1RIHL

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DLVLTQSPATLSVTPGDSVSFSCRASQSISNNLHWYQQRTHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSISSVETEDFGMYFCQQSNRWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of antibody 14F7
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
total genus 56
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihL01
4K8RH 4OLYL 1AGCB 5F1IB 5IESL 32C2B 5T1MB 3UEZA 5IWLA 4C54A 4M1CC 3SDAD 3FQRA 2NY1C 1I3GL 3QDJD 3GBNH 3V6OE 1H3UA 4OI7A 2YC1B 2DF3A 4JZOB 4R2GD 5FYJL 4F33A 3THML 2I9TB 1CICB 2VITB 3VXQB 2BFVH 4HPYL 1A1MB 3QDGB 5INDB 2Y07H 1QSFA 4X6DA 4GKNB 1TMCB 3RWFA 3BGFB 5E5RB 3ARGB 1MCSA 2ZG1A 4GW4A 4G42B 3X12A 3DV4B 4LCYA 2O5XH 4L8DA 4J7RA 5DVLA 5C0BB 4Y4KB 3C6LA 4XP5L 1GGCH 4F57H 3RAJH 3T0EE 2Z31C 2R0LL 1RK1A 2NXZB 3IJYA 5ESAA 2Z91B 1KB5H 3MUZ1 5D7IB 4IBLT 2Q3AA 3VCLB 3TESA 4JHWL 3RWCB 1MCRA 5HHQB 1P69B 4JFQA 3HC3L 1JHTB 3DUUB 5JHLH 4NWTH 1CE1H 3VGBA 5E2UL 1QVOB 3ARBA 3MOBH 4F7CB 3T1WA 4LASL 3P0YH 5BJTB 4OZGF 2DJSA 5ETUA 1IQWH 1HH6A 2P7TA 5AZEL 1JRHI 5DUPL 2NXYC 4NKMB 3ULSB 3S96A 4GRWE 4JG1H 3K8KA 3NFPB 2DJUA 4WWKB 3L3JB 4GG6F 1FNEB 4NZUL 4OCRH 4MSWB 4PRPB 2C9AA 1XGRA 5C0IB 2Q1EA 4D8PB 3QQ4A 2PYEA 5C0AE 5HHOD 4HX1B 4XP1L 4JN2A 1RUKH 3B43A 5ECJE 1FL6B 4NQEB 4FG6D 4D9RD 1CIUA 3TCLB 3KPOB 3TN0D 5JOEA 4XNQB 3BESR 4PRHE 4RMWA 4UDTA 3PABB 3GFUA 3FO1A 1KELL 4EQ3A 5CLTA 4HKJA 1OF2B 1UXWA 4HWBL 5TGBB 3S35X 4DGVL 3FQTB 1RY7B 2C1OB 4F37F 1LO3L 2FZ3B 4Z7OE 4HQQH 1K8IB 3WJLA 4P0DA 4YHMH 1Q9OB 1DQJB 4PY7A 3VFPA 3OTTA 2Y72A 3RDTB 3HCVA 1I3RA 1QRNE 1I8IB 2NY2D 4RWHA 5D1ZC 1YY8B 3REWB 5EFIA 5C0FA 3VXRB 4YEEA 4ZAKB 5FUCE 4NHUA 3WS3B 2E7LC 2PR4L 3O6FD 1OD9A 3GIVA 3Q6GL 4MA7L 3QBTB 5KSVA 4JY4B 5CINL 1KLUA 2Y36H 1PGRB 2O5YL 3HPJB 2GCYA 1C12B 4J8RA 4PB9H 3UZQA 2PTTB 4GRLA 4BH8A 4PYGA 5B8CA 1C1EL 2Q3ZA 3G5YB 1KJ2H 3O81A 1HQ4B 5SX5H 4DUVA 3ARFA 5EC2B 5FM5O 4XNYH 4NQDE 3BPOB 5F7FA 3PP4L 5ICXB 5FYKU 2ITCA 1RZGB 4FZ8H 5DJCB 1BBJA 4G6KH 1DLHA 1UCBH 3OKKB 3HFMH 2BOCA 1OQOA 1ZS8A 5FOJA 3X3FL 3RQ3A 4PD4K 1PKOA 1HINL 3MJ9H 3MRBA 3OF6A 1XF3B 3L3IB 2KQNA 4FTVE 1B0GA 4NOBA 4U6VH 1GPOH 3K4DA 3HUJB 5AG8A 5FGRA 3HTLX 1S7XB 4HUMB 1BD2B 5GSRA 4X80L 3SQBA 4RIRA 4HKBB 3ECBA 5I1KH 1RULL 2AK1L 5JHDB 1VENA 2CMRL 3ROLA 1DBBL 4IM8A 3PUCA 4U6TA 5KVGL 4MHHG 5I75C 5TE4H 1OSZB 5FYLD 2BXZA 3TWCH 2OK0L 5CKAA 4XHJD 2C7UA 43C9B 2BP3A 1WICA 4MJ5A 4XI5C 3DHJA 5EU4A 1CFBA 5KSAA 3DX8A 3QUYD 5DK0A 1G0DA 1X44A 1XFPA 4ETQB 4OZHB 3O3AB 4KKCC 4F2MA 2OCFD 4OQTA 3MRRA 1XCTA 2V2WB 4XB8A 5EZJB 3HE6A 1Q9KB 2BDNH 4L4TD 5DJDA 3TYFB 2WBJA 4K3DH 4YGVA 4KK5C 3STLA 2PO6B 3U0PB 1KSRA 3HR5B 1DQQA 2R1YB 4PJEB 1EHAA 1AR1D 1UJ3C 3WE6A 3CC5A 3VXSE 4UT7L 4X98A 2B5IC 3GSOA 5E4IA 2NLJB 3LKRA 5DJYA 3FCTB 3AFLA 4YJZL 1D6EA 3F58L 3FB5B 4IMLA 1FSKC 3P3YA 4JLRB 2HKHL 4ODHH 4LSTL 1UC6A 1G6RA 3ZE2F 4HKXA 1RUMH 3MLTB 4OCYL 1JUFA 4BFIB 4UINH 2X5PA 3O0RH 3NPZB 4KMQA 2BXYA 4X6FA 1KIPA 1GAFL 4H8WH 5FKAB 4POYA 1CGXA 3O6KH 5CILL 1FG9C 3VH8B 2I60L 4MCZA 2DWEB 5DD0L 4AENA 3AVEA 4NNXA 2O26U 2BHUA 3FFDA 2EZ0C 3QULB 1OP5H 4POZC 5LCVH 3B5GA 4JJ5B 2FJHA 4ZUUA 2XQYG 2MSPA 4GG8A 5IM7B 1UA6L 3NZHL 4KQ3L 4NC1E 5IMKA 1XF1A 3WO4C 4ERSL 1OD7A 5CCKL 1GVIA 4IIQC 2Z31A 4MNGA 5DD6A 4XC3L 3TEUA 3E8UL 4NCC2 1XZ0B 3BGMA 1Q9LA 1DE4A 2EDEA 3O3BA 3O4LB 4PJAF 3TVMD 1H3XA 3FB8B 3PHOB 1TZHA 1K8DB 4G9FE 3T77B 2VISB 3WFEH 3CNKA 1J8HA 4OQTL 3T4YB 1OTSC 3BEVA 1N5YH 4HIJB 5DMJB 4XNXL 4TVSa 5DHXB 2AABL 4MJ6B 4C59B 3D85D 3TO4C 4YAQB 5D5MB 3AMKA 3GHBL 5JIPA 2W9EL 5IFHL 3PQYB 4FQXD 1WAAE 4UB0L 3QUMA 3V6ZB 5DD5L 3QG6B 2D31A 3HI5H 5GRVL 4M48L 3BXNB 2FGWL 4L8SC 4AEIL 3PE9A 3TP4A 1S5HB 3PWJB 1HWHB 3FRPG 1MPAL 2FR4A 1UQSA 3VXUB 1BFOB 3G6JE 2YPLB 3K1DA 3VFMA 4WY7L 3MV8B 4M8VA 3ZT7A 5ENWB 1ZT4A 2G9HB 3I9GH 4TVPD 3QH3A 3I6KB 4DZBA 1JZ7A 3MRPB 1PVHA 1SVZA 1BPVA 4Y19D 5DJ8B 1NAMA 3PNWB 2X4TA 2LV4A 3C5JB 4M5ZL 4EN3C 2FH8A 3KPPA 4UIKH 1X4XA 5L2JB 1J1OH 1U3YA 5HJ3B 4H1LG 2FX9L 5IVOA 2IGFL 3CFEA 4PJ9C 3SCMD 4CGTA 4Y5VC 5EU6D 4XMPH 2J8UB 2VNCA 4BZ1H 2NY3B 4QRQA 3OL2A 4HULB 3DETC 2UVEA 1EFXB 4MAYB 3QHFL 4NKDA 1WFTA 1E27A 5EIIB 2NX5E 4P5TD 5D1ZA 3RWHA 4J2XA 1LGVA 4PJDF 1I7RB 4PB0H 3G04A 1NCBH 4KC3B 5AEAA 3CU7A 2VR4A 1H5BC 1SEQL 3U36A 5KG9A 3T0VA 5KSUB 1DBJL 4TULL 2EDRA 5HVHC 5IMOB 4DWHA 4JM2C 4ZYKA 4RMSA 3NCMA 4R4FH 3QEUB 1T03H 1T89C 3TM6A 1DBKL 5DJ2A 3FQWA 1HSBA 3BT2H 3QUXC 1YNKL 4X6DF 3MPCA 3DYPA 3O4OB 4LIQH 4MXQD 1KC5L 3CLEH 4OLVL 1NAML 4PJIF 2JKXA 4BH7B 3EOBA 2R2BA 4GKZB 2P48B 2YUWA 2OZ4A 1GGIL 5LGJA 1NANH 4KVCH 4TUJB 3GSRB 4LU5L 1OGAA 2BRRH 4MA8L 2W65A 4Q97A 1BBDH 4LLYB 4ZFGH 4DN3H 4PBWD 4XZUB 5IB4A 3CVHA 1SEBA 4IHOA 4JPVH 4P23C 2ICEB 3ABZA 1ZLWK 4GRMB 5BV7B 5F6HJ 2HA1A 1KXVC 2FHCA 1E4WH 1V7MH 1FH5L 4S1RH 3DI3B 5GRJH 1JF6A 4G43B 3RHWF 3HMWH 4Q0XL 4WTXA 1U92A 4NRYB 1BZ9B 1I1CA 3S5LA 5HHME 3TNNB 4R7DB 1P2CA 1X5AA 4NN5B 1MY5A 4OTXH 2UY6A 3VFRA 1IAIH 4POUB 1IGJA 2R4SL 2KKQA 1CXKA 4Y1AA 2LU4A 1DJSA 2N7BA 5E99L 2OMBA 4LSVL 4J3WA 1EO8H 1IKFL 1YNLL 3MLUL 4JFPB 4V1DB 5E4EC 1AD9B 1T1XA 3IRPX 4KDWA 3OHXB 