1RIHL

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DLVLTQSPATLSVTPGDSVSFSCRASQSISNNLHWYQQRTHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSISSVETEDFGMYFCQQSNRWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain of antibody 14F7
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
total genus 56
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL01
4Z7WE 3NCMA 3ZT5A 2RAMA 1LO3H 4LCWD 1R24A 4Y2DC 2FYYB 3WO3B 5C0CA 4LCWE 4G5ZL 4OF7A 1KCRL 1JPGB 4LSTH 4ELKA 1TTGA 4FTVA 4PJ5D 3TT3H 3KVQA 4QGTA 2D7QA 1OQOA 4BZ2H 4PIRF 4PJ5E 3B2VL 3U6RA 2DB8A 1HSBA 2NQCA 4PP1D 4G9DB 5IW6A 4MXWH 5C86A 1KPUA 1WAAA 4ZAKA 5FHBH 1OAUL 5JZ7C 3G5ZA 4P9MH 3FQXA 4PJHB 4WI6A 3BPOB 5E2WL 5FOBB 4K7FB 2AEQH 1XGTA 4GAJL 1LGVA 3KR3L 5GZOC 1EFXD 5HHVL 5ID1A 3OKEB 5I73B 3HZVA 3HCVA 2OP4H 5D4QA 1FPTH 2PTUA 2E7BA 4LSRL 1IC4H 1Q9OA 4L1HA 5DRXA 1QRNB 4PG2C 4LK4A 5HI3C 5L0QB 5ALBH 5C0BA 3I9GH 4X9BA 2W60B 4CADA 5EZJB 5KVDL 4YEFA 4FFYL 1I8IB 1FE8L 4U1IB 4RFEA 5E8NB 1PZ5A 1BMGA 3GBMH 2WBJD 4X5XA 1YECL 4KHXH 5I9QC 4N9GB 5KW9L 1FL5A 2RB8A 2Z4QB 5IMOB 4GAYB 5CSZB 5DJAB 3MLSH 2AK1L 5IESH 1I4FA 4MQXD 4D94A 5TGBB 3TM6A 1A1NB 4CMMB 3PGCA 5C7XL 3VXQB 2L7UA 3IJYA 1B4JL 1T1WA 5C0FA 2OK0H 4Z9KB 3O2VL 4PJIB 4XXDA 4C59B 3SKJH 4LNRB 2E9JA 5K9QG 2WWKO 2R0LL 3MACL 4LMQI 3V5HA 4XI5C 1JWMB 2RR3A 3FB5B 4IJ3B 3C5JA 4JFYB 4P3DB 1JWSB 1A1OA 4QF1A 4KAQL 1XR9B 2X10A 4HUWB 2BSRA 1MLBA 4LLWA 5JIKA 3RVVC 4JDZB 4PJHE 1YPZB 1ZA6A 3AFLA 1DLFL 2J6EH 3I3BA 1L7TH 1IC5H 3EJYC 3SDYL 4F7PA 5HBBA 3VRLE 2YKLH 1BOGA 4GMSH 4XPHH 3HE6A 3TCLB 1MREH 1QRND 1A7QL 4OCNC 1JZ8A 2LTQB 1QRNE 2RGSA 3U46B 3E6HA 1JZ2A 2VC2H 3P40A 1ZHBA 1CDIA 1MCCA 3DX9B 4GQPH 3S37X 3M8OL 3IFPB 1FZJA 2H26B 4OGYH 4XVJH 5J6GB 5DUML 4PGBA 1OTTD 3H3PL 3MGTA 5KJRL 5I8EA 3LRSB 1P4BH 4UV7L 2B4CC 3BUTA 3TBWA 4PJGB 3VE0A 4YZFE 1G7QB 3AAZA 3IXTA 3BH9B 3QUYB 1TENA 4UILH 1CDGA 1U8KB 3VXMD 4JZNA 3LEXA 2ITCB 5DYOA 3T1WA 2PXYB 4AG4H 4IOIA 3HLAB 5IV2B 1EK3A 5J4MA 4Y5XB 4TOYL 1CIUA 3WXVL 1H8OA 4KTEL 3SQOL 3WLBA 4PJIE 5EOCL 5CBAB 5MEOA 1IM9D 3U7AA 4TTDD 4P57B 1JL8A 3RVWC 4KU1A 4MJIB 4UOJA 1QSFB 3W9DB 4OKDA 5DK2B 3PP3H 5JW5B 5IHUL 1YPZE 1BJ8A 5ICXA 1Z9OA 1AD9B 4P4KB 5IR1B 2DTML 4XPGL 4UNUA 2W0FA 1ZLVH 1ZSDB 3VWJA 3QFDB 4LSSL 1HCFX 4GKSA 1I9EA 3LEVH 2N4IA 4P9HL 3W11D 4XZUB 1F4XH 4L9LB 3O4LA 1NSNL 1OARL 2ICEB 2J12B 3O4OC 4YR6B 3SGKC 4C54A 2DQFB 4X8JB 5KVFL 1AI1H 3CSYA 5EO1A 4NQCA 3DETD 4HZLA 1T2QH 2RQ8A 4BQBA 4O2FA 4HX1A 4NZRH 3PGDA 5TE6L 3QUYD 4PJGE 3CIQA 5IVXF 5E5UB 5ADOL 3EZJB 2PXYD 3V6OC 2CLRA 5CJOH 1B6DA 2C1OA 5MERB 4OZHB 3DYOA 3D39D 4PG9B 1LK2A 4WI3A 5DHVH 5GS0L 3BD4A 1OAXL 1A2YA 1U92A 4ZQKB 3S4SG 4EDXA 5GRXG 5LAXB 1A22B 4JPWL 4K2UL 3L3GA 4ZTOH 5I1CL 1UADC 2CDFB 2PYEB 4MJIE 2EXWD 1QSFD 3LIZL 4X5WB 1QSFE 4HJJH 4XT1C 2W65B 3KPSB 4GRMA 4KXZI 5JPMB 5DMYA 4NNPH 3V6ZB 1PJ9A 3RGVC 5GGUB 2UZIH 1YMMB 4P4KD 5AYUH 5JUEL 2XZCL 5KAQF 5JORA 4DN4H 1NBVH 4FZEL 1MFEH 1ZWIA 2AXJA 4FQLL 2FX8L 1B0WA 2D7TH 3DIFB 3ARBA 4F15B 1JK8A 1ZVSA 1MRDH 1LE9B 5HGAB 1DANU 3MOBH 3MNZA 3BPCA 2YPLA 1CF8H 4LAJH 1FLRL 1M6OA 3I84A 1VADB 4XPFH 5ICYA 4FMKA 3SDCC 4M48H 3NGBB 5EDXA 1CL7I 4OZHE 2VERN 4FQJL 4P23D 4U1KA 1FL6A 3QULB 2VDLL 2IPUG 4JRYA 4BK5A 4EDWH 4ODSL 5IF0B 3FB6A 4JO4H 1REIA 2PYED 1K5NB 2XRAH 1NBYB 5D6CB 3I75A 2PYEE 3WN5C 5DJXB 3KPSD 5I30L 2OXHA 3KPSE 4RMRA 1JGUL 2A1WH 2HVKA 1OD9A 4PJ8D 5BS0B 1YMMD 5HGDB 1FL3B 1DQJA 4JZJA 3QIUB 1YMME 1EEQA 4PY7B 3UC0H 1JPSH 1WISA 3QCVL 1FYTA 5J3HD 1X5ZA 3GUTB 3VXNB 3GSVA 1ODAA 3R0NA 3T4AB 4BM7A 1CI5A 1RK1A 4NWTL 4U6XB 3SGDH 3DO7A 3QHZH 5FGSA 5HI4D 2EH7L 3X3GL 2DWDA 3CU7A 4JQXA 1LVEA 2CUIA 2R2HA 4JN1L 3ZKMC 1D5IH 3QG6B 3RVUC 4FFWC 1EVUA 5EIIB 1I8LA 2O5YH 1A6AB 5D1ZC 4DGVL 3U7YL 2D0GA 4AIXA 3CH1A 5T3ZD 4HGWB 3VW3L 5T3ZE 1P7QA 1IGYB 1UB6B 1KB5B 1B2WL 1FCCA 4HT1L 2F54A 2W0KA 3GK8H 1I3GL 5DC4B 4YHZL 2ZWLT 2UUDK 2J8HA 4ZSOB 2QKIA 1AGBA 3P9WB 1F4WH 4N8CL 3CVHL 3JTSB 4OD1L 4XP6H 4P2QA 1DUYB 2V17L 5SV4A 4JFHD 4XP4H 4X99A 2P24B 1BECA 1GIGH 4JFHE 4R4FL 3N9GH 1AD0B 3U36B 2ZSVB 5C0EB 1WWAX 1GC1L 3MUZ1 1AXTL 5BS0D 5IFAL 1F3JA 5BS0E 5TQ0H 5EU6B 5AWNL 3B6SA 5C92A 3BN3B 4KPHH 3FB7B 2A6JB 1WGOA 7FABH 2ZUQB 3IAPA 5I8CB 2I25N 1G9NC 3BHBA 4IRZH 5FUOL 4BZ1L 3MLVH 3P30H 25C8L 4ZUSA 1JF1B 2A73B 2VN4A 3WJLC 4PGDB 2BVPA 5DQ9B 1J10A 4Y19A 2N7BA 3HUJB 3UAJC 3DRTA 2LVCA 1RURH 3HMWH 4HJ0D 4JB9L 1F90H 3VD9A 3S88L 4AEFA 4M3KB 4X80L 4PJ9A 3QZWG 1EEZB 3RWIB 3P9LB 2GY5A 1RPQA 1KCKA 3QQNA 4XPAL 1I8KB 5CMAA 3KPQB 1K6QL 3WS3B 4FXKA 5JDSA 4ZSOE 2X4SA 4FS0A 3BPOC 4O02H 4NQVB 3TBSB 1QSEA 4U1MB 5KVEH 1BGXH 5I73C 4HIHA 4DOHB 1JZ3A 5H35A 1MAML 2JCCA 1T3FB 5IIEB 2WP3O 4JFOA 3U4EB 3STLA 2NX5A 4N0CD 5B38B 2X4UB 2OXGA 5L0QC 5E7BA 4JFXA 5EU6D 5DT1L 1U3HA 4HH9A 5EU6E 1E4KC 1XF3B 3RWFB 3SJVB 5B3JE 4ZPTB 3DXAB 4NC0B 3MO1B 3EJJX 3MTRA 3MGOA 2VAJA 1OTTC 4XCEB 3U4BL 5TDOB 1J5OH 3S4SA 4WV1C 1FGVH 3OG4B 3VWKB 1P7HL 3OKMB 4QXGL 1NBZA 1N6QH 2IPKA 4WW2C 2EE2A 4XVTH 4H0IA 2HMIC 1F4AA 2PR4H 4GOSA 3PJSB 4Q2ZB 3HUJE 4PRPA 3P4NA 3DX7A 4HUVA 3VFTB 3E2HB 5GJSL 1F6AB 1RJYB 