1RIHL

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DLVLTQSPATLSVTPGDSVSFSCRASQSISNNLHWYQQRTHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSISSVETEDFGMYFCQQSNRWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
molecule keywords light chain of antibody 14F7
total genus 56
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL01
3OGCB 4M1GL 1DQLL 2KQMA 3SJVB 5GGRB 2R23B 4G8FA 4QRRA 1OSPL 5JXAL 5E00A 1DQMH 3LN4A 4LGPB 3KPSB 5BS0B 3PQYA 2X4PA 2PF6A 1EFXD 5I1HL 3OKDB 4PJ5E 3L3JB 5D5MB 1BWWA 1X5ZA 1JK8B 8CGTA 5AYUH 5FUCC 5MEQB 3V7AE 1J05A 1D5IL 4OLXL 3P40A 5CZXC 4HK3J 4KJWD 1FN4A 2H6PB 3RDTC 1X5AA 5MERA 3CSBA 4LOUC 2FEEL 2FB4H 4NT6B 1MJUL 1KN4L 3HUJB 2IQ9H 4XC1L 2Z35A 5L88L 1DQDL 5GHWH 3OZ9H 3GMQA 5K33A 5DJ0B 5C0EA 1MI5B 2B4CL 1UJ3B 1P84K 5GS2D 3BEWB 1KTRL 2NY5L 3LMJH 3DOSA 1HEZA 3CAFA 4OCYH 5AEAA 1TJIL 4JREC 5IMMB 3X14A 3U7YH 1MWAB 3CD4A 2D31B 3DMMC 3ZSSA 4KC3B 4XGZB 1MFCH 1ZGLA 4LEXH 3UTQB 4WV1A 2FIRT 2HJFA 3OPZL 3ULVH 2VE6B 5F9OH 3MGOA 4OFKA 5TF1L 4IHOA 2BVEA 1NC2D 3TBTA 3OXSA 1LO0L 1ZMYA 5I30L 1IKFH 4POZD 2D7QA 2AK4D 5EO0B 1TNMA 3QO1B 2X4RA 2P5EA 4U1KB 3LKNB 5AZEH 3N1FC 4WW2F 2VR5A 3C60C 4JDTH 4PJHE 5HGHA 4Z76A 3WXVH 3MGAA 1QRNB 4F8TA 1QSVA 2KQNA 3PDOA 3QCVL 2QSTA 5C0IA 1UWXH 2NX5E 4JFXB 3HAEH 3HE6C 4WFFD 1NFDB 4XVSL 1B4RA 4LDEB 1NBYB 4OZFH 5J6GA 5DUBB 3MCLH 1QFUH 4WWKA 1S78D 4GKNB 2DQFA 1K8IA 3WLWC 3QUKB 4CN4A 2E7MA 5GISH 3U4EB 4NQSB 5DWUL 3IXTA 1H8SA 3L3OB 3UTPD 3BVNA 1KIRB 2W0FB 3TPUA 3QNZB 7FABH 1NAMA 5HYIA 1MNUL 4WHYH 1NBZB 1LDPH 2W60A 5F7WC 4EI6A 2A6JB 1HYSD 4GG6E 2VDOH 2E7HA 3C9NB 4Z0XB 1S7VB 1WFTA 2J2ZA 1J8HA 4YX2L 2FJGB 3WYRA 3B9VA 3H7BB 1F90H 3QAZB 1TVHB 2FGZA 3QFDB 1OTUD 1EUUA 1L7TH 2HFFB 5AWNL 2VDML 2VLLA 3LRGA 1RURH 4Q9QL 1F4WL 3V7MA 3GI8H 3RQ3A 2ZUWA 1DBJH 3TV3H 4OZFA 3DXAE 4PJDB 5BOPA 4ORZC 1MQKL 1U3HB 1LE9B 4MDIB 4LVHB 4RWYH 3ULUD 1P5UA 3MRQA 1I1AB 3NIDE 5DURD 3WNPA 1WTLA 2Y23A 4XC3L 4ZFZA 3CVHB 1SJEA 3SJVD 5DVMA 5F72S 3RWEB 2R2CA 1O7SA 2WWMC 1Q1JH 5T1KA 3D2UD 3U7YL 3QP3A 3PXJA 4OCRL 1VEMA 5EU7E 4KV5E 1MAJA 1FZOA 3GRWA 4M61B 3A6BL 3H3PL 3O2WH 3Q6FB 3NH7L 3IDUA 1J8HE 3WFZA 2HH0L 5HHXH 1OM3H 1XF4B 2KUTA 1WEJL 1PG7H 3VXSA 3AS2A 1LO3H 1CQYA 1MEXL 4L3AA 1TJGH 4OIBA 3QZWG 5DEZA 5T33H 1JWUB 4N90E 4OIIL 3BPCA 3CFIC 1N5YL 5IB5A 4GG8A 1CWVA 2OMBA 1NGYB 4TNVK 5JUEL 3UYPA 3HR5B 4RMUA 2AJZA 2BVUA 2VLJB 3BSZH 3TA3C 5I1HH 2FLRT 4EDWL 3GUTA 2ZSVA 1TQBB 2HLFC 1Y0LB 4JLRA 3RRQA 5I1CH 1UB6B 4RFOL 1U8OB 1JMXA 2FX7H 2Y72A 3BFOA 3IDYB 4OTXH 5DQJB 3T65A 4F9PC 3I50L 4C83B 2Y7QB 1FBIH 4UTBH 1XCQA 3ET9F 3RY5A 3P9MB 2W38A 1LNUA 1J8KA 4Y4KA 1AQDA 1LO2L 1QVOA 4YE4H 1U8PB 5D7LE 4HKXB 3FT2A 5IOPB 3TJEH 2R9HD 2VXVL 5D71L 3PG2A 3OKMA 2Z31D 1S9YB 4ELKA 3F5WA 1HI6B 4PV9A 1FHGA 2D03L 1W0WB 2AABH 4JO3L 2X09A 4NPYA 3CSPA 5F9WC 2O61A 1FORH 4U3HA 2BDNH 3T3PE 2VLRB 2R8SH 2APTA 1EK3A 4M7LH 2VQ1A 5KVEL 2Y1VA 4KI5D 3O3EA 5GS1B 4PBXA 4IDJL 3QXVA 5E99H 3SDDD 1T2JA 2ZUSA 3FQNA 4G42A 3DGGA 3NPSC 5FYKD 2X7LB 3VW3H 2BFVH 4DAGL 3LQAL 5T3XD 1FO0B 5C86A 4OJFL 3RWCA 1AGFB 3K1DA 2ZOKB 4X8JA 4OZ4A 4LMQE 3U48A 1UQSA 4QNPF 5DK0A 4JY5L 2ZPKL 4R0LA 2A6DA 1BM3H 3X13B 1IEBA 2V7HB 4F37F 4AL8L 3BZ4B 5DEFA 1AY1L 3MRIB 5IW6B 3OMZA 5LQBL 1O7VA 1C7TA 1YQ2A 3G5ZB 4GAYA 1N6QH 3EDJA 2PTTB 4M7JH 2VDPH 5H37G 3P2TA 2XV6B 4XWOD 3NVQA 4O02L 1E27A 3VRJB 3M17A 3GMMA 5F6HI 4GKNA 5I71B 1PY9A 3S96A 1GXEA 5BV7L 1VGKB 3CH1B 3RL2B 2NY2C 4MJ2A 2FHFA 3P4OB 3TPUB 1ACYL 1DANT 2P46B 4KTEL 1P53A 3FO2A 2J3SA 4FZEL 4UIMA 1AIFB 1MY7A 1O0VA 1BX2B 3QO0A 4OCSL 5D2NA 3H7BA 1BVZA 5IF0A 1RHFA 4UILL 5DVOA 4KZEH 4B5EA 4M48L 1F8TH 1PSKH 3SOBH 4UTAH 1UA6L 4NFCA 2DJSA 1T20B 3GBMH 4LPCA 4MA1C 3B2UD 3EOBA 3G5YB 1MELA 2OK0L 5GGRY 4YZFF 1M6OB 5KSAD 2YPLB 4PJ7B 1U58A 3ULUE 3BUYA 1FZMA 1JGVL 1DP0A 5IJVA 5HBBA 3DUUA 1ETZA 1EA9C 1RUAH 2R2EA 5D1QA 3MRFB 4CKVX 4Y4FD 3A6CL 1SJEB 5ANMA 3D9AL 3EYQD 2MQ3A 4HXAL 1ZK9A 1URLA 5B8CA 3ZE1E 4F58L 4U6TA 3RY6C 3BMWA 1J10A 4NIKB 5AG9A 3KPNA 2P24A 2R4SL 4NKIL 1M71B 3MLPA 4PJBE 2IH3A 1WT5C 4PPTA 1KPVA 3BRFA 4GG6A 3BPOB 5DD6B 5J13C 2O26U 2RCSL 4N8VG 5DMGD 1J1OL 4MS8D 3SDDB 3D39E 3TO4B 5EBLB 1TTFA 4JFHE 4D0BA 2GJJA 1JGDB 1KCLA 1CLCA 3SPVA 32C2B 3L3DA 2AK1L 4UV4H 3OTTA 4LSDA 5IQ7H 4YDKH 4PJ9A 3RGVB 4D3CH 3BPOC 5SX4H 2E9JA 3R8QA 3T3ME 2I26N 2VZ3A 4OD3H 3JWDH 1U8OA 1NANH 5IFJA 1PX3A 3RDTD 4NQEE 2ESVE 4OB5L 1CBVL 1XF3B 3UC0L 1RUQH 4HLZG 3DXAA 1A6ZA 3EKCA 3RVXD 1XCQB 4JFEB 2J88L 2W65A 2BK8A 2DD8H 1G7LB 4BH8B 1BQHG 4DZ8A 3OHXA 1LO4L 3I6LE 2NX5A 5HVHB 1DBKH 4NJAL 4U2ZA 1I4FA 7CGTA 1AKJA 4G7VL 2XWJA 2JJSA 1ZHNA 2PYEE 3FN0L 4ZO8A 5DXWA 3TNNA 4CL7A 4J3TA 3BZEA 4LLVA 3W39A 3TBSA 4LSSH 2CKNA 4MAUL 1N4XL 3G5XA 3QDJB 1FE8H 1FFOB 2X4PB 3W9DB 4APQA 5B38A 2IADB 2GT9B 1CFVL 1T1XA 2HKHH 4C56E 3HLAB 4OM0H 3GMPA 12E8L 4FQIL 1FZJB 2CIKB 4Y8AA 1CXEA 3UPRB 1KFAH 3GGWB 3G6DH 1J88A 3JWOL 4HDIB 1T83A 3I50H 1MCLA 4UAOB 4JFFB 3DSFL 1IM3A 1HH6B 5ITFB 4JJ5B 4BZ1H 5IFHH 2VISA 3T0EB 4MYWB 1J18A 3RZCC 1DFBH 5KSBF 5DUML 4BSWB 5KG9A 4H88L 1JMZA 1MCOH 3C2SA 1ITCA 1DBKL 2UY7A 4IRJB 