4BFEA 2GHWB 3CVBA 3AVEA 4LB8A 3HS9A 1E3ZA 5D2LA 2F54A 4P57B 4HWBH 4AEIH 2OI9C 2XJLA 5HJGA 5T3ZL 3O6FC 1NLDH 2FGWL 3BAYA 5CLTA 3U2SB 3GS4A 2OI9B 5I6PA 5IVNA 1DUZA 4KKLD 4QY8A 5FW6A 4A2DA 5BW7C 3DRTA 4TVPD 3OKLA 4MMZC 1ZLVK 2NY7H 1AI1H 4MNGB 1S9XB 2H3NB 1T6VN 2AAAA 3J07A 3BSZA 1INEL 2CM6A 3SOTA 5I1DB 2B5IB 3K91A 4MRCA 1JZ8A 1A4AA 3ZRCC 4WI7A 4X6CE 3MOBH 2Z31A 4FNLL 4KNQA 3TIEB 2VLRD 5C2BH 1CLOH 4NZUH 1KCSL 2OMWB 2Q2LA 3IAPA 5ICUA 4X6DF 3OVUB 3GHEH 3RWJB 4YX2L 2WP3T 3KHOA 1OXYA 2AXWA 4FI8A 5AW8B 1G7JB 1QKZL 4MAYB 1N3NB 1PZDA 2BHZA 4HOXA 5D2NB 1QFUH 4ZFOB 3WNJA 5KYUA 3AQYA 3VFMA 2BS8A 4ERSL 2D0HA 4ATWA 3ELQA 1TCRB 3G5WA 3KL3A 3QDMB 1A1MA 3Q9QA 4O9HH 4PREA 4CC4C 2CLRB 3BJLA 4HDIA 1RK1B 4Z5RB 4AQ1A 4N2EA 2D4DA 2A4ZA 4S1DC 3L7EA 5IHUH 2WQVA 1CK0L 5EDSA 4UB0L 4X6DB 3IJSB 4B9IA 4YO0B 4IK6A 2PO6D 5HVWA 4QRQB 1D3CA 2EDDA 3CH8A 3MRKA 4PRAB 4G7VH 1X9RA 2XQYA 1CICC 4JM2A 1ORSA 2XV2A 5GIRA 4EUPH 2CPUA 3B8SA 4I1PA 2H45A 4QXUH 4TUJA 3AFLA 3SDCC 4M56A 1F8TL 1A65A 2K6WA 2ZTBA 2PYEB 3FS9A 4GKZB 3KPOB 4W9EC 4G8GA 1N18A 3KLAB 4HUUA 3EXJA 5FV2A 2BXZA 5HYSG 3NJKA 4NQCD 1ILSA 1JV2B 1I1AD 2R23A 1IB5A 2R1XB 3B83A 3QUYD 4KQ4L 4XMVA 5E08L 1NANH 5FCUL 1JE6A 3QRFM 4JO1H 1D7DA 2VRQA 4MXQC 2IANB 4JO3L 4IU3B 3C5ZC 5DT1L 1PX4A 3BXNB 4Y9GA 5TDOB 2W65B 3CSTA 3SJVE 1KN4H 1VFMA 2KC0A 2KLRA 1Q0XH 4N9OB 1AZRA 4MJHA 1P6FA 3OHMB 4DNLA 1JI1A 3FCGA 2BIOA 6FABL 4FCHA 4C58B 4NQVB 4CVXB 3MV01 4EIUA 4EE2A 1X5XA 2XFXB 5ID1A 3TP4A 1QFPA 1D6VH 1HHGA 3MNZA 4CDHA 4LFHG 2Q5BA 2ZSWA 3IU4H 4JNXA 3PL6C 4GP8B 3TBVB 1KXQE 1REIA 5DHYA 3ML8A 4I3SL 1Q1PA 1SUJA 1ZPUA 5E2TH 3WEAA 3GB7A 3GBLA 5T3ZE 3BP6A 4YXKL 1JPTL 3CFKB 3G6DL 2IGLA 4G42A 2IPUK 4R8WL 4RAVA 4EBQH 4EQ2A 3JWNG 4TUUA 1IM3D 2BP8A 2CA4A 3IXTA 1G9MC 4NWTH 3ARDB 4HISA 4UYPA 3INUH 3O2VL 3LIZH 3VCLA 3ZZSA 2X3CA 1CD9B 1JYVA 4G6JH 1M3IA 1ZJAA 4FXKC 2AEOA 2VKXA 2JELL 3WDJA 1YO4A 4HK3N 1S3KH 1ADWA 1XL4A 1LP9E 2ESVA 2VZOA 3MV7E 1PZBA 3KYOB 4IK7A 4F8OA 2ZXCA 3CAFA 3DX4A 3NUKA 3APDA 1HESA 4PJXA 3VO0A 3GMPB 5H4YA 2ZUUA 1FL5A 1SVZA 5C0BA 5GGTA 5AALA 3RGVC 4J2XA 1OP3K 2K9FB 4OIBA 4HCRL 2WY3B 4NHUB 2IQ9L 3MR9A 3CHQA 3DYPA 2YXMA 2NYYC 4KHTL 2YAOA 1ACYL 1RZ7H 1UFGA 2WWOA 4N2MA 2WTOA 2CGYA 4A7UA 3IPFA 4EZKA 1U36A 2UZYB 4NKMA 2Y1YA 2EEBA 4OLYL 5F7KC 5CAYB 3DSFH 3Q48A 5DTFB 5BO1L 3LZRA 3IMWA 4PY8I 2HKFH 3LPWA 1DUYB 2EDHA 3EYUH 2R8SL 3KDMB 1V3KA 3CZJA 3VQ1C 1DR9A 2YAPA 1OAUL 3DRQB 4JX0A 3RWDB 