1WTLA 4JHZA 4TNVF 3IDJB 5IB4B 4PJHF 5DQDL 4G5ZH 4HWZB 4U1NA 1KCRH 5DQJA 3RWJB 2D0FA 4TTGA 2E7HA 4MX7A 3REVB 5DEGA 1AO7D 2X70B 3B2VH 4KKNA 4ONGL 3O3AA 1DQLL 4Y1AA 5I6XB 3CVHA 3ILPA 1B4RA 1HYSD 4DOHE 1OAUH 4U3HA 5FUCC 3SGJA 4AEHL 5E2WH 3CDCA 4GAJH 3EUUA 3KR3H 5DJYA 5HHVH 5L8KB 4WW1B 3EW3B 3MRIA 1JHTB 3SJVD 2G75A 5GISL 5ERWB 4OKVA 5FF6A 3SJVE 4LSRH 3S37L 3DXAE 4XC3L 2V7HA 4YDJB 5T3XD 2EDKA 4WW2F 3QI9B 3DETC 4TN9A 5T3XE 1U58A 5KVDH 3KGRA 1TDQA 2B4CL 4FFYH 4FQ2L 3VWKD 5BOPA 4I18B 4LARL 1FE8H 3GSUB 4WI4A 5IFHL 2P49B 4UIMA 3WHE1 4DVRL 2PXYC 4P5TB 2ZCLL 3AROA 3VFGL 1YECH 5KW9H 4MS8C 1N2RA 2HN7B 2AK1H 3ARDA 1PLGL 4S0SD 5D71L 1F13A 1IGTB 1HHHA 1BPVA 5C7XH 1SEBB 1B4JH 1O7VA 1P84K 5LGJA 3BDXA 3O2VH 1M1SA 4X7DC 2EXWC 5DLML 4J1UA 3BP5A 3HI6L 3O2DA 3FO9B 2I9TA 4UTBL 4BH8B 5IW1A 3IDYB 3MACH 5A43C 4JDTL 1UCBL 5SWSA 1P2CA 5MEQB 3V0VA 3NCYP 4KAQH 3HC3L 5J89A 3D1MC 1TPXB 3WIHL 4JE4B 3MXVL 1NAKL 1OPGL 1WK0A 1DLFH 5CD3A 3I6GB 1P84J 4M93C 3SDYH 1XF5A 2DJSA 1I7ZB 1MCJA 4K9EC 1A7QH 3AGVA 3PHQB 3ECBB 3B9KA 4U1JB 2P8PB 3QI9D 1ZHNB 2IFGA 2GY7B 5HHMD 4EI5B 4BELD 2DIAA 3M8OH 5LXGL 1SEQL 3SCMB 3FRPG 5DUMH 4F3FA 1DE4A 3H3PH 4P5TD 5KJRH 4JFPA 4Y16A 4JY4B 3NCFB 4UV7H 2BXYA 3OKLA 1R5VB 4OCRL 5ITFA 3WFEL 4P23C 2DF3A 1N0XL 2HT3D 1KXVC 1N59B 1JGEB 5J06A 1UQSB 3BZEA 4TOYH 1WQVT 5FK9A 3I50L 4Q6IC 3WXVH 4RAUB 3O41A 4KTEH 4LGPB 5EBMB 3SQOH 5EOCH 4NNXA 5FM4A 35C8L 4MLIA 4X98A 3BKML 3UEZA 5JOFB 5JLZB 1A6TA 4PJ8C 3MRDA 3T77A 2ARJB 4U7KA 4Y89A 4ZXBB 3STBA 4JAMA 2B0SL 4RSVA 1PGRB 2IQ9L 5IHUH 3T2QA 5DHYA 4DFHA 3QZWA 3ALXA 4IS6B 1YMHB 3BEVB 2DTMH 4XPGH 2OZ4A 1VACB 4TNVK 4MDJB 3MLTB 4FRWA 4LSSH 1K4CA 3VFOA 4BQ9A 2VZSA 5CJXC 1QFPA 5DMGC 2OTUA 4P9HH 3ILQC 3M1BB 1NSNH 1OARH 4OZHF 1J7VR 1R3JA 3SCMD 1TZHB 4U2ZA 5KVFH 3VRJA 3QO0A 5DC0A 1E28A 2FCBA 5A16A 1U8HB 5TE6H 2D31B 1BBDL 5ADOH 4H1LH 3TYFA 4MNQB 4PJAA 3HI1B 3V5DB 5ESQB 1A64A 5EFIA 3GI9L 4JJ5B 3HB3D 2ZP0T 4HUUB 4UUJA 4I0CC 5GSRA 1MUJA 3OR6A 2P5WB 4NYLA 1QQDA 4RQQB 3RIAF 5GS0H 4P2OB 1OAXH 4IIQC 4OLXL 5D7JA 4K2UH 4JPWH 5I1CH 2J1KA 4YFEA 5HHXL 4Y4KA 4ZXBD 2JLLA 2M2DA 3LIZH 1RZJC 5EPMB 3VFUB 5K9KA 1IQWL 4JPVL 3KWWB 3L6FA 1BM3L 5JUEH 2BSED 3RNQA 2XZCH 2HJLA 5F7LB 3V7MA 2EH8L 3IAGC 4RGNC 4FZEH 2BP3A 2NY5L 5JXEC 3QQ9C 4FQLH 4PLJD 1M7IB 2FX8H 3L5IA 3E6FB 3TIEA 2YXFA 5CIPB 5F7WC 5I16B 1CQKA 1LP9A 3JWNC 5DTFB 4MAUL 1ONQA 4Z7VB 1Z5LB 3EDKA 2XQBL 3MLUL 3QA3B 1QR1B 1FLRH 1U3YA 3QT2A 1I8MA 4UT9L 2FJHA 1I3UA 1LEIA 4MNQD 4PGCB 4MNQE 1VFAB 3PNWA 3SOBL 1KPRB 2P5WD 4FQJH 1VFMA 4ZUVA 5BJTB 4I48B 2P5WE 3GKWL 3VFVB 2VDLH 3OJDB 4U1GC 5JO5B 4KROB 2CLZA 4ODSH 2VDPL 5D7LA 5ENWB 2NR6D 5CEXB 1BQHG 1CD1A 2Z91B 2XNAB 1MHCA 4N0CC 2EDLA 3OJVC 4AH2B 4M00A 5I30H 5HVWA 1W8OA 1JGUH 2VSDA 3T1FB 5CILL 1RIUL 4W4OA 1Z9LA 3CAFA 4B50A 1X5IA 4Y4FA 5LKNA 4L3ED 1AIFA 5C9KA 4V1DA 3QCVH 3QNYB 2ATKA 3HS0B 2DQGL 1PX3A 3VDBA 1T04A 3W82A 4NWTH 1EEYB 2GJZB 1KEGL 1EERB 4QHUA 4X6BB 4MAYC 2EH7H 3X3GH 5HYJB 3G6AA 3NCJL 1HHKA 3C6LB 4HW6A 4KDTA 4JM4L 1YN6B 4JN1H 3CMGA 4DZ8B 3QISA 3FZUD 4Z7VE 4CRPA 2B5IB 2BOBA 3DBXA 3GSOA 4KTYA 5L8LB 1CK0L 5BO1L 4MHHI 4DGVH 3WIIL 3U7YH 5ICZA 4CN6A 1XEDA 1T1YA 4GT7A 2NXYC 3SO3C 3VW3H 1XMWA 5E1AB 4F33B 1AGFA 5B39B 4YX2L 4MHHG 2ZUSA 1B2WH 4HT1H 1I3GH 4QRPB 1XGYL 4YHZH 4KROD 3QPQD 1UACL 2NY1B 4N8CH 4OD1H 4RNRB 4NHUB 2V17H 3SDDD 5SX5K 3OXSB 4G9FA 4M7ZC 3WO4C 5IMKB 5EC2A 4R4FH 3LKRA 3SEPA 1AJ7L 1GC1H 1AXTH 4ZDHB 2H32A 5IFAH 1ZGLP 4I5BB 1DANT 4JKLA 4MXQC 1KJ3L 4YGVB 5AWNH 1BFTA 5GRJL 1T89C 3MR9A 4M61A 3HUJF 1NCUA 2Z92B 5KSAC 2OX5A 1CU4L 3RIAK 5FUOH 2VLJB 4BZ1H 5HYJD 4JG0L 3ARRA 5DMIL 3C6LD 5HYJE 25C8H 3WHE0 4Z7WA 4UI2A 3S97C 1XR8A 3E1F1 1TVHA 4OZFB 4JGMA 4LCWA 1NCWL 4ODWB 3T8XA 3RWEB 1R5IB 1QOKA 5L2JA 4PJ5A 3KYOB 1XGPA 4JB9H 1URLA 1MCFA 3QUMB 5GIRA 12E8L 4G42A 4MD0A 3T0ED 3U48A 3S88H 4X80H 3ULUD 3WCYA 1MSPA 2AKRA 5HJ3A 1HXMA 2YD6A 4XC1L 1HEZA 3FKUS 3AREC 1UH3A 4XPAH 4JM2C 4Y5YB 3TJHD 2F53B 1K6QH 2MOVA 4QRPE 3FHQA 4YPGA 5AAMA 1EFXA 1D5ZB 5GRWA 4HUMB 3LDBC 3H9SB 5DJDB 4D0CA 4X4YB 1U3ZA 5A40E 4ZUUA 1MAMH 1ZHLB 2X4PA 4MNGB 4ZUWB 2COQA 1OTUC 4BA8A 1MJJB 2APFA 4M8QB 4GLRH 5JIPA 5D7IF 4PJDB 2VLKB 4Y5VC 1MJUL 5T1MB 2PO6D 5DT1H 4LKXB 2EYSA 4R9HA 3RWCB 2J8UF 3QQ3A 2SEBB 1YNLL 1N5AB 3EOTL 1IGIL 4WI5A 5SV3A 1IAMA 5DJ0A 2WBJA 2VLJD 3U4BH 1WZLA 2VLJE 1QLFA 2E7LC 1S7QB 4P4RB 2V2XB 5I75B 1GYAA 2PYFB 4DZBB 4Z6AT 4QXGH 3HZYB 1KNOB 3THML 5GXBB 2FYYA 3NH7L 1AHWB 4GBXC 4LSPL 5DWUL 3I6KB 1JPGA 2D9CA 3HZMB 4J3VA 2LQRA 4FQQB 3RNKB 3IFNL 2CQVA 4JM2F 3BX7C 5GJSH 4YHIB 4G9DA 5DQDH 3KAAA 3NTCL 2F53D 2O5XL 1MCKA 2DI9A 2IALB 4IRSC 3MRLB 4PJHA 2F53E 4K7FA 5FOBA 2BVEA 4PPTA 3OKEA 4QO1A 4ONGH 2JB6B 2BFVL 3S98A 1DQLH 3HRZB 3H9SE 1JRHL 3FOLB 4ODVL 1JI2A 3SY0B 3JBG7 1QRNA 4MNGE 4AEHH 3FFDB 2W60A 4K9EL 4PRAB 2VLKD 5EZJA 1IGJB 1I8IA 1ZK9A 2VLKE 4PJDE 5F7UA 4Q74A 4UT6L 5E9DB 5GISH 4U1IA 5E8NA 4B7LA 3S37H 4K3HA 4XC3H 3CGTA 1MCOL 3N1GC 4N9GA 1L6XA 2UUDH 2IGFL 2Z4QA 5IMOA 4GAYA 2WV3A 5CSZA 4K07A 5DJAA 2B4CH 4FQ2H 3KPMB 4LARH 5BZDB 5IFHH 5TGBA 1QRKA 2A83B 1A1NA 4CMMA 4DVRH 1TVDA 