1RIHL

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
b'DLVLTQSPATLSVTPGDSVSFSCRASQSISNNLHWYQQRTHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSISSVETEDFGMYFCQQSNRWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of antibody 14F7
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
total genus 56
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL01
2R2CA 4KDTA 5DRXA 4YHOH 3RKDC 4BZ1H 5JW4M 2A6IB 1CXEA 4QCIB 4XWGL 3T0AA 1UA6H 3UC0L 2YA2A 4ODXB 4O02H 3JSSA 1U3HB 2NY6B 1PZ5A 3DX7A 4QRUA 4UINL 5D1QD 2P43B 4U3CA 3IKCA 5GGTL 2X6MA 2Y06L 2CIKA 3LKSA 4EDWH 3HS0B 2W92A 1JTPA 3H42L 4I0CC 1VGKA 1AGEB 2DLHA 2PNDA 4JPIA 4U3HA 3Q5TA 3ZT7A 5JZ7C 1RZGB 1VB9A 3DRQA 5DMJB 5DFWH 1KB5B 4WCYH 1KNOA 4P5MA 1OQXA 4BK4A 2H6PB 2P5EE 3G5XA 2L7JA 3X11B 3V6FA 3H6JA 3EYSL 3CXHK 2AS5M 3C8KB 2EO9A 2NXZB 1EXUA 1H15B 4XNQB 3V0WH 2ZNXA 4L8SC 1MH5A 5I1GH 4OLXH 5EFIB 4JM2F 4KRNA 1QFPA 2VXSL 1RJZA 3KPMA 2QQQA 2EE2A 5IVNA 4MJIA 1MI5A 5CZXD 4R4BB 5EULV 1R24A 3CPLA 1QD0A 4NFBA 4Y1AE 3NACH 5B38B 4ZUSA 3AC0A 1VADB 3QR2A 1KENL 4HIIA 2Y07H 2A77L 3BWAA 5CHNA 2J5LC 2BHUA 4F80A 1G9EA 3TFKC 3MMEA 4X4XA 3NOIA 1DCLA 3EKCA 1OAUL 1QLFA 4OZFA 4FQ2H 5DJ2A 5M94B 3MLUL 4HFWA 2UY6A 2OSLB 2GAZA 4QHNB 1G7HB 3RDTB 2WM0A 5DJZB 5ABDE 5I8OL 3RVVC 5H2BA 4G80A 1JWSB 2BY3A 5IHUL 2ZSWA 4M6NH 3PG2A 2AJXH 4OLWH 4EXPX 1VACB 4N0UA 4L8BB 4MVBD 5KS9B 4RRPG 2VZSA 4P9HL 5HPOA 3BH8B 1HHIA 2HMID 2Q8BL 4KC3B 3SDCC 2R1WB 4JFPB 5HYJD 5DF0A 3P9MB 3W0WA 4ZOEA 3X12A 3UYRL 4YDKH 4OB5L 2WV3A 1FAIL 3Q6GL 4ZS7L 4QWWD 4H20L 3TJEL 4HG4J 1K4DB 1OW0A 4M61A 1PLGL 1JUFB 1G7PA 4OIBA 4Y8AA 3V6ZA 4PJXB 4HWUA 1KTLB 3BQUC 3IFNL 4HUUB 4LCYA 3TF7C 1HWHB 1MFEH 4X98B 2W0PA 3G5ZA 4DKFH 1JGUL 2F8XC 2HRPH 4JHZA 3C2SA 1EX0A 1TTGA 3QXTA 3QDMA 1BP3B 5JXEA 5D1QA 3SY0B 3DWTA 1O5DT 5TF1L 3O4LD 1CLOL 3QEQE 4JVWA 3QUYB 3RIAF 4Z7VE 4WW2F 1I8MA 1MCNA 1RUQH 5C0IA 3S5LA 4TSBL 4JO4H 3ROOA 4PRBB 5IG7B 4M9PA 4D9LL 1XT5A 4WU7B 4XGZB 3FQUB 3RIAK 3K8MA 3RVUD 4AEIL 1A0QH 3FTGB 4PD4J 1L9NA 4YXHL 3VRJA 3FT2B 5F9AC 4ONFH 3QH3B 3CH1B 4LSUL 3ARZA 2GKIA 1OQOA 1A7NH 1YEEL 2Y36H 3WIIL 3T0EB 4GFTB 5HHVH 4LCWD 3KPLA 5FA4A 5EBGA 5FOJA 3G6JE 3VXOA 3T09A 3TNMA 5MEOB 1AQDA 3SPVB 4ZAKC 2FX9H 1B88A 4PJAA 3ZDZE 3UTSA 2R2EA 4ZNCD 4PJGB 2E8YA 3FN0L 2G2RB 2RFXA 4U6YB 2CUIA 1ZEAL 4Y2DA 2ADFH 3HI5L 4Z5RA 1KN4H 5TQ0L 5JHDB 4LHUD 3ARBB 1XCTA 3DI2B 3H2WA 3QUZB 2AI0H 3ROLA 2CKBH 4HJGB 3R0MA 4JB9L 4MD0A 4MS8C 2E9WA 5ANMB 4H26B 4FFVD 1VGEL 2LU4A 3FRPG 3JV4B 4ZQKB 4FABL 2QKIA 1H3WM 4JKKA 4XT1C 4HLZG 2PUQT 4XP1H 2F74B 4XBPA 3V4UH 2YMXH 3PV7A 2BY0A 3GDBA 2WIIB 3QG6B 1G0XA 1CICC 2WINB 5C6TH 2H45A 4MB5A 5E6IC 5EN2B 4K3DL 2HA1A 3HUJE 1WWBX 4CUCA 2JJVA 5I16A 1RK1B 2DIAA 4K8RC 5D96B 1U8MA 4LPCA 4UV7H 3BKML 3L6FA 1WAAE 4GRLD 5JQHC 3TBTA 1PYWB 1UCBH 4K7PY 2DJSA 1DTUA 4J23A 5BO1H 4EKXA 3SDDD 1YY9C 3HMXL 4UAOC 3UTTB 5HJ3A 2Y6SC 3WEXA 3O6FB 4D3CL 2YN3A 1MF2L 4Z7QF 4FA8A 1HSAB 2E6JA 2RAMA 1A7QH 1BVKB 3RL1B 5E2WH 4EI5C 3RWCB 2J8UB 3QIBB 5JW3H 3WIHH 4MAYB 3KPRE 3GKWL 1KJMA 2IAMB 2VERN 2YR3A 1XGPB 4GAGH 3UBXB 3NH7H 2P5WB 4D9RE 2GUOA 4AEEA 1ADQL 1MJ7L 4YDLC 3E3QE 4MSWA 1IAKB 1NLBH 2HFEB 4MCZB 5F44A 5HI4C 3UZQA 1YY8B 2OJZL 1OPGL 3JWNC 5D7IE 2CDGA 2IGFH 3RVTC 1KXVC 1CLYL 2NY7H 1N3NB 4DKEH 4JG1H 1QVOB 2OZ4L 4UB0H 3DYPA 4NQSB 5C09E 2JJTC 2X4OA 5DK0B 1IGTA 4S1DD 1Z5LB 4OZHB 4UT7H 2FRGP 5CJ8A 4Y5XA 4LCWA 2X4SA 3R1GH 4U2YA 4JGJA 4GW1B 4L1DA 4X99A 2VLKD 1DZBA 2IH3B 3TA3D 5BS0B 1AXIB 4HJJH 4D0DA 4R3SB 4GKZA 4DVBA 2HJLA 1JI1A 4FNLH 1NLDH 2HKHH 4WHCA 5DWUL 1A9EA 1OY3B 1A3RL 1LE9A 4MNQA 3O6LL 3FFCD 4HS3A 2W65A 3U9UA 1PEWA 2PTTB 3MV9E 4LHUA 2FSEA 4PJDA 4PRNA 2AEQL 2IBZX 1I7ZB 1XH3B 4R2GC 3QDJA 3DURB 3QNYB 1XMWA 1JBJA 4MQ7B 1A6TB 1KJ2H 1M7IA 1FZJB 2CLZA 1P84J 4TVSa 1I9JH 3F6IA 1TJHH 1WBZA 3HZMA 1DEEA 3CLEH 2IH1B 4FRWA 3VDAA 4OI9A 3GMPB 3TYGL 1EVTC 5GRJH 4GBXC 2A9ML 2XWJB 2CDFA 4NHUA 3DUUA 4UQ2B 4X5XA 4OZGE 2FYYB 3I85A 4GRLA 2F58L 1FSKC 4R90H 5D2NA 4L8DB 3WBDA 2VXTL 3SDDA 3ILQD 3CDGA 1ZA6A 1W72L 2ICWA 2UZXB 3DUSB 5FGCB 1ZSDA 5SWSE 3F58L 1HEZB 4FXKA 3FCTB 3LKRB 3O2WH 1EEUA 4QRPA 2DQDL 2R0WL 1X5XA 4XNUL 4F15C 5MERB 1MEXL 1X7QB 4OZ4B 3LD8B 3L5HA 4QXUL 3MLVL 4NQVA 4MCYA 5FV1L 4LLVA 2DLFL 2G9HB 3VFGL 4LMQI 3RNKB 2H41A 1OAKH 4B41A 4XC1L 4X8XA 3SCMC 2DWDB 4M9OA 1JPTL 3P4LA 1GIGH 4ZS6C 2VL5A 4A6YB 3V0VB 4QHUA 1JWUA 3B9KC 3V2AR 1YYLL 2A6DA 1ZOXA 2MNUA 4YEEA 4X6CE 1UB6A 4OTXL 1JRHI 4K8RL 1CXKA 5E5MB 3KPQA 3LQAH 2O5XH 1NJ9B 1SJHA 4FQXC 1KIQA 4NUJA 2G75A 4PTUA 1IQDA 3KYMB 3RZCA 4HWBL 3PWNA 2VLKA 4JFED 3TA3A 1ITBB 2APVA 4XCYB 5C8JA 1LD9B 5EBLA 1J10A 1H5BA 3BAEL 5D8JH 3FFCA 1TVBA 1ERNA 4XP9H 5IB5B 4UU9B 4MJ6A 2LE9A 1FORL 4Z77B 1OB1A 1FNGB 1IQWL 1CFTA 5IM7A 3PDDA 4WI2A 4EUPH 5IMLA 5IB2B 1FVCB 2WBJC 3KXFD 2OCFD 4PP2A 4NT6B 1QNZL 1P4LB 1HK6A 2D3VA 1A7RL 2XXCB 4Q9RL 1MWAA 3SO5A 1V3MA 4Y19D 5IUSA 1YNLL 1CLZH 1M7DB 3WXWL 2X05A 4OGXH 4G8GD 3MRRA 1MRCL 3DNKA 3L3OA 2F19H 2UYLA 5F1IA 1Q9LB 1Q9OA 2ESVA 4WFHE 1BD2E 3BD3A 2R2HB 4K7PH 4WTXA 3VGFA 3QHZH 5CZXC 4RAUB 4HBCH 4BKLA 3C5ZA 1TQBB 