1LO5B

Crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
188
structure length
188
Chain Sequence
b'TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal Structure of a SEA Variant in Complex with MHC Class II Reveals the Ability of SEA to Crosslink MHC Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 34
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo5B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1lo5B01
3OV6A 1LO3L 5J1AB 2AXFA 3EYUH 4MDJB 3T3PF 3A6BH 3CSGA 3FT4B 3NACL 4E42B 4HIHB 4OZFB 5D5MB 5C7XH 1JIBA 2LVCA 2AXGB 4XCNB 2XZCH 1U8JA 3FHAA 1WAAF 5C0AE 4OZFH 3ZKMC 3IXTB 1I9IH 1UFUA 4WFGD 2YMXL 3GSXA 3F7YA 5D2LA 4IRZH 4Y4FC 4M61A 4HWBH 1T4KA 1T5WA 4X4XB 1R5IA 5JDSB 1CF8L 1MCKA 2PTTB 1FYHB 4I1NB 4OCXL 3VXUE 1HHJA 5ISZD 2X89A 4XPFH 4PG9A 5B21A 4PREA 5FYKE 3TZVB 4RNRB 1FO0A 3GGWB 3JV5A 3QCVH 2Z31C 3CK0H 1LDPL 5M7QA 3STLB 4LDLB 4JFDD 2JB6A 3EDJA 3BSZH 1KT2B 4P2OA 1J0JA 5I2IB 1GOFA 4WDIB 1BJ1H 3BW9A 4L9LC 3GI8L 1Y6MR 2W9EH 1U8OB 4ZPVA 4YDKH 6FABL 1UKQA 5F1KC 3CX5J 3BPLC 3QUYD 3SQOL 3VWJA 4LPWA 1TVDA 3MV01 3QRGH 4OLVH 4QOKE 4YH6A 5SWSE 3QCTH 4GS7B 1FNGB 3VDCA 3QFJD 4U0QB 4PJDB 3QCUL 5DMGD 3BPOB 1D9KA 5GGSY 4UINL 5I75B 4HF5L 2X4OB 2NR6D 3QXTA 2BP3A 3ZTJG 1MFEL 4BUHA 5A2KH 3HC4L 3P73A 5JW3L 3EHBC 3HRZA 3ZTJH 3QNZA 3RGVB 5DJ6A 5JTWA 4N0UB 5GRUH 2MHAB 3RWDB 1QO3B 1MCPH 5IOPB 4P5TA 4OZHF 5CHNA 4J3WA 4XNYH 1K9TA 3HCVB 4OF3A 2A0LD 2DJUA 1D5XB 5DJDB 5C0GA 1LEGB 1Z9LA 4KH2A 3EYOB 2EEDA 4JKWA 1CICA 5CKGA 4JLRA 1VADB 3CXHJ 1ZA3B 2FL5B 3PL6B 2C5DC 1MRDL 2CXGA 5EOCL 2NY2B 4M6ML 2VDNL 2CKBL 5EU7E 1P4LA 2X1OA 4TNWK 2CDFB 4G6JH 1XGRA 4O00A 1MLCB 1I7RB 5J7CC 1S7VB 1U8LB 2H26B 5BXFA 3N1PC 5EBMA 5EBWB 5E08H 4X6FA 3RUGB 5J6HB 2PYED 2VLME 2CLRB 3QP3A 4F7MA 1IGCL 2ZCHL 2NY1B 5GS0L 2XA3A 4HPOL 5LG1A 4Q6IA 5IQ9B 3PV6B 1XZ0A 3K8MA 2EC8A 3M07A 4NKOB 4M6OH 2QQLL 3LKPB 5IHUL 5HVWA 4YIQB 2F58H 2IG2H 3PWVB 4PJ5A 3KJ6H 3O8XA 4MA8H 2YS4A 4H88H 2P8MB 4XHJD 5ETUB 2GCYA 2X4NA 3LKSB 1XCQA 4XRCB 1YY9C 1WVZA 4JM2F 1CFBA 2QHRH 2YPVH 4JFOA 4MD5B 4NN5C 4NZUL 4OZ4B 3VCLB 1IEBB 4OLEA 1SMAA 3MRGA 4PJCB 2GY7B 1EXUB 5JPNB 1OF2A 3IDMB 3H9ZA 4X9BA 3RQ3A 1JNNH 4WJ5A 1ZAGA 5D1XB 2VLRE 2H2PD 3MLYL 4KMQA 5IW6A 1C1EH 2GT9B 3UJIH 2ICCA 3BGMA 1XIWB 3DIFA 4JRXA 3O4LE 2Z92B 3WJLC 5KS9A 3T2NH 2BNQE 2NNAA 4X7SH 4Q9QL 1TZIA 1RJZA 2FJFA 1ZT4A 2XZQH 3C5ZA 3DMMD 3IAGC 1TPXC 1VEMA 4M5ZL 4UOJA 3V6FA 1TVHA 3PWPA 1A7PL 2JK5B 4QRTB 3WFZA 5T5FL 1WFOA 3HI6L 5C0NC 3HS0A 4YZFF 2WUBH 4EQ2A 1A7NL 3D1MC 1C5BH 2R2CA 2IH1B 3L7FB 4APQC 5E94A 4ZOCA 1CGUA 2DLHA 3O11A 1MLBB 5I30H 2BDNL 3VW3H 4YDIL 1KTLA 5B38G 1CIUA 1ZXQA 5T5NG 4MQXC 3HRPA 3SDDA 1ZOXA 5C0AB 4MJ6A 1PYWB 4WW2A 5F44A 2JELL 4PJHF 3RPIA 3D0LB 1FE8H 1RUML 2P44B 4PJAE 4K3GA 1DE4B 5JLZA 3UPAA 1D5ZB 3HG1E 4ODVH 3OKEA 4P2CG 4TULL 5F8QC 4JO2L 1FLRL 5JIIA 5F1NB 5IB1A 4AH2A 3OF6D 3C8HA 3SPVA 3TYGH 2XWJA 3EDDA 3GSQB 3VXUB 2AJYL 3VXME 4JY4A 5GGTH 1M71B 2EDJA 1UM4H 5FUZH 2X6MA 5HI5C 3ARGC 3WE6A 3QHFL 3B9DA 4WI3A 4QGTA 4PV9B 1SYVB 2BFVL 3SCMC 5IMLA 1KLUB 4KK9C 3VG0H 5EA0L 2I9TA 1KN2H 1S9YA 3BUYB 3LDBC 4Z7VA 2YPLD 4XAKE 3BPNB 5LAXB 2CLZA 3MNWB 4QF1B 4Z7OE 5KSBB 3U0WH 3Q2CA 4TSCH 1U93B 3JV6B 4QOKB 1YECL 1H3PL 4EUPA 1CXEA 2PR4L 4X6DE 1FNSH 1TNMA 3WD5L 4LLAA 3SKNB 4E0RA 4RWHA 3PWNA 4Y4FA 1AXSB 4J3UA 4G9FD 2Q7YA 4ODHL 4MJ5A 3BQUD 3QDGA 3JUYA 4TNVK 1EO5A 3VRLF 3MLVH 1HQRB 4NM4L 1YJDL 2KQNA 3WHE0 3Q6FA 4E41D 2UYLB 4HKBB 2XY2A 4Z0BH 1QRNE 2FRGP 1K3ZA 1X3DA 5TDPB 2Z31A 3LQAH 4N8PA 4MVBD 5D70L 1F5WA 1I3GH 1BFTA 1LWRA 3OZ9H 3IKCB 5CSGA 1EJOH 4IJ3C 1HSAA 4L9LA 2E7BA 2W07A 1T22A 4HJ0C 1ZGLM 1VGEL 2WANA 2AABL 3O2DA 4HX1B 1G84A 2F53A 2OJZH 2VNCA 1MFCL 1BFVL 2FX7L 2HKHH 1XF3A 4S11A 1IQDA 4P46B 5DFWH 2VXVL 1HHKA 2VAAB 3GRWL 3O41A 3CXDH 5HHQB 1ES0B 3M17A 3S88H 1X5ZA 2FATH 5TE4L 1CFSB 2YBRA 3CFEB 4CW1A 4Y4HB 5C09A 5CCKL 3MV11 5D93C 3STZA 3V0VB 5D2NE 1D3CA 4XC1H 4R8WL 4QLRA 3R1GL 3RWCA 3NAAH 4UU9B 3KPPA 2VLJD 3R06B 1A4JB 2J8UE 4S1RH 4XBPA 2OP4L 2VLKD 5KTEH 3O9WC 4EN3B 5ACZA 1JWSB 4M48H 2W1NA 2OX5A 3TZVC 3U4EB 4O02L 4PJDF 4JY6A 2NW2B 5HDQH 1G7HA 1GH7A 3PNWA 4DFIA 1DBMH 5MI0B 1G9MC 1PSKH 4LSSL 3PQYB 2XT1B 2PW1A 1Q0XL 5DMKA 4M7ZB 2R4SH 1ZT7B 3QPXH 4AQOA 1RQ5A 4UV7L 3HR6A 3WO4B 4G6KL 4NQDD 3MOQA 2EH7L 4J8RA 2FLBT 4J3SA 3KJ4C 5ESVB 5IEKA 4X7DC 4X6EB 2QQKH 1ZHNA 1MJJB 1EHAA 4Y4KD 4HXAH 15C8L 5FV2A 1WWWX 1DBBL 1F6LL 4NNPH 5JW4Q 4KMLB 1INEL 2BNRA 3BD5A 1EZVX 4LARH 1A6VH 3F7VA 3FOLB 3MUGA 1JBJA 1BAFH 3BXNB 3N1MC 1UJTA 1FSKC 2GY5A 1LP9A 1QEWA 4XZUB 1R3KA 4ZXBD 1J5OH 2ADJB 3CVIH 1FNFA 2E7MA 3B6SA 3KYOA 4HDIB 5JO5B 1IAOA 3WIIH 3I6KA 4HUWA 2PN5A 1JK8B 3ULUL 4POYA 4WENB 3W5NA 3QQ9C 4PV8A 