5B4MC 4L9LA 1R9FA 1FZMA 1OALA 4JM2D 2LU4A 2EUXA 1WA2X 1MCFA 3HNSH 4PY8J 2DQGL 4R84A 2FR4B 3GBML 5I1LB 1RZJH 2VDNH 5KYYA 5I71B 3RFZA 2G5RA 1RJLA 2I9LA 1XR9B 5BZDA 1QFWM 5KW9L 5FK9B 3VXME 5E9DB 2E0PA 2XN9A 2GITB 4YH6A 1LEKA 4MNGE 1E4XI 1HEZB 1MELA 3ZKMD 3HA0A 4IBWA 4LRNH 1QRND 4HU2A 5IIEA 4LPYA 4R3SA 4WI5A 3D7PA 3GRBA 4J1UA 3CCHA 1QSZA 4YDVB 5CFHA 5JR1L 2ZONA 3VMNA 1AO7B 2Y6TE 1SEQH 3UZEC 4RVBA 4JUSA 2G3XA 1FUNA 3WEMA 4PS8A 5AG9A 4P5MA 1Q90A 2NNCA 3FTWA 5D7HA 5D72H 4P3DB 2BNUA 2K8MA 3N06B 4KGJA 5AZ2H 2H3KA 2Y3NA 4M7ZC 5HGBB 1G0YR 3QNYB 2ORBH 3V4PH 4F8LA 2FBJH 4I1NB 4I9WE 3I75A 4PJIF 1RZGB 4XPBH 4Q0XH 5EBMA 1JGDB 3QI9D 3AWGA 5FM4A 1E8XA 3F00A 1JZ6A 3SKNA 3VI3E 5D5ME 2WO2B 4QTIL 3HE7B 1IC7L 2LT9A 1BMWA 3FU0A 3MBXH 2FHBA 1BF2A 4JZNA 3MDJA 1MCLA 5IQ9B 5MEOB 4G8AC 1E4WH 2YAFA 5BS0E 1YEJL 2F53B 4HGWB 2EIZA 1UUNA 2DWDA 1SY6A 2Z4QA 4GOSA 5EZIL 3WTWA 3TF4A 1OTUD 3IRZA 3HHMA 4EN3D 43CAA 3UP1A 5JUEH 3MLVL 3LKSA 4TF4A 1KXVC 4FQJL 1HCFX 2EINB 3GSVA 4OH2A 5F7DA 3OMAB 1KLFA 4ZTOL 2YAQA 4RWHA 5KJRL 3QEHA 2WWMC 5I1KL 3EGXB 2W07B 2XQBL 4F7CB 2GJ6B 4TULL 1TU2B 5JDSA 1RIVH 5DZOA 5EBLB 4D3CL 1XCWA 3X3FL 3ZE2F 5KVDH 1CGUA 3QQ9C 1L0QA 4X4YB 1A7PL 2KLSA 2Y22A 4PAZA 5HYJD 5FKAB 4PM1A 4X42A 2HJKA 4YZWA 3G6JA 4X4KA 5ESVB 3TZVC 3ZTNL 1A6AB 1EXUA 1A5FL 3CFEA 3PAZA 5DQJB 2ZUQB 2FATL 3DOHA 3D0AA 2CJ3A 2QGDA 1CC3A 1HXMA 2XV0A 4X5RA 5J1AB 4TXVB 5BUPA 1CXKA 3BAWA 3C12A 3H4FA 4YGAB 1AKJA 1A14L 3MJ9H 5CHNA 4LPCA 3Q6GL 5TE6H 5I8KH 2F58H 4PRPE 3NPSB 2HT4D 1OGPA 1K4DB 3KYAA 1NBVL 4HWEL 4ODWA 4ICWA 4K5LA 5KVEE 2OZNA 1UA6L 1IBGH 1QR4A 3VWKD 3IGFA 1SY6L 3A4AA 3WENA 2P26A 5D7LD 1E7UA 3FONA 4ZFZB 5FYJU 4NZTL 1WFOA 2BNRE 3DDFA 1JHTA 4AC2A 1P1ZB 1DVUA 3FXIC 1OGAA 2C4FT 2MMXA 1MLCB 1D5IH 4G5AA 4NQDA 1A7QH 2IQ9H 5DC0A 2F1BA 1MCWW 3MLTA 2E6QA 1S78C 2VDRL 3KE0A 3V4PA 1S5HA 1WHOA 5B3JE 4PRIE 3RU8H 5CFAA 2CR3A 2ZG2A 3PNWA 4V33A 3PP4L 4YMPA 3IEAA 1PZSA 3B43A 2VAAA 2FLMA 3QUKA 1J5DA 2X0VA 5BW7A 4GXUM 3GKZA 4AVKA 2BS9A 5I1AB 5HDBF 5FWQA 2GVYA 4EF3A 1NAMB 3WOVA 4UT6L 2ZWLT 3QFJA 3N9GL 3NA9H 1IVLA 4UT9H 3VD1A 2AC0A 3FUFA 2X10A 5TDNB 2E47A 3D39B 2H32H 1EZLA 3U0TB 3AAZA 3QK0A 1O6VA 5I2IB 5H35B 2MHAB 1HSAB 4KVPA 4MB5A 2YGOA 2JB6A 1BFOB 3ZKXC 3EHBD 3LD8B 4UF7C 5K39A 4FKKA 3MGAA 3EJZC 3VE0B 4IGBA 4M93B 5LVEA 1LDPL 4MJJA 4AJVA 3NCCB 3DVIA 4W81A 1DBBL 5BVPH 4ZO7A 4XPHL 1JGIA 1M1XB 3V6ZB 1AGBA 1ES0B 1KCSH 1GA2A 1M1SA 2BS71 3II1A 1NAKL 