5KS9F

Bel502-dq8-glia-alpha1 complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
GVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSVAPGSDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 58
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07686 V-set Immunoglobulin V-set domain
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9F01
5AZEH 4M62H 1T03L 2IPTH 4NRYA 2X4SA 4NQVB 5DDHA 3CJJA 1I1RA 3PF2A 3S96A 5E95B 1Q0YH 5I6XC 4Z8FL 3U30B 4D9LL 3CFJB 5CCKH 3VXRA 2WSKA 4MNGA 5FGRA 2ADJA 3BDYH 5EC1A 5F21B 5F7UA 4X0KB 2VERN 1I8KA 1S7RA 1B0WA 3MV8B 3RBGA 1O7SA 4GUPB 3SE3A 1EXUA 4GG6B 15C8L 3QO0A 3GB7B 1B2WL 5C09E 1DQLH 4QRSB 3ARUA 5FECA 2MKLC 4JREC 3CAFA 3O3AB 2OZ4L 4BK5A 3T8XB 5TDNB 1YEGL 2WBJB 5HVHC 1N4XL 3KHOA 5JW4M 1UM6H 1WICA 2NY6D 3PL6D 5BOZG 4LSDA 1S7XA 1DFBL 3HC3H 1WZKA 4TNWK 2DQUH 5J8OA 3BXNA 1PX3A 1ZKAA 1DEEB 5IM7B 3KPPA 3V6ZA 5GGRY 2ITCB 3P11L 4HUNB 2UWEB 1AE6L 1CGXA 4QHMA 3BJLA 1Y6MR 2P49B 4UILL 4L5FL 1QVOA 4F9LC 3BOVA 4N0FB 1PW3A 4LOUD 5KSVB 5E00A 3F6LA 4WO4C 4HBCH 4U1HB 4HMCA 5I1LA 1BF2A 3BVNB 1D6EB 5KSUB 5D7IF 4I0PC 5CMAA 3QULB 1HHGA 1EO8H 4LPXA 3KG5A 1J0KA 1FZMA 4MDJA 2YOCA 5JDJA 4Y16A 1UZ6F 3WFCL 4B41A 5ICXB 5F89B 3AREC 1N26A 2V2WB 3IU3B 3WNMA 3V7AG 2P24B 3X11A 1LP9E 2R1YB 3RWFB 5FDWA 3MV9A 1AGFA 1R3HA 4KPHL 2DQGL 1CR9H 4LAJH 3IKKA 1OAQL 3EJYC 5HHQB 3MA7B 4WI5A 4LSUL 2HLFD 3MZGB 3ZT6A 1NMAL 2AXGB 4MD0B 4WIQA 5F9AC 2FLRT 3DSNA 1BQHA 3P9WB 5HYQB 5JLZB 4X6CF 5AAWA 5C0CE 5DEGA 3QCTL 4GAGL 1K8DB 4DZ8B 1NLDH 1RJZA 5EBWB 4NQEA 4Z7WE 5I1AB 4R7DB 1BECA 2R8SH 3GMNB 3RL1B 1WFUA 2RCSL 5A2IH 1C7SA 3KPRA 5HHNA 4P9HH 2APTA 5SX4I 2AK4D 4L29B 4MB3A 4ZAKA 3I84A 3U0TA 1SEQL 5CEZD 4R90H 1J0YA 3GM0A 1OTTD 4HJJH 1NSNL 2B2XH 3TCXA 3GHEH 2AKRB 3KGRA 3U4BH 5AG9A 4E41A 1ETZB 3KVQA 3WBDA 3B2VL 2D7QA 1ZGLA 2E7BA 4M00A 4XP9L 3QCUH 5CKGA 5LGKA 5C3LD 3O0RL 2RFXA 1UCBH 2AGJH 4P59L 3AM8C 1NPUA 5D1QA 2G75B 1EH9A 1MOEA 1T3FB 1MFAH 2UY7A 3WS6A 1HSAA 3G6JF 3QDMD 5F70A 5I73C 2JJSC 1A6VL 3FL7A 3B2VH 2N56A 2X4UB 4PB0H 1AO7D 5BZWB 3QRFM 2A74A 4YDKL 1FAIH 4M1GL 5EOCH 3QIUC 4HWZA 3NVQA 3O3DA 1IARB 4KHTL 2ADFL 1ZTXH 3S4SG 1I1FB 2VR4A 2Q7YB 2CLRB 3FONB 4P2QA 2E9IA 1CIUA 3GMQA 2A6IB 4FFZL 5IMLB 3IETA 4JFDA 1FPTH 3MJ8B 5I1KH 3TH4T 3UJJL 1TVBA 4PTUA 4E5XB 1FO0H 2XQBL 1JTPA 3RUGB 5H2BB 4WFHD 32C2B 4QOKA 1U8IB 3V8CA 1I7RB 1KUMA 5E1AA 5ADOL 3IU4L 1PFCA 3DMMC 1A3LL 1MCLA 4Z9KB 1BWWA 2HN7A 3CZFA 3QQ3A 4MMZC 4U3HA 4PTTB 1SMAA 2FWOA 4GG8A 3PWNB 4HIJA 5I1HH 4H88H 1W0VB 4J6RL 4JFOA 1PX4A 4HFUL 5TDPB 5J6GB 1I1AB 4M7KH 3HNTL 1HHHA 2NNAB 4LIQL 5EU5B 1CFQB 1QLFA 3VFUA 3BGAA 4U33A 4OZIF 2MKWA 3MRKA 1MRFH 1QO3B 1OARH 2DWEB 3U7WL 5EIQA 3QDGD 5GJTL 4GQ9L 2XKSA 1OL0A 3WDIA 5J1SC 4HUVA 1INEH 3QB7C 2GW5A 3JV4B 5JW5B 1BP3B 5K59E 1M7IA 2B7DT 1K8IB 1HQRA 2YUWA 4F7EA 1MIEH 3DRQA 1KNOA 4KGLA 5GJTH 5LAXB 3ZYOA 4RSVA 3C9NB 2R2CA 2YMXL 4P46C 2C3HA 3HC4L 1KTDA 5DMGD 4BSJA 5I16A 5I18H 4M1CD 4KI5E 5D96C 4TTDD 5ERWA 4R2GC 4JKPH 4TQEL 5DURB 4XNMA 3UC0H 1E6JL 4YQXL 1BGXL 1NUNB 1QFWI 5DGRA 5D1ZC 4Y4FD 4U0RB 3ULSB 1IGFH 4PJCE 4HFWA 4HULB 4Q9RL 3A6OA 5C08E 5FM4A 3ELAT 1BGXH 3V52L 2MQ0A 5HYFA 3HRZA 3BPNB 4PJGF 4XRCA 1TETH 2HTKC 3HZYB 1JNHB 3RWJA 2BSED 4Z77B 5JXED 1N6QH 5DFWH 5J13B 1NBYA 2XWBA 3D9AL 3MJ9L 3PXJA 5MENA 4LSVH 1KCKA 1BX2B 4J3SA 4PLJD 3ZSSA 3B9KB 1B4JL 5BS0E 4YBQC 3HI5H 3L3JA 3VXPA 2FEDD 4I77H 5I15L 4WW2F 1EHLH 3BO8A 4LLWB 5F6IC 4PRHD 2AQ2A 3BISA 4RZCA 3MLTB 1BVLB 2Y72A 4KZDL 2WINB 4DGIH 1B4JH 1F6AB 4R26H 3CSYB 2F5AL 4NQCE 1LQSR 1YECL 1OSPH 5FO9A 3V4UL 5ISZA 4H0HB 3S8WA 3RX8A 2NXYB 2YA2A 3HR5B 3MMEA 2Y6SD 4QCIA 1WV7T 4NGHH 1JUFB 2CK2A 3AVEA 4HK0A 1AHWB 2VN4A 4XPTH 1MPAH 4UIKL 1KCLA 2LABA 4DJMA 1JWUA 4GG6F 5FV2A 3LVEA 3KR3L 4HS3B 3QDMA 1J8HA 3SGJA 1UM4H 2Q76A 2QQKH 4ZO6A 3KYKL 2ZSVB 4LPYA 4OF7A 4Y5YB 1FVDA 1HYRC 3F7YA 2BXZA 3CH1A 4NZDA 4Z78B 1JE6A 3BWAB 4GT7A 1X5JA 1DUZA 5ETUA 4EXKA 5ESQA 1TVDA 4GRLD 1T7VA 1DQJA 2JIXD 1AIFB 2YWZA 1R24B 4YO0A 3IDJB 1J11A 2UWEF 3DUUB 4OUUA 5SWQA 2OJEB 4MNHA 5DUPL 4KRPC 4NNXB 4KK8C 3MODH 4L4TB 4V2BA 5DFVC 2VZUA 1W0WA 3N9GL 4JFHD 4AEIH 5CJQL 4G6MH 3BH9A 4LLUA 3QDJE 4HWNA 5JHLH 4ZFOL 3RKDD 1QHOA 1BOGB 3N1QC 4U1LA 2J12B 1G7JA 3D3VB 3LPGA 4MA7H 3BPLB 4L3EE 2YEZA 5AD0B 2IQ9H 5D2NC 1I75A 4JZJB 5IFAH 2GAZB 2D7OA 3QZWB 3B43A 1GIGH 2LVCA 3AS3A 5DFTA 4FOMA 4GH7B 4WUKL 4OI8A 3S3SA 1N0LA 3MRHB 5IF0B 3K8KA 1WGOA 3CC5A 3A0OA 1BF8A 1FG2A 1F4HA 5I8EB 3EZJB 5JORA 3WSQL 1HZHH 1ONQB 2JCCE 2VABA 4G9FA 4MSWB 5HGBA 3QDGA 3C60C 4PJFE 4Z0BL 2E7MA 4KVCH 4FFWC 2C7UA 2YPLE 1H3VA 3QRGH 3QHFL 1IC4L 1CGYA 3VWKD 3K3QA 2GSGB 4JO1H 1EGJA 2FIKA 4FFVD 1CU4H 1A7OH 1PLGH 4NO5B 1QUNA 2PW1A 1U3HD 2UUDH 4CMHC 4ONFL 1CK0H 4ZXBC 4GKOA 3CDYA 5T3ZD 4U6XA 4ALAL 2Y1VA 4TNWF 3OPZH 4OZFG 3ORJA 1HKFA 4TSBL 3CZJA 2EZ0C 1KPUB 1NGZB 4HIHB 3INUH 3UAJC 5IB1B 4Z95L 2VXVH 4ZOCA 1KENL 3RFZC 4YDIH 2IWGA 4HWBL 4WI7A 1OGAA 4NYLA 4N8CL 4HZAA 1EEUA 4G6FD 5FGCB 3CH8A 4XXCA 1GHFL 4TVPL 1C08B 4KK9C 4M61B 5KS9E 2FX8H 5IEHB 3WFDL 1V5JA 3KYMA 2VL5B 3SO3B 1YJDC 5HDBE 2BK8A 4QRTB 