3VXQA 3UBXB 2W0LA 2ZCLH 7CGTA 3VFGH 1CGXA 4PJIA 3HB3C 5HVGB 4LNRA 1A9EB 1MI5B 1YQ2A 4HLZH 5IB3B 1PLGH 2AQ1A 5D71H 5E4EC 1MH5B 3HE7C 4JO2L 1NFKA 2I24N 1JWMA 1TJIL 1UJ3C 4LNVA 2NCMA 3RKPA 3FB5A 4JFYA 4P3DA 1F3DJ 1JWSA 1QUNA 1XR9A 4HUWA 1MCNA 2ADFL 1UEMA 4JDZA 5DLMH 3W39B 1YPZA 4ZXBC 4LLDB 4GRLC 2EDFA 2EIBA 3HI6H 1CXKA 1JE6A 4UTBH 3VG9B 2C3VB 1Y0LB 1NMCC 4GUPB 1QYGL 4JDTH 1D5BB 1UCBH 4Y88A 3TCLA 3X14B 4NBZB 2L4OA 3S5LG 3HC3H 3U46A 3WIHH 5GHWL 4G43B 3MXVH 2V9TA 1NAKH 3DX9A 1OPGH 1MCWM 3IFPA 2JJUA 2H26A 3C09B 5J6GA 3BYYA 5E9DE 3F7PC 4I0PB 3MV11 3TP4A 1S7XB 2ENYA 2Y6SD 3LRSA 2YD5A 5A2JH 4PJGA 3TIDB 1G7QA 4OD2B 3BH9A 3H7BB 3QUYA 2DTSA 5T3ZL 1U8KA 3SBWC 3V52L 2ITCA 5LXGH 1SEQH 2PXYA 5LQBL 1U6AL 3ORJA 4W81A 5IV2A 1JWUB 2ZKHL 3HLAA 3K8LA 4YPJA 4HLJA 4Y5XA 1LMKA 1NH6A 3PGFL 1ZLWK 4OCRH 3LQMA 4R0LC 1MI5D 1NJ9B 4M5YL 3RZCB 5CBAA 3WFEH 1MI5E 2VITB 2BY2A 4MQ7B 4P57A 4MJIA 1N0XH 3BJ91 1QSFA 2AV7B 2K9UA 4LVHC 3W9DA 3I50H 5DK2A 2OL3B 2VNCA 5JW5A 3DO3A 3Q3GB 4PBXA 4OV5B 2FJGB 4M6OL 1RZJL 35C8H 3BKMH 3G6JF 1AD9A 4NPYB 4P4KA 5IR1A 1ZSDA 4IEFB 3QFDA 3MZTA 3DUUB 2B0SH 2D7OA 3FAWA 1HILB 4XZUA 2IQ9H 4L9LA 2WINB 2ICEA 4YR6A 3D85B 2DQFA 4X8JA 1QTYT 4KK9D 4I0PD 4PLNC 1CGYA 4FQPA 2W91A 4JGUA 5CEZD 1WSST 1A3LL 1JUFB 5CEZE 4YGAB 2DLTA 4KY1L 5HGBB 4MMZC 1VFUA 1JP5A 2IG2L 4NQDB 4PJCB 5MERA 4OZHA 3LH2L 3FONB 3WJJC 1PKOA 3CMOL 2GTWB 1B90A 3EZ8A 3RZCD 2VDNL 4ZQKA 1SYVB 1BBDH 5F9JB 3QFJB 5LAXA 4LEOB 2CDFA 2YHGA 2PYEA 4KROC 3GI9H 3GIZL 3PP4L 5DEZA 2MQ0A 4X5WA 3ZE1E 3SDDC 2W65A 2FEDD 3KPSA 2HTKC 5JPMA 2NY7L 3V6ZA 3V95A 5GGUA 4OLXH 3S36X 1YY8B 1YMMA 4HQQL 1S9XB 1TQCB 1F2XK 2H9GB 4R2GC 2AABL 3ES6B 1MFCH 5HHXH 1CDHA 4XWOD 3D87B 2Q7NA 1IQDB 1VEMA 4S1DD 4PJBB 3A67L 1IQWH 4JPVH 4WHTB 4WO4C 2KH2B 3DIFA 3D85D 4Z7VF 1BM3H 3TV3L 1X3DA 1LE9A 5HGAA 2EH8H 1UKSA 4DJMA 3FO2B 2OTPA 2NY5H 3RL2B 4YFLF 5TDPB 3QCUL 1VADA 3RA7L 4NQDD 3HAEB 4MAUH 4NQDE 4PJCE 3SE3A 2XQBH 3MLUH 4LFHD 3T0EC 3ULUC 1KOAA 4UT9H 5JOEA 3QULA 3QFJD 2GK2A 2DLHA 1PEWA 5IF0A 3QFJE 2V9QA 4RGOL 3TJHC 1K5NA 3QP3A 5EO9B 3SOBH 1NBYA 5D6CA 4N8VB 1VKXB 5DJXA 3U2SB 1RSFA 2X40A 3GKWH 5KSBB 5E2VL 2P5EB 5BS0A 5HGDA 2VDPH 1FL3A 1J86A 2HLFD 3QIUA 4POZC 1FIEA 4PY7A 3GUTA 4EZMA 3VXNA 3T4AA 2PO6C 3REWB 1GJIA 4U6XA 2CRYA 3QWRD 3L7FB 5CILH 4PJBE 2JIXB 3KPLB 2NTFB 2YA2A 4J3UA 4MB4A 2P4AB 2WIIB 3L9RB 3QG6A 4AK1A 4U0RB 1GGIL 4X9IA 2DQGH 1SJHB 4DWHA 5EIIA 4Z8FL 1T0PB 2BOCB 1KEGH 1A6AA 1J8KA 1LD9B 3ULUF 4WGVB 5JW4R 4LHJB 3NCJH 4JM4H 5E99L 4F9LC 1CN4A 3B8SA 4HGWA 2Q76B 4PGEB 4OQTA 1IGYA 2A77L 3CLFL 1UB6A 4HC1L 3ZE0F 2BSTB 1KB5A 2R9HD 1CK0H 5BO1H 3VG0L 4ZSOA 3VGDA 3WIIH 3P73B 3JTSA 2H8PB 1DUYA 3FL7A 3ARUA 3AM8C 2P24A 4U1HB 5DRWB 3P9MB 1QBBA 1NKOA 2QLVB 4YX2H 1AD0A 3WD5L 3FQNB 3U36A 2ZSVA 5C0EA 2P5ED 3VGHA 4UV4L 1WCQA 1XGYH 5KSBE 2P5EE 4EOWL 1UACH 4M1CC 2IPUK 5EU6A 4EN3B 1MQ8A 2FL5B 5C2UB 2ERJB 4YH6A 3FB7A 2A6JA 3CVIL 4YHYC 5I8CA 4FOMA 1AJ7H 4DEPB 2JIXD 1CD0A 3FJTA 1KJ3H 4OIBA 3K4ZA 1JF1A 4BZYA 2EEAA 5BW7A 2A73A 1ITCA 5GRJH 4GFTB 4ONOA 4PGDA 1X5AA 4FQ1L 1RY7B 5DQ9A 1CU4H 1JNNL 2DJ4A 3IFLL 3HUJA 5EZLB 3EOAB 3MXWL 5D1XB 4JG0H 1AHWC 3AB0C 5DMIH 3QUXC 2C7UB 3S8WA 2HFEB 1EEZA 2VLMD 1XH3B 4NUGL 3RWIA 3F7YB 5HYQB 3LKSB 3P9LA 2DM2A 1NCWH 2W9DL 3D18B 3SGEI 1I8KA 2C26A 4FMFA 4G7YL 3KPQA 1CG9B 3LHPL 2J8OA 2LE9A 3WS3A 1F6LL 12E8H 2KQMA 4B7IA 5MEPB 4NQVA 3TBSA 3MJ9L 4KGLA 4U1MA 4XC1H 4CMHC 2HT2D 3DSNA 5D1QC 5B8CC 1T3FA 5IIEA 3O8XB 1JFQL 2RIKA 1PG7W 3U4EA 1YNKL 5B38A 2X4UA 4TYUA 2XZQL 1LO5B 3MRQB 4EN3D 3PXJA 1UJTA 3D9AL 5CLWA 4L8CB 1XF3A 5IG7B 3RWFA 3SJVA 5C2BL 4ZPTA 3DXAA 4JQVC 2WUCL 4OB5L 3MCLL 5C1MB 3MO1A 4LLUB 3WNOA 4IM8A 4R4BB 4ONHB 4XCEA 5H8DA 5TDOA 5D8JL 4JGJA 3OKNB 2Y6SC 1MJUH 1RUKL 3LQZB 3CFCL 3VWKA 2QHRL 3OKMA 2HKHL 4P2YA 2LU7A 1YNLH 3EOTH 1IGIH 1ZE3C 4IOSD 4KC3B 5D1XD 1TMCB 3PJSA 4Q2ZA 1KTRL 3EAKA 3ZO0A 5IHLB 3VFTA 4CJ0A 4XVSL 1F6AA 3G5VB 1RJYA 1DBML 2BMKB 1HQRB 2YK1L 3THMH 3IDJA 5IB4A 5IEKB 3NH7H 4LSPH 4HWZA 2QQLL 5DWUH 5C9JB 5E5RB 4X83A 1OAYL 4HC1A 3RWJA 3IFNH 3DSFL 4NM8L 3REVA 1IVLA 2X70A 4I9WE 3H9HB 2HH0L 3MLWL 4YFLI 3DGGB 3DURB 5I0ZA 3O3BB 4HPOL 3O8XD 3NTCH 2O5XH 5BVJB 5I1JL 3ZHKA 4I8DA 4C83B 5D6DC 3R4DA 4WW1A 4OV6F 2BFVH 3K81A 1JHTA 3S6CA 1B0GB 5ERWA 1JRHH 4ODVH 2Y7QB 3C09C 2R4RL 4YDJA 4S10A 2OBGA 1EH9A 3VGAB 4K9EH 2ICWB 3QI9A 4G6KL 1NQBA 3WNLA 4I18A 2APVA 4UT6H 5IJKA 3GSUA 3IS1X 1HCVA 4JVWA 3VXRB 4P5TA 2HVJB 4NCC2 1X6LA 1MCOH 2GFBB 2DKSA 1CD9B 2IGFH 4QTHB 4TSCL 3F6IA 1IARB 4NN7C 1Y6KR 2WSKA 1IGTA 1PQZB 2YPVL 3RVXD 1SEBA 3G6DL 3O6FB 4RMVA 2OSLA 2ZNXA 5SX4H 3FQUB 3NFNB 3FO9A 3U0TB 4BH8A 4JO2H 3T3PE 1V7NL 1CTNA 2ZJSL 3FOMB 5JW4N 1TJIH 3MJ9A 5JIIA 5MEQA 2ADFH 5CHNB 5F3BB 3PV6B 1XT5A 3I6GA 1IEHA 4OUUB 4M1GL 3T65B 3IXAB 1I7ZA 1MAJA 1QYGH 1QA9B 3ECBA 3PHQA 3LPFA 1WUNT 4U1JA 4E41B 3QDAA 2P8PA 4OZGF 5GHWH 4EI5A 4OCYL 1SBSL 4PJFB 2VDRL 3SCMA 4LVEA 3RDTB 4ENEC 3VXRD 2QR0B 3VXRE 4JY4A 4UDUB 3EJZD 1R5VA 5HPMB 1N5YL 1DL7L 5T3ZH 5F1KC 2Z31B 3V52H 2DMBA 5LQBH 2AQ2A 1U6AH 1WBXB 2C3XA 2ZKHH 4Z7UB 5KTEL 1N59A 1JGEA 3V0WL 1UQSA 