3LKQB 3PF2A 5DZNA 5TE6L 35C8H 3EOAB 4MXWH 2VLLB 3DRTA 5D5MA 5DJ6A 3BPOB 4HULB 3VJ6A 2P5ED 5IGXL 1HHJB 2IEPA 3BEVA 3SOBH 4I0PD 1JGEA 1I1RA 4RWHA 3ALWA 3U4EA 2EYRA 2YPVL 1Q94A 3L5WB 5DFVC 3WNMA 2OJEA 4X0KB 5JOFB 4I3RH 5DD0H 5KSAD 2QL1A 4WUUE 3QEGH 3RUGB 2F53E 4YXKL 3MXWL 1PAMA 4UNTA 1NC4B 4L8CB 2AV1A 5AG9A 4Y1AD 3MO1B 1AIFA 4PBVC 4XWOD 3SN6N 5I1HL 3B6SA 5EU5A 4DK3A 1BAFL 1G7IB 4TUKL 2ZG2A 2AABH 4NQCB 1CFVL 4IOSD 4KK5C 3PV6A 4PV8B 1KOAA 4LCCA 1OP3H 3IXTA 5IKCA 2YD3A 2VZVA 4M03A 4OCRH 3FJTA 4PJ7E 2FHCA 5E2UL 2H9GA 4QWWC 3VFTA 3CSGA 1HQRA 2X4TB 1I1CA 4PJAF 2VITA 5CJXA 2AV7B 4JFEA 5BMFL 2J6EH 4K3GA 1YEFL 1GC1C 4P5TB 2VSDA 2IF7A 5C0JB 3KLHD 2OK0L 1PVHA 3GRWH 1HHKB 1CYGA 4KPHH 1FL6B 4V1DB 3VXUE 2DQJH 4JQIL 3FQRB 2XZAH 5D1XB 5E94B 4BK5A 1LK2B 1VFAB 1OOAA 4XNXH 1HXMA 1G6VK 1DL7L 2A73B 5FHAH 1GZQB 5B4MD 1F42A 4PJEA 3T0DA 4LARH 1CDCA 1ZHNA 2OR9H 3KXFA 1GAFL 4AQ1B 1NANH 3P73A 4H8WH 4ZTPH 5IK3B 3SE3A 3D85D 1EJOL 4Y4KB 3L3KA 1UXWA 1A1NA 1F3JA 1AR2A 2I60L 4Y19A 3RVUC 3FB8A 5E00A 4PB0L 1VERA 4O5LL 3GJFA 1QBLL 4G8GA 1OWWA 3HAEH 2EEDA 4KK6D 2VQ1B 3K4AA 5A2IH 1C8PA 4YDIL 2G5BB 3HRZA 3CLFL 1A1MA 2HWZH 1EERB 4TTDC 3LQZB 3UPAA 3QEQD 3VXSE 1HHHA 1YN7B 3BRGC 2EECA 3DBXA 4HKJA 2XICA 1F4YL 3CNKA 1AJ7H 1P1ZB 1S9XB 3ZKXB 2B7DT 1XF5A 2OS7A 3BMVA 4J3UA 4JO1L 5I1EH 4QHLB 4HUVB 2B1HL 4I0PA 1ZHKB 3BZ4B 2PETA 2VLRE 2X10A 4IMKA 1C1EL 1X5ZA 3NABL 1T66C 3JZ7A 3ILPB 1MQKL 5IBLD 3N50A 3N1MC 4MXQC 1DQLH 3H7BA 3OX8B 4WTZG 1S5HB 3QFDB 3HHRB 4R8WL 3BIBX 5JOEA 4M7ZB 3QDHA 4LKCA 4Y1AA 4J1UB 4JPWH 2R9HD 4WHTA 3HFMH 2P24B 1LP9A 4OFVA 5I15L 4DW2H 4P59H 1AE6L 1KELL 4X8JA 3M8OL 5GJSL 3SKUD 4LVHC 2QSVA 4GQ9L 3STLA 4OZFG 5ACZA 4PGDB 4HQQH 4GG8A 4AG4H 4WWKC 3VWJD 3OF6A 4ZFOL 2XZQH 2X7LB 1T2JA 1WT5C 5FYKH 3GBNH 3AU1B 3SGEI 4F7EB 3HE7C 1FL5B 3CU7A 1KCRH 3V95A 1JZ2A 5DMKB 3TZVC 3DVIA 1YYMH 2ATKB 2HAZA 4Y16D 4YIQB 1W0VA 5EOTB 5FKPA 1CK0L 4ZD3L 1FZOB 3QPXH 3MJ9H 4URTB 4ZPTA 5A16B 1OTTC 3J8F7 4PJDF 2I07A 4BH8B 4R7NA 4GG6A 1A7OL 2YD5A 3LZFL 3MJ8A 1D5MB 2AJSH 3DXAA 3BD5A 1WF5A 2WNGA 2RQ8A 5GRXG 4NNXB 4XHJC 1JVKA 4P46B 1JGVL 3D85A 3RRQA 1JPGA 3QCUL 3BIKB 3I2CL 3PHOA 4GS7C 2J7LA 2FL5B 3TVMD 3KDMA 5EZOH 3ZKQD 5DMIL 1SVZA 3EYVA 3KPRD 3CK0L 3LV3B 4P23B 4FQQA 4U1IB 3OJMB 1AC6A 1P9MA 3QEQA 3A67H 3DOSA 5C0FB 1A2YB 3R0NA 1BZ7B 5DSCA 1DBJH 3S5LG 4HS6A 1KPUB 1HILA 2R1XA 1GC1L 4QTHB 4UTBL 5ITFB 4Y5VB 1NEUA 2EH8L 5DEFB 5I73C 4Y5YC 3FN3A 1T03H 1DLFL 1YJDC 5HTSA 1OTSD 2CJUH 3KJ4B 1LO2L 3VGGA 5FECB 1F6AA 1YNTA 1WQVT 2VZOA 5C09D 1UFUA 1E4KC 2ZSVA 4DUWA 2JIXD 5DMYA 4LLUB 1KPVA 5I1LB 3CVIL 1QFOA 3BGAA 1Y6NR 3RTQD 4G6JL 5CAYB 4NNPH 4OAWB 1DUZB 1U8HB 3O11A 5D7JD 1JHKH 5JA8B 5BRZB 1G9NC 1UENA 3EGSA 5C0AD 4ETQB 1GL4B 4GXUN 1TVDA 4Y4FB 3U9PL 4S1RL 3A6CL 2P8PA 2C7UB 3CXDL 2ERJC 4HPOL 1AD9B 3MV9D 5JIIA 5CWSA 5C2BL 3KPOA 4CN6A 3VWJA 4X4YB 2HFFA 1MFCL 3EYUH 2ITCB 3P4MB 5FA3A 3W39A 5FYKE 3U30B 1NDGA 3G9VA 3ARWA 4M1GH 5A2FA 4Y16A 2PN5A 3TO4A 1AI1L 3AAZB 2BJML 2NXYD 1C5CH 3BI9X 2APWA 4IDJH 4JN1H 5FGRA 3MRBA 3NCMA 3OSKA 4ZPVA 3K0WA 2CDEB 5I1IH 3D39E 1U8NB 1X44A 4Z7WB 5GGRB 4NO0D 2HT4D 1AQKL 3D3VB 4KI5C 5F7DB 4OQTL 1B90A 4YJZL 2IALB 4IRSD 3VGHA 5I8EA 1UKSA 2R0KL 5IVXB 5C0GB 5SWSD 4LBEB 4JHWH 3IJYB 2O61B 3GB7B 1UJ3B 5IVZA 1D5IH 4HIHB 3RWHB 1S7UA 3KPRA 3UPCA 1I9IL 5HHQA 5H94B 4GW4A 4XMPL 4S0TD 3VFVB 5JMOC 4I18C 1FIGL 4DN3H 3OAZH 5ILTH 3ZKMD 1I7RB 3GSWA 5D5MF 1AHWA 3P4OA 1UEYA 1EO5A 1G7LA 2MFNA 5F21B 3T1FA 1JF1A 4RFEA 3WE6B 3DMMB 4KRPD 4Q6IA 5DQJA 4KROB 3ARED 4G6ML 1PKQE 3C5SB 2FDBP 1HSBA 3WSQL 1I9RL 4HV8A 3L3DA 1ADQA 4OD1L 3TESA 2JIXA 3L9RB 4P3DA 2EYSB 4RX4A 2ZOKB 3RTQA 3LN4B 1GGIL 4EOWH 5IW6B 1XGTB 1RUPL 2FX7H 5CBAB 3S98A 2Z4QA 1L6XA 3MRCB 2LU7A 3H9SB 1BJ1H 1HI6B 1S7SA 4K2UL 2ILLA 3KJ6H 1YMMB 4PG9A 5C0AA 5SV4A 3IDUA 1UWXK 3U7WH 4JPVH 2WK2A 3WXVH 1XGRA 4EN3B 5C7XL 1S8DB 4LHUG 3WLBB 4M6OL 4HFUH 1K8DB 3WFBH 2X2YA 4JJHA 4IIQC 1S7TB 5K9JH 5DRWB 3F5WA 2CKBA 3MTRA 3VRLF 5IMKA 1S9VB 1J12A 3KG5A 5JXAH 4GW5B 4X7TA 1KLGB 1QLEL 4TN9A 2XZCH 1T5XA 2AEPH 1V8HA 5IQ9A 4ZNEE 3WFDH 5I76B 4P48A 3ESVF 3QJHA 3PWPE 1JWMA 2V5TA 4PJEF 1QFUH 2B39A 2EDHA 1JNNL 4PGJA 1QRNE 3X14A 1ACYL 5GGSB 4OZGA 4A2LA 4WFHD 1BD2D 5KSAC 3B2VL 2CLRB 5EH1A 3AM8C 1IGIH 3FZUC 4IRSA 2QHLA 3SKNA 1BOGA 4QY8A 1G9NL 1Z3GH 5SWSA 3F7QA 5D7LB 3PGCA 4X5WA 4N0FB 4BZ2H 4CVXB 4XX1E 5EG6C 1I85A 3C8HA 4G6FD 3CVHB 4CVUA 1KCKA 5FKAB 3BE1L 4N8CL 3GJFK 3WIHA 4G5ZH 3DLQR 1U6AL 1OGTA 1GGBL 4R7DA 1MPAL 1EO8L 5E8OA 4WUUD 3ECBA 2DDQH 1HDMB 1UXSA 2F53D 5HPMB 2NW3A 2IANA 4DGYL 1JFQL 2X70B 5JO5A 1WFOA 3O0RH 3RX8A 1OCWL 2YD4A 3KLHC 1SYVA 3S96B 3RBSA 4FZEL 3PJSB 3AREA 2GJ6E 1BQLH 5T1MA 4XH2B 4JRYA 4S1SL 4NQUA 2QQLH 1U93B 4YDJB 5HHXH 1PG7X 4X6CA 2KPNA 3CDCA 1DFBH 4WO4C 1S7WB 1Q0YH 5B4MC 4OKVB 3AY4C 5E4EC 4UDTA 4CMHB 3QUMH 3TN0C 2LVEA 1ZXQA 1LP9F 3IDJA 3BGMB 2IPKA 3WUWA 4XXDA 4KVCH 2KKQA 3VD3A 4J3XA 3N9GH 4MQXD 4XCEA 4XP4L 5E1AA 2X1OA 3DX7B 3QEHB 4ISVB 4QRUB 4JRXE 3IKCB 3AS1A 4HWBA 3OXRB 2CIKB 3LKSB 5HGHA 2E7LC 5IB4A 2FO4B 3ULUF 5ESVA 3WL9A 4HMCA 2PW1A 2D2OA 1KNOB 4G9FB 3HC4H 