1X6LA 3DVFA 4P2OB 3V55A 2QTVA 1FH2A 2R2BA 4OB5L 3T3PF 3B7UX 5JYLA 3QUYA 4BUQA 4JHBA 4NQDE 1MXGA 3HAEB 4U3CA 2MRYA 4Q6YA 4EI0A 4ZOCA 5IQLA 4GKNB 2WBJD 4K9JA 3II3A 5E2JA 1ETJA 5HPMB 4XNXH 2MFNA 2XACC 5HDRA 5HDWA 1IEBA 3MRNB 1XGYL 2A9AA 5BQDA 4AGOA 4AGMA 4GP4B 1RVFH 4XAWL 5IJKC 1BVLA 5IVXA 2ZKWA 5D1ZD 5IW3A 5AW3B 3FQ1A 3DHPA 5F9AC 5JTWA 1QBLH 4X98A 1G7HA 3CBKB 1WA0X 5TH2A 3T0ED 1IGJA 4QRSA 2O1AA 5BOZG 3FFOA 3TEWA 2OMUA 4HIJA 4X99B 4A2FA 2LAAA 4N68A 1PS3A 3H9SB 1S2EA 4XB7A 5AKVA 1MJUL 5DS8B 4BWUA 4I0PB 2XX0A 4Y4FB 3I6GA 3WD5H 2VB5A 4OUUB 3IJYA 1WEJH 1UCBH 4LPXA 3VSTA 5D1QC 2CH8A 4EUPA 1JGVL 4PPTA 2X4RA 1JHKL 4L3EB 4MAUL 1PZ3A 4HWBA 3ZQ9A 3DMMB 3FSZA 4L4VB 1CT8B 3VGDA 4ZW5A 3E6HB 5TE7H 4PJEE 4XVTL 4FTVD 1BG1A 1YRKA 3KJ6L 3TPUB 3CC1A 3F7VA 5IR1B 5CBEA 3PWLA 4R0LA 2BZCA 3R18A 5HHVH 3U2SA 3BP7A 3BGFB 1Q0XL 2H0FA 4KJQD 4X4ME 1HL9A 3V5DB 1U2CA 2ZCLL 4Y5VB 3SYCA 3VI4F 4KV5E 1OZUA 4G8FA 4ZO6A 2G30A 1I9JL 4PD4J 5HSFA 5BS0A 1ZY9A 5CJ5A 1U4EA 2Y5TA 1E9QA 3VRIA 4R5VA 5L2KB 3SE8H 1EEYA 1N70A 4A63A 2CPCA 3KH4A 2B77A 5E2UL 2P28B 2X2JA 5E4EC 1QNIA 3DX6B 2E7DA 3KLHC 4Z7QE 2W0PA 4JB9L 2X4UA 1QRKA 4NZTH 4F2EA 1KN2L 2TSBA 4PI2A 4XH2B 3LXBA 5DK2A 3QYCA 3U1SH 3FKUS 3FMGL 4IQHA 2LU3A 3GIVA 4Y16B 2F9BT 1JNLH 2AQTA 4YEFA 3KG5A 4OZFA 4HJEA 4WCYL 3T4YA 1KJ2H 4J3OC 1J1XH 3WLWC 4E9TA 3RX5A 3B56A 1PKQB 4XC3L 1FIGH 4U33A 2VN7A 4H20H 3B3BA 3RNQA 3AM8A 1UD5A 1JWMA 1L7TH 1XD0A 5I17A 3IVKB 1S3KL 4LLVB 1KEML 1RJYB 2YFOA 3P9MB 4KAQH 4M00A 4N1HB 2V3FA 4N8CL 4PGEB 5FUCC 2PYEA 5M94B 1KCRH 2B15A 4J4PC 4HKZB 4LHUB 4P49A 1G4RA 1SOKA 5IFAL 3NIFB 1LE9B 2A1WL 2DBLL 2SODB 1T22A 3KBEA 5IQOA 4NKDA 4AYDC 2HA1A 4Z7UF 4ZTPH 5D6CA 1JZHA 3FQWB 2Y2WA 1W6WA 4HLJA 3ILQD 1T1YA 2OW6A 4JVWA 4P2YA 4AG4L 3ARVA 2N4IA 4U3SB 5H94B 1AACA 1F86A 2BVPB 3OLDA 4XCFL 3QYNA 2J6EH 4C55A 4O2FB 2HKFL 2ZWKA 2W65A 4PTTA 2OYPA 2NXYC 3HZMA 3DJZA 2WPGA 5GGUB 1QO3A 1FGNH 5KJ7E 5ES4B 3WTYA 1QLEB 2VL5B 3UX9B 4CC0A 2A0LD 5AVSB 4L5FE 4UT7L 2P7TB 1GZPA 3OSVA 2DM2A 5GRZA 4BFIA 1AG6A 1A25A 1GGIH 1JZFA 2NX5D 1R3IH 2HVJA 3O8XC 3GK8H 1KEGL 3HG1E 1ZTXE 3BFWA 3DK0A 3IRCA 3Q0HA 4K9EH 2OMZA 3D2UA 4PJHA 4DVBB 2DQFA 2H3XC 1DBMH 4DEPB 5T3XE 5IG7A 1IGTA 4BZ1H 5EV7A 4XAWH 2I85A 5ACZA 3QFDA 2EH8L 4IU2B 4ODXA 5CEXA 5EIIA 1WAPA 4L37B 1S8DA 5JQ6H 4LO9A 5DHYB 5DJDB 4ODVH 4MXQD 2GFBB 3ZW3A 3DYMA 3RB7A 4S1SH 3C09B 4YAQA 5KS9F 5D4JA 2CJUH 4KWUA 3QQ4B 3HS0B 1JNHA 3RL1A 4PV8B 1OCWL 3SSGA 