4A2LA 3MCLL 3IDIB 1UJ3A 1ZHKA 3QJHB 5L2KA 2Q20A 3U6RA 5HHPA 1UCTA 4MVBD 4PLOB 4UZGA 35C8H 5IB2B 3G6DL 4TSAL 2NY4B 1J10A 2UWEF 4G8FA 1U8OB 3CU1A 1VESA 5HPMB 1MVUA 5ADPL 4TRPL 1QLFB 1AD0B 2FJFA 1A4KB 1OWRM 4JGUA 4Q9CA 1N7ML 3WBDA 4N90E 4BK5A 1GZQA 5BZDB 5DQDL 1M6OB 3C60D 4PV9B 1IZKA 3CK0L 4E42B 3QCTL 3LPGA 5EC1A 1MHEA 3VFUB 5JA8B 4LKXA 3GMPA 1KPRA 2PCPB 5D70L 5C2BL 5DUPH 1JMZA 2R2CA 4GKSA 1KLGB 1JI1A 4QOKA 4IIQA 5CEYB 4JY6A 5F7NC 3LH2L 4QTIH 4C56A 4HIEB 3G9VA 1IM9A 2EYSA 3MRJB 2W92A 1AO7D 1V3MA 4K2UL 1YDPB 3WNOA 3H9SB 1MJUL 3BPCB 1UKTA 5I2IA 1RHHB 2DRUA 2VE6B 3KHOA 3QQ9C 4IMKC 1CDUA 4U0QB 3TIEA 4N1EA 5AG9A 4AT6A 3U4BH 4WFHE 1UH3A 5C0GA 5D7IE 2FX7H 2OL3A 4K07A 5H37H 2I26N 5BVJA 2DQGL 3BKMH 4FQ2L 2HVJA 4R26H 4PJCF 4MNHB 3IXTA 1CDHA 5TE7H 4QNPE 3LMJL 1N6QH 1K4CB 2VDML 1JFQL 4MD5A 3NCYP 4LGPB 4R90L 1G9NC 4P2RA 2AJXH 4GW1B 4NYLA 1OP3H 4L8SA 3TT3H 5HY9A 3QCUH 4EUPH 5FB8B 1T0MB 2EXWC 3O9WC 4FS0A 2DJ4A 5EDXA 1WZMA 15C8H 2CRMA 4ORGA 1XIWC 1BLNB 1P4LA 4IRJB 4Y16B 1A14L 4KHTL 2DLFL 1G7IB 4OFDA 5DC4B 3KPLA 3BWAA 4NHCL 4OZFG 2RCSL 2AAVA 3KYMA 1G9EA 3GO1H 4CVZB 5EH1A 3BZFB 3RVVC 3QEQD 4V2BA 3L3GB 5EU3A 3JTSA 3VI3F 4PJ8B 4NQTA 5FAAA 3UTZB 3GJEA 5B39B 4EOWH 5J12C 1WCBB 3QYCA 5KTEL 4PJ9A 3I02B 4Y5VA 3ARRA 4AQ1B 3RJQB 4EI5D 2NYYD 1FFPA 3CSGA 3V6OC 4Z0BH 4HXBH 2YBRA 3BIKB 4KK8C 2FL5B 4JFDA 3VGDA 3LEVH 4C58B 3MRFA 5FA4A 2M26A 1DUYB 1X7QB 1QA9B 5IVXE 2OL3L 1YEEL 5ANMB 3RY4A 2APWA 4LPTA 4YDIL 1FO0A 1FFNB 2Z8RA 4LLWB 4ELME 1XF5B 1KN2H 4LEXL 4D9QE 3U0WH 4ALAL 3DTXB 5MENA 1H5BA 5IV2B 4JFZH 3SY0B 2BOBA 2ITDB 3HLAB 1I4FA 1CQKA 1FFOB 3T0EC 1XGTB 3X13A 4RAUB 3T65A 3TBVA 5IHZA 3VXRE 5I1CL 4JM2A 5F7MC 1CF8H 1T89A 4HS6B 4U1JA 2V7HA 4ISVA 2BVQA 2CIKA 2YPVL 2W0LA 2N1KA 1JPFA 4BFEA 2OQJA 1NCDH 3SQOL 4HIHA 2P5WA 1EAPA 2OK0H 1P7KA 2P5EE 4WO4B 5IEKA 4BSVA 4DKAA 1NFIA 3EO1B 2X1OA 1NMAL 4ZOEA 1M71B 4XX1G 4KKAC 2CLRA 2X4RB 1PFCA 3UZVB 3KYAA 3OAYK 5F9DC 1X5HA 2RAMA 4JO1L 4P23A 4ENEC 4Z5RA 1KUMA 4PS4H 4JO3L 4JAMA 2F54A 2OYPA 5ERWA 5ISZB 1NCCH 2FDBP 4YXHL 3LIZL 4QWWC 3HUJE 1MWAA 3UTSB 3H42L 5TDOB 5LGKA 3B9KD 1DR9A 1VERA 4LSTH 2BY3A 1FO0L 1FCCA 4LGRB 1KPUB 1LO0L 1H8NA 5I8CB 1BIIA 3U9PL 5JHDE 1Q0XL 2EECA 4NDMB 4RBPK 2B0SH 3QHTC 2A73B 1EPFA 5DD0H 5JMRA 3OB0K 1U3HB 3V6BR 1RSFA 3MYZA 2JJVA 4PJBB 2HLAB 3QIUB 4PJXA 5TH2A 4YDVB 3H0TB 1KTLB 2FYYA 3VGAC 2LTQC 1KCVL 4UTBL 1MI5A 4UT9H 2NR6D 1F58H 3Q3GA 1XGUB 5F7KC 5FK9A 3E8UH 1IC7L 3DARA 4HWNA 5CP3A 5BS0B 3UPRA 3O8XD 2QADC 1PBYA 1QNZL 1BM3L 2VLKB 2DMKA 3BPLB 5FIEA 5FUCC 3NFSH 3IVKA 2Y5TB 4PFEA 2FO4B 4HIXH 4PP1D 3OJVC 5HI3C 3VXMB 2BNQA 4OQTH 1OAQL 2VQ1A 3VWKB 4P2QD 4KROB 1FCGA 2AABH 1OOAA 4YHNA 4P4RA 4U1NB 1Q8MA 4KI5E 4NUGL 4Y5YB 4N9GA 4UB0H 3S3SA 5F3BB 1LO2L 4X6CA 3L7EB 4PLJD 2W59A 5BRZB 2HG5A 4XMLL 5F3HB 4KJPD 1K5NA 4F15C 4Y89A 1MWAL 3ARQA 5DK2A 2ZOKA 3MLSL 4AEIH 3P0VL 3K2UL 1HQRB 1UACH 3NABL 4XNZC 1LO4L 1OTTC 4PLNC 2P45B 2DQJL 2K3TA 1BEYH 1G6RH 4OAWB 4XBPA 2QEJA 1MHCB 4U1IB 5J8OA 3MRIA 3ZO0A 3AM8C 3KPRE 3KS0H 4FRWA 2IPTL 1URLA 3K0WA 4IMKA 1SJEB 2A0LC 1A6ZA 1MEXL 1F4YH 4OCXH 3VXPA 3PWVB 1G7HB 1WGOA 3TJHD 4M5ZH 1S9XB 2DKMA 3QRFM 2EIZB 4OCWL 3RVXD 4MNQB 3D3VD 4OLZL 4GXVL 3V95A 3D39D 3CFBA 1RUQL 3GK8H 4RSVA 5GZND 2X9XA 2GI7A 4JRYD 4LP5A 1MIEH 4H88L 4KDTC 4LVEA 1YEFH 2YD7A 4YFDB 4NOFA 5D6CB 1I7ZB 5FYJD 2HT4C 1NCWL 5D8JL 3O9WA 3NGBB 3QNZA 2VAAA 1N6VA 1XH3B 2IAMC 4WI2A 1F3DH 2E7MA 3EFDH 4XPTH 4FABH 1FBIL 1XIWA 5L8JB 4X99A 1QACA 4OUOA 3WNNA 4P3DB 3MLZH 3VA6A 1QBML 1YY9C 3CCHA 3QUMH 4I0KA 3T2OA 3UO1L 4ELKA 5IB1A 1EH9A 5D7KD 2VLJB 1D5MB 4M7ZC 1MUJB 2WUBH 1RJYB 1I9EA 4JFFB 5D1QB 1XR9A 4FXGB 1DQMH 1I9IL 3V52L 4XWGL 3W2DL 2XN9D 5FUOH 3W0WD 4HD9A 2G60H 4OBSA 5EUOF 3V6OA 4J4PD 1U8MB 1QR1A 3V7AE 4Q2ZA 3UJJH 4MDIA 4UV4L 3UAJD 1HILA 4P2OB 4TYUA 4KAQH 3TIDA 4RGND 4EEEA 2AJUL 1NAMH 4OLWL 3SOBL 3IU4L 1JHKH 3ARED 1LE5B 4PBVC 4P4KB 1U8IB 5FGBA 4K7PL 5LAXA 3EYVB 4RWYH 3BP4A 5E1HB 4NC1C 43CAB 1ZGLA 2UZIL 2ADJA 3T0EA 5FXCH 2IPKB 2X9WA 1NFKA 3QCVH 3EDJA 5L9DL 4XPGH 4G5ZH 5AYQA 1FH5H 5T3ZH 3MA9H 4CU6A 5GIRB 3ARWA 5T1KA 1HHJA 1SJVA 1QSEB 3GHEH 3NN8A 5EBMB 1A02N 1NLDH 1T2JA 3MC0A 1JJUA 4OM0H 1KB5B 3ARTA 3L5WA 4YDKL 1CGVA 4QRRD 4ZTPH 3HE7D 3TH4T 3D2UA 4LLQA 5L0QC 4ZS7H 1OARH 2QSCL 1UVQB 1CFNA 4H25B 2PKDA 5GS3A 2B1AH 3C5ZC 4JREB 4L29B 4JFOA 3HG1B 1YNLH 4I3RL 3I3EA 4JZJB 4LGSB 2NY5L 1A8JH 2VXQH 3GJFA 3GBML 1V5JA 2EH8L 3WKNA 2VAJA 3FT3A 4X7SL 3FMGH 1RIUH 4IRSB 4X6EA 3KPNB 2VIRB 3SJVD 1GIGL 3WS6C 4TSAH 5I76A 5I30L 5C0AA 1NDGB 4RCAA 1S8DB 3VH8G 2OZ4H 2RJMA 3FZUC 2Q7YA 4LQ1A 3CFDB 3OKEB 5TPWH 4AG4L 4KTEH 2GT9B 1NSNH 3GMQB 4PRHA 3WHE0 3CFKB 1TTGA 4U1KB 1MHHA 4LSUL 4CADB 4LEOA 3CVHH 1A7QL 1YQVH 3JWNC 1V05A 1MFCH 1A1OA 2J5LB 4I48A 2DQTL 2JB5H 3GKWL 4FQIL 5C2BH 3JV6A 3M17B 4QXWA 5C07D 1FQ9C 5CZVL 2EE3A 2YEZA 2Y1VA 2DI9A 1MCWM 2W9DH 2VZOA 2MQ0A 5HYSA 1QRNA 2L0DA 1KJMB 1J1XH 3SE8H 3MV9A 3D0VA 4V1DE 1CLZH 2B2XL 4JG0H 1EEZA 4JKWA 2HFGH 5E2JA 3DXAD 1CLOL 3MGOB 3NVQA 2VLRD 1Q0YL 3FFCB 4F7TB 2LU3A 3ZDZF 5GXBB 2X6MA 3P4NB 2I5YH 1N6UA 5J11B 2AV1A 3P4OB 