4JFQB 4K7PX 3MLZH 1SHMA 1KJ2A 1P2CA 4GG6F 5SWZE 2FIRT 2AK4B 3PL6D 3EOBA 1MIMH 1EXUB 4NFDA 1N5AA 1A8JH 1NGXA 4NCDA 2A2QT 4KJPD 1IGFL 1BJ1J 5IBLC 4OT1H 1U8QB 3VXSD 1I1FA 3CPLB 5HGBB 4ONGH 3D9AH 12E8L 3LEVH 3RA7H 5L8KB 4KY1H 4YHIB 4NKMA 4ZUSB 2O5YH 2HFGH 5IEHB 4XI5C 1SEQH 2F54A 2KBGA 4JM4H 4F58L 2XWBA 3BWAB 2NY0B 3B5TA 3IJSB 4EVNB 4F3FB 4EDXA 3TJHD 1CE1H 2BSTA 5I75C 1QLFB 3MBEA 2VLRD 4WJ5A 4HSQA 1KB5H 1FYTB 5DR5H 5E6ZA 2YD9A 1UG9A 4WUUA 2RJMA 2ZSWB 2F53A 1FZKB 3ARRA 4N0UB 1A7PH 4POZC 3CX5K 3RWDA 5LVEA 2EXYC 5T1LB 3U7AA 2QQNH 2RHEA 5IHZB 5J4MA 5F3HA 3QWRA 4NZRL 1UM4H 2MQ3A 2NLJA 5CSZB 5MENB 4FQHB 5JIHA 3MLXL 2YBRA 1WZ1H 4PJ7A 3PWJB 1XR9A 3ARSA 5KW9H 1HCFX 4NYLA 3F62A 5ALBH 1R3IH 5BV7C 2OMBA 3DROB 1KT2A 3MUGB 3MREA 1F4WL 4LCYB 4M48L 3RGVD 3TWCL 2ZUQC 4I1NB 1KTKE 3U4BH 1JE6A 1NMCC 1QKZL 5JHLH 3I75A 3OAYK 4JY4A 3QDMB 3KGRA 3GHEH 4JFDA 2JB6B 5I1DA 3TVMC 1A22B 1DQQA 4PBXA 1D9KD 3TO2A 1UWEH 3QNXB 5JR1H 3VI4F 5KVFL 1I8MB 4AIXA 4ZXBD 3GSNL 1I8LC 4EUPA 1A4JB 1RY7B 2HKFL 1RVFL 1VENA 4KGJA 3VI3E 5SWQB 2P44B 2B2XH 4KJYB 4ODTL 1BQUA 3Q3GA 1HYRC 3U1SH 3RJQB 4K07A 1IC5H 4JVPA 2C1OB 5EO9B 3T8XA 2JCCB 4N0CD 3WJJC 3ARGD 2FEDC 3WS3A 1OTSC 4B7IA 2J4WH 3D25A 3L3IB 3VCLA 2MCG1 4X6FA 1CTOA 4BZYA 3TNMB 4PJ8D 1AQDB 3VXSA 3TBVB 5EOCJ 3C8DA 3MROB 3CD4A 4UV4L 1PX4A 1MRDH 2IBBA 2XPGA 3LRSA 3UTSB 1FFNA 4OCXH 2NY2C 4RMSA 5D7JC 1AO7B 3SGDI 2RFXB 3EYFA 5DHYA 3JV6A 2YKLH 3KYKH 1WBYA 4JO3L 3ARXA 4Z5RB 4XBGA 3TPUB 4LNVA 2N4IA 3IGAA 1WTLA 3ARFD 4MD0B 2VLRA 5DJCB 4BQBA 3MJGX 3GSOB 2Z35B 3REVB 4KHTL 3E6FA 1MRFH 1J05A 3WNKA 3HE6A 1CG9A 3VWKC 3OKNA 4EDWL 1I3RA 3CCHA 5BOZG 4LPVA 4NBYB 1AR1C 4Y8DC 4F2MA 2Z8VC 3BPCB 4P4RB 3MR9B 4PB9H 3UO1L 1NCTA 3ZYOA 5F9OL 3KNBB 4HCRL 5A2JH 4H0HB 4PYHA 4KXZI 1X6NA 1DBBL 5I16B 5ICYA 4NQTA 4CW1B 1I7UB 5LCVH 3L6FB 4NP4L 4IBLT 5GGVL 4Y89A 3TCLA 4PGCA 4APQB 3THML 5J3HC 4UMGA 4TPRL 3EJYC 3NFSL 3S3SA 2DICA 4HK0B 1U8PA 4I3SH 4U1JB 1MAJA 1S5IH 5FYKD 3WEXB 5HDBF 1T4KB 4ODSH 2WLYA 2YRLA 3HI6H 5ICXB 4PG2A 1CDUA 3SKJL 1TDQA 3NACL 3UDWA 1NFDB 3GRWA 2MPAH 2A83B 1QSFB 1KG0A 1J0KA 4KTEH 4OF8A 3K46A 1RJYB 1HYSD 1YEHL 3HA0A 4LVEA 4W4OA 1FGVL 2C3VA 2QQKH 1ZVSB 3D39D 5J89A 1XGUA 2NY4D 1FN4A 4ZXBA 1FE8H 4P0DA 3T08A 5KS9E 1R5IA 3NCFB 2ZOLA 5E8EB 1ZLSL 1U58A 4K3EH 2A1WL 3ZKMC 4N9OB 4QRSA 4PJFF 4O00A 3EW3B 4NKIH 2W0LA 4PLKD 4NBZB 3NIFF 3OZ9H 1A47A 3D0VA 4DGVL 1BVLA 1T20B 2XWTA 4OZGF 4R26H 2EYTA 3HAEA 4XP6L 4WEBL 1NGQL 4X99B 1A6UL 1Z9OA 4PJXE 5L6YL 5BV7L 5I1KL 4GKZB 1U92B 1Q72H 2HJLB 3VW3H 3BUTA 3H3KA 4HIXH 3U82B 4JLRB 3ARVA 1FH5H 1BFSA 1T04A 3BN3B 1IAII 3SKOA 3LIZH 5GS1C 4MNQB 3KVQA 4HZLA 5L2KA 4HS3B 3S3JA 2W65B 4PJBA 1LO5B 3VXRE 1U8IB 4HS8H 4DKFL 4DGIL 4F33A 3RWJA 1A3LH 1H3PH 3PNWB 5B39B 2P46B 4NDMA 3B2UC 2AXJA 3A6BH 1M7IB 5BJTA 1FNSH 3K2UH 4PJHE 1DDHB 1MJUL 2CLZB 4HKBA 1R3HA 1EFXA 4NZTL 5ALCH 3WFHA 1ZE3C 4NQDA 3TH2T 4JHBA 4GSDH 1VSCA 3LKPA 4YBHA 3C5JB 2Z0BA 4X6CF 5IMMA 4ORGA 4X4ME 3DUUB 1T7ZA 4I77L 4ZO7A 3BZEB 2ADGA 1JRHL 4RMUA 2YSSA 2VXVL 5A43C 3WDIA 3SGKA 1A7NL 1NCDL 5E6YA 5ETUB 3UZVB 4PJGE 1YUHB 1ZA6B 1LO3H 3ESUF 5F6IB 4QRQB 3HB3D 4NUGH 1U8OA 2R0ZH 4YEFA 3MJ9A 4QF1B 4M5ZH 4Z7OE 1FBIL 4HH9A 3PWPD 2ADFL 3NA9H 5L88H 5F7NC 3LS4L 2BDNL 2J8OA 5I66A 1QRND 3D39A 4HH8A 9CGTA 4X7SL 2UY7A 2AKRA 4LRNL 1A3QA 1WFNA 1NCBH 4XVUD 5FM4A 3ZT6A 5CKAA 1B4JH 1LO0H 1GGCH 3RWEA 2ENYA 3WIFB 4ZUWA 4ZOCA 1ZVHA 1V7NH 2YD2A 1JJUA 1OGAB 3BKJL 1AXSB 1YNKL 5C0DA 2VH5H 3ZDXE 3LS5L 2RCSH 2Z8SA 4NHCH 2BNRB 1NKRA 3PHSA 4NRYB 2OL3B 1IQDB 1CGSH 3QQ3A 3PWNB 5CMAB 3BSZL 2CR3A 4TNVK 2EDNA 3VXTA 1MNUH 1UWGH 5EBLB 1DSFL 3MRMA 2J8UE 3MLRL 1FL3A 4MA3B 3IVKA 4MQXC 2VC2L 2GJ6D 3I50L 3RPKA 4CU7A 4L4TE 1FO0A 1WT5A 3NGBB 1MHCA 3C08H 2VXUL 2P5WE 2WUCH 5FV2A 2GFBB 3U46A 5IIEA 4JQVA 4M3JA 3OKEA 4F9PA 1GOFA 2Y4SA 1RHFA 1YQVH 5F88B 1XGYH 2ADIB 4ACPA 4A6YH 3IAGC 3QIUB 1PW3A 5DEGB 1B4RA 2NY5H 4GRMA 5CSGA 3F6LA 3BXNB 4IM8A 1FLRH 3PL6C 3EHBC 4OZHE 5F1NA 5GRVL 3OPZL 5F1IB 1FVDA 4DKEL 1SBSL 4GAFB 4RIRA 5GZOC 2ESVB 4BFIA 25C8L 5LKNA 2HG5A 1NGZB 2DQUH 3B9VA 5F7UA 1JPSH 1EBAA 2F15A 3UCRA 2VDOL 3C5ZB 5TDOA 1QA9A 1ZVYA 4NJAH 4XPBH 3TT1L 5DJ6B 1FAKT 3DRTB 3FB5B 4M7JL 3ZL4H 3F12A 4FNLL 3SDAB 5SWZD 1MLCA 3BEVB 3KR3H 1X5HA 4I2XB 5F9JB 4YO0B 2FJGB 5BVPL 2VR9A 5DD6A 3OKLB 3G6DH 4E5XB 4LEXH 3MCKA 5J6HA 3V5HA 1CGXA 3EAKA 4Q74A 5TE7L 4TSAL 3QP3A 1S7VA 1RZIB 1YEIH 1CR9H 1WIPA 4BJLA 3QI9B 2AV1B 3BZDA 1AIFB 2EXWC 2FLRT 3QDGB 1CD8A 4M1DL 4QOKD 3MRDB 3ZTNL 3MFGB 4ODWA 4WV1C 4JO2H 1RZFH 4XP5L 3RIFK 5IKCB 5EZIL 4HC1H 5DA4A 4DK6A 3DGGA 2QEJA 4ZTOL 3PHQA 2VZTA 5FYLE 5MP6H 1JGDA 2VQUA 4FXGA 4KJQD 4F7PB 3VFTB 3S35X 3MJ7B 1A1OA 5EWIH 2M8XA 3NFPA 1P4IH 2QADB 4U6TA 3RJDA 2KUTA 3RGVC 3BJLA 3NVQA 4OLVL 2X1XR 3MLYH 4NZJA 3SDXB 1L7TL 4LFHD 3UTQA 1P4BL 1DQMH 4P9ML 3QB7C 3BX7C 2ZP0T 4LU5H 5DTFA 4M7LT 4DAGH 1D9KC 2JJSA 2YD6A 4JQXC 4P3CH 1MCLA 2GTZA 2FHBA 4JGUA 1D6EA 1BEYL 1CT8B 4GKSA 3GMNB 5TQ2L 1A1NB 1S7QA 3GBML 3V5DA 5T33H 4JAMA 3WUWG 2C4FU 4PJ5B 2H3NA 4K23L 4F8TA 1F8TL 5IJKC 2YPLA 4ERSL 1T1XA 2YZ1A 3FT3A 3GJFB 4J7RA 3CC5A 4Z95L 