2C3VA 2PYEA 1AXTH 1OCWL 2X1OA 1RPQA 3MRGB 3G04A 4JY5L 1PVHA 2QSVA 2LTQB 1NCAL 4JR9H 1G6RA 3Q5OA 4JO3L 5GRUH 2Y7QB 3DX9A 1Q8MA 3T2PA 4AIXA 4PRHA 4XP5L 5DTFA 5F6HJ 4PGEA 4S2SA 3AAZA 3O41B 2P8MA 3IXAA 2X4OA 4G5ZL 5DK2B 3MR9B 1NDGA 2NXZD 2ZCLL 2ZWLT 4EI6A 5LXGH 5C09D 43C9B 4J8RA 1CLYL 1NC4A 2ZUUA 4QRUA 1S5IH 1RV6X 1U58B 2HVKB 2OBGA 3TN0C 3PHOA 3HG1A 5EU4A 5HY9B 4NKIL 3GMPB 3Q3GB 4TTGA 2HRPL 1B0GA 1KIQB 1E6OH 1CVSC 3QUXC 1FHGA 1BFSA 2ZOKA 5GJSH 1CLYH 2F53A 2GJJA 5MEQB 3CXHK 3SKOA 4NSKB 4F15B 4JN1L 4KROB 4NZRL 2Q87A 5D71L 4HIEB 3I3EA 3GBNL 3WL9A 4FQ2H 4NBYB 1KIPB 3LD8C 4BSVA 1YYLL 4J3WA 3RBSA 2ZUSA 1JWSA 4FP8H 3FN3A 5E6ID 4NHUB 1H0DB 3MCKB 4BZ1L 1XT5A 5DD5L 3OB0H 5GHWL 3NPZB 1EK3A 5LWYL 5KSAA 5F1KC 2ZPKH 5BV7H 1YYLH 2G5BA 5IMOA 3I50H 5KSBA 1UXSB 4JFYB 4H1LH 4QGTA 3MC0A 3WIHL 2H6PB 3SN6N 3LDBB 5CEXA 4YZFF 5KW9L 4U3CA 4LF3A 2NY1B 1V7MH 4O4YL 4ZUSB 3V0VA 4GFTB 1CE6B 3QEQB 5HI3D 1OAZH 3ARDB 1MWAH 1CFTA 3FOLA 5DWUH 4E9LA 5FHAH 4NO0A 2NY2C 4PRIE 4JHWH 5DJZB 1Z0MA 4NZUL 4PGBA 4UBDD 5C0CD 3WNOA 5E99H 2AP2A 5CJXA 5CJ5A 5KJRL 1Z0NA 1P4IH 4OZHA 5E2UH 2IJ0C 1WIPA 2A9ML 1KXQE 4G43B 2VLKB 1UH2A 3FZUC 4PY8J 1KF9B 3DBXB 1YNTA 2FO4B 3KXFB 4HGWB 4HF5L 2AXHA 5KVFL 3VWJA 1ZLVK 4G9DB 4KV5F 4ZFOB 1VENA 3BH8B 3LCYA 4XWGL 3C2SA 1R3LB 4NCDA 4BFEA 1BQLL 2VZTA 4PRBA 2DBLL 2X4QA 1ZSDA 1RJYB 4OLYH 1HILA 4YHYC 4NC0B 4HWEL 5AWNL 3M1BA 1TITA 2FECL 3VWKA 2EDRA 3IFOB 4NRXB 5IP4A 5CD5D 4WU5A 4NJ9H 3FO0H 4LLVA 1FRGH 4XHJD 1Y6NR 5GGVL 2PTUA 3NABH 4R97B 5AWNH 1HOCB 1KN4H 1VFMA 4PJHB 4OGAD 3H9SE 5JO5B 4YX2H 1GC1C 3DWTA 5DHVB 4XB7A 1XF1A 1QSZA 3HZVB 4PJDE 3STZA 5FUCC 3BZ4B 1DANU 3IFNH 3TVMC 2RGSA 2C1PA 5I6XB 4UINL 1FL3A 4ZUVA 1E4XH 2D31A 3ULUH 2NW3A 2FR4B 4LSSL 3OJ2C 2GK2A 2FATH 5DMIH 2C1OA 1KELH 4DQOL 2B0SL 1U8QB 2OJZL 3BE1L 4YR6A 4B7IA 3K2UL 2M2DA 2X1PA 1EA9C 4G8GA 1WFOA 3T3MF 4ORGB 4OZGE 1ZA3B 3QJHA 5TQ2H 5HYJB 4ZO7A 1HWHB 4KUZH 5IV2B 4PY7B 3NFNB 2CQVA 3JVGC 4OQTH 1OGTB 1J0IA 4HX1A 4ZPTA 3MO1A 4JREB 3U0PA 4HC1A 5HVHB 1OQOA 1GOFA 4FS0A 1C5CL 1G7MA 2NY7L 3BPCA 3FT2B 4M7ZC 3WD5H 4X99B 3OKEA 3SE3C 4YEFA 3L5WB 1TJGL 1TNMA 4AG4H 1OTSC 2J8UE 3TH3T 4OGXL 4Y5XA 3WLWD 5DJ8B 5FYKL 2A38A 4F33A 3MROA 1YNKH 3OKKA 1CGSL 1KXVC 5I75C 1YDPB 2R0ZH 5GS1C 5C09A 1KTLB 4WO4B 1C12A 1JPST 4R4BB 1YQVH 3GZKA 3T0EC 3MRBB 2MMXA 3NA4A 2P8LA 5EOTA 2ICWA 4I0PB 2GCYA 2JB5H 2YA0A 1WC7A 2R69H 4FNLH 3ARGA 5T1MA 3AREB 4JRYB 4Q58C 3F5WB 3C5ZD 3MLWH 4L9DA 3Q48A 2ZG2A 4Y7MA 4XT1C 3MRLA 3DSFL 3EFFB 1MFDL 2JF1A 2ICEA 4OD1H 1HH6B 4KI5D 1JHTB 4K8RD 3QH3A 1XR9A 4Y16C 5E6IA 3HB3D 1GGBH 2WIIA 2BNRB 5FKAB 1WCBB 4S11A 5GS0C 1DQQB 1JGUH 4H8WH 2R1WB 5FOJA 2R4RL 5IKCA 1YY9C 5H8DA 1T2QH 1PEZA 3IDIB 1NBZB 5C08D 2ZUYA 2XQYG 3D1MC 5LGJA 1MVFA 4OFKA 4JM2A 1JV5A 4HUXA 3GK8H 2Y4SA 1LP9A 2J88L 3VFOA 1E28B 1GZQB 3GMRB 3X12A 1WEJL 2AJVL 1U3YA 1UADC 1QYGH 4KMTL 1KCSL 3MXVL 4WEBH 2AJSL 4RBPK 3EO1A 5JHDE 2H9GB 1KLUA 3VXUB 4ONHB 4Y2DC 3DGGA 2NYYC 4GXVL 5J57B 4FZEL 2Z31A 3HE6D 1OPGL 4JANB 3DX6B 5BS0D 8FABB 2BSSB 2MQ3A 1G9NL 1A6UL 3QI9A 2ICCA 2W91A 5T1LD 1MHCB 4ELMB 2P5WB 4HJ0C 4Z7WA 4LVHC 4OLUH 1MEXH 1F2QA 4AEHH 4ZAKC 4KKBD 2BVPA 2XOTA 5I73B 1JPGB 2CDGB 4HDIA 3Q2CA 5JW3H 3QFDA 2PCPA 1S8DA 3LOWA 3QIBB 2XTJC 3HFML 1G9NH 2WWKT 3ZYIA 1A6UH 1NCCH 4YHIA 4NQCD 4PJIE 4H26B 1H3PH 3WCYA 3QIUB 5DJYA 2X4NB 1MFEH 1ZA6B 5D1QC 4KTEH 3UYRH 1P2CB 3A6CH 4FN0A 5GGSA 3RIAK 1IC1A 5C0IB 2XN9B 1CLCA 5T33L 4LPCA 1UA6H 4LLYB 4ORZC 4EDXA 1ZVSA 3CFEB 2BX5A 3G9VA 3W0WB 1BFOB 1FLRH 4KY1L 1XZ0A 3D85D 4A2MA 2O93L 2DQIL 5CHNA 2ZNWA 2G2RB 3DROA 3VDCA 1KEML 1NGPH 5LCVH 4JGMA 4U6TA 4XI5C 2XV6B 3JXAA 5SX5H 2EDOA 1R0AL 1P7HL 3ZTNH 3DMMB 3GSXB 2ICWJ 4XPBL 5IR1B 3G5ZB 3N50A 3WE6A 5JPMA 4QHLA 1XCQA 1NCTA 1SHMA 1YEJH 1QLRA 5I8KH 1ZHNB 5D1XD 3RVTC 1VEOA 5DD3H 2R0LL 4H0IA 4LKCB 5D6CA 3N0PB 4HJGA 4LLQB 1HIML 2XWJB 3T65A 5CFHA 4W70A 1LHZA 1F02I 2ATPB 4XC1H 3MLZL 2APXA 3VXTB 3QDJD 2EYTA 3MRJB 1YEDA 1BZQK 2DLIA 3PDOA 2Q8BH 4FQIL 2BVUA 3GSWA 1YMMA 1HHIB 5BVPL 1MH5B 4LK4A 2IADB 4ZOBA 4L3ED 4IDJL 3TEUA 3UTTA 4G6JH 1CD9B 1NUDA 2FJGA 1DDHB 2HT2D 5BRZE 1RK0B 1TTGA 1CT8A 2YSSB 2CXKA 4KKAC 4UT6L 1A0QL 2D7TH 5BVPH 3KHQA 4X4XB 3LRSB 2E3VA 3S4SA 4P46B 1U2CA 5I8OH 4YC2C 1IAIH 3B4NA 2JKXA 5D96B 4CVUA 5E5RB 4C57C 5I76A 3HAEH 4X8JA 4R2GB 1UFUA 4AH2A 3VXNB 1YJDL 2YBRA 5HPMB 3RAJH 1HEZA 1YY8A 2NTSP 3L3GB 5HHVH 5D1ZB 4YXLL 4XP4L 1VSCA 2YPLD 3I75A 1M71B 1BJ1J 1J1PL 3NTCL 2IEPA 4XBPA 3D2UD 1JFQH 5JTWA 1K6QL 3MV01 4YBLC 4P23D 1RUMH 4YFDB 3SJVA 4UMGA 3O81A 3BP6A 3NTCH 1QSFB 2VKWA 5I71C 3RWEB 1I9JL 2OR9L 4TUOB 3HE7C 1N5AA 2CR6A 4Y2DD 1OAXL 4CADB 1FG9C 1J18A 5GGTA 5DQJA 1A7QL 2QEJA 3LKOA 2LFGA 5C08A 5F6IB 2AJXL 2NW2B 3CFKB 2PO6C 2CMRL 3ARWA 1SYSB 1A5FL 3AS2A 3D69A 4BQCA 2HKFL 5DC4B 4HV8B 1OAXH 3BZEB 3KPMA 4ZTPH 1RFDH 4PJHF 4P2YA 3VGHA 3FQNA 4FFYL 3QQ4A 4ZFZB 4OCRL 3MRMA 1A1OA 4UQ3A 2FCBA 5D7LA 4OCSH 4DUVA 5LKNA 3CVIH 4AZ8A 3F65A 2FECI 2ZUVA 4W68A 2JELH 3CDFA 4RWYH 5ESAA 1T20B 3IS0X 1FORL 3NCMA 1SEBB 1MCRA 1A4JB 4JDZA 2CJUL 4MA3A 3T09A 4GBXA 1U8MA 1G7PB 5BW7C 1E4XI 1U8JA 