1RIHL

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DLVLTQSPATLSVTPGDSVSFSCRASQSISNNLHWYQQRTHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSISSVETEDFGMYFCQQSNRWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
molecule keywords light chain of antibody 14F7
total genus 56
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL01
5I75B 3SJVB 2CKNA 1AE6L 5F6HI 3HZVA 1BPVA 4K9EH 1ZA6A 4NN7C 2B1HL 3OX8B 3QPXH 4J3WA 3PNWA 4U1LB 4PFEA 2FLRT 2J8UB 1Z9OA 1E27A 4PRBA 4MCZA 3BOVA 1JV5B 5AUMB 3UTPE 1MWAB 3U6RA 4QCIB 1YYML 2NNAB 1AJ7H 4NJAH 3QCUH 4F58H 4CMHB 2AJVH 1A3LL 2FX7H 1FAIH 4X6FB 1HYRC 4PG2A 4E42A 5KSAC 3I84A 5HGDB 4M1CD 2NY2D 4Y1AD 1BM3H 1N2RB 4UB0H 3WEXA 2WINA 2F53E 1FFOB 2XTJE 1CZ8L 2W9EH 4F57H 5D1QB 1GOGA 5HHOB 1G6VK 2MQCA 3AY4C 2WBJA 2OTUB 1JE6A 5DK2B 1TJHH 3ZO0A 1B0WA 4JREC 2R2EA 3EYOB 3SDXF 5FKPB 1SBSH 2DOCA 2QQNH 3SHSA 4N5EC 1S7RB 3IU4H 3HE6C 5JOEA 4OIIH 4MHHG 1QBBA 2J8OA 5DYOA 1U3YA 1C08B 3ARGB 4KROC 4KUZL 3RWHB 3UMTA 4YHLL 2I5YH 1G7HA 1Q9KA 4WHTA 3OJDB 4F7MA 1R3HA 3HI1A 3UC0L 4L8SC 1OP5H 1C12B 1FBIH 1K2DA 4PJGF 5AZEL 1AHWC 4KH2A 1FG2A 3VW3L 1JYNA 1HEZB 3SKMA 3DVIA 4GW4A 2L0DA 4PLKC 4DKAA 2GSIB 1INQA 1JRHI 3DIFA 3GHBH 3O9WD 4CMMB 2ZKHH 3TZVB 1JI1A 2GT9B 1RU9L 5CIPH 3D39D 4HH9B 3W0WD 1T7WA 3FTGA 1FVDB 1HXMA 2HMID 5MHSD 5E56A 1A6UH 1DJSA 3I6LD 5AG9A 1ZHKB 4O5LH 5JMOC 3LEXA 4LDLB 4X7SL 2FEEL 5C07D 3LSOA 4ZXBB 3IFOA 4JFEA 2V2XA 2ESVB 3RBGA 5C0EB 4KDTC 4ZXBD 4RFNC 1YPZA 3PHQB 3I9GH 1QSVA 5LBSL 5DRXA 3SJVA 2V5MA 4PJ5E 4BK5A 4J2XA 1BD2A 2SEBA 3KR3H 3OPZL 4UDUB 4ZD3H 2Y6SC 2BC4B 4PTTA 3S96B 2IANA 3WIHA 4OZIF 2JLLA 2V5RA 3V6OA 3RNKB 2BSTB 5EBMA 5BZWB 4FQLH 4MB5A 1HDMB 1ZOXA 2ID5A 4RDQF 2Y5TA 1Y6MR 2H3NB 1CQKA 1KCUH 1T20B 2YMXL 3QXUA 1ORQA 2EDKA 4ZUUA 3OXRA 1LP9F 3OKYA 5JOPE 2VERN 4S0TD 3JUYA 4Z7VB 4AEIL 2EDFA 4OZFB 3DUUB 2BDNH 3GM0A 3L5XH 1WICA 1AO7E 2X4UA 4AIZA 2C3VB 5E4EB 4JPKH 1ADQH 4YHOL 2IADA 4HC1A 3VRJB 1W0WA 4X7CC 1X4XA 1UH3A 1J18A 1ZHNB 2VXTH 1JF1A 1NANI 4QRUB 5A40E 3MRIB 5TFSL 3DNKA 3IDJA 3MTRA 3MV01 2R29L 5KANI 5LCVL 4ZOBA 3CAFA 4RGOL 3B2VH 4OLZL 3C8DA 5BS0B 1FBIL 3MLSH 1ZT7A 4RZCA 3O6ML 2CLVB 2QHLA 2E8YA 4KI1A 1IGIL 3CIQA 2JB6A 4OFVA 4YX2L 1FGNL 1NBZA 4Z7NE 1NFDB 2NXZD 2VRAA 2BVQA 2A74A 3H7LA 5B3JF 3KPSD 3KXFB 1W72B 4K71B 4GG8B 4M43H 2VSCA 3ZKMD 3RZWA 5I1EL 3C5ZD 2IAMC 4GRMB 3E6FA 3WFEH 4D8PB 3MFFA 1U8PB 4JO2L 4JM4L 2IH1B 1H5BA 3CSGA 4R90L 2PF6A 1WTGT 3LEXB 4E41D 5ACZB 3BAEL 3D2UA 4NUGH 4FFWC 4M02A 1UZ6F 5MERA 4G6KL 3MUY1 4OUUB 1CLYL 2AJ3A 1BQHA 1DQTA 3BD4A 4OLYL 1AGEB 2OYPA 3PWNB 3TO2B 4MZ3A 3P73A 4UUJA 1S9VB 5TE4H 4YLQT 3QXDB 4MVBD 5C71A 3P30H 4U6VH 2Z31C 4GUPB 3BPCB 4TSBL 3NIDF 3QO0B 4F58L 4IRJA 2PXYD 1B4JL 1ONQB 1U58B 1P2CB 3P4OA 2AQ3A 3DRTA 4FQPA 4JREB 5FYLH 5FGSA 3K8KA 2PYEB 4PG9B 3HB3C 3TYGL 2HAZA 5GZNC 4G8GD 3QUML 5E2TH 5BRZA 1RK1A 1YEGH 2F54A 3F58H 3QDMD 4U6YB 1VFOA 3L3HA 4YIQA 8FABB 1T89C 2D4DA 2VDML 4AG4H 4B7LA 4G6FB 3MUJA 3D3VB 1RURL 2RIKA 5T33L 4KK8D 5M7QA 5HPOA 4Z76A 1J8HB 5BW7C 2MMXA 4Y16D 3QWQB 1KG0B 4KKNA 1MI5A 1P7HL 4IRJC 4CN6A 2AKRA 1E6OL 1I7ZB 4NHCH 2J4WH 3OKLA 3T08A 3QIUD 4BJLA 2JE8A 3OF6A 3T0EA 2IWGA 4HXAL 5IBUB 4A6YH 1EXUA 1MVUA 1H5BB 2VH5H 4S11A 5FYKE 5GRJH 3TT3H 1HZHH 5DD6A 4LPTA 1D6EA 1QQDA 2WWMC 3W82A 3EOTH 3H3PL 1NC2D 1D3CA 1OP3H 1LGVA 2YRPA 4JFXA 1NLBH 2BVPB 3G6DH 5F9WC 3RPKA 5I0DA 3MMEA 3THMH 5GS0H 3ULVC 5FHBH 2NY3D 3RJQB 1NAMH 4HZAA 1Q9OB 4NWUL 4K7PH 4QT5B 2AJSL 2IH3A 5DWUL 1CLCA 3KXFA 2DMBA 4LEOA 4DQOH 3I02B 1CCZA 1FL6A 2ZUTA 3HCVB 4XBEL 2WBKA 4XI5D 3MRFB 5IF0B 4DCQA 5IV2B 2F15A 1HQ4B 3V52L 3MACL 4Z7WF 4X5WB 2OL3H 5IR1B 1W0YT 2EE9A 2GJ6B 1FDLH 3ARED 2D0GA 3K2MC 3BMWA 2Q3AA 3QZWA 4J3SA 4U7KA 2CO7B 4ODWA 4BQ9A 2H1PL 5C86A 4WI9A 5F97E 4ZDHA 1PYWA 3OB0H 3GB7B 3NCFB 4C57C 1A7QL 3BDBA 2B1HH 5A2IH 3NA9H 4DZBA 3BWAB 1DANU 1VFBA 4Q6IA 3HPLA 3FO9B 5JUEH 2NLJA 2BMKB 3STZA 4W6YB 2EDXA 4X9GA 5HYQA 3MJ8A 3RA7H 1V3JA 5KOMC 2K1MA 1UYWL 1JMZA 2AV1B 3UTSE 1R0AH 2I07A 2WWMD 2XNAB 3BH9A 5KSAA 3QJHA 1A6VH 1GGCL 5CEYB 5CEZD 2NLJB 4GKNA 1EO8L 1YEDA 2DYPD 4MA3B 1RZKL 1NC4B 4JKPH 5HHMB 1KCVH 2RB8A 4LCYB 2F8OA 4YHOH 3ULVD 2WBJC 5JPMB 1ZVSB 2DWDA 1GIGH 3ZDXF 2H26B 1BFSA 3TA3A 3ARFB 1KB5H 1OY3B 1B0RA 4F9PA 5SWSD 3VXUA 1D5MA 4PJFE 4TUJA 1FYTE 3X12B 2YRZA 3UAJC 4ETYA 1YZZA 4JRXE 5C0BE 4L1DA 2E7BA 5EO9A 4RAUB 2EEDA 1XT5A 4QRRE 1JPFB 2DKMA 4MB4A 1G7QA 4DN4H 3FB8A 2J6EL 5EU4A 3PWUA 4P46D 5GGVL 4KRMB 4U6HB 3WHXA 4AMKH 4YHKH 3KPQB 4WNQA 3TPKA 4NCC1 4WEUD 3MRRA 4OT1H 1T1WB 3WE6B 1KGCE 3CXHK 1QFUL 1T2XA 1AXIB 1CE6B 4JCMA 3W5NA 5SV3A 2VABB 2EH7H 5GGSB 4JHBA 4GW1B 1YEJH 4OD2A 5E6IA 1JWSB 3HPLB 4P3CL 4ZAKA 3T3PE 4PJBA 3VXOA 3PV6B 2BFVL 3QAZC 3TWCH 1RU9H 4PYHA 4OZIA 5D96B 2K7QA 4MD5B 4W81A 5KOVC 4FQJL 4LIQH 3W11D 2ARJA 2X4PA 4H5SA 1SY6A 1P84J 3WLWD 1J7VR 1T0NA 2WUCL 2NZIA 4ZUTB 2IEPA 4LEXL 4ZFOB 2X6MA 1XEDA 1MQKH 4D0DB 3REVB 1TZHB 1J1XH 1FL3B 4G3YL 4P48A 2J6EA 1ORSB 1NKRA 3BEVB 3EJYC 1CK0L 4OTXH 4F8QA 5EC2B 1VFBB 4JFHD 4Q6IB 3FQWB 3K1KC 2VDKL 4WCYL 1MWAA 3GK8L 2GCYA 2Q20A 1XH3A 2G5BB 