2ED9A 1HOCB 3O3EA 4Z7VE 4ZPTB 2F5AL 2XZZA 5DC9B 4JANB 4YR6A 2WV3A 4WHTA 1WT5C 1I7UB 1GC1C 2E3VA 1IBGL 3QFJB 2QSTA 3IFNL 3MNZB 4NQDA 1PZ5B 4Y2DB 2DQEH 5HDOA 4RAVA 1R3IH 1UWGH 3NCFB 4FZEH 4YDLC 3B8YA 3BVNA 4TPRL 3QDJE 3AM8A 4WU5B 4W6XB 3EGSB 1CL7H 1OHQA 2FD6H 4U6YA 2W91A 4FQPA 2IMNA 2DLFH 2XA3A 1KJ2B 2X89D 3CMGA 4GXUM 2C3GA 5KSBA 1BVZA 3RPIA 4ZO8A 3EDFA 1WWBX 2O5ZH 3RGVC 4JM2F 4XXCC 2OM5A 3ZE1F 2VJXA 1KFAL 2A77H 3K46A 3FO2A 2EDNA 4LSQH 3GUTA 1R5IA 3TZVD 5DURD 4UQ2A 2D03L 1ZHBA 3HMXA 2Z8SA 3QUKA 2EYTA 4KDTA 1EVUA 5I1IH 4ZQKB 1ZSDA 1S9KC 1MCBA 1PLGL 1RAMA 3IFPB 2IAMA 5E00B 2H3NA 4NRXB 4LCIL 4NUJB 2BVOB 1CFTA 4GG6B 5FO7B 2VN7A 4K7PY 4Z7UF 2V9QA 3O3DB 3KPSD 3QXUA 5I19H 1ZVYA 1CDGA 4YBQD 1IEAB 3VXSA 1JP5A 4PGBA 3Q48A 1H15A 3LV3B 3W5MA 3OKLA 1UZ6F 1P7QB 3DVIA 3IDYB 3MBEA 4UTAH 4U3XA 3QFDA 4MQXD 1IFHH 4J3UA 1AQKH 3SQOH 5HHOE 2Y9RT 4NQXB 1AGFA 1PY4A 1XGQB 2FX8L 4BA8A 3DRTA 3V2AR 1BQHB 1NAKL 4PJXF 4CJ1A 1T1YA 5GSVB 3CXHK 2CDFB 4OT1H 2ZUXA 1KXTB 4QHMB 1KCUH 3ZKSD 1BECA 1A3RH 4BYHA 4LVNC 3RKDD 1UXSA 5FDWA 1Z3GL 3I50H 1JE6A 4JO1H 3CIQA 2ZSWA 5CWSB 5HD8D 1TJIH 3AS3A 5D7JD 1FGVL 2R56H 5FV1L 1VFOA 4YXHH 4OD3L 2A9MH 4E41B 3LIZH 3BKYL 1JGEB 3HAEH 2D7OA 3KWWB 1UH2A 3MNWA 4O2FA 1CD1A 3BPNB 3H42H 3L3DB 4HFWA 1A4JA 4I18A 2NXZC 4WTZA 2DQUL 4JEGB 1VFMA 4X6CF 1MF2H 4U1LB 3SDXF 1WAAA 2D7TL 1AHWC 5MEQB 3FT2B 3IKKA 4HAFA 4MDJA 4P59H 3QO1A 3VFVA 4HHAB 5JUEH 3BH8A 1A9BB 4UIMB 4CVUA 3GSNH 1N59B 3ZHDA 2X4OB 3PP3K 2DBLL 1OM3L 1R3JB 3G6JA 2VLMD 2X09A 3ZKNC 4DJMA 3H9HB 5F93C 2M2DA 1IC7H 4D94A 4XPBH 3WHXB 4M6OL 4NC2B 3ZSSA 1KF9B 1QNZH 1BM3H 1IC1A 2CK0L 3BD4A 4M7KH 4K7FA 2CO6B 3ZL4H 1T7WA 4PJFA 3OKMA 2HRPL 3NA9H 1PDKA 4YHIB 3EJZC 4K3JL 4ZTOH 2NY0B 5IFJA 5F7EL 5J1TC 2H2PC 2MPAH 4PTTA 4OIIH 3CXHJ 4U3HA 4NUGH 3UJTH 1WBYA 3QDMD 3OKOA 5JNYA 3KJ6H 1B9ZA 5DQJB 1ACYL 3UDWA 3BZ4A 1KT2A 1HDMB 1FDLL 1BVKA 1OB1B 5JIKA 3ARDB 3DPBA 2WWMD 4YPGA 2YKLH 1LO4H 5FYLE 2V17L 2NX5A 1N5AA 3C5SB 3R0MA 1IQDB 4I0PB 4Q9RL 5MEOA 2QR0A 2IBBA 1KIRB 2BHZA 4JGMA 3O2VH 3MREA 4M3JA 4K23H 1QFWL 2GITB 1MEXH 1RJZA 5DMKA 4L4TE 5F7HA 2E7CA 3KYKL 2CGRH 5INCA 2NW3A 1ZXQA 2XPGB 5F72S 5I8KH 4OLZH 5E8PA 1WT5A 5CP3H 4N0FA 5FECA 3JWOL 1P6FA 4RA0C 3FQUB 1PKQB 4KV5E 4DK6A 5JLZA 4XGZB 1UENA 1ZANL 3K81A 4MJIB 2VXSL 3FO9B 3WIFA 3T3PE 1PSKL 3UTTB 2FIRT 3JUYA 1ZEAL 2HJLA 4ORZC 4ZFZA 5GISH 3W39B 4GXUN 3LDBB 1F8TH 1EFQA 1VEOA 3L9RB 2FATL 4ODVH 5HDQL 1M1SA 2I9LA 5B39G 5JOFA 1LO5B 3RGVA 2DL2A 4PJAB 3UO1H 3ZHLA 4IOIB 2JF1A 4NKIH 3SDCD 2YN3A 5ADOL 4M1GH 2CDGA 5FHBH 4OKDA 3DIFA 2COQA 2HKFL 2OR9L 1JYNA 1SVCP 4XNMA 2XIDA 2AI0H 5LWYH 1U8JA 4XB7A 1I9IH 5LXGL 1MCQA 4PRNB 4N0UA 3W2DH 2OJZH 2Q6WB 4WEUD 1ES0A 1TQCB 4CAGA 1WISA 1DCLA 5MP6H 5GS2D 2EEBA 4DOHE 3S4SA 3VMOA 4HJ0D 2YD9A 5FGSA 3HI1A 4CNIA 2CDEA 4GH7B 3J8F7 4OLWH 1T2QL 3HNSL 1NANI 4GRWF 5E2WL 2A6DA 4YBLB 1Y6MR 2A2QT 3NPSB 4EDWH 5SWQB 4OCNC 1G9NH 2X9YA 3E0GA 1T5XA 1GC1L 1DQTA 1ZOXA 5DQ9A 5IHUL 1N64L 5HYIA 2ZSVA 5HGDB 3P11L 3C9NA 1U42A 4F7MB 2GK2A 4N9OB 5DFWH 1I7TA 2VB5A 1W72A 3RTQD 3D25B 5F1NB 2OJEA 4JFFE 3MJ6A 4NNYA 1FGNL 5EO0A 1MELA 3BUTA 1IAII 1BJMA 1A21A 5E6ID 4YDKH 5DR5L 3RZWA 4Y19E 3EOTH 4M6ML 4KI5C 4Z7OF 2ESVA 4AM0B 1JF5A 1C5DA 4R4ND 3LRGA 1CGSL 3PHQB 1EUTA 5D6DC 4KK6D 4I3RH 4U4BA 4U7SA 3VE0B 4WDIB 1G9MC 3A67L 4OCLC 5EU6E 1M7IB 2VABA 5IJVA 2YA0A 1QHOA 3O3UN 4OGXL 2ZCHL 2CUMA 3KDMB 1G1YA 3MRLA 3G08B 2AJVL 1CU4L 3MJ7B 1C5BL 5I30H 2D3VA 5E0QA 4U1SA 3HKFA 3FQRB 4LSRH 5I1EH 5IBLC 4HGWA 4F33B 5I18H 1RU9L 5L88H 3IDXL 1AHWA 1U0QA 2R0WH 3CPLA 2QQLH 4NQSA 4C56D 1TPXC 1DQDH 3UTQA 5E5MA 1QSFB 4X6DB 2G75A 1IM9D 2ERJB 3DUHA 3RWFB 1FZOA 4GW4B 3X12B 1NUGA 1JPST 4FQIH 4HMEA 4LCYB 2RR3A 4L8DB 5SWSD 5CZVH 5SWZA 2P44B 1NPUA 1W72L 4XPHL 1TZGH 4NBYB 3C6LB 2BSSA 1L0XA 4CUCA 1RUAL 4HFUL 4LRIC 3VWJA 2WQ8A 1RK1B 3Q5TA 3IJYB 3KHQA 5ESAB 5F7DA 5ALBL 4CN6A 3RWGA 1J86A 1U41A 3BQUD 2F58L 4IJ3C 1CLOH 3WXWL 1I1FA 2C3HA 4JFQB 2MKLC 3Q1SH 3CFCH 5GZOD 4UT6L 4GRWH 1F5WA 1MRFL 3VRLF 3ARBB 2ATPA 1KIQA 4XPAL 3MTRA 3FAXA 3AROA 5D7SL 4QRTA 1EERB 5BVPH 1ZE3C 5ETUB 2P7TB 1HH6B 3SGDH 2EO1A 4E9LA 4ZUWA 5DHVA 5D72L 3BGAA 1J1PL 3B3IA 5FGCB 1AP2A 3S96B 3U7WL 3MYJA 1DUZA 3NACL 4YZFF 1SJXA 2EEDA 1JIBA 4LLUA 1N0XH 3P9LA 5IVXA 5TE6L 3RZCC 4KUCF 1N3NA 1XGRB 4JCLA 2VLLA 4YHPA 5KJRL 3QQ4B 4JRWA 5EZIH 4ZFOL 2PYEB 4HWZA 4ELMA 4AJ0A 3QA3A 4P5MA 4MAYC 4JN2B 2XOTA 3V7MA 1T7XA 3MV7D 1OWWA 1ZLUK 4CJ0A 1UGNA 5E2VL 2VXVL 4UDTB 3RGHA 3FO1B 3GRWL 5FYJU 4HKJB 4Y4FD 1LDPL 5KW9L 5FFLA 3OJDA 3EKCA 1E6OL 3UPAA 2P5EA 5FM5M 1G7PA 3WLWD 4PGZA 1CI5A 4PY7B 4TNWK 3VFPB 4ONFH 5BMFH 1LE9A 3CDGA 3HCVB 1I3RB 3S36L 2AXGA 3FTGA 1V7NL 2DDQL 1YJDL 5EFIB 5C0FB 4DKFH 2XWTA 3S37L 3T04D 2OI9B 4JO4H 3T0BA 5FM4A 3QRGL 4JVUA 1MRDH 2HTKD 3VG9B 2OSLA 5T3XL 4NHUB 5D9SA 3T0DA 3GIVB 5HVGB 4TNVF 3LS5L 4Z77A 5KSVB 4H0IA 1CXIA 4R0LA 4XCEA 1KLUB 1YN6A 3MRHA 1I9JL 1TTFA 2GCYB 4J8RB 1AO7E 1S7RA 4GRLB 3R06A 2DWDA 4L4VA 4BH8B 1YMMD 5B8CB 5TQ2H 3DVGA 2EIEA 1RZ7L 4GAGL 4U1HA 4YHLL 3T2QA 1FZJA 3ARFB 2XZAH 1P9MC 3CFJA 3WNLA 1F90L 1BBJB 1DLHB 4QRUA 2BOCB 