1IRAY 3B5TA 4X6EA 2AJYH 3ZTJG 3MGAA 3T1FB 4NQCA 3NCFB 4I2XA 4OZ4B 5D7JC 5BZDB 4XPAH 1BFTA 2YHGA 1QSEA 5CD3B 1GAFL 2A83A 4ZSOB 1BBDH 5HDQL 5DMKB 1WZ1H 1IT9L 1MLCA 2DKSA 3LEVL 1MVUB 5D72H 2O61A 2HLAB 3CLEH 3SGJC 3BSZL 1L0XA 3MJGX 1LEIB 4KRPB 1LK3H 3D85A 4DFHA 4BH7A 1MCNA 1FBIL 3HA0A 1ZT4B 3PGDA 5DJ0B 1UACH 1YUHA 4GKNA 5FEBA 2W0PA 5KVGL 1YNLH 1XCTB 1NFDE 5D2NB 1HSBB 3MOAH 5TGBA 5IJVB 2Q86B 5IGXL 4BKLB 5B39G 1QZ1A 3TM6A 5EORL 4OT1L 1X6NA 1S7TB 4OF5A 1BD2E 1OW0A 1E4JA 4Z7UA 3O45A 4N0YH 2SEBB 2VDML 1U42A 5C07E 1CD1B 4KQ4H 5CJ8A 3O9WA 2DF3A 2HMID 3RPIA 3QDJA 3S98A 4CVZB 5IUSA 1LK2B 4NN6C 3VFGL 3C60B 3GSVA 1GC1L 3MXWH 4PRID 5EUOB 3T0VA 2CKBL 3FRUB 1RZFL 2OR7A 3SY0A 3FB8A 4KTDH 2DRUA 1T04A 1IKNC 1DVFD 1MJ7L 5KBNC 4IMLA 4OGYH 4H5SA 4GO6B 3E1F1 3VFGH 5BMFL 5DEFA 1U8PA 3V6FA 4CMHB 2EC9U 3PWVB 4ZXBB 5IQ7H 4XCEB 3O6ML 1NQBA 5HVWA 4DVBB 1AH1A 1U8KB 2EYSA 2D0FA 1IC5H 1XFPA 1CGWA 3T0BA 4M8QB 1S5HA 1T22A 5L6YL 1U36A 4PJFA 1BREA 4YHKH 4WDIB 1ZHLA 3QNZA 5F9DC 3QFJE 4D9QE 1CLZL 1Q94B 4K94C 1F3JB 1FFNA 4ELMF 5I74C 4QXTB 3FMGL 2DKUA 5IT2L 1QBAA 4U6VH 4PJ5E 3GSQA 4P23A 5ITBH 4J2XA 1S9KC 1KFAL 4OCLC 2DL9A 2NR6C 2OP4L 3H9SD 4GOSA 4JJ5B 5J6HA 3MRDA 5K9QG 1T0NB 2ZG1A 2BVOA 2DQDH 3B2UD 2FX9H 4MMXC 5T3XE 2OTWB 2XACC 4J1UB 4X5XA 3UZVB 4DZBA 3BD5A 1BBJB 1AFVH 4XXCC 4NFCA 4LCIL 5FYLH 3TA3D 1T1WB 1S7WA 2CD0A 1F3DJ 2OP4H 5DUBB 1NMBL 4Z7NE 4CNIB 4JRXB 1N6VA 3L3OA 1PD6A 4PBWD 3VE0A 2R23A 4XCYA 5KS9A 2HFFB 4TULH 1MCIA 4PV9A 4R8WL 2DQJL 3L3IA 4L4VB 2X4TA 3EYFB 5J06A 1V05A 3TN0B 2VLJA 2DYPA 4X6DF 4K71C 3R1GH 2YN3A 4OZFA 3IDYC 5GS0L 3QUXB 3MLYH 1KIRB 1KJVA 2BDNL 2P8PB 4LMQE 3BGMB 3RNQB 3O3BA 3UPRA 2OXHA 1KPRB 4NUJB 1DP0A 3PABA 1WK0A 5FK9B 5IB4B 5GRJL 4QRPE 4M5ZH 4R7NA 1RZIA 3RU8H 1VA9A 5E94A 3LD8B 5C0DB 4ODUA 2QSCL 4ZUWA 1GZPA 3MNZB 4GW1A 5IOPA 4TN9A 4XNQA 3BAEL 4XBGB 5TH2A 1X7QB 1V3JA 3V4VH 5L2JB 2YRPA 3W2DH 1UKTA 5L2KB 3T1WA 3SQOL 3FN0L 1ZE3C 4UDUA 4JAMA 3RIFF 3QJFA 5DVOA 4W4OA 4M4PA 3DTXA 3TIEB 5IHZA 5C0RL 1FVEA 1OLZA 4HXAL 2MHAB 1FIGL 4RAUB 3RIAF 1RURL 4C56E 4PJBB 2V2TA 5DJAB 4R4ND 5L0QC 2XXMB 5KSAC 5I1EH 3FN0H 3KS0J 1I3RB 2BMKB 2IFFL 5C0AE 1QQDB 3O2WH 4OKVA 3VDBA 2NY2B 4L8BA 2CGRL 1A6WH 1TTFA 2W60B 2E7CA 4NWTL 3S5LB 3TJHC 4GXUM 1NAKH 1TLKA 2A6KB 4MQTB 1JPSH 4H20L 1U3ZA 1KBGL 1RU9L 4OFPA 5BXFA 2DS4A 4FQPA 1IM9B 2VITB 2H45A 35C8H 3K4ZA 1N59A 3PWPB 2IQAA 2O5ZH 2F74B 3M8OH 4TRPH 5FF6B 2HJLA 4JQVC 5CJXC 1EDQA 2H32A 3G6AA 3MUGA 4BZYA 1D9KD 4X5WA 3PWLA 5EWIH 3VXME 4UIMA 4PRIA 1XF3A 4XMPL 3SDXE 4YHYB 1NGXA 2AEQL 1YPZE 4QTIH 5CINH 5B4MC 3VWJC 3O4LE 5CIPA 3C8KA 3QXDB 2XG4A 3NZ8A 4HQQL 4N5EC 3RWHA 5I66A 2IBZY 3V79C 3CLFH 2IAMD 5GSRA 2DLFH 4MHHI 1DE4B 4HIXL 1DUYA 2WIMA 2IGFL 3N85H 4U0QB 4U1MA 1RIVH 2EKJA 1KN2L 1RZ7H 3I02B 2CKBB 2I25N 2VDLL 3H9ZA 1RIUL 4NKQB 5JOFB 2GK0B 3TVMB 3SOBH 2QR0A 3UJIH 3SCMA 1AP2B 3DIFA 5CGMA 4YHZL 1KYOJ 5EO0A 3RWIA 3KJ6L 3U1SL 4NRYB 2C3XA 2X4SB 4OM1L 4PG9A 3VFRA 3GUTB 1KB5H 5SWSE 3VW3L 3VXSD 4K7PX 3WNKA 4NIKB 3H9SA 2HG5A 1KACB 1LD9A 5CKAA 1PSKL 4MNGB 5IG7A 2ADJB 2DM3A 5EC1B 1XEDA 4J3UA 3MUJA 3RTQA 4OBSA 5FCUL 2GY5A 2OM5A 4M7ZB 1OP9A 4H1LG 1EXUB 4IEFB 3QO0B 5AG8A 4Z0XA 5C1MB 2BHZA 4LCWE 5E9DE 5H35A 5J3HD 2NY5H 3NCEB 5FECB 5HHOA 4P5TA 3L7FA 1FSKC 5ANME 3MJ7A 5C0BE 3TZVA 2G60L 1QFWM 5DQDL 5I75B 5GS1B 1IGJA 3WJLA 3AB0C 4ODHH 4HK3J 1S7XB 3MCLH 3T0EB 4J4PC 2KH2B 4YFLF 3K80A 4GJTB 4YXHL 3KPPB 3V6ZB 1S3KH 4QF1B 2RR3A 4P2OD 1PAMA 2JB6B 4QHMB 4Y5XC 3ECBA 1QVOB 2CUIA 2DJSA 4HPYH 4U1SA 4V1DE 5DRZB 5BRZD 1BEYL 3X14B 3PGFH 5E00B 3C2AL 4NT6A 1HINL 5HD8C 4PS4H 2DI8A 4IOIA 1A7BA 1F4WL 4HSQA 4CN4A 3X3FH 3RL2A 3ZKND 4OLZH 3D39A 5CMAB 5D7IE 1TZGH 1HHGB 3ROOA 4NRZA 4Y19D 4MDJB 3JV0A 4Y16B 3ARGC 4M7JL 2R15A 1UZ6E 1XGTA 3RVUC 4XVUD 2V5TA 3HKFA 1MUJB 4WV1A 2IG2H 2A9NL 1CFVH 3MRCA 1EJOH 2J4WH 3X11B 1FZOA 3MV9B 1AGFB 1R3HB 5DVMA 1X5IA 1RULH 3IDUA 4OUOA 4U1IB 4XVTL 4M7JH 4XH2A 2HJFA 3BGFB 3VU2A 4G6AD 5F1OB 2OK0H 1KJ3L 3DGCR 4MA8L 4BJLA 1BQHB 2HRLA 4U6YA 4MVBC 2V5YA 2XFXA 4KI1A 4NZTL 5EBMA 4X6CE 4PIRF 5H37H 3V6OE 4D0DB 5F9OH 2YD9A 4Y89A 4NQEB 1UZ8A 4L1HA 1JNLL 1FYTE 1KJ3H 2AJUH 4JM2C 3H0TA 5M94B 1AI1L 5CEZH 3KPRB 1HH9A 3V5DB 2BNQE 5HHNB 5DUMH 1BVKB 1NCBH 1E4WL 3IAQA 4LVHB 4NDMA 5I19L 3QPQC 4ZAKB 4XGZB 3MRIA 2VLME 3ALWA 3VFNB 3HNSH 5E2TL 4E41B 2XTJB 1TCRA 4XMLL 4IIQA 2Z31C 4X4ME 1I9IH 1D9KA 5JHDA 3QI9C 3C6LA 2E9WA 1KCRL 1NGWA 3W82A 5D1QB 2AXJA 4OAWA 3BZFA 5EU6A 1IVLA 1HSAB 3MA9H 1T80A 2LVEA 1GGCH 2QHRH 3EJZC 3LHPH 4NHCH 1KTRL 5DHYA 5DD1L 1HHKA 2A74B 4TUKL 2IAMA 1P4LB 1ZWIB 1H15A 3A67H 3MRQA 4HWZB 3O3DB 3EGSA 3LEXA 3IJHA 3NIFE 3MLXL 1DR9A 2XA3A 1JPFB 3VG9C 4UV4H 3IETB 4JFDB 3P73A 3SKNA 3N1PC 1TVBB 2C4XA 3SDDA 1F6LL 2Z92A 3LIZH 4PTUB 5AUMA 4Q9CA 2B1HH 1HYSC 2XWTA 6FABL 3MTRA 4QOKB 1BFVH 4KU1A 1G7QB 2BVYA 4ZD3L 1UJ3A 5JW4N 2B1AH 3FQWB 3CZFB 3QQ3B 3ZSTA 4APQA 1QEWB 2BHUA 5I30H 2CRIA 2UZXB 2BFVH 2FWOB 4GG8B 2FJHA 1DQDH 3RRQA 1ACYL 4JFOB 1OB1B 2C26A 4NWUH 3GFUA 1TJIL 1T0PB 2YZ1A 3FFCE 4S1QH 3WN5C 5JQ6L 1EGJL 5K59F 1HHHB 1JVKA 1QLFB 3VFUB 5HI4C 3SDAD 4FG6C 