2V2WA 2WLZA 4XPHH 1WV7T 4N0CC 1NBYB 1OARL 2R29L 3HG1B 1GIGL 5K9OA 1WWWX 2W0KA 1CQKA 2NTFA 3MRJB 3KYAA 5H35B 4HKJB 2KZ1B 4NCC1 3RY6A 4F7CA 1NCUA 1LK3L 1XCQB 1LHZA 2XNAA 1G7MA 4TRPL 2R4SH 2NX5B 3EO0B 4DTGL 3TV3H 4OCNC 2YWZA 4OM1H 5SWZA 4MXVF 1J1PL 1BZ9A 4OSUH 3WFEH 3QIWA 3LB6D 1PG7L 3K81A 2FH6A 5F89B 3V52L 1HIML 5D8JL 5ESAB 3ARFC 4RGMB 3EDDA 4XVTH 4A2MA 5JPNA 4DUXA 2ZCKL 3H7BB 2CMRH 4JPKH 3OKDA 1VPOL 5HGDA 2YS4A 4BYHA 1AGBA 3F7YA 2Y7QA 2F8VA 4CKVX 4F7MA 1OSZA 1N2RB 5IFJB 4WHTB 5DMGC 4QOKA 1LP9B 1SY6L 3QFJB 4HT1H 2V5SA 3ZE2E 2Z31C 4L4VE 4X8JB 1U3HD 2NY6D 4HWZB 1PSKL 5F93C 3W82A 3UMTA 1T0PB 4O2EB 1JF5A 4W6XB 4LPWA 1YEKH 2FGWH 3IJHB 1R5WA 3FB6A 1ONQA 4MNGB 3L3GA 5LGKA 3ZYJA 1J8HB 4YHKL 5HDOA 1OAYL 3WFZA 2XRAL 1I3GL 3C60A 1EJ6A 2ED7A 1ZLWK 4RA3A 4IRJD 3TM6A 4PJBF 4KK8D 1B9ZA 1TCRA 2NXZD 4J4PA 3QO1A 2DQGL 4R7NB 4JFXB 2R8SL 4L3EE 2VLJB 2FB4L 3DXAB 5A3ID 5FHBL 4UT9H 4NN7B 3WKML 2BXYA 1HYSC 4BUGA 3FO0L 5EC1A 3GMOA 2WMPA 2VB5A 4R4ND 3Q6FA 2W59A 3GI9H 3FT4B 3O8XC 3VFWA 4MX7B 3K2MC 4U1GC 4FMFA 4NQCE 1T1YA 3QUMA 4IS6A 4ELMA 5E8NA 1K6QL 5DLML 2XQYG 1T7VA 1UJTA 3S36L 1OTUC 2V2TA 3RWFB 3KDMB 4MJ5B 3S34L 4GLRH 3LEYH 3DO7A 1TZHA 3EYVB 5KVDH 3JV5A 3T4YA 5EO0A 3W9DA 1HKFA 4QXWA 5KOVC 3RDTD 1BQSA 4O4YL 4MZ2A 5I17B 5HYSA 4L9LB 3WDJA 3ALPA 4EUPG 2D31B 4PY8I 5HDQL 1G7QB 1XR8A 3AFLA 3GMRA 1T89A 4S0SD 3C09B 2BVQA 5J57B 4V1DE 1HINL 3HNVH 4LNRA 1YEDA 5AD0B 4LLWB 2PCPB 4LVOB 3U36A 2GSGB 3LKOA 3WFCL 1F6AB 1RUAH 3X13A 1VA9A 2D4FA 4XVJL 1RURL 5EZJB 4OZIA 5HVWA 3VFRB 1T2QL 1HKLL 1QO3B 1UC6A 2CK0H 5DJ8B 5D7KE 5DI8B 1A6VL 4ALAH 1WWAX 3BVNA 3CSPA 5T5FL 1EHNA 1N7MH 4ZG1A 4LARL 1F90H 1FFOB 1GCFA 5GS0H 2W1NA 4LSDA 5KSBA 1K2DB 5TPWH 5JW5B 2A6IA 4UT6H 4GMTH 4NJ9H 4F37K 3ZKSD 4WO4A 2H1PH 3VXRD 2XV6B 2ICEA 4XZUB 2PXYC 1FNFA 3QUYD 4OM0H 3TLRA 3HS0A 5GISH 2HFFB 1AGEA 3IDIB 3GMQB 1RZGA 1QHOA 1CIDA 1KB5A 5I6XC 5C9KA 1OAQL 3WUZA 3TT3H 1CD1B 3G5VB 4TTGA 1UYWH 1G9MH 4CN1A 4ZFGL 4YE4L 3C8KA 5F3BA 1F3RB 2J2ZA 3WLWD 4XNQA 2R4RL 4MAUH 1CF8L 4ZUUA 2EKJA 4O51B 5EFIA 3GNMH 4ETYA 4M43H 3T0ED 5IWLA 4FZ8L 2BFVH 4ODHH 4KAQH 3VFSB 4TOYH 5CGTA 2Y72A 1J9CT 3MV7A 4U7SA 3OB0K 3ZE1E 5B38A 4PYGA 3F7VA 2IFFL 4XVUC 4YK4C 2LVCA 5HYQB 4LSSH 1MCFA 1JZ3A 3QSKB 4RCAA 4OJFH 4LSPL 5JHDD 3ARQA 2YHGA 3QUZD 2XN9B 2OP4H 5FUOL 2OSLA 4QHNA 1MCRA 5CBEB 3RDTA 5DJZA 4GW4B 2Z92B 4AZ8A 1CZ8H 4HQQL 2M1KA 3O9WD 5BW7C 1VACA 4AG4L 2NW2B 4L8BA 5KS9A 3QCVL 3ZKND 4NNYB 3BH8A 5IOPA 2J5LB 4N1HB 2DTML 2EH7H 4G9DB 4LOUD 1LEIB 5EBWB 1JF1B 2R1WA 3JWOH 4JFPA 1GGTA 4JGMA 5DQJB 4DVRL 1VESA 3NZ8B 4TQEL 4JZJC 4KJWC 3ARUA 3TEUA 4YGVA 1B0RB 4EIGB 4JFZL 4LCUA 2ZJSH 4X9FA 3VRIB 4LQFL 2GT9B 3HAEG 1HCVA 1Y18B 3BDXA 5JQ6H 3MOQA 5C0EA 1RUKL 4PJXA 4JKPH 1KTLA 2WBWB 3SDCB 4C57C 3FO9B 2JJWA 4JN2B 4RBPK 4X98A 5DGRA 1HOCB 3O6FD 5J12C 1E4JA 1S7SB 1QEWA 1FZMB 3VFOB 4P2OC 2VOTA 1VCAA 3P0VH 1UADC 1MHPH 5FYJH 3IDXH 2AGJL 2JLLA 1ZWIA 2W9EL 3QPQD 4YHYC 1IT9L 1AY1H 4HMEA 1KULA 4CADB 3QUYA 4LVNB 2P5WD 4G6KL 5DUBB 4M93C 4NO3B 4PRBA 3PDOB 1ZGLB 3BRDA 3VXPB 2EZ0D 4WU7A 4XGZA 3FQUA 2L0DA 3STZB 3LHPH 3FTGA 4X7TB 1ED3B 2XA8H 3FT2A 4PJFB 3OAZK 4YHMH 3QH3A 4FQLH 3QJHB 1KUMA 5EU7C 2V9RA 3T0EA 5L2JB 3P9LB 2AXGA 3X14B 2H26A 1I9EA 1WGOA 2HJKB 4OUUB 4Z76B 5M7QA 3FQWB 5BS0D 3QA3B 1KPRA 2VDRL 5BRZE 1BBDH 4P49A 1BIIB 1BFTA 3T65A 4NWUL 3RX7A 5DXWA 3Q0HA 4MNHB 3PGFL 2G2RA 1U91B 2ARJB 3OQ3B 4KV5E 4YUEL 2XQBH 4U6YA 3PGCB 1LGVA 2VDNL 4OBSA 1L0XA 1S9WB 4WI6A 5JHDA 1PDKA 3ARBA 3NN8B 5IROC 4N1EA 3QUZA 3VG0H 4WUKH 4ZAKB 5ANMA 3KPSB 1J5OL 2YUXA 4H26A 3JV4A 1OGTB 1W72B 4ZQKA 4GXVL 3HCVB 4XPAL 4AEHL 3C6LC 4EEEA 2WWMC 4WVRA 3B9AA 2P7TB 2F74A 4PS4L 1MCWM 5JO5B 5KZCD 1SYVB 4BSJA 2WINA 1NCWH 4KRMB 4DFHA 1WEJH 4G3YH 5EN2A 1RFDL 4Z8FL 1YN6A 7CGTA 4OCSL 2FNBA 3EDJA 3U6RB 4JRYB 3S88H 1RK1A 1V3KA 4YFLF 1DBKL 3D3VE 3VWKA 2VRAA 2GSIB 2CR6A 1PYWA 1T83A 4PUBL 2AEIT 1JGLH 1LNUB 3UJTH 1DBAL 2NY3C 4N8VB 4RMTA 3UTTA 5IVXE 1CICB 3OG6B 4J8RB 5E6IB 3O6FA 1S78D 3CVHH 1HSAA 3H0TB 1NGPL 1BVKA 3RL1A 3HNSL 5DJ0A 2BY2A 2VDMH 15C8H 1TETL 2BX5A 2WWKT 3QIBA 4BSWB 4MAYA 4WW1B 3OJVC 5FYJE 1N6UA 2IAMA 1A6AB 4JHWL 5BZWA 3UBXA 1XGPA 2KQMA 2HLFD 3HC3H 2AK1L 2BVEA 1GHFH 2QHRL 3CFDA 2E27H 4WU5B 5EOQL 2P5WA 4M5YH 4UAOB 5T1KD 5IB4B 5DJDA 1OP5K 2HH0L 1IAKA 2HFEA 4MCZA 5IESH 5ESVB 5JA9A 3DJ9A 1F3DH 1YY8A 5GGQL 4EI5B 4RA0C 3MLSH 1DE4B 3BOVA 2E7BA 2NR6C 1SBBA 4Z0BL 1QVOA 1NAMA 1ZLUK 2IBGA 2NYYC 5DK0A 1L6ZA 1Z5LA 2UUDH 4OZHA 3OHXB 3LB6C 3MGAA 5T3ZH 1INEL 4LHJB 3B9DA 4WFFE 3I84A 4J6RH 5I71C 4WNQB 1NBVL 5BS0A 4YPJA 1SMAA 5JOPD 4R3SA 3I6LE 4RZCB 3KYNA 1YMME 1T5WA 2JELH 4ELMF 2DMKA 4KXZH 1IBGH 5CP7B 3MLWH 3QAZC 2DD8H 3WN5C 2PTTA 3CFBB 4EDXB 5DD5H 4RWYH 3LOWA 4JRWA 3W2DH 3MBEB 4OIIL 4G6AC 4WJ5B 1I75A 1IEBB 3MNWB 5T3XH 4KZDL 5IFHL 4Z0XB 3H7LA 2DQHH 4GAJL 4HJ0D 5AZEL 5KVMC 2IFGA 2MJWA 1A6TA 4MQ7A 5EUKA 5K9JL 3QHFL 2PYEB 5LWYL 2DQCH 3RZWA 1G7JB 1A6ZB 4AMKH 2H32B 4IRJC 1G6RL 4HG4K 4KK8C 5JXAL 1IC4H 1FPTL 2IH1A 4R2GB 4BM7A 4XX1G 3STBA 3GMPA 4OZIF 1CBVL 1DUYA 4UQ2A 2YRZA 2KH2B 2YBRB 5A3IC 3S4SB 5CJOH 2FYYA 