1T66C 3BDBA 5FUOH 1UWEH 3O11A 4AEEA 3DVNA 1RUQL 1G7PA 3ULUF 1IC7H 2GHWB 3FRPA 4KROD 4LLAA 1HQ4B 4FQLL 1CCZA 1RUPH 1B0GB 5FO9A 1QKZH 1P7QA 4XRCA 4KDTC 3EZ8A 4YFLI 4OZFG 1IGML 1KPUB 3DX8B 2P49B 4M7KL 5GRJH 2XTJB 3FB7A 4F37K 4U3CA 4EIGB 3IFPB 5EO0A 2XY2A 3VXRD 3LDBC 3FMGL 1CS6A 2LAAA 3FB5B 4AENB 1EEUA 4LIQH 4M1CD 5T3ZE 1N6UA 5HYJB 1KYOK 1L6XA 2WUCH 3ALXA 2FZ3A 5E6IC 2A6KA 3DETD 1G9MC 3Q0HA 5D7JB 5BZDA 2VZVA 4HUMB 5JORB 3MRNB 2NY2B 1GC1C 1YUHA 4PGBB 4KQ4L 1U6AH 5D70H 1AIFA 1WV7T 4ZUUA 4D9RD 4CADA 4I3RH 1KCRL 4LSUL 4NO3A 4EI6B 4RFEB 2A77H 3WXWH 2A9NH 1K8IB 2QSCL 1JL8A 3KYNA 2AJVH 4PR5A 1S7XB 2BHZA 4NFDA 3RIAK 3IXTB 3ESVF 4A6YL 1NCDH 3V0WH 4X6DB 4S2SA 3LZFL 4HEPG 3P30H 2FX8L 3C9NA 4KRMB 3RWJA 1U3ZA 3TZVC 2NW3B 4FTVA 4JFEE 4MGXA 2BNRA 4NZUL 2P5WA 3RX8A 5CEZL 4Y5XB 3EO0B 4J4PD 2MHAB 2A2QT 3TVMB 1T5XB 1UWGL 4LARL 5ENWA 3ARDB 2J4WL 1BIHA 4ONFL 4O58H 4YDVB 1QRNE 1RJZA 4P5MB 3ARVA 3HC0A 4WUUA 1OP9A 3E6FA 4JR9H 2Z93B 4V1DA 4ZTPL 2AERT 2ZUQC 2NY0C 2VZTA 5DD6A 3V79C 3ALPA 1YNTB 1SMAA 4P57A 2P48B 3QXDB 2V9TA 4M61A 4Y16B 1DVFD 4DCQA 1GSMA 4NZUH 4WI9A 1P84J 5CEXB 2NX5D 4RNRA 5F7LB 3S5LG 4HWZA 4ZYKB 3P30L 1XF4A 4LLUA 4GLRH 2X4UA 1ZVSB 4P4KC 1GAFH 1JVKA 2XZQH 1TPXB 2QQKL 3DX6A 3DV6B 4NCC2 1HINL 5CJOH 3EFDL 4GW4B 4OLVL 2NZ9D 2AQ1A 4HX1B 3DRQB 4OGYH 1IKNC 4CDHA 5HVFB 1D6EB 1ND0B 4NQTA 2WLYA 4E0RB 2JCCE 2AJZB 5HHQA 4NNPH 4K23H 2Y9RT 3GJFK 1KT2B 1P1ZB 2NY5H 5GGVL 2F54B 3HE7A 3S4SA 1G6RA 2NY6B 4M5YH 4L8SC 5C07A 4OV5B 2C1PB 3FONA 5EPMA 1QFOA 2E5EA 4P2OC 3WL9B 4ZXBD 1DUZB 4NN7C 4R96A 2HT4D 2FB4L 2HTKD 3UTSE 1FNFA 4RAHA 1AO7B 1EO8H 1G7QB 1JFQL 4OFVA 1NCCH 1T0PB 5FOBB 4KI5C 2R4RL 4UT7L 4YEEA 4AIOA 2W91A 1VFMA 1CR9H 4D0CB 1PYWB 4M9OA 5EBGA 2BOBB 1QFWI 3FFCA 3MR9A 1P9MC 2Z92B 3SDCA 1MIML 3BPNB 5FDWB 5ID0A 2XFXA 3IDJB 1VFBA 5JIIA 4D8PB 2PCPA 2OL3A 4YHKH 2VQ1B 5DO2D 3P73B 2YUWA 1S7TA 2CH8A 1Q9LB 3PV6A 5TDOA 4YXLL 2KDGA 2O61B 1BEYL 2IH1A 3RVUC 3NFSL 3IJYB 2VDQH 1MLCB 5F3BB 2Z4QA 5BZWA 3HUJE 2AABL 1HXYB 5EFIA 2R2HB 3W5NA 1XR9A 2N1KA 1I8LA 3QSKB 2IEPA 5ICXB 4OTXL 2AJYL 3KPLA 4JFFE 5F6IC 1QR4A 2YUZA 4YHNA 3P3YA 2HJLA 5FHAL 2EE9A 2FO4A 2PW2A 1MH5A 3JWOH 3K7UA 5GSRA 2XA3A 1QPPA 1B0RB 2NLJA 3C6LC 3VXRA 3QDGD 2VQUA 3RJDA 1GGIH 4ELME 4PJFB 2B7DT 1DUYA 2J8OA 4NQEB 3ES6A 4MLIA 5DGQA 3UBXI 5TPWH 4AENA 2H3NB 1D9KD 3JWNC 3DMMB 4Y88A 3C8KB 1IEBB 3VD4A 4XT1C 3KYMB 1CGTA 1WBZB 4M7ZB 5EBMA 2WIIB 1XGYL 3ZKXB 6CGTA 5JORA 4P5TA 1LO4H 4Z7UA 2VXQL 1TZGH 1BJ1H 3WJJC 2ZSWA 3MUZ1 15C8L 1OARL 5DGRA 5F3HB 3NBNA 3MA7A 1BVKA 1R5IB 3QA3A 4EQ2A 4RIRA 3QUML 4ZFOB 1HQRA 2X1PA 2OQJA 3SE8L 1I1FA 4HKJB 4ZQKB 5F1KC 2HLFD 4PR5B 4KHXL 4QOKE 1M7IA 3OSKA 3QRFM 1LEIB 5IBTL 1V3JA 2EIEA 4KI5E 4PRIE 1YYLL 2R69L 4CVXB 3VXPA 5DRXA 3ZDZF 3RTQD 4ODHL 1JPTH 5ALBH 1JF6A 4HIEB 3ULVD 5HI4C 1CLOH 4HF5L 4NQCE 3S3SA 3DURA 4U2YA 1F90L 2Z31C 2EDJA 3LKRA 4LSPH 4OUUB 4UT9H 5IEHA 4X98B 5KSBE 4TVPE 3U9UA 1DBAH 1IQWL 2HWZL 1DBJL 4RRPG 4HQQH 3B6SB 4XPAL 4X6EA 3EHBC 1OOAA 2YPLA 4YXHL 2C7UA 4DGIL 3UTSA 3BDXA 4R6UA 3UTZA 3O3AB 1RZFL 3GMRA 2V5YA 3CK0H 2VDOL 5B22A 4HIJB 3HN3A 4FRWA 4IRSB 2W07A 3QRGL 5DTFA 2X6MA 1FZKB 3D25A 4N5ED 2R1XB 2AJXL 2E27L 2X70A 4M6MH 1X5XA 1XIWC 4I0KA 3G08A 4OM1L 4HC1L 3DV6A 5EULV 2C3WA 3VJ6B 1CICC 4M9PA 5CZVH 5SWZB 1MWAA 4YDIL 3T0WA 2OR8A 1BD2D 3BJLA 2CRZA 3MUHL 5IMOA 3IFNL 2ITCB 3L3DB 3LS4H 4LSRH 2NY1C 1U8IB 4XVSH 2BNQB 3TBVB 5F7HA 1NMAH 1A14H 2E27H 2ITDB 5IWLA 35C8H 4TUJA 1MFDL 3ULVL 1UXSB 1DEDA 2X5PA 4UT9L 1QO3A 3WXWL 2IFFL 5DJYB 3ARXA 1VGEL 4HK3N 4YR6A 3BH8B 1JNLH 1I4FB 3SKUD 3QEHA 3CZJA 4X6DE 1A6PA 1ROWA 1P4IH 4MQTB 4YUEL 3BZEB 1Z5LA 3VWKA 1G7IA 5BXFA 2CRIA 1HE7A 4P3DB 5MP6H 1MCWM 4GH7B 3K0WA 5BJTA 4JRYB 2V17L 1WZ1H 4P2RE 1EHAA 3QNYA 1TMCB 2AXHA 1BPVA 5DUBA 3JVGC 3TNNB 1RJLA 4NGHL 4KK6D 3BPLC 4NQDE 1H8OA 5C0AB 3BP4B 3EO1A 1Q9LA 4QRQA 4WFGE 3LB6C 3L3OA 5FKPA 2CLRB 4JGUA 1OAXL 4MXVE 4EEEA 3CMOH 4XCYA 1SBSL 2GJZA 4W68A 5D7IA 3PHQA 4I2XA 4F2MA 3O9WB 4FFVD 1CFQA 5K9OB 4BZYA 4LCWD 4PD4J 1U8QB 3MRBA 2PTVA 5DDHB 5BRZE 4Y1AB 3BI9X 3V95A 1ZEAL 5DHVA 4OZGB 3X3FH 1AHWB 3QR2A 4XX1G 3TIDA 5MEPB 3MBXL 3KLDA 5B8CC 2R1WA 3KPRB 3RVVC 1YDPA 2PYFA 4JFOA 5D72H 1Q72H 1JZ8A 3VGBA 2EYRA 3LCYA 3VXTA 1UVQB 5IVNA 2OTWA 5D7JD 2VZ1A 1R5WB 1YYMH 1OD7A 3DYPA 1GH7A 4NP4H 4ZOBA 4ODVH 3TP4A 5MHSD 1NDMA 1ZT1A 2HA1A 1UCBL 1K2DB 4OD2B 3DX7B 3EYFB 4G5ZH 4WI2A 1WBZA 3H7LA 3B8YA 3QH3B 4XRCB 3L3IB 4IDJH 2ICEA 4LHQB 5E08L 1T0NA 1FVCA 4AEIL 4JY4B 2C3VA 2CIIA 4F7EA 3GIVA 2V2TB 2F8VA 2VIRB 1W8OA 1AP2B 3NTCH 4M1DH 1A7RH 4JO3H 4XXDB 3O3UN 1W72H 4MAUH 3PWVA 3ARFA 3IFOB 3P9LB 1BGXL 3U46B 4PJ5A 4MXVF 2XKNA 1CF8L 2N7BA 5ABDE 1OP3K 5KSVB 1Q72L 1BD2A 2BHYA 3MXWH 1P4LA 4GRLD 3V5KB 2P8PB 1KFAL 5ID1B 1YNLL 4YXLH 5H8DA 1YEJH 3NABH 3V4PH 2DBLH 2VDQL 3RWGA 2XICA 3F7YB 3LKQA 4S2SB 4NNXB 4ZAKC 4RGND 2NXYD 3EGSB 3QAZC 4YNYB 5BQ7B 3LKRB 1NUFA 4IS6B 1NFKA 3WIHH 4S1SH 2QHRH 3R1GL 5IW3A 1GVIA 4WI4A 1X5FA 5AZ2H 1FDLH 5E9DE 1LMKA 1PKQE 3JSSA 1J1PL 4PJDF 4LCUA 2YEZB 3REWB 4YDVA 4XX1E 1I1YB 2WBWB 1YEKH 3ARDA 3G6JF 4HW6A 4MNGE 4ZTOL 1KG0A 