1Q1JL 5FO9A 4GH7B 2WIIA 3DETD 4U1LA 1RURH 3ARDC 3MV9D 3T4AA 5A1AA 5DRXA 3RUGF 5ADPL 3LPWA 4LSPH 4Y19D 2EH8L 3HZVA 2ZPKL 4I0PD 3QHTC 3LH2L 2XOTA 3ZKND 4LFHG 4F7PA 1VFUA 3VFWB 4U0RC 3NZ8B 3MRPB 5MHSD 2VYRE 3CLEH 3HG1B 1G7MA 1U91A 3A67H 4HJJH 1NLBL 1BEYH 1ZSDB 5DJ2A 3BD4A 3E1F1 4LFHD 4WV1B 4QHNB 5TQ0H 3WJLA 4LSVL 4QEGA 2GFBA 1L9MA 3PWLA 4MZ2A 3VXMB 1U8KA 1NC2A 2VXQH 4HAGA 2YK1L 4IRJB 4BZ2L 4JDVB 1S5HA 4ONFL 4LVOC 4KRMB 3W82A 4XP1L 1NGXA 2VISB 3FRUB 4BH8B 5D71H 4KQ3L 4NDMB 4WWKC 2EZ0C 1V8HA 4AMKL 3QEUB 4PB0H 4HCRA 4APQA 1VPOH 1QNZL 4XPHH 2Y1VA 3RNKB 1FO0H 4X4ME 1J1OH 1D6VH 2X89D 3D85A 5IVXB 3RY5A 3MOAL 4JFXA 3WSQH 4X6DB 4ZD3H 4JKMA 1I8KA 1I9IL 2XTJD 4P3DB 1A6PA 4ERSL 4HGKC 1LE5A 5HHXH 2JLLA 2DQIH 4P2OD 5T5NF 1GIGL 3PABA 4JG1H 3QXAA 5J12B 1MRFH 3FZUD 3GMQB 3O45A 4WY7H 1D5MA 2QQNL 3CC5A 3VWJD 4XPFL 1NCBH 3MNZA 4CJ0A 3L5JA 4RDQG 1KEGH 2YRZA 4Q97A 4JPIB 1BZ7B 3MRLA 3IDNB 2R1XA 3DYPA 3FQXB 3QNYA 3SJVB 3KPOB 1T1YA 4LQ1A 3L9RA 5ANME 5HVGB 4NO3A 1CE6A 1N5YH 1D9KD 1JGLL 3JWOC 5HSFA 5F6HI 5DI8B 3H3BC 1T0PB 3U0PB 3FB6A 4ODWB 2XACC 1A9EB 1P5UA 3V6ZA 4CVWA 2GJZB 2FX8H 1N8ZA 2EDOA 3TJHC 1TJGL 1UG9A 3DVIA 5CEZH 4P5TD 4NHUA 2B4CC 3FMGH 3UTTE 4S1DD 4UB0H 5CEZD 1U58B 1UH3A 5DUML 1JE6A 1XT5A 4ZS7L 4D2NA 7FABH 1WUNT 1CICD 4KJQD 1RI8A 4U1HA 1ZHLA 2E7HA 5KSBF 25C8L 3FQRB 4RRPA 5C0CA 5T33H 3ILQD 3LKQB 5EBLA 5KZCD 1MCPL 2HFFB 1OSPL 5J6GB 2VZOA 3OKOB 2HMIC 2VXSH 2YC1B 3GMPB 4U7KA 2HTLC 5CBAB 2D4FA 3T4YA 4XP4L 1H5BA 1S78C 3ARBC 1A6TB 1ZV5A 3ULVD 1WBXB 3MLZH 2Z91A 1WTLA 3QRFM 1K2DB 2Z9TA 1L9NA 1JWMA 1T80A 4IDJH 4K9EC 4AIZA 2GK0B 3UTSE 4YO0A 3RZWA 1Y18A 4V2CB 2W0KA 5T3XH 5GJSH 4YK4C 3T8XA 1AGBB 3GSRA 4OZGF 3O3AA 1NBVH 4F3FB 1Z3GH 5KANI 4Y5YB 4P2YA 3IFPA 2DI8A 3OSKA 2M1KA 1RZ7H 1EHNA 1U41A 3NIGE 1BX2B 5C08E 4PJ5D 3HI5H 5BMFH 3GSNB 3DI2B 3O8XD 3K8KA 2VQTA 1F8TL 2BVOA 4XB8A 4UQ3B 4ZPTB 1YC8A 1IAIM 1G9NL 4V2BA 1JRHI 4OD2B 3GSNH 1NLDL 3BKCL 4S1SH 1LHZA 2HWZL 2RFXB 1OGTB 1DLFL 1OQOA 3O9WA 3S5LB 4ZNEE 5HGAA 2FHBA 2MKWA 5IESH 3LY6A 3TZVA 1EMTH 1IILE 1VEPA 5KVGL 2XWBB 4JRXD 1HIML 2EDBA 1GVIA 4WEBH 1BM3H 1BVKA 2NY4B 5KANG 1SBSH 3MBXH 1A7RH 1GZPA 1QA9B 3C5ZD 3F7QA 5GHWH 4NO0A 4DKAA 2QHRL 3PWPD 1NFDF 3QT2A 4LEOB 5E0QA 1S7WB 4OGXH 1LVEA 2VN4A 3EOAA 1JNNL 1UQSB 4GAJH 3IDIA 4JVPA 2R15A 2PUQT 5C8JB 4HK0B 3U7YH 2E9BA 3VFVA 3NCJL 4G8EB 5C3LD 3H42H 1FH5L 2P1YA 2I26N 2R0KL 1JRHH 4W68A 1KPVB 2MCG1 3INUH 3LIZH 3LQZA 2HLFC 2E9WA 2HJLA 4Z95H 3SDDD 1JUFA 1LD9A 3WFEH 3IF1A 2VUYA 3OKKB 4XMKL 2NZ9C 1DN0B 1T2XA 4D9LH 4PJXA 1AY1L 3F58H 1JTTA 4XX1G 2CSPA 4UTAH 4HUVB 1L0XA 5IB4B 3RIAK 4KVNL 5DRWB 4NKMA 4ZFFA 3ARDA 3V52L 4K3EH 4XMLH 3EFDL 5IOPA 2WUCH 2I60H 4R96B 4WI9A 1R3IH 5I30L 3FN3A 1RD6A 3NGBB 1KLGB 4LOUC 1TXKA 5H94B 1YPZA 4PRIA 1LEGA 3VGEA 2PO6B 2AK1H 3MBEC 5E8OA 3IDJB 2CMRL 1YQVL 4RX4A 3TP4A 4NQXB 1BD2A 5DD0L 1ZA3A 4ODVL 1IM9A 4JFQA 4XHQA 4WTWA 5T3ZD 1Q8MA 1I3UA 1YEJH 2IPUK 5C9JA 4Z7UB 1A14L 4EUPG 4JFHD 3I2CL 1TFHA 2J6EL 1HEZB 2I24N 4L8DB 3VXPB 4XNUL 4IOIA 1UM4L 3RVXD 1S7VA 3VH8B 5FUZL 4BA8A 1FORH 3ZKMD 5D7KE 3LEVH 3UZQA 2E7LC 5HI3C 4X7FC 4WWKA 3AC0A 4Y4FD 5ANMB 5I1LA 4X9HA 3QDGD 1PKQB 1NC4A 3GMRB 5AZ2L 1KN2L 5LQBH 1ZHBA 5IQ9A 4U6VH 1HZHH 2WSKA 1X4XA 4G8GA 1U95B 1ONQB 5MENA 1REIA 4LASL 4PRBB 3TCXA 5FYLE 4PTUB 1N2RA 2Z31D 4S2SB 5DS8B 4OZ4A 4FFYL 5FUCC 1ETZB 1I9EA 1IEBA 4PJCA 3T0AA 4MNGA 1NSNL 4BH7A 3QDMA 4JRYE 5EIQA 3MLVL 3UJJL 1RZFH 4MCYA 5D1XA 1I3VA 3OBAA 4Z7OF 1MFBH 2F53D 4J4PC 2Y07H 5IVXF 3C6SB 5DURD 1ZEAL 4Z0BL 3S34L 5SWZE 2DQHL 1A7BA 1Q9OB 5IW3A 3P77B 4H8WC 3AU1B 2VQUA 3WHXB 5E6ZA 3VGDA 4BFIA 3E6HB 3OZ9L 1XF4B 3X3GL 5C09D 1JNJA 2ADFL 3H3KA 4QRTA 4F7EA 4NN6C 3EHBD 2H1PL 3WFDH 1YDPA 4NQTA 3GBLA 3W0WE 1U8NA 1U3HC 3SDCC 1NCDH 4PJBE 5MEPA 1NCCH 3TH2T 1KOAA 3GEWB 4XWOC 3HA0A 5C08B 1K4DB 3S88L 3W9EA 1RHHB 3WIFA 4QHUB 1JHKH 3L7EA 1D5ZA 2ICEB 3HPLA 4MA3A 2OCFD 3QEHA 1PGRB 4C59B 3O3DA 3U7WH 3RI5F 2X1XR 3LPGA 2JCCB 1B2WL 3PXHA 3QI9C 3U0TA 3BIBX 5E2TL 4H20H 3MLRL 1TQCB 1WJ3A 2DL9A 4XCYB 2D2OA 3ARBA 3GDBA 2QBWA 4LU5H 3L3HA 2W92A 1AJ7L 4NUJA 1JP5A 1G6VK 3L3IB 4OGYH 4YBLB 5JOFB 4WFED 4L4VB 1T0MA 4PGJA 5LAXA 1MAML 1ZGLB 3JWNC 3CFBB 4M5YL 2AVGA 1MHCB 5HYJE 4GUPA 5FGBC 4OV5A 4HXAL 3VXOB 5DRZA 3EZJB 2Z4QA 1MFDH 1J8HB 2DQFA 2D7QA 2AGJL 5SWSA 2NY0B 4FQJH 3SKNA 3V4UL 1YY9D 1JGUL 3HAEB 5JOEA 4Y5VC 2DTMH 5D2NC 1UZ8B 4I4WA 1WBZB 4YHNB 1YYML 2FHCA 5FF6A 2OR8A 1JI2A 4QXGH 4QO1A 1SYSB 3QJFA 4NBXB 2HFEB 2L4OA 1GYAA 1NC2D 3ZE1F 1X7QB 5CMAB 3J8F7 4LSPL 4XAWH 3FO1B 1QSEB 1YMHB 2VZVA 2ZUQC 2X44D 2IBZY 2VZ3A 5EZJA 4HCRH 5C0ND 1CGVA 1CDJA 4XNMA 4HIJB 4Y5XB 4WU7A 2XFXB 4NGHH 4OJFL 1QOKA 4A2LA 4APQD 1R0AH 1CQKA 2NY6C 4OSUH 1XGYL 