2FH6A 3E1F1 1S3KH 3MV7A 1FV1A 1QA9A 1T83A 5FFLA 4P99A 1JPST 2ADIA 3G5XB 4P59H 3MV8A 2DBLH 1B6DA 4YHIB 4E5XA 3N1MC 3BPNC 3PWVB 5SX5H 1NJ9A 4X6CF 3VDCA 4FQ2H 2X89A 2F74A 2E9IA 4JJ5B 5GRZA 1FV1B 1CF8L 2JK5A 1INDH 1ZT4A 4R0LC 5EBLA 3T3ME 3HAEH 3O11A 3GI8L 1SVZA 4E5XB 3BYTA 4NRZB 3ROOA 4UT7L 1UXSB 3G5VB 4ONFH 1DFBL 4G9FE 2QQNL 1E4XH 4Y0GA 1E6OH 4LLWA 5HHXL 2HTLC 4LGRB 1MHEB 4PGEB 1ETZB 2H2SD 2OMNA 4OIIL 3BRFA 1G7HB 4PP2B 1IM9A 3D9AL 1I9IH 3NFNB 3WKNA 4CU7A 3KWWB 4FQQA 2ORBH 2ERJC 1IMHC 3ES6A 3ULUC 3O11B 2C5DC 2FH8A 1CDIA 2IAMA 4JM2A 2NY4B 1G6RL 3WXVH 1LMKA 4Z7UA 1TZHA 3O3DB 1MCEA 1RIHL 5CP7B 1KLGA 2FR4B 4Q9BA 5K9JL 2NX5A 4F7EB 4RAVA 4PJEB 1ZLVH 2EECA 1JYXA 4OCNC 3TBWA 3FAXA 3RWIB 3BPNB 4G5ZL 4P9HC 2PN5A 3QDAA 4XRCB 5EU7E 3SDDC 3T2PA 3VXSB 3NFNA 3LRSB 2JJVA 5F7MC 3HC0A 2Z8SA 4XWGL 3MBEC 4OZIB 43CAB 5T3XH 2ATKB 3SO5A 1HOCB 4RFNB 4RX4A 5F3HA 2OBGA 1X5FA 2AABL 3WLBB 3G04A 1XF5B 5H2BA 5IQ7L 5GS3A 3U6RB 1NMCC 1T6WA 3PDDA 5F1IB 3QJFB 2P5WD 5IK3A 1T1ZB 1RY7B 1QSED 3DGGB 3TO4D 2P5WB 4X6EA 1NKOA 4U1GB 2C4FU 4GAYA 4S1SL 1SMAA 1FO0B 1JUFA 4BZ2H 1D9KB 3DX9B 4EI6A 1EBAA 2MQ3A 2FECI 3OL2A 3GK8H 4HS6B 3QO1A 1NGYB 5TFSH 3P73B 4UUJB 4KUCF 1TJGH 5D6CA 5FYJL 1WWCA 5E2WH 3M1BA 1FJ1B 5EPMA 4DUWA 4LGPB 4JFDB 2FSEB 4DGIL 1LD9A 4HGWA 5F8QC 5C6TL 2W92A 2QADC 3TA3D 1NGZB 5DMIH 4M4RA 2X7LA 5JHLH 1NC2A 2XWJA 5HJ3A 2F5BL 5J9PB 3GMNB 1FZMA 3UTTE 1MHPH 5KS9A 1ZVHA 5JW5A 4BM7A 3MRIA 4PGZA 2VL5A 5EU6D 3ULVF 3LCYA 5IG7A 4Z8FH 5IBLD 4H8WC 7FABL 3VXNB 2LU7A 1NDMB 3MV9B 5FEBA 4ERSH 1A02N 2R0KH 5FUOH 4RQQB 1WGOA 1UB5A 1BMGA 3ARSA 4JRYB 4TRPH 2K7PA 3VRIA 4P5TB 2ZUUA 4YFLF 3WLBA 1GCFA 3TGXA 4NZUL 3ARFC 2BXZA 1OAKH 1MRDL 4IOFC 1LDPH 1RHHA 4IDJH 3LKNB 4EI5C 2KUTA 4O00A 4HUXB 5ADOH 1JGDA 1QSFA 4P4RA 4ODBD 1C5DB 3RVWD 5JA9A 3X13A 4O2EB 2P5ED 3B3IA 5FYKL 1IT9L 1B88A 1J05B 1IAKB 4NM8H 3P9WB 4JVPA 4OCYH 1OTTD 3QEUB 1CFVL 1JK8A 1FFNA 2AABH 5CBEA 1L7IH 1OM3H 3TJHD 5HY9B 5H37H 3D1MC 1QRNE 2HFTA 4HFWB 1DE4B 1KNOB 4YDIL 3ZSTA 1JYVA 5EG6C 5F9WB 3KPRE 3MRKA 4X6EB 5L2KA 3UX9B 2Y5TB 3QFDA 5LGKA 5IMKA 3FB5B 4J6RL 3KYNA 3PGDA 3P9LA 3RX7A 5LWYL 3GJFH 5DK0B 1P1ZA 1R3LB 1I3GL 2QSTA 1HH6B 4XP6L 5F8RC 1BOGB 1D9KC 4DK3A 2AAVA 4OAWB 2HFEB 1G9MC 2ADJB 2QTEA 3CCHB 3HG1B 3TT3L 1RK1B 3NA9L 1AGFA 5CCKL 3MNWB 3O2WL 3H3PH 4D2NA 2B39A 1H3PL 4HIJB 4XVTH 5B3JE 1KCRH 3QI9C 3ZT7A 1S5IH 3GJEA 2CR6A 4NKIH 2Z4QB 3GI8H 1UB6B 3LS4L 3QUYB 2AK4D 2JIXD 2VYRE 4M61A 5TH2A 4EUPH 5B3NA 3L3KA 3WN5C 4MJ5B 4PJ8C 1JIBA 5DD5H 3NFPB 5FK9B 4KRPD 5C09D 2FGWL 3ULUH 5C0BA 4GMSL 2XA8L 4JFQB 1Q94B 4L9DA 3G08B 2DJSA 2WM0A 5DRWB 3VD3A 4W4OA 4I3RL 4R3SA 4NP4L 1TTFA 3T65A 4HWBL 4LOUC 4XMKL 4PRHB 3WNNA 4LP5A 3RGVD 1EIBA 2RFXB 1ZK9A 3C60A 2GI7A 1NGWA 4HQQL 4OZ4A 3NN8B 2DI8A 1MH5B 1MFEL 2W9LA 5D7LA 3C6LC 3S4SA 1KN2L 3LEYL 5F3BB 3DXAA 4LBEB 2OZ4H 4WV1C 3SOBL 5DO2C 4CJ1A 2DLHA 2IANE 1LP9E 3F12B 5JNYB 1UENA 1L0YA 2C9AA 1Q0YL 2X9XA 2AK4B 2JIXB 1C5BH 3RUGE 5HI5C 1FFNB 1DTUA 3EZJB 4W4NA 4GUPA 2ZZUT 4XZUB 2O5XL 4PJDF 3L3JA 5FA4B 4NN6B 3QUXD 1WLHA 5FO8A 1S7VA 2IPKA 3E2HB 1U0QA 2R9HC 1EVTC 3CXHJ 4P3CH 4WY7L 3UPRA 3BH8B 4NKDA 2NCMA 1LO4L 2AK1H 3HS0B 4FTVD 5EUOF 3C08L 5JW4M 1VCAA 1WV7T 1RZFL 1AD0A 2YWZA 3VXTB 4WWID 4PRHE 5ACZA 4N8VA 2R4SL 2NW2B 4LCUB 3RVVC 3GGWB 3LKQB 1SYVB 4NC1E 2PYFA 5BJTB 1BF2A 2EYRA 1QO3B 2DQJL 5ELIA 4FTVA 5HYSA 5E1AB 1SEBB 2B2XL 1UADC 1NCTA 4KUCD 3RVXC 2WBWB 4K2UL 3RFZC 2D2OA 3CMOH 1VA9A 5EO1B 4EXKA 2DBLL 3RGVC 2ZOKA 1M7DB 3HI5H 3FB7B 3VG9C 2AEQH 4MNQA 3FCTB 1SBBA 2ZWLT 2Q7YB 2GW5A 4DEPC 1G0XA 2WANA 1YJDL 3JWNC 1QO3A 1I7TB 3L5WB 5KZCD 1KJMB 1NFIA 4JGUA 5BV7C 2JB5L 3SE8H 1L6ZA 3CMGA 1TZIB 3B2UC 2IBBA 4UILH 5HHNB 1RV6X 1KIQA 4JG0L 4YPGA 4WUUE 3LN9A 1CFSB 3RL1B 3U9UA 3MCLL 5I1AA 5J57B 5CEZH 3PDOB 2D7TL 3QEQD 1B2WL 3D0LB 3FQRA 1G7IB 2VDNH 3BH9B 4JO3L 3AS0A 1A3QA 2J88H 1U2HA 2IPTL 4ORGB 4BQCA 4JAMB 4AQOA 4WNQB 5B4MD 1FL5B 5ESQB 1INQB 5DZOA 3SY0A 3QA3B 4LCYA 4OLVL 4O02L 3H9SE 4K3GA 1MAML 3HKFA 3QWRA 1OD7A 3O6FC 1D5BB 3MJ6A 4N8CH 1IKFL 3WIHH 2JELH 1CD1A 3AROA 5BZDA 4K94H 1A1OB 1SVCP 4GAJL 3QEQB 2WWKT 3T0XA 4N1EA 4LRIC 3O2DL 2A0LD 1UFUA 4M5YL 3WJJC 3CDGA 4X6BB 1G0DA 3R06A 3PG2A 1UWGL 1IEBA 2GSGA 3UZQA 2FO4A 5JPNA 3VXSA 1G7JB 1GHFH 4U49A 3GMOA 5DF0A 2VWEE 3V0AC 5T3XL 5HYSB 2GEEA 1RIVL 4PGDB 3EO9L 5EOCL 3DX7B 4UTAL 4MQSB 1FC2D 2GSIA 5JHDD 2XG4A 1TVHA 2VDPH 3WO3B 1JL8A 1TENA 2QR0A 3I85A 4DTGL 3GMLA 1AXTH 2XWTA 4HC1H 4HKZB 3ULSA 2ITCB 5FM4A 3LS5H 1MI5E 2PTUA 4NO3A 3RDTA 1RZIA 4N5UA 3UO1L 4HULB 4LSRL 5HYSG 1BFVL 5J3HC 2P5WA 2G75A 1MFCL 4JANB 4MMXC 2XZQH 1N26A 3VJ6A 4LCWD 3IJYB 5D7IA 1I9IL 4U0RB 2FECL 4FTVB 1MIEL 1I9JL 1OHQA 1EAPB 4MNGB 2WK2A 4M7ZB 3ILPB 4NO5A 2X4NA 4R7NB 1IKNA 2R1XA 5DJAA 5ADPL 1G6RH 4KKAC 3ZZ1A 1D6VH 4KJWD 1CS6A 3QIBD 2A83B 3ZYIA 1JZ3A 2NYYD 1Q9WA 4G43A 4WRLA 4HBCH 4QWWD 2EDOA 1K2DB 2ZOLB 4NQDB 3OWEA 3HNTH 3HC0B 3CGTA 3LQAH 3GRWH 4ZSOA 1XGUA 3VXPB 1DBKL 1NAKH 4MNGA 4OB5H 4R3SB 5FV1L 3Q6FB 5TQ0L 1XF5A 5H2BB 4EI5A 5FM8A 1BLNB 1IM9D 4M6MH 4R9HA 5EZIL 4Y19B 4KVNL 1J86A 3LD8B 3MLZH 2AQ1A 3O3BA 3EDFA 