1FSKC 1IGTB 3X3GL 3S88H 4N68A 4WW1A 1FRGL 3T1FA 2YUXA 3VMNA 3HPJA 3D0VA 1AFVH 2I60H 1FAIL 3GI8L 3WO4C 5T3XE 5T1LB 4LGSB 5FKAA 3H9SD 1O5DT 3IDGB 2IPKA 4EDXB 3CLEH 2NCMA 4PP1D 2VB5A 1FG9C 4Y19B 3BKCL 5JW4Q 4OQTH 3HA0A 4Z95H 3EDKA 4WO4B 2MSPA 5IHUH 3WO3B 3IVKA 4G8GE 1JF1B 1I8KB 3EFFB 5TE4H 5JOPD 3MRDB 3K8KA 1IT9H 1S7QA 2ITDA 2WINA 3FOLB 2COQA 2F54A 4HWBL 5AD0B 1P2CB 3QIWB 3VWJA 3W5MA 4A2MA 2BRRH 2UV3A 3QPQD 3MRHA 4P23D 1EEZB 4ZDHA 3E6HB 3QUZD 4XNZC 4QTIL 3ZE0E 5C6WH 5F7UA 2VH5H 1QR1A 1QFUL 1ES0A 5BXFB 2J7LA 4ZPVA 1DJSA 5LG1A 4MMXC 3BQUD 4DUXA 3P0YL 3AAZB 3PWUB 5IHUL 2CR3A 5DD0H 1CIDA 4DTGL 5JA8B 2FL5A 1LHZA 4PJCB 5C8JB 4R9HA 1KCKA 5KJRL 3GSQB 5FYJL 3RDTA 3SOBL 3DVFA 1OP5H 3K80A 1FN4B 3MCLL 4AY0A 4L3EA 5ID0B 3GMLA 1PLGH 4G6AD 3PWLA 3QCUL 4FMKA 2EKSA 2X2YA 1C5CL 3DTXB 3P11H 1F2QA 3RI5F 3CNKA 3RU8L 3TH2T 4LGRB 4NFBA 5JOEA 1MIEL 1R3KA 2DMBA 3RWIB 4RDQF 1MRDL 3SDCB 3PDDA 3GMQB 1MI5A 1TZHA 1KUMA 1VCAA 3P0VH 5F9OL 5CJXA 3BX7C 4JKWA 1BOGB 5TE7H 4NC1E 1PGRB 5IIEA 4Q2ZB 4NRXA 2IQAA 1YN6B 3C5JA 1FIGL 1N26A 2HLAA 4C4KT 3RVVD 2Z4QB 2ATPB 2Q76B 4MAYC 3HRZB 1S7UA 3IJSB 1EEQA 4PJ7A 2R2HA 2YR3A 3N1MC 4S1SL 3QEGL 2GFBA 1L9MA 3LAFA 4OBSA 4R90L 2WSKA 5CMAA 4DVBA 4Q6IB 4PJIF 1FFPA 1I3GL 2FBOJ 1DLFH 5D7LA 1FNGB 1R3JA 2FJFA 4RAVA 3GIVB 2FCBA 2Z8SA 3L1OL 5IV2A 5EIVA 4F7TA 2GITB 2J8UB 1A6TA 2R2BB 1FYTB 4N1EA 1UM6H 4PBVC 4GFTB 2EE2A 1YEGL 1YC8A 5D8JH 1FJ1A 1FLTX 4KRLB 3VCLA 5IW1A 1UWEL 2ZUVA 5JQHC 4F15B 4OFYA 2Y5TA 2AXFA 5DJAB 5SX4I 1A7QH 3MUY1 1MWAH 4GSDL 2VRAA 1FO0L 4GW5A 2HRLA 1MCCA 1ZXQA 1N0LA 1MUJA 4LNRA 1LEIA 4QOKD 2ZSWB 4Y2DC 5L9DH 4WTXA 3S8WA 2ZCHH 1T22B 4ONHB 3ZYZA 2EXYC 1PX4A 4FXKB 1BFVL 1JPGB 3FHQA 4XCCH 2NZIA 4ELMB 4JRXA 1BWMA 4MD0B 3FFDB 4DVRL 3V5HB 3K1KC 3QUYA 3NIGE 1N5YH 3W0WD 2E6PA 2ADIB 4G6KL 4MA3B 4Z7VA 3C60A 4L9LC 3QZWB 5KOVC 3L3GB 3BD5A 5D8JL 3LY6A 4JFQA 3TN0C 4L29B 4FXLA 1AJ7H 5JNYB 4PRHB 1FFOA 1MOEA 4UU9A 3W9DA 3ZDXE 3IKKA 1G7HA 1KG0B 5CBAA 3HC4L 3QDGE 3MLUL 4ODVL 4PJXB 1OCWH 4QCIB 5I74B 3NFPB 5EU5B 4HG4J 3NH7H 5CFHA 1JPFA 3FQTA 3SDAD 4G7VH 1A7OL 4WI6A 1L0XA 4NHUA 2YD5A 3B9KD 4QHNA 4NN7B 4OT1L 3QBTB 1OGAA 4QRPD 4YDLB 4ZO9A 5DK2A 2R4RH 4MJ4A 3SDXB 1XCTB 2ICWA 1IGIL 2OXGA 5GSVA 1XGPA 4J3SA 2CK2A 2YD3A 2DQJL 4WHTA 2EH7H 3U7WL 5CGYC 2HH0H 1IAKA 3B83A 1QPXA 4YDKL 1NLBH 3OL2A 4AEIH 4UNTA 4NJ9H 5BMFL 3MA9L 2JF1A 5H37H 1BHGA 4YDLC 4CW1A 1XGTA 5CGTA 5C09E 4FZ8L 1A6AA 4FFZH 3DVNB 2VDMH 1DQJA 3MQIA 1VEPA 1UXWB 5E1HB 2ERJC 4ODSH 3VMOA 1UEMA 3LH2H 3TVMC 3IS1X 4L8CB 3R0NA 5I1IH 4MJIE 3IFLH 5CIPA 1UB6A 2J6EL 5GS2H 2VDNH 1J0ZA 5ESQA 5JMOC 4F58H 1H3GA 4PJBB 3ARFC 5K9JL 1WBYB 2FL5B 4AYFA 4L4TE 3FOMB 1A2YB 2DLFH 1NEZB 4OGAD 3MRJB 3MFFA 2V7NB 2AXGA 1XR8A 1F8TL 1PSKL 1YMHB 2EDYA 4HPOL 3SGDH 4CUCA 4MXQC 3FB8A 2OYPA 2BVYA 2MJWA 4QTHB 4NOBA 2C26A 2R23A 4ZTPH 4N1CA 5IVXE 2EKSB 1XT5A 2EDWA 2MKLC 3JV6A 3PP3H 2YA0A 5IBLD 3VXQA 4CVZA 2WWMD 4KTEH 1RZJC 4ONFH 4V1DE 1U8MA 3BDYL 1MAMH 1CZ8L 1HHHA 1A7NH 2VO5A 3GJFA 4QLRA 4G6JH 5FA3B 5JHLH 2JIXB 5SX5H 4LKCB 1XF5A 4LF3A 3LRHA 1RFDL 3O3EB 3ZT5A 4N0UB 3RUGB 3T4AA 4I2XB 4F2MB 3FQNB 3MROA 5DVLA 5KBNC 2GJ6E 1U8NB 5DDHA 4Q0XL 2CLVA 5C2UB 3CJJA 2H8PA 4Y19D 4YUEH 2W59A 2AW2A 3W11D 2D7OA 5C70A 4ZSOA 4JKPL 5HXMA 4DZBA 2AJVL 5L2KE 3B9AA 4HFWB 2J5LC 2IFGA 2OR9L 3FQXA 3ARBD 1AGCA 1M4KA 4M43L 4RZCA 3HZVB 3RIFF 3FB6A 3BQUA 1NGWB 4R0LB 4YPJA 4LSRL 2F74A 2ADGB 2YPKA 3B2VL 2B4CH 3WHE1 1K4CA 5E2UL 3P9WB 3M07A 3WFBH 4LRIC 1ZA6A 4G3YL 5F7NC 4AQOA 1FYTA 3O0RH 1RIHH 2VLKA 3QXTA 4GRLC 5GS3A 3KG5A 2C3VB 2HRPH 4LNVA 4Z78B 3LRSB 3PP4H 4DN3H 1G9EA 3HG1B 1KN2L 3QH3A 2X4RB 4YDJB 3KJ4B 4FFZL 1QEWA 4KHTL 2YD8A 5FYKU 3SKOA 1BD2E 2E9BA 2VZSA 3WEXA 4GW5B 4HH8A 1OLLA 1S9WA 2CRYA 2QR0B 1P9MA 2CDGB 4L4TB 1NC2B 1Y18B 1YMME 5GGSY 1YECL 2N7AA 3ILQD 5D2NC 2PUQT 4JFXA 4OQTA 2MMXA 1F02I 1XGQA 1CT8B 2AP2A 3G6AB 1N59B 4JRXB 1DVFC 4XP4H 5LXGL 3HAEG 3MJ7B 5KW9H 1IFHH 3HI1B 3AU1B 4W81A 2J6EH 5F7MC 5GJSL 2FLBT 3LQZA 5MENE 2CGRH 1OGTB 4HWEL 3SE3C 2EDNA 2H2SD 1CLOL 4NZDA 1FVDB 2CXKA 4X4YA 4L3CB 2PR4H 5L9DL 1DQQA 4NQUA 1FL5B 4FFYH 3UXFA 5GS0C 3ZKXC 5MEQA 3DROA 1FL6B 2CMRL 5D9SB 5DC9B 1VB9A 3CSYB 4TTDC 3CLFH 4OCWL 4OF7A 1GHFH 2V2XA 5JHDD 4ODBD 4PJEE 4M62L 4LSSL 4NRZB 3U4BH 5JQ6L 5MENB 3P73A 4EDWH 5A3ID 3OKKB 1F3RB 3W9EB 1PFCA 2FATH 1KB5B 2DIAA 2Y07H 4MA7L 1I8IB 4LVOC 1FPTL 3FO9A 4PJ5D 1DZBA 2APBA 4M3KB 1YY8B 4JO4L 1T89C 1PVHA 1VADB 2E7BA 3MRDA 4BZ2L 2XWBA 4BA8A 5JHDB 4U1HB 1P2CA 3VWJB 5A2FA 1MH5B 4LLWA 4RBPH 3AB0C 3PF2A 1ZA3A 1B88A 1QFHA 5DJDB 1EZVX 1U8JA 5LGHH 3OG6B 3REVA 3TV3L 4MNQB 1KCVL 4PJ8B 1JHLH 3MFGB 4RA0C 3U0PA 3QIWA 3UO1L 5KS9E 2XOTA 3CU7A 2DLTA 3QDJD 4WGVB 1TFHA 1JYXA 3BRDA 1FVEB 1FFNA 5EBMB 2VLKD 1NDGA 4GBXB 3RTQC 2QQKH 5DMIL 3QI9C 1Y6MR 4H20H 2AEPH 5EBWA 3ARWA 1A6UL 3O8XD 1I7RB 2X9XA 2R0KH 2VXTL 5DRNB 3THML 3U1SL 1C7SA 1A22B 1KENH 2FJHB 5F3HA 5FA3A 3BKYH 1NAMB 1CICD 4RMQA 4YFDB 3MYJA 2C4FT 2DI8A 3D0LB 4PFEA 3V6ZB 3RDTB 2EC8A 4PRID 5C0DB 3VI4F 2FBJL 2OTUA 1EGJA 3OKMB 3CVHH 1P4BL 3QNZA 1X4ZA 2GCYA 3TYFB 5HPMA 5FB8A 2O5ZH 1NFIA 3BHBB 1T2XA 