3G04A 4XRCB 3TA3A 4WNQA 2QHLA 3O6KL 4BV1A 1U3HD 1ZD6A 3CVHL 5GGVL 1MCOH 3T0AA 5FUZL 4NLHA 2CRZA 3NFSL 5B21A 1KBKA 2OL3H 1X5YA 2EIBA 2ORBL 3K6DA 4UQEA 1NCDH 4HIHA 3RJQB 3STLB 4P2CG 3VFRB 5BVJA 1BSIA 3NFNB 4NWUH 3GM8A 1R46A 3IDMB 1MZYA 2FLRT 7FABL 5IEKB 5FYKL 4JN2B 5SWZB 1CL7H 5AB0A 1YN6B 3GJFK 3NH7H 1GC1H 1M6OA 3SGDH 3IE9A 1JYXA 3L08A 4I3GA 5IF0A 2JKNA 2O61B 4NFCA 4J39A 1YYML 4UT6A 4FQCL 4NQCE 2BLFA 4AGLA 3GSWA 1BX2A 5A16B 2X89A 1NGPL 2DL2A 2X53A 4DIXA 4Z3TA 1M7UA 1E5AA 2WNGA 2OR9H 3HBGA 4NHUA 2FQEA 3TM6A 3IAGC 2P80D 4NHCL 4W1TA 2OYLA 1JNJA 3C08L 3EYFA 3GSXA 3HIZA 3FUIA 4D0BA 5I6XC 4NKMB 3QHFL 5KYNA 4P59H 2NY2D 1A4KA 4TLUA 1Q0EA 2YGQA 5I16B 4C4BA 5KBNC 3SDXE 4OLXL 4BFKA 2NTFB 5D7LA 3LOWA 5E1IA 2VDMB 3LB6C 4TULH 5F1SA 4ZW8A 2EQDA 5TK2A 3ULVL 2PKDA 3I50H 3LRKA 3T6WA 4MB3A 4FHBD 3SGDI 5CILH 4Z7VE 2EABA 4JFDB 4BEIA 5CSZB 1EANA 1JCVA 1LE9A 4DW2H 4ONGL 3U9UA 5JHDD 4GQPH 3BVDB 3KMDA 2A5UA 1IC5H 1NCIA 5HI4C 4Z7NE 5SX5H 4P5TA 4PW4A 5CINL 1D5XA 3FQTA 2OMTB 4I5BA 3WLBB 3BKYH 4JL2A 4HWEH 1X9UA 2FWUA 2B4CH 2CGRL 3CFTA 2D73A 5DC4B 1CGSL 4TNWK 5HYFA 4JBSA 2AJUL 3WKMH 4PVLA 4KVCL 3KPRD 2EYRB 4NUPA 2VR5A 1AE6H 3OHXB 4ZPTB 3CQQA 3U7WL 1IL1B 1S9WB 3OGCA 1WCQA 5B39G 3QNYA 3C6SB 1T3FB 2VR3A 1CDHA 1X4YA 1YYLL 4K23L 4MA8L 3VFPB 4R7DA 1OARH 1V7ML 4FG4A 1HYSD 2VDOH 4HH8A 1DCEA 4OM1L 1MRDL 3ZKND 3RU8L 4JM4L 4P5KB 3C8HA 3T1FB 4LKXA 4ZQKA 4LCIL 4NC0B 4WFED 1XQ4A 5C2BL 3BVNB 4J3WA 3FFCA 4OCRL 4D0CA 5L0QB 5BOJA 4QYOA 3DI3B 3VU1A 3E8UH 1A7RH 1EJFA 2GEEA 3MRLA 4UT7H 3AJ7A 4Z95H 4NZ8A 4OI8A 4ABWA 4QCIA 1JVLA 2P8LB 3FSWA 4L8SA 1SHWA 4OCMC 4AYFB 1HK6A 3K2MC 3NSDA 4IS6A 3LKSB 4L3CA 5DURD 4LESA 4XO9A 2X28A 3GSVB 4ONHA 5I8EB 4DF9A 4L23A 4OZIF 1LEGB 3ULUH 4NKOA 1VF5C 5JNYA 1J1PH 5IBLC 4YHIA 5D1ZC 1G7LB 3TEXA 2BDNL 4BCYA 2KUTA 3LQAL 2JKIS 3Q2LA 1X7QB 2JE8A 5J4MA 3VA6A 3KPSE 3ZE0F 4UUJA 4OGAD 2R1YA 3PIQB 5A2JH 4ZJ9A 5C3LD 4MA1C 1N59A 1CZ8H 3VFVB 2MH4A 5ESVA 1AGDB 3WEXB 4LDEB 1BAFH 4FS0A 4ELMA 2F15A 1U33A 4ADJA 4W4NA 5DVKA 1JPGA 1GIGL 3QZLA 4J6IA 2IPTL 1OB1A 2JIXA 3ZE2E 5I1CL 4KK8C 1QTPA 4OZGB 5FYKH 3OJMB 3BCDA 1HSBB 2K78A 1V54B 3T6XA 3EJTA 3HHSA 2AJXH 1FVCA 3X14B 2DQDH 4R4ND 2YPLE 3C9NA 4JPIA 3DLQR 3VD0A 4XOEA 1T0NA 4NNXA 1CDUA 5C07A 4JLRB 2E59A 4JDVB 3KWXA 2BZDA 2FQDA 2WWNA 4EDWL 5JXAL 1D5MB 4KUCF 4B3VA 4KTGA 3S4SA 5GZNC 4IMKA 4F37F 4AIZB 4FE9A 3CFMA 4LP4A 4AIEA 3U30B 3W9DA 1DBJL 1RK0B 2R0KH 2FUQA 4N6RB 1J05B 