4L8BB 5ABDE 2ED7A 4WI8A 3PGFH 4RAUA 4LLYB 4QYOB 5EBMA 2KQNA 3GKZA 4M5YH 1FFPB 2VZ3A 3W2DL 1HWGB 1YEKL 5F88B 1KIUA 5JOFA 5JLZA 3L3OB 3M45A 4XP9L 3S36L 2ARJA 3EYSL 5FO8B 4EXKA 3T2NL 4ZXBA 4ZD3L 1DVFD 4G7VL 4ORGB 4BQ8A 1UA6L 1BFSA 4M6OH 1RZJH 2XY2A 4IS6A 1YMHA 1BQSA 3BEVA 5T5NF 1VACA 4MDJA 3LD8B 3MLTA 3ZHLA 4E41D 1F58L 3HKFA 4Q6YA 3O6KL 4E41E 3E3QE 3M1BA 2FX9L 3RDTD 3PDGA 2V5MA 1TZHA 1ZTXL 2WK2A 4PJFE 1A9BB 2WWKT 5ISZD 5F7YC 5HTSA 3VH8B 5EIQA 4U33A 1T5XB 3G04B 1BP3B 5CD5D 1A3LH 1U8HA 2HRLA 2D31A 3K4AA 4KY1H 4PTUB 2Z31D 3ULUL 4MNQA 3HI1A 4JKMA 5ESQA 3V5DA 2IG2H 1A7OL 4HUUA 3LH2H 4JJ5A 1LO4L 2VISB 3DVIA 4Z7UE 2EE6A 4P59L 3UTQB 2P5WA 2R1YB 3CMOH 2PETA 4RQQA 4P2OA 2VDNH 5CS7A 3HG1B 4HGMA 3TA3B 3R8QA 3L3JB 1ZVYA 4J3TA 3GIZH 3PP4H 4PJBF 5EPMA 3VFUA 1QHOA 2NY7H 1D6VL 5DFTA 3VI3E 1OQXA 4C57C 3RY6A 3P77B 3KWWA 4HQQH 5CFHA 2Z8WC 4AM0B 2AABH 4N9OB 3KPOB 2ZUTA 3CFDB 5GZNC 3MOAL 2EDXA 3A67H 1MCDA 3WLWC 1M7IA 5I16A 5C08D 3E6FA 5CIPA 5EO0B 3GMNB 5F93C 3TV3H 5DTFA 4Z7VA 1Z5LA 5C0DB 1U8OB 4UU9B 5F9WB 3QA3A 1QR1A 1U9KA 5FECB 4DK6A 1J0IA 1CXFA 3QUML 3QCUH 1LEGB 4LVNB 3L1OL 3RA7H 4PGCA 1VFAA 4XPBL 1T6VN 1KPRA 1S8DB 3GGWB 3G9AB 4EUPH 5KSBF 4TPRL 5BJTA 4I48A 3UBXI 3HG1D 3HNSL 3VFVA 3OJDA 1CQYA 5JO5A 3L7EB 3TA3D 2HT2C 3HG1E 2PW2B 5K9JL 5ENWA 5FYJD 4RGOH 5CEXA 3GHEL 2Z91A 3PIQB 5FYJE 5HY9B 2XNAA 1MHHB 3UBXG 4AH2A 2JJTA 4LP4A 2YZ1A 3T1FA 5E2VH 1LO0L 4NZJA 4MD4B 4H0HB 3QBTB 5E6ZA 1QO3B 5CEYB 3QNYA 1FNSL 3HS0A 4DW2L 1QP1A 1ZLWH 4CBPA 1EEYA 2GJZA 3BGAA 4X6BA 5EA0L 4H20L 1YZZA 5CSBA 2CKNA 5HYJA 1PZUB 3C6LA 4LF3B 1V8HA 1YN6A 4DZ8A 9CGTA 4EKXA 1GGIH 3X3FL 5JHDD 4YDVB 4Z8FH 2G5BB 3ZKXC 5EULV 4Z5RB 5DK3A 4X4XB 4BSVB 5HDBE 3JWDC 5E99H 4JZOB 3WS6A 5IBUG 5E1AA 2KUTA 4IMLB 4F33A 5B39A 3C5SB 2A77H 3CLFH 4RBPK 4HC1H 2J2ZA 1JMZA 3K2UL 4XNZB 3TVMB 1G6VK 5IMLB 4QRPA 2XTLA 3P0VL 3VG0H 3SDXB 2KKQA 3O8XC 1L9MA 3GMPB 1CYGA 4RNRA 4HJGB 4NHUA 4JKWA 1JYWA 2V5SA 3OXSA 1S3KL 5IMKA 3WD5H 4DFIA 4N68A 3CH8A 3D3VB 2FX7L 2NY0D 4UV4H 5M95B 2NY2D 4ZDHA 4EOWH 4I5BA 1YNTB 3J7HA 4R4NC 2YR3A 4YGVA 3BFOA 1G0XA 1K4DB 4HAFA 1KT2B 1FSKC 1D7FA 2Z92A 1W0VB 1G9EA 3CVIH 5FUZL 4CDGC 2F9BT 2B7DT 3C8HA 3WKNA 2VLJA 5F97E 3WKML 2X9XA 4OZFA 2HAZA 1OP5K 2I9LB 1G7HB 4FQ1H 4ODWA 1A7RL 3O6ML 4HPYL 1AGEB 3NCEB 3RWEA 1R5IA 1J12A 1JNNH 3IFLH 3MXWH 3KYOA 1DEDA 1JIBA 1SY6A 3QUMA 1Z0MA 4L4VB 4XCNB 4NUGH 1G7IB 5F89B 5D93B 4YDLB 3TVMD 2W9DH 2H6PB 5A2LH 2IQAB 4Y5YA 2R8SL 2F53A 4G7YH 4KMLB 3LHPH 2DMKA 3SDXE 1D5ZA 4WHYH 1EMTL 3DI3B 4FFVD 2OCFD 1UKTA 2ICCA 3H9SA 5DJDA 4X4YA 2GSIB 4MNGA 1ZHLA 4ZUWA 2EECA 3D3VD 4PYGA 1JFQH 1LHZA 4M8QA 2Y06L 3D3VE 1FH5L 2CUHA 1YNKH 1NCTA 1DLHB 4PJDA 2VLKA 1K2DB 2XZQH 3KJ4B 5T1MA 4LKXA 2YSSB 3RWCA 4HKBB 3D9AH 1C5BL 2N56A 4RMSA 5C2BH 2VDKL 3FTGB 2WUCH 4OB5H 2SEBA 3MCLH 3OKYA 1N5AA 1QR4A 3S3SA 3VXOB 4XWGL 1A8JH 5D8JH 5JMRA 4Z7NF 1RUKH 1S7QA 1NPUA 4P4RA 5C0NC 2V2XA 3CFCH 3MV7B 2QHRH 2QSQA 2PYFA 2HKHH 4DZBA 4Z7OE 3HZYA 1KNOA 1U2HA 1AHWA 1ND0B 2YN3A 3I6KA 3HZMA 4TUKL 5B3NA 1S7WB 4FQQA 3RNKA 4M7JH 1I1FB 4NZTL 4RMWA 4URTB 4L4VD 4FNLL 1LO2L 2AJ3B 4XVSH 4YHIA 4L4VE 3BDBA 3BZFB 1DBMH 2YK1H 1HNGA 2OL3L 4PBVC 3LKOB 2XXMB 2QQLH 1MY7A 2IALA 1OAYH 3MRLA 4IMKA 4WTXA 3DSFH 4NM8H 2AJYL 2OMBA 5LG1A 4OFVA 1X7QB 1MVFA 2JB6A 2XG5A 2HH0H 1DVFC 4RFNC 4ZFGL 4HUKB 3HAEG 3HRZA 3MLWH 3EDFA 5E2UL 3FOLA 4HPOH 3SY0A 3ARQA 4O2CB 3PG2A 3U30B 4DVBB 3FFDA 4KJYB 5I1JH 4PRAA 4BH7B 1IGJA 4WFED 1T5WB 3EO9L 5E9DA 3CSBA 2DQIL 3K74B 4WFEE 2XA8L 2MCG1 3P2TA 3TO4B 4DAGL 2W1NA 2CKBL 3L3IB 5JXAL 2R4RH 4KUZL 4G6KH 4ZS7L 1U2CA 3MV7D 5CD5C 3KPMA 3SGEH 1TCRB 3Q0HA 5BZDA 1WLHA 2VRAA 3MV7E 4KKCC 1H9VA 2A83A 3RPIB 2Z31C 2XZAL 3UBXA 3HPLB 3GRWL 1HKFA 2N1KA 2H2SD 5FV2A 1A9EA 1MI5A 4TSCH 4LSDA 1DBKL 5IB3A 1MLCB 1CLYL 1GOFA 1MH5A 2YPVH 2GYSA 1K8IB 4MD5B 1X44A 5AUMB 5GS1B 3G6DH 1MVUB 2W07A 2VR4A 4APQC 3W39A 1UEYA 4LLDA 3LMJL 2AS5M 2HLAB 2PN5A 2C3VA 1Y0LA 1W0WB 1V7NH 2ZJSH 4OFPA 3GSWB 4GUPA 3X14A 1D5BA 4GAFB 4EVNB 5ITBL 1AR1D 2E7MA 4G43A 4Q0XL 4M1GH 3B5TA 2MQ3A 1T83A 3TO4D 4I0PA 4FXGB 3BQUD 1S7XA 2CDEB 5JMOC 4JREB 5T1LD 1WWCA 4PR5B 2R0KL 1I7TB 3TIDA 4OD2A 3EHBC 4W6WB 2Y36L 4HS8L 2ADJB 4OCYH 1SBSH 1OY3B 2WANA 2VDRH 3B9VA 1JWUA 3ARFB 4XX1E 2XYCA 5D2NC 2DRUA 2R1XB 1WT5C 3RZCA 1NJ9A 3GHBL 3LSOB 1E6JL 2GI7A 1DL7H 1N5YH 2VITA 5MI0C 3QDMB 4MQ7A 1IILE 4QTIL 5I1EL 2F5AL 2XTJB 1DBBL 1EUTA 2NW3B 5KTEH 2KPNA 3VI3F 4PV8B 2Y23A 3TPUB 3V0WH 3V7AE 2AV7A 3DARA 4ACPA 2WBKA 1VA9A 2OL3A 4OI8A 3Q3GA 4OV5A 2FJGA 3W2DH 1YEKH 4NPYA 1V3KA 4XRCB 4XP9H 3S36H 3EYSH 4PS4L 5IQ9B 3WHXB 3T2NH 3DUUA 1UZ6E 4ZD3H 5AYQA 4G7VH 4P0DA 3TN0B 1HILA 1UA6H 2WINA 1WFNA 3BVNB 3ESVF 1BD2B 3D85A 5D2LB 5F6IB 1F11B 5ELIA 1I1AC 1S9WB 2VUOA 1F58H 1JUFA 3ETBF 3O6KH 5HGBA 3EBAA 2O61B 2FX9H 1ULVA 1FBIL 1ZTXH 4NQDA 4PJCA 3ARFD 2EE3A 3F58L 3FONA 4AQ1B 1DQQB 2R2BB 2FGZA 2GTWA 1J9CT 1NGQL 3GRWA 1SYVA 5F9JA 3QFJA 2EIEA 5JPNB 2NMSA 3ULUH 2VR5A 4LEOA 4GG6F 5K9OB 3QDME 1HINL 2XTJD 1EEUA 1A7OH 3IFOB 2BVYA 3QXWA 1LO4H 2AJSL 2XTJE 4P59H 5GS3A 2P47B 2WIMA 1YY8A 3KHQA 1S9XA 4E42B 2NY0C 2H9GA 