5KS9F

Bel502-dq8-glia-alpha1 complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
GVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSVAPGSDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
total genus 58
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07686 V-set Immunoglobulin V-set domain
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9F01
2A6IA 5B22A 5IW6A 1IKNC 1JK8A 3U4BH 2PYEB 3HNSL 1A1MB 4LBEB 1P7QA 1WZMA 4JREB 2K3TA 1LEGB 1Q1JL 5IIEA 4C59B 1E0OB 4K3EH 1NFKA 5AYUH 3HC4H 3MLVH 1FJ1B 3QIBD 2CRMA 5ADOL 1UJ3B 4OIIH 5C6WH 4IS6A 3TA3C 5IEKB 2WBJD 2BC4A 1IAMA 5HHOA 3MGTB 4KK5D 4NWUH 4P3CH 4NZUH 2VQUA 4LLVB 1AO7D 5I1HH 4NKIL 4LLUA 3EOBA 2BOCB 4JDZA 4N0YH 1NAMB 2DQEL 4Z0XA 1HNGA 3SDCD 1JI2A 5E2VL 5DJDB 2ENSA 2HFGH 3SDXA 1VSCA 3UJJL 1PLGH 1ZA6A 4L4VA 2A83A 1I85C 2VISB 3CXDL 4FZ8H 5CFHA 4N0FA 4ZFOL 4ZUSB 2XXMB 3H6JA 3Q6GL 3D48R 3BPNB 5GQBA 1XF3B 3DOSA 5TDOA 3WEXA 3O3AA 4NUJB 3L5IA 4WFHD 2P5WE 4DEPB 3KPNB 4RSVA 3WCYA 3WUWB 2HWZL 3GIVB 2QTEA 4DKAA 5F44A 5K9KB 1N59B 1RK0A 4JREC 4H1LA 4KJWC 1ONQA 5ILTH 3ULSB 3MGAA 1MFCL 1W72H 1EHAA 4UU9B 4EN3C 2EO1A 3ZE2F 1PEZA 1MCKA 5CJOL 2HKFL 2Y6SD 1IARB 1JZ5A 2HRPL 1H3WM 1PG7H 1L0YA 2BVQA 5I74C 2WNGA 3SDXB 5ICYB 1B90A 1BZ7A 4EI5A 2X4QB 1ZVSA 2X4RB 4YC2B 3VRIB 2QKIB 1UFUA 5DQ9B 2AJ3B 3M1BA 3L3KA 1YNLH 2DOCA 3KPQA 4FQHB 2NXZB 1JWMB 3MCLH 4PGBB 4IRJA 3VXMB 4TQEH 5C0ND 5KSVB 2VDPH 1WF5A 1S7UA 3C60D 3OKEA 5J13B 3VDAA 4UMGA 3BP6A 5T1MB 2BVPA 1WTGT 5I75C 2I9LB 4NPYA 3H9SB 4NBYB 5HGGS 3I02A 4NDMA 2AJVL 4K9EH 1XIWA 1IGYB 1NGYA 5D96B 1YEJH 2E7HA 1MY7A 1ZWIA 4QRPA 4UU9A 4GT7A 1BF8A 3MLZH 1BGXH 3DGCR 4K3DL 1A22B 5E56A 5J12B 1AGDA 2YUWA 1U3HB 3CXHJ 1I7TA 1NCBL 1AXTH 5AD0B 4F7CB 3MRNA 4TRPL 5TF0A 4Y4HC 1R5IB 2M26A 4DGVL 5C09D 4HUXA 3NFNB 3PNWA 5CHNB 3UC0H 3DPBA 1MQKH 1OLLA 1BEYH 4X6CA 4ZFGH 3TBSA 3WIHL 2DLEA 1V3MA 3LKOA 4HUVB 4CVUA 2A6IB 4IOFD 1OTSC 1OSZA 2OLDA 1J8HB 3BIBX 3DMMB 1TITA 4LPUA 1K9TA 4A6YA 5F97E 4ZXBC 2V7NB 4TTDD 1OAXL 2LAGB 1Q1JH 1U58A 3QCTL 4ZO9A 1JP5A 4FABH 4OZGE 1QFPA 2AJVH 4OD1L 2DMKA 4R7DA 2JJVA 2YK1L 3FN9A 3OJ2C 4R7NA 5DUPL 3VFSA 5IMLB 4ZOBA 3VWJB 1CFTA 5J1TC 5E2TL 2ED7A 1J9CT 5DF0A 4C55A 4EN3D 1F4XL 3MV8D 4ETQB 1HIMH 4ZS6C 1CBVH 4WW1A 4MS8C 3T4AB 2BNUA 4PPTA 2BNQD 2CDGB 7FABH 3TNMA 3BHBA 3VXRB 2H32A 3HAEH 5IB5B 4NN7C 4ONGL 4XH2B 5LAXA 3DVIA 1FFOB 3O4LD 1BVKB 2WWMC 4ZPVA 1WBYB 4TSCH 1TTFA 5EBWA 3RI5K 4WW2F 5FOJA 1T4KA 1LEIB 3DETD 5IJKC 2HTLD 4HHAA 1W0WB 3IAPA 2E9WA 3MBXH 1IT9H 1EFQA 3MLYH 5GGVY 2NR6D 4D3CH 3GJFK 2HH0L 3O9WA 5ERWB 1LO3L 4NFBA 4YHIA 4GLRI 3QI9C 5HYEA 1KYOK 2NY3B 1AO7B 5C07A 3P4NB 3GSVA 5D1XC 1KPUA 8FABA 3L3IB 3UTPD 1Y18A 3MUGB 1LE9A 4O4YL 5J1AA 3LRGA 1NBYA 1XGRA 5SX5K 5D4QA 2UZIL 4F3FB 4APQA 5EDXA 2C7UA 4QNPF 5FYJH 1JUFA 5LKNA 1ZHBA 2FEDC 3E3QC 1RIVH 1TIUA 5T1LD 3QUXA 4U1GC 4MQ7B 1MVUB 1NGXB 4XAWH 4K71C 2JJUA 5DJZA 4LCIL 4P5TA 2DS4A 2JB5H 1GOGA 5I76A 4F9PA 3DV6A 3PWPE 4PTTA 4MQXD 1T1YA 4OLXH 1EEQA 4QY8B 1EGJL 4TSBL 4JB9H 2C26A 4XGZA 4F9LA 4J8RA 1W0VB 1OB1A 4IRSA 3BPOC 2IALA 2NY6D 1MIEH 3HC0A 4IRSD 4Z77A 1WAAA 1G9MC 2XZZA 3RP1A 2VC2L 1YEHL 4GS7C 1PG7X 3RUGF 5C6TH 4XP6H 1E4KC 3M45A 5BRZE 2VLKA 1JGLL 5AZEH 1RMFH 4NP4H 1P4IH 2CKBH 4H0IA 3MLPA 3VWJC 1I8IA 4IHOA 3BKCH 1EBAA 3LHPH 4HS8L 3HG1A 3QHTC 2ICEA 3QUYD 4ZD3H 4JR9H 4K23L 1R0AL 5I8CA 2RJMA 2FH8A 4XVTL 2VH5H 5C8JB 4J8RB 2XZCH 2PYFA 2Q7NA 5JZ7D 4NRXA 4X6CF 4X8XA 4YFDB 3REWB 3IS0X 3X3FL 2G75B 3FOMA 1JYWA 5FO7B 2MKLC 2H1PH 1DL7H 2HTLC 4OZIE 4MJ6A 4G6FD 2FECL 2VJXA 4FXGA 5EU6E 3KPTA 1VEOA 5A3IC 3IDXL 4MLSA 3C6LD 4KXZH 4ZOAA 3U2SA 4PRHD 4NO5A 4BQ9A 2X9YA 4Z95L 3QXAA 3QUXD 4TOYL 2WINB 1E6OH 4WW2C 3VGBA 2HFEA 1WQVT 4JG1H 2IPKA 5AWNL 1FZMA 2PYED 4P4KB 5I1JL 1JGUL 4HK3N 1IQDA 1U42A 3IDNB 5GS0H 1FSKC 1JJUA 2C3VA 3T4YA 1K8IB 1YEKL 3KYMA 5D71H 3QDMB 2LTQB 5EC2B 5BV7L 1ZS8A 3V6OA 1MI5D 3VFPA 4HXBL 5HD8D 2OZ4H 1NCBH 4MJ4A 4JVUA 5JIKA 5I73B 3LEXB 2AK1H 3WDIA 3SOBL 4WVRA 3EZJB 2VAJA 4KJQD 1ES0B 4JFQB 3GRWA 1B6UA 4KJPC 4RCAA 1KCUH 4W6WB 4JDTH 3IU4L 3QUZB 5KAQG 5JOFB 4KV5F 4QHUB 1JL8A 5D72H 3MLRH 1IKFL 1ED3A 1S9WB 1FO0L 4Y5YA 4R97C 1OAZL 3VRJB 1H5BA 3L9RA 1F11A 2HFGL 1TQBC 2BNQB 2AJXL 3RL1B 5JDJA 5T5FH 1F13A 1T7VA 1YNTB 4JY5H 1WFOA 4U1GB 2B5IB 1P6AB 3U82B 1HI6A 1AE6H 2EE6A 2DKMA 2DBLH 4ODXA 2XWTA 1OARH 3OAYK 3NABH 3DO7A 1KT2A 1VGKB 2WBWB 1IT9L 3S6CA 5TE4L 2HVKB 5KG9B 1XF5B 4TSAL 3N1QC 3MR9B 1ND0A 3RVTD 2ICCA 4YK4B 2FCBA 5I30H 3CVIH 5DO2D 4UT6L 1FGNL 1NUNB 5CJXA 5I15H 1G7QB 5I16A 4I4WB 3QT2A 2DJSA 2FX9H 3VFMB 4K2UL 4AJ0A 5D7LE 3CDGB 3I9GL 4LSQH 4L4JA 4P2OA 4QGYA 1KEMH 5A3ID 1DUYA 2APFA 3TVMD 4U1NA 4WO4D 1PKQA 2F74B 1OY3B 4I9WE 1DVFA 1S5HA 3BUYB 2IG2H 4LU5L 1AR1C 2FX7H 1NFDA 5TGBB 3H9SE 3LB6C 2QQLL 5AEAA 3JV5A 4YHYC 5DMIL 4FZEH 3QFJD 5E8NA 1TCRA 5JMRA 3AB0C 4CKVX 5HY9B 1HHIB 4Y5XC 1GVIA 3G08A 5GGUA 4NRXB 4KAQH 3GMOB 3M17A 2G75A 2DQCL 3LOWA 5F9OH 3GSWB 3MRCB 3QG7L 5KSAB 1L6ZA 3IKCB 3U9UB 1FZKB 1FIEA 1T1WA 3O3AB 5DUBA 35C8L 4UNVA 3OX8B 3QPQD 3H7BB 1XR9B 1XIWD 3HZVA 3OHXA 4MJ2A 4OZHA 1NMBH 1LO4H 