2YD1A 4GAYB 4MQXD 3D85D 4P4KB 5L7XL 1DUYB 3CFEA 4WIQA 1ED3B 2NCMA 3KPSE 4GBXB 1PY4A 1V5JA 1A0QH 1A6WH 2J1KA 1LEIB 1X5KA 2BC4B 3FFCE 1WBYA 3C8KA 1TCMA 3WFHA 1QACA 3GMLB 3QR2A 1Z2KA 1WGOA 1EFXB 1BF8A 5M94B 4NP4H 4W6YB 3TN0C 4LLQB 4UU9A 1A4JA 4MWFB 5DQ9B 4I0CC 2EC9U 4PB9L 3U4EA 1J1OL 5HI5D 3LB6C 4TPRL 3EBAA 1I8MB 4F7TB 3MBEA 4M00A 4JGMA 5GRYA 2CO6B 5E6IC 3M1BB 2KBGA 1KCRH 4KK9D 2Q8BL 3BKYH 5ESVA 5FYLH 4ZTPH 5HHME 4JRYB 4X6EA 5I1IL 1JPSL 1UJ3C 3DX8B 1SJEA 2VLRA 1GGBL 3IETA 1Q9KB 5F7WC 2GJJA 2AXHA 1HHHB 3P0YL 1T3FB 2J88L 5CIPB 3S37X 2BVEA 3O4LA 5SWZB 4RGMC 4J3XA 2BNQA 3B5TA 4HD9A 1S7TA 1VKXB 2YUWA 5IFJB 4CNIA 2E7LA 4KU1A 1A1NB 2DQEL 3BP4A 3U7AA 2DQUH 4K7PL 4RFNC 3GB7B 2FO4B 4RRPG 2IBGA 4NCDA 5I1KH 5J06A 3FCTA 4Z7UF 1DN2A 1N6QL 4DN3L 3SE9L 1JK8A 1IGTA 5LVEA 3FHQA 4G8IA 4LQFL 3VD7A 1BZQK 3QIWC 2CDEA 3RFZC 1GC1H 5GS1B 5I76B 4MNQA 4NHCH 5C0CD 5E8EB 5KVDH 2FX8L 5FHBH 5K9KB 3MOBH 5EN2B 1XF2B 4OD1L 5JNYB 5EIIB 1KCLA 1JFQH 4BQ9A 3CIQA 3FMGL 3TNNB 1CLCA 4PJIF 2ZUYA 5F7YC 3CVHA 4PJAA 3H9SA 3VFWA 2Y4SA 3NZ8A 5EU3B 5IJVB 4HJ0D 2ITCB 4LCCC 5JORA 4NQVA 1B90A 1JNHB 2GUOB 1WWCA 4J4PA 4WV1A 1SY6A 1M4KA 5A16A 5IJKC 1BQHA 1F90H 2A6JB 4NT6B 4N8CH 2GTZA 2YZ8A 4LLMB 3VFSA 3VXMA 3JBG7 2GAZA 3LSOA 3IFLL 3BPCB 1TZGL 2VXSL 3NCYP 3ULVL 1UYWH 3EW3B 1KCKA 5ICZB 2VERN 1H3GA 2YN5A 3D18A 4KTEH 3ZZ1A 3SKMA 3KPMA 3NTCL 1IGFH 5LGHH 4KJYA 5TF1H 5FA3B 4KI5E 2V5TA 2FJHA 1U3HA 1IGJA 1KC5L 1XGPB 2QJDA 5H37H 1CWVA 2HH0H 3DUUB 3TA3C 3CMGA 3WFBL 2QQQA 3O9WD 4FQHB 35C8L 1AKJA 2MMXA 3LN5B 1G9MH 1FG9C 1QLRA 4LVHC 3TZVD 1RZ7L 5ERWA 1JZ6A 5JIPA 3D0VA 3VFPB 3GIZH 4IRSC 4X6DA 5JHDE 4PRPA 3MRBB 4QRQA 4P3DA 3AY4C 4MNHB 2H8PA 1MNUH 2DAVA 4NO0D 1PLGL 2XNAA 4H1LB 2VWEC 4RGOL 2G75B 3DYOA 3KGRA 3W39B 2FH8A 1MPAH 4UUJA 1WSST 1S7SA 2P5EE 1QRNA 1A6AA 2DL2A 4M93C 1KN4H 4JJ5B 4F57L 3WN5B 4H1LH 3ARWA 4LLVB 5F6IC 4JPIA 4MQSB 4PGEB 2OZ4A 3FONB 4K8RL 1QHPA 3V79C 4I48A 4RQQB 5MP6L 2YRLA 4YHOH 12E8L 1YY8B 4NOBA 2JCCF 4HKJB 2DB8A 1G1CA 2X4PB 4PGDB 4PJ9C 3EOTL 1JPTL 5F3BB 4Z0XB 5ILTL 5JDJA 1LP9F 1MIML 4NWTL 4RFEB 2V7NA 4PJFA 3QA3B 3BH8B 5ENWB 5FGBA 2VXUH 4EVNB 4R0LB 1LDSA 2Y7QA 5HHOE 3VWKC 2B2XL 1JNLH 3ARDD 1MEXH 3CH1A 4JHBA 4JHWL 3D2UB 4OT1H 4WHTB 2X4RB 1FIGL 1RVFL 1MAJA 1H3TA 2CK0H 4RMVA 2D7PA 2E27H 4YHML 3BZFA 4PRID 4DK3A 1J1PL 4XP6H 1GGIL 2G9HA 3HNVH 5CLWA 3MROA 3FFCB 4Y5VA 4RX4D 5D2NA 1BD2D 1FNEB 1CD8A 2IPKB 2XN9A 2NX5A 1DQLH 1CE1L 1Q38A 3ARTA 1M7IB 4R26H 1IM9D 4JHZA 4Z7NE 3RTQC 4N0CD 4JREB 2J8UA 2EKJA 2R8SH 1QBMH 4XBEH 3V5DB 1G0YR 3OAUH 3V7AE 1QZ1A 3TT1H 2W59A 1IAIH 1X44A 3RIFF 1P69B 4JFYB 3RKPA 4EI6B 1F4YH 3UDWC 1E4XH 2HFGH 4NRYA 1I7ZA 5BOZG 1OSZA 1JWUA 3H7BB 1GGCH 3QH3A 4MHHI 4WWKD 1G7JB 1NEZA 3KS0J 5T3ZL 4GQPH 4FABL 2A77H 3C08L 1NC4D 1DDHB 3VGBA 5HHMB 1HXYB 1VFAB 4X6CA 1FVEB 3B83A 3WKNA 3P0VL 5CP7A 3MRMA 4PBXA 3V5KB 3V8OA 4G8GD 2ICWB 3O2WL 5MEND 1FAIH 4NYLB 5C0DB 3G6AA 3ROLB 3LKNB 2QV2A 2L7UA 1CFNA 1MJ8H 4L4TE 3D69A 4TVSa 5CINL 2R56H 3QUMB 4ZPTA 5ALCH 3JWDC 1GHFL 1FG2B 3GJFB 1MREH 1AO7E 3BN3B 3TN0A 3K1KC 5F9AC 1DEEA 4I3GA 3QDMD 1KELL 1U8MA 1OAZH 3MJ9A 5D1XD 4MHHG 3QUMH 1SJVA 3K0WA 4KKLC 2FYYB 2HLAA 2EO1A 4QHLB 5GGVL 4PRAA 1QLFB 1ROWA 1DQQB 5E2WL 5EC2A 5E5RB 3ZYJA 1MWAB 4Y2DC 3REVA 1TETH 1XF1A 1E6OL 4YC2B 3O6FB 3BGFC 5MEOB 3P9LA 5E6IA 4HFWB 1A6ZB 5GIRB 4GT7A 4AEHL 1QA9A 2XQYK 3MRRB 2YXMA 3HR5B 4K94C 5T1MA 2ZSVB 2V2XB 2OXHA 4G9DB 4UNUA 3RWGB 4U3XA 4MXWH 2HJFB 3LRGA 4ZDHA 2DKUA 1UJ3A 1J0IA 4Z7WE 3WKMH 2HYMA 3O2DL 4O2CB 1XMWA 4NNXB 2YUVA 4GW4A 4JQVC 1U2HA 3BIKB 4HK0A 1MFBL 4ZTOL 3LZFL 3RWHA 3T77A 3TJHD 1KPRB 1EVTC 2DLFH 5IFAH 1U8HA 2LTQC 2G2RB 3NCCB 4JPWL 5D7JC 1G7PB 4QY8B 4NQEE 1R3JB 5C07B 3Q5TA 4OCLC 1MHPH 2ATPA 3EIFA 1IEHA 4QRUA 3TPKA 3WNKA 5SV4A 1FC2D 4HUVA 3QIWA 1JMZA 3NZHH 1QD0A 2ZUUA 4KTDL 4N1EA 1NMAH 2ZKHH 3T65B 2HMID 4C58B 5H94A 2HTLD 5FYKD 3ESVF 1M6OB 1ORSB 5JMRA 4OCNC 1S78D 3ARBD 2WBJB 3TT3L 2C9AA 4KFZC 3UTPE 1YN6B 3RI5K 5IGXL 3V4VL 1BP3B 2MQCA 2YUZA 1LEKB 3MREB 4D8PA 2IFFH 3SE8L 4NQXA 4PJ8B 1T1ZB 2QADC 3AAZB 4KVCH 5IJKA 1WK0A 3NCEB 5DHYB 3V6BR 5HYFA 1PQZA 1G6RB 5KVEL 3AREB 2AKRA 4OUUA 1P4BL 3B9KB 5J89A 5GGUB 2IEPA 1YEDA 4DTGH 3ESUF 4CDGC 5FECB 4QOKD 4FQXB 5BVPL 1EPFA 1NMCB 5SWSD 5I9QC 4X80H 1VACB 4PP2B 1FFOA 4GMTL 1CLOL 1QSFE 1CD0A 3I75A 3BKJH 1DVFC 3GMRA 4WUKH 3KXFE 2IH3B 1YNTA 3MRDB 3PJSB 1AGEA 4I18B 4L29A 3TA3A 3L6FA 1CXKA 4GG8A 4P2RE 1I7UB 1U95A 5HHOB 5IIEA 4G43B 3I3BA 4PTUA 4S2SA 2AK4A 1JGVL 3UTTA 3PF2A 4JQIH 3OR7B 4Y89A 4AG4H 4ZFGH 4XBGB 1YEEL 2AXJA 3AGVA 4UIKH 3LMJH 1NGYA 3FO9B 5GRJH 3C87A 2YD8A 4ETQB 1RSFA 3UTQB 2YD2A 3H0TA 4FQCL 2OTWA 3MLSL 4UDUB 5CILH 4CL7A 2DTML 3GKWH 2X40A 1B6DA 2X70B 4X4ZA 