2C3VA 3RWFA 4NKIH 4UQCA 4CGUB 5IESL 3VXRD 3APFA 1QATA 2VDQL 5F2FA 2QKIB 2EZ0C 1NJ9B 5B8CA 4OZHE 3QDJE 3TBYA 1MFAL 4B0MB 3D05A 1JDAA 4N0RA 3MV8E 4CAGA 4PUBL 3EG9B 4QIRA 4CNIB 3ULUD 3ET9F 4PJ9A 1SMOA 4G9DA 3KJ6H 4HWBL 1I1CA 4DKTA 3GO1H 2R9HD 3U2IA 4I18C 5LGYA 1MVFA 4FI6A 1QPPA 1OTUC 3T77A 1YEGL 2WKOA 3EFDL 4I1RA 4RLDA 1CFQB 4TSCH 4U3XA 1Z9MA 1ZVNA 4QRUB 1JZ7A 1MVUB 5MERB 3OF6A 2RBLA 4ABQA 4FA7B 3GF8A 1DJIA 1MNUH 3OKMA 3ZBMA 3BWUF 5E1GA 5MEQA 3L2LA 1TZHB 2AXHA 1ODAA 4FC3E 1DYZA 2ICEA 4OM0L 3FF8A 4XNZB 1UKSA 4R4FL 4GKOA 3UBXA 1R33A 1XGPA 2Q6WB 3BGAA 5F3HA 2JJWA 5FDYA 1AKJD 4X50A 3IWUA 5DK3A 2TRHA 3EDEA 1AHMA 1FG2A 1MREH 1AC6A 4PI0A 3U0PA 1KIPA 4Y2DA 1NEZA 2C3WA 2CLVA 2QLVB 4Z7OE 2VC2L 2H2PD 1G9EA 3VD5A 3A3YB 3V0HA 2D7OA 2G2RA 1KJ3L 3NA4A 3KPQA 5HYJA 2PWEA 4GKNA 3WHE0 2X2YA 1FPTL 1KGJA 4E41E 4CU7A 2Z3FA 3DO3A 1U8PB 1X5ZA 3OJ2C 4KKBC 3PP3H 4LKCA 5FHAL 5LG6A 2WYHA 1J0HA 1CFVL 4N4YB 1CU4H 3IETB 2XX1A 5KSAC 1U6AL 3QORC 4XX1E 3VGAC 1RZJC 2F61A 5JYMA 5KSAB 4ZX5A 1UGKA 1A1OA 3DSNA 4FABH 2GJ6D 4XNYL 1YEEH 4EI5D 1XL6A 4AZ8B 1NH6A 4W6WB 1F42A 1NINA 4OFPA 1Q1JH 2GK2A 3GJFH 3S6CA 2B9AA 4BSVA 3S37X 1XX9C 3HZVB 1ZHNA 3QQDB 2HRPH 1Y07A 4WENB 3MLWH 4WEBL 1UUSA 2VZSA 3MUGB 1WS7A 2Q2EB 2ARJQ 4GINA 2ICCA 4QOKA 2DKSA 1RPKA 4OGQC 2ZUVA 1T5WA 2H6OA 3IWVA 2X4RB 2G3NA 1D5ZB 1D7FA 5IBUG 1IAIL 1E8YA 5C9JA 4YE4L 1ACZA 4AOFA 1WE5A 1KUMA 2FL5B 5IMOA 4LLUA 2EVJA 3HUJB 4PMFA 1WAAF 2WP3O 4FNLH 1DUZB 4FQHB 2B9BA 3PWLB 1AR1B 3WDIA 4XGZA 1UZGA 3BP7B 4WY7H 1FYTD 1S9VB 3OZ9H 4PJGB 1I7ZA 2DW5A 4H88L 2H5UA 5HDBE 2RR3A 3G08B 3SQOH 4BD4A 1UJ3B 3ATEA 2JLPA 2O72A 2V2XA 4W6XB 3V4UL 5JOPE 3S5YA 1L3NA 3K0WA 4YNYB 5T5FA 1UFUA 1CK0H 1QLEL 1N2RB 4TSAL 4WU7A 4YL9A 5GS0C 1QPXA 4LCWA 3V0GA 3FTXA 3ZO0A 4R7NA 2G60L 4RMBA 5F1KC 1BXXA 3QI9B 5KSBE 2AV7B 5D2NA 3B2UD 4F27A 2X1PA 4I89A 4BBWA 3GHBH 1BJ1H 3NJLA 6CGTA 2CIIB 2AJSH 2YPKB 1PG7L 3ECWA 4PCKA 2JCWA 4LOUC 1AQKH 2B0SH 1TO5A 4OZFB 7CGTA 2BPBA 2Q3XA 3H3PL 4RMSA 4UI2A 4W9GC 2YD9A 5MEPB 4C4KO 3HI1B 5DJ8A 4OJFL 3LHAA 1MW0A 1F00I 4KQ4H 5DYOA 4LDCA 3DDGA 3QG7H 5IK3A 3ALPA 4B9JA 2F19H 1JF1A 4C4KT 5LN8A 3L3OC 2QR0B 4NO5A 4DPAX 4GKZA 5H2BA 1PY4A 5JHDA 4GKSB 2GSIA 3R4RA 4ZW7A 4LLYA 2VM9A 1Z5YD 1UXSA 2J72A 3EFDH 1CLYH 3H55A 4G6KH 5E7FA 4YSCA 5I9QC 4XX5A 1M71B 2ZP8A 3GPEA 3L16A 4YHOH 5IHZA 1T22B 3QIWA 4ZDHA 2UXGA 3EOBB 4H8VA 3GDBA 4HCIA 1UACL 3EDFA 4QRRB 1J5IA 2DJSA 1SXZA 3PU7A 4LNRA 3WL9B 