1B9ZA 1YEDA 2FD6L 1NFDB 2D7QA 2EEBA 4YPGB 3L3OA 1P53A 1TZGH 5E5MB 1UM4H 3V0WH 1U0QA 4DZ8A 5IB1B 3STLA 4MCZB 1P84K 4PGDB 1E4WH 1IJ9A 4LEXL 5HSFA 3PIQB 1TNNA 1F90H 5CP7B 2WWKT 2A9ML 1MLCB 3MACH 4YH6A 4OCSH 3HCVB 4IIQA 3MCKB 2F5AH 1MCRA 1OF2A 3SKMA 1U6AL 2R29L 4G42B 4KJPD 4N8VA 4ZMAT 5H35A 1MEXL 2DQHL 5EN2B 3SBWA 5JDSB 4GO6B 5GSRA 1UWGH 5E00A 4GKSA 3K8KA 3MFFA 1RIUL 2ZSWB 4Y2DB 3PV6A 3WXVL 3ARSA 1MI5B 3FRPG 1GPOL 5MENA 2X09A 1JZ8A 2YD4A 2P5WD 4UV7L 3HUJB 4M5ZL 3S7GA 1FYTB 5E5MA 1LO0H 1XEDA 4U3HA 3WFCL 4YNYA 4PY7A 4GAYA 5T1KB 3RY5A 1RZKH 3O0RL 4ONGH 2D03H 2AJSH 1A64A 4HUWA 1YNTA 4L4VD 3VD7A 1KB9K 5GRJL 3SEPA 2V9QA 3O4LB 4KI5C 3GSRB 3HN3A 4OKDA 2NXZC 4M7JH 3MXWH 3MRGB 3PL6B 2PW2B 5CGTA 5T33L 2RIKA 3PJSA 1SM3H 2JCCE 4KPHL 1S9YA 3GIZL 3SDYL 1HILB 4MSWA 4WDIA 1I7UA 1HZHH 1X4ZA 2ESVD 3QEQA 3MNWB 5JHDE 4F8QA 4YDLC 1MI5A 4KK5C 1A1NA 3ARGA 5FKAB 1U8QA 1XFPA 4XRCB 1CE1H 5D1QA 5F1KC 2XTJE 2FL5A 2X41A 4OLUL 1NAMH 4F7TA 2NY3D 4PY8J 5ANMA 3GNMH 3SOBH 3FHQA 5CJ5A 4LCCA 4LLMA 4WFHE 4PJXF 4XH2A 3S34L 3GI8H 3E2HC 4X7DC 1OTUC 1S5IH 3EO0A 5I18H 3P9LB 3BPCB 1JWSA 2CIIB 3SE3A 4PRHA 4EXKA 4M61B 3AMKA 4XC1L 1QLRB 3VFOB 5EU4B 3MJGX 1T0MA 4X6DE 4JVPA 3RAJL 4PJ5A 1D5MA 4HBQA 2BMKB 4D9RE 3EFFA 3ARRA 1IFHH 4ELMA 4RGND 2AJUH 3ARFC 2O5ZH 4I77H 1XR8B 4P5MA 3KYNA 5FF6B 4WO4B 3IJYB 1U8QB 3BH9B 1JGDA 4X9BA 5DSCA 1MCDA 3PF2A 3QIBC 1UCBH 43C9B 4MYWB 2IADB 3JWNC 4NC1C 1NL0H 3W9DB 3RJQB 3QDJE 3VH8B 3SDAA 3VXOA 3DYPA 3PL6C 1OP3H 4RDQF 5FXCH 3KXFE 3E6HA 1BVKA 5DZLA 3ARXA 1A9BA 3BZDA 4L5FL 4PRAB 5BS0A 5BZDA 5LGHL 1CK0H 1UWXK 4ZOCA 2DDQL 3CPLB 4JG0H 4MA7H 4HMCA 1JNLH 3CVHA 3S37X 1B0RA 3HZKB 1BZ9A 5SV4A 1ZANL 3L3OB 1NCAL 3CFEA 4M7LT 5DHYB 3RX8A 5SX4I 4WCYL 4A6YH 3D39B 4LASL 3HZMA 3ES6B 2BVEA 4EIZC 5E8EB 5FHAL 5KTEL 3UPRB 4HWBA 4JFFB 3RI5F 3T08A 1J10A 3HMWL 3HB3D 1ZOXA 3D5OF 5EUOA 4ENED 3KVQA 2YKLH 3FMGL 4FZEL 3QDAA 5ILTL 5KVMC 4M3KB 1NMCC 2NY0B 5DFVC 4GKSB 1VKXA 4UQ2A 4MDIA 2OTPA 5MEQA 4HGWA 4GJTB 2VLJB 4IJ3B 2X70A 1UT9A 4YGVB 2DWEB 1FN4B 3LQAC 1MPAL 2R4RL 3CLEL 3IFLL 4KTEL 5F7DA 3X14A 2PCPB 3W2DH 3TYGL 4XPFL 3EJZC 3IU4H 1QSFA 3LKQA 3IB4A 3SJVE 3JXAA 3C6LC 3ZYZA 4Y2DD 4GAYB 5T1KA 1RUAH 1NBZA 5E8EA 4HIEA 2CR6A 1ZLSH 1SQ2N 3W5MA 2DIBA 4MLIA 3C6SA 1BEYL 4NQTA 1U8JA 3Q1SH 2NY5L 3PWNB 3MNVA 4WU5A 4X4ME 2FO1A 2D2OA 4PRIB 1DLHA 1JGVL 3UTZA 1HHHB 5FHBH 1Q72L 3ZKSD 4O5LH 2AXGB 3H3BC 1ODAA 2R1YB 5DC4B 1T5XA 4JN2B 1C5CH 1XMWA 4LLWA 3ULUD 5IMOA 1HHJB 2WUCL 1S9VA 5DD5L 2X4PB 4OIIL 4U6TA 2D3VA 5L6YL 2H32H 3HG1B 2LU7A 4MAUL 1AGEB 3HFMH 3LS4H 5C0JB 5GZOD 2J8HA 4GRMB 4WTZA 3WL9B 1CFNB 3O6FB 3QFJE 3WXVH 3EAKA 1NFIA 2WM0A 5LXGL 4LVEA 1LD9A 4KK9D 1IAIM 1W8NA 3QQ9D 1HQRA 5F6HI 4XBGB 1QSEB 4EDWH 5EOQH 3W11D 3VFOA 3OTTA 4QWWC 3HI1A 3D0VA 4U6YA 5EZOH 1P7KB 1S7RA 3BP4B 4KTDH 3KPSA 3A67L 3KPRE 3JZ7A 3AUVA 1ZGLA 2PTTB 5FGCB 2ZPKH 1KELH 5IBTL 2GAZA 4NNYB 4U0RB 4JB9L 1I1YA 3QRGL 2IADA 4TSCL 2NMSA 5D5ME 1MREH 3LD8C 4FFZH 1BFOB 3GSUB 2BX5A 2X4TA 5ISZE 1BD2D 3WN5B 4K2UH 1KGCD 2WWMD 4J3OC 2Y25A 3RX5A 4O51B 1A6UH 4WEBL 1A14L 3FONA 4JFDA 1SJEA 4PREB 1T0PB 3QI9A 4RISH 4D0DA 1N4XL 2EZ0C 3GMLB 1G9NH 3OMZA 4E0RA 2AK4A 4XBEH 4FQJL 4HIXL 2NR6C 4AM0B 3UTSB 5TH2B 1SYSB 4NKMA 4I1NB 4Z9KB 1QVOB 3RUGE 4OCNC 4OZGF 5CP3H 2ILLA 2WANA 3AMLA 4QLRA 3ZT5A 4R4BA 1ZT7A 3T4AA 1UM4L 3CSYA 4CL7A 1UXWA 3CFIC 2FIRT 3NZHH 3QIWA 3WNLA 1K3IA 4OF5A 1C5CL 1I1FA 2NX5A 3KLAB 4OGZA 3J8F7 5FECB 2FEDD 3SO3C 4JZNB 2GT9A 4NQEB 4JRYD 2YPLD 5DRXB 1LEKA 4AQOA 2H2PC 3JWOH 5HHXL 4HGWB 4DGYH 1CXKA 4LCCC 3OJMB 5DEGB 2FJHB 2MHAA 4YBLB 3SY0B 5TFSH 1QBLL 4IRJD 1K6QH 3QPQC 1KF9B 1D9KD 3IS1X 3UTQB 4RWYH 2O93L 4HFUL 3T09A 4KJYB 3SGEH 1BAFL 1ACYH 7CGTA 1YEIL 5HYJB 5JXEC 5DHXB 2CMRH 3MXWL 4Z18A 5ID1B 4U7SA 5IW3A 2HAZA 5DUBB 3LQMA 1IAOB 4R90L 5AAWA 2NY0D 1DTUA 2W9EL 4JO1H 5KVDH 4NZTH 2DQIL 1ZGLM 2JIXA 3V6FA 1OAYL 4K94H 3U1SL 5D2NB 1WT5C 4HX1B 2BC4B 2ICWI 1MWAA 3EOTL 2VLJD 1DR9A 4OLZL 4QRQA 4LEOA 2XA8H 4P5KA 3HNTH 1HKLL 4G8GD 5IVXB 4KUCD 5GS1A 1LO0L 3FHAA 1TJGL 1LDSA 4RMTA 4O4YH 5DGQA 4XCFL 3RKDD 1NCDH 3TFKC 1C7SA 1UM6H 2P5EE 1RJLA 3TCLA 1X5YA 2OTWB 4CU6A 3IXAB 3QBTB 3VD5A 3VGGA 4WFEE 1A2YA 2XQYK 1NAKH 3C09B 5C08B 1BJ1H 1FC2D 4HS8H 4NQCA 1HOCA 1M7IB 2VDNL 3F58H 2W0PA 3LKRB 1Z9MA 1Y0LB 3AS0A 3MFFB 3PV7A 4JFHE 4M48L 3IAQA 3H9HB 4NM4L 5FK9B 4V1DB 4U0QB 5D1ZB 1M71B 5KVFH 4Z7OE 4OLWL 1IC7L 3K80A 2VXTH 3JTTB 3OJVC 1LMKA 2PKDA 2VC2H 1C7TA 3C5JB 4IMLB 2A1WH 3ET9F 4WWKA 2OX5A 4L9LA 1NEZB 4O02L 1OM3L 4RGNC 1C5BL 2B4CL 3JWDC 4LPYA 3RWJB 2GY5A 1J8HD 4S10A 3OAZK 1BD2B 2XACC 4HJGB 4JRWA 2VKWA 5ACLA 2A77H 5TH2A 2EIEA 4DTGL 5F9WB 5BVJB 4LBEA 2Q20A 3AXLB 1H3TA 2MQ3A 4PLNC 4JVWA 3IDMA 2UUDH 4AEHL 2E27H 2VE6B 2UZXB 1S8DA 3UAJD 5DMKA 5ESAB 4HFWA 3ESVF 4XMPH 3BP7B 3RY6A 3D9AH 4HJJH 1V7NL 1DZBA 3ULSA 3GJEB 3ZDXE 5IB3A 4FG6C 3QRGH 3P30L 3U4EB 4PY7B 4NRZA 2D9CA 4F7TB 2PUQT 2Y07H 4I0CC 2B1HL 2YEZB 4BH8B 2Y1VA 2XWBB 4K7FB 5GJTL 5I1LB 4L9LB 5FCSH 1Z6JT 5TQ0L 1K5NA 1P4BL 1ZS8B 2CPCA 4WU7A 4I18A 2X1XR 3PJSB 2HRPH 1FQ9C 2X4UA 2NY5C 2DD8H 1HN1A 2EYSA 2ZUTA 1A6ZB 