3TPUA 3P4NA 4K94L 5ALCL 4OZIE 2RB8A 5IVZB 4DVRH 1BD2D 3SGEI 3MRKB 3T77A 3QQ9D 4NBXB 4LEXH 4Q97A 1HHJA 1DQTA 4PJBF 3C6SA 5C07D 2NY4C 4YC2B 1EGJH 1JGLH 3GGWA 1IGYB 2VLRA 3OKNA 3VMPA 1VADA 4EDWL 3L95A 4LVEA 2GI7A 5JR1L 1HQRB 4I4WA 5I0DA 4F7EB 3DRQB 1KNOB 4PJCF 1R5WA 2Q20A 1IEAA 2W9DH 3IYLW 4RMWA 2X09A 1CZ8L 1KTDB 1OP3K 5I16B 2VC2L 4V2CB 1WTGT 5ERWB 2UVEA 1OAKL 4YBLB 1PZ5A 2R2EA 1JNNL 4XNMB 3I9GH 3QP3A 1G84A 1XF2B 3VH8G 2P5EE 1BJ8A 4I9WE 5JUEH 5E08L 3LB6D 5I71B 3JWDC 2JK5A 3HE7B 4HFWB 1EX0A 3SDYH 5A2JH 2EIZB 5FHBH 1A6TA 1G6RL 2HFGH 2AI0H 3QFJD 4D9QD 3LQAH 3P9LA 1MQ8A 2VAAA 3HRZB 4IBLT 4POZC 3ZHLA 4XRCB 3ULVE 3NCYP 3L7EA 5EU3A 5B38G 5HVGB 3O6KH 1FZJA 2PO6B 4L3AA 1NBYB 4I0CC 3R0MA 1MNUL 4PJ5D 4HK3N 4K2UL 2PR4L 4Q0XH 5MENB 3P0YL 5HHXL 1BAFL 5F88A 4HUUA 3QO1A 3MV11 1QFUL 2F9BT 3L3JB 1MJ8L 3VXPB 1WWBX 5F1NA 3TNMA 3JTSB 5T3XD 5D2LE 5I1IH 4RZCB 2PW2A 2EXYD 1FNFA 5DRXB 2CK0L 1WZLA 4ODSL 4HXBH 2WMPA 1IC7L 1JJUA 4ONOA 4P9ML 1QFUH 1LO3L 4E42A 3UYPA 4F37F 1VB9A 5DT1H 4ZS7L 5ISZB 1EEZA 4J3VA 3H7BB 3MMEB 5IFJA 1IGIL 2IH1A 4QCIB 2CIIA 3QHTC 1IKFH 4M03A 5D7JB 4F9PA 3LKNA 4HK0B 1JGDA 1YEHL 2Y06L 4GBXC 2KUTA 3MV8E 4UTBH 2N7BA 1JWUB 2NLJA 4GG6E 2Q6WA 2A2QT 1J8HB 2VISB 1CFBA 1XGRB 4ERSL 2Q76B 4XWOD 3S35X 3H2WA 2IH3A 4NJAL 5E6ZA 1FVDB 3TNNA 3V0WH 3HAEG 3F7YB 5FGBA 3CH1B 2J1KA 4WHCA 4QRPD 5CBAA 1UWEH 5IBUB 3TBSA 3BHBA 2F58H 1DUZB 2X4RA 1QBBA 2EC8A 3VRIA 1ACZA 1D5ZA 3CVHB 3G5VB 1DQJB 3FAWA 5INCB 4L4JA 2UWEE 4OUUB 5EIVA 1F90H 1YMHA 2ZUXA 4HPOH 1W0WB 3VXQA 1H3GA 5AYUL 4MXWL 5FUOH 3BH9B 5IVNA 4LLUB 5GISL 1TQBC 4PB9L 3CD4A 2AK1H 4ZPVA 5F7NC 1ORSA 2DTML 4WY7L 1G7JB 4C56D 2A73A 4ELKA 2JCCF 2IANA 3SDCC 5LG1A 5KZCB 1DSFL 4FQCH 4NN6B 1WJ3A 5C0AD 5L88L 4Z5RA 1DLFL 4KJPD 4HUWA 3WO3B 4NO3A 3U2SA 1NFDA 2QQLH 3T4AA 1JCKA 4W6XB 3G6DH 5TE4L 3CC5B 3SDAA 4MXQC 5IQ9B 1BQUA 3OBAA 3C87A 3O9WC 1FG2B 4DKFL 4OSUL 5JORB 4MAUL 4NN7C 1ZLSL 4QKXB 1KJ2H 2VABB 4G9FB 5KANI 5HGBB 5ID0A 4JEGB 4QLRA 4CAGA 3PQYB 4PJ8D 2MPAH 4QXGL 3DHMA 2QQNH 4MCZB 3S88H 4QXUL 3VXMD 5T3ZH 3ZLQC 2FIKB 1IMHC 1A7NH 2EO1A 5C7XH 3GEWB 4OB5H 3GSOA 3QISA 4DN3H 1HI6A 5I74B 3O4LD 1Q1JL 5E24E 3BEWA 2DMCA 3SGDH 5CSZA 1PQZA 1JTTA 4U6HB 2Y07L 4A6YH 3BRFA 4KKLD 3P4MA 3OX8A 1CDHA 1IGML 3FQRA 5HDBF 4LRIC 1ZLWH 5EU7C 5B39A 2A6DA 2BY3A 1P5VA 2OCFD 4FQLH 4HC1L 4O2CA 2A77L 5EUKA 1OGAB 3UTSB 2PKDA 2H2PC 1VFAB 4I3SH 4X7SH 1IGMH 3E2HC 2DOCA 4GRMA 3G5XA 4GRWB 5JW4Q 2J6EH 2WW8A 4L1DA 3KYMB 1OLLA 4KKCD 5K9JH 3ARBC 2X9XA 3UEZA 1X5GA 2C3VB 3IKCB 2PYEB 1OAYH 2ILLA 5D5MA 1UYWL 4NQDA 2W9LA 4FQHA 3TBVB 3G04B 4M9PA 4U05A 5SWSD 5IBTL 1MRCL 2BSTB 2CPCA 1K2DB 5ECJE 2DM4A 4LSQL 1G6RB 4Z7QF 3U6RA 1DEDA 3EZ8A 2YD1A 4K71B 5IK3A 1QFPA 4PGEB 5DTFB 3WYRA 1ES0A 1U8OA 3IDYB 3KNBA 5F6HI 1FFOA 3AAZB 1GL4B 2P8MB 3DX8A 4WUUB 1NDGB 3BUYA 4LCWD 1B0RA 5E9DD 4EI6B 5E8DL 4L9LC 1WVZA 1GRWA 1NC4B 3Q6GL 3F7QA 3IXTA 4QRUB 4OD3L 3LSOA 5C0BD 3PHOB 5HGGS 3HG1B 5EU4B 1UWGH 3CDGA 1U93A 4XNUH 1EZVX 2WP3O 1B0GB 2YK1H 5C0GB 2MCPH 2H2SD 2ZOKB 2R2HA 4GMSL 3ALPA 1UCTA 2F53B 4LHJB 1S7UB 3SKOB 4JFED 1CDYA 2Z9TA 2MNUA 3HCVA 2CRYA 3ZE0F 5C0ND 4V1DD 3WL9B 4CDGC 5EZOL 3RZCA 3ZO0A 4O2EA 1LILA 4BSVB 4S0TD 5FXCH 1JWSB 2YXMA 5HDLA 3VA6A 1F97A 4HHAB 2DL2A 3K8LA 1AD0B 3HMXA 3LKPA 3U36A 1YEEH 2DQFA 1JGVL 4O51A 5L0QB 4IOFD 3L9RA 5KSAB 2DDQH 1K5NB 4OM0L 2P7TA 2QTEA 3WIIL 1DBBL 2CLZA 3ME0A 2D4FA 2G5BB 3PV6A 2DMKA 5IMOB 3LKQB 5KSBB 3G08A 2R29L 4W4OC 1TNNA 4XZUA 4WWKC 5CEXB 1NEZG 1MF2H 4GKSA 1UKSA 5C86A 1MCQA 3OAUH 3V0VB 1MCCA 5F3HA 4IS6A 1DBBH 2FZ3B 3WLBA 1MCOL 1XR8A 4YHLL 5I1JL 4KAQH 4JFPA 1CFTB 3FOLB 3HI1A 2JE8A 4NP4H 4NO0B 1BJ1H 1WWAX 3I6LE 2ITDB 3QG7L 1TFHA 1R3KB 3O8XD 3TJEL 2ENYA 1NGYB 4OZHB 3WIFA 1N2RA 4PD4K 2EH8L 1RZJC 1E0OB 2OSLA 3S34L 2XNAA 4GAYA 1MQKH 1I9RH 1NC2B 5I1JH 4OCWL 1YNTB 1FGNH 1FYTD 1I4FA 4PY8I 1JZ2A 3VWJB 3VI3F 5ABDE 2BNQD 2D03L 2X2YA 4KV5E 3TJEH 4EBQL 4O2FB 3RHWF 4JG0H 3ALXA 4M48L 4FTVB 3OKMA 4LCUA 4PRBB 1J7VR 5F7EL 4GLRH 4PGZA 4GQPH 2X4QB 1UB6A 2FNBA 4NKOB 2VLMD 2MCG1 1ZSDB 3RNKA 5KVEL 2BRRL 2AEPL 2I9LA 1M6OB 2YR3A 1LEKA 2WZPD 4JFFB 4X9BA 4EN3A 2VWEE 3FFDA 3H9HB 4OFYD 4XX1E 5TE6L 4LCYA 2E8ZA 3SDXA 4WU5B 2H1PL 4LLVB 3FCTA 5GRYA 1JZ6A 3OZ9L 3TT3L 5EPMA 2E27H 2FX7H 5SWZA 3O4LA 2GKIA 2JJUA 1P4BH 1WBZA 3UO1L 3P9MB 3ARBD 1IEBB 1U95A 3P0GB 2FBJH 1LGVA 3EJJX 4OKDA 1AQDA 3STZB 1HNFA 1I8IB 2YD4A 4P0DA 4NZJA 2C1PB 3VGAC 1KIUA 2LV4A 2NY3C 1FL3B 3MGTA 4PJAA 5E2WL 3SCMC 3CK0L 1FNAA 3U7YH 1C5BH 5IVXA 2NW3B 1N7ML 1T83A 4UZGA 3QEUA 3CMOL 5A40E 2C1OB 3LQMA 4HD9A 4JRWA 4YGAB 5FYKU 4QRRE 3GNMH 4YR6B 1A7RL 4X7DC 2VYRE 1KPVA 3BIAX 4X6FA 3GJFA 2W9EH 4G8GB 4RRPG 1C8PA 3VJ6A 3T3ME 4LDLB 3MREA 3WUWG 3QJHB 1JHLL 2ADIA 5DJ6A 3TBYA 1XH3A 3U48A 4D0BA 2EDXA 3MV7A 3ZZ1A 1NLBH 2Y9RT 4RMVA 4B53A 3LS5H 5E8EA 5F3BA 4K3JL 2EDBA 1FSKB 4HX1B 4ZPTB 3MO1B 4JPVH 1F2XK 5SWSA 1G7MB 3WMSA 3BPCB 4FQJL 1EVTC 3DVGA 1CTNA 5HBBA 3RTQC 4R0LA 5AAMA 3AB0B 1JHLH 2FD6L 2E7LA 2OTUA 1MAML 5T5FH 1UEYA 1Y18A 3OAYH 4IM8A 3QHZL 4JVPA 3JWDL 4BQ6A 5DLML 3CUPA 3FFCD 2YPKA 3HN3A 4P5TC 4Y5XB 4L4TE 