3S97C 1ZS8B 4NN5C 3V0WL 3UYRL 3HMXH 3G6JF 4JM4L 3MRBB 1P4BH 2H2SD 1B0GB 4AEHL 1TVBA 5FEBA 3TF7C 1II4E 3HNVL 4NN7B 1TIUA 5GSRB 4RIRB 2BMKA 2BERA 5E24E 3ECBB 2GFBA 1O5DT 2MOVA 1PQZA 2YWZA 2HJFA 3ROLB 3GI9H 2P49B 1YA5A 1EGJA 1F2XK 3VA2C 4F80A 4ZXBD 4WCYH 5ILTH 2C7UB 2CD0A 1HI6A 3IDMA 4MJ5B 1HKLL 4ZO9A 2KDGA 5IQ7L 4MJ2A 5EU4B 5KSAB 4K3HA 1N4XL 3DX8B 3F12A 4NC0B 4G3YL 5DK0B 1ZWIA 4LKCA 3RVTD 4F2MB 4YX2H 4PJHE 3MRRB 1XCTB 3L3OA 4NZTL 1P5UA 3HE6B 1C7TA 5DJDB 3K7UA 2P8MA 2WBJB 4APQD 3V8OA 4YGVB 3STLB 1BWMA 1DQQB 2F74A 2BNQD 3SDAC 3WE6B 3CC5B 5E8EA 1OAXH 4X98B 4OF7A 3GSOB 3KPRA 4HUNB 3LKRB 4HCRA 5DJYB 2BNRA 1BOYA 4JDZA 3MLRH 3SPVA 4XVJH 1D6EB 2CK0H 3H6JA 4ODTH 1BFVL 1U8KA 1RIVL 2NY1B 3EBAA 3MOQA 1MCEA 2HRPH 1G6RB 1NL0H 4HKXB 4J12A 1H3TA 1FP5A 1JUFB 2UZXB 1C16A 1NFDE 4X6FB 5C08D 1KIPB 1O0VA 3PL6D 5CEZE 4MCZB 4PJGF 1INEH 4AENB 4NNXB 3FFDB 4YFEA 1HZHH 3HB3D 1JHLL 3DMMD 2NQCA 4Z7WE 4ODWA 1ACYH 2FJHB 4ZUUB 3S34L 4OGYL 4GG8B 5SX4H 4Z7NF 5IMKB 2GTZA 4PLKC 1EGJL 2DD8H 2Z31B 4MNGB 5DD6B 1JYVA 1IC4H 2XRAL 3BGMB 3DVFA 5D7LD 1Q9LB 3OAZH 1DE4B 3O3BB 2EH7L 3SN6N 4K3EH 2DIBA 4KVNL 1MFDL 1TZHB 1IC5L 1SJHA 4L5FL 4XVTH 2VDQL 2P4AB 4LHUA 4KPHL 3DSFL 4FOMA 1A6UL 4HF5L 1J8HB 4F3FA 3BEVB 2JIXA 4CMMA 2YK1L 3DHMA 1CZ8L 1QPXA 2Q76A 4R3SA 3NTCL 3QUMB 3TPKA 2F53A 5IBTL 1QTYT 2D31B 4PJ8C 3UYOD 4HCRL 4B7IA 2OTPA 5I15H 1S7SA 4X7EC 4XPFL 2C4FU 3MLPA 3O2WL 3RZCA 2FR4B 3GMNA 1UQSB 2AV7A 4FG6C 3ZE0F 3HI6H 3UJIL 3TN0C 3VFMB 1FVDA 3QUZD 1HWGB 3NZ8A 4FQ1H 1ZT4B 2JJSC 2BRQA 3FRUA 3QH3B 5HDQH 2OX5A 5LBSH 4DZBB 1DSFH 4NGHL 1XMWA 3V4VH 4NQCB 1NAMB 1U6AL 2X4TB 3OGCA 3PWLA 1LK2A 3KPPB 1NCTA 4KKBC 1U2CA 2GJ6D 5ELIA 4UAOC 2X4UA 1H0DA 1NUNB 4N5ED 3WIHL 4G6AD 5DLML 2H32A 4GLRI 1JGUL 1SY6A 4O5LL 3WXVH 3CFEB 1MCFA 4HAGA 2NY2C 4JGJA 4QRQB 4F9PA 3RKPA 1HN1A 2FCBA 2QV2A 3OAUL 3VFGL 4F7PA 1E27B 4JKPL 4P2QE 3O6FC 5D1ZB 5E2WH 3RWHB 5AAWA 2NNAA 4GBXD 3G04B 3ULVF 4AY0A 7FABH 1TCRA 2YR3A 5T1KD 4QCIA 3K4ZA 1GC1H 3U36B 2KZ1B 5KG9B 2DLTA 3CZJA 1I75A 4OZFH 1F11A 4RFNB 3MRDA 2P1YA 4ZYKB 1A3LL 4LARL 5D7IF 3NIFF 3MRGA 1MH5A 2BSRA 5DJ2B 1RQ5A 4TUKL 5SX5K 5GHWL 5C6TH 3FQWB 1BQHG 1J5OL 5DD3H 1HSBB 4HBCL 4NJAH 4QNPF 2A38A 2D0HA 2GJJA 4MWFA 2W9LA 5FOBA 1UM6H 1VDGA 4PJ7E 5HTSA 1P9MA 2X05A 3KYOA 4WUKH 4GS7C 1EMTL 2DYPA 5CKGA 3EOBB 2QQNH 2R2BB 3HC0A 4C55A 5LQBL 1AY1L 1UT9A 5LGJB 1YEHL 1BAFL 3D3VE 3VD7A 1OGAB 3C2AL 2W65B 2W0FA 3MOAL 3RX5A 3SKUD 1SY6L 4CDGC 1U3HC 3A67H 3CVHB 4UMGA 4JRYE 1SEBB 4IHOB 1WIPA 3H3PH 2AJYL 4W4NA 3HR6A 5FYJE 4O58L 4XHJC 4O00A 4Y4HD 5EPMA 2A9NH 5E95B 1JL8A 4LOUD 4ZOAA 4I2XE 2EE2A 3MBXH 3QUYC 5I75B 4RFEA 2EIBA 4NFDA 3GSVA 1PG7L 5IUSA 1U92B 4QY8A 3S5LB 3RBSA 1P2CB 1D6VL 3MUHL 3INUH 1YEIH 5D7KE 3VFRB 4RQQA 1IGJB 4Y1AB 2KL6A 5MERA 5D71H 5DFTA 3ARUA 5IVXF 2H6PA 1T1XB 3DOSA 3GSXA 2XN9E 3SDAA 1UJ3B 3W0WE 4F37K 1ZHKB 3QDJA 4LVHC 1S9VA 5L2KB 4ELMF 2KUTA 5HHPB 2B5IB 3U6RB 4MMXC 1GCFA 1KJ3L 3TH2T 3EO9L 4GMTL 5D4QA 1NMBL 5E2TH 1ND0A 1Z0NA 1HE7A 4G8FB 4RGNE 3VGHA 2R8SL 1EV2E 1MVUB 1FSKB 4JPWL 5DVNA 4MS8C 2FJFB 4AZ8A 3REVA 4KY1L 3EJYD 3CVIH 5FO9A 1MJJA 3SDYL 5DHYA 1OP5K 1MRFH 1ZHLA 5E56A 2V5MA 1RZFL 1UWXK 5EC1B 2VZTA 3IETA 4LKXB 3GMPB 1KPRB 3EIFA 5FCUH 2WZPD 3TVMC 2B4CC 3BOVA 5D72H 4GKSB 3ISWA 1RI8A 3DX7A 3BRGC 3WO4B 3CH1A 1QSFE 4EVNA 4QOKB 2CSPA 4IIQB 3NCCB 4JY6B 3ZKMD 4BZ2L 1CL7I 2EYSB 2DIAA 1TJGL 1QLEL 2BK8A 5HSFA 3EFFA 3L3KA 4J6RL 4QRRE 2BVPA 1FIGL 5KOMC 4JQVC 4FQXC 5I2IB 3TIEB 1B0RA 3GBLA 4AT6B 4N0YH 3HUJF 5C0GB 1EJOH 2OL3B 1FPTL 4F58L 5BVJB 4JFED 2HFTA 2HVJB 2RQ8A 1IVLA 1QFUL 1F6AA 4ZD3H 1IZJA 1GGBH 1WIOA 1E4JA 3IXTB 4JY5L 3BZEA 3T2PA 4KJWD 2DLEA 2WM0A 4Z8FL 1E4XH 4LSPH 4P2RB 4I4WA 5F9JA 4NYLB 5KW9H 3DSNA 4L8SB 5D1QC 5KZCB 1L7TH 4KHXH 4R7NA 5HHOA 4R4BA 5L8LB 4PY8J 4OJFL 4NZJA 5C6WH 2A74A 2X1WL 3TN0A 3IYLW 5HVFB 3WIIH 4KXZI 4ORGB 3RY6C 2CJUL 1P4LB 4P2OC 4RMUA 4QHLA 3QG7H 3GB7A 3KPLB 3BWAB 3VXOA 4QT5A 3MBED 3W5NA 3KYMB 1VPOH 5EN2A 4X5XA 3H7BA 4OZIE 3SCMC 5DHVH 4KQ4H 1NC2D 4PJEF 5DMGC 3JTSB 5EU3B 3JUZA 5IG7A 5C07E 3O2DL 5JQHC 1MFEH 2ADFH 3GJEB 5CJ8A 3FN0L 4RFOH 1OVZA 1NCUA 1QSZA 2FB4L 4TSCH 4PJ9B 4HEME 4Y5VB 1FNSL 1MHPH 3LAFA 4YHKL 4P5TC 1FFPB 4KI5F 4OV6F 1AC6A 2YBRB 5A16A 2ENSA 4GAGH 3DXAE 1PAMA 4JFDB 1QLRA 1IGIL 8CGTA 3FHAA 1D5IL 1HIML 3MRFB 5FA4B 2XQBH 1EO7A 1OAZH 3C08H 4Q6IC 4HK3N 4CU8A 4YE4L 3O6FA 3RIAF 3C8KB 5JPMA 3IFLL 1FO0B 3QI9D 4Z76A 5MENB 1H5BB 5E1AA 2IAND 2BOBB 2I07A 1CGYA 1I4FB 4LPUA 1ADQA 3X13B 5HVHB 4JREC 3T65B 3TBVB 5IHZB 5IT2L 1NBVL 5HXMA 1WV7T 4WHCA 4JM2B 1CDYA 1S7QA 4MXQC 4IRZL 4DAGH 4U1JB 2V7HB 4ISVB 5AWNH 2BVQB 2V5YA 5GGQL 2CIKB 5IFAL 1JPFB 3P77A 5BO1L 2OQJB 2BVEA 4HIHB 2P5WB 2APVA 3LS4L 1EAPB 3BKJH 3CLFL 1P7KB 3VMPA 4NP4H 5IEKB 4BSVB 5FUZH 3U48A 1JGDA 1NFIB 3PWUA 4NZRH 1KCSH 5GGVL 2CLRB 1CN4A 4GMSH 3W81A 3D0LA 1QFHA 1VACB 1YMHA 3GIZH 3VXTA 2GHWB 1LILA 4OQ1A 4P23B 4XC1H 2ZCLL 1R3KA 4Z5RB 2JELL 4HV8A 4HUWA 2F54B 4RRPA 5ERWB 1QFOA 1TJHH 1BFSA 4DQOL 1MWAB 4FP8L 3QUYA 4P3CL 3CXDL 1KEGH 2BHYA 2QHRL 5DA0B 1DN0A 1U8HA 1AQDA 3FO0H 4L4TA 3KLAA 1BIIB 3KPSE 3NIGE 