2PKDA 4P99A 3S36L 5CEXA 1KXQE 3NIFF 4OFIA 5C0RH 4RAUB 3WHXA 3IJHA 2HLFD 4PRDB 2DIBA 4X5LA 3O2VH 4QYOA 3ZDXE 4X5XB 3OX8A 2D3VA 3V9FA 4ZSOA 2NZ9D 4PJ9A 2IADB 4LCYA 4LIQL 3DVGB 2F8VA 2VLMD 2FB4L 4HJGA 4X6BB 1UEYA 1S3KH 1P7KB 4HCRL 4RMWA 5F1IA 5C86A 4UV4L 3UTSA 3VWKA 5FM5O 1J0KA 1S7RB 1NAML 4ZUSB 3ZE2E 2ZUWA 4LOUD 3QISA 4NC1C 1DUZA 3X13B 4AENA 2F5AL 1E27B 1S9VB 3T0EC 5C08A 1K4DA 2ZOLB 2NTFB 2WAHA 5EOTB 5CAYB 3N1QC 4N0FA 2B5IC 1YPZF 3MBED 1I9RH 4L4TB 4FQ2L 5D6DA 4A6YA 1FCGA 2BCKA 1AO7B 5DXWA 2ZZUT 3ARPA 3BEVA 1JMXA 1C12B 3S4SB 3RTQA 4U1NA 2GQHA 2W0PA 4EJ1C 1EIBA 2OL3A 4GW5A 4ZNEA 2VLRD 2DQCH 3RNQA 4TSBL 1L7IH 4WHDA 1JPST 3UDWA 3O4LD 1R3LB 5EBGA 2BNQD 3CLFL 2QKIA 1TITA 1A4KB 4DVBB 5HI3D 3EAKA 3HKFA 5JOFA 4PJGA 5L6YH 2UWEE 4LGRB 1KIQA 4Z7WB 3CFBA 3VGGA 3OPZH 1PZ5B 5FV1L 1I7TA 4B50A 2H45A 4FZEH 4YJZL 3TBWA 4JN1H 3VXOA 1IEAA 4MNQD 2UZIH 3TF7C 2H6PB 4MLIA 3PP4H 3NH7L 1IC4H 5IFHL 4NQEB 4MD0B 5CJQH 3LD8C 5E4EC 3MR9A 4P57B 1DBKH 4FMKA 3H9SD 4J3OC 1BREA 3UZEA 3MXWH 1BQHG 5FYJE 5GGRY 4M62H 4H25B 4D3CH 3VFNA 1WBZA 2PYFA 3RL2A 4BJLA 3EJZC 4J4PD 4RMUA 1FFPB 4EI5C 5CEYA 2HA1A 1SYSA 1R5VA 4Y2DA 2Y5EA 3DVNA 3BGAA 3IS1X 1PG7W 1M05B 1IQWH 3MOBL 4U3HA 4KROC 3VXMD 1B0GB 4HMCA 1FPTH 3IGAB 5CSZB 1NFIB 5CMAA 3UO1H 3KLAB 3T04D 4B53A 5CBEB 1YMHA 1CT8B 1EEZB 4ZFOB 5LGJB 3HC0A 4D0CB 4Y5XA 1XGTB 3LN4A 4JQVA 2ESVB 3TLRA 2A6DA 2QR0A 4JN2A 2Z0BA 4OLWL 5JOPE 5IVZA 3BP7B 1LE9B 1OGAE 3RJQB 1U3HD 3MQIA 4CVZB 5DK0A 1W72B 5D7JA 5GGSB 3OJMB 3EJJX 4LAQL 3GSWB 4L4JA 5E9DE 4UAOC 1AKJD 4XWOD 4P4KA 5HGGS 1DUYA 2WQRA 4MZ3A 1N5AB 1ED3A 3U2SA 1AE6L 5FO7B 3MJ7B 4PRPD 4KKNA 2BNUA 1QSFB 1FJ1A 2A1WH 1I9JL 1AH1A 3N1GC 1EO8L 2ERJC 5TF1L 3SDAC 4NZRH 3UXFA 4OZIE 4MWFA 4RMQA 4P23B 2D7OA 1RJYA 4I0KA 4P2RB 1QRND 2OZ4H 5E8DH 5KSUB 3MV8E 4M1GL 1MCWW 3PDOB 2GSIB 4AM0B 1FCCA 3M1BA 3UP1A 2XG4A 1FN4B 5F7UA 3KLHD 3KWWB 3C9NA 1CL7H 1YMMB 1UENA 3IFNH 2HP4A 3QUKA 3Q0HA 5TDOA 3TIEA 4DKEL 3ARFB 1AI1L 3DX8A 4GRMB 5JA9A 4HS8L 3OR6A 2P43B 1U6AL 2MCPH 1NCTA 4K55A 3KNBB 4U1GC 4JANB 3IS0X 5CIPA 2IGFH 4XMPH 1ZLUH 3EYVB 3PG2A 5FKPB 3QQ3A 5I1AB 3WDHA 1TJIH 1NEUA 2CIKB 5SWQB 1ZVHA 2JJVA 4NBYB 5ITFA 5DJCA 1DVFA 1J10A 3EOBB 1MI5E 1WZLA 2XXMB 2Y5TA 2FO4A 5EO0A 5D9SA 5HDOA 3B2VL 4U1MA 3SGDI 3GMNA 2DICA 1AXTL 1ZANH 2XN9D 1QBBA 1IT9L 1UB6A 2NX5D 4YAQB 2JJSC 3CUPA 3W0WA 2GITA 5I15L 5KJRH 2R2HA 3MGAA 2VXUL 5E8EA 4GG6A 1F4WL 1MIEH 1FYTB 4WRLA 4PJBA 4G5ZH 1MUJB 1ZLSL 3QJHB 1ZT1A 3U30B 3OKMB 2H32B 3QBTB 5JW4N 1NEZG 1AC0A 4KTYA 5E2VH 1D5BB 1N64H 3KYKH 4YHIB 2B20A 3ZDYF 4XP6L 3MA9L 2NY5C 1YEHH 4F33A 5K9OA 1P84K 2R23A 1ND0A 1UZ6F 2OI9B 2DBLH 2H32H 3MJGX 4FMFA 5I8KH 2BRRH 1BVLB 3OJ2C 5DK3A 3TYFB 4KHTL 5FDWA 1N3NB 4QXTB 3X17A 2XY1A 4NUGH 2V5YA 4NJ9H 5DJZB 2P5WE 4YHPB 1K4CA 3FN0H 4G8FB 5J8OA 4XBEL 1FRGH 5F7DB 1NGQL 1N59A 2D9QB 3SGDH 3RWEB 5F3HB 2J4WL 4JZOB 1DBJH 1V3KA 2QSQA 5KW9L 4UBDC 1IGIH 1UKSA 4XGZB 1RIUL 2VDPL 5E2UH 4Z5RB 3FTGB 3MJ9H 3TN0D 5K59E 3KAAA 4RWYL 4K7PY 2V9RA 3CD4A 4F15C 4R2GB 3ZT6A 4FQHA 4JCLA 3U82B 1NGZA 5HYJA 5ID0B 4NQCE 4YEFA 3U9PL 4I2XE 5LBSL 3T0EA 1JHTB 3I3EA 3BKML 1MCDA 1T83C 1FAIL 2I07B 3VFPA 2B0SH 3BE1H 5HDBE 3BWUC 4CMMA 4B41A 2B8OT 1I1AB 3MRBA 4R6UA 4YNYB 5E6ID 4EDWH 3LKRA 1Z5LB 4DZ8B 5ALCL 5ALBH 5HHPA 1MREL 2VXTH 1ZA6B 4GXVL 3BT2H 3W39A 4B7LA 3SY0B 5IM7A 4QRPA 1FQ9C 4O51B 3O6LH 3QIBB 5IB3B 3B4NA 1OAZL 3QO0B 2ZWLT 4AL8H 1BQUA 4HEPG 3FFDA 3GO1H 5ITBL 3VI4F 2EIZB 4YXLL 2RR3A 3QNXA 3VE0A 3KPTA 1R3HA 1ACYL 4HC1H 1YJDC 4E5XB 1QQDA 4LHUB 3JWOL 5F3BA 1ZVSA 4HHAA 2C3HA 5DD6B 1GAFH 4P3CL 2CLVB 2UVEA 3QIWD 2X4SB 1OGAB 5E99L 1CU4H 3L5HA 4M43H 5FAAA 2B4CL 2NY7L 5CS7A 3E6FB 4WHTA 1WWBX 3DX6B 3KG5A 2DM7A 1DFBH 5TE7L 5J9PB 1R24B 4NIKB 2R69H 1NL0H 1S7XB 3KPSA 4KDVA 4MAYC 2X9YA 1SEBA 2P24B 3PHOB 3OKLB 3QUZC 2AV1A 3QDJE 3GFUA 3BYYA 2IPKA 3UC0L 3ECBB 4OLUH 5I74B 1A5FH 4EI5A 3BH9A 2D7TH 4OZIB 5F9JA 2NY3B 4LKCA 4XNZC 1NMAL 2ZKHL 3ZDZE 4NC0B 1WZ1L 3MMEA 5FYKL 5KAQG 1T1WA 3C5SB 3HC3L 5FOBA 3EKCA 5I1CH 4NQUA 1GPOL 4WVRA 4CRPA 5K9JL 1CQYA 3N9GL 4BELD 4I3RH 3IJYA 1PY9A 1RK0B 3PWUB 4TOYL 3KPRE 3TCLA 3DRQB 3H7BA 4F58L 4NRZB 3KPQA 1P6AB 4K9EL 5SX4I 2IFFL 2IPTL 3OB0H 5DUBA 5DJ8B 4NO2B 3D25B 4XH2A 1HDMB 2WLZA 3H9HA 3SBWC 1ZHKB 4KVCL 2R4RL 3TA3D 1YNLH 3V5KA 5HD8C 5HYSB 1WC7B 1MHHB 3V4PH 1MRCL 3QHZH 4O4YH 3B5HA 3ULSB 5F71A 1Q9WB 1EAJA 1FGNL 3ROLA 2CKBA 2AK4D 3WNOA 2FCBA 2WWKO 4U6YA 3UTTD 3VFOA 1LO4H 2EKSA 3GJFA 2ZNWA 4Y1AE 4U05A 1RK1B 4DEPC 2C3XA 3BKJL 3SDAA 4FP8H 1EGJA 3MCLH 3GUTA 1NGPH 3HHRB 4WUKL 4M6NL 5CWSA 1AQDA 1M7DB 1MY7A 4ZO8A 4PUBH 2KL6A 3BYTA 1L4IA 1MWAA 4HUUB 4R7NB 1QP1A 3TBVA 3K2UL 4JQXC 5MEOA 5HGBB 3ZKSD 5GIRA 5DD1H 3VMOA 4JPVL 2AV7A 