1U8QB 3B4NA 3ES6A 4PLKC 2NY2C 4X7SL 1UWXK 1CXLA 1U36A 1IQDA 4AYFA 2XY1A 1DN2A 1D6VH 4PJBA 3ZDYE 4WHTA 3QWRA 3L5XL 1FIGL 1BD2D 2WWMD 1BD2E 5D2LE 3GI8L 4YBHA 2H45A 2EDDA 4FQXD 43C9B 3FO2A 1R3LB 3MOAH 2IJ0C 3RL2A 2WQ8A 5TDPA 1ZXQA 3ZDZE 4OZFH 4RWHA 1H5BB 2ICWI 1S7RB 3HAEA 4G8GB 2K1MA 3JWDL 1HOCB 2A9ML 3QUMH 5L88L 3MRFB 2NXZC 3L1OH 4XNZC 3TVMC 5EO9A 4XPBH 4NKMB 4N8VA 4HWBA 1VKXA 1BHGA 1KACB 3VRIB 1NFIB 4TPRH 2N7AA 3U2SA 4KK5D 4HULB 3HNSH 5KSBA 2P5EA 3FQRB 2VZOA 4OFIA 5K9JH 5DJ6B 3LKQB 2APXA 4HIIB 2ZG1A 5E6IB 3GHEH 2CXKA 5FM8A 5BMFL 3REWA 2VXVL 4G80B 3L7FA 1LO0H 4KRMB 4H1LB 2JIXA 3KPLA 2NTFA 4Z18A 2IAMB 2WIIA 3CFEB 2VMFA 5DO2D 1FNSH 2J5LC 3L9RA 4HXAL 1SJHA 4DW2H 1QFUL 4CAGA 3O6LL 4HZAA 2WM0A 2BOCA 4XTRD 5EA0H 4H20H 1LD9A 1OHQA 2WQRA 4JHAL 1MHPL 4G8GD 2Q76A 3K7UA 4G8GE 4MJ6B 4PGEA 4WU7B 3CX5K 3MYZA 3X3FH 1ACYL 2XKNB 2BSTA 4JFDB 3SDXF 1W0YT 4Q9QL 2QL1A 3P73A 2IADB 2VQ1B 2H8PA 4K7PX 4C4KO 3VD5A 4U1HA 1MJ8L 5DRWA 3P9MA 3MROB 5BQ7B 2EIZB 3FQNA 3G5YB 4MA8L 3K2UH 4JG1L 3P0VH 3OR7B 1Q0YL 4NQSB 3CX5J 5E6ID 3VXUD 4EN3A 1QPPA 1YJDC 3PWUB 1S3KH 5KS9B 2FL5A 1HE7A 2PNDA 4CN4A 1FFQA 3C5ZC 3EGSB 3OX8B 3EFFB 2FX7H 3QIBB 2IAMD 4Z7OF 5B22A 1WF5A 3CXDL 5CGYD 1H8NA 1AH1A 2EKSB 5GS0D 1NGXB 4ZUTB 1RD6A 5FUZH 5TE7L 5EZLA 1AP2B 2UVFA 3EOAA 5D1XA 5C0GB 3JSSA 2B39A 4J2XA 4Z7QE 3WKMH 2C7UA 2BERA 5D7KD 2HFEA 1XH3A 1PY9A 3F7YA 4A6YB 4EI6B 5D7KE 5HYQA 3LKSA 3IDMB 4YWGL 1A7RH 3O6MH 4JFDD 4HPYH 3D18A 3T4YB 3NVQA 1X9QA 1CDCA 4JFDE 1CG9A 3KJ6L 2KDGA 5EN2A 5J13B 1SJEB 3UXFA 4MCYB 1F3RB 3CDFA 4XMKL 4OIAA 1EX0A 5MEPA 4WTWA 1CFQB 3O8XA 2CR6A 3WDHA 4EXPX 1WFOA 2R8SH 5DR5L 5A3ID 5EZIL 4ZO7A 3U30C 1LO5A 3MRQA 3RX8A 3ZKSD 1EMTH 4L8CA 5DUPL 5IG7A 4I4WB 3Q5YA 5KS9E 4LLUA 2ZSWB 4G6AC 4R4BA 4ONHA 4X7EC 4XNYL 2Y06H 1FH5H 3BQUC 3OKNA 1I85C 5E00B 3LQZA 4G6FB 5IMMB 1C5BH 4CVZB 1IM3B 2VDKH 1MCRA 4IOFC 1FZMB 1ADQL 1TJHL 4F8QA 4L4JA 4LCCC 4XWGH 2CJUL 3KPRD 4NT6B 1QD0A 5HD8D 1Z3GL 3G5VA 2BMKA 1HQRA 4Y2OA 5FM5O 3LN9A 2Q3ZA 5IEKA 4RDQG 1RUAL 2J3SA 5C9JA 4TUKH 2ILLA 4NZTH 1OP9A 1G9MC 3QXTA 3H9HA 2F8OA 4RA0C 4FNLH 1LO2H 3B5GA 1O7SA 1D9KC 1HDMB 3DGGA 1NEZB 3DURA 3X11B 3O3BA 2OL3H 4GMTL 5BVJA 3S35L 2FO4B 4NO3B 3JV5A 2AJYH 4C83A 3PHSA 1U8LB 4ZFGH 4Y4HB 4U3CA 1B0GA 3WXWL 4HS3B 4Q58C 5GGTL 5ANMB 5E2UH 1KLGB 5EU7C 4M9OA 2QEJA 2Y7QA 2HT4D 2P45B 1GL4B 1Q9LB 4Y2DB 3TNMB 2ICWA 3QJHB 3DVFA 4G6FD 3EO9H 4NQED 2DQIH 2XA8H 3VXRA 4DAGH 1S7TB 2CKBH 2XACC 3TH2T 2HVJA 4RBPH 5JXAH 2GFBA 3ARFC 1RZ7L 2DL9A 1DN0B 4KUZH 2XKSA 3GBNL 4QTHA 5FO9B 4ZS7H 4Y1AE 4KQ3L 5HDOA 4ZNCD 3FFCB 3TWCL 2JKXA 3MREB 1PQZA 4J3OC 2XZAH 4MSWB 1QBML 3GRWH 3O6FA 2XTJC 3EYFB 1B0RB 2OTWA 3BGFC 2VO5A 5FYJL 1P9MA 1DBKH 1F5WA 3FQUA 3NFNA 1CLYH 3U0TA 1H3WM 5DSCB 2P8LB 3F7QA 2QTEA 3FOMA 5SWZB 5CHNA 2F8XC 1BZQK 4PJ7F 5F3BA 3PV6A 3LMJH 3EYQD 4Y4HD 4I3RL 5I9QB 4NRYB 1AFVL 4OUUA 2Q86B 3T65A 3IXAA 4PY8I 5ANME 1OP5H 4LPYA 3RJQB 2WWMC 2EDEA 4Y2DD 3U9UB 4E41A 5ITBH 4BSWB 4Q0XH 4FQXC 4PJFA 1BZ7B 5E7FA 3RDTA 4NDMB 2QR0A 3QEQB 5JOPD 1QFWI 4IRJB 4UDUA 5JOPE 2UZXB 2BY3A 3TYGL 3B83A 5HPMA 4MDIB 2R0KH 5C0AD 2Y36H 4HS8H 2Z31A 2CR3A 5GZOD 3FFCE 1I9JL 1INDL 1WBXA 4Z7UA 1P6AB 3NIGF 4L8BA 3MBEC 4LPUA 3ROLB 4LLYA 4QYOA 3UTZB 3GHBH 5HI3D 1E6JH 4JFFB 1SQ2N 3QEGL 1FFPA 1SM3H 5E56A 3VGFA 4O5LL 5F88A 3L3OA 4QTIH 3SKOB 5I1EH 2F5AH 1DBBH 5SWZD 5FO8A 5SWZE 3DGCR 1PVHA 4LSUL 1HSAB 4ORGA 3CUPB 1EAJA 3TZVB 1KENL 2XKUA 2P42B 4XMPL 1DQDL 2AEPH 4ZTPL 1R3KB 4PS4H 4K55A 1HYRC 2JJWA 3MCKB 4L8SC 5IVXB 5BV7C 1CGTA 2C5DC 4YHKL 1A9BA 3QEQD 3R0MA 1OAZL 4DUWA 3VH8A 3UTSB 3QEQE 4IRJD 5TF1L 1T5XA 3G04A 3S34L 5C07B 1AXSB 4PTUA 4OCSL 4ZYKB 3RVVD 1FBIH 3CXHK 2OYPA 2X4TB 3OAZH 3OV6A 1RZGB 3F58H 2VISA 1WT5A 1S7VB 4JVPA 1MFBL 3EJYD 1LE5B 4WY7L 3UTQA 2R1YA 1FO0H 3UPRB 1NGQH 4JFFD 4MA1C 2ZG3A 3HG1A 2APWA 5FYKD 4JFFE 3TA3A 4WFFD 3L3JA 5FYKE 1HINH 3ZKNC 4WFFE 3UYPA 4XVUC 5IVOA 2AJSH 4XAWL 3O4OB 1OW0C 1IEAB 4ODXB 3VFRB 3MRMB 3OG6B 3CXHJ 3ARGC 3CU1A 1F97A 4L9DA 3TZVD 3P77A 1QFWL 2RHEA 4OLYL 1SMOA 3CX2A 4AM0A 3OKKB 3ROOB 3KPOA 3CFDA 4FZ8L 1FC1A 2OMNA 3C2SA 4ELMF 4PRHB 2NY3C 3QDGB 2F58L 5IVXE 3U0WL 5CGYC 1C12B 4QCIB 3L5XH 1FIGH 1KIQB 5EO0A 5J57B 3GMNA 3QHTC 3UTSD 2ZUXA 3GI8H 1JZ5A 5C0DA 3UTSE 1U8OA 3GNML 4UU9A 2E27L 3UDWC 4PJXF 1NC4B 5C07D 5FECA 1KEML 5DUBB 4DKAA 2P44B 5C07E 5AD0A 3T0WA 1LEGA 4NWUL 3DV6B 1MCEA 3RGVB 3MUGB 4MMXC 1EJ6A 4LDEB 3TJEL 3CLEL 4UMGA 1S8DA 3QO1B 4LCUB 3GGWA 1IE5A 4K7PL 3JWDH 2A9MH 3NPZB 1PSKL 5L88H 5E5MB 3L7EA 2PW2A 3RY5A 1ZANL 2AI0L 3SE4A 4OFYD 4CGTA 3RGHA 1EUUA 3PIQA 5HY9A 1A0QL 4LASL 1MHHA 3DI2B 3B8YA 1QEWB 4PGJA 3NFSL 4GH7B 5I71C 3OSKA 5GQBA 4MD4A 1NLDL 2R15A 5DD3L 1J88A 1QBAA 4W70A 2X1QA 2YA1A 5IWLC 5CEYA 1QO3A 1X4YA 5BMFH 4WRLA 3MFGB 1AKJB 3SDCB 1CCZA 3V6OE 1IAKB 2GJ6B 2VXVH 4PRHD 1I1CA 1WIOA 4PRHE 3QDGE 3TO2B 1NC2B 4F58L 4LF3A 4CW1B 3AMLA 5HD8C 2XT1B 4HEME 1NC4D 4HXAH 3UO1L 4YDVA 1QFUH 3MV8B 3O6LH 4PREB 3WN5B 2G5BA 3ARXA 3X13B 2Z35B 3TH3T 4Z5RA 1AC0A 3NN8B 4X4XA 4JHAH 4BSVA 4R7NB 1MHPH 3IU4L 4JZOA 1CR9L 5B4MC 1T0MB 2IC2A 4IMLA 3MV01 3C5SA 1ACYH 3H3BC 