3DC0A 2OMXA 1W72B 2E3VA 1I3RB 4WDIA 5L8JB 2YARA 5GS2H 5K9QG 2LQRA 3CDFA 1XBRA 5L2JB 2Z4TA 1MQKL 1TXKA 5E00B 2WSPA 1BVNT 4B53A 3MCKA 5ID0B 2CIKA 5HHXL 5C0FA 3WXWL 1ASQA 1M2VA 5J11C 4NBYB 3BIKA 1YG9A 2NY4B 1IM3B 2HX8A 3EDKA 3GBMH 3TBWA 3NIDE 2LE9A 3NMEA 2VLJE 5L2KD 1OCRB 1S7RB 3QA3B 3M1CA 2BK8A 3BWAA 2DQFB 3A67L 1Q9LB 3IDXL 1N9PA 2J4WL 1IC5L 4ES9A 3MHZA 2YQ3A 1OY3B 2DLHA 3S36X 3PJNA 5IVZB 1XCQB 2YUZA 3WE6B 2P5EB 1IAKB 2IWGA 3GB7B 1VACB 2X70B 3PWJA 3RHWF 5G4OA 1WA1X 4KDTA 2W92A 2WXOA 4U1LB 2R1WB 1MHEA 4WU5B 4ZUWB 2HFGL 2BP8B 3LCYA 2FTAA 4FQXC 3RL1B 1JD9A 1JIBA 4IDLA 2ZCKL 1JRHH 4NO3A 1FFTB 3X12B 2P1YA 5DHVA 5HHMB 5BRZB 1BF8A 4H1LH 3W2DH 3BRFA 4FFYH 3RDTA 1L9OA 4PTUB 3DX7B 4ZUSB 1B0RB 2YN5A 3KVPA 5BNXD 4CN1A 4R90L 2DQMA 1BXVA 1ADQL 4XX1G 3IFOB 1NEUA 1QBML 1QSVA 3FBQA 3AXIA 5KTEH 2A9ML 2KQMA 5F9OL 1FL5B 4JW3A 4UV7L 3F6LA 4FNPA 4N87A 2X12A 1UZ6F 2DMCA 2A38A 5EUKB 2WQUA 1I1AB 4BUGA 4EIZC 4R7VA 1MCCA 1TENA 2DJUA 3ARXA 2EXTA 1E4HA 3SQOL 3A4EA 3VSVA 1B0IA 3S8FB 4AQAA 3I6SA 3ELAT 1RZKL 5KVMC 3Q2CA 3RG1C 1FFOB 2OYKA 1XFPA 4YQXL 5AVRB 3U6RA 4KHXH 4BUHA 1TJIH 2UZXB 4N1CA 5I1KH 2Y7SA 4UQ9A 1UWEH 3MLRH 5IOPB 4HS8H 2FR4A 2DMHA 4NZJA 4PV9A 5EU6A 2A74A 3S0PA 3MJ9A 4CKVX 2GJRA 4NT6A 3IE4A 4PVNA 2NNAB 3OB0H 3C5SB 4ZMAT 1OSZB 4M7KL 5FK9A 5A1AA 1AGCB 1ORQA 1U8KA 1K3IA 3SDYH 5KYXB 3AT8A 2LTQC 2Z64C 3G5XA 1KC5L 1EO7A 2B59B 3SQRA 1EEQA 3D69A 4P2AA 4R3SB 8FABB 1U3HC 2JKTM 5J12B 5EU5B 2DQHH 3G3LA 1D5XB 2CHDA 3NIGF 5FUOL 5DLMH 5F7FA 3WLBA 3QQ3B 4MAUH 2B5IC 3KZ8A 2AABH 4D94A 1AR2A 5KS9E 4LLMA 3VXNA 1T5XB 2ADFL 3HLKA 1MCWM 1MIEH 1FNFA 1CQYA 2IWFA 1GHFL 4EI5A 2ADGB 3ZX1A 2YQGA 3EGSA 3GEFA 4FQLH 1DBAH 2VDNB 4U0RC 1K6QH 4NSKA 3UC0L 4N8VB 1FWXA 1TJXA 4FQ1L 1A3QA 1AJ7L 4NRZA 5D7IF 2H2SD 3PHOB 3OX8B 2C9SA 3EJYC 2VE6B 3T1FA 3E7JA 2Q8AL 1YMMA 5D93B 1NCUA 2C7UB 2X4SA 3QNZB 4HV8A 4X6FA 3EBGA 1UXWB 4NOBA 4PUBH 1CS6A 2Y7NA 2ZUQC 5I76B 2O5XH 1URLA 43CAB 5KVDL 2IFFH 5T1LB 1FNGA 2PCFB 5GGTL 1HOEA 5B1KA 3RVVC 3UG5A 2OCJA 1KLFB 1VZGA 2MCPH 2W9EH 3PDDA 4IJ3B 5E0QA 3FB7B 2R7EA 2F54B 2XSKA 1GSMA 2YQBA 3UO8B 5DFTA 1XEDA 3BOVA 4NO0B 3WS6A 4NKOB 5DUBB 5I15H 5I6MA 2PXYB 1JTPA 3VW3L 7TAAA 5LNDA 1UCTA 1G87A 2C9UA 3FB8A 4MVBD 5ICXB 4GQZA 2JKXA 3G6JB 3Q8AA 4ZFFB 3FUDA 3HC3L 4MJIE 3BPLC 2BSSA 1TKWB 5ADPH 1HT6A 1OP5K 4RBPK 5D1XE 5AVXB 5LAXB 3BN9D 2RFXB 4KH9A 1AZNA 2K3HA 3N3EA 3WLWD 3U0WH 4U3HA 4PJCA 3HS8A 1DQDL 1SEBB 4LGRB 2ARJB 