3ULUC 2JTDA 1EBPA 1CVRA 2PW2A 4LSTH 2DQDL 4PJ9D 1IAKB 2W9DH 3L5WA 1PZUB 4KV5F 2C3GA 2NXYC 5DWUL 4OLYL 4M3JA 1KJ2A 2P8LA 5LJYH 3UTSD 5LXGH 3VWKD 3Q3GA 4PJFF 5IMOB 3HZMB 1AQKH 4OB5H 3TO2B 3WS3B 3KYNA 4PY7B 4JRWA 2QSCL 4X5WA 3BO8A 4Q7DA 2W60A 4KUCD 5T1KA 1R3JA 3NIDF 4LSDA 5TFSH 1I1YB 3DXAB 4K7FB 1YZZA 1W2KT 3BVNA 2XA8H 5C08D 3O2VL 3C2AL 1BFOB 4KZEL 3RGHA 3RL1A 5BZWB 3I9GL 2HVKA 4ZO6A 5AWNH 1B88A 5GGQH 4TSAH 4KRPB 4BQBA 2BOCB 4JZNA 4O2EB 5CD3B 1ADQA 1X5XA 3IDGB 2JJSA 1I8IA 2MPAL 2VZSA 5IB2A 5IKCB 1DQDH 1F3DJ 3CSPA 4G7VH 3U6RB 1YC7A 3RTQD 3K4AA 5IR1A 2E8YA 1OTUD 1CLYL 4ZUUB 4CMHB 4DUWA 5DQJB 1T5XA 4NQCB 3F65A 5EO9A 4LSRL 4QRRE 2ITDB 1ORSA 1BPVA 4I8DA 1YN6A 5FGCE 5GGVY 5JHDA 4NJAH 5LGKA 4KWUA 5IVNA 2AEQH 3MLTB 1YN7A 4GMSL 4RZCB 3L3DA 4MQ7A 3RWJB 4JO3L 2VITB 3H2WA 4HAFA 2VTFA 3BRDA 1RZJC 1CFTB 3UX9B 4W6WB 1VESA 3C60C 4OQTA 2W0FA 1WIUA 3MACL 1S8DB 2COQA 2P5EA 2BY1A 3Q1SH 1XGQB 3LEYL 4X6CF 5IEHA 3BDBA 4GKZB 1H0DA 8FABA 3VXQB 3JWDH 1RIVL 2A74A 4M1DH 2HRPH 4M9PA 4NSKA 1U92B 5EC1A 1DZBA 4NO5B 3K8LA 1RUQH 1EA9C 1W0WA 5LWYL 3RVUC 3OAZH 1CFQB 1DCLA 1F4AA 1HHIA 1KFAL 3HUJB 4KKLD 1U36A 1JHLH 4EBQH 3V7MA 5DEFA 3HFMH 5D1ZC 5EZOL 1I7UA 4V1DE 1ZE3C 2VDOH 4K23L 4Y2DD 1T83A 3IU3B 1MQKL 5ESQB 2B39A 3OR7A 2FZ3A 2WINB 2F15A 2AQ1A 3VXTB 3CVHL 1HXMB 2R0WH 3D6GA 3GBML 1HH6B 1EO7A 3P4LA 2LFGA 2ZOKB 3QDJB 4OGAC 5FCUL 3L3KA 5E00B 3I02A 4ZODA 1UM6H 4GQ9L 1SY6L 2FSEA 4G80A 1AFVH 3UJTH 4XPBL 4B5EA 3RX7A 4H8WL 5D7JD 1DQMH 4BKLB 1P1ZB 3H9YA 4P4KD 2IAMC 4Y16C 3IDXL 4X5XA 3WUZA 1JL8A 2JB5H 1JF1B 4P4RA 5D7KD 2ED8A 4KGLA 4UIMB 3IU4L 3G5XB 4UT7H 3P4OB 5F8RC 3D3VE 5KOVC 5AZEL 2A6KB 2R2EA 5D1QB 3RAJH 1A1MA 3FOMA 3VU2A 1YNKH 4PD4K 3X14B 5JPMB 1S7UB 1DJSA 1UM5H 2ZCLL 3OHXB 4ODSH 5AD0A 4Z8FL 2VDKL 2W65B 5AG8A 3VI3F 5TE6H 2XKSA 3U4BH 4Z76B 5A3IC 3FQTA 5F72S 4MAYA 5H2BA 4L4TA 2EICA 4NM8H 3RY6C 2BXYA 3TNMB 3REWB 4Z7QF 3TBYA 3GRWA 2ORBL 5IMMA 3TO4C 2OTUB 1H8SA 5E8PA 3E3QE 1INDH 3QB7C 5EUOB 3OG6B 3V95A 5FYKU 2DF3A 2NW3A 1CGXA 1U8QB 5D7IA 2V2WA 4ENEC 4BK5A 3P30H 5J56B 4MA7L 2PTUA 5J11B 4OM0H 1CVSC 5J57B 2EDRA 4FTVB 1G9NC 5J13B 3KVQA 3BAEH 5EU5A 5BRZE 1WF5A 2JIXB 5D7SL 5L0QB 3QEQA 3C2SA 3WFCL 3ZHKA 2X1QA 1LK2B 1DVFD 1KJVA 1TQBB 3EZ8A 4FZ8H 4TVPH 3FB7B 3DV6A 3SBWA 1SM3L 1FGVL 3WO3B 4AIOA 3W0WD 3MRCB 1B6UA 3AS3A 3WS6C 5I1DA 1F11A 5CD5C 2R0ZL 5AYUH 4QNPE 4NQEA 2X41A 1J1XH 1A47A 4N9OB 2X4QA 4LVNB 4J12A 3IYLW 1EHLH 4GSDH 1IC7L 4MDIB 2G5BB 5C6TH 1J05A 4AEEA 1Y6NR 2R2BB 2J2ZA 3VFMA 5FKAB 3DSFL 3OXRA 3IRPX 5CZVL 3WJJC 4YUEH 1AGFA 1FFPA 2BJML 3W9DB 2I5YL 3R4DA 4XWGH 1Q94B 5KJRL 4ZAKB 1KV3A 1SEQH 4C56B 4JQXA 1R5WB 4XPGH 5JR1H 1BJMA 4JKPH 1B0GA 1J0HA 4EOWH 4TRPL 2O5ZH 1H3VA 3MCKB 3WCYA 3T3PE 4U6TA 4O58L 5JUEL 2NLJA 4JR9L 5FGCB 4G6MH 3LCYA 1RHFA 3HE7B 3W2DH 3NA9L 1M7XA 5IHZA 1AR1C 1LO2L 3PIQA 2WBKA 5JA8B 1BLNB 1K5NA 5FHAH 2XKNB 5F88B 1WAAE 4KJWC 2DWEB 2DTSA 5DR5L 4CVZA 1OL0A 1DTUA 5IF0B 1W72A 2ZCKL 2XI9A 3I50L 5J1SC 4X8JA 3HZYA 5HYJD 1OY3B 2C1OB 3FN0L 4GW1A 3NACH 2DIAA 3T0ED 2HTKC 3L3GB 2EXYC 1FL3A 1D6EB 1XF5B 3EUUA 3CX2A 1JGEB 2NXZB 1Q9LA 3QULA 5C71A 5EOQL 3MJ7A 5A2FA 3GMMB 4L3CB 3QUXB 1T21B 1CXHA 3VG9B 3KDMA 4QT5B 1IGIL 2AJ3A 2LAAA 1TENA 4ODBD 4TYUA 3KXFA 2V17L 5D6CA 5TDNB 2YMXH 3DUSB 4LDEB 3MJ9L 4HXBL 4QRPD 5L2KE 3GNML 1RUKL 3DBXA 5IG7B 5BJTA 1CF8H 4MXVF 1NUDA 5I71B 1KYOK 4LNVA 3I6GB 1S7QB 1X6NA 2B0SL 5EWIL 1JPGB 1DANU 4RBPH 2X4TB 5BVJA 4EDWL 4JO4L 3BN9C 2DYPB 3ZE0F 1LDPH 3P9MB 3C60A 1T0NB 3GSOB 2QSTA 4LCWA 4PJGF 2CUIA 4NFDA 3OAYH 2MSPA 4L3AA 2RCSL 5HYEA 4WO4C 1NJ9B 3GI8H 2Q8AL 4IHOB 4IS6B 1B0RA 6FABH 1UCBL 3HLAB 2IQ9H 3SQOH 3KPLA 1U8IA 2DMCA 3HE6B 1HILB 1GOHA 1G7LB 5F97E 5L88L 3EOBA 2VIRB 3UEZA 3KPSD 2YUXA 5A2JH 1FNAA 1U9KA 4OZHE 1QHOA 3QCUH 3TVMB 1JZ8A 4HWEL 3GIVA 3WBDA 2EYTA 3CFDA 4YAQA 5D1ZA 1CD1B 2X7LB 2XZAL 3EJZD 3OXSA 4HF5H 4JKLA 4UINH 4EI5D 4X99A 1MFEH 1CDCA 3MODL 3HC4H 3JTSB 5JW3H 4Z78B 3SO3B 4HIIA 4M8QB 4KROD 1CGYA 5I17B 1Y0LA 3WMSA 4ZUTA 1QFUL 1KJMA 1FL6A 1XH3B 3S6CA 3JTTB 3MRKA 1D5BA 4OIAA 4QXWA 2EDLA 1NL0L 4C54A 4LHQB 3HUJF 4LVEA 2WLYA 3H7LA 2VABA 4HV8A 1BJ1J 2ZUTA 2XRAL 5DQDL 1UWXH 5HHMD 1T7VA 5DYOB 1HOCA 8CGTA 4XNXL 2QSVA 1MRDH 3BEWB 5EOCH 4M6MH 1I75A 1A3LL 2CKBH 3CH8A 2IAMA 4Y16A 5F7DA 5I1CL 4DKFL 2IF7A 3IVKB 4F7CB 4RFOH 2Q76A 1AHWB 3CX5K 1LK3L 2UWEA 1I1RA 4TNWF 5DMJB 2V2TB 5BO1L 3SDAD 2CR3A 4PGCB 2VB5A 4OBSA 5DJYA 4B0MM 4EQ3A 1PEZA 3G5VB 1T04A 2FBJL 1BHGA 1IGCH 2ZCHH 3FT3B 4ELKA 5GS0H 3V4PL 4HPOH 1LNUB 1QPPA 4JFEE 1JHTA 2ATKB 4LLYA 4WFFE 3BRGC 4WUUE 3CJJA 3I85A 2I07A 3ELAT 2R29L 5AUMB 3LKOB 4MJIA 1HYRC 3RY6A 2K3TA 2BSRB 2QQLH 3H8NA 1OM3L 5IHUH 1OHQA 3TO4A 4LKXA 5T1LB 3DHMA 3ARSA 5C0BE 