5CZXD 4F7TA 3TZVC 4F33B 4KK5C 5GRXG 2GIYA 1HKLH 4WENB 4LCWA 5E9DA 1P1ZA 1MJJB 1WFTA 1C12B 2C5DC 4RWHA 4XP6H 4IRJA 5K9KA 1QD0A 3D3VE 1L7TL 1ZV5A 5C0BA 1VEMA 2P8LB 2ICWB 1F4XH 1MCPL 2GCYB 4MQXC 1X5XA 1CICD 2XZQL 3RDTA 2P1YA 3ARGB 4UB0H 3AU1A 4M1DH 5T1MB 3JBG7 1J05B 1P53A 5B21A 1FYHB 1QLEL 4K8RH 3ROLA 4S1DD 3OG6B 4M5YL 5DQ9A 3MRLB 1PG7H 1IAKA 4L8CA 4YDLC 2XY1A 2GEEA 4ZFFA 3PHQA 4V1DA 2YD6A 4OLVL 3QWRD 2QV2A 4MAYA 4YEEA 5GGTH 3QH3B 1AXIB 3D25A 3O6FA 4LRNH 1GPOL 1FFPA 2WIIB 4H1LA 2VB5A 4OV5A 1F58H 9CGTA 3VFPA 2P5ED 2R0KL 3LEYH 4I9WD 1MJUL 1RZKH 4LIQE 3RWCA 4MQ7A 1FV1B 2MFNA 5KG9A 4NM8H 1MWAA 2EDDA 4JM2B 1AJ7H 3GIZL 1ZS8A 5CSBA 3ULVD 3VFOB 1TZHA 4ENED 3X12B 2IPKA 2HJKA 2AV7A 3K7UA 2F54A 2PF6A 2YS4A 1FCCA 1KLUB 3EO1B 3VG0L 3NZHH 4EUPG 4Z7VF 4EOWL 3DGGB 4FABH 2AV1A 3SGDI 2Z31B 4FRWA 1KSRA 5LQBH 2H3NA 3LKSA 4P2RB 4X6CA 2FSEA 3V6OA 4LP5A 3QI9B 3EYQC 5FO8A 3U46A 4OLXL 5FGCE 1GH7A 4GRWF 2X5PA 1O7VA 1QNZL 1WAAA 3VG0H 3TT1H 4JDVA 2BVPB 5GSVA 1ZOXA 4P3WA 4HDIB 3MOBL 4MX7A 4QEGA 3QFDB 1S8DB 3C08H 2BY1A 4IIQC 1QA9A 4YHIB 4K7PH 4F58H 4UV7L 1OM3L 4EI5A 4HCRH 5TQ0H 5DJYB 3C6LC 3FRPG 1F3DH 3OAYK 4LNRA 3NAAH 4HT1H 5GGSB 3GSUA 1CFSA 4KVNL 4YH6A 5IW6A 5ESVA 5EOQL 2QLVB 3GHBL 3VG9B 4WI9A 3RVXC 4QY8B 4NQXA 3OF6D 4EDXB 1ZVSB 1IQWL 3MV8D 4RFEA 3G6JA 5ITFA 1QPPA 4N8PA 1DBKH 2Y36L 43CAA 1IFHL 2JLLA 5ILTH 2GTWA 2YKLH 3TV3L 3MLSH 2WBJD 1U8NA 3GO1L 1RY7B 3EHBC 2ICWI 3WE6B 4AMKL 5JPMB 3B9AA 5E1HB 3RI5K 1QLRB 2O5XL 2NTFA 1RUKL 1XIWA 1JRHL 3SDDC 1DBAL 1KT2B 3MOQA 1YEIH 3KPOA 4IDLA 1AGEA 1GCFA 4NO2A 3UTZA 3B5GA 4LQ1A 5INDB 4HJGB 1MREH 2BZDA 2Q8AL 5ADPL 3T65B 5ICYA 3MNVB 2XZZA 3GIVA 2EKSB 1PKQA 3EKCA 5HJ3A 2EH7L 3WDHA 5GS2D 4MJ4A 4APQC 1Z9SA 2EYTB 1VEPA 1RUQL 1YEDB 2X70A 2F19H 4P4KC 3CXDH 3GSWB 1YMMB 3VGGA 1RUAH 1Q9KB 2NY4B 4BZ2L 5ADPH 2H26B 4M6OL 5IW1A 4XVJL 1UWXH 3UTTB 4WCYL 3VA2C 4Q6IC 1LWRA 3V9FA 1CT8B 4P3CH 3SE8L 3TGXA 4PFEA 1CF8L 2QKIA 4DKAA 3S4SB 5A1AA 3BKML 3KS0H 4XPFH 4X9HA 1MI5A 3O6LL 2BOBA 5BVJA 4YGVA 2GITA 4NKMB 1DBMH 2YWYA 3QEQE 4X8JB 5I76B 3V5KA 4AH2B 5CGYD 2YBRB 4WW1A 4BELD 1HEZB 1YY8B 3MLVH 4AL8H 1A21A 2GJ6A 2Z91A 4YHMH 1I7UB 4U0RC 2DD8H 4PP1D 4M43H 4IRSA 5DYOA 4OZHF 4F7MB 2A6JA 2ARJQ 3EOTH 3I75B 4PGDA 1H3WM 5DD6B 1CL7L 3BQUA 3HZMB 3RVVC 2VLKE 1LO4L 5DR5L 1JPTL 3B9VA 3KXFE 5E4IA 1F4YH 1SM3L 3HUJB 3FT4A 1NJ9A 3SJVB 3GI9H 2BCKA 1FDLH 1T6VN 2E6PA 2V5SA 1S78D 3BP6B 3U9PL 3Q5TA 1EFXA 4OD2B 4HS8H 3P2TA 1D5BA 1T1YA 1TJHH 4ODVL 1LVEA 4YUEL 5DQJB 4J3OC 1AR1C 4JPKL 3H6JA 1UGNA 2D9QB 3LKOB 1DLHA 1JN6B 2V17H 1K85A 5CJOH 3D69B 3TO2A 3KPMB 3ZL4L 4PJGA 4ZDHB 4PJHE 3W9EB 4ODVH 2WQ8A 4JG1H 2BJML 1QR4A 4JE4B 5D9SA 4M6NL 1A1OB 1FE8H 1HCVA 2CRMA 2Y5TA 4OZFH 4UQ3B 5D7LB 3OJMB 2D9CA 2DMBA 4P9HC 3ILPA 3K1DA 5TF1L 4U1GC 5TPWH 3NACH 5DEZA 4WW2A 4JDZB 3WNNA 4DGVH 4MA3B 4YPJA 3UTQA 4GBXB 1U8MB 4Q7DA 3ES6A 3MRPA 3VH8A 4O5LL 4XMKL 5HYJE 3LH2L 2VXQH 3D0LA 4RIRA 1Q0XH 4X6EB 2FJFA 1ZLUK 4UOJA 5D70L 5FA4A 5HDOA 4C4KO 1S9YB 1OTUD 4NQVA 5C6WH 3WJJA 4I2XB 4XAWL 4F9PC 1JWMB 1QSEB 3TO4A 4LAQH 3ZKQD 3UJTL 1MLCB 1VGEH 4DAGL 2CSPA 5B38A 4F7CA 4G80A 2O61B 2GTZA 2M1KA 4F57L 4TVPE 4XC3H 1I1AD 3DV4A 3MV8A 1RZJL 4GUPA 2HT3D 4GSDL 1X5FA 5E7BA 1WCQA 1QBLL 3MACH 3PGDB 1TQBB 1CN4A 1FN4B 4TYUA 3MRNA 3K81A 3O3AA 4KHXL 4XPHH 3OSKA 4LQFH 1YUHB 3W5MA 3U0WH 4GSDH 2XZAH 3SDCB 4JZJC 5TGBB 3CSPA 4X4ZA 1CLOH 1ZANH 2BSRA 3PWUB 4JRYE 5IBLD 1C1EL 1HNGA 4GW5A 3D18B 2ITCA 4Z7UB 2QSQA 2UWEA 1AQKL 1I1YB 3O45B 2H32H 5DGQA 2DIAA 3FJTA 3O9WB 1T7WA 4YK4C 3T0AA 3ILQD 5IJKA 4P99A 4NN7B 3FTGA 3RPIB 3EDDA 5DURD 2BNRE 4U31A 1D6EA 4PLKC 1A6AA 3NH7L 5KSUA 4X4YB 2FGWL 3GSVB 3B9EA 4X7TB 3I6LD 4TPRH 1G0XA 1T04B 3MBEA 1VKXA 3ZDZE 2DQCL 2I07A 2X1QA 1MFBL 3LS4L 3HAEA 4H5SB 1MCWW 1Y6KR 5DEFB 3NH7H 1CGUA 3MLRL 1U8PB 4NNPH 3V6FB 2R1YA 4JM4L 5E2VL 2XTLA 3QUZA 4PJEA 3FN9A 5GGQH 3MA7A 4CJ0A 4PR5B 3IFPB 2DQCH 3CFIC 5TFSH 2EYSB 3QUYA 1KYOK 3VXUE 1S5HB 2CIKA 1T22B 5GIRA 3S37L 4OLWH 3B9KD 4PJFB 5IHUL 1YEKH 3SE4A 4OFVA 1YEFL 1ZHLB 2A1WH 1J5OH 1T6WA 4AEEA 3VFVA 4DZ8A 1AGDA 1FFNB 4MDIA 5CILH 4ELME 2P5WE 1Q72L 3W5NA 4CBPA 2Z4QB 3CFCL 2LE9A 3E2HB 3ZYJA 3GSQB 5T1KB 4ZS6C 4YHPA 4G6KL 4UOW1 1JI2A 3EBAA 1LO0L 3REVA 2CRZA 5J6HB 4RGNC 4POYA 3GMLA 4FQXA 1LEGB 3SKJL 2BVOB 2NXYD 3K46A 1M05A 1LNUA 3H3KA 4DZBB 5K33A 3BN3B 5IW3A 2XN9E 3EO0A 3EYSL 4RGMC 1NEUA 4GMTH 2HTLC 3W0WE 5FYJL 3L3OB 4O9HH 4YHOL 5JZ7C 4OTXL 4WWID 3S35H 3VE0B 2R23B 4XCYB 4XVSH 1HN1A 4MWFA 5D93C 3OXSA 7CGTA 3QNYB 2YD5A 4L9LB 1S7QA 4Z76B 3L3IB 4O58H 5D7SH 2X4TB 4I0KA 2VLJB 2VDPL 2DYPB 5JXAL 4OFDA 3LMJH 2KQNA 4P5MA 2VXUH 4W6WB 1I1FA 3I3DA 1NBVH 4KJWC 2UYLB 1QPXA 2XIDA 1KJVB 3N1FC 1T89C 2GSIA 1DANT 3KPQA 5E5UB 4S1SH 3O3BB 4I13B 3UPRB 2ZCHH 4L4TD 5KVDL 4E5XA 32C2A 3SPVA 1IJ9A 3O2VH 4WFFE 1U8IA 3BKJH 1L9NA 1IILE 3GSNH 4ODUB 4ZUWB 5IFHH 4O02H 3D3VD 2YD7A 12E8L 4GW1B 5IOPB 3WXVH 2KBGA 1JRHI 2OQJA 3CMGA 1KCUH 3PWNA 5FA3A 1H3UA 5HGDA 3ZHDA 5E56A 3QPXL 3D5OF 5JA9A 4UT9L 3E3QC 1CE1H 5E0QA 4UDUB 2AABH 4JAMB 5TDPA 1I1AA 5F93C 3QJFB 3RZCC 4JQIL 3DTXB 5IHZB 4LASH 1U91B 