5F1IB 4ELMB 2OSXA 1D5IL 1AHWA 4S10A 2DWEB 4JVPA 4QLRA 1N3NA 3GUFA 5LGHL 5FEBA 1TLKA 2I32A 5EEXA 3HHSB 2HVBA 3WIHA 3VFGL 4XVJH 4NM4L 1BZ8A 4A7VA 4GI9A 2GT9B 3C60D 4RESB 4YZFE 3IAQA 4KY2A 3O6LH 1O7VA 5J57B 2UXVA 4YXHH 4YLCA 2GB2A 5IMLB 1I8KB 1KGIA 3GMLB 4RGMC 4A7GA 4QRQA 3TA4D 4DESA 2CCVA 5AZEL 1XIWD 2Y07H 1LILA 4JM2B 5CR8A 4X2UA 3ZE0E 1ZSDB 2M83A 3DPBA 3NZ8A 5I0ZA 4BRJA 4N6RA 1BZ7A 2MPVA 1J05A 2O6DA 4ATTA 3M07A 2A73B 3JYCA 3WD5L 3CXFA 5F89B 2D4FA 1RPQA 2VH5H 4XC1L 4UCFA 5FHBH 2Q86B 4GH7B 2MJWA 4G9FE 4LGPB 4MQ7B 2AJZA 2WBJC 5JZ7C 3WYRA 1G7QB 1TTFA 2ZF9A 3LN5B 4MNQA 4NB7A 2KQNA 1PD0A 2V17H 4OUOA 4U1GC 1N5YH 1AO7D 1HSAA 4O58H 1WICA 4KJYA 4U1GB 2IANA 4P4KA 1ZANH 2JWYA 4KKAC 1DQLH 1OT4A 2WJ7A 2G9KA 2DM3A 2HLFD 4E5XG 3RGVB 4ETQB 4E42B 3CIAA 4MDIB 1MH5B 3GWJA 3L45A 5DR5H 2K6ZA 3D06A 1MCSA 4P2RE 1L5GB 5CJOH 2IBZX 3FW6A 3GSRB 4TSAH 3I3EA 3KPLB 4GSUA 3MRRA 5C7ZA 2B20A 1UXLA 2WXRA 1ICTA 3D4YA 3LVEA 2XFXA 4DK3A 2WLMA 2OXGA 4I0PC 4Y4FC 3UG4A 1OPGH 1U92B 3LKQB 3STZB 3US1A 3VTTA 4U1MB 3MV11 4ZBJA 2EECA 3I2CH 3L5IA 4Y2DB 3TOPA 4L8DA 1YAZA 2ZSWB 3D48R 1DN2A 5CZRA 5AUMA 1BVKA 1WC7B 1MJJA 1TTBA 3L4CA 4JZOA 4ZK8A 5INDB 1RP8A 4K94L 1BFVL 3PJSB 4GRWF 4O2EA 5HHQB 4LKCB 2QVMA 3L1EA 1WAAE 1OZTG 3ARYA 4AX3A 4KJQC 5JPMB 2ZT9C 5AVWB 1A6PA 3TNMA 3UJTL 1IGJB 4H20L 3AREB 4QRSB 3RY5A 3ZXAC 1E6JH 1TZOA 4Z7QB 1FA4A 5DZJA 1R4XA 3NIGE 3VXRA 1BYPA 2W0FB 1Y0LA 1INDL 4WGWB 1A3ZA 1U30A 3VB9A 4M5SA 2E9JA 4PJ7E 3RPIB 5F1NB 1BYNA 4BSVB 5IB5B 5JXEA 2CRIA 2NY6B 3B7YA 3NCJH 4K7FB 4JZJA 3ARFD 1CQKA 2VM3A 4ONGH 2ZOWA 1BM3L 5D7IA 3KCPB 5GSRB 1EO5A 4QOKB 1WGVA 1AC0A 3KM2A 4DH2A 1CT8A 3Q43A 4IOIB 4A2GA 3VW3H 5D1QE 1WRFA 2XIBA 1PG7W 1AO7E 4NQQA 3UJJL 4GRWE 4CSTA 2I60H 1DZ0A 2B4CL 1WFTA 3EHBC 3HUJA 3MACL 4Y8AA 1RH8A 3FN9A 5K9KA 4PJ7F 2NY0D 3T2LA 4HMDA 3U48A 1UOWA 5FOJA 2C1PA 2Y6SD 2KDYA 1KN2H 2X1WL 1F1GA 4TRPH 4WKZB 3EUUA 2YEQA 4FMVA 2FIKA 1FYHB 1UH2A 5EU3B 2Y7QA 4HCRH 1L4IA 1PAZA 3ECUA 4QAWA 4MB4A 4EZLA 2ADYA 4L9LB 2EVFA 2NY3D 3HE6C 1WZMA 2J1WA 4P5RA 4ZNEE 4YNYA 4ZNEA 4WCYH 5IBTL 2FJGA 2NYKA 1G9HA 1F3JB 1YPZA 3MFFB 1F0LA 1IC4H 4U1IA 4LLQB 1UM5L 1KBVA 2NZ9C 4HWZA 2ICWJ 2OTPA 3UERA 2BVOA 5J6HB 3O6LL 3OR7B 1OCZB 4APXA 35C8L 2HFFB 2NXZC 1MWAA 3DIDA 3S4SG 4C54A 1HEZA 1VGKB 4Z3HA 1X9LA 2YPKA 5DFWH 5CBAA 3MRIA 4KAQL 1BD2E 1W9XA 2WXLA 1KTJA 1P2CA 3P3YA 3T4YB 4AL8H 1FCGA 4KH2A 3ZK0A 4MJ2A 5F93C 5C0JA 4EQ3A 1AO7A 4JDTH 4WTQA 1X5IA 4FMKA 