1XR9B 1N4XH 1L9MA 4L8DA 1CI5A 1VEPA 1DQTA 3GSUB 3MREB 5KSBF 3OAUH 4R4NC 1OWRM 2N1KA 3FFDB 2VKWA 3IDNB 5GZND 5HHPA 3FCTA 1W0YT 4GBXB 3LKRA 1GXEA 4JDZA 4NM4H 3I75B 4BFEA 2ZCHH 2DL2A 4ORZC 3V5KB 1UVQA 1FSKB 4K3HA 4OZ4A 3TO2B 2VISA 4UTAH 1AP2B 1YQ2A 2YRPA 1IC7H 4MDJA 2FGZA 2G9HA 3OGCA 3RNKA 1FC1A 2FD6L 4M8QB 1NC4D 4CBPA 4G5ZL 5AWNH 3N85H 1K3ZA 2CGRH 4PJ9C 1YMHB 1LE5A 4U0RC 2MWCA 2E7HA 4F15B 2I5YH 5J13C 4NQCD 3V0VA 2FO1A 3WO4C 1MAMH 1CFNB 5B21A 1PQZB 5E5MA 1U42A 3D25B 1NJ9A 3S35L 1BQLL 4CU6A 1WCBB 2PO6C 4AENA 3SCMB 5DUPH 5E99H 1KCSH 1Q9KB 4XCYA 3FQNB 4R97B 4BQ6A 3LRSB 1LD9A 5IW3A 2JB5H 3B9KB 1DN0B 2IQAB 3EYFB 4JCMA 4V1DD 3AS3A 1OAZL 5LQBL 4J3SA 3GO1H 5IB5A 1CXFA 2R23B 1D5XB 1I1YA 1KN2H 3E2HC 4FQXB 4UU9A 4XBGB 3P40A 5D1XD 1HZHL 5C9JB 4FQPA 3BP5B 5EOCL 3D18A 5IB2A 2GHWB 1NMBL 2Z91B 3GI8H 1FVCA 3SBWC 5KS9F 1GH7A 3OR6B 4NT6A 1U0QA 3WHXB 3X3FL 3GMMB 3MRKB 1P4LA 3HE6B 4Y4KD 3OKNB 3MUJA 1I3RB 1WLHA 3CCHB 4H0GA 1KCUL 3VXNB 3LH2H 4DQOH 1W8NA 2AK4E 1KFAH 4UI2A 3DO3A 4BH7B 1IARB 1M7DA 3NMEA 3DHJA 3MACL 3RU8H 1B2WH 2XG5A 4U6VL 3C2AH 5DJYA 3WLWC 2WBJB 2YPKA 5A2KH 1Q9LA 4MJIE 5EUOB 1MI5E 2R2HA 3PWVB 4HC1A 4PJXF 3OR7B 5KTEL 5C0BB 1KIPB 1A5FH 4RAUA 1NCNA 1U8PB 3DX9B 3LKQA 4YPGA 4U1MB 4ZO9A 2E7MA 1H8OA 1T21B 3IFLL 3LEVL 5HI3C 4XAKE 4LFHG 3L5XL 1LDPH 4DZBB 5E9DB 5INDB 4U1SB 4ZFOB 3L5WA 5CJQL 5JLZA 1FYTE 4X0KA 5JOFA 2C3VB 3MXVH 1BMGA 2EDWA 4KZEL 2AXFB 2DQTL 2ORBH 3RUGA 3DSNA 4N0UE 4LDOB 3QXUA 1DQDH 5K93A 4GUPA 5DK2A 3O6KH 3R8BB 2ZOLB 3MO1A 3O9WC 5TE4H 3ZKNC 4UUJB 3W0WE 1G7IA 4NQCA 3OTTA 4PV8A 5GSVB 2DM4A 3ZYZA 4EBQH 3G04B 2X89D 4YWGL 4FOMA 4LKXB 3D48R 1QBML 5E8DH 5HYSG 2AV7A 3MBXH 5AZ2H 3UJJL 1N5YL 3IYLW 4P5TA 2MCPL 3K4DA 4GKOA 5HYJB 5B3JE 1HHKA 3VA2C 4X6EB 3DTXB 1FL6A 2OTWB 4XMKL 3QDME 3FQRA 5L2KB 4PJBB 5FK9B 3QZWB 5D1XA 5E94A 1JN6B 1LK2A 1VFAA 2P4AB 1JF6A 4F33B 1F13A 3LMJH 3RWJB 2WP3T 5GGUA 1JL8A 2A73A 1GZQA 1FNAA 5D70L 1NSNL 1MFNA 1RK0B 1CGTA 3IU4L 4PRPA 1GPOH 4NDMB 4Y4KA 3IRPX 1U36A 5FGBA 1EFXB 2EZ0C 3QCTL 2JE8A 2GITB 2HT2D 2JCCE 1AGCA 5GS0D 4WI3A 1X5JA 4KUCD 1KC5L 4YHZL 2B2XL 3LY6A 3O4LB 3V4VH 4J12A 4FTVB 4XPGH 2G5BA 1HQ4B 2LV4A 4P23D 2YD7A 3DX6B 1YN7A 3PXJA 1LWRA 1CXLA 2C3GA 3I9GH 4PJAE 3UTSE 1N64H 4QYOB 4CJ0A 2VKXA 2HTLC 1P1ZA 3BP6B 1AO7E 1S9XA 4HAGA 1MY5A 4LPUA 3BESR 4QHLA 4HUVA 5FUZL 2J88L 4HGMA 1ZHKA 2QLVB 2DQEH 4TVPH 3ULVH 3ILPA 4U31A 1ZTXL 2VR4A 1ACZA 3WKNA 5EU6B 3OX8A 1S5HA 1U8JB 4OFIA 5BVJB 4CMMB 3RX5A 4N0RA 2OI9C 5B38G 5BRZD 4J1UA 1DBML 3T04D 3CMOH 4XBEH 1DANU 2P24A 3U2SB 3VDCA 4Y4FD 1O0VA 4GQPH 2K9UA 4M4RA 2BNUB 2IADA 2EEAA 2OM5A 4OZHF 2AQ2A 2Q7YB 3W11C 2X89A 4U0QB 5ID0B 5KAQF 2BY1A 4PGDA 5KJRL 3EO9L 2YK1H 2AJUL 4RAVB 4NM8L 3AU1A 4F7EA 1E4XH 5E24E 1FL5A 1D7FA 3HNTL 5DMKA 1FGNH 4JANA 5E7BA 1ORSB 2ATKA 4YIQA 5FO8B 3B43A 2G60H 5EOTA 1FZOA 1J1XH 4LVHB 1NBZB 4K9EC 3HTLX 1JPFB 4BH8A 5E4IA 1UEMA 1FL3B 3IVKB 1QSFE 1F2QA 2ZPKH 4WWKB 5T1DH 2I9TA 3KYOB 4FFYH 4YZFF 1UKQA 5LGJB 4MA7L 1FO0B 1MHCB 3HE7B 3T0WA 4M7LL 3AMKA 4NNXA 5JUEL 4JR9L 4M3KB 3TZVB 3D3VD 1RUMH 2LAGB 4P46A 3EZ8A 1J86A 1UH3A 1R3KB 1T0NB 2E7CA 2VMFA 5MEPB 1FE8L 3X3GL 5DD3L 5ADOL 1FV1A 2N56A 3INUL 5CINL 2VN4A 2R1YB 1JP5A 5F71A 2FL5A 5DT1L 3IDGB 2E6QA 1E6JL 5I9QB 2OL3H 4L9DA 5FYJD 1NUDA 4RGOL 3TBWA 3LV3A 4P23A 3SE9H 5C0FA 3GGWB 3O8XA 1A2YA 1BZ7A 1BJ8A 2HTKC 2R0LL 5GRWA 1XF2B 1BM3L 2H2PD 3L3JB 5L7XH 5ITFA 4Y5VA 4GS7B 5HYIA 3HMWH 2DM2A 3MA7B 4MNQE 3HLAB 4O58L 1JI2A 2QBWA 3DMMD 4KROD 5IMOB 1H3VA 3S37H 1MREH 5FECA 1F4XH 2X4PA 3NCBB 4QT5B 1WJ3A 5DD6B 3QDJE 4IOIB 3BKCH 2VDLL 5FCUL 3V4PL 4TVPE 4LLUA 1MFBH 1HH6A 1INDH 3VMPA 5I1LA 3WS6A 4WFFD 4MWFB 4HJ0C 3QXVA 1JZ6A 4C54A 1RULH 3U0WH 1S7VB 1DUZA 1U8HA 4H25B 4QXGL 4Y5YB 4OQ1A 4TYUA 5DUMH 5I73B 5DJXB 4H5SA 1LEGA 3I6LD 3BN9D 5BRZA 3H9SD 1BGXH 3L7FB 3VG9C 1OF2B 1YMMD 1L7IH 4CRPA 4Z78B 3E8UH 3MRGB 1BBJB 2C7UA 2CRYA 4WRLA 1FRGL 1VHPA 5D2LF 5IT2H 4WDIB 4J3OC 5ALCL 1AD9A 4I4WA 3NIDF 4K94C 2BNQB 1QFWM 3AS0A 2EDRA 3PHQB 2WSKA 4KRLB 4UILL 3WJLA 4FXGB 3V6BR 5D2NE 4X4YA 3MCLH 3DSFL 1OAXL 2ITCA 3P4MA 3MRQB 2DBLL 3LN9A 8CGTA 3VGDA 3MA9H 3TIEB 1WBXA 3EIFA 2F5AH 1MJ8H 4XAWL 3DGCR 6FABH 2MMXA 1FJ1B 2EDKA 4DFIA 5CZVL 1L4IA 4QRPE 3FQXA 5D72H 3UTQB 2GK0B 1EMTH 1LO3L 2FWOB 5ITBH 3VE0B 2ZUVA 1H3UA 5CGYD 4NUGL 4Z7WA 1U8NA 4P5KA 5GGRA 1T7YA 4DN4L 3D3VA 4XPFL 2A6KB 5CILL 3I3BA 3ABZA 3I6KA 5F7DA 2OMNA 2IALA 5C0CB 1XGQA 5CD3A 4IRZL 3QRGH 4Y2OA 5IVXA 5C0GA 4C56B 2V9QA 4LBEA 3QXDB 3WDHA 2YPLB 3LAFA 3HKFA 4FFWD 5ADPL 3IJYA 1IL1B 3GB7A 1OGAE 1UJ3A 2ICWJ 4XCCH 3CC5B 4KWUA 1LO0L 3D0LB 4HIHA 2QR0B 2IPTL 1RMFH 5IQ7H 1PG7W 2BNRE 3RWHA 3UBXG 2B4CH 1C5BH 4LSVH 1F97A 5TFSH 2VLKE 5H94A 3MRIB 5FYLL 3VFVA 2NTFB 1ZT7B 4UIKL 4G8FB 5I30H 1I7RA 4F7CB 1NCAH 2V17H 1RU9L 2R39A 2CD0A 3EYQD 3FFCE 4K9EL 3WE6A 4NPYB 4OLEA 3DVNB 3DMMA 3CAFA 1A14L 2VDKH 3DV4B 1A64A 4RISL 3C5SA 3BKYL 3QIWB 2X4QB 3UTZB 3R06B 1ES0B 4I18B 1KF9B 3TP4A 4U1KA 3RUGF 3O2VL 4TSCH 2X1QA 5KAQG 3L9RA 1QOKA 2EYSA 5T3ZD 2ZOKA 4HUXB 5IW6A 3SQOH 1XGTA 3F7YB 2Y7QB 5FYKU 2Q8AH 3GJFH 3H9SA 3O3BB 4FP8H 1Q0XL 4U1NB 