3WUWA 5C7XH 5H37G 1ZLSL 1T1WA 1INDL 5DWUL 2Q8AH 1DTUA 3TBWA 3E6HA 1NGYA 4Q6YA 3BX7C 4QRPD 4GQ9H 5J11C 2IFGA 4U6HB 1HH9A 4L3ED 5C9KA 4PJXB 5E4EB 5TH2B 1CXHA 2EDJA 1HYRC 3DGGA 2FYYB 1VHPA 2K7QA 1MI5B 1KENH 3P30L 3Q3GB 4OLUL 1I1RA 3K4AA 4JN1L 3KLHD 5FK9B 5E8DL 1PJ9A 2VOTA 4AQOA 3UPRB 1EHNA 4Y2DC 1WEJL 5EO9A 3MRQA 3C60C 1T4KA 3B9DA 1CFVL 4KPHH 3IVKB 2BVUA 4UILH 2EDLA 2VQ1B 1ODAA 1WFUA 1G9MH 4DKEL 4LK4A 4YHNB 4P4RB 3WSQL 2FEDD 2AKRA 1ZAGA 3AXLA 4N9GB 4X6CB 4HH8A 1MIMH 3VD3A 2HG5B 3TVMA 1KACB 4PJ5D 2QKIA 1K5NB 3ES6A 5DK2B 2ZOKB 3BSZH 1NGZA 4Y5XA 3BMVA 2R0ZL 4X7FC 1H3PH 3O2WH 3IXAA 3ME0A 4XBPB 4I77L 3DRQA 1FNLA 3MRIB 1K6QH 3D85A 1EHLH 2XI9A 2IBZY 2J8HA 2AVGA 1E4KC 3NCJL 4JQVA 4FQXA 4PRAA 1K3IA 4X4ZA 4RGOH 3TNMA 5B21A 4NO5A 1MFAL 4JVWA 3SE9H 1A6ZB 2XZCL 1U6AH 3VXPB 4R97C 3ZTNH 1Q1JL 3AAZA 4HC1A 2FLBT 1OP3K 5JW4M 3L5HA 2VLME 3CFBB 3S88H 2R1XA 3CAFA 4GT7A 5L7XL 3DNKA 1HYSD 1NKRA 1CIDA 1AXSA 3O9WB 3PIQA 5EZOH 2NZ9C 3E6FA 2VAAB 2VDPL 3E1F1 3QNZB 4Y19A 2DQCH 3LD8C 3H8NA 5ESQA 4JKPH 1XIWB 4P9HL 4X99B 1RZKL 1WVZA 2XWBA 5TF1L 5FO8A 4ELKB 2VUOA 3CCHB 1ACZA 5IB1B 2APFA 3SCMA 5EU6A 5EA0H 4EI5C 3KXFD 5HDBE 2NYYC 5F8RC 2JJWA 5C9JA 5C86A 5GRUH 3U7AA 4G6FD 3VGFA 1XR9B 5J12B 1JZ6A 2XKNA 5I71C 1A3LH 1U2HA 1FLRL 5T1DH 3A6BH 1SYSA 3BEWA 1NUFA 5CEXB 3DX6A 3HC4H 2YZ1A 3JZ7A 3BI9X 4J3XA 4Z7VF 3X11A 1QR1B 4Q2ZB 1F97A 1U8PA 1HILB 1OLLA 2O93L 3PJSA 2D9CA 1JWSA 4WEBL 3TIDB 4BQ8A 5A2LH 4MXVE 3B9VA 3SE4C 1U95A 2YA2A 4HJJL 3PWPD 4FQQA 1FAIL 5GGTA 4HC1L 3LQAL 3QQ3A 3IKCA 5LAXB 5GGVY 5JOPD 3LEYL 3BP4B 1I1AD 4S1SL 1Z9MA 1SY6H 4JQIH 2MCPL 3F62A 3MUGA 1ZGLB 2ADJB 1L7IH 3QIWD 2NXYD 3T0EB 4TVPL 3NAAL 1EXUA 1AJ7L 5C6PB 2VR9A 2DMCA 3WV0A 2AJYH 4XCYA 2ZJSH 4AIZB 1LD9A 5EBGA 1AGBA 3OX8A 1HHJB 4M1DH 5I66A 3NN8B 3KGRA 4HT1L 4MHHI 2DKUA 4LP4A 2GJZA 5C0CD 2ORBL 3L5WB 4FQLL 4G8GD 4WUUD 1B6UA 5FV2A 4NQCD 3D2UB 4LLQB 3JWDC 4WNQA 4LSDA 4MXWH 3M45A 1CFNB 2E6QA 4JJHA 2WINA 5CS7A 1JPGA 1LK3H 4JFOB 4GRWB 5I1GL 1G7MA 3I6GA 1YECL 3GJFB 1D9KD 3B9KC 5E08H 3FT3B 1FYTD 3WNKA 2HJKA 4M6NL 1MREL 2FBJL 4X6EB 3I3BA 3J7HA 3SE3C 4KZEH 5I76B 5C0AB 5EOCL 4K71C 3X3GL 5IMMA 1QBBA 4JPWH 5GGTL 4R8WH 4JB9H 5T3XD 2Q7YB 1E6JH 4NJ9L 2X4SA 3LEXA 4PRHB 2ADGA 4JRXD 5IVZB 1OPGL 1MHHB 5DRWA 3RX7A 4LEOB 5J4MA 1MAKA 4D0CA 3OMZA 4FNLL 1A1OB 2NR6C 3SGDI 2E8YA 5GJTH 1G84A 4HIIA 1YEJH 2VKWA 4I48B 4KMTH 2F5BH 2Y25A 3QXDA 3O8XC 3JV6B 4DVRH 3VGAB 3KYNA 1VADA 5ALCH 1ETZA 5F6HI 2R4RH 4PP1C 1KEMH 5HYSB 1QRNB 4XCCH 3HZYA 3MV9B 4PG2C 3D0VB 3V79C 1EEZB 4CDHA 3ARYA 3DI2B 1BQLL 3C60A 4J6RH 4BK4A 2VDRH 4HWEH 1BQUA 4JPKL 4KJYA 4P46D 4X7DC 4DEPC 3OR6A 2GK0A 4KJPC 3LDBC 3JVGA 4K3GA 1A7PH 4X9GA 2AV1B 1FPTH 3ARXA 3AS2A 4G6JH 3HN3A 3O3EB 1X4ZA 4NZDA 2J88L 1JPTH 3GMOA 3DX9A 1WZ1H 1A0QH 4Z8FH 1AO7A 4YR6B 4F15B 4WHTB 3WFBH 4NM4H 2RFXA 5IGXL 2VXUL 4JDTL 4YHZH 4PBXA 2R69L 3LZFL 4NQDB 1RIHL 3RL2A 4XNZB 2HLFD 1N8ZA 3BVNB 1NBZA 5H2BA 1C8PA 2LAAA 1S5IL 4ESKA 3TJHC 1E4KA 4U6YB 5CJXC 3RVXC 3EDEA 4QOKE 5KSBB 2K7PA 4Z78A 4FTVB 3RPIB 5C09D 1PD6A 4C56E 1D5XA 2Y06L 3JBG7 1LMKA 5GZNC 4LNRA 2XZQL 4YBLC 3FO2B 3GUTB 2XYCA 5SWSE 1R5IB 4UQ2B 1ZHBB 1IGCH 3QUKB 3GSWA 2H45A 1J0JA 2YC1A 1FORH 1ZSDB 1LDSA 1OSPH 1AXTH 4O2CA 2ZUVA 1CBVL 2DQIL 2IAMB 3DVNA 1KCKA 1ZHNA 1D5IH 2H3NB 5KVEL 1K2DA 3QEQA 4QLRA 1CFTB 4I5BA 2ATKA 1YEGH 4PJHA 3V0AC 2VDOH 2YMXH 2AGJL 2Y23A 5HPOA 5I1LA 4YHOH 4DGYH 4HPOH 1EX0A 1AR2A 4EI5A 3LN4A 2A6KA 4M7ZB 1GHFL 1H3GA 3S8WA 3VXSB 2Z91A 4OF8A 5F7LB 4J4PC 4PGBB 3UAJC 3CDFA 3QPQD 4ODUA 3QP3A 1F13A 1H15B 3ULUF 1KYOK 2X42A 4DW2L 3OKLB 1R24A 5TQ0L 4RGNC 2Q8BH 2PXYD 3BYYA 4DTGL 5EWIL 3B9EA 1XCQA 4UDUA 1ERNA 3VW3H 3ZYZA 1CFSA 5IFAH 5J9PA 2HYMA 3AREC 3QFDB 3TO2A 4I3SL 1GH7A 3SO5A 1NFDA 3PWNA 5J3HD 1XGYL 3KS0J 4OZ4A 3SE4A 1AGFB 3P4MA 4TNWF 5IWLC 3DRTB 1VKXA 3MV7E 5HGAA 1A7OH 4PUBH 4RMRA 3BE1H 4Z7WA 3RA7L 5EG6C 2J2ZA 3TO4D 4JFDE 3T3PF 4WWKA 3VXNA 1RZJL 2JCCE 1R0AL 5BW7C 3QR2A 3P0GB 3SKMA 5JXAL 1WTLA 4ZNEE 3QAZC 1UXSB 5FDWB 1DL7L 2BJML 3QNYA 2XNAA 2ZSWB 3OQ3B 4H20H 4FQCL 5MENE 3S5LG 4O2FB 4NKOA 3OBAA 2NTFA 4MD4A 1CD1B 1WWAX 3HE7C 4OGAC 3CXDH 4HFWB 1A4JB 1F3DJ 3B2VL 4I18B 4G9DA 3MLXH 1NBQA 4AMKL 3TV3L 3MQIA 4DVBA 5T5FH 2JJTC 3MRNA 1ZLSH 4KZDH 3FQTA 1ADQH 5L0QB 1JRHL 4EN3D 2BY1A 2EDOA 4HZLA 4MDJB 3MODL 3QO1B 4ODBD 3D9AH 4WV1C 4ZODA 3VFVB 4JQXC 4S2SA 5E6ZA 3RUGA 3BH8B 1MRCL 1AI1L 5ITBH 3PDOA 3TJEL 3B9KA 4PG9A 1FIEA 3G6JB 3VG0L 1YMME 1A5FH 3QWRD 5E8DH 3SE3A 1AKJD 4J1UA 1WEJH 3G6AA 2DQDH 3OV6A 3QXTA 2LAGB 4K7FB 3WNMA 4PJFB 3OKMB 4LCWD 5I9QC 1F4XH 3D69A 3U0TA 4HS8L 5IFJB 1V3JA 1G7QA 1BVLA 5E03A 4Q58C 1P1ZA 4PTTB 1GXEA 2IBGA 5FYLH 1CT8A 1P84J 5B38A 1WBYB 3OKOB 5JNYB 4QEGA 4M61A 1EUUA 1LEGA 3BZ4B 1KT2B 4KTDH 1BVKB 4A6YA 3UCRA 2YD6A 2VDLL 3MMEA 4YPGB 3MGTA 1S78C 4P2QA 4X8JA 2NX5B 2QQKL 4PG2A 3QUXD 1N5AB 1MAML 2QSVA 3WJLC 5E9DD 3L3HB 5FHAH 1XF3A 5HHXH 5MEOB 1T6VN 4FMFA 1RPQA 1RUPH 2QR0B 2J12B 1T66D 2EO9A 3T1FA 3MREB 4XAWH 3MRMA 3EYUL 2R0KL 5DMKB 1KNOA 1C08A 1I9RH 4CW1A 2OI9C 3DWTA 2XY2A 2NW3B 4KKLD 4KUZH 3RWDA 2BNQE 1SBBA 4LLVB 4OFVA 5E8PB 3F5WA 