3TVMA 5IMLA 3P0GB 4Q9QH 1PDKA 3H0TB 3MUHL 3SDXA 2OI9B 5D70L 2QSTA 4RISL 3GMPA 4HJGA 2FR4B 1XZ0B 5FGBC 1T21B 1MJ8H 2E6QA 2FDBP 4MA8H 4JG1H 3D3VA 2MTPA 1Q0YH 1F45A 1YNTA 5D1ZB 1EO5A 1K4DA 3VXSB 5JDJA 3MJ8B 2Z8SA 1AKJD 3SDCD 3TEUA 1KT2A 2GJ6D 1W0VA 2VXTL 5DJ2B 1VDGA 3RU8L 2GJ6E 4LKCB 1NCNA 3IT8D 1NC2D 2X09A 3ARTA 2XWTB 5H94B 1JGLL 4F37F 2I9LA 3CXDH 1G7HA 1F02I 1TNNA 3LS4L 4NKDB 3MV8D 1AGEA 1A21A 5TE7H 3MV8E 1JJUA 2P48B 3RTQD 3FQTB 3OL2A 5F70A 1YEFL 4L4VA 4XCNA 4ZFFB 1G9ML 4PD4K 1UWXH 1G7IA 5F89A 4YWGH 2H6PA 2IQAA 4XBGB 2UZYB 3KJ6H 4X6CB 3BI9X 1L7IL 1RAMA 3K8KA 4HV8B 4XMKH 4Z76B 3C60C 3ZKMD 2GSIA 43CAB 2M26A 1UVQB 4UIKL 3RVUD 2NY6C 4FFWD 3RWHB 1GOHA 5DR5H 2XQYG 3VFWB 1J1OL 1DLHA 4RRPG 5EZIH 1K2DA 1K3IA 2Q8AL 3MA7B 5D1ZD 5LCVL 3VXSD 1DFBL 1YA5A 2YSSA 2HP4A 4HKBA 1H0DB 3VXSE 5DUPH 4WEBL 3FTGA 5SWQB 2A6IB 4QXTB 4Q97A 3VXOA 5HXMA 4OJFL 4R97C 4XNYH 1IGML 1KF9B 4POUB 1MCBA 3MV7A 2CIIB 4OD3L 4TUOB 1ADQH 1TJHH 5HDQL 1ND0A 4WNQB 5CBEB 4DK3A 2BVOB 4EEEA 1S7WA 2CJUH 1I1FA 3QXAB 4NN6C 1Z3GH 1RZFL 3AS1A 2AJ3A 1JNLL 1BFVL 2DKUA 4R6UA 3BZFA 4MLSA 4M62L 1BOYA 3LKOA 1RUAH 2CD0A 3B9DA 1X7QA 4X6CE 3K80A 1FC2D 2FB4L 4WV1B 1XIWB 4BFGA 4GMTH 2X4QB 1GGTA 4L4TB 4O2CA 2YRLA 4DVBA 3S35H 4WW2B 3VXMB 4KJYA 3OAYK 5LJYH 4N5EC 3UAJD 3V0AC 4BH7A 1T5WA 4QHNB 5JW3L 3WXWH 5GGTH 1CDBA 2CRZA 3TO4A 3T0VA 3L3IA 4MNHB 4X6DB 3O9WB 4KZDL 4J3WA 1IM9B 4IRJC 3KYAA 2IBZY 1KCSL 5CCKL 1XAUA 2Q8BL 1OAKL 1NGYB 2ESVB 1TCRA 1QVOB 3QHFL 3R1GL 3RPIA 4H26A 3HPLA 2IF7A 1RZ7H 2P43B 3GBNH 2OJZL 4UB0L 4KQ3H 1MLCA 4ODUB 1QLRB 5J7CC 3TWCH 3TNNB 3K0WA 3AY4A 3V4PL 3BYTA 5FB8B 4NBYB 5A2IH 1K8IA 1QBMH 4MD5A 5AUMA 5GS1A 1MVUA 4XXCC 5FYJH 5F7DB 1Q72L 2HLAA 1IAOB 5CINL 3TZVC 1W0WA 1XIWD 2EYRB 4F37K 3GSWA 2WW8A 4L4TD 4EVNA 4L4TE 4S2SB 3VXME 3LPWA 2HMID 3WFCL 1H3XA 4I3RH 1AFVH 1IFHL 1I1YB 5L9DL 5BV7L 3D39B 3PE9A 4FXGA 3ET9F 2CDEA 3CSGA 2EXYC 3O9WD 3F7VB 4XHJD 2AQ3A 3FCTB 4X6DE 4PR5A 1Q9KB 1I7TA 2YS4A 2ADJA 2ESVD 3V79C 1FG9C 3STZB 1U42A 2YRZA 2ESVE 1JNJA 4KRPC 3ARFA 3NMEA 3UZQA 2YPKB 5FCUL 1OP3K 3PWJB 3Q6FB 1KIPB 4OTXL 2R1XA 5DA0B 3TYGH 1T4KB 3LSOA 5F8RC 2GAZB 5FUCE 1OVZA 3IDNB 5DS8B 3QDMA 1BQUA 1INDH 1I9JH 2NW3A 4PV8A 3TPUA 4M93B 2JJSC 3FQXB 4FQIL 3QEGH 4O5LH 1XFPA 4MA7L 3MLXL 2X41A 5FGCB 3FO0L 2B20A 3QQ4B 4XRCA 2F74B 5IQ9A 1DCLA 3WHXA 1MIML 1YYML 4LSUH 1QACA 3TN0A 4PRNB 4CDHA 5LGHL 4LHUB 2VH5L 1KENH 3BVNA 2O93L 1BD2A 4MS8D 1DQDH 4XMPH 5LWYL 2A6KB 5D2LA 1F11A 4ZTPH 4MB3A 4PGZA 5I66B 4P23B 4AEEA 3D39E 4Z95L 3KYMB 3LCYA 4HSQA 1S9WA 4G6ML 4NO2B 5JR1L 1KYOK 2IH3B 3EDDA 4Q6IB 2O61A 4YHKH 1ZA3B 5KZCB 5GRZA 2KZWA 5DD6B 3QYCA 1OAZH 4X7TB 1T7WA 4G8FB 5J1AB 1ZAGA 5TF1H 1CGUA 4ZG1A 1DQQA 2R2BA 4PJ8B 3S34H 1Z9MA 4XPTL 4RRPA 5JPNA 4OCSH 2QHLA 5K9OA 5GRVK 1MCQA 5AG9A 3IFOA 1BQLL 3TBYB 1HNFA 2DM7A 1KYOJ 1MFBH 3UTPD 1CTOA 4WY7H 1TQBC 1U8JB 4WWKC 5DFWH 1JYXA 1U8PB 1WWBX 3CDGB 4LRIC 1P53A 4E42A 3BP4B 5DVNA 3MSPA 1T7XA 1U8QA 5FGCE 4HKXB 4F7PB 4XAWH 3F5WB 4LDLB 3ZKQD 2AJUL 1DQML 3MMEB 4F9PC 4LHUD 2D9QB 1QFWH 3CDYA 4X4ZA 5HI5D 4OLYH 1YC7A 4XBEL 1NEZG 2AJZB 5E24E 4FZ8H 3KLSA 43C9A 1R3LA 5FYLD 1P1ZB 1B88A 2VDOL 4KJPD 5FYLE 2F58H 3U0WH 4F7CB 5KZCD 4FQCL 2X05A 1G7JB 1H5BA 4A6YL 3DVGB 1S7RA 4IIQB 1C5CL 5DGRA 4G8GA 1HQ4B 3RTQC 1FNLA 4U7MA 4FA8A 2C3WA 5I2IB 3GNMH 2E27H 4OIIL 1HOCA 2ZNWA 1KEMH 4GO6B 5CWSB 2NZIA 5JIHA 3ALWA 4O51B 3MRFA 5F21B 1UM5L 4HF5L 4NWUH 1F4YL 3MNVB 2OI9C 4NKMA 2C4FU 3TJEH 3CLEH 3IVKB 4HHAB 3VRIA 1TXKA 1NFIA 4UAOC 4K7PH 3L95B 4GS7C 2X44D 3D0VB 1PSKH 3QIWC 4RGNB 3FQRA 2X4RB 3A6CL 4GLRI 1ZANH 2AI0H 3FHAA 4KTDL 4X0KB 5DMGD 5DJ6A 3ILQD 3LKQA 4HIIA 5E6IA 2WUBL 2AP2A 4YXKL 3RWGB 1A0QH 5DXWA 4LASH 5JA9A 5F44A 3HE6D 3NFSH 3ISWA 1VFBB 2YOCA 1A1MB 4G80A 5GSVB 3H8NA 1A6VL 2EDRA 4H1LA 1NLDH 5DD3H 2BVUA 2IAMA 1N7ML 4M5ZL 3CFEA 2DOCA 4PJEF 4UBDD 4ERSL 3N1FC 5ID0B 1RIHL 4F58H 3WFDL 2DM4A 5CP3H 4U1GB 3WUZA 3RRQA 4MJ6A 4WU7A 5AZ2L 4OF3A 1H3GA 5EU4B 3UO1H 2XKNA 4JFDA 3CC5B 2V2TB 1KN2L 1DQTA 1FQ9C 1GHFL 5IROA 2IADA 2VQ1A 3IU4H 5HHQB 4QT5B 2EC9U 1CR9H 1RU9L 2NY4C 3MROA 4M4PA 5BQ7A 4NQXB 2EIZA 3CPLB 3G5YA 1FNAA 3TCXA 3BP7B 4RGND 3OR7A 5JXED 4RGNE 1CGWA 3QG7L 4NQSA 5D70H 3QQ9D 1CFVL 4RISH 1NFDF 4MAYB 2MWCA 1CE1L 5M94B 3PWUA 3ULVC 5KS9A 1FNHA 3D25B 3VWJD 1RV6X 1GGBL 3EGSA 5DJZB 3OX8A 3EFFA 4HCRL 4EQ2A 4Z0XB 5IB2B 3QIBA 4AL8L 3EYVB 1P69B 3BT2L 2BVQB 2HWZL 1FAIL 4ZFOL 4ZNEE 5GRVL 1FZKB 4QRRB 4YBQD 3KPPB 4EUPB 4CU6A 2EKSA 2NXYB 1NGXA 2VXTH 4ZUTA 3SO3B 2GT9B 3RU8H 4NCC1 1NCAL 1AO7B 2LU3A 1AP2A 2ZOKB 5C0GA 5I1DB 5HGHB 1HWHB 3N06B 4LPXA 1L0YA 2JF1A 1D5MB 3OKDB 5EBLB 1JGLH 5KBNC 4A6YA 4EI6A 1NEUA 3LS4H 3IDMA 4M7ZB 3T4YA 3ARVA 4EQ3A 4X6CF 3WO4B 4UTAL 1ES0B 4HLZG 4TNWK 1SJEA 4MCYA 3VFPB 1GVIA 5K59F 1YEFH 3DX8B 1KFAL 3I6LD 4QRSB 3MRBB 4O2EB 3I6LE 1G9MH 5CZVL 2WNGA 1S9KC 1CFQA 1SVCP 1DTUA 3ULVF 1Q38A 1XIWC 5D7IB 3ARYA 5KSAB 4YBLC 1J05B 1L7IH 3JVGA 4MAYD 4ALAL 1YN7B 2J8UB 2W9EL 5AAWA 4I4WA 3HZKB 1ZGLB 2DIBA 2LVEA 1WTGT 1Y18B 1I7RB 2ZSWA 4JN2B 4UIKH 1K3ZA 3HR5B 5AZEL 1J1OH 3BEWB 3O9WC 4XHJC 2Q8AH 5E00A 5LCVH 1DFBH 