4GH7B 1JHTA 1I7UB 4KKLC 5I9QB 3FN0L 1Z0MA 3BRGC 4HXAL 5HGAA 4XBPA 2ARWA 2BVPB 5BO1L 3TBSB 3GMQA 3WXWL 4PBXA 4LSVH 1YMME 2KKQA 3FO0L 1LILA 2EKJA 1C8PA 2PN5A 1OVZA 1OSZB 4WTZG 1KJ2L 4J3VA 2FH6A 1PY9A 4EN3B 4O2FB 5F21B 3VGFA 2BNQA 4NP4L 4PD4J 3LQAL 5GRJH 1XCTA 1AGCB 1NMCB 4LLQB 5F9WC 4UBDC 5ADPL 3F8UB 3BEVB 1OARL 2H6PB 1BWWA 2XY2A 3QI9D 1CFQA 5E8PB 4B53A 3PP4H 4HUXB 4JKWA 2CMRL 3JWOC 4JRYB 3RWFA 5EWIH 3RIAK 3INUL 2ADIB 1J1OH 2CJUL 2YUVA 4MXQD 5DJXA 4RNRB 3HFML 3GEWB 3O6MH 2VZ1A 3L3KB 4NC1E 1GSMA 1SVCP 2BHYA 5HHVH 4GUPA 3STZA 4LP5A 1N64L 4XCEB 5GGQH 4Y4FD 5GGRA 4NQCD 4RWYL 4RGMB 4F80A 4Z0BH 3SO5A 5IFAH 3QNXB 2IEPA 2HWZH 4YHZH 5GS0L 5A2FA 5MI0C 2EDEA 1IGIH 1FN4A 4RBPH 1FIGL 4NO0B 4HZLB 2X7LB 2NY1C 1X4YA 5IBUG 3RWEB 4OZ4A 1UH2A 1YQVL 2HFTA 3PP3K 4R3SB 1FDLH 1Q0YH 4YHIB 1B3JA 2EICA 4LHJB 5BW7C 4HMDA 5C0RH 43CAA 5I71C 4X4YB 3KWWB 3L6FA 2V2WA 5IP4A 3BN9D 3EHBC 5KS9E 3LKNB 1OM3H 3UAJC 3UBXA 2ATKA 3QHZL 4L8CB 2BY1A 1YY9C 2GW5A 4J3WA 1KENH 1AGBA 2E5EA 2BSRB 1W72A 1AGFB 5SWSA 4XPHH 3MRRA 1ZHBB 1N5AB 1NDGB 1ROWA 3TZVD 3NN8B 4PJCA 5T5FL 1HHKB 2Q6WB 3X14B 3QJFB 2E3VA 4PJIF 3MBEA 4NT6B 1RIVL 4GG8A 2X4PA 2AAVA 4JDZB 5DRNB 1P4LB 2P5ED 4R3SA 1KC5L 4C56A 2GITA 4OUUB 4MA8H 1F4WH 2DTSA 1GCFA 3CX5K 3PABA 3ESUF 4P46C 2X2YA 2NW3B 2J4WH 1JI1A 1XF3A 3WEXB 3RZCA 4X7EC 4CVXB 1F00I 2AJYH 4CN1A 4GAGH 5TPWH 4F57L 1MJ8H 3OKKA 3ZHKA 3TPUB 3T0DA 3H9ZA 3HNVL 1MVUA 2H32B 2UVFA 3MRFA 5D6CB 3WFBH 4U6XA 1ZGLB 4OD3L 5LAXB 1CCZA 1YN7A 2R2EA 2VLRA 3IGAA 4XP6L 3LEVL 5FEBA 1L0QA 2IANE 4KI5D 4RRPA 3WNKA 4KQ4L 3NZHL 4MD0A 3S37L 1F6LL 2D0GA 1S7QB 2J5LC 1FFPA 1KJVA 4NZRL 1QNZH 4XB8A 3P11H 1QEWB 3T0BA 1G9MH 1BAFH 1T7ZA 3QIBB 5E5RB 4Y2OA 3QUZD 2P4AB 2J8OA 3GM8A 1J86A 4Y5YC 5D7KE 1KIRA 2P5WB 5FHBL 1LNUB 4E42A 2R2BA 1T03L 2ERJB 1RZGB 5AZ2L 1II4E 4ODWB 4MZ3A 4PP2A 4HCRH 4XWGL 2Z4QB 4U6HB 3FRUB 3U1SH 2G60H 1KCKA 4DQOL 3C9NA 5E2UH 1V8HA 2CLRB 3MNWA 5EPMA 4XX1E 4L4VB 1EJOH 5CEZH 1BQUA 1IAIH 2HRLA 3D18A 2ADJA 5GSVB 1BF2A 1CL7H 2BSTA 3VXSB 1C08B 5JTWA 4QCIA 1RUKH 5B3JF 5T5NF 4M9PA 1S7QA 1IQWH 5TF1L 4DVRH 5CCKH 5CD3B 3EYFA 4LAQH 3FONB 5T3XH 1IEBB 1ZHLA 2E7MA 3L3JA 3E6FB 5FGCE 4JCMA 4YFEA 1KCRL 5IMKB 4FXGB 3SQOL 1UZ6E 3L5XH 1X9QA 2EDRA 4M5YH 5KSBB 1VDGA 4X6EB 1DQLL 2XTJD 4HXBH 1MSPA 2V2TA 4QHLA 3G04A 4PRPB 4WEMB 1OGAE 4E5XB 4P4RA 3OKYA 2NXYD 2XXCB 4YO0B 1G7PA 4RIRB 1RQ5A 4L4TB 4WI6A 2E9IA 2BSED 1BX2A 4M7KL 4DW2H 1KLFA 5LWYH 1A14H 3UO1L 1OQOA 3GMRA 5F7KC 4FQQA 2UVEA 5D2LE 1AFVL 4KMTH 5EOQL 4RX4D 1G84A 1I8IB 3C6LA 1AGBB 4HJ0D 2R1WA 5DD1L 4YEFA 5GRWA 2R4SL 3D2UD 2XIDA 2GTWA 2EDKA 1WCBB 1EUTA 3X17A 3ZTJG 3KYOA 4Y4FB 1AQKH 3PGDA 5C1MB 4YXHH 2IQAB 3MUHL 3C2AL 2EH7L 1EAJA 3HRPA 3FTGB 4G5ZH 4Y5VA 2XTLA 1KELL 2B7DT 1T20B 1IGTB 1M7DB 4LVHB 1A4JB 1FVCA 5J6HA 2LE9A 2MKWA 3GBML 4PUBH 5DD6A 5GS1B 2A0LD 3KNBB 1R3HB 3GO1H 4U2ZA 4YHLH 1A7OL 3PP3H 4L4TA 4WEUD 1N6QH 4L5FH 2GQHA 3OB0H 1J11A 4DK3A 1FZJB 1FNLA 3FB8A 5F88A 3MOBH 3RNKA 1YEEL 5C09B 3WFCH 5L8JB 1H5BC 1EXUA 2W9DH 2I9LA 4NPYB 3S4SG 2RQ8A 1T4KB 2P42B 2HJKA 1RMFL 4LSUH 4QRUB 5KW9H 2WWKO 2R2CA 2FHFA 5DT1L 4DCQA 4BELD 5JLZB 1G0XA 2H9GA 4XVJL 3GSXB 4NFCA 1F4WL 3CXDH 5I17B 5EOCL 1RZ8B 3ZHLA 1BQSA 1P69B 1N0LA 3L3GB 2EC9U 5CLWA 3OR6B 1LO2L 3B9KC 5BV7C 1T89C 3LV3A 4PP2B 4NYLA 1G6RH 4P2RB 4TNVF 3KGRA 4DAGL 1AQDA 4OV6F 3BDBA 3RU8H 4LDLB 4P5TB 3INUH 1XF1A 3PGFH 5JMOC 3TIDA 1BJMA 1WBYA 2JJTA 1BBJB 3GJEA 1HI6B 4WUUE 5EU7E 5F3BA 2VDKH 4JZOB 4RFOH 1YEFL 2EH8H 5FDYA 1MCJA 4PJEE 2W07A 3CJJA 4BH7A 1DQTA 1NCUA 4GW1B 5L2KA 1WIPA 1QBMH 3C5ZD 1D5ZB 3V6ZB 5J6GA 4HD9A 5CBAA 2EEAA 2X1QA 5T3XE 2EYTB 3HPLB 4LRNH 2IAMB 4FQCH 4KKNA 1HYSD 5IFAL 2CDFB 4H88L 3OKLA 2NY2D 4XP1H 1G7QA 5I16B 4IBLT 3TBTB 5KSBA 3FN3A 2VXQH 3HS0B 3UTSE 2A0LC 4AL8H 1VACB 1I7RA 1OTUD 3RRQA 1BIIA 1OT1A 1X6LA 2IH3A 2J2ZA 3PWLB 4RAVA 2X42A 1Q0YL 3LRHA 5FAAA 5DEFA 3FT3B 1WEJL 2FBJH 1NDMA 1GGBL 5MEPA 3T2NH 1DE4B 1T04A 1EA9C 5E4IA 4GMSH 3HE7B 3DROB 1PKQB 3PG2A 4GRLD 3TA3A 1BQHA 1QR4A 5I8EA 1MLCA 4UDUB 4Y7MA 4UILL 1ZHNA 5KZCD 3OZ9H 1ADQA 2CLVA 3L7EB 1NMAL 4LLVA 4Q9QH 1TTUA 4KRPC 2R4SH 3OAZH 1N0XL 1QQDB 3QHFH 1F4HA 2JB5L 3C8DA 4OQTA 3VGAB 4L9LC 5FB8B 2NNAB 2R1XB 5D2LF 3TBVA 3T1FA 2KQMA 3ZE0F 4DN3H 3ARGB 2Z93A 4JPWL 4RAVB 4Y1AE 1X5IA 1XGPB 1EEYB 3QCTH 4QXUH 4RGNB 1S3KH 2XYCA 2ZKHH 1A9EB 1MHPL 3CZFA 2QR0A 4P4KC 1SEQL 1ZHKA 4JY6A 2NW2A 3JVGA 5DHVA 5DK2A 5E6IB 3VXQB 5IB2A 2DLGA 4YFLF 2OZ4A 4P59H 2JCCB 2GJZA 3LKPB 4NQVB 1LDPL 3NMEA 1FLRH 5EU5B 3MRMB 1FORH 4XCCL 4X80H 5JHDB 1J05A 1RU9H 4P23D 1ZT1B 2ZWLT 3VXMA 3QNYA 5J9PA 1T22A 2CLZA 5JOPD 1QA9A 4GBXA 5CSZB 4ZXBA 2FR4B 2BERA 3FFDB 1MCWW 3VFRA 1U8IB 1OCWH 4PJAA 1IAII 4ISVB 5DUMH 4AMKH 1MJJA 2FSEA 4E41E 2EDXA 2VXVH 3U46B 1WT5A 1I7TB 2AP2A 2JJTC 3SKJL 5E6IA 2ZSVB 2VDMH 2DN7A 3MRHB 1JYVA 5T1MA 2NQCA 2AXHA 3E1F1 4RQQA 5INCA 4H1LB 4D94A 5F70A 5EULV 4XC3H 4NIKB 4LIQL 1NGYB 4AK1A 5LBSH 1AD0B 3GMPA 3MROB 1DN0B 2VXUH 1BWMA 3BGFB 2EDFA 1GOFA 5EC1B 4JFXB 5DMYA 3S36X 1XR8A 4JQIL 1T21A 1CN4A 4OZFH 1I8LC 4XXDB 1F2QA 2AXFB 4XBEL 1BOGB 5M95B 4UT9H 4X8JB 