4WWKB 2OXGA 2EXWD 1CFQA 4JKWA 4TOYL 2DWEA 1LDPL 3ARRA 3L5JA 1N3NB 2EICA 4G8IA 3X3GH 3BN9C 5CBEA 4N5UA 2P4AB 2IF7A 4OKVB 1OHQA 2IFGA 1NCDL 3MYJB 5F8QC 4WTXA 1J1OL 2XA8H 2YPVH 3WHXA 3RJQB 1VERA 1DL7H 5DJXB 3QWOA 2XPGA 2XZCL 3DPBA 1CBVH 1K8IA 4XCNA 5BXFB 5FYKE 1YPZF 1CGVA 3OWEA 3HUJF 1N0XL 1NFIB 4XTRD 3GJEA 2IQAB 2Y23A 4JPWL 2OZ4A 1QSFE 2HJLB 2XKUA 4MNQA 3QUMH 2C3WA 3ZKSD 2VQTA 3G6AB 5T1DL 3T0XA 3PWLB 3NIGF 4UIMB 5FB8A 1XF3B 1A6ZA 4NKDA 1VGKA 5GRZA 1NGXB 1GJIA 5AZEL 1CL7I 4M62L 2IPTL 4OCYH 5CIPB 4JO2H 3RWHB 3FB5A 1Q0YL 5DC0A 1LE9A 5CCKL 4NN5C 4Z77A 1DUYB 1NKRA 3K74B 4ZS6D 3BDYL 1YN6B 2P42B 4DGYH 4U1MB 3O2DH 4MB5A 2V7HB 2PUQT 2J8HA 3BYYA 2R39A 4IOSD 4EN3C 4ZG1A 1NEZA 1D6VH 1KGCD 3RGVA 3VGAB 2NY3B 1DQLL 2QR0B 3ESVF 4DUXA 1EHXA 3SCMB 3DIFB 3CFDB 3E6FA 2E6JA 1WT5A 3TBTA 2X89A 2OL3B 5EO0B 3MLTA 2ESVA 3KPNA 4N0CD 1UM6L 1OOAA 3RWIB 2EDTA 2FB4H 4Y1AB 4PG9B 4B0MM 3HC3L 5J1AA 2DQUL 2EDQA 3GI8H 2APBA 1CXEA 1OT2A 4RAVA 1LD9B 5AZ2H 3NCJH 5IG7B 1T83C 1BPVA 4ZSOE 3HR5A 1VFBA 4EEEA 3RTQB 4HBCL 1T66C 1S9XA 5LGHH 1MIMH 3FQTA 2BOCA 2QBWA 3W11C 1AHWA 3X13A 5H35B 4DK6A 4QRRA 2X7LA 2IALB 1EO8L 4HZLA 5HHOB 4HS3A 4P5TB 3BI9X 3L7FB 4KROD 1P6AB 3MJ7B 1G7HA 3QIWC 3TZVB 4UUJB 3E0GA 4IJ3C 3O4OB 1VACA 4TSAH 2E7LC 5F72S 4Z78A 4PRNB 3B8SA 3PHSA 1CR9L 5D2NE 5F7DB 3IDGA 4LPVA 4Y4KC 3GMOA 2DLHA 4Z7UF 4RFOH 2OJEA 2V6HA 3ABZA 4ETYA 2ZCKH 3GSRA 4IRJC 4R96A 4IOIB 4YDLB 4MJIA 2NY1D 2QQQA 4HKBA 1NLDL 1L4IA 3HMWH 3D39B 3ROOB 4G7YH 4N8VB 1BOGA 1MLBA 3QEQD 5IWLA 3RDTC 3ARDD 4Q9QH 2R8SL 5EUOE 1H8OA 1XGTB 3KDMA 4XCCH 3VD5A 4RRPA 4P9HL 3WUWA 4GXUN 1H3XA 2WNGA 3MRCB 2AW2A 2EIEA 1FZOB 2GAZA 2XQYK 4R90L 4HJJL 4KXZI 2B2XL 5F7FA 3GHEL 1NH6A 1ZT1B 2VLKD 3L6FA 5HGAB 3U4BL 4LCCC 1P84K 4NOFA 3I3BA 4MAYC 3KXFD 2HJFB 3MRHA 5BV7C 2EEBA 5I17A 3O6FC 5M7QA 3QCUL 4GAFB 1JHKH 4U6YB 1UCBL 2XFXB 2AGJL 3DARA 4F7PB 4TVSa 4K9EH 1ONQA 5EBMB 1K4DB 1MFAL 3QDAA 5CLWA 2VZOA 3FO2A 3QWQB 1U92B 5DO2D 4ZYKB 1AXSA 4PB0L 1UZ8B 3LZFH 4FXLA 3GKWH 1C16A 3AMLA 5F97E 1FAIL 3H0TB 1P7QA 5EOCL 4LGPB 4R9HA 4PRPB 1KEGH 1ZTXL 2VQUA 1R6VA 3QIBC 3R0NA 3MRIB 5CP7A 1TCRB 1FPTL 4ODXA 4JZNA 4IIQB 5I1KL 3NIFF 5JHDB 2D7PA 4HIHA 1FO0L 3C6LB 5IB1A 2LU3A 1RJLA 4OAWB 3WFBH 3WFEH 1B6UA 3BZFB 5EU6B 1FP5A 2H8PA 2WUBH 1INQB 5DHYB 4JRXE 1LDSA 2WUCH 3CFBA 4KQ3H 3RA7L 4EI5C 1H15B 2RQ8A 3MRQB 5IEHA 5HYJD 3EGSB 3LEXB 3NFPA 4H88L 5DD0H 5I1HL 3IJHB 3PIQA 2VL5A 3VDAA 1RIHH 3QT2A 4QRTA 4L4VE 4OLEA 1PYWA 4M7KL 1QACA 2HP4A 3RA7H 3DO7B 1MRFL 3SKNB 1KB5A 1OARL 3SDDB 3IDXH 2Z92B 5AUMB 4TVPD 2XWTB 5HYSG 2DIBA 1TIUA 3ULUC 4U1JB 4EUPA 1E4KC 3RVWC 3K1KC 1INEL 1A2YB 1PJ9A 5DK2A 3S5LG 1IAOB 4M6MH 4WO4D 4YE4H 1KLGB 4YPGA 4FA8A 4APQB 1XIWC 1MIEL 4P4KB 2HVKA 3B83A 3ZTJH 3P30L 1MHHA 4BSWA 4I0PD 4CU8A 3NPSC 3PL6A 1ZEAH 3GMPA 3KPSB 1YN7B 5I18L 4AQOA 5EO9A 1KIQA 3MRRA 5JIIA 2WWMC 3FOMB 4JKPL 1S9WB 4Q6IB 5L2KE 2AJZA 3UC0L 3ARED 4JRYD 2KL6A 3TPUB 4M7LT 1FNSH 3FRPA 1FH5H 5A2FA 3P30H 3VCLA 2DLEA 4MJ5A 5E8OB 4MLIA 5ID1B 3F7RA 1F8TH 1HHJB 3C6SB 4PJBE 4PJ7F 4HIEA 1IGFL 2E9JA 3EJYD 1AD9A 1HK6A 2VLRB 4JPIB 1JGEA 1Z3GL 3QXVA 3EOBA 2OX5A 2BNRD 1V7NH 1VADB 3IAPA 3L95B 4U1KA 1TETL 1ERNA 1N6QL 4I4WB 4G3YH 3B8YA 2YA1A 1R5WB 2VQ1B 3DUSA 4JHAH 4Y88A 5L9DH 4LSVL 4KDWA 1Z3GH 4JFYA 2VRAA 2Z93A 2H6PA 3CSBA 1MHPH 2VDRH 5C9JA 3ULVF 1PZ5B 1ZGLP 3PWPE 5GZNC 4Y4HC 3HI5L 3PP4H 4KJQC 4OCXH 4I77L 1EHLL 4ZUSA 5GGVY 4IRSC 3DXAB 3ARDA 4G8EA 1K3IA 2JK5B 3VXUD 4MGXA 3KLHC 4M93C 3BQUC 4DGIL 2R56H 1DQMH 1FNGA 4R26L 4ZOAA 3P9LB 2VAAB 3ARFC 5D2LF 2P5WD 4H8WC 1OSPL 2Z35A 3L7EB 5EU3B 4X8XA 1SY6H 3DBXA 3OJDA 4LSRH 1P9MA 4NGHL 2AK4A 1WWWX 3NA9H 4JY6A 1GSMA 4NC2B 5T3XH 5F44A 4XPTL 1MPAL 1R3LA 5J9PA 4QRQA 1FZKA 4UAOC 2EC9T 3QIUD 5EULV 4DCQB 5FUCE 5F1NB 1U6AH 4UTAH 3TNMB 1UM4L 4F8TA 2QQKL 5GGRA 4U1GB 5DJCA 3IFOA 2HWZH 2XN9D 4NRXA 1QSVA 4KMLB 3BKCH 1JZ4A 4E42B 3SE9H 3W0WD 1CVRA 1D7FA 2CO6B 4EZMA 5EBGA 1JNJA 1BOYA 1AO7A 1QR1A 4PJHA 1EEZB 5JO5A 4ODTH 1L0YA 3MYZA 4MNGE 3U4EA 4PJ9C 1WIUA 3DMMD 3FAXA 4LVOC 5ACZB 1KXTB 4OIIH 1DZBA 3MODL 3BZ4A 1G9NC 2ZKHH 3CU7A 3LKNB 1JGDB 4AEIL 4G6ML 2L4OA 2B39A 3IS1X 2ORBH 3FB6B 5JHLL 2FR4A 2NLJB 5KAQF 1L7IH 2Q6WB 5GQBA 4ZTOL 25C8H 3EIFA 2PXYC 4MA7L 3HMXH 2WLYA 2ZOLB 3BW9A 2IH3B 2IQ9L 4MQSB 3WJJC 1H8NA 1ZA3A 5IFAL 4NC1C 3NFNA 4N0UA 4WFFD 1NUFA 5CBAB 3BHBB 1GIGL 1FO0B 4ZTOH 1A4KA 3T0EE 2X4RB 3VRIB 3VGBA 3AS1A 1M7DA 1EBAA 3FT2A 3W39A 3M17A 1HZHL 2M26A 2VH5H 3PP3H 4XB8A 1YMHB 5KN5A 3ZKMC 1YC8A 1A02N 4KVCL 5KOVC 2QADC 3WEXB 4K3EH 4BH8B 2MTPA 4U1NB 4P46D 4RNRA 3ARSA 5D8JH 5TE7H 3QRGL 1ORSB 4F9LA 2KQMA 2K9UA 2A73B 4JO1L 4YK4B 4WO4A 1CU4L 2IANB 1A7OL 1PLGL 4R2GD 2VDNH 4R4BA 4D3CH 1QP1A 3F7VA 5F8RC 2R4SH 3MRBA 4XPGL 1CK0L 5D1ZD 4Z5RB 4QT5A 1GGIH 1IGCH 4KRNA 4QTHA 1Z9MA 1Z9LA 3OPZL 3U2SB 5K9OA 4KDVA 3T4AB 3MV9E 3VFMA 3DRTA 1LO5A 4M8VA 3LKRA 3AREA 2I27N 5FYKD 3INUL 3GMMB 5DA0B 4XPGH 1IBGH 3QUKB 2VXVL 5ACMA 2HTKD 3EFFA 1G9EA 3WFHB 1HH6A 5ID0B 1F6FB 4YDIL 5JDSA 4YIQA 4ETQB 1N64H 1QSFD 3J8F7 3MBEC 4NQEE 4XNYH 4Y4FA 5FKAA 2FX8L 3ZE1E 3DV6A 4YBQD 3GSOB 5JIKA 1AXTL 