2Y9RT 1N6QL 3BHBB 2GUOB 3OX8A 4U1LA 5CSBA 3CH1B 3EOYG 3GSOA 4PJIF 4DVBA 3DXAB 1E6JL 4MSWB 3V7AE 3QPXL 4PGCB 5ESVB 3H0TA 5JDSA 5AYUH 3MRDB 2FBOJ 4FRWA 5F88A 5IIEA 3RTQC 4IRSD 4KROB 2R15A 4YUEL 4YHLH 3N06B 4R0LB 3WFCH 4QHUB 2I24N 3STBA 4HV8A 2R0LH 3TO4B 4WU7B 3REWB 1KEMH 4E42B 2VLKA 4U1NA 3H9HB 5FF6A 4XP5H 5IFAH 2APWA 1KJ2L 5IMLA 3VW3H 1FSKC 4YBLB 1QLRA 1Z2KA 4NSKA 3EO9H 3WE6A 1YEKH 2EIZA 3DI3B 3CJJA 5FO7A 3OZ9H 1Q72L 4IMLA 1AGEA 3O3AA 1FFPB 1UXWB 3MA9L 2GJZA 3GSXA 1JWSA 4M3KB 4HC1L 1NCCH 4M6OH 3ULUF 1NDGB 4KVCH 4NWTH 3IDUA 4NFCA 4XC1L 4PJCE 5CJBA 5SX5K 2J2ZA 3FB6B 2EKSB 4IOIB 2JJSC 3MV7B 1JPTL 3UTPD 3HG1D 1TQBB 4N0FA 5JO5A 1AIFB 5DD3L 1AHWA 1MRCH 4UINH 2C4FT 5IP4A 3MBXH 3UBXG 5IQ9B 2R2HB 3M45A 4F80A 4PRNB 3NA4A 5FECA 4QCIA 2VOTA 2KKQA 5T1MA 1CK0H 3MRPB 4OTXL 4X6CB 4WEBL 3E6HB 5EZOH 2AJXH 3S37L 1MFBL 1R3JB 1NC2B 3KPLA 4PJ8B 5LWYH 2JTDA 3OHXB 4WCYH 4HDIB 4PJIB 4Y16B 2ITDB 3ESVF 4PP1C 3FO2B 5ADOL 4IS6B 4WI7A 3VH8A 5I8EA 4YJZL 4JQVC 4LCWE 1VSCA 1GAFH 1X4ZA 1E4WH 3G9VA 3DX6A 3BSZL 1F13A 1WBZB 3GBML 5T1DL 4LLMB 5ILTH 2HKFL 5ETUB 3WIFB 3FHQA 1VGKA 2EXWC 1KBGH 4NN5C 5D93C 3MCLH 1N4XL 3F7YA 4PJCB 4JKWA 1Q1JL 5H35A 2CJUL 3U0PB 2ESVA 4OIAA 4YHPB 5DJCA 4LSVL 4NQTA 4HX1B 4XBGA 3MX0A 4HXBH 1IC7H 5E5RB 3TN0C 5B38G 3U9PL 1MVFA 3MZGB 1LILA 4PJEF 3VU2A 2EIDA 3SBWA 5KS9E 2MCPH 1QSFB 2M2DA 3QIBB 2QSCH 3QCTH 3C5ZA 3C8HA 1QPXA 3E3QC 4HJ0D 5KSUB 4I0PA 3DOSA 3O45B 3RPIA 4WWKB 3BP5B 1AKJD 1N59B 2B4CL 2VB5A 3FT4A 3VFUB 5I1IL 2OZ4L 4LVNB 4X8JB 1IKNC 3QT2A 1FNGA 3EAKA 2LABA 4K3HA 4WFHE 5DHYB 3VGBA 1U8KA 3SDAC 2BNRD 1F4XL 4GO6B 4MMZC 1M05A 2YMXH 3LZFL 1O7VA 3TT1H 1A6TA 1IJ9A 3UTTB 5HGAA 1MCOH 1KJ3H 1RZJC 1AR1D 3QDMA 2WQ8A 3MCKA 4P46A 4U1HA 1P4IH 4FNLH 2DM7A 4P9HH 4X5LA 3QYCA 4ZUVA 1DLHA 1PBYA 5IW6B 5KVDH 3RQ3A 2M26A 2FL5A 3MV7D 3FO9A 4U3XA 1N5AB 3MV9E 4I18A 4WUUD 1YEIL 2ZUYA 1IGML 2OP4H 1CGSL 4KJPC 2NR6D 5KSBF 2UYLA 1YNTA 4XNXL 4NRYB 3HA0A 4NQEB 4ZQKA 3GMPB 4JFDA 4XVJH 1RZJH 2Q7NA 3GZKA 1EGJH 5TGBB 5DJ0A 4YAQB 2APXA 5E8NB 1OW0A 5C92A 3IF1B 3L3GB 3C08H 5EZOL 4ELKA 1OAZH 3E6HA 3SGEI 4JPVL 3B9DA 1BQHG 1LVEA 5INDA 4ZYKA 3DHMA 3ZYJA 1W0VB 4RBPH 4ZFGH 2VO5A 4U6VL 4ZFZA 5FYJH 2H8PA 2J1KA 4JDVB 4ZXBC 2GK0A 3PIQB 3QUZD 4NOFA 5LQBL 2Z4QA 2DI7A 2DI9A 4BELD 4JM2D 5IMOA 5C0GA 5D6DC 3QUKA 3DXAD 5INCA 1OLZA 4XPAL 1B9ZA 1SEQH 4P23B 3GRWL 1J87A 4JO4H 2F19H 5FYJE 4NDMB 4NCDA 2C3HA 5HHOA 3DETD 2R4RL 1JFQL 4U7SA 2VXVH 5EN2B 4G9FB 4G9DA 1RHFA 5I1KL 3Q5OA 4EBQH 3ALPA 4KTDL 2EIEA 4YBQC 3HC4H 4L8SB 4LCCB 2EYSA 4NC0B 1P4BH 3UZVB 1CLYH 3M07A 3QPQD 5FYLD 4J1UA 2L7UA 5F96L 4I4WA 3T0EB 4QHUA 5I18H 1IQDA 3DURB 2ICCA 5DT1H 4D9QE 3WIHL 3L7FA 1FRGL 5HBBA 5FB8A 3L3HB 1UJ3A 2UVFA 3FB5A 5J11B 1RUAL 1LDPL 1KIPA 4XNQB 3PP4H 4MNQE 1QLFB 1TETL 1F58L 5FYLL 2N7AA 1CD9B 3CDGB 1NGPH 4X6BA 1IEAA 4ZPTB 3H3KA 3RWFB 4DW2L 5I1GH 5FOBB 2NY7H 4WTZA 4CU8A 1UKSA 3OR6B 2V2WB 1I7ZA 4XNUH 1ED3B 1W2KT 4OFYD 3UYPA 5EIVA 3LRGA 3GIZL 3QXWA 2DJ4A 3LN5B 2V9QA 1Z5LA 3D18B 3TO4C 1Y6NR 1PKQA 1S9VA 5J7CC 3FRUB 4I18C 1RUQL 1QFWH 1J1PH 4APQC 4PJFF 1ZLWH 3JVGA 3F7VA 4IJ3B 3VRLF 3CDFA 3VA2C 5DUMH 2XY1A 2VXQL 4XH2B 4E41E 2EDNA 5FUCE 2QQQA 2A6IB 2H26A 1I9RH 3L3OA 4EN3A 4JO3H 1HHHB 3NOIA 3MJ9L 2D03L 3OKMB 1MLCB 1MIEH 4MHHI 5DGRA 5J12C 5JW3H 3L1OH 4E9LA 4YBQD 3ZE1E 3BW9A 3QHTC 1YMMA 1KEGL 1EJOH 4DKEH 1S7WB 4HS8L 2ICWB 1FZJB 4MNQB 5EU3A 2NY0D 5HTSA 3U1SL 4Q2ZA 1KT2A 8CGTA 3O9WA 3GMQA 5MEND 2MHAB 1CVSC 2QKIA 5I8OH 1TNMA 4Y4KA 4Y4HB 3WDJA 5DJDA 4IRSA 4EVNA 1I8IA 1S7WA 4QGYA 1WIOA 3R0MA 1VADB 4BA8A 3QUZB 5DQDL 3IDMB 1LQSR 2V7NB 4X4XA 5MI0C 1T03L 3NZ8B 2VDNL 3RZCB 3SKOB 4PJBB 4PRIB 2P8LB 3DO7A 3GSQA 3SDXB 1FE8L 3S35H 2ED7A 1OAQL 3WIIH 4Z77A 3DTXA 2BVEA 2QKIB 2W91A 1AO7A 3IAGC 1TMCB 4OF5A 5EZLA 3B2VL 1S7VB 1I7TA 1JF5A 2A6KB 5CJ5A 1HCFX 3AM8A 3LPWA 4ODSH 4XPHL 3RVWC 2HH0L 4OM0H 4PBXA 1RZ7L 3JZ7A 1D5ZB 5F1OB 5I1AB 2VAAB 3SDXA 2AV1A 5J56B 2DQIH 3HHRB 3NH7H 3BRGC 4O9HH 4N8VB 1IEAB 3QIUC 3DO3A 2P48B 1GGCH 5IT2L 2Q8AH 5DZNA 3GHEH 4NPYB 5DHXB 1OAYH 2C1OB 1KXVC 5JIIA 1EEYB 3EJZD 4RRPG 4LVNC 1SJHA 3BGFB 1DVFC 4FG6C 1ZVSA 2DWDB 3LKPA 4JFDD 5F1NB 2VLRB 4F9LC 2D7PA 5DMKB 3FRUA 4HIXH 3HE6B 3S88L 1ZLSL 4KGLA 3SCMD 4U1KA 4XX1E 5DDHB 1ZGLA 4PJ9C 1E4KA 3QH3A 1R5VA 1T7ZA 2DIAA 1QNZL 4ZO8A 1XGYL 2WIIB 5DJXA 1D9KD 3FHAA 1GZPB 2N56A 4H1LH 1NBYA 5GGUB 3VXMD 1I1AA 1MHEA 4D9QD 2FATH 4GRWH 5JIPA 2GJJA 4CADA 1MFBH 4XAKE 3W0WA 1QRNA 1JUFB 3K46A 1MCCA 5E5MB 3MRJA 2X4OA 3QZWG 4KU1A 3WNOA 4ZOAA 3OHXA 4N0UA 4HFUH 2Z35B 1K8DA 3KPMA 3SDYL 4JN2A 4UOJA 4MQ7B 3QCUL 1HHIB 4WO4A 1II4E 4U1IB 1XGPA 5HDOA 2VKWA 4JO4L 5KG9A 1Q0XH 5FDWA 3WSQH 1HINH 5JXAL 3V9FA 3EGSB 3WEXB 4LHUA 1CDJA 3QIWA 1XCQA 2ADGB 2VL4A 2ARWA 3SKMB 3MXVH 1EX0A 5I1LB 1RZGA 2GJ6E 5MP6L 4MCYB 3EJZC 1NDGA 3UTTD 5D1ZB 2GT9A 1UQSB 3MV11 1XCQB 1DSFL 5CD3A 3L7FB 3FT3A 4P4KA 4RFOL 4LNRB 1QBML 3VFVB 1AQDA 2R2EB 1RVFL 3EGSA 1K4DA 4NQXB 2BNQD 2FWOA 1S7TA 4DOHE 4HPOH 4X80H 4L8CB 1F3JA 2XN9D 1MEXH 4YUEH 1P7QD 1D6EB 1QQDB 4PD4K 4XPFH 1JF6A 4PJHA 1QD0A 1RZGB 4JY5L 5C0RH 5KVFH 4NRXA 4K9EL 4M1DH 4N90D 