2FEEI 4OZGE 1VGEL 2VH5L 4N0FB 5FECB 4LBEA 1JCKA 3L1OL 5JLZB 4PJ7A 1IGMH 4YDLB 4OZHA 1NC4D 3WIFB 3ZDXF 2AK4D 4GRLC 4ZFZB 2HJLB 5B8CC 3D18A 1GOHA 5CJXA 4ODSL 3D3VA 2AXFB 5C08E 1GOFA 4X4XA 3TZVC 2I9LB 1JV5A 1AE6L 3D39A 5JOFB 3O6LL 3WJJC 1YYMH 3RGVB 2EC9T 4PTUA 4XXDA 4WI4A 4JRYA 2FJGA 2B4CH 2CDGB 1J7VR 2RIKA 3N85L 3DIFB 1J05A 5DJ6A 1R5VA 4XNMB 5B3JF 4F7EA 1U8JB 2P8LA 4I2XA 4N0UB 1DBAL 1YN7A 4FXLA 1VGKA 5HI4D 4WGVB 3X14A 5DFVD 5D7LE 3VFWA 1ES0B 1YPZA 2ZP0T 5HHMB 5GJSL 4WFGE 3S4SB 4HXAL 4WEBH 3HI1B 4CNIB 2CDEB 2M1KA 4YBQC 3GNMH 3A6CH 1D7FA 3LKPA 2JB6A 2A6DB 3LN9A 4IEFB 2EE6A 3VMNA 1CK0L 4WENB 4M7LL 5KSAC 1GGYA 2XN9A 1T5XB 3W0WA 4J4PA 2WK2A 5DQ9B 4MQXC 2ZSVB 4JKKA 2ZZUT 3C9NB 3IAPA 3HE6C 4O4YH 2WBJC 3HZVA 3TA3D 4N8CL 1I7TB 2XTLA 1W72B 2UYLB 1KB9J 1QPPA 4LAQH 4YHYB 4KRMB 1BWWA 2CKNA 2OJEB 4EIZC 4NNYB 5EO0B 1F6FB 4LPVA 1A7NL 3QQ9D 1F6LL 2BNUA 4G7YL 1NLBL 3L5XL 2J4WH 25C8H 2ESVB 1F4WL 2F9BT 5HD8C 2OTWA 5DRXA 5D7JC 4U31A 2GJ6E 5BW7A 3ZKXC 3PWJA 4LVNB 4DFIA 1XF2A 5I1GH 1HSAA 4XP9H 4OLXL 4IDJL 2CH8A 5IHBA 4TTDC 2VABB 3TBYA 5IJVB 2B1HH 2OBGA 4JO2L 3MRLB 3N1FC 2R29H 4QRRA 3DO3A 3IAGC 4M43L 2NY6B 4NBXB 3HE7A 4D9LL 4YXLL 3CUPA 4XMKH 1RVFL 4HWBA 3C5JA 4U1SB 4ZDHA 2BSED 3MXWH 1LP9E 2BZDA 4NIKB 1ITCA 3I84A 3RNQA 2JJTA 3MXVH 3U1SL 1AHWB 1SBSL 4KRPD 4NQSB 4AIOA 3UTQB 5E5MB 2G75B 5IQ9A 2V5SA 2WMPA 4WV1A 4JQXA 3SJVA 1FZOB 2CO7B 1ORSA 4M7JL 4BKLA 4L1HA 4CVWA 1CDBA 1Q72H 5SWZB 3SDDD 5EULV 5H8DA 3S35L 3ALPA 5ESVA 2BSSB 1DQLL 3BD5A 4X4MA 3I85A 5GRXG 2HVKA 4PYHA 3VWJB 2EDFA 4GSDL 5F7DB 2XKUA 5GS1A 3VFOA 3RWGB 1XGPA 4OD1L 1EDQA 4V2CB 3Q5OA 3N9GH 4QXUL 5EZLA 1I1FB 4OZIA 1WBZA 1DVFD 5I17A 5C07A 2CRZA 4HDIA 3ZE2E 1BJ1J 2ATPB 1KIQB 1L9MA 4UNVA 3MR9A 4QRTB 4EBQL 3T2NL 1ZA6A 2DQHH 1NUDA 2YRLA 3ZDYF 2PW2A 4ZUWB 5DHVB 3B3IB 4JFXA 1AP2B 3DXAA 1D5BA 3MYJB 1DUZB 2Q7NA 2NCMA 4PJHF 2R69H 2OXHA 5KAQF 2VLRA 4LLUB 4LDLB 3G5ZA 1F45A 5F88B 3P9LB 2WBKA 5IVXB 5F71A 5F9OL 1KULA 2GY7B 2YUXA 3UTOA 1N3NB 2CIIA 4X7CC 2VLLB 4YHPB 5IMLA 3U46A 4HWZB 4ELMB 2Y6SD 3QA3B 1NGPL 4DN4H 4P5MB 1Y0LB 5IF0A 2E5EA 1NCAL 4N1CA 3MV9E 4U6XA 3LHPH 4KKAD 2EKJA 1T1ZA 5CJQL 1EBAA 1MCPH 2P24A 1MNUL 4N68A 4QGTA 5F89A 3TFKC 4ENED 12E8H 4RFNC 1YYLH 1P4IH 3OJDB 2X89A 3GEWB 3RI5F 2VXTL 2A83A 2P5EB 4Z7WF 2DQIH 1G7PB 3KVQA 1KBGL 4LRNH 3SDCC 1LE9B 2E27L 3CDGB 3V4UL 2AXGB 3FTGB 1WZKA 4WRLA 3B5HA 2IH3A 4PRID 4OIBA 1QYGL 3TZVA 5DO2D 3P4LA 5KVFH 3WJJA 2ZPKH 3LQZA 2ZKHL 2OMNA 2XWTB 1QRKA 4CN1A 1IT9H 1KCRH 1DBMH 4XP6L 2OSLB 5HYFA 3ILPA 5D9SB 5C8JA 1CLYH 5KSBE 4Z77B 4DW2H 2R9HD 4HJ0C 4R0LB 5CFHA 3CFIC 4XP4L 4XCEB 5T1LD 2GQHA 1YN6B 4QHKJ 4H26A 3MRHB 3LVEA 1S7RB 4L4VB 3R06B 2DWDB 5J1AA 1LEKA 5J06A 1MLCA 2ADIA 2QADD 5EORL 3RWJA 3VGGA 3DVGB 2R2EA 2AQ2A 1NEZA 4U1HB 3MNVA 3KPSA 3MZTA 1FZJB 3CMOL 1UM5H 1OQXA 1A7RL 5BV7L 3CFJB 1WWWX 4JPIA 4IOFD 3WDHA 1DN2A 1DLFH 3KLDA 4QRUB 4JFEE 3I3DA 1UM4L 1R0AH 5CEYA 4PJDE 5DVKA 2D7MA 4M62H 5DJXA 1TVBB 3AU1A 1U8QA 4NCDA 3RTQC 4NBZB 5T33H 4UV7L 2IADA 4TOYL 3ETBF 3M07A 4HJGA 4D3CL 3MLVH 1FRGH 2BMKB 2APXA 1KV3A 5BXFA 2GFBB 1OTTD 1FVEB 5E6IC 3RWEA 1PQZB 4ONGH 4LAJH 2HJFB 2J6EL 5LGHH 4L8CA 3FB7A 2XTJB 2X4QA 2AEQH 3QIBD 4R4NC 5I8EA 1QKZL 4I9WD 1RMFL 4FTVD 3TBTA 5GGUA 1HI6B 1JNLH 3MRKA 3TC9A 3F7YA 3F12B 4YQXH 3FONB 4PJIE 1ZWIB 4LKCB 5D7JA 1C5CH 4K9EL 4MB3A 3CX5K 3MODH 4AL8H 5IB3A 5ITFA 4U49A 2AEPH 3L3OB 1LQSR 1MRCH 2OR8A 1AI1H 2P8MB 4Z0XA 1YEDA 2F74B 2EEAA 3HNTL 2NY7H 4QHUA 3IGAA 5E8EB 1SQ2N 3QXVA 4S0SD 4AH2A 4W6WB 2HH0L 3KPRB 4QXGH 5CEZH 5JW5A 1CE6A 3SPVB 2BNRB 4JDZB 3MX0A 1U8KB 5D1XD 2DM4A 1JNNH 2NW2A 1VCAA 1C16B 1TPXB 1JPSH 1CTOA 1S3KH 3DYOA 5HYSG 2DTML 5BQ7A 4ODWB 1ZTXL 3BQUC 5DJZA 2GTZB 1MFBL 3U30C 2SEBA 4DGIH 4XWOD 5GZOC 3QEGH 4M5YL 4WI6A 1GOGA 3U7YL 2IG2H 4M9PA 4IJ3B 1OAYL 3BKCL 1SJHB 4OSUH 3JWDH 3BN9C 5HGBA 4LHUB 5KS9A 4YGAB 3MV11 3QDMA 1AGDA 4OI8A 3FQXB 4F3FB 2WUCL 3C8DA 2H9GA 1OCWL 3NBNA 2JIXB 3PDGA 1K3ZA 1EAJA 4RDQG 5L6YH 4CMMB 5J57B 2CXGA 5D2NE 5DUML 2Q76B 4R3SB 4PJFE 4WU7A 3CX5J 2F53B 2FHFA 4ZUTA 1RFDL 2WQRA 1MCJA 3EYQD 2IBZX 1T7YA 1VGEH 3MLYH 3WFDH 2XQYK 1CFQB 3EYFA 1S7TA 5A2IH 5J13C 1MJ7H 1UH4A 4G9FD 1S7SB 3NA4A 3PV7A 4G6MH 2ARWA 5DEFA 2NMSA 3RZCB 3GMNB 2AV7B 4LQFH 4LSSH 2AJSL 3TYGH 1FVDB 1OAKH 3QZWA 3VD4A 3NZ8B 1CD9B 3FRUB 2N4IA 1SM3L 1T6WA 4Y4FC 1AGEA 4DK3A 1N2RA 2F19H 1BGXH 3C5ZD 4QHNA 3OGCB 2J3SA 3PWLB 4YBHA 4EIGB 4L3EE 1LK2B 4BSWA 4A6YH 3N85H 3IJHA 2R23B 2X4UB 1H0DB 3W9EA 3WLWC 4ODXA 1QD0A 4PJCE 4WI5A 1B2WH 2H32B 2ARJQ 2VZVA 1S9YA 3QJFA 3F65A 1HXMA 3TT1L 3X17A 2A1WH 4HXAH 3CX2A 1I3UA 3SDCA 1IEHA 2HTKC 4F7PB 1YEKL 2OP4H 3GI8L 1Z5LA 5TFSH 3UYPA 4K94L 2X70A 4PRDA 3PV6A 1A6VL 2NNAB 3OPZH 1I8KA 3O41A 1TCRB 3JV4A 3JTTA 1YNTA 4QCIB 1D5ZA 1OW0C 2LU7A 2VDNL 3VU2A 5IOPA 1UWEL 4HK0A 1F11B 5I1HH 3MRDB 1X5FA 2ZCKH 1AFVH 2V6HA 4PP2A 1UG9A 3MRGB 1MH5B 4LPXA 2BSRB 3ESVF 4XCFL 5DD1L 1A6WH 1U58A 4HKZA 1WSST 3EYSH 3DJ9A 3PGFL 4MWFB 1V3LA 4OLYH 4Q9QL 5FOBB 1G7JA 4NO0D 4Y5YA 2H2SC 4N0UE 5IESH 3KYOB 2GTWA 2IF7A 2DYPB 1ZLVH 5CJOL 5HYJD 3MV01 3UC0L 1I3GH 3HC0B 3H9YA 4BQBA 