4LARH 3KPRE 3WDJA 1HI6B 3QUZC 4PJXB 4LU5H 5HSFA 3V0AC 1RVFH 5CSZB 1D5XA 5B22A 4C83B 5A2LH 3QUYC 5C92A 5JXEA 2D7NA 4F8QA 4I3RH 3OX8B 4JR9L 2BVTA 4E41E 2XTJE 3FQRB 1K4CA 3MJ6A 5GRUL 3SE4C 5B39B 1TQCC 2A6DB 4O2CB 5E6YA 1RMFL 4WHYG 3GJFH 4RGNB 2H9GA 5E4EC 4HG4K 2K3TA 5EUKB 2DQEH 2V7NA 1FFRA 1WBXA 5LXGL 4JANA 5F9JA 4X5LA 1IZJA 8FABA 2BSSA 3MPCA 4GRMB 3G5XB 3F58H 1S5IL 3HHRB 1MHCA 1WLHA 3K4AA 2P5WA 4RGMB 4WNQA 4ELMA 3WIHA 1RMFH 5B3JF 3RUGF 4ONGH 3UTPE 5D5MB 5GZOC 1E6OL 2JJSA 2RJMA 4HKXB 4I18C 4NQDB 4FQXC 5D93B 5C2UB 4S1RH 4PUBH 5L7XH 3HNVH 1NL0H 5GJSL 3P0VH 2EIBA 4NM4H 4LNVA 3GBMH 4PGCB 3HI6H 4H26A 3H9YA 4JFDE 3S3JA 1QG3A 1FL6A 2J8OA 4Z7QE 2HAZA 3LAFA 4UU9A 4FQ2L 2YUZA 2KPNA 5C0IA 1ES0B 3QG6A 3KNBB 4DW2H 5BCAA 4DTGL 4FP8L 4C55A 1KCVH 4HKZA 4QOKE 5C0EA 4LLYA 3DX8B 4H25B 3TIDA 1MFCH 4QGYA 1B0RB 3CFEA 3DETC 1BFOA 4KRPD 3F62A 2BP3A 4KK8D 5I1CH 5DFVD 3LSOB 2ZPKL 1MRDH 5JW4R 5BV7L 3CDGB 1U93B 3I50L 4Y5VA 4DTGH 4Z7OF 2A0LC 2Y5EA 3GSXA 4L3CA 4AM0A 5IR1A 4N0RA 3V4PH 3NCYS 2WBWB 3MSPA 1T5WA 4X6DA 1V7ML 2NZ9C 5EZIH 2WP3T 4GRLA 5C2BL 2JIXA 2UUDK 3REWB 3TYGH 1NAMH 1OAZL 3JWNC 2EECA 1MWAL 3HCVB 5DWUL 3S36H 5I1GH 5FHAL 3ZE0E 4JHWL 3RZCB 4D94A 5E99L 3Q1SL 2NX5B 5CUSH 1P4IL 3VMOA 5E2UL 5CSGA 5C2BH 3MBXH 3STLB 1A3RH 2BNUB 4MJ6B 3LKPB 3U36B 3VXTA 3MRJA 2DQFB 3VD9A 4O51B 3L9RB 1ZT7A 1JMXA 1UQSB 2P7TB 3C60D 3RPKA 5DRNA 2CLZB 3D48R 2IADA 2XYCA 4FFWD 3VRJA 5A3IC 3G08B 2AEIT 3Q1SH 3TWCH 1CTOA 2I5YH 4QWWC 5EO1A 1RK0A 4GKSB 3ARXA 2YSSA 3DVIA 4X80H 1LO2H 2YD3A 4OCMC 4LSTH 2CDEB 4OLYL 5F3HB 4IS6B 3WLBB 5EFIB 4ZXBD 2XG5A 4G7VH 3HI1B 3QDHA 5H94A 1EUUA 1OAUH 6CGTA 2EZ0D 4ZO9A 4NJ9L 3VXNA 2VR5A 3FO0L 1FRGL 1IGTA 5F7HA 1QRNB 4ZNEA 3L3GA 3P40A 3UAJD 2OSLB 1LE5A 2XNAB 3NABL 4GAYB 1KN4L 1KJ2A 3DVNB 4QHNA 4YX2L 1I4FB 4WJ5A 1BM3H 3TBWA 5LJYH 3VI3E 4P4RA 2R0WH 3IFNL 4JFZH 4OF3A 1U3HA 1NCNA 4KK9D 5DJDB 4PGJA 1E4XL 3OKMB 3C8HA 4LCUB 5MENE 4NN5B 3ULUL 2FHBA 1NANH 4K55A 1UB6B 3L5XH 2FATL 5DMIL 3RNKB 1KELL 2VR9A 4WGWB 1QSFA 4F2MB 1SBSH 3HC0A 1LEKB 3RWEA 1D5IH 4TUOA 2ZJSH 1ITCA 3BYTA 4EN3B 1QOKA 5F7KC 4LCYB 2YUVA 1I7ZA 2V5MA 5TQ2L 1W72H 4CADA 5J4MA 4KUZL 5F96H 4A6YA 2R2BA 3VXOA 3FCTB 4OQTL 2APWA 5EPMB 5IBUG 5SWZB 1CS6A 4JRXD 1WBZB 1FIEA 1PKOA 1UXWA 3MGOA 3T4YA 3WD5L 1B90A 3LPFA 4KK6C 5MERB 1OVZA 4DN4H 3OB0K 3QEGH 4AG4L 3MGTB 5JMRA 4PJAB 2NY0C 4L4VD 2J6EA 2VE6B 1Z5LB 5IVXB 1C5DB 3TN0D 1CQYA 4WFGE 1CWVA 1WT5C 3QEUB 4JDTH 1YNKL 2R0ZL 5EB9A 3QUXD 1KPVB 4AK1A 3BEVB 1T20A 1J8HE 1YQVL 4EXPX 1IQDB 1J1XH 1G7LA 1SEBA 3MREB 2ADIB 4LMQI 1XH3B 2R9HC 5K9QI 4D0BB 3MV7B 3DETD 5F3BB 2P48B 5E8EB 2JB5L 5FV1L 1T5XA 2I24N 2R69L 4FNLL 3QIWB 4U49A 3I6KA 3BP7B 3OHXB 5J1TC 1JIBA 3SBWA 4HKJA 3DVGB 2E8YA 4IJ3B 5ALBH 3MLWL 1UM5H 2A0LD 3IDMA 2OTUB 4FQ1H 3T3PE 1Y18B 3NMEA 5DMKA 4OD1L 3CUPB 3I6GA 3VRLF 1R5VB 4HEPG 4WTWA 2YPKB 4DOHB 3EFDH 5L2KD 4Y4KB 3I2CH 1GGBL 2GFBA 1LEIA 4TSCH 1P1ZB 1JGUL 1VPOH 4H8WL 1MCJA 4IRJB 5MP6H 5K9KB 2XXCB 2VO5A 1WTLA 1T2QL 2MOVA 4RMTA 1CI5A 3QCVH 1R3IL 4PREB 2HT4C 4MYWB 1JF1A 1J88A 5IMKA 3TC9A 4TUJB 5K93A 3HPJB 3RDTB 2NY2D 3GK8L 1ND0A 3WFZA 3KWWB 3TFKC 1YQ2A 4BFIA 3R8QA 5IJVA 1QYGL 4RISL 1L6ZA 4KH2A 4WEBL 1RK1A 5DQ9B 4BKLA 4L8CB 1R3IH 2LU7A 3MFFB 3OKDA 1IM9D 4IRZH 4RX4D 5L8KB 3OB8A 2DAVA 3PHQB 5EZJB 3FZUD 4LCCB 5FM5M 1FVCB 3BGFC 2GY7B 3HPLB 2E5EA 2WK2A 2X1WL 4MAYB 2SEBA 5IWLC 4G9FE 5JIHA 5BV7B 4KDTA 3PWPD 3O6FB 1ADQH 3O11A 3PQYE 4H1LB 4RISH 4OV5B 4M7LH 3SKUD 3VFPB 4OLUL 4OGZA 3LV3A 4UT7L 1MEXL 2EYRB 4AEHL 2G9HA 2BVQB 3KLDA 3C60A 3VGEA 3IVKB 3ULVH 3WHE0 2E6QA 5JW3L 1YZZA 5C0CA 2FBOJ 3V5HA 1MWAB 1NCCL 3KYNA 4PJXF 5HTSA 1R3JA 1ZS8B 4JVUA 1H3PL 3M45A 2DI9A 1TZHB 4UT7H 1A22B 1J10A 1MFEL 2HJKB 4KTEL 2AV7B 2DQHH 4L8SA 3UYRL 3A6CL 3S3PA 3PWVA 2F54B 3EYUH 2B4CH 5I9QC 4L8DA 4KKNA 1HXYA 2YD2A 4DVBA 4Z7VE 1UA6L 2AV1B 3WHE1 4XNXH 4NPYB 1FLRL 2FSEB 3UTSE 3TVMD 5FO8B 5SX4H 3U46B 2HA1A 3WS6C 1NGPL 5LCVL 1S9VA 4MS8C 4GRWE 3BIKA 3BP4B 2VDKH 1F3JA 5BO1H 5IHLB 4QXTA 3ZTNL 2YUXA 5IB3A 1Z2KA 4RMQA 1G9MH 2AJ3B 2PYEE 5CS7A 1AKJB 1QA9B 2PTTB 1YEJL 2UZYB 5I8KL 3DVFA 1AY1H 4EI5B 5IEKB 3VXSE 5DD3L 4NUGH 5KTEH 5FO7B 3ARPA 4LNRB 1CXIA 4AJ0A 4JJ5A 1JBJA 1UC6A 4BA8A 1XGPB 3GSUB 4ISVA 5IW6B 5E8PA 1QKZH 4XC1L 3RX7A 2OTWA 4J1UA 4NQXB 1T1XB 5HI5C 4RFEB 4ZQKA 3ZT5A 2Q8BL 1T1WA 3WS3B 3G6JB 5DUBA 5EA0H 3QAZC 4QYOA 4WUUE 5ITFB 4HBQA 3HS0A 1OTSD 43CAB 3AXLB 3SEPA 3WO4C 1JZ5A 4G6JL 3HG1E 2W59A 1B6DA 4HIIA 1EPFA 5CEYA 3ZDYE 4HS6B 2NTFB 4LSPH 1XIWB 2D7TL 3EYFA 3ZKXC 3T0ED 1J86A 3BJ91 1FC2D 4LLAA 1AGEB 2F53E 4K3DH 4CW1A 5I8OL 1MCWM 4NO2B 3NPSB 3UTZB 1IAIL 5GGUA 5GS2H 3QUXA 4ESKA 1KIRA 4G42A 1T7YA 1Y0LA 1CXKA 1PKQB 2MQCA 3RAJL 3JWOH 4JZOA 1U3JA 5HHVL 2UZIH 1EUTA 3THMH 3U79A 2P45B 3PDGA 3D6GA 3AGVA 2NY5C 2YN5A 4XP1H 2NY6C 3PL6C 4Y19E 4KZEH 1JFQL 2DM7A 4Y16D 3MNZA 4JJHA 3DX7A 5GS0D 3DUHA 4XBGA 3HZKA 4B50A 1RUML 1X4ZA 3KPTA 3RGHA 1YY9D 3MV9D 3IFLH 5L2KA 4LOUC 3C5ZA 1MI5B 1IM3A 4U3XA 2HFTA 5BVJB 4YGVB 2RIKA 1UVQB 3KLSA 2MHAA 3V5KB 4ZOEA 4Y4HB 4WW1B 4PJBA 5HHMB 1V8HA 3UPAA 2GJ6B 5EIIA 4MXVF 5HYSA 