2UUDK 3GKZA 1P7QA 2CIIA 5TGBB 5IBLC 1KJ2H 3NFNB 5I73C 2VL5A 2B1AL 3NFPB 4BQCA 4NZUH 3WV0A 4P2QE 4BK4A 4N8VG 1K6QL 4LHJB 4N9GB 3P0GB 3EGSA 5F96H 3MFGB 1ZLWH 3G04A 3MLYH 4UI2A 5T1KD 3MYJB 4YZFE 4HQQL 1HWHB 1NQBA 4E5XA 4LHUA 5EUOF 1RMFL 3O4OB 5I1GL 5I6XC 2HT4C 1MJ7L 3NABL 1EAPA 3WLBB 2DM2A 4Q9QH 5IBUG 4LPUA 43CAA 2AJXL 1JGDA 4I0PC 2C7UA 1K8DB 1A7PH 1RZKC 1LO5B 5F93C 2RAMA 1ITCA 2A6IB 4X4YB 5T5FH 4PJHE 3WS6A 4RGNC 3HI6H 3WNLA 3UPRA 2X1WL 5ACLA 5ID1A 3E6FA 2JJUA 3BZEB 3IJSB 3CPLB 5E9DA 1A7NH 5E70A 1ZLUK 5DVOA 4JAMB 3L95B 2C3VA 6CGTA 3U9UA 2N7BA 5TFSL 1CI5A 3O3BB 3GI9L 4HH9B 5JHDD 3PHOA 5H8DA 4LNRB 4A6YL 2ADGB 5GGQL 2XYCA 1JTPA 4QTHB 3ECBA 2JELH 5FGSA 1WT5C 3WJJA 5JXAL 3WUWA 4OZIA 2C1PB 4TUJB 2OL3L 4FXKA 4G7VL 3PHQA 1X5GA 1W0VB 1ACZA 4EZMA 4JO2H 1FLRH 2P5ED 5SX5H 3GSVA 3OGCA 5HVHB 2BHUA 1RK0A 3MV8A 4XTRC 5HGHB 2OMBA 1VEOA 4YR6A 2Q6WB 1OTSC 4YWGL 2AJYH 4G6FD 1IGML 3DRQA 4NRZA 1KNOB 2ADIA 4DZBA 3NPSB 4PLJC 4UBDD 3PDDA 5EB9A 3QHFH 4GRLB 4PGBB 4KDWA 5CSBA 3LRSA 2BFVH 4PRHB 1O7SA 4G42A 4HZAA 3QIUB 1FDLL 3RZCB 1UA6L 2ARJA 4P5MA 5E8NA 5EA0H 3ZTNH 2K7QA 1X5YA 4RCAA 2BZDA 3N85L 4WFGE 3ROOB 1MHEB 1Q9WA 5DSCB 2WP3T 3VRLE 4AK1A 3OKDB 2CR6A 2OK0H 2DLEA 3NFSH 2D0GA 1OQXA 2B7DT 4ONHA 2VO5A 1MI5A 3VFUB 1YECH 2YPKB 3V5HA 1H3PH 1RK1A 5KN5B 1RUQL 2PR4H 3WD5H 4OZHB 3DJ9A 3VD4A 4ODHH 1XR8A 3VGAC 5E6YA 4M7JL 4Q2ZA 3LEXB 1QR1A 2VDOL 4NM4H 4X7TB 5DDHA 1MSPA 1YJDH 1XGUB 5HGBA 4DWHA 4K94L 5DEZA 1T7XA 2HJKB 5D70H 3S98A 4ZUWA 2R0WL 4G6AC 4H26B 5DRNA 4P5KB 4YXHL 5JW4M 5MEQA 4S1DC 2Z8VC 3JV4B 4WO4A 2SEBA 4H5SB 4M7LL 4MAUL 3X11A 2AABH 3TO2A 2P5WA 3QFJE 3QXDA 1MCHA 4MXQC 2P42B 2ZUXA 3MRNA 3BJLA 3ZYZA 1MFCH 4P9HC 4YX2L 1BFVH 1I1YA 2FX7H 1XCTB 1MOEA 5JQ6L 4YPGB 1NDGB 3ILQC 4MAYD 3BDYL 3GRWH 1XR9B 4L4TD 4LF3B 1UH4A 5DK2A 4BZYA 1BIHA 4NKDA 4PJDE 3VGFA 5CCKH 3ULVC 5FK9A 1DL7L 4FQ1L 4BSWB 3RAJL 2EDYA 2CRYA 2Q20A 4YXKL 5FXCH 2C4FU 3CDGA 1MCQA 3EO1A 4R8WH 4NQCA 4I2XA 3R1GH 2X4UA 4ODSL 4JFEB 1PW3A 3BHBB 3C09B 3ARQA 4N0UE 2OP4H 3L1OL 4Q6IC 5BOPA 3TBSB 2N56A 4DJMA 4MS8C 4U1JB 4F2MB 1H9VA 4HZLB 3QEQD 4RZCA 1HQ4A 4O02H 1G9EA 3FB5A 5AAMA 1KENL 1TTFA 4LSSH 4U2ZA 1CFTA 5GGRA 2BXZA 1Q0XH 2GJ6B 4P2QB 5HD8D 4UV7H 4G6KH 3N50A 2EH7H 3G6JF 4MD4B 3P30L 1K8IA 2OM5A 4OM0L 4C83A 3ET9F 4MSWA 5L8JB 1T03L 3U36A 3C6LC 3FO2B 15C8H 1KB5B 4U33A 2VLKA 3BAEL 4NQED 3DTXB 3T1FA 1INEH 4ELMA 1A9BA 5B22A 3OB0K 3H3PL 4ODXB 3V2AR 4NPYA 4JZJC 3RUGE 4K8RC 1ZGLP 2BX5A 4NQDA 4PJHB 3IU3A 4D0DB 3ULUH 4YLQT 1OP9A 1PX3A 2J8HA 1IL1B 4K71B 1KIRA 4XP9L 5IW1A 3ULUD 1J1XL 3V8CA 4U49A 3UTPD 1HH6A 4FXGB 5ADPH 2EH8H 2BSTA 3PWJA 3QDJA 2ZPKH 2NXYD 4OQ1A 3LH2H 1UB5A 3E3QC 4WI8A 1MCOL 3TESA 4KPHH 4LLDB 4WI5A 4WW2C 3GBNL 3SOBL 3UAJC 5HPOA 2O61A 1NLBH 5I19H 5FA4A 1FVDA 4BKLA 4XNQB 3ZL4L 2OMNA 4HPYH 1KTDB 1P1ZA 4JKPL 1TTGA 2RGSA 4KKAC 5EFIA 5GJTL 3UROR 4LSVH 2V5SA 3OJVC 1CG9A 3KPRA 4JO1L 3P2TA 4HG4J 1EZVY 2YK1H 5CP3H 4TUKL 4BZ2H 3DRTB 2D03L 5DVMA 4XP1H 1FZJB 4R4FL 1U8PB 4R7DA 5D1QA 4KQ3H 3FO0L 3KXFD 4YDVB 2F74B 3MUZ1 3SDXA 4AMKH 5HYQB 4D0BB 3R0NA 4X0KB 1QNZH 1BGXL 4OGZA 4ZOAA 1BJ8A 4PTTA 3DVFA 5HXMA 4Y1AA 3FQUA 1WT5A 2MQ0A 3MOAH 3RVXC 1PX4A 4HS6A 3RVTC 3TPUA 4DGIL 5ISZB 3QO1A 3C60D 1QBLL 4LCWD 4UZGA 4ERSH 1CCZA 2VAJA 1FZMB 4ALAL 3MA7B 4EIZC 1GIGH 3KR3L 2FR4B 32C2B 1HI6B 5F89B 4JFDB 3NCFB 3PGCA 5EPMA 4M4PA 3DUHA 2JIXA 2OQJB 2LU7A 2DIJA 2QQNH 4Y8DC 3KS0H 2EYRB 4IEFB 43C9B 3Q6GL 3RVUD 4ZUVA 4DQOL 3QUYB 5BV7C 5E7FA 2PXYC 3WEXA 3VFRB 4HSQA 4FG6D 1RJLB 4DKDC 2Z93B 3G08A 1JGLH 5D1ZD 4RIRA 1MH5B 2F54A 5GSRB 3QFJB 4X7CC 4G9FE 3GMOB 4DOHE 1TZHB 4RAVA 2IQ9L 2AEPL 4U1SB 1T1XB 1HHGB 2VLLA 5IT2L 5KSBE 3FQNB 1TJGH 1XAUA 3G5YA 1J12A 4XCEA 3CFCL 1MVUB 3ZYOA 4MCZB 4OFPA 1FFNA 4E41E 4BSVA 4OGAD 1NGWB 4NZTL 5FGRA 1INQA 2DQJH 2OSLB 3OAZK 4HGWB 5DUMH 2H9GA 3U1SL 3VFGL 4ZS7H 1NDMB 4LLUA 5FEBA 5E24E 4JDZB 4DGYL 4PJEA 5BQ7A 4MA1C 2FH6A 25C8H 2XQBL 4QRRA 2G60L 4EKXA 1CXIA 5TPWL 2IAMD 4Y16D 1PFCA 3HE7A 1OSPH 4NN7C 2DKMA 4R4BB 4OZGE 4TUOB 4LLWB 1PEWA 4XP4H 5INCA 4R97C 4ETYA 1NCAL 2DN7A 1L0YA 1YEKL 2DS4A 4P59L 5IB5B 4XVSL 4WEUD 1C5DB 3L3JB 4ORGB 4X98A 2YWZA 3X12B 1J86A 4HBCH 4NQSB 3RDTB 4EDXB 5A3ID 1D6EA 5IK3A 3JUZA 1JV5B 1RZIB 4L9DA 4MJID 4ZG1A 2Q3ZA 5I8EB 1BVZA 3PHSA 3QZWA 1N26A 3TO4D 2P8PA 2P49B 5LCVH 4RFOL 2FWOA 5DA4A 4GAGL 1EGJL 5KSAC 1P7QD 1F8TH 3DUSA 4CVUA 4NNYA 2D31A 3GHEL 4ENED 3ZKXB 1IFHH 1G9NH 5HJ3B 1AD9B 1KGCD 1TVBB 5C2BL 2GSGB 3IDUA 5IG7A 4V1DA 1NLDH 3BKCH 1MWAL 5DA0B 3THML 3EFFA 5HPMB 2HWZH 5E5MB 1RZ8A 1NFDE 1DLFH 3P4NA 3DX9B 1QFWI 3I6GA 3J7HA 3NA4A 4K3HA 1KPUA 3WXWL 2GTWB 1ZWIB 2VZUA 5KVGH 2DYPA 2O5XL 4NBZB 4LHUD 1HIMH 3DARA 3MO1A 3VRJA 2X42A 1OD9A 5I66B 1QSZA 