3D87B 3QSKB 5FYJH 2HT3D 3RY5A 3THMH 1LHZA 1RZ8A 3OKDA 4GUPA 5CP7A 4O9HL 4KK9D 4HPYH 1IMHC 3VFSA 1QOKA 2AJ3A 2DB8A 3RTQA 1CR9L 1HHIA 4U1IA 4IDJH 4UNTA 5EU7E 2VZ3A 4JKMA 4UBDD 4ZXBC 5I8OL 1X4YA 4WTZG 3NH7L 3O45A 4XBEL 4OZIF 5E6IA 5EPMB 1RURL 4XP5H 2IH1A 5BZWA 1CDJA 4ZPVA 4RFEB 2R0LH 3RVTC 3GSVB 4QY8B 3FL7A 4P9ML 3IDNA 4JHWH 1OAUL 3ULUL 4Z7VB 4APQC 1JYXA 4XVUD 3HC3H 4RQQB 1UKSA 3KXFE 4KKNA 4U0RC 5AYUL 4G7VL 5MERB 4HG4K 4KTYA 5E2UH 5DSCA 5K9KB 1ITBB 3QHZL 3OZ9L 4M7JH 4LASH 5I1AA 2H6PB 4H5SA 4EKXA 2ESVE 3GSXB 3SDAB 2FGZA 5AZEH 4NM8L 3G9AB 3QDJB 4OV5A 1S9VB 5K59E 3PXJA 2JTDA 4R2GB 2IWGA 2P8PA 1P53A 1DDHA 4GSDH 2GUOA 4YWGL 1GGTA 1ND0B 4CU7A 1INQA 1F02I 3PL6C 4NZUH 1F42A 3PWPE 3FQNA 4B50A 2V2XA 3HB3C 3DMMC 1HCVA 3REVB 5J6GA 2DICA 1X5IA 5EOQL 5CD3A 5FO9B 1MJJB 4YUEL 5SWSA 5DHYB 4XP1H 1ZHLB 4HSQA 1PW3A 3ZYOA 1FE8L 2E7BA 4LMQI 2NZIA 2VC2L 3T2NH 4PGJA 2V7NA 1SYVA 3IETB 4TNVK 1GGUA 1TNNA 2CKBA 2G5RA 4NQVA 5CAYB 3BQUA 3DX7B 1KELH 2GW5A 3CH1B 4HWBH 3OAZK 5GS0L 2VDKL 4EVNB 4M02A 3RPKA 4DGVH 4X4YA 2Y5EA 3BH9A 3KPMA 1X5LA 1LO3H 5F9OH 3V4PL 1ZK9A 5CGYD 3ESUF 5SWZE 5FYKD 5C0CE 3H3BC 3L3KB 4G8GE 2BVPB 1FL3A 3DUSA 4WUUE 4JR9L 1B0RB 5IROC 1XF4A 5KVDL 3S3PA 3BDXA 1CICD 1QBLL 3MJ8A 3ARZA 5CJQH 1B4JL 3MA7A 3QDGD 1FL5A 3DO7A 1F6AB 3F7VA 2N56A 4GAJL 3BZEB 4HG4J 3ARGD 1BF2A 3NIGF 3ULVD 2PR4H 4I4WB 3Q6GH 3QUZC 4MA7H 4Y4KD 5C0BD 5F9JB 4MAUL 4RNRA 5CINH 4R7NB 5HHOB 4R4BB 2O5YH 3BRFA 1HHHA 2NY5C 2KH2B 2NXZD 3MV7A 4LFHG 4FA8A 2A74B 5F96L 3TN0B 3NCBB 5T3XE 1C1EH 5DT1L 4OM1L 3HG1A 3R1GL 3ORJA 4JRXE 3DURA 4QHLB 2JCCA 4RGMB 4LNVA 3PP4H 4Y4FA 3GB7B 4N5EC 4ZNEA 2MCG1 4G6AC 4QT5B 3VXOB 5EN2B 4X5XB 4ZFFA 2CKBL 3H7BB 3IJSA 5DK3A 5TDPA 3O6ML 5FGBC 5IG7B 4K8RL 3X3FH 1HINH 4UAOB 3S4SG 3WLBA 2CPCA 2NY2B 3GMQA 4X80H 2BFVL 5EORH 2AQ1A 4WWKD 1RULH 4X5WA 5A16B 4GBXC 4OCSL 4EDXA 1NGXA 2AK1H 2Y07L 1ZGLM 1QLRB 2CMRH 4PRPD 1DBBH 5KVGH 3AMLA 3O6FB 3AGVA 3NFNA 1B0WA 2O5XL 2OTUA 5JPMB 1RK0A 5A2KH 2MKWA 4UI2A 3GMRA 1GGCL 4F57L 4NQED 3RAJL 4Z76B 3BP5A 2DOCA 3WO3B 2A6IA 1I1YA 2I07B 1OW0A 1YMMA 1KB5L 3RU8L 4TOYH 5DYOA 1AIFA 4D3CH 4LPCA 1S7QB 4MX7A 4WGWB 4QYOB 5JHLL 4NWTL 3P77B 1CE1L 4UT7H 4TN9A 4UOJA 4X6BA 3MOBL 3SKOA 3P0YL 3RDTD 4N8VB 4D9QD 5CLWA 3F58H 4GS7B 5C09E 2B7DT 1ORQA 3N1GC 2HKHH 4EI6A 4L4VE 1JGDB 3V0VA 4MZ2A 3PWUB 1JZ4A 5KANI 3IRZA 4JG1L 4OCYH 3VXRD 2E6JA 4MCYA 4ZAKD 1GAFH 5CILH 4Y4HC 4OCRL 2I60H 3ALWA 3HZKA 3D0LB 4XBGA 1OTUD 4LOUC 5E7FA 1YMHB 3VXTB 4ZXBA 1R3KB 4HV8B 4HUWB 2V2TA 2UUDH 4CMHC 1RUKL 1UA6H 3NZHH 4KQ3H 2K9UA 4ERSH 5CCKH 3QUYB 4LLMA 4XC3H 2EICA 2Y4SA 4Y8DC 2XICA 2IQ9L 1DN0B 1U8HB 1AQDB 1UFUA 4L4TB 3KLAB 3MJ9A 3WUWB 4APQA 2VL4A 4XVSL 2XTJE 5H35A 1TFHA 1T1WB 3TBWB 3E6HB 2PTUA 1NGYB 4N0RA 4HQQL 4BZYA 3T0XA 3UBXA 4OZGA 3IFPA 4XNXH 4MXVF 5F8QC 4YHML 1HH9B 1Z2KA 3GHBH 3STZA 3WKML 2DLIA 2W9EH 1FLTX 1P6AB 1ZTXH 5IFHH 4ZOBA 3DGGB 2D0FA 5I73C 4QF1A 5DD5H 4EQ2A 4M4PA 4LVHB 5HI5D 1BD2D 3H7LA 3MFFA 3P9MA 3BIAX 4CKVX 4M48H 2FO1A 2PUQT 2FGWH 4RZCB 5JHDD 3SKJL 3CD4A 1FN4A 5C08A 3PL6A 5EO9B 3Q6FA 3MRQB 5JORA 1MPAH 1T4KB 4HUVA 4N0CC 4U1GC 3DMMA 4WY7H 2WUCH 4NFBA 3LV3A 3L95B 2BNRE 2Y36L 2AKRB 2ZUQC 3I2CL 3AXLB 4RX4D 1HKFA 1KJ2L 5D7LA 1A2YA 4L9LC 1U8NA 3TVMB 2QKIB 4XNYL 4RMTA 4YNYA 3A6OA 2PO6D 1Q9WA 3ES6B 1J0HA 4DOHB 2AJZA 4FZ8L 1NGZB 1UCBL 2FX9H 3LCYA 4Y5XB 2DS4A 3HFML 2IGFH 1EEYA 3IXAB 2Z92A 1X5JA 1LEIA 1IEBA 3DRQB 3MJ9L 1FZKA 3D85B 5DZNA 4U6VL 1GPOL 1NMCB 1TZIA 4KI5D 3I6LD 4FQXB 4PRAB 3TNMB 1X5YA 3QHFH 1KIUA 5IROA 2PTVA 4NO5B 4OCMC 5I1KL 3ZDZE 3AAZB 3L6FA 4FQJL 1S9WA 5ABDE 2CR6A 2LE9A 5JZ7D 1Z9SA 3OXRA 5TE4L 5DRNB 1SEQH 3IU3A 2QBWA 5GGSA 3TWCL 1DBJH 4TULH 2R1XB 3QUZA 3NCYS 4BJLA 1IARB 2FSEA 3L5JA 1AXSB 3PIQB 4HGKC 1IJ9A 1DBKH 2F53E 3E6FB 4Y19B 3MBEC 4L4JA 3O4LD 4LCWE 3ZTJG 5ESQB 3LY6A 1YNKH 2GJ6A 1KC5H 3M8OL 2XWBB 4OLVH 3VFTA 3WDIA 4GAYA 3SCMB 1GGIH 5EU6B 5HBBA 3T4AB 5C9JB 3ELAT 4LHJB 4LU5H 4MA8H 5IW6A 4U7KA 3PQYD 3MGAA 1O7SA 4PV8A 1BFTA 1JN6A 4ZSOE 4ODHL 2XKNB 1Y18A 2FIKA 1ZV5A 4JDVA 1OLZA 1SYSB 1RUML 2ICCA 3BEWB 3MCKA 1IAOA 3DX6B 4P5TB 5EIVA 5LVEA 4UINL 3O0RL 3X11B 5E9DE 1LP9A 4H8WL 4GBXA 4QTHB 5GPRA 1U8PB 2EE9A 5I16A 1JWSB 3VXUD 5K9OA 2YPLD 4Q6IB 5LCVL 3MV8D 1U95B 3UTPD 5LKNA 4I18C 4Q0XH 4FQQB 2WWKT 1EVTC 4XHQA 2RHEA 3QQ3B 3IKCB 3MO1A 3FN9A 1CGWA 6FABL 1CTNA 2WLYA 1BX2A 3BIBX 3FB6A 1BQSA 1T80A 2R4SH 4MLSA 5FCSH 1ZVSA 4XNUL 1VFBA 3MUGB 3F8UB 5E99H 3C5SA 1PEZA 1LWRA 4LSVH 1IKFH 1EXUB 3MLUH 3BWUC 3WFEL 4XCYB 3MCLH 4XBEH 1LD9B 3FAWA 2AK4E 4U2YA 1AGBB 1N5YL 1QFWM 1M05A 3AS0A 1NJ9A 2ZUWA 3OX8B 2NY3D 5I66B 3S9DB 3G6DH 1EFXD 2FECI 3JWOC 4PREA 3EO0A 4MAYD 2GJZB 3KJ4C 5ADPH 4TRPH 5D2NC 2R2HA 1G7LA 4GW5A 3HI5L 5GS2H 3SGJC 1N7MH 2HN7A 4PPTA 4WNQB 4M3KB 4DCQA 3KR3L 3QPXL 1V8HA 4DUWA 1J87A 5B3NA 5C2UB 2WINB 4Y4HA 1JPGB 3GMLA 5D2LE 5DQDH 1CDCA 1FZMA 1ZKAA 2RB8A 1CG9A 1G7MB 3CK0H 3I6GB 3QCTH 4S1QL 1W8OA 4GOSA 3ZMRA 5A2JH 2HJKB 3I9GL 1WC7B 5D70H 3UDWC 4P5KA 1CGUA 4MQSB 2QQQA 1FVCA 4PJAA 1HNFA 3LH2H 1UB5A 5IMMB 1T21A 3JV5A 3SKNA 5DS8A 4UIKL 1J1OL 1FJ1A 4K2UH 3O11A 2E9JA 2BCKA 