2IJ0C 3BSZL 4JO3H 4X5WA 5CJBA 4JGMA 4G6JH 1R3JB 4NQEE 3KWWA 1SMOA 4JY5L 3TNMB 4PJHE 4PJDB 2JELH 3GSQA 3IKKA 3PXHA 4XNYL 2GYSA 3LKNA 4H5SA 1D6VL 2RCSL 2X4OB 1FFNA 1WV7T 1UB6A 2ZJSL 5DK0A 2XZAH 4LLAA 1DBKH 3GKWH 2ZUVA 4G8GA 1MAKA 1SBSH 2OS7A 3UTTA 2GSIB 1CFTB 4O58L 4XHQA 4RZCB 5E6IC 4M5YL 2VDQH 1W0WA 3F12A 3MBEB 4KK9C 4N1HB 3BWAB 4M6MH 5JW4M 1T1XB 1Q9KA 3ES6A 2QSTA 5M94B 2X6MA 1JPTL 3OPZL 4X8JA 2CRIA 5IQ9B 1IEHA 4JFFA 2B39A 3IFLH 3BHBB 4KZEL 4S1SH 3CH1A 3NTCH 3X12A 4LSTL 5I19L 4MNGE 2ED9A 5MERB 4KUZL 2DQEH 1XCQB 3SGDH 3FQWB 1TMCB 3L7EA 2WIMA 3QEUB 4X7FC 3QWRD 4ZNEE 5B4MD 4IRSC 4QKXB 2MCG1 1PZ5A 2A9NH 4D0BA 1LVEA 1XGTA 3UTPE 3SJVB 5FA3B 1N26A 1QSED 3BYYA 2A73B 3ARGC 3EFDH 1YECL 3QG6A 3IFNH 3O2DA 5F9JB 4JFOA 4PRPE 3VWKB 4O5LL 1C5DA 3G6AB 3R06B 5EFIB 2PNDA 3MNZB 4JM4H 1OOAA 3V7MA 1AP2B 4CUCA 5B38A 3N06B 3EDFA 4MDJB 5IMMA 1Q0XH 1BM3H 2NYYD 2IFGA 2ATPB 3MCKA 3QIWC 2X89A 4FXKA 1RUQH 4PLJD 3G5YA 1DLHB 1QSEA 1A7QL 5H37H 5IW6B 5I0ZA 4MB5A 5CMAA 3BKCL 4U6YB 1EERB 3H3PL 4NQDB 3VFTB 1A3RL 3SGKC 5HHVL 1RUPL 4PJGE 1V7MH 3BE1L 2EECA 4PRNA 4X6FB 2XKUA 5I1JH 2H2PD 1X5JA 4S1DC 4O9HL 1C12B 4JO1L 1NBQA 4LSSL 4YHLL 4K7PL 3ZKXC 1AP2A 1FFQA 1KV3A 4X6BB 3P0VL 4Z77B 3DURA 4H8WH 4L8BB 1WIOA 3DMMC 2ADFH 3L3HB 1KYOJ 3HI5L 1MH5A 4QXUL 1IGMH 2PW2A 1IC4L 3O3UN 4IMKC 1QRND 1P7KA 1S7RB 1U8HB 2C4XA 2FD6H 1GJIA 5CMAB 3TYFB 3CH8A 3V0AC 4Q9CA 3EOAB 4JG1L 2XN9D 2GFBB 4AIZB 3U2SB 3W5NA 1BJ1J 1BPVA 4X5WB 3CK0L 3VMNA 1WVZA 2MQ0A 4ZAKA 3EGSB 3TJEH 2GY7B 3QXAB 2JB6B 5B38G 3BN9C 1IBGL 5IFJB 4Q6IB 3E3QE 2ORBH 5D8JL 1H0DA 2NY5H 3O41B 4RAUB 2H2SD 2ADGA 2CUHA 1SM3L 5C09A 4S0TD 4W70A 8CGTA 1U93A 3QULA 2YS4A 1KXVC 3F7YA 4Y88A 5DO2C 4ODHL 2FIKB 3GSOA 4PJHF 4HS6B 1JMXA 3SKJH 3VFUB 1N2RA 5EBLA 15C8L 5C08D 3PIQA 4DGYL 25C8H 3VW3H 2W0LA 1QR1A 5DD6B 4E41D 4IMKA 3QEGH 4NO3B 1EMTL 4XPTH 3QDHA 4Z7WF 4ZUSA 1ACZA 1F4XH 2A74B 3GI8L 4QXTA 4XP5H 1QP1A 4HXAH 1MNUL 3MJ9L 4IIQC 5C6TL 2DQJH 1NGZA 4UV4H 3THMH 4WI7A 5BJTB 1U36A 3D3VD 4KK8C 4EOWL 4HK0A 1JF1A 3Q3GB 4G9FD 4I2XB 1ETZA 2VITA 3QUMH 4BSWA 4RMSA 3K1DA 5I0DA 4WHYH 4Q9BA 2PYFB 3IDYB 1MCOL 3MJ7B 2ZNWA 2D4DA 5K33A 4R90H 1DBJL 1H8OA 3S88L 3W0WD 5EWIL 5E03A 1CD8A 5EORH 4NKIH 2Z0BA 5EZIH 1A7NL 1NC2A 5SWZE 2Z31B 2BY2A 4Y16A 4MAYA 3RTQD 2EDJA 3RVUD 3TF7C 1RZFL 3LIZH 1FAKT 4G7VL 4AYFA 3DLQR 1BBDH 4M03A 2XN9E 1KLGB 4TULH 1ZT7B 1ZE3C 3QA3A 5L9DL 1ZKAA 2GJ6E 2QQQA 3I3EA 4L8DA 5E9DA 4F33A 4LSRL 3R1GL 4APQC 3VFGL 4JPVH 1N5YH 3L5JA 1NAKL 5TQ2H 4WY7H 1KB5A 3U7WH 5DJ0B 3VXUE 1I9JL 1HH6A 1YUHA 2MCPL 3E6HB 3FO2A 1N8ZB 5BXFA 3S37H 1A0QL 3S96A 3T0EA 3MR9A 5MP6L 5ITBH 1AO7A 5HDOA 5C07B 1ORQA 3BZEA 5D71L 5MEPB 3VI4F 1MRCH 1B0GA 5HDBF 5C0DB 4AT6A 4JJ5A 1WBXB 1NSNH 1VGKA 4GAGL 1FCCA 1KIRB 5JZ7C 1D5MB 5CBAB 4U1HB 3O4OB 3EFFB 2ITDA 5EORL 5FF6A 3OKLB 2CO6B 3R0MA 3PE9A 4U1NB 1S9XB 3ILQC 2C4FT 1E6JL 1BM3L 2IFFL 4NCC1 2ZUQC 3SGEI 5I9QC 2Y6SC 2WUBL 2X89D 3VWJD 3J7HA 3TN0A 1PY4A 3ZE1F 4XPGH 3IDJA 3M8OH 1MFBH 2WLZA 4MWFB 4XPAH 1A9BB 1DE4A 1T04B 5CGYD 5JR1H 2DQDH 3AY4C 4U3CA 2VSCA 4MD4B 4XX1G 3BAEH 1NFIB 1U8PB 5GGRY 5EOCJ 3ULVC 4H20H 1X5LA 2F53A 2W0FA 3WIFB 4LPWA 4YBQD 1A02N 1MUJB 2KUTA 4LSSH 3MYJB 5DRWB 3IKCA 3I6LE 1QLFB 3SDXF 4K07A 1MPAH 4DGVH 3BD3A 4DVBB 5GSRB 3VI3E 2PYEA 1QRNB 5HJ3A 3TIEA 3ARDB 5F1OB 1ORSB 3ULVL 3G6DL 4HFWB 1PGRB 3VXRA 1HQ4B 2VL5B 2I26N 3T0WA 3P4OB 2CQVA 2W60A 3MREA 1EAPA 2VZSA 2C5DC 3V6OC 4U6VL 3C60A 4F7EB 1RZKC 5ABDE 5F6IB 7FABL 1NC4B 2R1WB 1AKJB 2BNRA 2EH7H 1YEDB 1KXQE 1VFAA 2ZJSH 1E4WL 3TWCL 4I3RL 5TJWK 2DQDL 1RZIA 4XGZB 1QSFD 4PG2C 5E00B 2WUCH 1RURL 4JFPB 3C5JA 4IMLA 3HC0B 5CILH 3B6SB 3GRWL 3HG1D 3TNNB 4KUCF 5ESVA 3GSWA 4BM7A 3B9KA 4BFIA 4PGEA 1J1PL 5AZ2H 3ARYA 3JV4B 3IETB 3ECBA 3EIFA 4NUJA 3AU1B 4IOFC 4YHML 5CINL 1NC4A 1ZMYA 2FZ3B 5I8KL 1VFOA 2HLFD 1MRDH 2O5YH 1MFEH 3WIHH 3WLBB 3ZDZE 5DJYA 3RWDA 2BRRH 4YHOL 4HWBH 4LAQL 3MA9L 2YD2A 3MJ9A 1E4JA 2JLLA 4XI5C 1CGYA 3QWOA 1S7XB 1EZVX 4FFZL 4ODTL 4I3RH 4QHUA 1I1RA 1QFHA 4R0LA 4UQ3A 3I6LD 1OSPH 4OCWH 4GQ9L 3GIVA 3S3SA 3N9GH 3IFPB 1PG7L 4OFKA 1WWWX 1L9NA 4ALAH 1N6UA 4K3JH 4KVCH 4LMQE 4KC3B 2AV7B 4XNQA 5I8OL 1J1XL 3MJ8B 1KTLB 3DHMA 3FQXB 1XIWC 3VRLF 1R24B 2EKSB 1RVFL 2YBRB 1ZLUH 4NUGH 1P2CB 5T33H 4ZPTA 4D9QE 3BPCA 1UZ8B 4WW1B 4DOHB 4LARH 1WWAX 2DQHH 4OLWH 3VH8A 3VXRD 4ZOEA 3FKUS 3ULUH 3E2HB 1MUJA 5IMMB 3AROA 1TVBB 3MFGB 1YQ2A 1P9MC 3JUZA 5D2NE 2E7CA 2HJFB 4PGCB 4Y8DC 1I1CA 1UXWB 1XH3A 4F58H 3MJ6A 4ELKB 3DX7A 3DI2B 3QG6B 4A6YB 1MELA 5DD0H 4PBVC 4WUUD 4DKDC 4Q2ZA 4KRNA 2R2EB 2BFVH 5JIHA 4R26L 3EO0B 5IOPB 4JPKL 1T89A 1FFRA 1S7TB 4NZJA 1D6EB 4MD0B 4UIKH 4Q6IC 2EDWA 1FVEA 4GKNA 4JZJC 4MQXC 3OWEA 2KQNA 3TJHC 4OSUL 4X99A 1PX4A 4RAHA 1HXMB 1QFWM 4X7TB 4CMMB 4FXKB 3BKJL 1U8LA 1A3LL 1CDJA 4U7MA 1ND0B 2DQIH 4YEEA 2P24A 4KGLA 5IHBA 5C0CD 3OX8A 3U0WH 4X4YA 1QPPA 2X70B 1SHMA 3O6LH 5IJVB 2IH1A 3TO4C 4X6FA 2COQA 2R9HD 1HHJA 4G3YL 1A7BA 5CBEA 5A40E 3RVVC 4JKLA 3I2CH 4RISL 3O2DL 3WLWD 2PF6A 2UUDK 1OL0A 1U91A 1MCWM 1WBZA 5TGBA 1ZGLP 1WZKA 5BRZA 1ZLSL 5EO1B 3IF1A 5E9DD 1Q9LA 4G6KL 4Z7VA 2GSGB 5DJ6A 