1XGYL 4A6YL 1UACH 4EN3A 1S8DA 2EC8A 2X41A 3MOBL 1RHHB 3LRGA 3WLBA 4PRDB 1K8DA 1UCTA 2ESVE 4HK3N 5SX4I 1O7VA 1S7TA 3GIZL 5FOBB 1CU4L 1NC2A 4FQCL 2V2XB 1T6VN 5DRWA 4NN6C 4XWGH 3UC0H 2ICWI 1S9VA 3BGFC 3EJZD 4KKAC 4LHQB 4C83B 1OHQA 4UINH 2V5YA 4YHPB 4G9FD 4IJ3C 5D5ME 2X4RB 3JV0A 1KSRA 4GW5A 5GGTH 2E3VA 2DQUL 2Y06H 3I6GB 5DC4B 3H42H 2MKLC 2AK4D 5CD5C 4IIQB 5I76A 5DC0A 4G42B 1I1AC 3CIQA 3VGEA 2B0SL 3FHAA 3GJEB 5GGSA 43C9B 3EYSH 4AL8L 5EO1B 3VGAC 2DN7A 1NBQA 3QDGE 1FYHB 5D7LA 1AFVL 4MJ2A 2VXSH 3QRFM 1P7KA 2UZIL 4N0FA 4XVSL 4P4KC 1LVEA 2NY0D 3CVHA 2Y5TB 1QR1A 4XAKD 5E03A 4K94L 2VWEC 5KSAB 1TZHB 5J6GB 1WUNT 1F02I 1J11A 1FYTD 5EO0B 1KENH 4JFEE 5GS2H 2A77H 5GQBA 3VRLE 5MP6L 1HDMA 5HPMA 1P5UA 1EPFA 1OAUH 2ZUUA 1C16B 5ACMA 2X70A 1EHAA 1MOEA 1R3LA 5T1LD 3S96A 3SDXE 3QYCA 3MGOB 5DA0B 3PJSA 5I8OH 2LAAA 5CS7A 3W0WD 4R0LC 4PRIB 3HN3A 1BFVL 4XH2A 4ZYKB 5IHUH 3LKOB 2PYFB 3FO1A 1U93A 2DKUA 5MEND 3P4NB 4P9HH 5EDXA 3S6CA 3GSNB 4WHYH 4X80L 1IAOB 2Q8BH 1QQDB 1S7WA 2BRRL 2NZIA 1OD7A 3K8KA 4JM2C 3UYRH 4OB5H 5B8CA 4IMLB 4ZS7H 1FAIH 3Q6GH 4K7FA 4Y19E 3BGMA 4Q9BA 5KBNC 1C12B 3TJEH 3T3ME 5KSBB 5C0NC 4LLDB 4FMKA 4JY5L 5C71A 1UQSA 4G8GE 5ISZA 1RZJC 4WHDA 1PLGH 2HT2C 5D9SB 4M6ML 4L5FL 3DIFA 3HG1E 3QDMD 5JXED 4WO4B 3QEHA 4ISVA 3IFNH 3RVXD 2VUYA 3OXRA 2HYMA 2ICEB 4M1CC 2ARJQ 5BOPA 1CQYA 4HPYL 1FDLL 1JGUH 3TN0B 3V9FA 2FO4A 4WTWA 3SGJA 5K9QI 4YLQT 5HXMA 5I19L 1NGWB 2BMKB 4G9FA 4LASL 2X9WA 2NX5E 3K1DA 3QUXC 4Z9KB 4JFQA 5TF1H 1CLOH 3QG7L 3S8WA 4OLYL 2AK4A 5F3BB 3EUUA 4CAGA 1EZVY 4ZUUB 3FOLB 1F5WA 4D9LH 4NRZB 4RAHA 2QSCL 4AEIH 4KDWA 1EEYB 4FG6D 4YXHH 3KPPB 2XKUA 1YPZF 1U8QA 1VFBB 3QEUB 5HGBA 3OAYH 4LPXA 4LSUH 2P8MB 2SEBB 3MV7B 4YHIA 3UTSD 5DD1L 1KBGL 3F7VB 1YEEH 1LP9E 5IEHA 1AO7D 3EFFB 4Y4HC 4KUCF 2FR4A 1ULVA 3E6HB 4Y2DD 4Y4FC 5C2UB 1WIOA 4EVNA 3IJSA 3TGXA 4F3FA 4DKAA 3WNPA 4MA8L 4LPTA 3MUY1 4AY0A 4MNGE 1QFWI 3FN0H 1FYTA 2DKMA 3NZHL 1EUTA 1ZEAH 2FBJL 3HI5H 1B0WA 2AJYL 3ULUE 3MRHB 5TQ0H 1FZKA 3IXAB 4WW2C 1EUUA 1YEJL 3PDGA 5T1LA 4JB9H 5IOPB 3HC0B 4S1QL 3BZFA 1VGEH 2BOBB 4GG6E 5IHZA 3VMNA 4BSVB 4PP1C 3DXAE 4NWTL 4YGVB 4R4FL 5CSZA 4LCUB 5MENA 4FQHA 1GSMA 5I0ZA 2CRZA 3PWJA 2WUBH 4APQD 5C0EB 4YNYA 1QSVA 4M62L 3DROA 3MUGA 5GIRA 1XF4A 4D8PA 2QV2A 1UGNA 4KV5F 1CGWA 32C2B 1QEWB 3BKMH 4YC2C 2DI7A 5CEZL 2AQ1A 3G08B 5TGBB 2F9BT 4AM0B 1U2HA 5DJAA 3GBLA 3HMXH 2JB6A 1QSFD 2V7NB 1ZWIB 4JKMA 4F57L 3QNXA 4D3CH 5BV7B 1MF2H 2NY1C 4OD3L 1BVZA 1A4JA 2E9BA 2R56L 2ZUQB 4N8PA 1NMCB 3GKWH 4AT6B 5SWQA 5IJVB 1TPXC 4QHMB 4KJYA 3U0TB 1ADQH 1MJ7H 2C1OA 2JCCA 2YEZB 3EDKA 4GMSH 5EO9A 3M45A 3HNVL 2OJZH 4Z7WF 1OPGH 3L3IA 2ZG1A 3ZE0F 1QP1A 2F5BL 4NO2B 3Q2CA 5E2VL 5IW1B 2AXGB 4LQ1A 2H26B 1CLYH 1UM5L 2OZ4H 3TBVA 5IVXF 4L3CB 3MROA 1KPRB 1JNLL 1RD6A 4Z7UA 3T65B 2GCYA 3U7YL 1N8ZA 1JNJA 1AO7A 4NC1E 3BN9C 3CX5J 1RZJL 4MNQD 4PRAA 2EO1A 2VE6B 3BDYL 3PQYB 3RWIB 1XIWC 4LAQL 3TPUA 4FQIL 3MUZ1 1TNMA 5DJCA 3JVGC 5DWUH 5K59F 3G5YA 3GSOA 3QDJD 3QWOA 2BSSB 2Z35A 4QNPF 1A3RH 4WWID 3REVA 5IBTL 4TVPD 3VI4E 3O6LH 2NY2B 5D7JB 1CL7I 3ULVD 1TFHA 4NGHL 1K8IB 2C5DC 5KG9B 2AEQH 1QUNA 1SJEB 3BPCA 4P4RA 3ZO0A 3MR9A 3F7PC 1YN6B 4YBLC 5EBMB 3KNBA 1U8KB 2RGSA 4CW1A 1I7UA 1CGVA 4APQA 3VWKB 1A9BA 3D2UA 4ODVL 2XTJC 5CEXB 5E2TL 3DV6B 3P0YH 4HK0A 1KXTB 4U1JA 3MNVB 3TYGH 5DVOA 2A9MH 4N68A 1MAKA 3UEZA 1Q9WB 3L7EB 1T4KA 3GSXA 4N9GA 5ICXA 1CS6A 2F58H 5DJ0B 1VKXB 1V05A 3CU1A 1NFDA 2ITDB 2VXTH 1TJIL 4QRPD 2A83A 1QSFA 1W72H 3BYYA 2XKNB 1KEML 2XFXB 5BZWB 1RJYA 4NO0B 3UAJD 4LRIA 3F58H 3CFDB 1IM9B 1X5KA 2YA0A 1ZVSA 4O9HL 5DJDB 3QO0B 4XNUH 2DQDH 2R0WH 2Q7NA 5E8EA 1MEXH 1JK8A 5CJBA 5BZDB 5J1TC 1OLZA 4KHXL 4N5ED 3R8QA 1KJ3L 4QXUH 3MLVH 4YBQC 1NAMB 3DX8B 2DLFH 3VFGH 2R69L 1D5ZA 1OGAD 3ARDA 4U6HA 3Q48A 1T20A 4XC1H 3K4ZA 5F7EL 3IDMB 1XEDA 3RHWF 2BNRD 1JPTH 7FABL 1XF1A 1EHLL 3RZCD 3S37X 5JIPA 1INQA 5D1ZC 3T0VA 3LQMA 1YYLH 2D7PA 1U92A 1P6AB 3EFDH 4OTXH 4GXUM 4YX2L 3RHWK 3KYNB 5C0AE 4K8RH 4JLRA 4AIZA 1T5WB 1ITCA 4KDTC 1EGJL 5HDBE 4XNYL 4JKPL 4TULL 2D4DA 4C4KO 4O2FB 1ND0B 4HWBH 2D03H 1LO5A 5C07A 1N6QL 1U8IA 5HGAB 5D7SL 5IV2B 1T80A 4X7EC 3UXFA 1F58L 3PNWA 2R15A 5B39A 4Q6YA 5D6CA 3BAEH 4OLZL 1QG3A 1NGYB 1QSEA 5EUKB 4FQ1L 4RQQB 3EO1B 5GS1B 4G7YL 1FORH 1GZPA 1DDHA 3EJZC 3ARYA 1IQWH 3H9ZA 1V7ML 4PJFE 5GSRA 4D0CB 4YR6A 3C5JA 3MV01 3H9YA 3NIFE 1QNZH 2HJFB 1DUYB 1A7RH 4GRWB 1NMAL 1L0QA 3GM8A 2W91A 3N1QC 2ESVD 3B4NA 4ENEC 3BZEA 3SDYL 1YNLH 3L5JA 3PIQB 3WXWH 1NDMB 5ETUA 3QQ9C 1DVFC 1MRCH 1YUHA 2UUDK 5CKGA 1M71B 5EORL 3C5ZD 2Y5EA 4AH2B 4N5UA 3BHBB 5HHPB 4QRQA 2YXMA 4JDZB 4P2YA 4IHOB 1UVQB 4QF1A 2XQBL 4BA8A 5KVGL 4NBXB 1BD2B 5TE6H 2VISB 2VL4A 4KKCC 1RZKC 2GQHA 5IGXH 4MDJB 4QGTA 1HXYB 1UZ6F 2IANE 3OGCB 2H32H 3QI9D 3JWDC 2YPVH 5HGGS 1LE5B 3QDGD 3BPLC 3BFOA 3WIFA 2O5ZL 1NAKL 4POYA 4JRYE 4YXKH 3MXWH 3ULSB 1OGAA 1AXSA 2P1YA 5D2LB 1ZT4B 1WEJL 5I1HH 4NRYA 2BNRA 1E27A 2OL3A 1OW0C 1BAFH 4TUKH 4AENB 1CFVH 5CMAA 5I1JL 2QADD 3VD5A 3WO3B 2PTVA 5I1CL 3HZYB 5E2UH 1CXIA 5DQDL 3K74B 5GHWL 3ZDYF 5F1SA 1H3TA 4MA3A 5CD3B 1I1YB 5FO7A 1YEFH 5JXEC 5D1QC 4ONOA 5F1KC 4Q7DA 