1GGIL 3O3DA 5DR5H 5BO1L 3EYFB 1LO3L 2XPGB 4PJDB 1OGTA 3GKWH 3S36X 4WWKC 3TFKD 5HI5D 4LLDB 5GZND 4Y4KC 1GGBL 2BCKB 2NY6B 5IMKB 1CXEA 2PUQT 5KJRL 1EEYA 3GSOB 3QUXC 4NQXA 2HT4D 5BS0A 3BMVA 4XMPH 2BHZA 3OKOA 3QEHA 2VLLB 2NY5L 1TLKA 4NO0A 5F1NA 4HZLB 1KB5B 1NSNH 4NO5B 2ZPKL 3BEWA 1DQMH 3IJHA 3CFEB 4KMLB 4KK5D 5GGRB 3VD4A 4LLWB 2FL5B 1ZLUK 2M8XA 4Y16C 2XIDA 4BZ1H 1P84K 1KIRB 5B8CC 5CBEB 4PLJD 3V0WH 5C7XL 2VC2L 1QA9B 3VG0H 3SGKC 5KTEL 4NQEA 1RZJL 4UBDD 3D69B 2CUHA 3ZHDA 4NQDA 2BZDA 2Q1EA 3VFGH 2HWZH 1DVFB 3B9EA 1AC6A 2GIYA 4LPWA 3ZKQD 1RULH 3U82B 2APTA 2FATL 4QYOB 4HK0A 1PD6A 3GMRB 4Q7DA 1JZ4A 4NKMB 5C0CB 2DKSA 3MV8E 3MLPA 1C1EL 5DTFA 4U1MA 3OAZH 4HFUL 4WFEE 1MI5D 1N0LA 4E0RA 5HD8D 3R4DA 1LEKA 1I3VA 2AJYH 12E8L 5I8OL 2H3NA 4UQ3B 2IQ9H 3SEPA 5JZ7C 2AGJL 4ZAKD 4OCWL 4XTRC 2RJMA 1HCVA 4FQLL 1MHHA 2FEEI 4G8FA 3PQYD 5FGBC 4AK1A 1WK0A 5TJWK 2ZCHH 3ORJA 4WWKD 5T1KA 2PXYB 1ADQL 1FE8H 3DTXB 5DEFB 1CL7I 4UNTA 4WFFE 3Q1SH 2XQYK 4D94A 1F42A 1H3VA 4R96A 1NFDF 1OPGL 3JTSB 5IBTL 4J4PC 5MI0B 2A6KA 3QQ9D 3G6JA 3MV9A 4OGAD 1MNUL 2NZ9C 5J1SC 5EO9B 4BZ2L 4WWKA 5CP3H 5EWIH 3QQ4A 1F3RB 2V17H 1T22A 1U95A 3N9GL 3F8UB 5C0CE 3RKPA 4BFIA 1T0MB 4DVRL 1JPFA 1NUNB 1WAAA 4Z0BL 1XF4A 2VNCA 3CSYB 1A47A 4U0RC 3L7EA 3I75A 3U0TB 5J9PA 2DQIL 2YD6A 4HCRH 1S78C 4HGMA 3FN9A 1CICC 4ZG1A 3MRCB 1HXYB 5ECJE 4ALAL 4WW2F 3ZE1F 3HZMB 3K80A 4TSAH 5C6TH 3IFNH 3VGDA 1FNLA 1BQLH 1S7QB 1CBVL 4C56D 4EUPG 4HV8B 2X1QA 3S7GA 4HWZA 4MGXA 1RUAH 4C4KT 1R3KA 2YD9A 2VLLA 3OKNA 1CL7H 5ALBL 4HS6A 3WBDA 5CSZA 4YXKL 3PABA 5TDPA 3BVNB 5FHBL 4X99B 3ZHKA 2LTQB 4JFED 4QXGH 4Z0XA 2DTSA 3O3AB 1NUDA 5BS0D 3UTOA 3M1BB 3NACH 4Y2DC 4NWTL 3WFHB 2P44B 1KXTB 5JW4Q 5T1KD 1LD9B 1LO4H 2AK1L 4K8RC 1UCTA 3I02A 1JPTH 4W6XB 2A6IA 3AXLB 2CRYA 3NIGE 5E8OA 2X05A 4WO4D 4CJ0A 4J3TA 2VLJB 1FLRL 1P4BL 1SJEA 3QQ9C 4JFQA 3V6ZB 5E8EA 3UTSD 2WQRA 3P4MA 3UTSB 2HFFB 1E0OB 4X6DA 4M6NH 4M7ZC 1M7XA 2EE3A 2I26N 4WEBH 3AMKA 4HXAH 3NIGF 4M7LT 3HR5A 1U93B 2EE6A 1GH7A 4JGJA 5BOZG 3JTTA 1KCLA 3VDAA 1NGXB 4PG9A 4NQCA 1H3PH 2XI9A 2APVA 1HH9A 5GS1C 1TETH 2XN9B 3SJVE 2VXVL 3SCMA 1ERNA 2Y23A 5MP6H 5KSVA 5SWSB 3VXRB 1J88A 2IAND 4NWUH 1UCBH 1FC1A 3EZ8A 5DJYB 5J6GB 3IFLL 3FAWA 3H8NA 5ENWB 3LVEA 4XZUA 5KBNC 5JXEC 4GMSH 4X98B 5D96C 1P1ZB 3PL6A 4WTZG 1GZQB 1FHGA 4Z7UF 2YHGA 1I1FB 1PLGH 2L4OA 3TBVB 3FQNB 5I17A 2Q86A 3GMMA 2VISB 1SMOA 4G8GB 5FOJA 2BXYA 3HRPA 1YNTB 1KXQE 3DJ9A 4P5MB 3HC3H 3SGJA 3S36L 4QY8A 1V8HA 1MAMH 3DV4A 3VMOA 4PRPE 1VKXB 4HS3A 1RJYB 2FDBP 4DFIA 5C3TA 1LO0L 3D39B 4I5BA 1PQZB 4G8GA 3WJJA 3SDCB 3CVIL 3KJ4C 2OM5A 1FNEA 2YZ1A 2ZNWA 4DN3H 3S3JA 2W1NA 4IOFD 4M7LH 5ICXB 1M05B 2AEIT 4OT1L 3U83A 5IKCB 2O26U 3JWOH 3NBNA 5IT2H 1DL7H 3T2NH 4KAQL 3HE6A 4FQIL 1UWEH 4UTAH 3TVMD 2P47B 1A8JH 4M7JL 3DX7A 5IHZB 1HH6A 3ILPA 3NTCH 3WS3A 4TVPE 1RURH 4ZNEE 4ZAKB 4M7KH 3K4AA 3W39A 2B5IC 1TJIH 2GCYB 3QIUA 5DVOA 3QIWD 4JKMA 1MCPL 3VDBA 3C2AH 3D5OF 1DUZA 1CT8A 1R6VA 3UO1H 1BVLB 1P2CA 4MCZB 4G7YH 5CEZL 5DJXB 3ZLQC 7CGTA 5GGSY 4PG2C 1BHGA 3BIKB 4UTBL 3ZT6A 1BGXH 2MPAL 5AZ2L 4RA3A 3SDDD 5DJDB 1R5WB 4K7PY 5D5ME 1BIHA 4Y2OA 1ORSA 5ISZD 1O0VA 1A14L 1QRND 4X6DF 3JV6B 3PHSA 5FM5M 5GGVH 3V5DA 4NNPH 2X7LB 4RFEB 5D7SH 1B0GA 4PRID 3RA7L 4R26H 4ZOEA 2QBWA 3FONB 4B50A 1PVHA 2YPVL 3T0DA 2Z0BA 4ZUWB 32C2B 1CE6A 2LVEA 3TESA 2R1WA 2VN4A 3PGFL 5SWQA 1OAQH 5EZLB 3QBTB 3CLFL 1KT2B 2B7DT 3N1PC 4QXUL 4UILL 3DGCR 1RZFH 5I8KL 4H1LB 4K23L 1KTRL 1RIVH 1XMWA 2XKUA 3D0LA 1AI1L 2PW1B 4PV9B 4Y4KB 4Y4HA 3MLUL 1MY5A 4LSPH 3KS0H 4QGTA 4WW2C 1KB5L 1M7DA 3MGTB 2XY2A 3BUYB 4JFZL 3OMZA 3SY0B 5D1ZC 4UOW0 3ZDXE 4B0MM 4S10A 2VAAA 1BQUA 3C5JB 1T1YB 1QSEA 5E94B 3LKSA 5F6IC 1G1CA 6CGTA 4PV9A 3BUTA 2GQHA 4P4KD 4QT5A 4C83B 2UY7A 3KLDA 3DMMA 4DGYL 4KY1L 2YXFA 2BVUA 1MPAL 1XIWD 2XTJC 5HGBA 4H1LG 3FB7A 1HOCA 2CKBB 1JGVL 5AD0A 4UT9L 5IMMA 4DN4L 5CKGA 1CT8B 1AO7B 3EOBB 3QSKB 3HAEG 4XNQA 1RMFL 1T04B 3QRGL 1S7UA 4P23C 1AKJA 5E9DE 4KJPD 2GY7B 1TZIA 3TH3T 1UWEL 2YD2A 2FR4A 3QP3A 3OR6A 4L4TA 5D7JB 3CFJA 1JZ2A 1NFKA 4LHJB 3GIZH 1I1RA 5CEXA 4YXLH 1KENL 1TJIL 3BQUC 3NCJL 3MXVL 5ESAB 3AREB 5C07A 2YD3A 5E1AA 4K3JL 4WHYG 1NL0H 2C4XA 3JUZA 5E6YA 5JOPD 3MYJB 3OJDA 1U8MA 2PTVA 4F7MB 2CIIA 5BRZD 3ZKSD 1BJ8A 3DX6B 3IDYB 2H45A 1BEYH 1VDGA 2NMSA 3CZFB 4ZNEA 1ETZA 5DUPL 3MBXL 3VD5A 1RVFH 3MRMA 2OTUA 4KVNH 1HDMA 2E9JA 4JHWH 3SKNA 1SBSL 4AM0A 2BNQB 4I0CC 4CU6A 1JZ7A 2XN9A 1XF1A 6FABL 2NX5E 5IM7A 4UMGA 2VR4A 3HUJB 5KVEH 5D2NE 1F11A 3ISWA 3FTGB 1YYMH 4NC1C 4ETQB 5CWSB 4RAVB 3REWA 2QQKH 4LAJH 3VFRB 1U8NA 1KJ2B 3D6GA 4RGMB 4NYLB 3WUWA 1IAII 3ROLB 4MJ2A 4EI5B 5EOCJ 1ZWIA 1JTPA 4L9LB 5L8JB 5DQJA 3KYOA 3W0WE 3KPPB 3RUGF 5IQ7H 3TYFB 3CXDL 5ICYA 2OJZH 2KDGA 3ARDB 2Y36H 1IM9B 3H2WA 3GSRB 5TDOB 4GFTB 4LSTH 3O4LA 5MEQA 1CYGA 4GAGH 4MAYA 4PBVC 1HILB 5E03A 4HPYL 1A3RH 5HHVL 1MH5A 1WEJL 5SWZB 4MCYA 2PKDA 1LO0H 4K3EH 2YSSB 4R97B 2NX5D 4PRDA 3BQUB 2IQAA 4M4PA 2Z93B 3NIFE 3FFCB 2UYLB 5KN5A 4JFYA 4U1GC 2CLZA 4LCWA 3MO1A 1EUTA 1EVUA 3TV3L 4PJAB 4H20L 4YHIA 2ESVD 3Q5YA 4V2BA 3VH8G 4EJ1C 4PV8B 1LE5B 2OTPA 2DQHL 4MLSA 3J8F7 