1MCEA 4MVBD 4R6UA 1LGVA 5GGQL 1FL5B 4W81A 5E6ID 2JIXD 4OF8A 2NW3A 1CLZH 1R5VB 3W0WB 1FZKA 1R5WA 4Z7UE 4YO0A 4PRIA 1OTSD 5JHDD 4PJCF 5J1SC 1BLNA 5TQ0H 3U46A 4XNZB 3LDBC 4PJHB 4ZQKB 4J6RH 1EHXA 4M9OA 1OQXA 4JGJA 2VLRB 3O2WH 4JHWH 5BRZB 4GW4A 4MNQB 4NGHL 2CUIA 3LZFL 2YPKA 4MCZA 4PGDA 2A6KA 5DC0A 1S5IL 2ZCHH 4XCYA 1DQML 3SDDD 3NA9L 5SX5H 4HUKB 1JCKA 1T21B 4XXDA 3LY6A 5DA0B 4Y4KB 2AI0H 1XGRB 5F3HA 5HHPB 1RSFA 2HLAA 5JA9A 2BOBA 5DJ8A 4TTGA 2R2HA 1ULVA 1T1WB 4S1QH 3U36A 3QDGA 5D7IF 2R1YA 5IBTH 1OD7A 2NX5B 1D7FA 3B8YA 5GS2D 4G6FB 4P46D 5I1KL 3ZE1E 4PLJC 3OPZH 3VE0A 3D85A 1LP9B 1S7SA 4PFEA 4HC1H 4DQOH 4M6ML 2DICA 5CD3A 2D9QB 3DETC 3O11B 2K9UA 1QTYT 3U83A 2H3NA 3MV11 5EU3A 2R0LH 2P7TB 2NY2B 1TZGL 1KCVL 3HB3C 1ED3B 2AGJL 1GAFL 5IHZA 2IPTH 2K7PA 1RZJL 4KTDL 1U3ZA 1TETL 3GHBL 4Z7WE 4YDIH 2P48B 4JCLA 4ODBD 5F6HJ 4XWOC 1G7PB 4BQBA 4QRRE 3SGJC 4HAFA 1HKLH 2Z9TA 1BFOA 1WITA 3RGVA 4HH9B 4FQXB 3ZDYE 3OG4B 3DO7B 4DN4H 4JFOB 4W68A 1MJ8L 4OLYL 2D7TH 3HC3L 4JKMA 4Z78A 1GOHA 4LIQH 2R0KL 4ZYKA 1EUUA 5I17A 1KTRL 2DI9A 4XXCC 4I5BA 2ARJQ 3UO1H 4R9HA 1NAMA 4X6CB 1H3VA 3O2DH 3P0GB 4P2RE 3HR5A 4NBZB 1QVOA 4AG4H 1T7WA 2NY6C 4HUVA 1NLBH 5FYLE 4FA8A 5LGJA 5IEHA 3MLVL 3TPUA 5D1QB 4L8SA 3O8XC 3SDAB 1CU4L 4N0RA 1EIBA 4WNQB 3MLWH 5I2IA 3N1GC 1RIUH 5FYJD 3OXSA 4OLEA 2AV1A 1BIIB 3DYMA 1A7PL 4JFZL 4PJ7F 1A6PA 3MXVH 4P2OC 5IBLC 3NCJH 4OM1H 3GMNA 3RDTA 3TV3L 2B0SL 5TDPA 4I48B 4PJIE 1HHKA 5GHWH 3OR7B 2SEBB 3RNQB 4G3YH 1CR9H 5E2VH 5EIIB 3IJSA 1UKTA 2P8MB 5DRNA 2Q86A 4DKEL 1UM5H 1ZLWH 1M05A 3BUTA 4OCMC 4WJ5B 4DKFL 2F54E 4WFGD 4IOIA 1AJ7L 5DQ9A 4ESKA 4JZJB 3C9NB 1XR9A 1YPZB 1CDYA 1KG0B 2H45A 4NUGL 1AXSB 4OZHB 2P5EB 2OTWA 4P9HH 2VDPL 3VXNA 4X83A 4WI5A 2VQ1A 3U36B 4YXKL 3L1OL 3WV0A 5IT2H 2OP4H 1CLOL 3AM8C 1BIHA 5IF0B 3SQBA 2ICWA 2W9LA 5IROA 3T65A 2L4OA 3BJ91 2QR0B 3MV7A 4U31A 3AREA 1QBLH 1I9RL 5ICXB 1KB5L 2BNRD 4WUKH 1NGPH 3F7YB 3MMEA 2P45B 4PR5A 4IIQB 3QIUC 3S35X 3FT2B 2Z8RA 4BUHA 1DBBH 3G6JE 5HY9A 3CZJA 2ED8A 2APTA 1B4RA 2IAMC 5J9PB 4G9FE 1KTDB 1U8JB 2QJDA 3IXAA 4PB9H 3VXSE 1JGUH 3UROR 4GSDL 4JKPL 1FC1A 4NO3A 4PGJA 2DQTL 1V3JA 2KDGA 2D7MA 2FX8H 4QHKI 4KRMB 3GBMH 3MPCA 1INDH 3C8KA 1U6AH 4UQ2B 3VFNA 5C0BE 4FQ1L 4F2MA 3H7BA 3GMRB 5IF0A 1KPVA 2QHRL 2ZNXA 3KPLA 2JCCA 2DWEA 1OCWL 1M71A 3O9WB 5ERWA 3QEQE 1U8NB 4OLXL 4X5XA 5B3JE 1HDMB 4HH9A 1HHIA 3EJJX 5HYSB 1D5BA 1FGVH 4BZYA 1T20A 5GGSB 4G7VH 4N8PA 1DVFD 2ESVB 4GQPH 1LO4L 1YJDC 5CUSH 2IGFH 2LVEA 4CDHA 2YPVH 4HH8A 4QT5A 5D7JB 2IF7A 2Y9RT 3VGEA 4AEIL 4F3FA 3T0AA 2CXGA 1MJ7H 1UZ6F 2FGWL 4R8WH 1H9VA 4YHMH 1QFUL 4D8PB 3HR5B 4GBXC 2NZ9C 4YQXH 4OSUH 5HYQB 3FO0H 5DDHA 4ZFZA 4C4KO 1JGLH 5AZEL 3WIIH 5EUKB 5TE7L 5HGAB 1GZQA 2VZVA 4ORGB 3O9WC 2QQNH 5KS9F 3GMQB 3CSPA 3SHSA 5ID0A 2BOCA 3D18B 5CZVL 1Y6KR 2XFXA 5EIQA 5DMIH 3K4ZA 5C9JA 1A0QH 4XTRC 1FNSL 4HBCH 4OGXH 4ENEC 3NCEB 4M6OL 4LLQA 3T0EB 4HWZB 1TQCC 3DX8A 4ZSOB 4P5MB 1UC6A 2EDTA 1S3KL 5FYJE 1JTPA 2IQAA 3K7UA 5L6YH 1CZ8H 1CXLA 2GK0A 3MV9A 3EYVA 3VGDA 1AHWA 5FA4B 3U7AA 1CF8H 2LU3A 4GMSL 2DM3A 3U7YH 2OL3H 1JPGB 5T5NG 1MFEL 2RFXB 2AEQH 1JGEB 4RNRA 2AVGA 2PR4H 4Z95H 1ZLVK 1SEBA 1T1ZA 5DJAB 2DIJA 3L5WB 3MOAH 2VZUA 1N64H 2QSVA 4Q9QL 3EYSL 1HYRC 3TA3D 4YDLB 3CFJB 2E7LA 4JZNA 5HI4D 3QCUH 3W0WE 1EXUB 4F7CA 1CFQB 5E8PA 3DX8B 4ZSOA 3VFPB 3VRLE 5LVEA 1LK3L 4Y89A 2F8VA 1QZ1A 3CFKB 5E6ZA 3S3JA 3N9GL 1B2WL 4GFTB 1G7MA 3MLYL 3ROLA 3BZFA 3G9VA 4Y2DC 5DLML 1UH4A 4JM2D 1FYTE 4HLZG 1UH3A 3HPLA 4NQSB 1A47A 3LKOB 4XMLL 4MNQD 2RFXA 3I02B 4I0PC 2DTML 2W65A 3MLRL 1IM3B 3C8HA 1J8HA 1Y0LA 3DI3B 3VXSD 3M07A 3RPIB 3SDDB 3N50A 5C07E 4LLMB 3BZ4A 4G8IA 3IJHA 5IQ7H 1JF5A 4ACPA 1UA6L 4K8RL 4NZRH 3QQ9C 4BSVA 4MNHB 3FT3A 2PCPA 1T6VN 5KS9B 2D7OA 3NAAL 3W11C 4PJEB 5I6XC 4OF6A 1BFSA 4OZIB 5F1IA 3PNWB 3L1OH 1H3PH 1A6AA 2GSIA 1BQLH 2ZUQB 4NJ9H 3P3YA 4YIQB 3TT3L 1XGYL 3TN0C 4K3EL 1QSZA 2B1HH 4QRQB 5C8JA 5I1EL 1JRHL 4H88H 3PQYA 3DXAB 1U8NA 4X5XB 5C0BD 1KULA 5K9OA 1RZIB 3P9WB 3V0VB 2KZ1B 4R0LC 3DMMA 2NY6B 4KKCD 4OI7A 4LQ1A 1NKOA 5MERA 2OI9B 3UBXI 1A2YB 4DTGH 3FOLA 4M43H 4Y5XB 4NN6B 1ZVHA 1GZPA 5BQ7A 3WFEH 3W9EB 3NZ8B 1M7IA 3K2MC 4MXVE 2HT2C 2VDLL 3GBNH 1RJZA 3DTXA 2PTVA 4Z5RA 2OR9H 1Q94A 4LDOB 4LSPH 5KSAC 2JJSC 1KSRA 3FQNA 2VLJA 1CQKA 3B9AA 3FT4A 2QEJA 2XZCL 2J6EH 1HHGA 3BQUA 4RX4A 1FE8H 3A0OA 3JTTA 4OD1H 4Z6AT 4K23H 4PJDF 3T1WA 3RWHA 3LEYH 3PWPD 4Y4HD 2A6JB 3QNZB 1MCNA 2R23A 2FIKA 4XWOD 2YD3A 3HG1E 4YHNB 1Y6NR 4IDLA 4Q74A 4HWZA 4OKVB 4OGXL 5EIVA 1RK1A 1V3LA 2VRAA 3EGSA 4O2CB 2OTUB 1I1YB 2DM7A 1FG2A 2IAMA 3MRDB 2A74A 1FNGB 1QLEH 5BOZG 5IQ7L 1JPGA 1UM6L 3EYFB 3RAJH 1S5HB 3EHBD 3IYLW 1JGEA 5C07D 2HTKD 5E8DL 5FUZL 2GCYA 5IHLB 2ADJB 3D2UA 1WCQA 4OM0H 1GIGL 1H3GA 2DAVA 1A9EA 3CZFB 3GSOB 5ICZA 1KPUB 3HE7A 3NACL 5E2WH 4NZTL 1XF2B 1K5NB 2R69L 5KJRL 4GOSA 3CFBA 3I75A 4Z78B 1YNKL 3KR3H 5ISZB 3L3HA 4JAMB 5I1AA 2G5BB 1CK0L 4LCWE 1U41A 4Q0XL 4ODWA 1EEZB 1UJ3A 3OKDB 3IDXH 2YPLE 1V5JA 3V6OE 4HQQH 3QUXB 4J1UA 4WFFD 3B9EA 3B2UD 3HTLX 5FUCC 5F96L 2LU4A 4XCEA 5I73C 1YY9D 2A1WL 3OAYH 5GS0C 4R4ND 2PTTA 1J0JA 2AQ1A 1J1XH 1S8DB 