3P77A 3H7LA 4IRSB 4OZHE 2BMKA 4PGDB 1QQDA 3OMZA 4XBEH 4M93B 4NQED 4ZTPL 3BQUB 1RFDL 3FO9B 2NYYD 3F6IA 4BFBD 1GOHA 4JGJA 3S5LA 2G5RA 1CXLA 1I85A 3ARFB 4PJCA 3FT4B 3KPRD 1QFWH 1MCHA 4OCSL 5F7YC 1NJ9B 4HJ0D 3E8UL 3FHQA 2HLFC 3WKMH 2BCKB 3CVIL 4FTVE 4ZAKD 5IB5A 3NN8A 3OXRA 1EFXB 5SX5K 1C7TA 2JELL 4RWYL 4FXGA 4UI2A 4E41D 1D5BB 2XTJD 4JFFE 1WQVT 3E8UH 4UAOB 4PRAA 2V2XB 3KPLA 2HKHH 1SVZA 1FNEA 1NANI 4HLJA 5D1QD 3HTLX 3HE6A 4LPUA 1DLHB 5BS0A 2AJYL 1NCWH 3BUTA 3OR6B 3P4LA 1P9MC 4YXKH 5T1LA 4PJGB 5DI8A 4XPAL 2CUHA 5FUZH 2HH0H 1BBDL 3QEHA 4XCFH 1JZ3A 1WZ1L 2O5YH 2Y5TB 1OTTC 3UTPD 1SMOA 5D72L 5DS8B 3ILPB 4OJFH 3CLEL 4HGKC 1FNHA 4XI5D 4PJAF 3I02A 4PV8B 4GAJH 4PJ9B 4LVOB 1LK3L 4JFDD 1VFUA 3WXWH 2I60H 1X5YA 3L1OH 4LHUB 3TVMA 3BDXA 7FABH 4HH9A 2ED7A 3UTQB 3RVTD 1AP2A 3MLUL 4HCRA 4IHOA 4G8GE 1DN0B 4X7EC 1UACL 2PETA 3TYFA 3D0LB 4QOKD 4CGTA 4RIRB 1RD6A 1O0VA 2PXYB 4ODWA 5FA4B 1YNLL 1KC5H 3GUTA 3MOAL 4OI9A 1MCBA 4LLMA 2FDBP 4I48A 3MLUH 3TO4B 1UG9A 4S0SD 4DKEH 5CZVH 3BKYH 2UY6A 3JVGA 2XRAH 4HLZG 4C4KT 5B38B 2DQTH 4F7CB 2X9YA 5MEOA 4FZ8H 4N0YL 4G80B 2GTZB 1T03H 5M95B 2VZ1A 4KQ4L 2J3SA 5D1XA 2UVFA 3DV4B 4X98A 4Z8FH 2L7UA 4D9LH 2DICA 4BUGA 4YDJB 4KKAD 3MXWL 2QADB 4EVNA 4AY0A 3K0WA 3MRNB 1IEHA 4KTDL 2PYFA 1W8OA 2VLLA 4KGJA 3PV7A 1EJ6A 5GS1A 5E5MA 4OGYL 15C8H 2X42A 3U83A 4GW4A 4K23L 1B2WH 3T0EA 2BSRB 4JY4A 5F1SA 4L3EA 2KKQA 5IQ7L 2OZ4H 4QF1A 4GW5B 2Z8RA 4Q9BA 3ZDZF 1YEGH 3PNWB 3AMKA 2JB6A 1BIIB 1N4XH 1PEWA 1IC5L 1EEQA 4YHNB 1T4KB 4YAQB 5DRZA 4K23H 3X14A 1DFBH 1BZ7A 4KTYA 3FTGB 4YHKL 3VD7A 1G7IA 3OV6A 4OCNC 5IIEB 1A6AB 5GXBB 3P11H 1AE6H 4UILH 1KG0B 3QXAA 4L5FH 2JCCA 1IZKA 4U6VL 3HE7D 3MBEB 1VKXB 2I07B 5EZLA 5ITBL 1MUJA 3HAEB 2YPLA 4JVWA 3VGDA 5DMGC 3D2UA 4U1IA 3QUZB 4M1CC 4YNYA 3MCG1 1SJVA 4PJEB 4RQQA 5FM5O 4TTDC 2PO6D 2DQDL 3QBTB 4ZUTB 3WFCH 2FX9L 1J12A 3OGOE 4NCC1 4AIZA 3QUYB 4WHTA 1AFVL 5DRWA 5MEND 3L3DA 3ETBF 4MCYB 5FYLL 2CIKB 4Y4FC 5GIRB 2HFEB 2EEAA 4QHUA 1TQCB 4KPHH 4P2RE 2DQGH 1F45A 5E2JA 1PZUB 4D0DA 1OAQH 3C5JA 5E4EB 1G0DA 1QBML 3VFVB 5FYJU 1AGDB 4LSUH 4MDIB 4Y2DA 4NQSB 1NMAH 4CU6A 1WAAF 2V9TA 4TULL 3NGBC 5JXEC 3DOSA 3V5DA 4P5KB 1BVKA 4ZUUA 5ACLA 3QCTH 4YHPB 3LQAC 1OSZA 1X5HA 4GAGH 1QBMH 3Q0HA 4XGZA 1X4YA 3REVB 3R1GL 4MB4A 3GMLB 3V7AE 3MLYL 3I85A 4FQXB 4I18B 3VFNA 4PLJC 5I1DB 5ISZD 1XF4A 4FQQA 3CCHB 1M05B 1LNUB 2RCSH 2FEDC 4R3SB 5D7JD 3EO0B 3QA3A 4WFGD 5ELIA 1KB9J 1SEQH 3PGCB 4WU7B 4M5ZL 1NSNH 3RU8L 4HUKB 4MWFB 1J8HD 1B4RA 4NNYA 1ODAA 1Q9LA 3OXSB 1F5WA 3UBXG 3X17A 3ULUF 4XP9H 4HH8A 1P4LA 1S7QB 2ZNXA 3O0RH 3Q5YA 4LKXA 5C9KA 1ZWIA 4P59H 1NBQA 3SGKA 4JFQA 3V4VL 3W2DL 5C6PB 2Y6SC 1JPFA 4P5MB 3MRFB 4WRLA 5EBLA 3EDFA 1A6VH 2N7AA 1CDIA 1TZIB 4LFHD 2W0LA 4YDKH 4XNZC 1SJEA 2GSIB 3KPQB 4M1GH 1A9EA 2APVA 5HGHA 4KHTH 3D87B 3JV6A 4GKZA 5I1EL 1TMCB 2ADFH 2DBJA 5LVEA 3SPVB 3O2WL 4Y5VC 1A6WL 4FFZH 5EH1A 1G7QA 1YMME 1UB5A 3UZQA 1NAKL 1JPSL 1INDL 2Z8SA 3UJJH 3FQWA 1G6VK 2ADGA 3UTTE 2CLVA 5KZCD 1QEWA 2XQBH 4GRLC 2OQJB 5FA3B 5HGDB 35C8L 2C4FU 4E0RA 1IAII 2IBGA 1NDMA 5ADOH 3IU4H 2O5ZL 1IAMA 1OB1A 3JTTB 1A3LH 3M8OL 4TRPL 1INDH 1W0YT 3FT3A 5EWIL 5IVZA 3RKDC 1PG7X 2E9BA 1V3KA 4J6RH 4G8IB 4G9FD 4QTIL 4LLDA 3DURB 4HFUH 5CINL 5CBEB 3HNTH 3WKNA 3PQYD 2W1NA 1IGYA 4LIQH 3WHXB 2I26N 3CLFL 3QWOB 3TCLB 2XPGB 2DLFL 3FB7A 3U7WH 5FOBB 4XCNB 2EDLA 3N85L 1DVFA 3HUJE 1RIVL 3LQZA 1RZ7L 4GQ9H 3GJEB 3IJYB 5F1IB 3SJVE 1PGRB 4YDVA 3SOBL 4MNQB 3UJIL 5C0JA 1J8KA 3NIGE 5FB8B 1XF2A 2NR6D 1A6ZB 2YMXH 4NKDB 3UYOD 1VGKB 3HC4H 3VWKC 4KJYB 3HE7A 1OGAD 4UQ2B 3DI2B 4FFVC 3UTSD 2EIZA 1KB5L 4TQEH 3IGAA 1E6JH 4WVRA 3FB5B 4YQXH 1II4E 1U3HC 3PJSA 3VFSA 3P4OA 4PRDA 1LE9B 4CVXA 1EAPA 4UNTA 3CX5J 2PO6A 2PYED 2X9WA 5D7LE 5DDHB 4Q9RH 1JTOA 5F9WC 1ZHKA 3S96B 5C70A 3V52H 2DN7A 3W9DA 2YXFA 1NEZB 1A9BA 3RGVB 3VXRB 1X4XA 2NY0B 2NY5L 4EUPH 1IE5A 4PJDA 3E6FB 4PYGA 3TBTB 2BERA 4CRPA 1I8KB 3JTSA 5C0FA 1S7RB 3D9AH 3MJ9H 4PLOB 5JNYA 3KPNB 2ESVB 3TA3A 5DRXA 2X4PA 2FLBT 1H5BA 4ODHL 4N9GA 3MCLL 5J1AB 4WUUD 1NGQL 1XAUA 5BW7A 5I15H 1NC4D 4RAVB 4I2XE 1S3KL 4OZGA 5IB2A 1QSEE 3HG1D 4NQTA 3TP4A 2HVJA 1FLTX 1MHEA 3H7BA 4HPYL 4WI8A 1VFBB 4KZDH 3PGFL 1S9XB 4PS4L 1NGQH 3FQTB 5D7JA 2BOCB 2F5AH 3BXNB 2F53D 3X13B 3X3FL 1YECH 2YC1A 4OLZL 4JFEE 3RWGA 1TZGL 4QRRB 2X7LB 3V4UH 1ROWA 4HZLB 3N1MC 5A16A 2VISA 1G7HB 4PLNC 2NXZC 1XGRA 4CDHA 2J8UA 3S9DB 3SBWC 5I1LB 2IG2L 1VACB 1DJSA 1CFVL 4FMFA 2COQA 4UIKH 1EJOL 2J4WL 5JOPE 1MFNA 1RULL 3KR3H 1FZMB 3QYCA 5KSAD 3IDGB 5EUOF 1NMCC 3CVHA 3G5VA 3KYKH 3GMOB 5INCA 2DB8A 2DI7A 2B5IC 2OK0L 4Z7UE 3GSNA 3TJHD 4U2ZA 5FDWB 3GSRB 4R96B 4MJIB 1S7SA 4HKBB 5F9OL 4WI4A 3G5YA 1XMWA 5E6IC 1MLBB 2AJUL 4NO0D 3U82B 5CEZL 3R4DA 3KDMB 1OWWA 5DUPH 5IROA 5DUML 1NCBL 5DEGB 3WUWB 3B3IA 3N9GH 5CJQH 5DJ2A 1RJZB 5J0BA 1T0MA 2KDGA 5IMMA 1NC2D 3HNSL 3L6FB 4HAFA 1IKNA 5B4MD 4KDTC 3VWJD 1I9IL 4PJEF 5I17B 5IQ9A 3D0VA 1I9EA 4N5ED 1BJMA 1MCDA 1EEYA 3U0TB 4FTVD 3JZ7A 5HI3C 3DHJA 3L3HA 3MA9L 3FO2B 1GGCL 2QHRL 2C3GA 5I9QB 3LHPL 4NHCL 5EU7E 3NCCB 1AXSB 3PQYA 4UBDC 4WUKH 1ZGLB 3QXUA 4MCZA 1C16B 4JFFD 1P7QB 3WSQH