2YUVA 4L5FH 4X6FA 4U6HA 1T5XB 4OUUA 1HKFA 3MRJB 5FYKH 1A3LH 1EEUA 1TJHL 1IC4L 1JWUB 2Z9TA 4MXWL 4OCYL 2KZWA 1WZKA 1EO5A 1H5BC 4JFPA 5DTFB 4JFHE 3PWNA 1LEIA 1A7RH 1KN4L 3PNWB 3QRFM 4KZEH 5E9DD 2YN3A 4Q58C 4XVJL 3ILQC 2DTMH 4WI3A 1LNUA 1EFXB 4QOKD 2IFFL 5KSBB 1JN6B 1T0MA 3SGEH 3AS2A 5E8OB 3B9VA 3V0VA 2HFFA 5F7DB 5DO2D 2CDEB 2E6PA 1EHXA 4C58B 4TSCL 4DGIH 3U30B 1B6UA 4MXQD 4OGXH 4QF1B 1MRDH 5E5MA 1MJ7L 4EN3D 1CXKA 4PJAE 4S2SA 1HSAA 2DQFA 2OJEA 2NY2C 1F8TL 5GGTH 1KCUL 1X44A 2OR9L 5E5UB 1K6QH 2OCFD 1H8SA 3QDHA 3EYVA 3QDJE 4LHQB 3KHOA 1FIGL 4X8XA 2XOTA 1RSFA 1NGQL 4BSJA 2LQRA 1T89A 2Y5EA 1C5CL 1G9NH 4XMLH 1B2WH 5KS9B 1MAJA 3MCKB 2NYYC 2NY0B 4UQ3A 4BKLB 5T5FH 3O4LE 3EYVB 1PZUB 4HDIA 4ZTPL 5TE6H 2ZJSL 3MNZB 2LVCA 1I4FB 4ISVB 5E4EC 5EBGA 5CZVL 1INEL 2DBJA 2HT3D 2YPKA 2UZIH 1N59A 1WC7A 4FA8A 5JDJA 1DQLL 2MKWA 3K7UA 4ALAH 3WN5A 1OSZB 4FQCH 3K8MA 4LASL 4QHMA 1D5XA 4NFDA 3VFTB 2YA2A 1JPGA 5JR1L 4HK0B 1A7OL 3SKUD 1MOEA 4PLKD 2XT1B 3BKYL 1CGYA 3C09B 4I0PD 1M7IB 1V05A 3OAZK 4YWGL 4QRRB 1I8LA 4U6XB 4XVSL 4ZUUB 1JPSL 3VFNB 2XWJB 1PQZA 5IB5A 2CSPA 2X1XR 2APBA 4MXQC 4P2QD 2BDNL 3JBG7 4JRXB 4PJ7B 5DSCB 4JO1L 5IEHA 2PTTA 2W07A 2H9GB 2ZPKH 4U1JA 1YMMB 1G0YR 4NFBA 4TUKL 4Q74A 1HI6A 1T21B 3RY6C 5HYJA 4DWHA 1VFUA 3BEWB 1CQYA 4Y16A 3HZKB 4OZGB 1MHHB 3FQUB 5LGHL 2OTWA 3MRQA 4P2QA 4LPCA 3KYAA 4FP8L 2DM2A 4QTHB 3DBXA 1WBYA 2F54D 2FIKB 1EFXA 4JY6B 1KFAL 4J8RA 4I3RH 5EOTA 3TP4A 3KR3L 3S34H 1C1EH 4LVOB 3B8SA 4LSUL 3F6IA 3EJJX 3T0BA 2HT2D 1MCQA 1GC1L 3FFDA 4ZFGL 3GKZA 2NXYC 1EJ6A 3BX7C 2BVTA 4NM4H 4YHYB 1KV3A 1I1AD 3MROA 5MEOA 5CEZE 3RL2B 5C08D 3HNTL 2V9TA 3SDCA 3OAUL 3UTZA 1XF2A 4X4MA 1QLFA 4PJ7E 1ZWIB 4L9LA 3TF7C 3I3EA 4K8RH 3IGAA 3P4LA 3OAYH 3IFLH 4X98A 3HR5B 1UM6H 4QKXB 4M6ML 3KPNB 1ZV5A 3H9SD 4JKLA 4UAOC 2XKNB 2BSSA 1KTDA 5J3HD 4NP4H 5I17B 5ITBH 5J0BA 4PJIE 4OQTH 2WUBL 3DVNA 2EXWD 1WWAX 3JXAA 5HHOD 3BZEA 3QWOB 2YA1A 5AYUL 3G08A 1YC8A 4OUOA 1XR9B 3FFCA 5D1QC 5FYKU 3E0GA 5C0AA 4YC2B 2GYSA 2BSSB 4DZ8B 1EHNA 4NN6C 1GXEA 3O0RH 4QHLA 4DGYH 3MLRL 2NY6C 3ARBC 4D0CA 4X4YA 3PV6A 5K59E 4NQED 2QQLL 4PJAA 3OG4B 1Z9SA 2AW2A 4NZDA 4LQFL 5D7LB 3BGMB 4X7EC 3EOBA 4PJXA 2X40A 3RDTC 1P4LA 4D3CH 4PJ9A 3UZEA 2PCPB 5SWSE 3TBVA 1XR9A 4NIKB 4PR5A 4R6UA 3QUMH 5E2TL 1WZ1L 4HT1L 1N0XL 1CD1B 2VLJA 4PLJC 1QACA 4KI5E 5CJXA 1X5KA 4R7DA 5HHQA 5I8CA 1MCHA 4O4YL 3ZKNC 5CIPB 2DYPB 1HHKA 4X6DB 3MRLB 4F33B 2A6DA 1T1XA 3NABH 1FL3A 3NFSH 3UJTL 3X13B 4FFWD 2YXMA 1FNFA 1EAPA 1BAFL 1BBJB 3VCLA 2J4WL 3KXFD 4I9WE 4TOYH 1CGUA 1TQBC 5K33A 4JE4B 4P23A 2R1XB 5JA8B 1K3ZA 5T5NF 5FGCB 3MLUH 1GOFA 3UYRL 2G5BA 1Z0NA 3VWJB 1EEZB 3UDWA 4LSUH 1U8MB 1KNOA 4W68A 2O61A 5CJOL 2C3WA 4I77H 1J10A 1BJ1J 4XTRD 1BEYL 2ED8A 4H26A 1A9EA 1G6RB 4TSBH 1YECH 5KVEL 1K4CA 3C6SA 4G6JL 1YJDC 3HUJA 1MCSA 3O2VL 1KIUA 3GIVB 1K6QL 2NY6D 5I16A 5CZXC 2HKFH 5CGTA 4PTUB 5GS2D 2R1WB 1V7NL 3JV4B 4ODHL 2H2PC 1VADA 2XACC 4YXHH 3SE8L 3MGOA 1AGCB 2Q7YA 2FO4B 3MNZA 5I71C 4X4XB 2DICA 1RZ8A 3QHZL 5GSVB 4PY7B 4HW6A 3NVQA 4OV6F 4PJGE 2BHUA 1M71B 5I6XB 3CPLB 5DJCB 1YJDH 3KPQA 1GIGL 5TDNB 3NAAL 3QFJD 4WIQA 1ZE3C 1KENH 4KC3B 4JQXC 4J12A 3U9UB 3WFZA 2UWEB 2A74B 4GBXD 3RRQA 4OM1L 5JQ6L 1ZLSH 5C09E 5IMMB 3AS1A 3RIAF 4MA7H 4FQCL 2X1OA 2ATPB 5C2BL 1PG7X 2ICWA 2JCCE 3BPLB 4ODSL 4NC2B 5BQ7A 3GBNL 3GSWB 1FFQA 2J6EH 5AWNH 5BV7H 4GS7C 3VXQB 3V6FB 4H1LA 2FJFB 2HTKC 1UXWA 2QLVB 3WS3B 3NZ8A 3P11L 4TNVF 4LU5L 4ODUB 4ZUSA 1R0AL 3V4VL 4FHBD 3R8BB 5I1CH 3EO0A 4YDLB 2XZAL 1P5VA 2E8ZA 4FS0A 1DUYB 1YEDB 1OAXH 2E6JA 1T0PB 3KLAB 4X5WA 5HYJD 1A21A 3TO4A 1A64A 5E8DH 1HHKB 2D7OA 5CZXD 3AU1A 3BDXA 3V5DB 3U46B 2H32H 2DLFH 4ODWB 4FQIH 3QO1B 5IWLA 5EU3B 3HNVL 4ORZC 1GRWA 3MRBB 1SEBA 4IRZH 1UH2A 1QLEH 2DQGH 1M6OA 2VXUH 3KYKH 3BWAA 1S9YA 2BNUA 3UYRH 5HHPA 2F58L 5B21A 4I2XE 2FBJL 2I27N 4JKKA 2I60H 1GC1H 4UAOB 5DJZA 3DV6B 5T3ZE 1U8IB 5C07E 2DQEL 4NRZA 2HTLD 4GG6E 3HLAA 2PR4H 3LEVH 4OGXL 5K9OA 2HP4A 3O2VH 4P5KA 1UZ8A 2NY3B 3KHQA 4UTBH 5MHSE 4K3EL 1PG7H 2JJSA 5IB2A 5SX4H 4L4TE 3D0VA 1I75A 1H3TA 3KLSA 4PJHB 3FL7A 2Y72A 3O8XD 5M94B 2XWBA 4XHJD 4KRPB 4XT1C 5JHDA 1F4HA 2Q6WB 2NPLX 5IOPB 5TPWH 1LK2A 5BOPA 1D6VL 1KC5H 1OGAB 5IB2B 1MCBA 4XXDB 1CF8H 3INUL 5I1KH 5JXED 4OCRL 2X5PA 3KPSB 4JM2B 3MUGA 4NNXA 3MLZL 1WAAE 3CFDB 4JN1H 1CGTA 4HWEH 1FCGA 1SJVA 1BWWA 1J1XL 3MRHB 4X9IA 1FFOA 1NBYB 1F3DJ 4PGBA 4OKVA 4RA0C 5D5MF 3DIFB 5BMFH 3T09A 4M1CC 1QBMH 3JWOC 4KKBC 5HDBE 1ZHBA 2DQCL 3RZCD 2VUYA 4Z7VE 1HE7A 1MFCH 2YBRB 1UT9A 5CSZB 1AFVL 4M62L 3UBXI 1JK8B 4HWNA 4AIXA 1OW0C 4M8VA 4UDTB 5F6HJ 4PJ9B 1JGEB 1MRFL 1AQKL 5I2IA 1INEH 4JHZA 2VQUA 1YN6A 4PJHE 4UQ2A 1QFOA 5EUKA 4NHUB 5DYOB 4HFWA 3Q48A 1F90H 5A1AA 2UUDH 3VXME 1RD6A 3TCLA 4LASH 3V8OA 3ARDC 5L2KB 1AJ7L 1DQDL 1KB9J 4RGND 4B53A 4JO1H 1BZ9A 4Y89A 3ZE0E 2Q87A 3KPSE 3RWGB 1WCQA 4IBLT 5E00B 1OP3K 4NUJA 3U4EA 4M3JA 5DK0A 4U1JB 4WDIB 2R0WH 4LPYA 3MJ7B 1NAKL 2VZ3A 4MDJB 3AAZB 5D2LA 3S3SA 1JF1B 2GTWB 1IGJB 1JTOA 2X4SB 4QOKA 3S5LG 1EV2E 3QAZB 3MNWA 5SWZE 3PIQA 2I60L 3KG5A 4P4RB 5CUSL 2ADJA 5JW5B 2VDKH 3WUWG 1EK3A 4HHAB 4ZQKB 3U1SH 4TQEL 