3BD4A 5HGBB 1XF2B 1A9BA 1GC1H 3S5LB 4BELD 2B1AH 3QWQB 5DJXA 2NTFB 5FUZH 5J13B 2GUOA 2GW5A 1B0WA 4KZEL 2XRAH 3CH8A 3VFTB 2EYTA 1G0YR 3VXMA 1RULL 1CDUA 3AC0A 5FYJH 4D9LH 4NRXB 5F96H 5F7EH 1AGBA 3VFPA 1NCUA 1IKFL 4KKLC 3N85L 3IAGC 4G8GD 3W2DH 2P45B 1TVBB 4JRYE 2ATPA 2Q76A 3BGAA 5TF1H 2VZOA 3O9WC 1DR9A 5D5ME 3A0OA 3GSXA 3D39A 1JV5A 4LARH 4PJHB 4NCDA 1KULA 4Q6IA 4UILH 4K07A 5B3NA 1QEWB 1ZHKA 1FFQA 2IAND 1HIML 3QISA 4NQCA 4Q97A 1XEDA 5GGTL 4X9IA 3TYGH 3S98A 1QLRB 5IKCA 4H20L 3F6IA 3NGBC 4OQ1A 5EOCL 1OT1A 1U2CA 4OF8A 4ZTOH 3VE0A 5E8NA 2GSIB 4N0FA 5JZ7C 3CUPB 1FJ1B 4U0RB 3GUTB 2MQCA 4ZSOE 4R7NA 1JGEB 4PJFE 1AXTL 1U6AL 4JCMA 4CBPA 5K59E 1AC6A 3MLRH 4O2CB 3QFJA 2XG4A 4M6AA 3NZ8B 5DF0A 4L3CA 1MHCB 2OS7A 3FFDA 4QRRB 3PGFL 4XWGH 1K6QH 3UBXG 4JVWA 4KK9D 4QXTB 1F3DJ 2VKWA 1MCEA 2ADIA 3PWJA 1WBXB 3KHOA 2FATL 3WE6B 5CJ5A 3BE1H 1N2RA 1JWMB 1KB9K 1D7FA 3T4YA 1HSBA 4XVJH 2FYYB 5T5NF 3WS3B 4OV6F 3BGMA 4J1UB 4NQED 1N8ZB 1WJ3A 3EJJX 3W9EA 2H6PA 4KQ4H 1S9VA 1LEGB 4I3SH 1NAKH 3DGGB 2JTDA 4QXUL 5C0BB 4M93C 5CJQH 1F3JB 1N0XH 3HMWH 4PB9L 4XTRD 3SQOL 4LVOB 2P4AB 4PV8B 3RNKA 1FO0A 2APXA 4CW1B 4LCIH 3ZT6A 1CE1L 1F58H 3PL6D 1JHLL 4WJ5B 3D3VD 3W82A 3WLBA 1LK3H 5JOFB 3TIDB 1JUFA 4L8BB 5C0BD 1OTSC 4XCEA 4MNQA 4WV1B 4OKDA 2ZOKA 1F58L 3ARTA 1UVQA 1FNEB 1NCAH 1MPAL 2DKUA 1D9KA 3X3FL 5F9JA 1FYTD 1ADQA 2X1XR 2AQ3A 3SHSA 1C08B 4QWWD 1M05A 1FAKT 4QY8A 1YPZF 3TNMA 5FFLA 4YZFE 3CVIL 1AO7A 2VC2H 1VACB 2YBRA 4NZRL 3NACL 1VGKA 3MUGA 1D5BB 5E1AA 4U1SA 5T1DL 3VG0L 1UCBH 3QIBB 4MQ7A 1Z6JT 3M17B 3GSNA 3KNBA 3T77A 5HDOA 3MRMA 1W72B 4MX7B 4XH2B 1CD1B 5HHOB 1Q9KB 2RR3A 2ZUXA 5C92A 1RZKL 5E8OA 1CFBA 4MHHI 4D9QD 3J7HA 3SKJL 5LWYL 2C3GA 3U4AA 1P4LB 4EXPX 2MCG1 4G9FD 3C6LD 3B2VH 5JPNA 1ADQH 2NY3B 4P23C 1X7QA 3RWHA 1JI2A 4J6RL 5C0ND 3MLRL 5DYOB 3P4NA 1NBZA 3WFHA 4HIIA 4NQCD 2IFFH 2K9UA 4NO2B 1T6VN 5FYJD 3MLZL 3T0XA 3HMXL 4RX4D 2ZNWA 2E8YA 1T6WA 2A1WH 2DD8L 2SEBA 1MCDA 2HJLB 2OZ4A 5C07E 1CDGA 5TH2B 4TULL 1V7NL 5IFAL 1RZJL 1GCFA 1FP5A 2F74B 4PJCE 1MFBL 2JJTA 5I71C 1FH5H 4K7FA 1T3FA 3VA2C 4AM0A 1AI1H 4JAMB 1AO7D 4HSQA 2X89D 2VDKH 4YXKL 5IG7B 3Q5OA 4F9LC 4QKXB 5IQ7L 3F7VB 3ZYJA 5KSAA 2G9HA 1A14L 3HG1A 2OK0H 4P2OB 2NY4C 2DIJA 2LU3A 3O2DA 3WMSA 5IMKA 4BQBA 4X7DC 2GI7A 5AUMB 4YHIA 5CILL 1YJDC 3SN6N 4QNPE 4ENEC 3Q1SL 2YKLL 4M1CC 4MA1B 3SKOB 3QXAA 2VN7A 3O6MH 1E4KA 1HDMA 4YIQB 4O00A 5GS0D 4KGLA 5I9QC 1X5KA 2CDGA 5FCSH 4CMHB 4YHZL 1OY3B 3KYOB 4X4XB 3O8XA 2NX5B 1FIEA 2DBJA 3WV0A 4NBXB 5IVZA 1XGQB 4IOFC 1WWAX 4U1NB 35C8L 1KLUA 4WFFE 5GGSB 5CEZE 4FTVE 4JFEA 3HE7C 1GOGA 2EC9T 3S3PA 5CEZD 3RPKA 4WFEE 5F89A 2DQEH 5J7CC 5I1GL 2AV7B 5DQJA 2WBJA 3BP7B 1S7WB 4NN6C 1RZFH 1TETH 2ZJSH 2C4FU 4GRMB 2X9WA 1QRND 4ZUTA 4HJGA 5B39B 5GRWA 4MNGA 4ORGB 1BZ9A 1P6FA 4NM8L 4Y5VC 4K9EC 2BRRL 4ZUVA 2GT9A 1T1WB 5J89A 3L7FA 4EI5B 4L1DA 4M6ML 3GMLB 1TZIB 2BNRB 3DWTA 4JJ5A 3VGEA 3F65A 3GMRB 4CMMB 5MENA 3I6LD 1A1NB 1TNNA 4CU6A 3NCCB 2FBJH 4XC1H 2V2WB 4RGNB 5E2TH 4ZD3H 2Z8VC 4ODHH 1HKFA 3W0WE 4HKBB 4WJ5A 2CUIA 4OAWA 4X7EC 3BN9C 4N90D 1KB5A 1HQ4A 3MRRA 4R8WL 4C56D 4C56A 5C6TH 1ZT4B 3BYYA 5E94A 2X7LA 4M7LL 5I18H 3LD8B 3GMNB 4LU5H 4KUZH 3KWWA 1H5BA 1FNSH 3IGAB 3RX7A 3VXME 2VDLL 4KPHH 4DUWA 5DJCA 3DX8A 4XCCL 2ILLA 1ODAA 4BQCA 5ACLA 1VADA 15C8H 3SJVE 1W2KT 2A74B 3RWDB 1M05B 3IFPA 5HHNB 4TUJB 4AEFA 4TUKL 3ZDYF 2IBZX 3SE9L 3RHWF 4Y4HB 2EIZB 3CVIH 5ICZB 2XIDA 3GSRB 4BH7A 2F8OA 4ZOCA 3LB6D 1FO0H 3X13A 2CKBA 5IBTH 1GGIL 3U7WH 5IW6A 4DKDC 1CGXA 1G9NH 1EFXB 4KMLB 5MEOB 4NKOB 3AM8C 1QQDA 1Q9KA 1YEEH 2FX7L 3B3IB 4W6YB 4Z7NE 1V7MH 2NXYB 5HDQH 3QXUA 3EHBD 5L2JB 3NOIA 4M3JA 5DMGC 1P7KB 4WCYH 4NN6B 4GKSA 4LPUA 2BJML 4JRXD 1MHHA 4OF5A 3QWOB 2V5TA 1MFNA 4NZTL 5HVWA 5FECA 5FB8B 4HJ0C 4GAJH 4OD3L 5F8QC 5ILTH 3DGCR 1DN0A 1VFAA 4GT7A 1KTLA 3QPXL 3JTSB 1JPGA 3IETB 4POZC 1I7ZA 4WI3A 3NA4A 5KW9L 4D94A 4JQXC 3S7GA 4NZJA 4YJZL 5KS9B 4MA3A 4XNUH 5KZCB 1KIQA 4RGMC 2PKDA 1QYGH 5GIRB 2JCCF 5C0FA 4MS8C 1J9CT 1MJ8H 2MHAA 3IXAA 3TVMA 1EUTA 5CEYB 1A4JA 1OB1B 1MCPH 3W11C 3C5SB 1AD0A 1ETZB 4QHUB 4DGYH 3OKNA 4GQ9L 5IB4A 3EYFA 1KIUA 3ZE2E 4WNQA 1Z0NA 3ZT7A 4QF1A 3QG6A 1AGEB 2FO4B 2PW2B 4HWZB 4JFDE 4P23A 4AT6A 1OAUL 4ENED 2HT3D 1RJYA 1CDJA 1EH9A 1TQBC 3RZCB 3P4MB 2IH3B 2EYSB 1I8MA 1U8KA 2F9BT 4CGTA 4GW1B 2BNUB 4P0DA 1QSEB 1EHXA 2HT2C 1NBVL 3V6OA 4RAUA 3UMTA 4Z7WA 4OLUH 2FWOB 1IMHC 4NKMA 3DX9A 2EH8L 2AV1B 5A1AA 1KYOJ 4ZFGH 4U1GB 5DWUH 1FL3B 2CLZA 2DQTH 4TNVF 1PAMA 4C4KO 3WIFB 4HUXA 3BO8A 4G3YH 2D0HA 1NL0H 3RVTC 3GI9L 1HIMH 4G6ML 2C1PA 3GB7B 3KLHD 4X6DF 5D6CB 2DKSA 4X4ZA 3VD9A 1L7TL 5L2KA 1QNZH 2ESVA 4Y5YB 5I17B 4GAFB 2R39A 4NQDA 1TXKA 2J12B 5JPMA 4FQ2L 5IEKB 1NGXB 2FSEB 3GSVA 1YY9D 4QRTB 4HFUL 4O02H 3R0MA 5CEZH 4D0CA 4GMTL 3BGMB 4PRBA 1BMGA 4QXTA 4YXKH 5CD3B 2A0LD 4XP9L 2FIKB 3CC5A 4BSJA 4OF0A 4MD5A 5JDSA 4FABL 5F96L 3IT8D 1HHHB 3H8NA 1HSAB 1WCBB 4HAGA 4LLMB 4HMEA 1UKTA 2AJUH 5GS0H 4X6EB 1JZ6A 3O41A 4HUWB 3C6LB 1MFCL 5E6ZA 4KKAD 5SWZD 2OMNA 3MRRB 2ENSA 5BRZD 5E5UB 4X7SH 1NCBL 3C5ZA 4H1LA 4M4RA 5M95B 2GY5A 3ZDXF 2DL2A 3OB0K 1Z3GL 1IGMH 2HFEA 