2DD8L 3PQYE 4YFLI 1QPXA 1JPFB 1KJ2L 3OQ3B 5F9WB 2DLGA 2YA1A 5JOPD 1V7ML 4O9HL 4R4NC 3DURB 4GFTB 4CU7A 4IS6A 3VXNA 4HKXB 3C6LA 5CD5D 3DMMB 1NAKH 3HLAA 3MRIA 5F96L 5E9DD 4QRSA 1U3ZA 1HILA 5FM5M 2WV3A 4WNQB 4L8SB 3NCJH 2VIRA 5GQBA 4ZFZA 2FHFA 3WUWG 1FH5H 2R0KH 4H0IA 2V7HB 4JZJA 1ADQL 1C08B 3DX7B 5AAWA 5F7LB 1KIPB 4NCC2 1NCNA 3T09A 4XVJL 3D3VA 2AP2A 4XMKH 2X7LA 2YEZB 2XWTA 3CDFA 1AY1H 4S1QH 1S9WB 3V6OC 4QHKJ 1NANI 4LGSB 4KK6D 4Z78A 1NUFA 4JM2C 1C16A 1PDKA 4KVNH 5MHSE 3G5ZB 3V52H 5IMKB 5B38B 2APVA 1W8NA 3EFDH 3MV8D 1AD0A 3ULUF 2NY5L 1AR1D 3RIAF 2IALB 2XPGB 1T2JA 1AIFA 3T0VA 5JZ7C 1HINL 5I16B 4KJWD 4M6AA 4MB3A 3AB0C 4G3YL 4HUXB 4LCUB 2CMRH 4OQTL 1YQVH 5DVNA 3VJ6B 3WL9A 2MNUA 1LMKA 3HI1B 3OGOE 2I9LA 2OJEA 4HS3B 5DD0H 4YDLC 2ARJQ 2PTVA 3QG7H 1CDHA 4ODUA 2Z8SA 2HTKD 2M26A 2EXYD 1HH9A 3EJYD 4IDLA 1A14H 3OKYA 2A83B 3I2CH 5BRZA 2J6EH 5EO1A 1IBGL 2CDGA 1UXWA 3Q5YA 3QWOA 4XNUH 4ISVA 5FCSH 4ESKA 2YPLB 3MJ8A 3R8BB 1KG0B 1MI5D 1NANH 3T0WA 5DMIL 4PGCA 4WCYL 5DJAA 1BIIA 4HWZB 3IDYB 4DW2H 1NMBL 5AZ2H 4OFYA 1CTOA 1PJ9A 1LNUA 1ORQA 3ZTNL 1I1FB 2XTJE 4G9FB 3BQUB 5AUMA 4JFPA 4DOHB 2AAVA 5C0JA 2BSSA 2OK0L 4LASH 3NFSL 3BN9D 1T20A 5IVXE 3D5OF 4KQ4L 2I27N 4E41B 5EUKA 4B7IA 3MZTA 1GGYA 3SQBA 4LRNL 3TH4T 4FFYH 4WW1B 5A43C 2VDML 1NSNH 4WO4D 5TQ2L 1OAKL 5EU4B 3UJJH 1C5CL 3TJEL 2P5WD 1V7NL 1MCIA 3E2HC 2XV6B 4HIEB 5CJ5A 4M7LT 2BMKA 1VGKB 1ZEAH 2XXCB 3S34H 4RBPK 2DQHH 3SDYH 1F3JB 5TH2B 3FT2A 2R1WB 4OZGB 2J5LC 2BVQB 4PJ7F 3UYRL 3SJVE 3DOSA 2PXYA 3NVQA 3QFDB 5IV2B 3T2QA 1H5BC 4XP5L 3X3GH 5EZLA 3OL2A 1LO5A 3OAYK 2ADFH 3MTRA 3C5JB 3GSUA 4NFBA 1E4KC 3JXAA 1I3RB 5CEZE 5INDB 4I5BB 2H1PH 4NQCD 5C3TA 3UBXA 1FL5B 3SEPA 1VFBB 2HG5B 4OD3L 3AXLB 3ALWA 3ETBF 1UVQB 3GK8L 2BHYA 1BBJB 3K74B 1DQJB 3LV3B 1A7OL 2VLJB 5DHVB 3SN6N 1MCCA 3EYSL 4YDJA 5L2KA 4GKNA 2P4AB 1A2YB 4WU5A 4X83A 1VFMA 2CUHA 1B2WH 4YFEA 4YHLL 5DHVH 1EUTA 3MLXH 3MNVA 5I1JL 5E2TH 4JPKL 1NFDB 5C0IA 2DWDA 3MLRH 3T3MF 2R1YA 3FQWB 2DMKA 3OMZA 5GSVB 3MFFB 3BWAB 1GRWA 5E1AA 3B8YA 1I1CA 3FB8B 4CVXA 3BP6B 3CZFB 1AJ7H 4HMDA 3DO7B 3OTTA 4Y4KB 4JFFE 1E4WL 5T3XE 4FRWA 1TLKA 1EEYA 2VDLL 2P45B 1UWXK 4WEMB 5CJBA 5DJ0B 4PJ5E 2JKXA 5FB8B 1P2CB 4GLRI 5HHNB 1MAMH 2VKXA 4M5YH 3HPJA 3CCHB 5EDXA 1ZS8A 4ZXBB 5AEAA 4HKZB 5C2UB 3W11D 2DQGL 1H3WM 1I4FA 1P53A 2AGJH 4F8QA 5KSAA 4UQ2B 5IBLD 4IIQB 1J8KA 3V4UH 3ALPA 5B8CB 5I1HL 3QDJD 4GS7C 1JGUH 1IM3A 4YHKL 4C4KT 1A1OB 3ZE1E 4JRXE 4DFHA 3CFKB 4UDTA 3RWFB 3BPOC 1HK6A 3LEXA 1Q72L 1UGNA 2D7NA 3LS5L 5FO8B 4ZQKB 3DGGA 4Y19B 5I75C 1CBVL 3LS4L 5HTSA 1JYVA 1BOGB 2CO7B 1YYMH 2QTEA 4LSUL 5C0EA 1RY7B 2F5BL 4CUCA 2PCPB 3RGVC 1T66C 2HJKA 3VRIB 4ZFOL 2AQ2A 3KPRD 2HT4D 2AXFB 2ZUSA 2EDKA 2H3NA 3M45A 2GEEA 4H5SA 5D1QD 1GZQA 1W72L 2BOBA 1F6AA 2Z35A 4KPHL 4RGND 4CKVX 2KQMA 3WIHA 1IKFL 2HVJA 3MRJA 1ZLWK 2VE6A 1MFAL 4OJFH 5I19L 1A6UH 3PL6C 1U0QA 3WNPA 2NY2C 4HPYL 1XGYH 3F7YB 4YPGA 5D2LB 1OB1A 4N0CC 1RZGA 4JE4B 4M61B 1T6VN 1T4KB 3MLWH 1HSBA 1T5WB 1KXTB 1R5IB 2BVPA 5L7XH 1KLFA 4Y1AD 5D7LA 4WI2A 2PNDA 1P84J 4XX1E 1IGYA 1UC6A 2IQAB 3V6OA 1HHJB 2EIEA 3BFOA 4PG9B 2G5RA 4PREB 1BQSA 3BMVA 1FO0B 4OUOA 2HT3D 4JM2A 4JFEA 3BHBA 4FQIL 4PR5A 4TTGA 3PGFL 2NY1C 4WUUA 2XTJB 4XTRD 2ZJSH 1OTSD 3UCRA 2JB6B 3VXSE 2JIXD 4XXDA 4F2MA 4P2OB 4PB9H 3L3OA 4NKIL 4PLJD 1NAMA 3BW9B 5T3ZE 1IC5L 4TPRH 4FQPA 4R3SA 3ES6A 5C0BA 1RZJL 4L8BA 4ZPVB 5HYIA 1QSVA 4U1IA 3VWJB 5E4IA 4P2QA 5SV3A 2WNGA 3TWCL 1MCBA 4BZ1L 1KCUL 1MFNA 2Q8BH 4C57C 3O81A 4MD4A 4CGTA 4KXZI 4LRIC 5SX5K 5I1IH 1JPSH 2F54D 4AJ0A 3FO2A 1GGBH 4Z7UE 3P0YH 5D1XC 1D9KB 2J88H 5C0FA 3MRFB 3FL7A 1DLHB 2EDEA 1XIWC 3P73B 5F70A 1AP2B 3HRZB 2AEWA 5D96B 3QNZB 2DQEH 1A3RL 4XI5C 4K7PH 3O6ML 4P5TB 5CHNB 4PJIE 4KDTC 1PKQE 4PP1C 1N6QH 3UTZA 3GJEA 4D0DA 3SE9H 4DN3H 5C0GB 4LQFH 3ZO0A 4QRRD 4OCSH 5H35B 3OKNA 1CICB 5ESAA 3WDJA 4JLRB 4OD1H 1SBBA 4P0DA 3HE7D 4G6AD 2A73A 5I8OL 2F53E 4KXZH 5JW4R 2M2DA 1P4LB 2YSSA 5KZCB 2DQJL 4LLDA 1IE5A 2UZXB 1SMOA 1XGRB 3HTLX 4P9HH 4MXQD 1SJHA 4OCRL 5BXFB 2GW5A 3OG4B 5C09E 5EBMB 3W81A 5ICXA 3QZWG 3B2UC 4X6FB 4UOW1 4BFEA 2Y36L 5CUSL 5DZLA 4F7MB 3KLDA 1YUHA 2R0LH 3IFLH 5L2JA 1TZGH 3AUVA 3ULVH 3CU7A 4RISH 5B39A 1XZ0B 4JFFB 3TGXA 3NTCH 5GISL 5CZXC 1E4KA 2VR9A 3B9AA 4YPJA 2X2YA 4IOFC 5DJXB 4PJ5B 3O8XB 5J1AA 4MDJA 4V1DD 1KC5H 3FT4A 2GCYB 2X4NB 4HBCL 5CJXA 4E42A 4N0RA 4HIHA 4OZFA 1XCQB 5D5MA 3BPNC 3WFBH 1DSFL 4U6HB 4JFOB 35C8H 4MS8D 2AXGA 3MRGB 2DRUA 4XCNA 1OF2B 4HWBA 4M8VA 5FOJA 2DDQL 2DYPD 3AS2A 3T2PA 4WJ5B 3M8OL 5LCVL 5IW6B 3IXTA 1OLZA 3BGMB 3HNTL 3DIFB 2BNRE 4JRXB 3MA7A 1YEFL 1PLGH 5KS9B 1IFHL 1N6UA 2LABA 4RGOH 4WTXA 4TTDD 2NNAB 4X4XA 4DCQB 2JCCE 5KOMC 5JDSA 3B5GA 5I18L 1S5IH 3LQAC 2BVTA 1TZIB 