5B38A 3G6JF 4M6NL 1NBZB 3SKNB 1CR9L 5GS0C 3ULVH 4WI4A 4XP1H 1I8IB 3X11A 2OXHA 4DGVH 3I6GB 3S98A 1G7LB 2VLRE 1UH4A 5JHLL 1MF2L 1H8NA 4QRPD 3P9MB 3TZVD 3IFNL 5D7IF 3RX8A 3OG6B 4KJYB 4XCEB 5TE7L 4Z95H 5ILTL 1HK6A 1VGKB 2RR3A 1JHLH 3U7YL 3U9PH 1A6PA 1CVRA 3L5XL 3ARUA 3HE7A 3TPUB 5DLML 1T1ZA 3DGGA 4JHAH 5E2VL 5KSUA 1OF2A 4HXBL 1X3DA 5C9JB 3ARBA 3GUTA 5K9KA 2XRAH 1A9BA 3W9EA 5A3IC 1TJGL 1SM3L 4XCFH 3RWDA 1ZHNA 4OCXH 4ZDHB 4HUWA 3JSSA 3O45A 3RPIB 5ANMB 3QDJA 4KRNA 5I1CL 5K9QI 4P23D 4MLIA 1Z5LB 4XRCA 3ZT5A 5DRXB 4OCWH 5F70A 3BWUC 3M8OL 5T3ZH 5ERWB 3TPUA 4B41A 3O6LH 1HYSD 5T1KB 2BSED 1M1SA 5CZKA 5E2WL 5I19H 5EO0A 2XXCB 4D9LL 4LNVA 5HI3C 1SY6L 1KOAA 1KLUA 2FHBA 4MNHA 4BSVA 3CFIC 3NFSL 2FEDC 4YDLC 1S9WB 5B8CA 4JR9H 2DD8H 3L5HA 1S7SB 2CMRH 3DVFA 4OSUH 1MNUH 4YFLI 3VXSD 3QI9B 2HFGH 4HK3J 1G7LA 3SKJH 2DYPA 1QLRB 1JNLL 4Y5XA 4S2SB 3LN5A 2ZUWA 4M9OA 3AUVA 4KK5C 3IU4L 3ZYOA 3DVNB 2WUBH 2VXQH 2DTML 5EBWA 3F12A 2XA8H 4LPXA 4GKOA 1A9EB 2DN7A 5DJ6A 3ZKXB 4WI5A 4TSCH 5FHAL 2MSPA 4F9PC 1AXSA 3EYOA 4N9GB 3S9DB 3EOAB 3HMWH 2OZ4A 5JLZB 5JTWA 2NY7L 5L6YH 4YBHA 3JV5A 4HLJA 4YNYA 3U36B 4NKIL 5BW7A 4IRJB 2Y7QB 3RAJL 2VDOL 4HH9A 5JW4R 1LEGA 5EDXA 2CIKB 4Q9QH 4EDWL 3TYGH 3QXDA 4XPTL 2KQNA 4QOKE 2A6DB 4I9WD 3BKJL 4M7LL 5E6ID 1R3HB 4WI8A 4FABL 1JWMB 2XQYG 4YIQB 4MNGE 1WFNA 4EEEA 1DL7L 1N7ML 4CN1A 4F3FB 1N3NA 4R2GD 2AK4A 2JIXA 4L8SA 4M62H 4WTXA 4G6KH 3BT2L 4Z76B 1ZT1B 3QNZA 2QQLH 3QHFH 3PWPD 2QEJA 1RIUH 3MLYH 5EH1A 4OLYH 1HNFA 4OGAC 4R90H 2HJKB 3RU8H 1HI6B 1T21A 1Z9MA 4JPIA 5TE4L 1FH5H 3VWJD 4PJXF 4JRYD 3S4SB 1KPUA 2EDJA 5C0NC 3BP4A 1EXUB 1FRGH 4XVTL 4LPUA 3RVVD 3L9RA 2ARJB 1ACYL 2NTSP 1ONQA 4MAUL 1B3JA 4BSWA 4CW1B 2AEPL 1NBVH 3KGRA 3DSNA 1T0NB 4PD4J 4YEEA 4ZUTA 4C56E 5F89A 3CK0H 1L0QA 3AU1B 5C0AE 3QQ3A 2F9BT 4OFDA 2IMMA 4LVOC 2F74B 5HDBF 3WMSA 1A6AA 4TUKH 4O2CB 3BKMH 5F1SA 2UUDK 3FOMA 3L3KB 1QPPA 5HHOE 4BQ8A 5E6ZA 4LL9A 4LARH 3LQZB 3O3UN 5E8DL 1QFWI 1Y18B 5BRZB 4U0QB 4QRUA 1XIWA 2MKLC 5LGHH 1KELL 3GSQB 4Z7NF 2BOBA 4XC3L 2A6JB 3D3VE 4NBYB 3V8CA 1DDHB 1UACH 2NXYB 5IB4A 3IB4A 3TVMB 4WI2A 2J8HA 3ULUE 1CR9H 5H35B 1QHPA 1P53A 4GMTH 5C2BH 5E08H 1U6AH 2V5SA 2D03H 5JW3L 4XPHH 1A7BA 5LKNA 2VLJD 2MHAA 5DD0L 3P9MA 5I9QB 2IADB 3QI9D 3X3GL 1ZTXH 4YK4C 5K9OB 4OD3L 4ZTOL 1DQQA 1MCDA 3EFFB 1WITA 1YY9C 4X7DC 4TTDC 1YN7A 3IDNB 5F44A 4X9BA 4LVEA 4KJQC 5I1DA 3OF6D 3T0ED 1DUYA 1QR4A 5I15H 1U8QA 4PY8J 4ZFOL 3P77B 5CS7A 25C8L 4WGWB 2YD5A 3HNSH 3TIDB 5C0IA 3PXJA 4DKDC 1G7MA 4HIXL 5C0AD 5BRZE 1P69B 4LLUB 5EOCH 4UV7H 3T4AB 1U95B 3VG9B 4GXUN 1KJVA 4JDZA 3LD8C 4YGVB 3S35L 3LQMA 3TIDA 4IDLA 4XBEH 5IF0A 1SYVA 1HHHA 1RZ7H 3C60D 1T3FB 4ENED 2YK1H 3ARZA 4C83A 5EFIA 2EDBA 3T4AA 4O5LL 4RWHA 4NQDD 3MZTA 1HXYA 2V2XB 2GJZB 3GSXB 3S37X 5CMAB 2AJUL 3MXWH 5CBAB 5D6CB 2UWEA 4M5YH 4ACPA 2C1PA 5GGTA 2MTPA 4XH2A 3GEWB 3OAYK 4PY8I 2YA0A 3T3PF 3G6AA 3U7AA 5HGHB 4R8WL 3WL9B 4PR5B 1UEYA 2R0WL 3L6FB 5J1AB 4FTVE 1FVCB 2CDEA 2B1AL 1FPTH 4KKAD 5JOFA 4TTDD 4IIQC 3B83A 3KNBB 3BZDA 4KJWC 2YD7A 2YUZA 1WFOA 3B9KA 4LARL 5HYFA 1DQML 2K9UA 4KPHL 3FQTA 1VFAB 1K8IA 1ES0A 1FNAA 3MLTA 5DS8A 5CJQL 1QFWM 1KCSL 4S1DD 1RUKH 2EIBA 3FN0L 4LDOB 2YKLH 3WJLC 1NCWL 3FQXB 3Q3GB 4QO1A 2DQJH 4OZHE 3CXDH 4B7IA 3FO2A 3V4UH 5CILH 1A0QL 1UXSA 2QHRH 4QRQB 4S1QL 5HVHB 4F7EA 1S9XB 3DRQA 2Y06H 2B5IB 1O5DT 3V6BR 4F7CA 1D7FA 5C0BB 4HGKC 1X6LA 5C0RL 5C0CD 5GGRY 4FMFA 4I3GA 4HHAA 3C60C 5TF1H 4PGJA 1KTKE 1TCRB 1A3RL 3LRSA 2F8VA 2X42A 2CIKA 4UT6L 1JP5A 2IH3B 5ISZE 4IRSC 4YK4B 2AJSH 5DWUH 4HKBB 1QR1B 1MFAH 3WD5H 4ZO7A 5JO5B 4WFFD 2YUWA 4OKVB 2HG5A 4Y2DD 4RCAA 5FA3B 2R8SL 1V3KA 1J8HD 5DQJB 1DR9A 5HSFA 1FO0L 5LGJA 1HHJB 4JG1H 4BZ1L 2GFBB 4KHTL 4MXVF 2F53B 1CTNA 4LF3B 4HPOL 4F37K 3TWCL 2G9HA 1XGYH 5I2IB 1IQWH 1N6QH 1LK2B 2DDQL 2D7MA 3REVA 4Y2DB 3HRZB 1GGIH 5LGJB 2H6PA 4RFOH 3PGDB 4Y4HD 4LEXH 1L9MA 3FZUC 3MV8D 4K94L 3VXRD 3JWDC 4R7NA 1IAKA 5E2JA 4NRXB 1A6WL 4HUVB 2PETA 2FCBA 3MV7E 1PY4A 2MJWA 2N7BA 3NPSB 3F7RA 4JRWA 4XMPL 5KW9L 1U42A 2W0LA 5IB1B 4HG4J 3E8UH 3O2WH 4XCCH 1HINL 5JXAH 3HUJF 4P3WA 2ZNXA 5GIRA 1OAXL 4HIJA 1A4KA 4QRRA 2OL3B 4X6DE 1CICB 1IGCL 1MJUL 3VI4F 5FKAA 1AGBB 3MUZ1 4NQCD 3QIBA 3RVTD 3MUHL 1B4JH 4JRXA 5DRZA 2OJZL 3QG6A 3WDHA 3WNLA 5I1HL 2VXSH 3LS4H 2MNUA 4OQTA 4Y4FB 2W9DH 3TBYA 1BZ7B 2ILLA 4PRAB 4M6AA 4JJ5A 3VFUA 4ONGL 4HKBA 1QR1A 4V2CB 1RUKL 3BPOC 1P5UA 1C7SA 5ID0A 1T5WA 2GAZB 2V5YA 3F7YB 4PJCA 4AG4L 4L3EB 4Z7QF 3BQUD 3UBXA 2VMFA 3QCVL 5TE6L 1G7PB 1P9MA 4DFHA 2XN9E 1HQRB 2W38A 3SDCD 3VXNA 2YR3A 1A1NA 3VXMB 5IB3B 1N8ZA 4YHKL 3QIBC 2JB6B 4KDVA 1Z3GH 1DBAH 5HVGB 4M48H 4QRSB 4NO0D 5BVPL 5GJTL 1QFUH 2VABA 4Z5RB 5EB9A 2VJXA 2B4CH 1D5XB 2EH7L 3H9ZA 3BDYH 5SWZD 4QNPF 1C16B 3CSPA 3DYMA 4RAUA 5D1XA 1F6LL 2IMNA 1A2YB 3L3DB 1S7XB 5E7FA 4P57B 3E6FB 2A9NL 5LXGH 4G6AC 3O3EB 5BZDB 4LLUA 4XBPB 3RGVB 3TNNB 5DJ0B 2GY5A 1OF2B 4X5XB 2DAVA 5BXFB 3OKNB 3PXHA 4XP9H 5DHYA 4YXKH 5EPMB 2OK0L 3QULA 3BUYA 1BFOA 1MLBA 2HFGL 4N0CD 2W0KA 4Z0BH 3FB6A 2M1KA 2IFFH 3TH4T 1P6AB 4XCFL 2HWZL 2MCPL 1FVDA 3QWRD 1OAUL 3IXAB 1VPOH 4HLZG 4KY1H 1T22B 3LKRB 