4IRSD 5LAXB 1OW0C 4IRSA 1NKOA 3ROLB 4ZODA 3DECA 4P46A 2NW2B 4JKMA 4UNVA 2WWKT 1GGYA 1GIGH 1DL7L 1UACL 5LBSL 2FEDD 3MXVL 2Q7NA 4P49A 3G9AB 2ICCA 4RZCB 2H3NA 4UT6L 1K9TA 1GGUA 4ZS7L 3SDAB 5IQ9B 2I07B 1KOAA 3WNKA 1DBAL 3KYMA 4JQIH 4H5SA 1SYVB 3PDOB 3VD5A 4ZOAA 5SWZE 3BPNC 4KKBD 1B2WL 4I3RL 4J6RH 2FX9H 4X7CC 1NBYA 4K9EL 1QFWM 4TVPH 3LMJL 3GJEB 3HB3D 1XIWA 2PO6A 4X80L 5JR1H 3QUKA 5E8PB 1BQLH 3O6KH 1IZJA 1IJ9A 3PL6B 3TT3L 3H3BC 3UCRA 1F2XK 4YHPA 3V6FA 5DC0A 1P5VA 1DDHB 3QA3B 3S34H 1K8DA 5DJZA 1HH9B 1S8DB 4P3DA 1NCAL 1N4XH 2B4CC 2KL6A 1KLGA 2MPAL 2W1NA 4R0LC 1FPTH 3RKDD 1KCSL 2V6HA 4YQXH 3MREB 3QI9B 2B2XL 2CUHA 4NO3B 1RD6A 4OLYH 4HGWB 4OUUA 1QLFA 3PL6C 3QDJE 1DFBL 1Q9WB 1ZOXA 5EORL 1RUKL 4Y1AE 5GIRA 5H35B 2J88H 5I8EB 4X83A 1AC0A 3MRGA 3U4BL 1MFAL 4U0RC 4LHJB 1LK2A 3SQOH 3P77A 4JO2L 1UJTA 1H0DA 4F9LA 2Q86B 2XT1B 2NYYD 4Y5XA 2XTJE 4U6HA 4XVTL 1U8QA 3G9VA 5DFTA 1BF2A 3H42L 5TH2A 3MGTB 3S6CA 4HIJA 4I0PB 4WIQA 5L8LB 1L0QA 3F7VA 3HUJF 3MV7A 4JG0H 2Y06L 3UTZB 1T5WB 5BV7C 2DQHL 4HPYL 1X3DA 1G1YA 4JAMA 4CAGA 1PKOA 3JWDL 2Y6SC 5D1ZB 5F88A 5ACMA 4P57B 2OJEB 3I84A 1BVLA 2NY6D 3MNZB 2IWGA 3FO9B 5CKAA 5C0CB 1QHOA 4RISH 1KLFA 4R2GC 4WHYG 1YMMB 4ESKA 1DL7H 3FN0H 3WIFA 4YHMH 1Q0XL 1MIMH 3IAPA 2OP4H 3ZKSD 3KPQA 3ZSTA 5CZXD 5GJSH 5D2LB 4YR6B 4R4BA 3TZVB 3L9RA 4P9HH 4E0RA 3DYMA 3GB7A 4H25B 5GGRA 2Z0BA 4KQ3H 3QNXB 3DHMA 4PY8J 4NGHH 1KJ2L 4KJQD 2I24N 4Y16D 4WI5A 2D0FA 4I48A 3BP6B 3E0GA 1GGCL 1RUAL 2R1YA 3BWAA 3WN5A 1FVEA 1D5XB 1DUZA 2YK1H 2ZCKH 1WZMA 1C5CH 1HYRC 1UG9A 5INDA 2NNAB 3OR6B 3SGEH 4PJAF 1JI1A 2H45A 5DMYA 2FIKA 3JBG7 1LP9F 1MCWW 2CLRA 1RI8A 3Q1SH 4GRMA 3TT1H 4KKCC 1A1NA 3LPGA 1H3XA 1PEWA 4ONGH 3FFCB 1IAMA 3MR9B 4U1JB 1AO7E 3QFJE 4NQVB 3GRWL 1R0AH 2OTUB 5KANG 3KLHC 2W0LA 1T1WA 3TH4T 2R4SH 4NKIH 3TYGL 3MJ8B 4WO4D 4JDVB 4UMGA 1JZ5A 4LAQL 5C1MB 4I0CC 3CFEB 4FZEH 2XTJC 4M43H 3KPRA 25C8H 1G7MB 3IJHB 5K9OA 4YHLL 1CICB 2JCCB 2GUOB 1RHHA 3VH8A 2D7MA 3UTPE 4M6OL 4XHJC 2A0LC 1DVFB 2ZPKH 4JKPH 3TF7C 1UZ8A 2WK2A 3SBWA 3UEZA 2WBJC 5HHVH 3GNML 3OXSB 2R1WB 2P8LB 4Q0XH 2V7HA 5T1LA 4Y5VA 5FKAB 1PZUB 1H15B 1HN1A 4YWGL 3MRCA 2ICEB 3C8HA 4FQ1L 5CIPB 5BS0E 1GGCH 5E9DA 2F19H 4XCNB 1SVCP 3WD5L 1NGQH 3GK8H 3S35L 5L6YL 1GC1L 1V3LA 3ULUC 3ARRA 1TCRA 3U6RB 2DLFL 2YA1A 4YHYC 4FQPA 3GJEA 2EEAA 5MEOA 3IFLL 3S9DB 2EIZA 4DEPB 3B8SA 3S37X 3QRGH 3FL7A 1B3JA 1QRNA 1U91B 3QIWC 5FF6B 3R4DA 3MV9A 3FQRA 1P7KA 3LOWA 3BGFB 1UADC 1EAPB 5CINL 5ID1A 1GRWA 2PW1A 1H3PL 4XPTH 1BX2A 5HVGB 4WGWB 1U2HA 1IGCL 3ZO0A 3J8F7 3BYTA 3S36H 2B39A 1XZ0B 2P8PA 4E9LA 1KB5L 3WIHL 4GXVH 4EN3C 2R8SL 3GSUB 3RWGB 4ZUWB 4MXWH 2DQIL 3QUMH 5FECB 1PQZB 1HNFA 1MJ7H 1AXSB 2XNAA 3UZVB 2D03H 3FMGH 1F11A 3U30B 4LLYB 4CVXA 4KKNA 4UOW0 2MTPA 5C0CD 1WAAF 5D71H 4JHWL 1S5HA 2J8HA 4FXGA 5EOTA 2G2RB 5CP3A 4MDJA 4TYUA 3PWJB 4I0PA 2UZXB 2MPAH 3FKUS 4R26H 2CDFA 3U9UB 2O5XL 3BT2L 1GHFL 1BIIA 3AMLA 5HHOE 3KXFB 1WCQA 1OM3L 1ZWIB 3ME0A 3HRZA 4HLZH 1WSST 1F13A 3ZMRA 2BJMH 2X89A 3P4LA 4FFYL 3GMOB 3O2WL 3Q6FA 4PJDE 2DWDA 4X5LA 4D0DA 2IAMD 2Y07L 3CVHA 4MA7H 5EUKB 3VFMA 5I19H 1A6WH 1WZLA 4JDZB 3LN9A 5FGCB 3JTTB 4TSBH 3ZDYE 4PREB 5EN2A 2GYSA 3WFDH 4LCWB 3WEXB 4P2QE 1X44A 2YRPA 1LO3L 4MQXD 4KK8C 3G08B 4X5XB 2WINB 3KPRE 1OF2A 1HKLH 1PKQA 4TVSa 5JOFA 5CLTA 3G6DL 5I8OL 1U8LA 4HCRH 4LK4A 1YEHH 5ESVB 2ZCLH 4DJMA 1Z2KA 3QI9D 1S7QB 4ZOEA 3DX9B 5T3ZD 2FH6A 3KYKL 5HGAB 1M7XA 4KJQC 4Y16C 2PXYC 4NP4L 2ZG3A 3GEWB 2OI9C 4FS0A 1K4DB 3L1OH 4ZDHB 1J0KA 4XB8A 3S37H 4JM2F 4QY8B 3QEUB 3KPOB 4OLWH 1K6QL 4KUZL 3TNMB 2NNAA 2BX5A 2MOVA 2ZSVB 1FGVL 5DJYA 2QLVB 5LGKA 2QHLA 3ZKQD 3BMVA 1NCCL 2BMKB 2BY3A 5CHNB 3QIBA 4Y4FB 4MD0A 1EO7A 4PYGA 4M8QA 5GS0L 1CDCA 2JB6A 4BUGA 1IGYA 2OL3H 1DEEA 2XKSA 2C9AA 4NWUL 4JHBA 1U3JA 5DS8A 1AXTH 4JPKH 3STLA 4N1HB 4TNWK 3NZHL 4D2NA 2F58L 1JNJA 4WI7A 2R56H 4OZIB 4M6NH 1L4IA 3QHFH 4G43A 1UM5H 1HHGA 1S5IH 5DD1L 4N9OB 5HHVL 4OGYL 1J1XH 3C5ZB 5GGVY 2DLIA 2JIXD 3BPLB 3TBWA 4F7PB 1OAQL 2I9TA 2UWEE 2ZNXA 2CSPA 4GJTB 1MHEA 3FT3A 4AZ8A 1UJ3A 4H1LB 3F12A 4K3DL 5E5MA 5EB9A 1HHIA 1RURL 5IMMA 1FNGA 3CFCL 1YN7A 4E41A 4OZHE 1I8LC 5ITBL 1J1XL 4I5BA 1MAML 1MRDH 5HGGS 1K5NA 4AM0B 2DWEB 1MFDH 1R3LB 5D7JC 4I8DA 1LDPL 1VFOA 3SDYH 3T09A 4C58B 2VL5B 3GIZL 4MNQE 4FHBD 3WXVL 5H2BB 3KPMA 1SYVA 2P8MA 1CU4H 4RGOH 3MV9B 5CSBA 2XZAL 1MCFA 2OJZH 2PO6B 2VDKL 1YUHB 2PNDA 5DHYB 3EO9L 5ESQB 4AJ0A 5ACZB 3CH1A 1S9XB 3RL2A 5C0RH 1LDSA 2DRUA 1EJOH 1I3VA 5HGDA 3D18B 4JPVL 4MD4B 3UJIL 5BW7A 4WV1C 2VDNL 4NQXB 4Q9RH 2LVCA 4LIQE 1XZ0A 4NHCH 3LN5B 5GJTH 4PGDA 5C09A 4C57C 4ZMAT 4B7IA 2HVKB 2RQ8A 5TQ2H 5J6GB 3GSUA 4LSQH 3RL1A 5DLMH 3V5KA 1WFNA 4RMSA 1AE6H 4HWUA 3D5OF 3RWFB 4FG6C 4P5TD 4Z7VF 4JFHD 1BECA 3EOBB 5I75B 1MY5A 1NC4B 5TE4L 3ARPA 1RIVH 1UENA 2JIXA 2H26A 3CIQA 1C16A 3H6JA 3LN4B 5F1SA 3TA3B 1QSED 1N6QL 1CGUA 1MRFH 4PRHD 2RJMA 3MLXL 5EWIH 2FEDC 2PO6C 3VXSE 4NN5C 3AGVA 3QDGA 5E0QA 5EA0L 4E42B 4JVPA 1BZ9B 2NR6D 1VFUA 3ZYIA 3UPCA 1I9IH 1G7HB 4YAQB 4X6CB 4EI5A 4HFWA 1BAFL 2EDBA 5MERB 4GKZA 2R2EB 2BRQA 5D1QB 1QKZL 3A6OA 4PUBL 5FGSA 1NAML 4JDZA 1JF5A 3DIFA 