4OAWA 1ZEAL 1AIFB 5CGYC 4DKFH 3MV8A 1IM3A 2CGRH 5E4EC 3SGKA 3L3DA 4R2GC 4EN3A 2DQGH 2DLFH 3KPPA 1FSKB 4QRTA 3STLB 3U7YL 1VHPA 4LSDA 3CLFL 4KZDL 1GGTA 4EZMA 4PB9L 1HSAB 3NBNA 1QO3A 1ZT4B 1UB5A 3TN0D 1B4JL 3DWTA 3FB7B 4O51A 5ACMA 4M02A 3VRIA 3FO1A 4P46A 1L7IH 2DKSA 3LD8B 1KJMB 4S1DD 4D0DB 1EGJH 1IC5H 3LAFA 2Q87A 3UTTD 2IAMD 1OTTC 4XCNA 3OSKA 3OKDA 5JDSA 3GDBA 4OGAD 1RHHB 3SQOH 4AT6B 3QFDA 3RNKB 4CAGA 3SGDI 3OKNA 1A1NB 1Z3GH 5LGJB 3DECA 3JWOL 1VERA 4OLUH 3BWUC 2NTFB 2XA8L 3CSGA 1YEEH 1IGML 4RWHA 4PJ9A 1FZMB 5DD3L 4CU7A 4YZFE 3IRZA 2P5EA 3O8XB 3EYOA 2R0ZH 5FM8A 3I85A 4YDJA 1Z0NA 3TVMB 4C54A 5ICYA 3OF6A 5HI3D 3PGDB 4JPIA 2AJ3A 4HPOL 2H41A 4FNLH 3V8OA 1K4DB 2FHCA 2OR9L 5A2IH 1CL7I 3EO9H 4UB0L 1IZKA 2YD5A 2DB8A 4PJEF 3E0GA 12E8L 2B1AH 3CNKA 43CAB 1I3RB 4FOMA 3HCVA 5I1GL 4Y19E 3IFNL 3B9DA 4CN6A 4WHDA 1FL5A 1FZOA 2OSLB 3LKRA 2ESVE 1K4CA 3QXDA 3UP1A 2IBGA 3FFCB 4MJIE 5FUOH 1CIDA 3MGOA 1TVHB 3C08L 4L8DB 5E9DB 3VG9C 3L95A 5SWSB 1FH5H 3H42H 1FNGA 3CCHA 2W0KA 3IDUA 2FX7L 4PJXE 3TO4A 3QUMA 2V7HA 4G6ML 1JV5B 3MMEB 5DMGC 4KHXL 3RWGA 3PDOB 3TC9A 2CLVB 1FL6A 2G2RB 4P5KB 3QZWB 1FE8L 5K93A 1A4KA 1HDMA 5DR5H 1VEMA 4HJJL 3VRJA 1OAQL 3JWDL 2B4CC 5GS1C 3TIEB 1UXSA 4DEPC 1ORSA 2AABH 1K4CB 3QXDB 3DSFH 5FCUL 1U3HD 1MHHA 3QUKA 4J2XA 6FABL 5IT2L 5DRZA 1TNMA 4J12A 2WQ8A 5E94B 3EUUA 3OAUL 4NHCL 4U1MB 2VLLA 4WWKC 3ETBF 3O41A 4RAUA 1KT2B 2F5BH 2BFVL 3B9VA 3WMSA 4B5EA 2VXSH 2EYRA 1T5WA 2X9XA 3BDYL 4MWFA 4JPVL 4OFYA 3BISA 4YUEL 2PO6A 3KJ6H 3A6CL 3I50L 5LGKA 3DROA 3ZYJA 4M61A 2CDGA 3MUGA 3TA3B 1IL1A 4HFUH 4KZDH 1JMZA 2HMID 5F89B 3VG0H 1CG9A 2Y06L 3NAAH 1T66D 5ISZD 3S5LG 4G43A 5ADPH 2OI9C 1IMHC 3GJFA 1JGDB 5F7EL 1KB5H 4WUKL 1LEIA 4OLYH 3ZZ1A 4BQ8A 3HPJA 4KWUA 5TFSL 1VACA 5T3ZH 4GMTH 3QAZC 4NCC2 4XZUA 4XVSL 1TVDA 3D39E 1IGFL 1DLFL 4NO2A 4V2CB 4Q0XH 1MHPH 5IVOA 5J0BA 3LS4L 2ZOLB 4L4VE 2BRQA 4WW2A 5DD1H 3B3IB 1E4XL 4M1GH 3V5HB 3PL6D 1KJVB 2ZUWA 5FYKE 3CVHB 1NMBL 5I6XB 3L3IA 5T1DL 3S35L 5EB9A 3WUWG 2J8UA 4ZG1A 1Q9WA 4NQVA 4F7MA 4XBGA 4NKQB 3DHJA 5B39B 3OGCB 4CMHC 1IE5A 5CD5D 4MAYB 5MHSD 4U49A 3R0NA 4NJAL 1OPGL 3MV9B 1HZHL 4L3EA 1A6ZA 1OP5K 4X6EA 4H1LH 2XV6B 1NGQL 1BQHG 4P2QD 4KU1A 1GHFL 3PV6B 4PBWD 4ELME 3U4EA 3QP3A 1IC7H 1JYXA 1TCMA 2KPNA 2C3WA 3F7VB 4D3CL 1UKQA 4YE4L 4Z8FH 5C0CB 2I9TB 1WFUA 5FGBC 1FYHB 3GSXA 3LB6D 1REIA 2QQKL 4I0PB 5CEXB 1KIUA 5GJSL 1CL7L 1RUQL 3BIAX 3WJJA 5CJXC 3BGMA 1AR2A 3TT1L 5K9QG 4XAWL 3ILPB 3EO9L 4NQDD 4U1HA 3C6SB 5ENWA 4YHZL 4ODVH 2EO9A 1M05B 5MENB 1YDPB 1MRDL 1YEFH 2EH8L 3HUJE 2IBZX 4K9EL 4PG2A 4EVNA 4CNIB 1NCCH 4POYA 4PJ8B 5GS2H 4JFFD 5KVFL 1QR1B 1RURH 4XRCA 1J88A 4YX2L 2J12B 4C83A 2E7BA 5JQ6H 1HXYB 2AXGA 4AIOA 2UWEA 3GI9L 2HKHH 5J13C 4O02H 2ZOKA 1LEKB 4JG0L 5HHQB 1MY5A 1UB6B 5DK0B 1JF1B 3RWFB 1VEPA 5ELIA 3V4VL 2D03L 1I8LA 3BGMB 4U0RC 3PWUA 2VDKL 3BO8B 3GB7A 3MLUL 4AY0A 3ILPA 4FXLA 3H3PH 5JLZA 4WV1C 4LVOC 3MRIB 4M7ZB 4NOFA 3LHPL 1V05A 4LSVL 3DMMD 1JZ3A 2ZG3A 2X4NA 2ZCKH 2QHRH 1ITCA 4K8RH 2YKLL 5IVXE 5CEYA 4OB5H 3LQAH 4EEEA 2OR8A 3A67H 2VL5A 2J3SA 4PJIB 5D7JC 5CLTA 3BAEL 3VG0L 2RR3A 3DXAE 1MRFH 2CRYA 3O3DA 4JRXB 4YHKL 5FKPB 4M93C 5B38B 3OAUH 4X6DB 4F2MB 2R15A 4QXWA 3KPNA 5CSBA 4B0MM 1XGUA 3V2AR 4CBPA 2ICEB 4ORZC 1UQSB 4XT1C 4M6OH 1UACH 2HVKA 5KG9A 1DBML 3U6RA 5EO1A 2AKRA 4NZDA 5E95B 3OV6A 4X0KB 2Y36H 2HVJB 1E6OL 4LCUA 2VAAA 4CGTA 5EH1A 3KLDA 4LIQE 3TCLB 2BNUB 5BMFH 3HMXL 3VFTA 2J88L 1CTOA 1F11B 4LSTH 4KXZI 1DQMH 4PRAA 5BS0B 4FN0A 4M93B 3QDMD 4RFNC 5C0GB 3BEWA 1EEZA 3ARDA 4K94L 5IJVA 1EBPA 1N6QL 3QEQD 3WE6B 1A7PH 1SY6H 4HDIA 3OGOE 5LCVH 2C3XA 4P2CG 5JQHC 1RUMH 4N5UA 5JIPA 5C7XL 1MREL 4ZUVA 2GIYA 3SCMA 5FO9A 5HHXH 2VQTA 3KLHD 3MTRA 4HS3B 4Z7NE 1GGCH 5D5MA 2Z31D 3RTQB 4WHCA 1F6AB 5F9AC 2GFBA 4X9FA 5HHNB 5HYJE 3Q6FB 2E8YA 4D9LL 3RVXD 5J1AB 4I0PA 2H3NB 5EU3B 5L2KB 3ORJA 4G7YH 1PDKA 3F7PC 1D5ZA 3MLTA 2HT3D 5C71A 2P7TA 4J3TA 3EO1A 2X4SB 3TBWA 4QTIH 2VZ3A 2J5LB 4GXUM 1VCAA 4MAYD 3RZCD 4OB5L 3MRFB 4Y4FC 3H0TA 5FOBA 1QSFB 2ORBL 4Y19B 4EIGB 1D6VH 2RCSH 1KGCE 3DV4A 5A16B 1AXTL 3RGVB 2NY1D 1RD6A 1I9RH 3P40A 1N2RB 2DLTA 1IEAB 3OXRA 5IGXL 2OK0L 2FX9L 3FFCE 3KR3L 2YPLB 4IRSB 2ZOKB 1J0KA 5KVEH 1H15B 1ZHLB 2AW2A 3ULUE 4OIBA 1NAML 1R3KA 5DJYB 3RWDB 3D3VE 1HHHA 3HE6C 4KJQC 1T7XA 1IQWL 2FB4H 1XGQB 5TF1H 2R0LL 3SDAC 5HXMA 1J0HA 5BVJA 4JFEB 4WI9A 3BRFA 4K3GA 3FN0H 4L1DA 5BJTA 3C2AH 3ZT6A 3IDMB 1FPTH 4EI6A 5IROC 3RIAF 4YPGA 5C08A 5C0JA 4PV8A 3QUYB 4W6XB 4N0UA 5E0QA 1F02I 5DWUL 3SDDA 4W6YB 3TO4D 3QFJB 3THML 4KQ4H 3DX6A 4HKJA 1T1XA 3TJHD 3DRTA 2GJZB 4JE4B 3FOMB 1U93B 3QULB 2IMNA 1BD2E 4LFHD 3WLWC 1CDHA 1AHWC 4NHUB 4S1QL 1G7LB 2G9HA 3LEYL 1BOYA 4ZDHA 3V52H 3CDFA 4LSQL 2QSQA 3RVTC 3L3GA 3IXTB 2VNCA 2NY4C 4RA0C 5GGUB 3RKDC 1RIHL 1UADC 5E2UL 2P24B 1QA9B 3JV0A 2KH2B 3F7QA 4P2RD 4YBQC 1VFMA 1D5IH 1R3JA 3RBGA 1MFBL 3DVGB 4N0UB 3AS3A 5JXAH 2XT1B 2ARJB 4PRBB 4FG6D 1S9KC 1F90L 4HIIA 2NY2C 1YYLL 4DK6A 4APQB 3WHE0 1V3KA 1JWSB 2CIIA 4P57A 3MRHA 3GMNB 1EV2E 4M4RA 1EGJA 2AK4B 4G8GB 4AENA 1G7LA 4OFVA 4I48A 3MO1A 2EXWC 4AEEA 3WJLA 3NACH 1A3LH 2F54B 