3RKDC 1FO0A 5IR1A 3WN5B 3NCMA 2NR6C 1VGEL 1R3JA 5KVGL 4F33A 5F9JA 4HK3N 1PSKL 1YQ2A 4N0RA 4OZFG 4XHQA 1D9KA 1WWWX 3BN9C 2X4UB 3BP6A 4QRPA 5A2LH 3VFPA 3OPZH 1ED3A 1RIUL 1IZJA 5JXEA 5GSRB 4EUPA 2DRUA 3RVUD 5EULV 4X4ME 4L8DB 2W59A 4XB7A 5H94B 5D5MA 5FGRA 3D69A 3GHBL 4LLMA 5B38B 5DURD 1P4LB 2Z31B 5ABDE 2Y4SA 1NGZA 5HYQB 3D39A 2FRGP 3ZDZE 2GHWB 3PV7A 4YZFF 2R2BA 1L6XA 2VITB 1CDYA 4UU9B 5FKAB 3K3QA 5I74B 1FZMB 3GBMH 5T33H 3QEGH 2MQ0A 5DVNA 4GKSA 4NQVA 4Q9QL 1KJMA 1NFIB 3N50A 3MRLA 3JWOL 4M93C 5CSGA 4EIGB 4K8RL 1QBAA 5DQ9A 1H3UA 3FFCE 3MRPA 4YQXH 4XC3H 1I8KA 5D7JC 1PJ9A 1YUHA 1E4XI 1NCBL 3AY4A 3DETC 3KWWA 4GXUM 4PJIA 4EBQL 3VXPA 3ZTJH 4GRLD 2YRLA 2IAMB 4G8FB 1MCPH 4P2CG 1BD2B 2SEBB 1HZHL 3LHPL 5DRNA 2A6JA 3OTTA 2BVPA 4Y19A 1ZLVK 3S36H 3QPQC 5L7XL 4G7YL 1QEWB 4PS4L 4QY8B 3U36A 2BVOA 5D8JH 4X4YB 1V7ML 4HUUA 1WFTA 3WNMA 2D31A 1N6UA 1BGXL 4PRHA 1WT5A 3OAUH 1NGXA 1ZA3A 2V7HB 3SBWC 3T0EE 5ITFA 1JNNH 4NZTL 3BN9D 3P4NA 5GGQL 1KG0A 5F3BA 2EC8A 4KI5D 5L2KD 1IM3A 1I7UB 2H32A 4H8WL 5KSBE 4ESKA 2HFEA 3OSKA 2Y36L 1I1YB 3TO2A 2EH8L 2NXZB 4G9FA 2VIRA 4TNWF 3RZCC 1U8HB 4JPWL 3V7MA 3BZEB 4PIRF 4HJ0C 1KFAH 2IF7A 4BQ6A 1U91B 1HILA 1WEJH 5KAQG 4JPIB 3O81A 1FFPA 3LMJL 3OR7B 1MHCB 4ELME 1DANT 4XP4L 5EORL 2P8MA 5GZOC 5F9OH 1KPVA 4O2FB 1S9WA 2QJDA 4NBZB 5GRUH 3IJYA 1A1MA 3BVNA 4Z7UE 2B0SL 4YHNB 1YUHB 3BEVA 1OAZL 2PO6A 1FGNH 3C60B 3H3BC 1MHCA 2R69H 3I3DA 3WFDH 1X7QB 4RWYL 1EDQA 1FAKT 1BP3B 1MPAH 5DMKA 5HHMD 4D0BA 3ALXA 1IAIM 2RBLA 3LV3B 1OGAD 4HKZA 3ULSB 4X0KB 2R2BB 4X9FA 2J8UF 5E2UH 4PJCF 5FO9A 1FVCA 1FZOB 4DOHB 2OP4L 1OCWH 5HXMA 4C4KO 1UZ8B 4R8WH 5IW3A 2CPCA 4U2YA 3DHJA 3LQAL 3X12A 2BRQA 1WISA 5B39G 4YAQA 3QXVA 4UIKL 3KNBA 5MERB 2YKLL 1KYOJ 5IM7B 1I1CA 4R4ND 2VR5A 1JZ8A 1CFBA 4Q0XH 3T1FB 1DLFL 2Q76B 4N0UB 1V5JA 2NQCA 3M17B 1TXKA 3WIIL 3LHPH 1ES0B 3MLTB 2BERA 4JPVH 1IRAY 2R9HD 5CWSA 2GK0B 2HJFB 2ZG3A 5CEYA 4N0YL 1QSEB 4Z77B 4JM2C 1XF3B 3CZFA 4AT6A 1NCDH 4S1RH 1PY9A 3PDGA 4I48B 4MA7L 5HHNA 5D1XB 3U30C 3CUPB 4ORGA 2O5ZL 1GJIA 4HMEA 3OXSB 4S1QH 5GZOD 1EUUA 1G7IA 1CU4H 1E28A 1MFAL 4ZUWA 2HRPL 2HT2C 1P7QB 2BFVH 1YYLH 1YDPA 4IHOA 2QR0B 4GKZB 3QISA 4K94C 4MQXD 1QFWL 2EYRB 3WO4C 1BFOB 1MLBB 4RX4D 35C8H 3DECA 3RVXD 5FYJD 4L29A 3EBAA 3NGBB 1A22B 4YGVA 3CDCA 5C09B 4P3DA 3V95A 1U8LB 4AT6B 2X1PA 5E95B 5IVZA 3IXAA 5CZVH 1Q0YH 4RMQA 1T7YA 1BX2B 3U79A 4LKXA 2AXHA 4W4OC 5C6WH 4JFEE 1HQ4A 2MFNA 5F9JB 3WHXB 1MCWM 2VZSA 1BVLA 1RUMH 3MGTA 4RDQG 3SO3C 5C0JA 1G6RA 1KCSH 4APQB 5C08E 3BP6B 4QRPB 1RJLA 3LIZL 2AJUH 4OM0L 4FN0A 3WS6A 3LB6C 4R4NC 2PXYC 3NH7L 3GB7A 4I0KA 2NW2A 4LCUA 4XCYB 4BYHA 3V6OE 1SYSB 3MMEB 5IWLC 5L0QC 5JUEL 1PKQB 3DUSB 4EQ3A 3IKCB 3SGKA 2FEDD 3PWLA 1HHGA 3NPZB 4P2OD 1QTYT 2EKJA 3QHZH 3T0VA 4JFYB 2AEPH 3EW3B 1T03H 1I8MB 1ZEAL 4LLYB 1O7SA 3V52H 3VXUE 4I48A 1U3JA 4IM8A 3C09C 2P24B 2BX5A 5F89B 1HKLH 3I2CH 4GKNB 4X9HA 2AEQL 1CZ8H 4D9RD 3BESR 1LO2L 4WDIA 5DRWA 3RY6A 3BKML 1XGTB 4DVBB 4NGHL 3SKOA 1UKTA 1J8HA 3GDBA 2H1PH 5E1HB 4RISH 2P46B 2B8OT 1MLCA 1UVQB 3OKMA 3ARWA 1PYWB 5DUBB 2FGZA 1AGCA 1HSAB 2DQFB 3UBXB 5D1ZA 2ED9A 1JNJA 4M93B 1UB6A 1A6UL 5IJKC 2WWKO 3P0YH 1B4RA 3PUCA 1WZMA 1MVUB 3T2QA 3IDXH 5HHVH 5CP7A 4I0PC 5T1LD 3WFBL 1XGUB 1KULA 4MJ6A 3L3IA 2I9LB 5IVXE 1N2RA 1G7PA 1VEPA 1ITBB 2A77H 1IVLA 1IBGH 1GGYA 3DSFH 1QFHA 1DBBH 4MZ2A 2XV6B 1GGTA 3RX5A 4MSWA 1MCNA 4L8CA 4I3SL 3AC0A 1MELA 2DLGA 1JGLH 1NMAH 4WENB 4YFDB 2PYED 2IALB 5FKPA 5HI4C 1GGBH 3SDDA 4HF5H 5F88B 5IIEB 1CG9A 2H6PB 3ROLA 4OZHA 1T5XA 2EZ0C 4NUJB 4JZJC 3FFCD 1VACB 3GI9H 1J5OL 4TVPL 4XNMB 5J13B 4FQXC 2CIIB 2DIJA 5BMFL 2HYMA 1WQVT 3D18A 5IMLB 5GPRA 4G42B 2ITCA 5TGBA 1I85C 4XPGH 1Y0LB 2R1YA 4UBDC 2Z8VC 4AMKL 2JK5B 5FUCC 3CFJB 1CD8A 5I30H 1M4KA 5C6PB 2X4OB 3PP3K 3WSQL 5IOPA 1DEEB 5CINH 2VSDA 3C8KA 2XZQL 4P2RD 5D7IB 4UV4L 4FG6D 5TDPB 1FP5A 3INUH 3P40A 1ZEAH 3RTQD 4GG6A 2EXYC 3AMLA 5INCB 2QQKL 3SCMC 5EU6A 2FYYA 4LLYA 4OIBA 4WJ5A 3HLAB 4MVBC 4O51B 4QRQA 2VAJA 4KDTA 3O6MH 1MUJB 2JCCB 4KKLC 1LO2H 5DJZB 1YEGL 3F58L 1TCRA 3MC0A 4RISL 5HI4D 1VEMA 2AS5M 1W0WB 3N1GC 4Y5XC 1MFNA 4JAMA 2UV3A 1PKOA 4J7RA 4ZFZB 3GSVB 1ZANH 4YDJB 3WV0A 2Y7QA 1KGCD 1ZLWK 1V3LA 4GXVL 1DQJA 4HIEA 1BFTA 4JM4H 4JO2H 2FZ3B 3MRQB 4JZOA 4JFFA 3QUKB 3QEQA 4NQCB 1YY9D 1DQLH 4GQPH 4P5TC 1RAMA 5IG7B 1H9VA 4IHOB 4HCRA 2NY4D 5AAMA 4JM2F 3VMPA 4X5XA 1YYLL 3SO3B 2P8PA 1GHFL 3B8YA 4UT6H 4P3DB 2CRZA 4LVHC 2BNRB 4LLAA 3I75B 4OJFH 4QEGA 2AK4E 3AS3A 3BSZH 3SQBA 4I2XB 3IFPA 4GG8A 3EHBC 1YNKH 3AB0C 1U8KB 3UJJH 2ZJSH 5I19L 4R4FH 2X4QA 1WBXB 4X8JA 2AV7A 2WV3A 1A6TB 4L3EE 4P2RE 4UDUA 2Z92B 4LLQA 4TPRH 2UZIL 1ZT7B 3GBNH 4KKLD 2DM4A 4PUBL 4RZCB 4ZTPH 1X9QA 1BIIB 3GSWA 2WP3T 4OGYH 1CIDA 3QEUA 3QDMB 1VERA 4KV5E 1PZ5B 4E0RB 1NUGA 4H0GA 2EDLA 1D5IH 4NQCE 2FJFA 12E8H 1OGAE 4QTIL 3ZE2F 3I6KB 3ULVL 2GTWA 1JNHB 2C26A 1MRCL 2R2HA 3VFTA 2ZSVA 3I3BA 4ZXBA 2EE2A 4D0BB 5MENB 1TVBA 5DHVH 4EOWL 4KFZC 1X4YA 3O9WB 1GAFL 3L9RB 3RIAK 4ODTH 2CRIA 1FZKA 1SJXA 3MJ8B 4GLRI 5T1DH 4BZYA 2NTFB 5IB1A 4YWGH 5I73B 2NY1C 1GOHA 5DEFA 3VRIB 3B6SA 4PRPA 3P0GB 5DI8B 5IW1A 4HUNB 4LCWB 