4QXGH 2R0LL 3BZFB 4DGVL 1E4XH 3O4LE 4EXKA 4PY7A 2XQBH 1KIPA 2C1OA 4F7CA 3EYUL 1T03H 3QPQC 4HXBL 3UTTB 5ADPL 1T5WA 2Q8AL 3QUYC 4XHQA 3RA7H 1H8NA 3SPVB 4DN4H 4TOYL 4GW4A 5JXED 1E28A 4WU7B 3N1GC 2DDQH 2LQRA 2D4DA 5KZCD 2XG5A 1TCMA 1GOHA 4XGZA 2UZYB 1INEH 1TQCB 5ECJE 5GRVK 5F7KC 4N5EC 4C55A 4K71B 3T2NH 1XGYH 2VLRD 1VENA 1JGDA 3RAJL 2JK5B 1KJVB 3VXSB 1T0MB 1S9WB 2HT4C 5FYKE 1RVFL 3LKOA 3I2CH 3V7AG 1I75A 4MAYD 3WIIH 5CP7A 5I18L 2G60H 5GRUL 2WZPD 3MFFB 5TJWK 2DQCH 3BP6A 2KPNA 3GSRA 1CFVH 4BH7B 4PRIA 3TZVA 5F8RC 5IVOA 3IYLW 5IROC 4ACPA 4BH8A 1LEKA 3MRJA 5D1XB 1UM6L 4HBCH 4ZXBB 3KXFE 5DS8B 4EBQL 1B2WH 1QP1A 2R1YB 2UUDK 3BWAB 3WN5B 3BE1L 1FZJA 3VI3E 3T4YB 3HMWL 4KK5C 4WWKB 2VLJD 3G5VA 4JO1L 4LLVB 1ZE3C 2PCPB 4K2UH 1ZHBA 5CCKL 4NHCL 5GJTL 2GKIA 4KHTH 3DV4A 4HDIA 5FGBA 4CVZB 3BH9A 1N5AA 3IDMB 5D7KE 5INCB 1S7RA 2X4NA 3IDNA 3EOTL 4XP4L 2WAHA 5ITFA 3BVNB 1U8NA 1EJOL 4HXAH 4HS3B 5BZWB 5HYQB 2DMCA 2LU4A 4WTWA 2ENYA 3GGWA 4K7PX 2A6JA 2ERJB 1JNNH 1EEYA 3N1PC 4KV5F 1KEML 1DCLA 2OTPA 3JTSA 3WNNA 1R3KB 1NEZG 3GBNL 1KNOA 1M7DB 2YC1A 2YSSB 4DWHA 1CICA 5TQ2L 2BOCB 2HFFA 2Z91A 3NAAH 4JQVA 5EU6A 4OCRH 1ZEAH 4JZNB 3OR7A 4K8RL 4LQ1A 5IVXB 4E41B 5JZ7D 1IGFL 1G0DA 3NCJH 3BW9A 4IMKC 3IJHA 4U0QB 1B6UA 4J12A 2HN7A 1CYGA 3JV4B 1MJJB 1DUYB 2V9QA 1LE5A 1KPUA 3BQUB 5EZLA 3DMMA 3O6ML 2Y36H 3C8KA 1OAYL 3V4VL 1P4IL 1AGFA 1C08A 2BP3A 3LRSA 4J4PA 3GIZH 4BKLB 4WNQB 2YMXH 9CGTA 4EI5D 4UDTA 1F4WH 4MWFB 4AT6B 1R3JB 3B5HA 1JGVH 3EYOA 1F6FB 4M02A 3RZCA 4XXCA 3W2DL 2H9GA 2YMXL 4OGXH 4B7LA 3FRUB 1HQRB 1GZQA 4P4KB 2Q6WB 2BNUA 3FFCE 4Q9RL 1CD1A 5B39G 4WDIA 4O2EB 5F7EL 3SGJC 1KTDA 1F00I 3I6GB 43C9A 1E27B 1Y18A 5T1LD 5F44A 1RFDH 3VI4E 4PGBA 1F6AA 1VSCA 4IOSD 3O6LL 5SV3A 1IT9L 2XN9B 1QA9A 3MLTA 4PJFF 5ADOL 1WIOA 4OM1H 3M45A 1GL4B 3L3KA 1TTGA 3JUYA 3QHFL 2XNAB 4QHLB 4FXKA 3UDWA 2DM3A 1JGUL 2Y7QA 4UTAL 2MNUA 1I3RB 2GTZB 2A9ML 2IANA 3L3HA 3TN0B 1N3NA 1OGAD 2SEBB 4QRPA 5ETUB 5ENWB 4DGIH 4KROC 3QQ4B 3BIBX 1KCUL 2R0KL 4PRNB 4HHAB 5F93C 4P2OD 4XBEH 1A3RH 5I8CA 5I30H 4K7FB 1FL5A 4KXZI 2E3VA 4G9DB 5DMIH 2A1WL 4MDJB 4J8RA 2E8ZA 4R97B 3BKCH 4U6XA 3ZE1F 5CZKA 2EEBA 3GHBH 1F4YL 1SMOA 3SCMC 2J1KA 3O81A 5FCUL 5BS0D 4XPBH 1FCGA 2W92A 3QXWA 5EOQL 4S10A 2VMFA 4KROB 4PRPD 3VGGA 5A2KH 1DSFH 1BIIB 1AH1A 4I18B 2H2SC 4AG4H 1FAIH 4PREA 4M7KH 5GRJL 1NUDA 1QYGL 1AQKL 2VXVH 5HJ3A 4DCQB 1C5DB 2AKRB 3PV7A 1BQSA 1WC7A 3UYOD 5F71A 1I3UA 5B38G 4GXUM 3VXSD 5EUOB 3JVGA 2A38A 1WWWX 2ITCA 3VFGL 1X5GA 1SJXA 2WUCL 2Z8WC 5BRZA 2X4UB 5ERWB 3FJTA 3SDDA 2CO6B 3LKOB 3QULB 1T7XA 1KT2A 3MLSH 2X41A 4CNIA 3KPPB 4R7DB 3HPLA 4Z77A 1PKQB 4X4XA 1CXHA 1FYTE 4X4MA 3HMXA 5IHZA 4G9FB 3HC4H 3MLUH 4N9GB 5ESAB 4N0FB 5AG8A 1ZLUK 2P44B 4M5ZH 5DEFB 3VW3L 1T1ZA 3TWCL 5IFHL 1QRKA 1G6RB 4X5WB 1JGEA 1CFSB 4J3VA 4P3WA 2W65B 5LCVH 1A2YA 4EUPG 4L5FL 1VERA 1DEEB 1KGCE 2ED7A 1XIWB 3ILPB 4YO0B 1CXLA 4MJ5B 5EZJB 1T04B 5JHDE 4OFIA 4Z9KB 5F21B 3STLB 4QRRE 3HG1E 3DHJA 2XWJB 1G7JB 4MAYB 4XP6L 5EA0H 3I3BA 4G9FE 3AS0A 4LDLB 1K8DB 2ORBL 3MLSL 4FQJH 3JXAA 4PG9A 4MQSB 1J5OL 4Z0BH 3WHXA 2NY4D 4WY7H 4KU1A 4JKKA 4OFDA 4APQC 2IH1B 1IC4H 5I66A 2V2WA 3QO0B 2XFXB 3IDJA 3ETBF 3TT3H 1CDBA 5KSUA 2LU7A 1H3TA 3QUXB 4LPXA 2FYYA 3TGXA 4BFGA 12E8H 1MQKH 2AI0H 2EYTB 5CD5C 3OKOB 3IRPX 4N0UA 3RUGA 3PGDB 3ZE2F 5IVXA 5I8KL 3QG7L 4KK8D 2EXWC 5HGBA 3DI2B 1UACH 3S35H 1MCQA 3UTQA 5L7XH 3MRGB 3GMNA 2QADB 5E7FA 1B9ZA 1CGSH 4LLDB 4ZSOB 1BJ1J 4EUPA 2E7LA 1QSFD 1ZT1B 4JQIL 5SWSD 3EYVB 2DLEA 1JBJA 4HWNA 4F80A 2GJ6B 3AB0B 5D1QD 5ANMB 2LVEA 3H9HA 1EHNA 3Q3GB 1ONQA 4JANA 4MWFA 1DN2A 1OL0A 1CXFA 5C0RL 5KVGH 4XPBL 4TQEL 1KB9J 1J1OH 4XCEB 2ADGA 2YPKB 3DUSB 3KJ6L 3FQUA 5E9DD 1MVUB 5IHBA 1CE6B 2YPLD 4GG6B 3RI5K 2HJKB 2W9DH 5KSAC 2X10A 5E6YA 4U1MB 4WO4C 3KGRA 3MNZA 2XZZA 2EE6A 5HGDB 5CUSL 1FIGH 1NC4D 2Q20A 4RIRB 2CD0A 4ZFOA 1BD2B 5DZOA 1RU9H 4Y5XC 4TSCH 1HHKA 4NYLA 5E8NB 4X7TB 2A73B 3GSWA 5KN5B 2P43B 4NQSA 3W0WA 4G6FB 3OAYK 2A6KB 3JWOC 5DD3L 2H1PL 4B41A 4WU5B 5I1DA 2X44D 3KPQB 3U36A 3KNBB 3T77B 4OI7A 1DBMH 3D69A 2QL1A 1TJHH 3NN8B 1WLHA 4R7NB 1LO0H 4R4BB 3RVUD 2HTLD 3QQ9D 4Z0XA 5GISL 2AVGA 2BZDA 3B9KA 1OPGL 2WQRA 3TFKD 3QNXA 2XRAL 4GO6B 4N8VA 3QFJB 2H32B 1QACA 4RMRA 5J11C 4OIAA 1IGFH 3MV8B 4PTUA 5HI5D 5E4EB 5IM7B 4OF6A 5FO8A 4MNHA 1CG9B 3GI9H 1C16B 4N8CL 2YPVL 1OSZB 3MJ9H 4G8EB 2DM4A 4X4YB 4RGMB 1L0YA 2JELH 3NIGF 2FNBA 4H26B 4P5KB 4YHLH 1QD0A 4KZDH 4H1LH 1T5XA 3QFJD 3DROB 1AGEA 4HPOH 3DI3B 1E4WH 5A2JH 2I60L 4EKXA 2NPLX 1WAAE 5DQ9B 1EO5A 4YAQA 2VNCA 3ALWA 4FOMA 5MI0C 1IM3B 5HJ3B 3TO2B 1KJMA 2BSTB 1PJ9A 2NY0B 1QTYT 3GM0A 4NRZA 4G8IA 1U8KB 1IM9B 3QJFA 2A9NL 2QSCH 4Y19A 4WU7A 3DIFB 1OGAE 4LSPL 4ONGL 3MV9E 5EZOH 4FQXC 1KPRB 3RNKB 1QBBA 3NIFF 3EFFA 1I8KA 1JF1A 1Q0XH 1AHWC 4XPHH 4JN2B 5ALCL 5SWQA 3T04D 1JPTL 2BCKB 5CEXA 1WVZA 3LPFA 4G80A 2FX8H 1JP5A 1CFTB 5HI3D 3MBEC 1BBJB 4XWOC 2ARWA 3X3GH 4XAKE 5HVHC 1BJ8A 2FR4B 3NCYP 2GK2A 1B0GA 3AY4C 5CCKH 5FO9B 5IROA 1AY1H 3V4UL 4HUUA 4L4JA 4BFIA 1KJ2H 4PRIB 4DW2H 2O5YL 2GK0A 2Y06H 5FAAA 3VWJC 2IAMB 4PJCA 1VPOL 3ARGB 4IMLA 1Z5LB 1A7OH 1UXSA 