2OK0H 2GFBA 3D69B 3D18B 4ONHB 1CDGA 2BVUA 5F70A 1X3DA 3RBGA 5HBBA 4ZFZB 3NTCL 3VD7A 4JQIH 1RSFA 3V79C 1MVUA 2DF3A 3HC3L 5F88A 2ADIA 1K4CB 3QIUA 3OWEA 3SJVB 5DEGA 1DL7H 2RB8A 1OM3L 3VXUB 2Z93A 3BXNA 1GAFH 3QISA 1KYOK 4JG0L 5DJYB 1UB5B 2KZWA 5FM8A 3HG1D 1EJOH 1X5GA 1EEZB 2YPKB 2FJFA 3DYOA 2I60H 1NGZA 4HBQA 4PB0H 4O5LH 4FG6C 1ZANL 1QBLH 5F6HJ 1KIRA 3VXQA 3AXLB 3GHBL 3EYOB 1UZ8A 2F54E 5B3JF 2UWEA 4YDIH 4YPGB 3PL6B 1LO4L 2NX5D 3CLFH 3S9DB 3RY5A 3FB5A 2ADJB 2EDJA 3SDAA 2DI9A 4OCWL 4YXLH 4Y2DC 4I2XA 5F9WC 1F4YH 3AGVA 5F9JA 4YO0A 1BHGA 1MIEL 2FJGA 5JLZB 3TC9A 3OKLA 4Z7NF 4JO1H 4XC3L 4E5XA 3B3IB 4P99A 4EQ3A 2B1HH 1MHEB 1N0XL 2BVPB 2WANA 1RZIA 4YAQB 1Y6MR 2CIIB 3T2NL 3QI9A 1B6DA 1U95B 4GUPB 5DK2B 1C1EH 3NABH 3O41B 4MVBC 3QDGA 1MQKH 2JCCF 3MRDA 3QFJD 2HMIC 4UDUA 3MRNB 3L1OL 2D0FA 2DQCL 4R8WH 4HGWB 3K3QA 5FM5O 3LDBC 4QEGA 1MFDL 2P47B 4XTRD 4F7PA 4LLQB 2OXGA 3MJ7A 1F11B 3D87B 1XAUA 3OF6D 3V6OC 3WV0A 1J0JA 4Z7UF 1AE6H 1KELH 3M8OH 5GJSH 2ATPA 3ULUD 5GS2D 4GQ9H 4M7KL 3RVWD 4WV1B 1KV3A 1NEZB 4ZMAT 4OCLC 3RL2B 1GOGA 4FHBD 1X4YA 3SDXA 3ZMRA 5GJTL 4JFDE 4J3WA 3MV11 1IFHL 3VD4A 2VLJD 4M00A 3DXAD 4Q9QL 5GGUB 1QRKA 4OGYL 4ZD3H 1FVEB 1RZKL 3GSQB 4D0BB 1R5VB 4PRPB 3SO3C 1A7OH 2J8HA 3LZFH 2MHAB 3JWDL 8FABB 3IU3A 1JYXA 1CT8A 5E5UB 3GMNA 2WQRA 4KQ4L 5BQ7B 1M05A 5ELIA 2ICES 4PJ5A 3FAXA 4DWHA 1AGCB 3OJ2C 2FJHB 1KB9K 3LVEA 3FOMB 1D9KB 1JGVH 3CMGA 1NBYA 4QRTA 2ZG3A 3HG1A 3QCUH 4QLRA 1ZLWH 3I2CH 4G7VL 4Y5XC 3T3PF 2XY2A 5IEKB 3MRJA 5H35A 2V9TA 2LTQC 5B3NA 3CFIC 1WCQA 1XCQA 2C3HA 5JMRA 1IKNA 5DMIH 5L0QC 2IBZY 1FG9C 3CK0H 1NFDF 2NX5A 4WFGE 3EO0A 4KMTL 5E99L 3OXSB 1BLNB 5GGTA 3O3AB 3GK8L 1GC1H 4RSVA 1MCOL 2WBKA 5F89A 4UTBH 5ESAA 2EH8H 5AG8A 4NC2B 1IGCL 3TH4T 2Q3ZA 4F9LA 4FFVC 1DLFH 5D6DA 1BQHB 4I3GA 1LO2H 4MDIB 1PZUB 5LGHH 1N2RA 5IFJA 1YECL 3QFJA 5IR1A 2IADB 4OFYD 3CVIH 2ID5A 3MNZB 3ARFB 4G6JH 4HWZA 2B5IC 1JYVA 5LXGL 3B83A 4O2EA 5EUOE 1G84A 2OR7A 3IJHA 1SYSB 3BT2L 3MGTB 1B2WL 4MNGA 1IE5A 5C0BE 3U9PH 4B5EA 1MCJA 4GRLC 4S1RH 3A6CH 3CXDH 1J8HA 4HIEB 3M1BB 4G8EA 5D2NC 3RKDD 4HPOH 1EFQA 2A38A 3P30L 2X4UB 3BIAX 4HXAL 3SDDC 4JANB 5C3LD 3TO4D 2Z31B 3CX2A 5FO9B 3LN5B 1MFCH 3W81A 5E9DE 2GIYA 2X40A 4HXBL 2H2SD 4JFXA 4MXVE 1P5VA 2I9TB 3WD5L 1KIUA 2VLJA 5JZ7D 1IEHA 3BPNC 3ULVF 4U1HB 3PGDA 1MCPL 2BJMH 5I18L 4U6XA 5I2IB 1YPZB 4P2QA 3FT4A 4MX7A 3CSYB 2P49B 1JTOA 3VH8B 1MCQA 4N5EC 1FV1B 5MEQB 1AQKH 1JCKA 4UNUA 4R96A 2PF6A 3NAAL 4GKNB 1YEGL 4JHAL 4OQTH 4MD5A 1C7TA 1AXTL 3RWFA 4MJ5A 2BXZA 3FRPA 2R0KH 4S1DC 5CEYA 3TBWB 5I17A 3BP4B 1ZV5A 3O8XB 4L9LA 3V7AG 3RZCC 2D31A 1G7QA 3TA3C 3MJ6A 3UZEA 1DANT 3H3PH 4P3WA 1I9IH 3TFKD 5L2KE 4PJBE 3DETD 4PPTA 4XMPH 1FO0H 1DQJB 1H5BC 4LLWA 5DZLA 5AD0A 5JORB 2PCPA 1FIGH 2GSGA 3ES6B 3FL7A 1MQ8A 2X4PB 3RVVD 3MUHL 3MPCA 1MCBA 3OB0H 5EZJA 5GRUL 2CXKA 4LAJH 3VFRA 1BIHA 1QO3A 2VDPL 4TUOB 1HH6B 5CUSL 1Y0LB 5DJ8A 5CGMA 1T1WA 4RX4D 5DI8A 4G6MH 3ZYIA 3RI5F 3SDCD 3WSQH 1I9RH 4H5SB 1LEGB 2YC1B 4NQDE 1FFOA 2MQCA 2DWEA 4OD1H 2NQCA 1K2DA 5JW5A 3RI5K 4OFYA 3Q5YA 3FMGH 5I8KL 1GGIH 4FTVE 3EOTL 4I4WB 3RPIB 1RUPH 3KS0H 2CO6B 4XZUA 2I9LB 3FAWA 4K2UH 4NZDA 4DEPC 3IDIA 3GMQA 4OF3A 1CXHA 4LIQL 1J0IA 5SX5K 1ZHBB 4XPGL 4OD2B 5C7XH 4JDTL 1WBXB 2X1WL 4M6OH 4KQ3L 3ILQC 1P7QB 1CD1A 3G5VA 2BHYA 3FQXB 5ID1B 4PLJD 4NO5B 2PXYB 3O3DB 4O51A 3BISA 4CVWA 4RBPH 5EU6E 3C6SB 1CDIA 2ZCLL 4KVNL 4P5KB 1QLEH 4N0YL 3ZSSA 2ICCA 1F45A 1NCCH 3I6KB 3VFSA 2V5MA 3O3EB 4TVPL 2KQNA 5LBSL 1JYWA 1NANI 1XGQB 1JNNH 4NRXB 4E9LA 5HYQA 1KCVL 4L8SA 4NQXB 4YQXH 1ACYH 4KTDL 4W6YB 3O6ML 3B2VH 2DLEA 4E41A 2DJ4A 3CMOL 4LCCC 2VNCA 2XN9A 3PP4L 4ZAKD 3KPSD 5CBEA 3HMXA 1EZVX 1RQ5A 4XMLL 1VDGA 2Y9RT 2ZWLT 3JXAA 2Z92A 1HWGB 3ZLQC 1JHLH 4YK4B 1NUGA 2UWEF 2Q87A 2IAND 2NW2A 3BE1H 3IDYC 4P2RB 4NNYA 4N8CH 3MOAL 3MQIA 3NCJL 4G9DA 1LEIA 5EBWA 1U6AH 2HVJB 1GGBH 1H0DB 1MPAH 5EZLB 1EO8H 3NZ8A 4N90E 1JV5B 5EU4B 4JRYD 4TNWF 1B0RA 4LSQL 4PY7B 4DGYH 1JFQH 2NNAB 3VRIA 3PP3K 4PFEA 4U1KB 2GT9A 2X5PA 1KTRL 1Y18A 4FZEH 2LFGA 1IC1A 4TNWK 5EIVA 4S1SH 1CICD 1MCCA 3N1PC 5F96L 3SDCA 3SE3C 3UJIL 3FO9A 2PR4L 4JN2A 5E6ID 1HOCA 2OZ4A 5EC2A 4JZJB 4K3JL 1FZMA 3VFOA 4S10A 5I1AB 4K8RD 1QPPA 5GGVY 4K71B 1AGDB 1KEGL 2ENSA 1QLRB 4KMLB 2ARWA 4CADA 1NC2B 5B39G 1YY9D 3BQUA 5DUBA 4G43B 2Y6SD 4NO3A 5J12B 2LU3A 1CFSA 4XP4H 1T22B 3PDOA 1ZGLA 4P2OB 3VXPA 1TZGL 5IB1B 5C08A 5M95B 3STZA 3SDXF 1ED3A 2BCKA 2OQJB 5HHMB 4PJFA 4YHYB 1YJDL 1J0ZA 4QRRB 1TJGL 4M93B 4JRXB 4I0PC 3BUYA 3BEWB 4U49A 1TNNA 5HI4D 4IMKC 5L2JA 1YZZA 3P9LA 4WENB 3S37L 4RGMC 2IG2L 1II4E 4Z76A 2HJKA 4OUUA 3FQWA 3RVTD 1T1ZB 3QA3A 4X6DB 1G6RB 1BIIA 1V5JA 2Q1EA 4JZOA 3T3MF 4MNHA 3KS0J 1MWAL 1U91A 2ARJA 1WISA 4XWOC 2VUOA 2F54D 1P7KB 1IGFH 1S9WA 4E42A 1H3XA 1OP5H 1EA9C 1QR1B 2RR3A 2BNQE 3NN8A 12E8H 1L7IL 3MBED 4ZAKA 4XNZC 3KPSA 4DJMA 5IT2L 4C58B 1W72A 4OF7A 4F58H 3HCVA 2FATH 1X5YA 3L95B 1BWMA 4CVZB 1ZLUH 2P7TA 3Q5OA 3KLDA 4FQJL 2PYED 1MHHA 4WEMB 4XCFL 1R3LB 3ULUC 3RVWC 1Z6JT 2O93L 1K5NB 5CLTA 1KACB 2WW8A 5JPMB 1QSZA 4MQSB 4R2GD 3U6RA 3FO1B 2W9DL 3MSPA 3QWRD 3MODL 4EQ2A 3C6LB 5C1MB 