2X4SB 3LEXB 1MJUH 2ADGB 5DGRA 5BOZG 5DRWB 3R4DA 3C2SA 3FT4A 3W11D 4D0CB 2E9WA 3UXFA 4BZ1L 4HIIB 3HPLA 1RZIA 5DGQA 2DQGH 4FQ2H 1JNHA 1TLKA 5IEHA 3MUY1 3KYNB 2XA8L 3LMJH 1H8SA 2VDMH 1F4AA 2ARJA 1VADB 1ETZB 1JFQH 4QGYA 4YDJA 4R90H 4LHUG 3PF2A 4FQHA 2JCCF 1L6ZA 4PB0L 4S10A 1NCBL 3HZYB 5DJ0A 3V5KA 3PGDA 1MQKL 3C60B 4ZUVA 5E94A 4Q7DA 2VUYA 4RMQA 2H8PA 3RIAK 1A6TA 1OT2A 1X5KA 4KJYB 3CZFA 1DEEA 3OR6B 2GK0B 4QXTA 1A14H 4KHTH 5F44A 5JXED 1GJIA 2JK5A 4QKXB 2QSQA 4R4FL 3V7AG 1T03L 1B4JH 4NHCH 4TTGA 2RCSH 1FG2A 4OUUA 3BT2L 5F1NA 3GMOB 4L9LA 3DX9B 3RP1A 1AO7B 1TQBC 4NT6A 4V1DD 1OT1A 1MY7A 1S7UA 1U3JA 2ZG3A 1WFOA 2RFXB 4AIXA 2H26A 3RL2B 5KTEH 1N8ZB 2OXGA 1NBZB 5H2BB 2XXCB 2BRRL 2NY4D 2BVTA 1BBDL 4OM1H 4ZFGL 4JFEA 5HHNA 4Y7MA 3EAKA 1FC2D 4PJDA 4J3VA 4Z78B 4JPVL 5F9AC 2F8XC 1XT5A 1JZ3A 1D5XB 2IQAA 2OL3H 1YEEH 3UMTA 4R97B 2CKBH 3KDMA 5EU7C 4LNRB 1E4WL 1V7ML 3O6MH 4YDIH 1HYSC 4S1RL 4MA1B 4YFLF 5GRJL 4LEXH 3QO0A 4ALAH 1MCOL 3DV6A 2FWOA 3HMWL 1OL0A 3GSWB 1Q94A 3LKSA 5I1CH 4HUUA 4OTXL 1T0NA 1IAIL 4O2CB 4OCSH 4WJ5A 3DVNB 3LD8B 2YPVH 1ZHNB 1GL4B 4E0RA 4YHYC 1K2DB 4PJIA 1JZ5A 3QEQB 1EO8L 1NC2A 4I5BB 2ATKB 4PJHB 1TETL 3H9SD 2ICWJ 3IDJA 2HT2D 5I1LB 4D9RE 3N06B 5GGSY 1NMAH 35C8L 3CSYA 4EI5B 5E8OA 3LN4B 2A6KB 4OFYD 1BJ1H 4I8DA 2QLVB 3RU8H 1HEZA 4ODUB 4PLKD 3U82B 4EUPA 1R24B 3EYOA 5I71B 1EO5A 1BREA 1VFAA 1A22B 1CLCA 4JO3H 1XCQB 4UDUB 1CFSB 5J9PB 3K3QA 4F9LC 3TO2B 4X0KA 4PY8I 3WCYA 4YO0A 4C57C 1ZT1A 1NFDB 3QI9A 3PWNB 2NY6C 3UPCA 4OZ4B 1I1AC 2IANA 3P4MB 1VKXB 4IRJD 4Y16D 1FO0H 3QIWC 1XEDA 4U05A 5HGAB 1LO0H 5E7BA 4Z7WB 3U9PH 1Q0XH 5J6HA 3TPUA 3VXNB 4QTIL 3SKMB 4CRPA 4MQTB 1T04A 4PJ8D 3QNYB 2XNAB 3M1BA 3ET9F 3LRSA 4ZS6C 5ACZA 4UTBH 1KCVH 5CJBA 4NKOB 2UWEA 3U4BL 4Z6AT 2NTFB 4MD4B 2FX7L 2B39A 2X7LA 1Z0MA 3VWJC 2VL5A 3BKML 4G9DB 1KTRL 4R26L 4PRIE 2IQ9H 1X5GA 5TE7L 1KPVA 1ZA3A 1N6QL 5KVMC 5D2NA 4DVBB 1M7DA 1QG3A 4XVSH 3MRNB 3HRZA 3FOLA 2AJXL 3SGJA 4M8QA 1D9KC 1OAQH 3TT3L 1L6XA 4KKBD 4HZLB 3RNKA 3QCUL 4S2SB 3RUGB 3VJ6A 3WKMH 2EXYD 4PGDA 1YJDC 3PDOB 15C8L 1LO2H 2GAZA 3VD5A 3B9KB 3G5XA 4PG9B 1XR8A 4UOW1 5J56B 1CCZA 4XMLH 1QSVA 1MWAH 1FFRA 3SKJH 4J1UB 3MLSH 3GO1L 3K2UH 3P0VH 4K71B 1R3LA 3NABH 2XG5A 3G6AB 3ARPA 4QRSA 4XTRD 2DQJH 4QRPA 3DLQR 3L5IA 3D69B 3U0TB 2YSSA 4L3EA 4EOWL 4WO4D 5F6IC 2IPTH 1G7QB 1BVLB 1EK3A 1P1ZB 1S7WA 4PJCA 3G5VA 1CT8B 3I2CH 2FLRT 4Z0BL 5B38B 4HXBL 1F3JA 1JK8A 3LEVL 3O8XB 4OCWH 4M61B 4XH2A 4QO1A 1LEGB 1G0XA 4A6YB 4GXVH 1L4IA 3P73A 5CBAA 1RUQH 4G80A 3MMEB 1P5VA 5ISZD 3MGTB 4P46C 4BQCA 1FNHA 4H88H 4P2QB 4X8JB 1KN2L 3U0WL 1NCWH 5D8JH 4I9WE 5H94A 3UTSD 4FFVC 4JFZL 4P2YA 5IIEB 2DQFA 5CGMA 3MROA 3T1FB 5B4MD 4DEPB 1FBIH 1NDMA 1O7VA 1A47A 3MRMB 4PJ5A 4FFWD 1CF8L 3HZMA 4JHAL 1KNOB 4S11A 1C08B 2C26A 1QBMH 3C6SA 4FQJH 3TGXA 4CW1B 1U3HD 3VRLE 3RWDB 2AS5M 1LP9F 1NCDL 4RA3A 2HLFC 1A1NA 2EDKA 3QIUD 3F5WB 3KLSA 5JW4R 3BJ91 3QXAA 4LBEB 3V5HA 4R0LC 4PJ7B 3V52H 4XWGH 2MNUA 4TSBL 1NQBA 4HW6A 3ULUD 3BW9A 4YZFE 1KN4L 5BS0D 3D18B 4UV4H 2VLKD 3D3VB 4OBRA 1TENA 1E0OB 2DLHA 4X4XB 3M8OH 1E28A 1JV5B 2AJUH 3VXMD 3D39B 4PS4L 3SOBH 3IU4H 3VWKD 2XXMB 4PTUB 5HYQA 4XXDB 1U36A 1NCCL 4JRYB 2FJGB 4KROD 3R8QA 4K7PH 3RWIA 1J05B 3RL1A 2APBA 5DJ6B 2V5RA 3QWOA 1R5VB 5JPNA 4B0MM 2UZIH 5BRZD 4F7EB 2P8LB 2ZUUA 4I2XB 3X14B 1YN7B 1VGKB 2YRZA 5CD5D 3VFWB 1YPZB 5L9DH 2B0SL 3T8XA 2X4PA 4D0BB 3WDJA 5IJKC 2J1KA 1KTDA 3BISA 5EBLA 4MS8D 2XTJC 2E7HA 3KXFA 4PD4J 4W4OC 3CSPA 4TVPE 3LKPB 1UWXH 3OGOE 2JB6B 2C1PA 3GGWA 3QPQC 4G8IA 4UT9L 6FABH 1JTPA 1F58L 1T2XA 5KANG 2PXYC 2XN9B 5GS0D 4XNUH 3W0WB 4WI3A 2QSCH 1BOGA 4MNQD 5CSBA 4LCCC 4PRBA 5DVOA 4PGEA 2ZUYA 3NFSL 3RRQA 2NY5H 4RGNB 5J3HC 3HZVB 4HIXL 4N8VG 3GBMH 2EH8H 3PWPA 4X7SH 1J18A 3AREB 3WNPA 4LCUA 4F9LA 2ID5A 5DTFA 1GIGH 4WW2C 3LPWA 1EEUA 4KJQD 2OS7A 1I1AA 4NSKA 3DBXA 2BNUB 2PYFA 3QIWA 4F8QA 2OTWB 5DRXB 4R6UA 4AG4H 2I27N 3N1MC 3KR3H 2CLZA 3QPXH 2CUIA 4RRPG 1UACL 2EDYA 3U9UA 4ZFOA 4RDQF 4LSUH 2VLJD 1BHGA 1XF2B 1A7QH 1BEYL 1G6RL 3QAZB 4KWUA 1HSAB 4S1QH 2ZWLT 2ZOLA 1B3JA 2DQTH 4JFFD 5D1QD 3GKWH 3TBYB 5C0JA 4MD0A 5I74C 5C0CA 3GMMA 4G8GA 4QRRB 3WUWG 4WUUA 2DN7A 3BD3A 2RGSA 3HE7B 3LB6D 1F4YL 3GRWA 4NQCA 3CUPB 4OCXL 4WFED 5KSBF 2E8ZA 4ZDHB 3UX9B 2IALA 4P2OD 5DDHA 3EOAA 2B2XH 2MHAA 4K8RD 2D7NA 3RNQB 3GK8L 1GSMA 1WJ3A 1KGCD 4C4KT 3A0OA 1D9KA 1Q0YH 1MIEL 4OF6A 1FYTA 1YEFL 3BAEL 5F9WB 4P4KD 3SBWC 1K4DA 5DMGD 5IQ9B 3NIDE 2FNBA 4WV1B 2V5TA 3SJVB 1ORSB 4BKLB 3GJFH 1UZ8A 5DRZA 2HMID 3EFDL 4XPTL 2F5AH 2XA8H 4FABL 5ESVB 2GSGA 3QNXA 3QEHA 2WBWB 2HVKB 1IBGH 3MLZL 3IFNH 4JRXA 3QUML 5GS1B 1MQKH 3VFOB 2E7LA 1XGPB 1QSED 5HYJE 4TPRH 3UZEA 2DAVA 2VKXA 5EZLB 5I9QB 4OZIB 4OFKA 2WUBL 1WBZB 4NO3A 5I17B 1DQML 5C07B 4HDIB 4LVOC 3MR9B 5FUOL 2G60L 4HH9A 1ZA6B 4PJGE 3UJJL 1U8LA 1KFAH 3HG1D 2PW2B 4KAQL 1J11A 4HK3J 4J3OC 1W2KT 4JFXB 2KQMA 3DXAB 2D03H 1D5BB 1UXWB 1T66C 1JHKL 1W0VA 2VLRB 4IRSD 4P46A 4Z7NE 3G5ZB 3BRDA 4RWYL 4JFYA 1J0YA 2HFFA 2X4NA 3LN5A 3QB7C 1PLGH 4F9PC 8FABA 2CIIB 4NKQB 5IMLB 3U46B 2Q87A 4KKLC 5IF0B 4LCIH 3QCVL 3H9ZA 4M93C 4U6XB 5GRWA 4XPGL 1T1ZB 4G5Z<