4HAGA 2QSVA 4QRRD 1VSCA 5IMMA 4WEBH 4CVZA 1IM3A 1S7SB 4QRRE 4DGYL 2NXYD 5C6TL 1FZMA 2ORBL 3H7LA 4OJFH 1IGMH 1AO7E 3AREB 4J23A 1MWAB 2E9BA 4NT6A 1ZT1B 4JM2B 1OD7A 1QBLL 2JE8A 4WIQA 5E70A 4OD3H 2MQCA 1Q94B 3LDBB 5J11C 5E8EB 2E3VA 5HDQH 4S1RL 1XCQB 4U4BA 5FYKL 3IJSB 2H2PD 4JRYD 2Q7YB 4GKOA 4YJZL 3VFSB 3ZDXE 1RIVL 1RZFH 3IDGB 3ZZ1A 1JNLH 4ZOEA 1BFVH 5FYJU 4Y5VB 1HDMA 4MXQD 3BPLC 3QUKB 4M62H 1NEZA 4W6XB 3X11A 2D2OA 3S3PA 5HHMB 1YYLL 2FO4A 2FIRT 4NO3A 4U2YA 4HK0B 5KSAD 1GXEA 5D7IE 3MJ7B 5CGMA 1U8LA 5IHZB 4Y4HA 4HS3A 1WC7B 2E6PA 2FB4H 2J8UE 5ANMA 5ACZB 4F8TA 4X6DF 1KLGA 1XF4B 1FJ1B 1Q9LA 1GAFL 4MB5A 3VDCA 1VGEL 4Y2DA 3TNMA 3WEXB 3QJHA 1T7YA 4GBXB 5F9DC 2BX5A 3MRHB 5JW3H 3PHOB 3BZ4B 4OZIF 1S7TA 3FN3A 2P1YA 1M4KA 1A4JB 1RHFA 1NAMB 4KZDH 3ARED 3G5XB 1DN0A 2XG4A 4QY8B 3SKNB 5CJ8A 4JM2D 1B6UA 5FO9A 1IAIL 1KCSH 5CCKH 3CFJB 5DF0A 2Q8BH 1OAKH 3FFCA 1IGFL 4IRSB 3MREA 3QHFH 3R1GH 4UNTA 3MLRL 4MSWA 1ZHKB 1U8NB 2I26N 2F54D 3EYFA 1B0RA 5AG8A 1OTUD 1T2JA 4ZAKC 2OJZH 4PG2A 4UB0H 4P2QD 3V4PH 3K4DA 5DSCA 2P8LA 1N6VA 5SWZA 5I74C 4U6VL 1II4E 3MJGX 1BX2B 4KMTL 2Z93B 5HHME 2BC4B 2DQHL 2IPTL 2XICA 4GXVL 4NRYA 1Q72H 5GJTL 5CINH 1V5JA 2Q86A 5HI5C 4Z78B 3D48R 3U9UA 2EEDA 3CCHB 1A6ZB 4GBXD 4BSWA 5KSUB 3WFCH 3SDAB 1BZ7A 1ZS8B 1IFHH 2UYLB 4KJPC 4NDMA 4ZPVB 5L9DH 3QEQA 5BV7H 5JNYB 2ENSA 1UZ8B 4IRJA 5E4EB 3HE7B 3ZYOA 1KSRA 2GW5A 4MDIA 1UJ3B 4LPCA 4U6YB 3QRFM 3MRCB 4IRSD 4WEUD 4TSAL 4GRLB 4NC2B 4U3XA 5F1NB 5FCUH 4BKLB 1WVZA 4ONFL 3ROLA 1DUZB 4OTXH 4JQIL 1NMCB 4DTGL 3KPTA 5TQ2L 3UTZA 4P2CG 4JFFA 4ETQB 3G6JB 5F71A 1A3QA 1RJZB 3SKOA 3SKMB 1TZGL 1HSAA 3KYNB 3PF2A 1X5XA 3CUPA 2NX5D 2VDML 1X5YA 4FQIH 3HE6C 5GRYA 3TZVA 4AT6B 4X4ME 4MA7H 3MLXH 4U1SB 3FO0H 3UZVB 1R3KA 4J3XA 2K7PA 3QWOB 1EIBA 1MIMH 3RHWF 3T3MF 4MJ4A 1YYMH 5FA4B 3FT2B 3MCKA 1BVKB 5IVXA 4WFHD 5LGHH 3SDAD 2VH5H 4UBDC 4WFHE 1JMXA 4R0LB 5GGVY 4TRPL 5LWYH 4L8DB 3UTSA 4Z95H 2YUXA 1OTSC 3HE7D 4OLUL 4IDJL 4G6MH 1D6EB 5CKAA 1EAPB 5C07A 5JR1H 3IRPX 1AXSA 4NM4L 4LVHB 4QRQB 4O9HL 1MFCL 1NKRA 2VL4A 4ZYKA 2V2WB 3LB6C 2X4TA 4GRLD 2M8XA 1RZGA 5IBLC 2X9YA 1S7VA 1T6WA 1ZLSL 1LE5A 1IMHC 1CBVL 3UJIL 2IEPA 3UPRA 1CLOL 3WIHA 5ESVB 4YO0B 1JPFB 1MFDL 1YEHL 1XF2B 4L3EB 4XPTH 2F19L 5T5FL 1X5HA 3G6JE 2R69L 3N50A 4OFYA 1BQLH 4TVPL 3SGKA 4ESKA 1IEAA 4ODXA 4NGHL 3VFRA 4PB9L 3MRMA 5KG9B 4I1NB 4L29B 5TE4L 3VWJC 1TTUA 4LLMB 5JTWA 2FJFB 1TCMA 3I85A 3OKKA 3ROOA 1Y6NR 3V6OA 1JF5A 3WNMA 3F6LA 4PRHA 2AJUH 3HTLX 3QDGA 1DQMH 4YBQC 5IEHB 1C12A 4QCIA 1KIQA 3NFPB 1J0KA 2YD2A 1ETZB 4WUKL 4M7LT 4XBEH 3BAEL 2Y07L 3GIVB 2M1KA 2XV6B 3FQWB 1NC4A 3WNKA 5BXFB 5IUSA 4LVOC 1G7PB 1J18A 2VDOH 4KUCF 5DUBA 3SDDB 4FQCH 4I0KA 3DV6A 4A6YH 3RGVA 2A2QT 1C5CH 4WEMB 3ZL4L 3MUGA 4AJ0A 3BRFA 3QO1A 5I1HL 4LCUA 3OGOE 2DBJA 3UCRA 4OIIH 1T20B 4R2GB 1G7MB 2YUWA 4UQ3B 1HH9B 3GJFK 4UINL 3ZLQC 5E5MA 5E1HB 1G9NL 4OQ1A 1UM5H 4L3EE 4HF5H 1M71B 3TGXA 4HIEB 5DD0L 1F4YH 3D69B 4WO4B 4N90D 4OCWL 1QEWA 5DVOA 1EHNA 5DK0A 3ULVL 5H37G 5HHNB 3A6CH 4KTDH 2FECI 1KTLB 4JHBA 4JY6B 2WUBH 4YXKH 2DWEB 4QNPE 1AKJA 3SDCA 4WUUB 1W72L 1IAKA 2GJ6A 1J11A 4JVUA 3BN9D 1A6VH 3T0EB 1MPAL 2DS4A 3TO2A 4P48A 1NC2A 2CK0L 2G9HB 1N7MH 3QEUB 4KGJA 4M5ZH 3DVNB 4YC2C 4CW1A 2VLRB 1WIPA 3MV8A 4ERSH 4PREA 3WN5A 3X13A 1PYWB 1RIHH 4ODTL 2Z35A 2HTKD 4NHCL 3NN8A 3IJHB 4R7NA 4WHDA 2BJML 3WFDH 3WFZA 1C8PA 1AC6A 2FIKB 2H2PC 1T0MA 1EGJL 4IDLA 5AZ2H 2GJJA 4R2GD 3BRDA 1G7LB 3RHWK 1KN2H 3GSQB 2PO6B 15C8L 4XAKD 1GHFH 4HD9A 2FR4A 4XAKE 4WO4D 3SE8L 1XZ0A 1T21A 5H2BB 1RU9H 4LDOB 1CDJA 3HR6A 2X4NB 1JRHI 4JZJC 4NRXB 2LU4A 3EFDL 1F00I 4CVWA 3QG7H 4N0UB 1CFVH 5DMKB 5D1ZA 3VXSA 2YD4A 3MJ8A 4FQHB 1CE1H 3SPVB 2X5PA 1KJVB 4WUUD 1RK0B 1C08B 4KVCL 2YA0A 4JQXC 1MCWW 1KXQE 3ULSB 4WUUE 3DNKA 1GGBH 5DJ2A 4LKCA 4HCRH 5FDWB 4P49A 5J12C 3DRQB 3F65A 3T0EE 1UYWL 4LIQL 3OAUL 3ULUE 4AL8H 2XWTA 2XWJB 1I8LC 3BT2H 2HWZH 1FAIH 5H94A 2AW2A 1X5FA 5HSFA 2VLRD 3N1QC 5E94B 4NKDA 3QAZC 2DL2A 3ZE0E 2VLRE 3ZDXF 1NCAH 4XBPB 5F96L 4LHUG 2CO7B 3NPSC 1UXWB 3FQTA 4CU7A 4QXUL 5SX4I 4Q9CA 3ZSTA 4ZFFA 1H3TA 4POZD 3PL6B 3QDJB 3QCTL 2ZCHL 2FECL 1MCIA 4UTAH 4XBGA 3MFFB 1ED3B 1AY1L 4X6CA 4YHYB 5BCAA 1T0NB 4GG8B 4AIZB 1V7ML 1MEXL 1KFAH 4HV8A 3D0LB 2I5YL 5BZWB 5E03A 3X12B 4Z76A 3RUGB 5CZVH 4LPVA 1T80A 2VLLB 2Y4SA 43CAA 1PBYA 1UVQA 4KJQC 3RWHA 2QADC 1NBQA 3WJLA 3BPNB 3ZTNL 3VFWA 4OF6A 3MA7A 5ADPL 4ALAH 4N0UE 2W9EH 1H0DA 3AB0B 5CGTA 3QUXB 5SWQA 2A6IA 4QXTA 3NZHL 1ZLUK 3SO5A 5AZEH 4QHLB 1A7BA 5FA3B 4BFIB 4HUXB 5TFSL 2AAVA 2CIIA 4DGYH 5C6TH 4TUOA 3MRNB 2ORBH 4PJ9C 5CBEA 4WNQA 1IBGL 2BVOA 4CMHB 5D1QB 5B8CB 2DN7A 3BXNB 3QXAA 1AQDB 1H15B 1QBLH 4M1CD 5CSGA 3PL6D 3QDJD 5CJQL 1JGDB 3QDJE 4KDVA 5D96C 4HMDA 1UM6L 4FG6D 1E4KA 5HVHC 1EGJA 4PP2B 3ZT7A 4S1RH 2ID5A 5CP7B 5FYKH 1RIVH 4N0RA 4P46B 3PDOB 1Q1JH 3DROB 1TTFA 4WV1A 4LU5L 4X7FC 3RUGE 1XIWA 2IBZX 2GEEA 1WCBB 1ZT7B 1EFQA 3QRGL 2X4QA 3LKRB 1U3HC 1IL1B 4L4TA 1YYLH 3BDYH 4WW2A 3VXMA 2BHUA 4GXUN 4WVRA 5E95B 1OWRM 4QHNA 2UWEB 5IB1B 1ZT4B 3SDAC 2B8OT 3LRHA 2GSGB 2YC1B 3QUXD 4IHOB 3C8DA 2X42A 5FYLL 4MNHA 4KKLC 1GAFH 4X6DA 3O9WA 