1J1OL 2GSIA 4P57B 1D3CA 4EXKA 5TJWK 1LNUA 2Z8RA 3HRPA 3C87A 1K9TA 1BX2B 2P45B 4N8VA 1CICA 5B8CB 4ZODA 4NZRH 4K7FB 3FQTB 1E28B 4J8RA 4OFKA 5E6IA 3MLXH 4JFOB 2YPLE 3H0TA 5E5RB 4DZ8B 4GBXD 1UQSB 1A6WL 5C92A 5ISZB 4LEOB 2ZUSA 4BSWA 3DIFB 4KI5E 5DYOA 1AC0A 1TVHA 4JFDD 4WW1A 4XCNB 2HLAA 1A6AA 1E4WL 4KK6C 1F4WH 4M48H 3TWCH 1EBPA 4WU5A 2NY3B 5IFAL 2HN7B 3Q1SL 1QKZH 1QFWL 1P9MC 2C4XA 2DQFB 1QYGL 1ZA3B 2D7TH 2YZ8A 4HWEL 4DCQB 4EI5A 1D6VL 3P11L 5ICZB 5KVEL 1DE4A 3ZT5A 4EJ1C 3GSRB 5KVFH 2R2BB 4HF5L 3GSNH 2HKFH 3RNQB 5AYUL 1OVZA 1RVFH 3U4AA 4LVOC 4NSKA 3OHXA 4NZUL 4ODTH 5CCKL 4X4ZA 4WNQA 3MRLA 4RZCA 4ZS6D 4QOKE 1NL0L 1Q1JL 3SE8L 2JJTA 2FR4B 2R9HC 1PJ9A 5CP7A 4WFGD 1R0AH 3C9NB 4RNRB 4FQXD 3CFBA 4UV4H 2AJVL 5I71B 1F6FB 2DLTA 4GO6B 1IEBA 3MNWA 3L3HB 2VAJA 4Z0XA 4QXTB 4RGNE 3VWJC 5EA0L 4JO3H 3QDAA 4PJCB 1LMKA 4N1CA 2W38A 3HE6D 2GW5A 4S2SB 3IS1X 2PYEA 3QAZB 3WN5B 1G7JA 2W60A 1A6ZA 4Y16C 3TO4C 2H32A 1BFOB 3BZFB 4X7FC 4KHTH 1GVIA 1UT9A 4WI9A 5D71H 2H2SC 4YHLL 2DQIL 2WBJD 4LSTL 4CL7A 4H88H 3S4SA 5FYJU 1AGFB 4LK4A 1OT1A 4YNYB 2OR8A 3O2DL 5C0BD 2EDDA 3UO1H 3VFPB 1X5AA 4QTIH 5F9OH 3GSUA 4HCRH 4IRJB 5GIRB 1XF4B 4D8PB 1DBBH 2DYPB 5JDSB 5F7LB 3CDYA 2D0HA 2E6PA 3FFDA 3IDNA 1Q38A 3AS2A 2EKSB 4NP4H 1EAPA 4OCYL 4U1LA 4GBXA 5GGVH 4ELME 3THMH 4TPRH 4KUZL 1RIUL 1PKOA 3NFSH 3W9EB 5E9DD 3V5KA 5DJAB 2FX8L 1PY4A 2HRLA 2BSRB 4M8VA 3MLTB 4WTZA 5HVFB 1DVFA 1S3KL 5C0RL 3B5GA 1AP2A 4FFZL 3SKJH 3PABB 1MFAL 4M8QA 1SM3L 5J1SC 3E3QC 5HD8D 1YMHA 1CL7L 3ULUL 3TCXA 1AHWC 5DHVA 1YEHH 2A9NL 4NN5C 2W0FB 1IKFL 1FGVH 5K9KB 4PRIE 3UX9B 3DETC 4HMDA 5DFVD 4MLIA 4Q6IC 1CFNA 3B8YA 1PQZA 4RFOL 1ZLSH 4OZIE 5TH2B 2A1WH 5I8CA 4YFLI 2A74B 3DUHA 1WCBA 4PJ9B 3SCMA 1JIBA 4U0RB 3UPRB 4GOSA 1OSPL 1Q9KA 3RTQC 5H8DA 3FQNA 1J0YA 5J13B 4DGVH 4HX1B 4Z7UB 2VABB 2GCYB 5KSBE 4OKDA 1RIHL 3H9HB 3B9KA 1N8ZB 1DN0A 2IJ0C 4KK5D 2D7MA 2IQAA 3WO4B 3E1F1 4XP6H 4X6BB 5D93C 4PRAB 4WEBH 5L2KD 1NGQH 1A6UH 2R23A 1D5XA 4FQXA 5BV7H 2O26U 5L6YH 5I1KH 4YHOL 2ZUWA 4BZ1L 4JFYB 5C9JA 2PO6B 4QGYA 1UA6L 3BP5A 2Z91A 4O02L 3G5YB 3QWOB 4PGEB 4LVNC 1YDPB 3OR6A 3WHXA 3GMMA 3N1GC 3MRKA 4MLSA 2A6JB 3VFMB 5DVLA 3WMSA 5J0BA 1WWCA 4DGIH 3VXNA 1EFXD 3E2HB 4NQDD 4WCYL 4BH7A 4OI7A 1HH9B 2NXYC 3VXRB 4NC0B 1KXQE 4PLJC 4PJIB 3NPSC 2WBJA 3JUZA 1MJUH 4FTVD 4NZTH 5EUOA 3RY4A 3PWVA 5LAXB 3V0WL 3OR7A 1A9BB 5I1GL 3D2UB 4OLXL 5C0BA 2Q3AA 2HT4C 3MV7E 1KIPA 4PJHB 3OGOE 3DX9A 3F8UB 2V6HA 4IRSC 3TIDB 5AUMB 4U1MA 4I77H 3GSXB 4N9GB 5J1AB 1H3GA 1DJSA 1T21A 1JRHH 1QZ1A 2VXVH 4JFHD 1WZMA 1I85C 1NCDH 4WI8A 2CXGA 5E9DA 4TTDD 5EIIB 5INDA 4DZBA 5C6WH 2NPLX 4U1SA 2EDOA 4ZFOA 1H8SA 2AP2A 2Y07L 4MB3A 1K85A 5E7FA 2AXFA 5EU6D 1T0MB 2EDYA 4FQ2L 4WEUD 4WHYG 1N0LA 1JK8B 4LDEB 4AYFA 1FBIH 5KN5B 3LS4H 2AW2A 4UUJA 2BDNH 4M6NL 2AJXL 4OLWL 1T66D 5FIEA 2C1PA 2OLDA 5GSVA 4KRPC 4X7SH 3AREC 4AJ0A 1D5ZB 3NCCB 3ARDB 4LRNH 3G04A 4U6HB 1U41A 4MXQD 4CDHA 4LKXA 4JDVB 2E8ZA 1MJJB 1KGCE 4YDKL 3CJJA 3O9WB 1C7SA 1INQB 4PR5B 4GAYB 3BKJH 2WUBL 1YNKH 4AIZB 5HYJA 4KTYA 3LS5H 1WZLA 4KKNA 4MD4A 4X6EA 3DTXA 4W70A 3JTTB 2OTWA 4O2CB 5FK9A 1MFEL 2VTFA 3QZWA 4NQEB 5C07B 3VA6A 3BSZH 4WWKD 1JN6A 1N6VA 1NFIB 1TXKA 4N90D 3V6OA 2CH8A 1MCSA 2HRPL 3AB0C 3HE7D 1IGYB 1WC7B 2Q76A 1J88A 1DSFH 4LGSB 1RK0A 3TZVD 2DMBA 2AXHA 5D6CB 3JTSB 3MLRH 1PGRB 3KHOA 1QSEB 2FZ3B 3CZFB 1WITA 2VC2H 3I50H 1GZPB 1OTTD 3NFNB 1NAMH 5E0QA 5DRNA 5IBUB 2VXUH 5KSVB 1RUQL 1A4KA 1CE6B 2GITA 4JO4L 4LDLB 4ZDHB 5GSRB 1W0WA 4YR6B 2DRUA 1TZIB 3O4LA 1A0QL 1ETZA 4L4TB 4XHJD 2VO5A 3T0EE 1DLHA 4FTVA 5EPMA 4ZSOB 1BJMA 1HQ4A 4GMSL 4ONFL 3DX6A 2IWGA 1E0OB 4LMQE 2Y36L 4QYOA 5HHVL 3BP6A 1SJVA 3OPZH 4OF0A 1SBSH 4J3TA 2OTUA 25C8H 2FX9L 3PQYE 2ED9A 5JHDE 1YA5A 3OJDB 1GGYA 1W2KT 5ANME 2FH8A 2VDOH 2M26A 3TT1H 3MBEC 1KN4L 3ZZ1A 1XF3B 4M7JH 5EU6A 2BC4B 4X9BA 1U8JA 2PW2A 2AI0L 2CKBL 5BVJA 2VQTA 4CMMA 3GMLB 2DKSA 4EIZC 5CIPB 3LSOB 5BVPH 4X7CC 4JY6B 3U2SA 2ZNWA 5DQ9B 2BNUA 4GRWH 4XP1L 5EB9A 2YMXL 4LF3B 3V4UL 5TE7H 4TSAH 2Q7YA 5ERWB 3X17A 5TDNB 2BNQD 5ID0A 5C6TL 4TNVF 3CFEA 4M1DH 4OQTA 1ROWA 2YUVA 1E27B 2GJJA 4RAVA 5DURD 3MYZA 2OI9B 3ZTNH 4JEGB 3HZKB 4H1LB 3UTTE 3LQAC 4WI5A 4UV7L 1ZS8B 4XP5H 5EZIH 5KZCB 1EO7A 1ORSA 1S7XB 4KI1A 4ZTOH 1T6WA 5FO8A 1UCBL 3I02B 5BO1L 1NBZA 1T7XA 3P0YL 1JPFA 2HVKA 3EZJB 3H8NA 1MCWW 1ORQB 5FO7B 4WWKA 3KYOA 4LCIH 4PGBB 1A7QL 5LGJA 4HAFA 5E2WL 3HE7A 2YOCA 3WIHL 5JW3L 2EDFA 3TZVA 2MTPA 1FNEA 3V7MA 4OLVH 1HE7A 3NIGE 1L7TH 1MVUB 4GAGL 1UH2A 1Q8MA 1R3KA 5C0CD 1P4BH 3NH7L 1DR9A 1T0NA 4P9MH 5DEZA 2CUHA 5C3TA 1URLA 5MEPA 4C56D 3VFNB 5FEBA 1NLBL 3HR5B 2DAVA 2YPLD 2Z93B 3KPTA 2IGFL 2R1YA 1X5IA 3IDGA 3MZGB 5KSUA 1U3ZA 5F8QC 5TDPB 2NY7L 1BEYH 4KI5D 5TQ2H 1I4FA 1LQSR 5T1KB 4JG1L 2FJFB 2P42B 3GBMH 5BXFA 3FONB 4UB0L 4K23H 1F8TH 5IHLB 3GGWA 5BS0E 4KJPC 1IVLA 5DO2D 4ERSH 1N26A 1XF2A 4RDQF 4UT7L 4Z95H 1E6OH 1B6UA 3L3JA 1TMCB 1CVRA 1OARH 1KIRB 2R29H 3R1GL 3VXQB 4R97C 1UZ8B 2UWEB 3TNNB 3MA7A 3HLAA 4Q2ZB 4HJJL 5DFTA 4OF5A 2D9QB 3EFDL 5IMOA 1NLDL 2HKHL 3CFJB 3QIWD 2N7BA 4QT5A 3VXMB 3IS0X 3TJHC 1LK3H 4YZFE 4IOIA 3SGEH 4EI6A 4TRPH 2D03L