3AROA 4N0CC 4HKXA 4OT1H 3GBNH 2MFNA 4MJ5A 5LGHL 3UZQA 2IQ9L 3KXFD 1U91A 8FABB 2OX5A 1K3ZA 3GHEL 5DJ2A 3UP1A 4H0IA 1ZHBB 1IAIM 3HHRB 2KBGA 5BV7B 5ILTL 5E2WH 1A1MA 1WK0A 3TO4C 4WHDA 3OJMB 5INCA 2VABB 3HE6A 4OLEA 1HSAA 4CADB 3O45A 3VXRE 5D5MA 3ZTNH 4M8VA 5HYQA 3T2NL 3ULVC 3NFNA 5KVDL 3MPCA 2IQAB 3C5JB 1V3MA 1ZLSH 4XVUD 4QHKJ 5K9KB 3EUUA 4JG1L 4LCCC 5FKPB 1A1OB 4XHJD 4D8PA 1Q8MA 3ZHLA 2OL3B 1K85A 3O4LA 3LPWA 5D4QA 4MB4A 4NT6A 1S7UB 3IJSA 1G9NL 1EEYB 3H42H 4EI5C 5JUEH 2CGRL 2F53D 5TDOB 4I77L 3T0EE 5A43C 3BW9B 1E4XL 5D72L 5FA4A 4PGZA 1BEYH 1U42A 5DT1H 2Y6SD 4JO2H 3Q3GA 4JANB 4LCCB 4MJID 1IQDB 2JJWA 5SWSE 5JLZB 5EDXA 1CDYA 1VA9A 4K9EH 3B9EA 5EO1A 3I75B 2AGJL 4KY1L 1I1RA 3MRIA 4XVJL 2GITA 1A3LL 1OAKH 5HDLA 4KJPD 5KVDH 2UVEA 3MLXH 5EWIL 5EIIA 4U1MA 5JXEC 2F54D 1NDMB 4Z7WE 3DX7A 2WNGA 1JV5B 4MLSA 1EFQA 4LVHC 3VFMB 5J56B 5T33L 1Q94B 3IKCA 1KN2H 1GGBL 4RWHA 1GZQB 5HY9A 3JTTA 2GQHA 1ZLUH 1EAJA 4X7TA 5F9WB 1CGWA 5TGBA 4YHOL 4KI1A 1PBYA 2XKNB 4MB5A 4I18C 3MCG1 3DX6B 5HI4D 1IAOA 1XGRB 4YGAB 3FO2B 4JFPB 1D6EA 1ND0A 5C08A 3ARFB 4KK9C 4HS8L 2XN9D 2FEEI 3F7YA 4OZGF 4JQXA 4AH2B 3E3QE 4PJ7E 4OZGE 4GMSL 5C71A 3QIUD 4QHLA 3VRLE 1S7WA 4JZOA 5J11B 1TETL 2ZJSL 3L3HB 4HZLB 4F8QA 2CO7B 4P4KD 4ZUTB 1ZTXH 1J05B 5FV1L 3LS4L 5JNYA 3P11L 2DTML 1S7VA 3NFPA 1KXQE 2DQDL 4U7SA 5CHNA 3VD3A 5IJVB 2EDHA 4P5TC 2B5IC 4UNUA 2LFGA 4H8WH 4S0TD 2BNQE 1OAQH 3A6CH 2YA2A 4XBPA 4XNQA 3IU3A 4JKLA 4H0HB 1NCBH 4JFZL 1X6LA 1IGTA 2W0KA 1XAUA 1NMAL 2HT2D 3SO5A 3GBML 4K94H 4ZG1A 1HSBB 5T3ZL 1M71A 3B6SA 1EXUB 2W9EH 3B9DA 4W4OC 1OB1A 4Z7QF 5F7DB 1INQB 1AD9B 4PRAA 5EBLA 2HJFB 1F3JA 4M48H 4HWBH 1CU4L 2CUMA 4RGOL 1QSEE 3ZHKA 1C8PA 2M2DA 3D0VB 4LVNC 5AYQA 4KJWC 4NBYB 4U6YA 2X4TB 4P9HL 5HHME 3IRZA 1S5IL 5DD1H 1RZ7H 5ERWA 3X17A 4UBDC 3QDHA 5E94B 1EZVY 5EOCJ 3Q48A 3LH2L 5IBUG 1FQ9C 5EUOA 4JFDB 5D2LA 5SWZA 3O2DL 4BFIB 5IHZB 4UOW1 1REIA 5FDYA 4RAUB 4HS6A 5FO7B 4H25A 3OAUH 3FOMA 4UI2A 3VWKC 4CNIB 1LQSR 3D2UA 5T5NG 4M7ZC 2AEPL 4Y4HA 1YMHA 2BHUA 4TULH 4X5WA 2CDEA 1U8IA 2Y36L 3D85A 4PYHA 3CXHJ 4N0CD 4KMTH 1U3YA 3MJGX 2VLJA 4NNYA 2EO1A 1FFRA 2ZKHH 4J3WA 4ZFGL 4EIZC 1X5JA 1VACA 3D85D 2GSGB 4MJIB 4NQDD 1V05A 4JO4H 5E1AB 3K46A 2ESVD 4PG2C 3PWLB 4NC2B 4ODUA 3U83A 5L2JA 3BD3A 4CJ0A 2R56L 4NQXA 5I17A 2R69H 2XPGB 2JJVA 2DQUH 3LIZL 1KJ2A 3TZVD 4YH6A 1LO5B 1JYNA 4XAKD 3E3QC 3GSVB 3HR6A 4QRTA 1NLDH 3QWOA 2R0ZL 4PJAB 3LKSB 5E8DL 1WZKA 4ELKB 1KELL 4CU8A 3FHAA 1ERNA 1TIUA 4LLQB 3VFRB 4PRDB 3WSQL 4LASL 2QQLH 4IM8A 2ADFH 2FGWH 3CZFA 5F7FA 4UINL 4PJ9D 4LCYB 4PJDA 5T1DH 3SBWC 4LLMA 3BKJL 1VESA 3QQNA 1A7BA 5CIPH 2FDBP 3OKOA 5DUMH 4W4NA 1SM3L 2VUOA 1IQDA 5I1AA 1DLHB 3WFDL 2DB8A 3SY0B 1QG3A 2VLRE 3DVGB 3L5WB 1SY6L 3I75A 5HHOD 3EDDA 1MREL 5T1KB 2FO1A 3BESR 4XAWL 2VDLH 4HUVA 2O93L 4U7MA 1PW3A 2H2PD 1YEHL 1BQHA 1YNLH 1YDPB 4JFOB 4GRWF 4OD1H 2PYEA 4NUGH 4QHUA 1UB5A 4JN1L 4Y4HC 2OSLB 1GPOL 1MVUA 1E4XI 3QT2A 1Q38A 2VZUA 3QG6B 2VLKE 1FE8L 3HKFA 1A5FL 5DHVH 3OX8A 2B0SH 4UQ3A 4WUUE 4UV7L 3PUCA 1YYML 5FUCE 2VAAA 5IR1B 3UTTA 1NC2A 1MLBB 4NKMB 4XP5L 2WQ8A 2EYSA 1I8MB 2AJ3A 1B6DA 2X1WL 1J0YA 2H32H 1E28B 2UZIL 4OIIH 3VFUB 5CBEA 3ZTJH 2IG2L 1QSEA 2CK0H 3W0WB 4I0PC 1KC5L 4PS4H 1IFHL 5IB3A 2ADFL 4MXQD 4XXDA 2GEEA 5E2WL 5DJAA 3WJJA 3INUH 3T65B 1HDMB 2F19L 1I9JH 5E8DH 1HZHH 2ARJB 4S0SD 5JW3L 2K3TA 4X6DA 4WWKC 3KYOA 4QOKB 3QUXC 4MCYA 5HTSA 4UQ2A 4XMLL 3NMEA 4DKEL 2FECI 1QO3B 4X6CF 3LEXA 4G7YL 3MOAH 4UINH 1HOCA 2FHCA 1KLGB 2HAZA 1MEXH 2N4IA 4PJIB 1S5HB 1RK0B 3ARSA 4QHKI 5EOTB 5D7IE 1G7IB 4V1DD 2NXYC 4PJXA 5DUPL 1KXTB 5EC1A 3DVIA 3VGAB 1BF8A 2FHBA 2M1KA 4XZUA 1RJLB 5I15L 5CSGA 4JE4B 4LAQH 3CMOL 5DR5L 3O41B 4HUWA 5IMLB 1ZWIA 4PRBB 3SKMA 3BH9B 3BUYB 1JNLL 1H3PH 2YEZA 3RBGA 3V52L 3REWA 4XC3H 5F7YC 3FQWB 3BKMH 5EOQH 5EU6D 3R06A 2WANA 3QDMD 4P3CH 4ZYKA 3GKWL 2J8UE 2X4TA 1MIEH 4NO0A 4JN2A 5SWQB 1ZVSA 4Z7QE 1CL7I 1XGTB 4Y1AA 3F62A 3PIQA 1HEZB 2ZCKL 7FABL 1KCUH 1KPVB 4NM8H 3SGJA 2P47B 1NGQL 4S1RH 1I7UB 4PJIE 4HS6B 3MLVH 1UYWH 3KWWB 4X6CE 2E6QA 2KZWA 4HD9A 3WFCL 4GBXC 3IGAA 5CWSA 1N7ML 4N8CH 4K7PL 4OV5A 3GRWH 4NUJA 4OD2A 1UWGH 3QCVH 4JM2C 3WS6A 5C9KA 5J57B 2V7NA 2JJSC 1JZ3A 5ICZA 3M8OL 3HI6H 1FH5L 4XVUC 3VRLF 3AREB 4P2QB 4RISL 4M8QB 5E95B 1G7LA 4K8RD 1U0QA 2AEQH 4ZPVB 3D0LA 1J0IA 4NKOA 1NFDA 3HE6B 4FNLH 4QHMA 1NLBL 1CD9B 3CVHL 3VFNB 4ZO6A 1DE4B 3FCTA 1NGZB 3CLEL 2GCYB 3OR6A 1PZ5A 1G6RH 1Y6NR 1QLFB 1UT9A 4FZ8H 3V52H 3PV6B 3KS0J 1J1PH 2LAGB 4JFYB 4JZJC 5H35A 1IE5A 4JEGB 4BK4A 4WEUD 1KIRA 5DJXB 2W0FA 4M00A 1IVLA 3T0BA 3HLAA 3HI5L 2H8PB 4P48A 4ZUSA 4M7JL 3BP5A 3NIDF 2F5AL 1DQDH 2KH2B 3L7EB 1I7TA 1J8HB 3AM8A 3MO1A 4B50A 3F8UB 4JDVA 3L5WA 1GGBH 4W6WB 2Z31B 2CLVB 4KVNH 1J86A 1Z9OA 5KAQF 3K8MA 4IOIA 3K4DA 1NGWA 5JW5A 1A6VL 3U9PH 4ZPTA 1B0RA 1G7MA 2NLJB 2YD9A 4RGNE 1J0HA 1UB5B 5AYUL 2NR6C 4PJFA 1IC5L 3K81A 2EDQA 3ES6B 3C87A 1DVFA 4DAGH 3G04A 2ZWLT 3X11B 4RFNB 5JLZA 1OCWL 4KHXH 4O2FB 5CGYD 2WWKO 4ZXBC 1JJUA 4Z78A 4ZNEE 5EO1B 1C12A 5CMAB 3NTCL 4DVBB 4QWWC 2C4XA 5HPOA 2P8MB 4YDJA 4DGVH 3DYOA 4YE4L 2FJFB 3GDBA 2VXQH 3Q2CA 1Y6KR 5I1KH 3SKJH 