1HXYB 1VGEH 1JV5B 1IM9A 1WWWX 2XQYK 2C1PB 1NGYA 2ESVA 3WFHB 1QVOA 3RAJL 4YHLL 2DQCL 5D1QD 1RMFL 1FDLL 1IAIH 4DUVA 4ODUA 1QLRA 3Q48A 1IGFH 3TNNA 3GDBA 4GKZB 4OLWL 2NNAB 2VJXA 1G0YR 3BIKB 1GGYA 5FB8A 3MLRH 3HA0A 1UGNA 1NGPL 4KKBD 4LCYB 4XNUL 5D7SL 3DECA 3OQ3B 5F7DA 4P46D 3SGJC 1IAOA 1QKZL 2EYRA 2XA3A 2LV4A 4H88L 4CU8A 5DD5L 3G08B 1VHPA 4U6VH 1GOGA 2V5RA 3B9AA 4KMTH 4OZGB 4S2SA 2DQHH 4QWWC 2IPTH 3MRRB 4GXVH 3U0PB 1TZIB 5ALCL 1I1YA 5GJTH 2UWEE 3ARPA 3D39A 4LLAA 4JCMA 2P8MB 4NN7B 4P5MB 4OCLC 3F7VA 3FCTA 1F4HA 4HG4K 1Q9KA 3V8CA 4J4PD 5MENB 4HBQA 3AC0A 3STZA 1CGVA 2QSCH 2ZUWA 2CH8A 1I9RL 2YPKA 3K8MA 2VZTA 2R56L 3ARDC 5EOCJ 3PWJA 3Q6FA 1KIPA 1T4KA 1RUML 2GAZA 3IDNA 5TDNB 5DVMA 5DS8A 4D0DB 1UM4L 4TSAH 5EWIL 1IKNC 3MRGB 4HG4J 4Z77B 4EUPG 3O11B 1RZ8B 1CVSC 4JFZL 2D7PA 1QHPA 2PKDA 4ONFH 4DTGH 4JQIH 5TQ2H 4Q9BA 3BISA 2XOTA 1BFOB 1MF2L 4G8IB 5CJBA 3BESR 2CLVB 2HTLD 3QQ4A 2CKBB 5EG6C 2F74A 4OCMC 2V7NB 5B38G 1TZGH 4WI7A 3TFKC 1MCSA 4RGMC 1BLNB 3V4VL 4D9LL 4DKFL 4PRNA 2A0LC 2VDMH 5IW3A 4OZGE 4LHUA 2XIDA 3B9KC 4G3YL 3BN9C 1FFNB 1SVZA 2A6KA 4PG9A 5I66A 4P23A 2YD1A 5IT2L 3MPCA 3KYMA 4CN1A 2Q20A 1JVKA 4NO2A 1FV1B 4K71B 2IH3A 3B3IB 4Y16C 5MEND 4Q6IA 3FO1B 5BRZB 1ZA3A 3ZMRA 5J9PB 4ZFZB 5MENE 4TRPH 2JTDA 5DD6A 2MFNA 1LNUB 4KJWD 4X7TA 1BQHB 1P5UA 4G8FA 5K9QI 1KV3A 5J1AA 1UH4A 3T2PA 1GGUA 4OLUH 4IDJH 3JWOC 4PJ8A 1NGZB 2VOTA 3HI5L 4NM4H 4GKNB 4O9HH 4OGAD 1T1ZB 3LN4B 3TBYA 1ZLSH 1CBVH 1U8JA 3UJIH 1CLOH 1MFDH 1U8PA 1YEHH 2JELL 2F19H 5T5FH 3CDGA 2AK4B 5CJXA 4QNPF 4X6EB 1JI1A 3WV0A 3BP4A 2R69H 3QUZB 4HKXA 3BD3A 5FEBA 3F5WA 4TVPH 4ENED 1K9TA 4GRWF 3NIFF 5MHSD 3GM0A 4NGHH 1AR2A 1X5GA 4GJTB 4PB9H 5ACLA 5MHSE 1A6PA 3MMEA 3ABZA 5TE4H 4C58B 4DCQB 1L4IA 4WTZG 1Z9SA 3BZDA 1BWWA 1NUFA 1FN4B 5FV1L 2VL5B 3HPJB 2AJZA 4OZ4B 3LZFL 1P1ZA 5IB5B 4DGIL 2GCYB 2HFFB 1EZVX 5BRZD 4F7CA 6FABL 4OLZL 3JTTB 1G7JA 5BRZE 5LVEA 3MODL 3DVGA 4IIQA 4WUKH 1HQ4A 1TLKA 4GW5B 2FH8A 2IANB 2Y07H 3BAEH 4N1EA 5I2IA 2VIRB 4X5LA 4NC1C 5IBTL 1KJMB 5CWSA 4CNIB 4O51A 5J0BA 5GGRY 2X1OA 3PDDA 4M6ML 1KG0B 1IKFL 2JB5L 3MNVA 3OHXB 3UTOA 3ZL4H 2DD8H 3IVKA 4HHAA 5I1HH 5D7JC 3JV6B 3L95A 4KVNL 5DDHB 4J12A 3D0VA 4K8RC 4UINH 2AK4D 4I3GA 4Y4KC 1G9NH 2X4RA 5JXEA 5E8DL 3AVEA 1DBJL 2AK4E 4WHYG 3QUZD 1SJXA 4X0KA 5DD0H 5DRNB 2MKWA 3FT4B 5I1IL 3VGBA 3OWEA 3RWGA 3UPAA 1R6VA 1YEGL 4CL7A 4OCWH 1MCLA 3ALPA 2A74B 1N3NB 1VFBA 1A1MA 3ULVH 5GSVA 3MZGB 2WAHA 4NUJB 2HA1A 3IDUA 1GCFA 3QXDB 4ZNEA 4PRBB 1HI6B 3VD7A 2LAAA 3DUHA 4F7TB 1W72H 1FO0B 4KK8C 1CS6A 1MWAL 4UQ2B 5I19L 5ID0A 1JPST 1MPAH 4PJAF 2CK0H 1EBAA 4GXUM 2IAND 2IANE 5I1KL 5EU4A 4NNYB 1KC5L 1MRFL 4Y8AA 3NIDF 1QNZL 1R3HB 3CC5A 2V2TA 3PL6C 4ODTH 5LGKA 4NHCH 3GM8A 5IKCB 4FG6C 1H3VA 5HHQA 2BJMH 4NRZB 4QT5A 5I1LB 4MJID 2PCPB 4K7PY 1PEZA 1EGJH 1KUMA 2VE6B 1NANH 4NQXA 3CPLA 1ROWA 3BP7A 3ME0A 3PXHA 5GZND 2EZ0C 5DJ8B 15C8H 2RJMA 3DUSB 3WLWD 3BPNC 4MAYA 3SE8H 4W4OC 4WI2A 4Y4FC 3D25A 4FABL 1CGSL 2ZZUT 4OM1L 5DJZA 4JHWL 4B41A 2NYYD 5IB2A 4Z0XA 3QJFB 3GO1L 5JW4Q 1LP9F 2ZPKL 3EFDH 3K46A 3EYVA 4XNQB 1WBYB 2VLME 2BVQA 1KLFA 3WIFB 3ZKXB 5TPWL 3DMMB 1FZKA 2XFXB 4MGXA 4AQOA 4HKZB 1NAML 4QRRA 3KPPA 4EUPA 1VESA 4KVCH 4KDTC 3BKCL 4S1SL 2GT9A 4TVSa 1AO7A 2D7MA 2ZOKA 4M7KL 5I1DA 4WHCA 5HGHA 4QHMB 2YD3A 1UYWH 1KTDB 4LIQH 3OAUH 5E2TL 3WSQL 4LCIL 1D5MA 3OKDA 5EBLA 3JZ7A 2P7TB 2DQUL 2J7LA 5ILTL 1WEJL 1AE6L 3NACL 4K94C 5F96H 1ES0A 3A6OA 2ED9A 3BUYB 3VFPA 1INQB 4KKBC 2BSSB 3RUGF 3DX8A 3NBNA 4QXUH 2VXSL 5FYKU 4QRSA 1S9VB 4R3SB 3MRBA 4O2EA 5TH2B 2BY1A 3KS0J 4P46C 5D72L 4J7RA 3QCTH 2ZCHH 5EOQL 1T89A 1FSKB 1AY1H 5D7IA 5KSAA 1J05A 1V7MH 4OF8A 1MEXH 2AV1B 1EO7A 1YN7A 2J8UA 4PRDB 2I5YH 4QGYA 2H41A 3HZKA 4OAWB 1ZGLA 1WZMA 3VXTB 4M7JL 1Y18A 5DZOA 1JZ6A 1I7RA 4JN2A 3EIFA 1CXEA 3HR5A 3ZTNH 1BVLB 3BEWA 1MIEL 1CVRA 3RX5A 5ADPH 5F72S 1E0OB 1MHEB 3DMMD 4YK4C 3IETB 1YUHB 4UOW0 2E6JA 2NY5C 4J4PC 1S7SA 1X5KA 1PY4A 1CD8A 3RVTC 3NZHH 3GJFH 3AREA 1MWAA 1U8IB 2ARJQ 2ITDB 1ZT1A 4JM2A 5AEAA 4M9PA 5TFSH 2GITB 2WMPA 5C6PB 3SHSA 3EKCA 3OZ9L 1H8SA 1Q94A 5FDYA 1CFTB 1BWMA 3FN9A 5E8EA 4YUEL 1IBGH 4PP1C 1XCQA 2CMRL 3Q5TA 3S5LB 4FXLA 3AS0A 3IJSA 1BVZA 2Q7YA 2DICA 2FWOB 1OM3L 2KZ1B 3F8UB 3VFSA 4WTZA 3IDGA 2MCPL 1BAFL 4Y5VA 4R4ND 3QUKA 5CJQH 1P7KB 1UM6H 3GSRB 4KQ4L 2FRGP 4HIJB 2HTLC 1WV7T 2UVEA 4HK0A 2HJKB 1J8HB 2UWEF 4XB7A 3MJ7A 3WFBL 2DBLL 5IHZA 3L5WB 3QIUD 1YC8A 1IEBB 1WC7A 2E7LA 5ACZA 3GZKA 3IKKA 4LU5H 2CO6B 1XF4A 1FJ1A 3QRGH 2HN7A 5EB9A 3WEXA 1CL7L 4Z7NE 5SX5H 4GBXA 3TBTB 4Z7WF 2VABB 3MRHA 5FO7B 2WBJC 3PHOA 3BZ4A 4POYA 3ELAT 2YD7A 5FYLH 2WZPD 2D4FA 4D8PB 1A4JA 4XNMB 1NAMA 3I2CL 4KJWC 4MQXC 3G5XA 4QY8A 4LRNL 3SKNA 3CFJA 1S7UB 4IRSA 3RAJH 1WBZB 4YHLH 3L3DB 2DQCH 1A3RL 2FD6L 4OGAC 4RFNB 1DVFB 2K7QA 1ZHKA 1U8NA 1Q9WB 1RMFH 2BDNL 4RIRB 1FDLH 5JQHC 3O2DL 2QQKL 4ETYA 4DN3L 5B39G 3FMGL 4OLWH 4N0YL 3DWTA 3E0GA 1ZHNA 1NGPH 3W0WB 1KBGL 4MYWB 1I3RB 1HH6B 3TPKA 4YXLL 1BX2A 4XNUH 5D7SH 1J8HD 2Z93A 2BC4A 4OSUL 3T0DA 1J8HE 5TJWK 4X4MA 2FBJL 1HHGB 5ISZB 3U9PL 5C0ND 1QSZA 1QKZH 1YEEL 3UMTA 2ATPB 4H88H 4Z78A 5DD5H 1IZKA 1N8ZB