1C5CH 2I9TB 4GBXC 5C70A 4ZS7L 4TTGA 4O4YH 4KTEH 4I4WB 2XTJB 3FMGH 3NCYP 4WEMB 5FCUH 3L5IA 3ARPA 1K4CB 4LEOB 5ICZA 5HHXH 3U4BL 2HLFC 4U33A 3RGVA 4LRIA 3H0TB 5F7HA 4CVZB 3T77A 5I16B 3KLHD 1BAFH 3WO4B 4BFGA 4JG0H 4AL8L 5F71A 4RAHA 5E9DB 2I5YL 3ARVA 4Y5VA 3HFMH 4YHML 5DZLA 3O0RL 3ZE0F 3C87A 3KPPA 1K9TA 5J13C 5F9OL 1QSFE 3LN4B 3WXWH 3K81A 5ITFB 3AFLA 1ZSDA 3VFVA 4MD0B 3WXVL 4IMKA 5TDOA 5MENE 3C5SB 4LQFH 1CU4L 4TVPD 3QEQE 3UTZB 3HC3L 1QBLL 4OF7A 1A7QH 2NY2B 3RU8L 5CLWA 1FVEA 5L8LB 5MEOB 3QG7L 4D3CL 1TDQA 4JVUA 4S1RL 4G5ZH 1W8NA 1B90A 1ZS8A 4WW2A 3C9NA 2VDOH 1ZHLB 4NNXB 2FO1A 1UJ3B 4P46C 4OLWH 5INDB 2ICWI 4BSWB 5KN5B 3GI9L 1J5OH 4ZS6D 1FVEB 4MAUH 1CLZH 4P2OA 4N0FB 5DJYA 4LSQH 4R0LA 3S4SG 4PLOB 2D31B 4X7SH 3VGAB 3C5SA 3QWOA 3RJDA 1ZHLA 4PJFA 4XWOD 4MS8C 2VLKB 4U1NB 5DC0A 5ICXA 3PL6B 3ZTJG 1AGDA 2PW2B 3IJHB 3BT2H 1DN2A 3EOAA 4OQTL 4D0CB 3W11C 4P2RA 3QDGB 1GZPA 5J11C 3CC5A 4HIHA 2PO6B 4NQSB 3MLYL 3FKUS 3WLWC 2IH1A 3S34L 3O8XC 1LEGB 3B5TA 3ZDZF 3BAEH 5I18L 1KLFA 2R69L 3KYMA 1TCMA 1FH5L 3HTLX 5ICZB 2G75B 1XGRA 3IETB 1RZKC 3EYUL 1R3KB 1TQCB 1KB9K 2WINB 4JN2B 5HVFB 5D7JA 3B3IB 2AJ3B 3D85D 1DBML 3RVTC 1AC0A 2EDRA 5ALBH 1N3NB 5GSRA 4EUPB 2E7MA 3V4VH 2H8PB 1FLTX 2P5EE 5FDWB 1A4JA 3MSPA 1FCCA 3BD3A 3VD9A 2CR3A 3EO0B 4NQDE 2EDQA 4YDIH 5LQBH 1T1WA 2NW3A 1FG9C 5EBWB 2EDYA 4DUVA 4NJAL 4HEPG 3I50H 3R8QA 4OD2B 4WO4C 2BVOB 1JHKL 4UNUA 5CAYB 3DMMB 1YEJL 3CVHL 3B9KB 3MRMB 3ARYA 4QRRD 4X4ZA 4OZFH 3OB0K 2YD4A 3MJ9A 3F5WA 3HNVH 1I3GH 1K8DB 2W9EL 3KPMB 5J1TC 3SE3C 4M5ZH 4JRXD 4FFVD 3FN0H 1MCLA 1T2QL 1FYTD 3KJ6H 4XWOC 2CH8A 1ODAA 1IFHL 5KS9F 1EHLL 3IVKA 2ATPA 4FOMA 3FOLB 3AB0B 1KPRA 1KIQB 4HKXA 3RZCA 3BGAA 5D1ZD 2BSRA 3BO8B 3IDIA 4RIRB 2DLIA 5C0DB 4EDXB 1T7XA 3T1WA 2IPUK 5C8JA 1VB9A 4G6AD 5EOTB 1FGVH 2VLRA 5BS0E 4P9ML 3FT2B 3FQWA 3MGOB 4JGMA 1B0RB 4P49A 3VWKD 3V5HA 5GGSA 3MNVA 4UT9H 5K93A 4QHNA 3UJJL 1OSZA 4NZTH 5C8JB 4HEME 4MD5A 4POZD 2P1YA 5AD0B 3QXTA 1JZ6A 1U8PA 3OJVC 4K23H 2BMKA 1L7TL 5D1XD 4UV7L 1CDGA 2F5AH 4LSPL 1SM3H 3TVMA 2E7LC 4FZEL 2VZVA 2WLYA 43C9A 1A1OA 1MIML 3IRPX 1XZ0B 1MQ8A 2P49B 5AWNL 5LAXB 5BV7L 4H0HB 4KMTH 5D71H 3CNKA 5JHDE 1HHGB 2R23B 1AD0B 3K2UH 5GS0D 1G7JA 4NO2B 3VE0B 5IVNA 2GJ6A 3IAQA 3FOMB 2CK0L 4EN3B 5JPMA 3JV6A 3PE9A 4NO0B 3GIVA 2CKBA 2B0SH 4R26L 4MDIB 1NAMB 2MPAH 1OD9A 1D5ZA 2RAMA 3CMOL 3DARA 2AJYL 2GAZA 4WHDA 1F3DH 1FFRA 3TVMC 2E7LA 3GNML 2O5YL 4EVNB 4RFEA 4UQ2B 5EUKB 4PBWD 4WJ5B 4PJ8D 5D7SL 3L3JB 5IVXA 1G9ML 2PYEE 1DEDA 3QR2A 4F37F 4PJXB 4RBPK 2LU4A 3PJSB 3PWPE 3STZB 4X7TB 4KTDH 5CGYC 1LNUB 4O51A 1CDHA 4H25A 1S7TB 3DO7B 4GRLC 1BM3L 2JB5H 3IXTB 1E4KC 3Q1SL 4LOUD 43CAA 1ORQB 3S5LB 2R4SH 2ICEB 3BJ91 4OF8A 4XNMA 3SDAA 1KBGL 1BZQK 1LEKB 3DURA 4PJBE 2WZPD 4YHYC 3T65B 1U3HB 2OI9B 4Q0XL 3X3FL 3UEZA 2DQCH 4HKJA 5IBLC 1IQWL 5ENWA 5CD5C 2FX9L 1HYSC 2IALA 4GAGL 1NUFA 4NNPL 3BZ4A 3E2HC 1OTUC 1J0HA 5L6YL 1CE1H 2AI0L 4GSDH 2F8XC 4L4JA 3O41B 1K3IA 2EYSB 1FG2B 1VEOA 4MAYB 1EAJA 3QDJD 4NHUA 1YEKL 3ARFD 3BHBA 1C12A 2BVYA 4U1IA 3MRGA 4XXCC 3SN6N 4HJGA 2OSLA 1FL6B 3CX5J 4KVCL 5KANG 2LFGA 1BREA 3BGMA 1CFVH 3S88H 3G04B 3STLA 2OL3L 4PRHD 5BCAA 2QSQA 4OCRH 4KJQD 4ZO6A 2EDDA 5DEGA 3TZVA 3ELAT 3BH8A 4NKDB 4NN7B 4AIOA 1TFHA 2ZKHL 4ZPTA 2DKUA 2GK2A 3OBAA 4JQXA 2CRMA 4FXKA 4MD4A 4A2LA 2Q8BH 1RJZA 3IJSA 3PQYE 4P4KC 1CXHA 4L3CA 1BECA 2A83A 4HPYH 1DZBA 4Q6YA 3MOAL 3QH3B 3ESUF 3CFBA 2QADB 3P0VL 3QFDB 1ZANL 3GMPA 1K4DB 4P5KB 3LKOA 1ROWA 1C08A 3ARGA 1A5FL 4G8EB 2YN5A 5IFJA 3FQTB 5B8CB 1AR2A 4HWUA 3EDJA 5DVLA 1RMFH 1LO3H 2F54B 4QXTA 2XWBB 2PTTB 4KTYA 5JIKA 3WD5L 1FZKB 1F02I 2EO1A 3M8OH 4MQ7A 1OT2A 5D5MB 2R0ZH 1YY8A 3E3QE 1TVBB 4LHUB 1OQOA 4EN3C 5C07B 5IGXL 3EDDA 2AQ2A 3DV6A 3UDWC 4KTEL 3VGFA 1JJUA 3IAPA 3DRTB 2ZCKH 5E8PA 1UJ3C 4Z8FL 4Y4FD 1U92B 2XICA 3MLXH 3L7EB 4OCSH 2BNQA 4I0PB 1JFQH 4FXGA 4I8DA 3RWJB 1CG9B 1Q8MA 1JNLH 5L0QB 4YGAB 1DFBH 1XF2B 5C0ND 5E24E 2XKSA 2XRAL 4NZUH 2VXTL 1REIA 2V7NA 3RL2A 2BK8A 1CXLA 3BN3B 1JI2A 2BNUB 2GITB 1DBAL 4MWFB 2H9GA 4ISVA 5L7XH 1F4WH 1U3HD 3O41A 5I15L 5B39A 1CIUA 2BSTA 5EBMB 5BZWA 4GRWE 3C5JA 3R06B 1BOGA 1J11A 2IBZY 1NEUA 4YHPA 3O6LL 1P4IL 2BY1A 1WC7B 4Z95L 3BKCH 3TJEL 4DKFL 4NM8L 2KL6A 3VXQA 3QDGD 3H9SA 4JQVA 3DBXB 2E7CA 5DDHA 2CGRL 3OJMB 3KJ4B 3O6FB 1JGUH 5GRWA 1L7IL 1OM3L 4XP9L 2BVQB 2GITA 4JLRB 4ZAKC 2HVKB 4M9PA 4WI6A 3EO1B 4UZGA 1QZ1A 1YEEL 1AXTL 4YEFA 1MIMH 4XVUD 4QRTB 4KKCD 1URLA 3MFFB 4MYWB 2YK1L 2APFA 1QKZH 5C9JA 3GSNH 1JGDB 4PJ7A 5DSCA 4ZFFB 3VXRE 1VPOL 3VA6A 4P46B 4U1HB 1T80A 3N9GH 5DUML 2D9QB 3O6KL 3BYYA 2B20A 4J4PD 4NUGL 3W9DA 5KTEH 3UTTA 1J9CT 2VZTA 5T3ZL 2X4QB 2NZ9D 5CIPA 3H7BA 2L7JA 4P2OC 3CVHB 3QJFA 5IK3B 5BXFA 3GMRA 2VL5B 2UWEE 3MJ7A 1KCKA 1JPGB 2C3GA 1IC5H 3F7PC 5ISZB 1EFXD 4GRWB 4LLVB 4OZFA 4QWWC 4P57A 2AGJH 4HX1A 3KPLB 4PJ8A 4K7FB 4RSVA 5F1KC 4JZOB 1MJ8L 1VFMA 2B1AH 4LFHD 3CSYA 3C5ZC 1TQCC 2N1KA 3VXUB 2NXYD 4IS6A 3VH8B 2DM3A 4G80B 2CUIA 3DX8A 3OKDB 4MWFA 5E2UL 1KTLB 4F7TB 2BY0A 4YO0A 1MFDH 2OQJB 4F7PA 3FRPA 4YE4H 2ESVE 1S5HB 4WU5B 3JTSA 3K0WA 2IPUG 4U3HA 4YHZL 4JKPL 3MOQA 4OLEA 1MHPL