3U0PB 4BZ2L 4HZLA 2X7LA 4UZGA 1HHGB 2Z31C 2BVOB 4FTVE 4RMUA 1MRCL 1QFWH 3IJYA 1IKFH 2GSGA 4AH2B 2ADFL 5C0RL 3R8QA 2GKIA 5L88L 4CMMA 4EDXB 1JHKH 3GSNH 3MLSL 4P99A 2ICWJ 1N5YL 2HYMA 3BKML 3SE8L 1FCGA 4KHTL 3D87B 3TBWB 4G7YL 5D1ZD 2YMXH 3EBAA 1WAAF 1MFDH 3ARUA 3GGWB 4LU5H 1YJDH 4GW5A 4OD2A 3QH3B 3IDIA 5L0QC 4HX1A 1KCLA 4MA3A 5F1NB 4U1SA 2OXHA 1W0YT 1FDLL 2GTZA 5FGSA 3RDTB 5IVZB 2DYPD 3BH9A 1J1PH 5AYQA 1PAMA 4MD4A 2CKNA 5T3XD 4FABL 5F96H 5FB8A 3GI9H 5FO7A 3QDME 3MUJA 1PKQE 4X99B 4WDIB 2DTMH 1CG9B 3BKYL 1Q9WB 4PIRF 4F7MB 1VPOL 5GS0D 5I18L 1KBGH 3QQ4A 4JQXA 5C0AE 3H9SA 2FO4B 3K4AA 5KZCB 4UNUA 1I8KA 3Q5TA 1JZ2A 5HYQA 3OB8A 5D6CA 4YHYB 4ODVL 2WUBH 4XP5L 3HAEA 5L2JA 5DR5L 2EIZA 5I1CH 3MZTA 1NBZB 4LLYB 4WW2B 3MRNB 4J3SA 3MNZA 5HYSA 4PJFE 3MBXL 4PJGF 1CVSC 4F37K 1EHLL 5GPRA 3PWVA 1AC0A 3WIFA 3PABB 5FV1L 3MRQB 4QOKA 3FZUD 4OZGB 4QYOA 4KMQA 3P0YL 5D7KD 3F65A 2QSCL 4JGUA 3RGHA 1K3ZA 4MXQC 3WSQL 3MRPA 3A6OA 4U1LB 2XPGA 4V1DA 4P59L 3LCYA 4U6XB 1JN6B 4OZFA 3BH8A 4WUUB 3BP7A 1ETZB 3BQUD 4YQXL 3MCLL 3UMTA 2AEIT 5FV2A 2GEEA 5E70A 4EI5C 4DUVA 2O61B 2GJ6D 4F7EA 4P9HL 3ARFA 5BV7B 4NWTH 1WWBX 4G6JL 1D9KC 4MD5B 1JPSH 5CJQL 3SBWC 4H26B 1U9KA 3LQZA 2P5WA 4N8VB 3MO1B 4Z7WB 2Q3AA 1TZIB 3T2OA 3FO9B 1SEQH 5EBLB 3ROLB 2VDOH 2W91A 1MHEA 3VA6A 2V2TB 4KRPB 1JE6A 4CNIA 1F42A 3WS6C 1I3RA 3ILQD 4Y4KA 1FBIH 2Z35A 3QHZH 4FFYL 2HLAB 5EA0L 2OL3L 3H3KA 1MLBA 3ZKMC 1LE5A 2ID5A 2O61A 1KPRA 5KANI 1TZHA 1CICB 2VUYA 5I8KH 1PSKH 3JUYA 1A3RH 1MCFA 4ZUWA 4KZEH 3MGOB 1TJIL 5JPNB 1MFAH 2IPTL 1ZLWK 5GJSH 3TFKD 1MCSA 1NUDA 1G9EA 1QFUH 5JHDA 4PRID 4YJZL 32C2A 4FQCL 2Q1EA 1NUGA 2VB5A 1FIGH 3BZFB 2P8LB 3GSVB 4YHOH 5ANME 4XB7A 8FABB 3PQYB 2ADIA 4K7PX 4XNMB 1AY1L 1MAMH 5KBNC 3G04B 2XZAL 4HAGA 2NYYC 2WBKA 1DUZB 1U95A 3BPNC 4PRPA 1NEZG 5B21A 4M1CC 4ISVA 1NBVL 4L3CB 1TXKA 4PD4K 5F7YC 6FABH 1AXSA 2ZKHL 1ERNA 1EO8L 4UAOC 4U7KA 3D25B 4URTB 3MUY1 4ZUWB 1A6TA 2H6PA 3AS2A 2YD9A 4PJ5E 2WMPA 1NANH 2HJKB 5EZJB 4RMQA 3FQTB 4Y4FA 3QR2A 4AEFA 3MROA 2QQLH 5EU4A 3QB7C 4AM0A 5DJ2B 4HWEH 1IZJA 1SYSA 1YNLL 3BVNA 2MNUA 4FMKA 4NKMB 4Q2ZB 1MCQA 3V0VA 5DVNA 3VI4E 3KXFA 1Q9OB 4HUMB 4ZUVB 6CGTA 2AJZB 5D7LD 1YN6B 2DQCH 1QRNA 3EDEA 4C58B 5JW5A 2FNBA 4OCRH 1G9ML 2Z31A 4GS7B 4MMXC 4QOKB 2VDQL 1H8NA 4RMRA 4OCWL 1KIQB 1YMHB 3DUHA 4OZGA 5CZKA 4FS0A 4XNZC 1SMAA 4ZUUB 1OP5H 1FGNH 3GJFB 4WV1B 3TN0B 2IMMA 4OCXL 3OKMA 5FYLD 4DVRL 5CCKL 1OLZA 5DJCB 5IESH 3DJ9A 1BBJA 4HPOH 5F9DC 3QUYC 4TVPH 1VGEH 4UOW0 1KEGL 4OCSL 2R56H 1A7RH 4RFOL 2Q76B 3CVHH 5F1SA 4KKAC 1J18A 4ONOA 2NZ9D 4LCWD 5C0DA 1YYLH 5C0AD 2FWOB 1WBXA 2LABA 5DRWA 4HJ0C 5I1GH 3NCFB 2Y7QB 2G5BA 4FQ2L 4KROC 5SWZD 4PTUB 4CW1A 5AYUL 3LKSA 4HPYL 1S9YB 3D1MC 4RDQG 4L3EB 2R2HB 3CC5A 2A6DA 3SJVA 2NY3C 1ITBB 3G5XB 2A73A 2AQ3A 3H0TB 4GKZA 4UOW1 3BP6B 3S4SA 3O6LL 2QHLA 1K6QL 3IFOA 5D1ZA 3MRBA 4HGMA 2XKNA 2GCYB 3CU7A 1IQDB 2XFXB 3SO3B 1P4LA 1IGYA 1RUAL 4KVNH 4OUUA 5E7FA 2VZTA 4S0SD 4JLRA 4G6MH 4H25B 3TPKA 4RFEA 4JZOA 3ARWA 1RJLB 4X98B 2IAND 4HWBL 1INDL 1S78D 4ZAKC 3REVB 1HCFX 3KPMB 5HYJD 5AWNH 4FQLL 2XRAL 4KGJA 4CVXA 1U2CA 1GYAA 5DXWA 3O8XD 4FTVD 4LCYB 3TP4A 3FT2A 3WIHA 1RZGA 3NIGF 3PWPA 4Y4HA 3ULVE 1OGAD 4L4TD 4J7RA 3IFPA 5D7SH 4HIHA 1U3YA 3WO4C 2VDOL 5HGHA 3RTQC 1IC5L 3IFOB 1F58H 2LAAA 3JV4A 4TNVK 4DN4L 1RY7B 1DUZA 3O4OC 4U05A 1F3JB 1H3UA 4IJ3C 3K3QA 1X5KA 25C8L 4GXUN 5DQJA 3T0EC 5IB4B 3VXOB 1CLYL 4BK4A 5IFJA 3DX6B 3DUUB 3MLUH 4LHUD 5D7JD 3HUJF 1PSKL 3N85H 3EYUH 4GRWH 3ALWA 5CJOH 3CMOL 3KPSE 2ITCA 4X98A 2W1NA 4MA7L 3O6ML 4UUJB 4J4PD 3E6FA 5C92A 2YPKB 3KPMA 3QSKB 3RWJA 4BKLA 3F6IA 3L7FB 2J6EA 1T2JA 4XCYB 1EFXB 1LP9A 1S7SB 3QNYB 5HGDA 3VJ6B 4Y16B 2CLZB 5FGRA 2APXA 4KKBD 4N8CH 2CDEB 2ERJC 1A1OB 3MOAL 4LPXA 1U8OB 1SJXA 5DEZA 2MWCA 1HK6A 3NIDE 2VXTL 4JFDE 1U8KB 4U1KB 4OQTL 4HIJA 5HYFA 4OTXH 3TLRA 3X3GL 1KOAA 4F58L 3HS0A 4MS8D 3QEGL 3QCVL 4JHWL 3EJZD 4JPIB 4GKNB 4KY1L 4P3CL 1K4DA 1KLUA 1CT8A 1JK8B 1UB5B 2E27L 3NPSC 5DJCA 3BX7C 3CMOH 1YA5A 1BQHB 5I8EB 2P8MA 3IDGA 1VADA 4FQLH 4Y1AB 4G9DA 3P4NA 4JO3L 1NMAH 4ZYKB 2Q8AL 4L1HA 1FZOB 5JW3H 1SYVA 4L29B 1JRHI 4N8CL 4EDXA 4M3JA 4IS6B 5D8JH 1F3DJ 4DOHE 2AV1B 5GISL 5D9SB 5C0EA 4TVPE 2EEDA 4NM8L 4P4KD 4QHNB 5FECA 4PTUA 4CW1B 4YX2H 5E7BA 3BEVA 2NCMA 3QIUB 4LNRB 5D1XD 3RZCC 4KV5E 1DBAL 1YNKH 4JPWH 3X3FH 4JRYA 5JA8B 3L5WA 4EQ2A 4XPFH 3CGTA 1LO3H 4LPTA 1ZSDB 4PP1D 1YUHB 2PYEE 3FB5A 3P4LA 3HAEB 4YDJB 2OJZL 3ZSSA 3WBDA 1GGCL 2PXYB 1D6EA 5DS8B 3FJTA 4JLRB 4ONHA 3MV9D 4M1DL 5FGBA 5KSBF 4LVHC 4I5BB 3E8UH 3K2UL 3RA7H 5BCAA 4G6KH 2YHGA 3DGGB 1A7RL 2EYSB 3MYZA 1JHTB 4EXPX 3FQRB 5DURB 1CE6A 2CSPA 3QA3B 1TLKA 5JW4N 4Z7OF 5GRYA 3HI6L 1MJUH 2BNRE 1LO5B 2ITDB 4CVZB 4HEPG 5E24E 3LV3B 5I1EH 1WZ1L 2DQFB 2OL3A 3V5DA 2HJFA 2YZ1A 4JFDD 1CDBA 1LHZA 3HPJB 3BP5B 1AKJD 1UCBL 2VABB 4RZCA 1FV1B 5IR1A 5JORA 3F12B 1XCTB 3S96B 1J0IA 2BSSB 1NGWB 3ROOB 1TDQA 3BYTA 1DBAH 5IWLA 2HT4C 1ZEAH 4YR6A 3BJLA 4UTAL 4XMKL 1RZ8A 5D7LA 4QRPD 3MLSH 5DYOB 4C4KT 2D7PA 4BH7B 1FRGH 4MD5A 3Q0HA 1RVFH 4EUPG 3DVNA 4OF7A 1S7UB 2G2RA 4HIXH 3F7RA 3GMLA 5CWSB 2ATKB 5FO8B 3N0PB 