5LWYH 5FYLE 2XACC 4PGJA 1NAKL 4JRXE 1CFNA 1FORL 3QDAA 4MD4A 1ZVYA 1XGRA 5MHSE 2AJYH 2MCPH 3IVKB 1M7IB 3BSZL 1R3HB 2MWCA 3LEVL 5KS9F 4AH2A 1A6WL 3RKPA 2HG5B 4U1LB 5LGJB 3TJHC 4MZ2A 1HNGA 3NZ8A 5C08B 3HNTH 1PY4A 1MUJB 3DO3A 3MBXH 2W0PA 4GSDH 4LNRB 4LEOA 4L8DA 3BO8B 4KVNL 1T1ZB 4YHKL 3EBAA 1RK0A 4LRNH 4KH2A 3IB4A 2DS4A 1VKXB 2HKFH 5F9DC 1CL7H 5F6HJ 3O6FA 1RUKH 4YGVA 1UH2A 4KAQH 4X7FC 1QUNA 4JM4H 4PJEB 3OB0H 1RZIB 5HYSA 3FRPG 5C8JA 4XZUB 2XYCA 2BNRD 4OSUH 4IRJC 1OAXH 2BC4B 4MCZB 3U82B 4J1UA 1QSFE 2VDRH 3CSYA 3SE3A 1LWRA 2O5YH 3FAWA 3MJ8A 1T21B 2RFXA 3MLWH 4HV8A 3TN0D 1MJ7L 4FP8H 2NZ9C 5C08E 2G2RA 5SWSA 2F5AH 3HS0A 2BY1A 4FG6D 3ZKND 4NOFA 4XTRC 3PGCB 5ICYB 4KKLD 3G6JE 4F7CB 3IF1B 1S3KH 1U92A 1JIBA 4OLZL 4GMTH 4K94C 1RMFL 3FN9A 4Q2ZA 3MJ9A 1D5ZA 3ARQA 1CLYH 3EJZC 4YFLF 4G42B 5B4MD 3OF6A 3GJFH 2AJUL 5IMOB 2GIYA 4RNRB 1OTTC 1GZPA 3IU4H 2V17H 5D7SH 4JPVH 5IK3B 1MCBA 1MRCH 3QUZC 3AXLA 3EOAA 4OGZA 4LLWB 1T7VA 3T0VA 2CDEB 5EU3B 4LSQL 5IVXF 3BZ4A 3QQ9C 2DM7A 5D7JA 4H5SB 5BZDB 3AREA 4P2QA 3UROR 4JY6B 4GS7C 3SKNA 3PQYB 4YK4B 5HGAA 1SJHA 1RZ8A 3EW3B 1I7RA 3C09B 3BXNA 4AEHL 2OLDA 2B8OT 3C60D 1FGNH 3FCTB 4TUOA 1ZKAA 2IALB 1NFDE 4H8WL 4J3XA 4S1QL 5C0DA 2P5EE 4J23A 1NUGA 5DRWB 1S7XA 4F9PA 2DTMH 3DRTA 3P4OA 3LKSA 4M4PA 4Y0GA 4P2CG 4XPAH 1ACYH 5DYOA 5E8EB 3HC3L 3AS3A 1P6AB 3C2AL 4GUPA 2DQTL 1FNLA 3PHQB 2Z35B 2W9LA 3CCHA 1A9BB 3S5LA 1RPQA 1CK0H 5FDWA 4JQVC 3LQAC 1YMMD 2GTWA 2ZOLA 1WUNT 1EVTC 1M1SA 4FA8A 3PHSA 4N0UE 3RUGE 5DHVB 3NAAL 2C3HA 3MACH 1RZGA 4LLYA 3GFUA 4PTUB 3K4ZA 3IDXL 1DQTA 4LCYA 3N85H 5KVFH 3L6FA 4LSTH 4PRPA 3I3DA 4P9MH 6FABH 2X4SA 4X0KB 5E03A 1DANU 4YBQD 1H0DB 1BQHB 2E7CA 4PJGE 1X5LA 3A67H 3CFBA 3OGOE 4E5XB 3EOTH 3MRFA 3D39D 4I0PD 2PYED 1BZQK 1UM5L 2RAMA 2VDRL 3BIKA 1T0NB 4OJFH 4P99A 1I9RH 3FTGB 3MRKB 4OBRA 2ICWB 2YN5A 3R1GH 1MFEL 1ZA6B 2LTQB 1K5NB 3GSNL 2D7PA 2OZ4H 4WFHD 4LRIA 4NDMB 5TE6H 1AJ7L 1I9JL 2OI9B 3QG7H 1IC7L 1DBBL 4NQCB 2ADJA 2O5XH 3VXUD 3BGFC 4K3HA 3DO7B 4FQLH 3BIAX 2WIIA 3QEQA 3WNOA 3HE7B 3S4SB 1KV3A 1T66D 1S9KC 5J8OA 4I1NB 2YRLA 1TZGL 1EBAA 1S9XA 2PN5A 2DI7A 1QA9B 5GS1C 4R96B 3SO3B 4NNXA 5FGRA 2UWEF 1C5BH 3K3QA 1YPZB 3PJSA 2HFGH 2OQJB 4KKCD 1A5FH 3L9RB 5IB2A 2B0SL 2BMKA 3OBAA 1KCVH 2F53E 4HJJL 3O8XC 4L3EE 3EIFA 4GS7B 5DEGB 1XGUB 4QRSB 3TN0A 1AGDA 4QRPB 5ETUA 2GY7B 4MNGB 5A40E 1TQCC 1HKLL 3C8DA 4XNXL 1RV6X 5DRXB 4LOUD 5EC1B 5LCVL 1CTNA 4JRWA 1OGTA 1T21A 1RVFH 3EAKA 5AAWA 1FG2B 4OZFB 5C0JB 4QRUA 2Q1EA 3FT4A 3ZKMD 5CP3H 4TUKH 5BVPL 1N8ZA 1NGPH 3VXQB 2HFGL 3UJJH 2VABA 5IEHB 2EDLA 4PJEF 4XPFL 1MFEH 3UYRH 1N2RB 1IILE 5F3BA 3O3BB 1CVSC 1IC5H 3QDGB 4PJXE 3CFDA 5E5RB 2E9WA 4GAGL 4PJCF 2DLHA 5EU6E 3SDCC 1VEOA 4V2CB 3D3VB 4OB5H 2D31A 1CBVH 2VSDA 1S9VB 4JGJA 4GKZB 3S34L 5FYLD 3TBWB 4F7PA 3GHEH 1IM9D 3R06B 4J2XA 4DKFL 3S36L 3BZFA 4DZBB 5DTFB 3LHPH 4GKOA 2VLJE 4I5BB 4YFEA 1SQ2N 1YZZA 2ZUYA 4NQEA 4QT5B 5AD0A 4UV4L 1JWUA 1JHKH 4UUJA 4PY8I 1UM4L 1NGYA 3H9SE 4RA3A 1T83C 4DFIA 4KMTL 4KK6C 5DJ8A 5BO1L 5JHDA 3OB8A 1R3LA 5F1NA 5EUOE 4YBLB 1EX0A 2EC9U 4R8WH 5DJDA 1QLEH 3TBVA 5D2NE 3F7PC 3KPMB 3LV3A 5GGUB 3ARBC 4FFVC 1Z9SA 5LKNA 5J3HC 1W72A 4S1QH 5AWNH 1CDHA 4JCLA 5DHYA 3QEQE 4HH9B 1YJDL 4XP1H 4IDLA 4L3EB 2PETA 5L0QB 1FFNB 3RL1B 3EJYD 5F1IA 1G9ML 2W9EL 4G8GB 5FHBL 5DFVD 2W60B 3RU8H 3WUWA 1MCHA 3LN5A 5A2IH 3VXPB 4MX7A 4XH2A 5HHOA 3QHZL 4JFYA 3RVXC 4K7PH 2X05A 3S97C 4MSWA 1L9NA 1D9KC 2XQYK 1N59A 4PLJC 5D93B 4ZS6D 3I9GH 3O4OC 2EXYD 1TZHB 4XMKL 2I9LA 3VXUA 1UYWL 3HI1A 4FQ1H 4OI8A 2XZAH 3NCFB 3LSOB 3QDME 3WIHA 1N5AB 4FABH 2XXMB 3SDCD 3MO1B 1FGNL 4JFZH 4ZUWA 2EDXA 5LJYH 1QLEL 2XXCB 5JMRA 3UPAA 3P4NB 2NY5C 4HQQL 2QBWA 3IXAB 4MB3A 3WFHB 5FM5M 4POYA 1ZS8B 1ZT7B 2J4WH 5D7IB 1JTPA 3C5SA 3SCMA 1CFQB 4Y4KD 1XF2A 3MNWA 3EYVA 2NTFA 2JKXA 3OJDA 3QUMB 1YEFH 4KTDL 1AI1L 1KCRH 1WF5A 5EZIH 4MVBC 4NBZB 3CFCH 1TJIH 3G04B 3X11A 1YEIH 3K4AA 3FQUB 4HIXH 1CLZL 1YYLH 4JM2B 3HZMB 1SEBA 2K7PA 3VXTB 4DKFH 2QADD 3EYQC 1EIBA 3NCJL 5FV2A 5CILH 1KIPB 2C1OB 4WUKL 1AR1D 3ARYA 4PP2A 2VWEE 4TNWF 3TVMD 2DWDB 1CZ8H 5H94B 3F58H 3OKLB 3L3IA 2AV1A 2LABA 5I75C 1UC6A 3V4VH 4NYLB 3LHPL 1RJCA 2BNQA 3VWJD 5IUSA 5C7XL 2DTSA 3NZHH 2Q3ZA 4RMVA 1X4YA 3HZYA 2H9GB 1CL7L 3FRUA 3U36B 2DOCA 1YPZA 3PJSB 1JGLL 2HMID 5LGJA 3U2SB 3QEHB 3E1F1 2XWTB 4R2GD 4WDIB 5KVGL 4U1NA 1IGIH 1W0VB 4PJ5B 1WGOA 4DK3A 4POUB 3V5HA 4LSVL 1AGDB 3RGHA 1XIWD 3WKNA 4WUUD 3O8XB 4Z7VB 4L9LB 5C0CE 4JVUA 4EBQH 3FONB 5EPMB 2UY6A 3QNYB 3RP1A 1NCWL 3QEUA 4JG0L 5E2VH 1OSPH 5JXAH 4C54A 3EGSA 3KYKH 3DSNA 3KPSA 1OSZA 3VDBA 1LD9B 5FOBA 3CLFL 3V6OC 3ULSB 4MD5B 5JDSB 4LBEB 5KVEH 2G60L 5GRUH 1UKQA 1PYWA 4L5FH 4ODTH 2NYYC 1G1CA 2DQCL 3DLQR 5HI3C 4X80H 2ZG1A 2I25N 4ZUVB 1N64L 2DAVA 1KNOB 1M7DA 3QWRD 2CQVA 1I1YA 4MVBD 4G9DA 1MREH 2BOCA 4GQPH 3WS3A 2JJUA 1CIUA 1AHWA 1WFOA 3UAJC 4JHAH 1A47A 1N64H 1ORQB 1KPRA 2G5BB 2VJXA 1KACB 5C0BE 2NW2A 4NUGL 1KCSH 1ULVA 3QIUA 4U1IA 5CJQL 4RQQB 5HYEA 3VGDA 4ZNCD 4MJ6B 4Y2DD 2FGWL 3FT3B 4RMTA 3X12B 3QJHB 4U33A 3IDGA 3BN3B 4FQQB 3EDFA 3RAJH 1SEQH 3RZWA 5E5MB 4L4TD 5F97E 1BQUA 3P0GB 3C6SA