2YK1H 4B96A 4FN0A 2AI0H 3GMQB 4XMZA 3DPDA 4K3EH 3AXLB 4IDJL 4AZUA 2XZCL 2R51A 5B38G 5FFOA 5LGKA 3L2MA 1RP9A 5DYOB 1JSYA 5GZNA 1CBVL 4NN6B 3UBXG 5IROD 2E6PA 2FX8H 3FT2B 4DFIA 1DLFL 2PNDA 3KXFA 4LSUH 4PGEA 1PIGA 1YDPA 2J21A 3QPKA 3KPNA 4NIKB 4YIQB 3RRQA 3QXWA 1MWOA 1NWOA 4UIKL 1IT9L 1C08A 3LN9A 1W0WB 1XO8A 1AGFA 1BQLH 1KTDA 1ZWIB 3FQXA 3O3EB 4FQCH 4GIAA 4YX2H 1NIDA 4IIZA 2E9GA 2P46B 4WW1A 1J9QA 1OM9A 1OQOA 1LO4L 4OD3H 1R3JA 1JK9A 1TTUA 1Z5LA 2ZKXA 3MBEB 2P5ED 3HZMB 4ZMVA 1MW2A 2CR0A 2Q76A 2OMXB 3CD4A 2BCKA 2ZWNA 2NY6D 5C0CE 4CVZA 4P5TD 1VB9A 5F0MB 3LRSA 1LLAA 2BVYA 3MLYH 4K94C 2EE6A 3AB0B 2UWEF 2N7SA 3W57A 5IB4A 1OPGL 1OKEA 1IAOA 1CFTA 1YEJH 1E3XA 2DKUA 3FB5A 4RCAA 1XR8B 3WIIH 4AQOA 5HGHA 1T6WA 5AOLA 5DA4A 1A3LL 1L9PA 1KLGA 3N55A 1YEKL 5CP3H 3NZHL 3K6SB 3F3HA 2QEJA 3AS1A 4QR7A 1D6EB 4F7TB 2E8ZA 2PXYC 3L8QA 1HWWA 3AG2B 3OKDB 4DP1X 1KNOB 2V6HA 2ZKMX 1ZTMA 4ELKA 2G2PA 1L7IH 2IPKA 3IN2A 2XY2A 1ZT4A 4GKLA 4PLJC 4FDWA 4RGMB 2NUPA 3EZ8A 3WTUA 3CZGA 2DLFL 5EEUA 5E24E 1BJ8A 4IHBA 3UBXI 5FCUH 3N2JA 1JCKA 2OPCA 3H53A 2WVVA 4WNQB 3QNFA 5DDHA 3WJMB 4EXPX 2R1WA 4WU5A 4ZO9A 1AY1L 3X3GH 4DP2X 4AMKL 4WWNA 1A7NL 5DD5L 4LLDB 1ETA1 4PYHA 1LE5A 4XWOC 2DMKA 4YDNA 4BSWA 2XFGB 5MENE 4J3UA 5F7EH 4ISVA 3JXAA 1M6UA 1JHTB 3VH8G 3PHQB 4KHTH 1T03L 4LASH 3FO2B 5T8IA 3SZ6A 1YN7A 3MA7A 4JKKA 5IOKA 3G5VB 3BUBA 1YMMD 1NSNH 2VSCA 1T0MA 5I1IL 1G0DA 2PR4L 4X7DC 4LCIH 3MLTB 2CDGB 4FERA 1TO4A 4EO5A 1IE4A 4JKWA 2WINA 1NFIB 4OJEH 4OLXH 3N04A 3EYUL 4UNVA 2R8SH 1J5CA 1CLCA 1J87A 4YDZA 4HXBL 1S7QA 3ARSA 1OAUH 3LKPB 1X5JA 1QYGL 5E2TL 3B2DC 4TRPL 4D9RD 3KWWB 3TA3D 3GXDA 3QO0B 3K71B 4G72B 3P9LB 3JV6A 2XQYK 1A4KB 3POHA 2L7QA 2MOQA 3CBJB 3IKKA 4G7YL 3UZEA 1ZLEA 4LVOB 2C4FU 4W9CC 5MHSD 1NMCC 2MTAA 3MRGA 2DQJL 1IC4L 4MNHB 4KV5F 4G8EA 1T4WA 3JTSA 3X1BA 4ZX4A 2HKAA 3S5ZA 2UUDK 1JV5A 1E3FA 5IOPA 1QEXA 1BFOA 4PMEA 3NSFA 1AHWC 1G1CA 3D2UD 3JV4B 2ZPKH 5B8CC 2FZ3A 3CN3A 1N12A 1Z3RA 5F3FA 4DVRL 3CWGA 4PVMA 5HVGB 1NPJA 3VXTB 2ZCZA 1FE8L 1FL6B 2VLRE 4CADB 4I8DA 1MCJA 3VXQA 2ERJB 4QHNB 4O02L 4GRLC 4BA0A 5ETUB 1C9SA 4M1GL 1GGBH 4JFFB 4L4VE 2N0MA 2Y1VA 4MA3B 1G5GA 1TYJA 3OD3A 3QUYC 4X83A 2E8YA 1SDYA 5AL8A 3HPJA 3QS3A 5E9DE 2B2XL 5BVPL 3W0WE 4HXAH 3HCVA 3UJIL 5JPNC 3R06A 1ZVYA 2EDTA 5DA0B 5JOFB 1SRDA 3QEGH 3FRPB 3JT2A 2F7OA 3B2XA 2XU9A 1R5WB 5ANMA 3THML 4NAMA 4UM9B 4NSKB 1BVLB 5IVXB 2ALAA 4MYWB 1JVOA 4NN5B 2DQGH 3BUPA 4BFGA 3O4LD 3DUUA