4NQCB 4OGAC 5HGDB 1NCAH 1NLDH 3MRRB 1IM9A 4OKVA 2PW1A 3WYRA 2N1KA 3RVWC 3TIDB 4WIQA 3PQYD 3CDYA 4JR9L 4NQUA 2RAMA 3QO0A 5DUML 5D93C 4C56B 1DBKL 3GKWL 3T65B 4HKJB 2CK2A 5CIPB 5IEKA 4DJMA 4Z7UB 4N0CD 3DURB 3FAXA 1IM9D 1Z9SA 3TZVA 4OFDA 4NO0A 5HPMB 1UWEL 1T2QH 4JM2B 1PQZA 3ZDXF 2CRZA 2V2XA 4WO4A 3GHEH 4U1JB 3W2DL 4A2MA 1KEML 5HHOE 1F8TL 1RUPH 1JHKL 3ARFD 1ZA6B 1HQ4A 3HKFA 1DFBL 3ARPA 3VXPA 5GRZA 1C16B 2F8OA 3T8XA 5BRZD 3TJEL 1M4KA 4JHAH 4NNXB 4QCIB 1MLBB 2N7BA 1VENA 4P23A 1MCHA 4CDGC 1P6FA 4Y1AD 1JPSL 4PJ9D 5CJQH 4ZO6A 4OTXL 4JY6B 2OM5A 2I9TA 4X6BA 2VH5L 1JBJA 3ZMRA 1VFBB 3LRSA 5ID1A 3GO1L 1IC4H 1JWUB 4QHKJ 5CP3A 3QQ3A 5MENE 3R06A 5EFIA 1KJ3H 4PS4H 1HWHB 5F7UA 1I85A 3RQ3A 4Q9RL 4NQDE 5KN5B 3NIFE 4NRYB 2NNAA 4XVSH 1HEZA 4UILH 3ULVD 4OCLC 2BNQE 1CDIA 1YDPA 3FB7A 5IB5A 5BVPH 1FO0H 4NFDA 2V9RA 1AQKL 4AIZA 3OGCA 4QEGA 4OFIA 4TVPL 3DGGA 2DQTH 4NWTL 1CDGA 3RPIA 1WISA 4MCYB 1HCVA 4KUZH 3PXJA 4GRWE 2DQJL 4WWID 1KTKE 1TJHH 4GG6E 4NJ9L 2BZDA 3LMJL 4MNGA 4X9GA 4ZUUA 4LEXH 4OAWB 4ONFH 4Q7DA 2CO7B 3RVWD 3U30C 3F7VA 4P2QE 3RBSA 4L3ED 5BS0D 3NFSH 3ZL4L 4TVPD 2FATH 3OJDB 1FV1A 5IR1B 1FNSH 1MI5E 4HBCL 3HLAB 1HXMA 5CUSL 1U8LB 4FFYH 3KXFB 1U2HA 1LK2B 2DM4A 2VTFA 2F8XC 2MTPA 1NANI 1U92A 4YHPB 4NN6C 2VN4A 3VA2C 2APVA 1ZLVH 3VG9B 3BGFC 3O2VL 4PJ5D 3O4LE 3L5HA 1X5AA 4XHJD 2FYYB 1IKNA 5CKAA 1RUKL 3QQ4B 3LPFA 5CBEB 5HBBA 3IU3B 4BFBD 1I8KB 3CFDA 4XNQB 1CGSL 3RGVD 1N3NB 4FTVB 3KHOA 4PGCA 3QCUL 3UYOD 4UINH 4HG4J 1CFNA 3O6FA 1IGJA 5KANG 5I1IH 3NCYS 3D6GA 1CXIA 1SJVA 2BXYA 2N7AA 2P49B 2XTJB 1H3PL 1Q72H 1JZ4A 1Q9KB 3CDCA 3HC4L 1ZTXL 5HHQA 1JZ6A 1MF2L 3V6BR 4BH8A 1WSST 1GPOH 5A43C 3DSFL 1UYWL 5FCUH 4PJDE 1R3IH 2A6JA 4DGIH 2CUMA 3WDJA 1MCIA 3EKCA 3D0VB 5DD0L 4LHUB 1ADQL 1OSPL 3KPSB 1KACB 3SDDC 1OF2B 3SKMB 2X4OA 2ZUYA 3MLTB 4U2YA 1RJZB 1T2QL 4M8VA 5J11B 5CJ8A 1X6NA 1PLGL 1GC1H 3Q2CA 3F62A 1Q94B 1WLHA 1BFVH 4ELKA 1VFUA 3FQUA 1TJHL 3V5KA 1UVQB 4XNYH 4X9IA 2WP3T 4QRUA 2VLRD 2QADB 1R3LB 4N9GA 1GZPB 2EDDA 5BQ7B 4XTRD 2AXJA 4R2GB 5FKPA 1DQJB 5D96C 1Z9OA 2QQNL 2EDLA 2WIIA 2HKHL 3SN6N 1SVZA 1KN2H 1XF2A 4FP8L 2WLYA 4MHHG 1WJ3A 4LKCB 3MJ7A 5K9OB 1AD9A 3Q5OA 3BQUB 5DGRA 2YRLA 5C3TA 3G6JF 1MF2H 1FL6B 4XVUC 1X5GA 2VLRE 1EFXA 1R3HA 4JO2H 3VJ6A 2IANA 5KSVA 3RFZC 1RZ7H 3ZKMD 1I3UA 1P5UA 2D4FA 5D7IE 3FQUB 4APQD 3HRZB 3V4VH 3FOLB 4UV4L 5DI8A 4N0FB 4JHZA 3ME0A 4PRNB 3MCG1 5HHME 4JANA 3AY4A 4OZFG 4ZO7A 3UEZA 4O2CA 2R0ZL 1YEIH 4J3UA 3T3ME 1MFAL 2Y4SA 5E8OA 2V9TA 3D3VB 4ZFFB 3RY6C 3MV7B 3HNSH 3BT2L 1N59A 4QXGL 1WUNT 1MJUL 1R3KB 1T1YB 4S1RL 5D1XB 2NX5D 2HJLA 4P5TC 2B2XL 2J8UF 4WGVB 2JTDA 3LPGA 5GJTH 1QPXA 2FATL 3QFDB 4BJLA 4UT6H 2WW8A 4LNVA 1HINH 1J87A 2Z93B 3I75B 5B3NA 5IUSA 4PS4L 1I8MA 1T1ZB 2VISA 4JANB 3M1BB 3QFJA 5I1HL 3KPPB 3BXNB 4GLRH 3TH4T 4XP4L 1E27B 4OQ1A 3DUSA 5EUKA 4LGPB 3UZEA 4KMTL 1NPUA 4X7SL 5DMGD 5DWUH 4PG9A 1QSVA 3KS0H 3QO1A 3T2PA 3ARVA 5IG7A 4PRDB 3R4DA 2FEEI 4NN7B 2DYPB 3UXFA 4NO2B 3BGAA 4QNPE 1KCVH 4IDJL 4TSAH 1U8HA 5CZXC 3VWJA 1CD1A 3PUCA 5C0CA 1NCWL 3QYCA 4NCDA 1AC6A 3SDYH 1OAQH 5ISZA 3TT3H 2Y23A 5ITFB 1KJ3L 2QSCH 3MRKA 5J3HD 2IPUG 5IEHB 3MYJA 3KXFD 3QQNA 4R0LB 4UQ3B 4Z7VF 1RIHH 5DMJB 3N85L 3VFWB 2CDFA 9CGTA 4P9ML 2VL4A 4D9LH 4GQ9H 3RVVD 3UX9B 5DDHB 4ZFZB 5D70L 2PO6D 4HKZB 2EDBA 2MPAL 5IG7B 1GZQB 4ORGA 4RRPG 5FUZH 1SEBB 4HK0B 3O2WL 3PDGA 5EU6A 1V7NH 2XZQL 2XY1A 3P77A 1ZSDA 1R24A 4L3AA 3U6RB 2GUOA 2YC1B 4IM8A 3RPKA 2BCKA 3LN5B 4Q58C 2HVJA 3ZHDA 3UCRA 1CLZL 3MRKB 4R7DB 5IVZA 1L6XA 1CE1L 1P4BH 3EOYG 1I1AD 1K8DA 2NX5E 3QG7H 2VYRE 3SCMD 3TH2T 2M1KA 3A6BL 4YBLC 4PYHA 4YXLH 1PKOA 1HINL 4TSBH 3ULUC 4J6RL 1R6VA 2C1PA 3QUKB 5BW7A 2F53E 3Q3GA 1G6RL 4LPCA 5J12C 2BVUA 3NPSB 4KI1A 5EUOF 4PRBA 2VIRB 1KIPB 5I66A 1CR9L 4ERSL 1JPFA 1RAMA 5GSVA 3K1KC 3QWRA 3ISWA 4G80A 3QEHB 4NKDB 2Q8AH 2UZIH 1TVHA 2OXGA 5SWZB 2FZ3A 3HAEG 4Z76B 4UIKL 4RFEB 5J89A 4R2GD 1YECH 2CIKA 3CCHB 3EFDL 3VFSB 5D7SL 5F7MC 1WICA 4KROB 1FLTX 4KRPD 4YC2C 2MCPH 2DI8A 2CH8A 3MA9H 1I9IL 2GJ6B 5EZLA 4JRXD 5SWQA 3AS1A 3ARBD 5F7LB 3NCBB 4UBDD 3MUZ1 1A4KB 3VXUB 3TO2B 3T04D 1LDPH 2M2DA 4HIHB 4Y16C 5DJ0A 1KN4H 3LIZL 1Z9LA 3B2VH 3O6KL 4GRWF 3UYRL 5JNYA 5CEYB 1NC4D 1E4KA 3I3DA 5CS7A 2DJ4A 3EDJA 1PZUB 4Z5RB 2MOVA 2D0HA 5IQ9A 4NQCE 2VXSL 3MRJA 4V1DD 5CZXD 5T3XL 1DVFB 4UTBL 4FQQB 4TN9A 5L7XH 2PETA 4F7PA 5IJKA 1DN0A 3BKJH 5HVGB 2Q86B 3ZE0E 1I7ZA 5HHOD 5EC1A 4PY8I 3LN9A 2DLIA 2WBJA 4KTYA 1N0XH 4W4OA 4QYOB 5IK3B 3EOBB 1UWXH 3DRQA 4EUPB 5J57B 3QNZA 1TZIA 3JSSA 1QHPA 5D5MB 4RGOL 2F9BT 3FO9A 3K0WA 1G7HA 1B2WH 3M17B 1GH7A 1MHEB 2IH1B 4XZUB 2EZ0D 3C2SA 3S98A 2JJSA 1JFQH 1T03H 4O58H 5GGRB 1UYWH 1MFCH 1A5FL 1W72L 3LPWA 3NH7L 5AAMA 3WS6A 2QQKH 4F9PC 1QO3B 1ZT4A 4YDVA 2FLBT 3WFHA 3O6KH 2VMFA 3T4YB 5B8CA 1WBZB 5L2JB 4GW4B 1ZHNB 4MNQA 3HA0A 2EIZB 3OKOB 4ZXBD 4YAQA 4JFEE 5HI4C 1IFHL 4YUEH 2XKSA 4GAJH 3SE8H 3V7AG 3B8SA 4B7LA 1U3JA 4OZHE 2KZWA 1FO0B 3T77A 4M7ZC 1BMGA 1W0VA 4M6NL 4YWGL 3ULUF 3BIKB 5J8OA 1OHQA 4Z0BL 1F6AA 5GIRB 3ARGD 1TTGA 4ZUTA 2YD7A 2H26B 5BZWA 5JIIA 1IAKB 1K8DB 1ZV5A 4ZSOE 3FMGH 3HNTL 1A6UL 3O3BA 2ZSWA