1RJZB 2PTTA 1ZT4B 3C5ZB 3C6LD 4HK3N 1LP9E 3G9AB 4K3DL 2B1HL 4HT1L 1GOGA 1TVHB 5JHLL 3PWPB 5AYQA 4F57H 3EYQC 1V3JA 4RNRA 4J2XA 4AT6B 3HS0B 3GGWA 4K8RH 3RY4A 2CKNA 3LQMA 5MP6H 4HGMA 4ELMF 1GJIA 5E94B 4K8RD 2FD6L 3O11B 3STLA 12E8H 4KY1L 3D3VD 2A9NL 2YD7A 1KT2A 1MH5A 3EOTH 1JPTH 4ONGL 2VN7A 4L4VE 1KTLB 4WDIA 5I2IA 5ILTH 2VDRL 1MIMH 4NWTH 2N7AA 4FFWC 3SDDB 1U8OA 5L9DL 4MJ6B 4AY0A 1NAKL 3RPIB 4U1SA 2B2XH 1HHGA 3T0BA 1CYGA 5JLZB 5EU7C 4JHWH 1J8HE 4MCZA 4P46C 1FIGH 1RVFH 1KEML 3L5XH 4I9WE 4UNVA 3IB4A 5I8CB 1Y6KR 4YHMH 1FNGA 1MCRA 5D72L 1J1PH 5HDLA 5GPRA 4AH2B 4PJDA 5IB1B 1GGIH 1NDMA 3SPVB 2XWJB 4OLZL 4Y4HC 4JY4B 1QFWL 2X4OA 3UAJD 4S1QL 2ILLA 3WE6B 2NZIA 1CE1H 2J3SA 4P3WA 1UWGL 3QDHA 4KKAD 4KK8C 5CLTA 3RGVA 4N0UA 2MHAA 3RWDA 1QO3A 5IMLB 1S9KC 5BRZD 1TNNA 3VXSB 2I9TB 4EN3C 1S9YB 5DTFB 3HCVA 4Z7VB 4LPTA 1D5XA 5DJDA 1PVHA 3ZHDA 2CLZB 4RA3A 5MI0C 4PYHA 2W9LA 3O0RL 3EYOA 4Q9RL 4CADB 1QSEE 2O93L 4M7ZC 1VADA 1TCRB 5GS2D 5T3ZH 3WNMA 4FABH 4HUKB 3C08H 2Z8WC 2FL5A 3PL6A 4OFYD 3WO4C 3RDTA 3QG7L 4EDXA 4EUPB 3RBGA 4E0RB 3P0VH 3PWNB 3PUCA 4Y4FB 2Q7YB 1KB9K 4MJ5B 2CRMA 1DP0A 2CDFA 3O2WH 3UBXI 1MLCA 1F3DH 4QXUL 1I7RA 1H8NA 4EUPH 1U8LA 2H26A 3IFOB 1GXEA 3DHJA 3VXRE 3RVTD 1ITBB 5EBWA 3Q6FB 5CINH 1VDGA 2UVFA 2PETA 3RUGA 5J6HA 1GHFH 2CLRA 1B4RA 4DW2L 5KVFL 2Z31B 1BWMA 4PJIB 1OARL 1KELH 5D2LF 3PV6A 4ODTL 1F42A 3PP3H 3RU8L 5GGVH 1J7VR 4L9LB 4NKOA 1T22B 5E2WH 1DBAL 1QUNA 3LKPA 5C9KA 4YIQA 5BV7H 1E6OH 3PWVA 2BSED 3N0PB 2P8MA 3BPLB 2WK2A 4KKCC 5ETUA 2F53B 4AEHH 1JPFA 3LKSA 5DURB 2PXYD 5BS0E 4XRCA 4MD5A 3UBXG 1IQDB 3VCLA 4OIBA 4LRIA 1HHKB 4OF7A 3O41B 3ILPB 4EXKA 1EXUA 5JPNA 3IDMA 3O2DH 4UTBL 4LSQL 3NCMA 4K3JL 2YBRB 4CW1B 1B4JL 5C09B 4ZTOH 2GT9A 3LZFH 5I1EH 3UZVB 4CN4A 1XIWA 2X5PA 4WV1C 3STZB 4JPWH 2XTLA 4OIIL 1PBYA 2Z92A 2LVEA 1VHPA 3SDYL 2FEEL 5FUOL 2YD9A 4N68A 3RWCB 2ICWJ 5IP4A 5C0CE 4IRJC 1OTTD 2VOTA 4WGVB 3KPPB 1WZMA 1MCSA 4KDTA 5ACZB 2JK5A 3QEGL 3K7UA 3TC9A 4GRWE 5L2KD 4JY6B 4RDQF 1G7HB 3ZSSA 3IAQA 2ARWA 4KTDH 1FVCB 3F8UB 2IH1A 2PW1B 3L7FA 4PJEF 5DMKB 1MLBA 2VRAA 4MX7B 4J8RB 3TT3H 5IEKB 2AJZB 1ZHNB 4HW6A 5C0AA 3V4VH 1PYWA 5IGXH 1Q0YL 3NBNA 3D0LA 4CBPA 4LCUA 3VJ6A 4OI7A 3SE8H 3HI1A 1DE4A 5BZDB 3D39E 2BNRB 5GGTA 3F7VB 3MUGB 5F1NA 3HB3D 5KVEH 3MLXL 1LP9B 1QEWB 1L7TL 4OV6F 3GSQA 1R3KB 1P4BH 3VXUA 3ABZA 5J12C 1M71A 3KYOB 2WIMA 1T2QL 3LAFA 3I6KB 4HUWB 5BVPH 5KSAD 5JXEC 4GMTH 4IBLT 1CLOH 1RPQA 4PV9A 4PV8B 5FO9B 2WIIB 1SYVA 3ULVF 4U1LB 3KLHC 1KLUA 3T4AB 5JIHA 4W70A 5T1DL 5DRXB 3GHBL 3BUYA 3HZVB 4OM1L 4NN5B 3RVWC 3MNWA 4F7PB 4XXCC 4QF1A 1A64A 5KSBA 1QBAA 1G7MB 1U93A 3JV6A 4QOKA 4FQQB 1U91B 4CU6A 4JM4L 1JGVH 1KCVL 5DJ2B 3S35L 3NIFE 1FV1B 4LPCA 1IRAY 2AJSH 1MCNA 1YEEH 3AM8A 1AXSA 4L1DA 2GFBB 3F5WB 4R4ND 3PWLB 5F7EH 1U8KB 1NC2B 1E6JL 4FQCH 3MLSH 1HQRA 1TPXB 1FNHA 1NGXB 2UYLA 1G0XA 2J7LA 4HKBA 3S36H 3KYAA 5TDPA 4M1CC 5TH2A 2V5MA 4FOMA 4LK4A 4APQB 3CSBA 1X5JA 3IKCA 4ZOEA 1RZKL 5KS9F 5D7LD 5IHLB 4LIQH 5ABDE 4DAGH 3L5IA 3D85B 4R90L 1YPZE 2FB4H 5DUPL 1CFVL 1EJ6A 3B43A 3DPBA 4PRIE 4UV4H 3MGOB 4QTIL 4JFXB 4HX1A 4JM2D 4JFED 1VFBA 4Y7MA 5KSVB 1A6UL 1P5VA 1I8KB 4WUUD 3AXLA 1NAMH 4P46A 1LE5B 4PIRF 2VAAA 4UT6L 2F5AH 5HHQA 4Y5YC 3T2OA 1ES0A 4HFUL 3MLWL 5C0BD 3PABB 1CFSA 5JZ7D 3VXRB 5MERB 4Y4HA 3QXAB 4FQ2H 3O45B 3CC5B 3DSNA 3V0VA 3ARGB 4WW2F 4P2QD 3MNZB 5DT1L 1VA9A 2GYSA 3A0OA 1IVLA 3MRLB 2R1XB 2HAZA 3QNYB 3SCMB 5B3NA 1T1YB 4KKBC 1NFDA 3R06A 3L9RB 3G6DL 2ZJSL 1DQTA 4TSBH 4EN3A 4NO3B 1CE6B 1JWSA 1OAQL 4EIGB 3LDBB 1H3UA 4M7KL 4UMGA 2NW2A 3CZFA 4NWUL 4WFHD 3DO7A 4ZS6C 3CLFH 3FB6B 5CGYD 3PQYA 2OR7A 3V6ZB 1N8ZB 5BS0B 1ZT7A 2NY4C 2WW8A 1F97A 4TQEL 4KRLB 4Q9CA 1OOAA 4XC3L 2CJUL 4ONOA 5CJ8A 1MJJA 3CCHA 3ALXA 3HNSL 1JZ5A 4Z7VF 5FIEA 4MNGE 1MF2L 2IPUG 2W38A 1ZTXL 1EEUA 2ED9A 4L5FL 3NH7H 4UQ2A 4U1HB 1ZHLB 5IFHH 1N4XH 3FOLA 1BQLL 3I6LE 3GM8A 4UT9L 3BXNA 5C0CB 3P4MB 2AQ3A 1A1OA 4XZUA 5EBLB 4JHAL 2ADJA 4ZQKA 4HLZG 4HDIA 5BCAA 3MPCA 2DI9A 4K2UL 3T4YB 1RFDL 4GRWB 5JO5A 4IJ3B 5HHVH 1AR2A 4OCSL 2PCPA 1W0YT 2Z91B 3MX0A 5B39G 1X5IA 1JWMB 2A9ML 4GRWH 2E9JA 4AIZB 3NGBC 4YO0B 1Y18B 1RIHL 3T8XB 3GSRB 3O3AB 1G1YA 2PO6C 1WIPA 3MRPA 3IFPB 4OZFG 3HG1A 3D39B 4P9HL 3OWEA 4OLWH 4OCYL 1ZSDA 1CGWA 4XPAL 2BVOB 5D93B 3LHPL 4QHNA 4HIXL 3TFKC 1F4XL 4LAQH 3RVVC 4IRJA 2R0LL 4JDVA 5C07E 4PBWD 3MXVL 4RISL 4KJPC 1AE6H 1CDBA 3O9WB 2IQAA 3FRUA 2VISA 5HGAB 4BH8A 4D9QE 2WBWB 4NDMA 1I9JH 3QEUA 1HE7A 1EO8H 1EDQA 4ZMAT 1QVOB 1BVKB 5EU6E 5ACMA 1B9ZA 1GZPB 4GKOA 2AJVL 2DJSA 1NUNB 4NO0B 3BZ4B 3S96B 3RNKA 3KJ4B 1N7ML 5IVXA 4M1GH 4FS0A 2RB8A 5EG6C 3EOAB 2WZPD 3IDIB 2FX9L 3U4AA 1GGUA 1P4IH 1QLEH 3ARRA 3VFVB 3P11H 2C4FT 4DKEH 3LQZB 1AI1H 2HJLB 1FSKB 5CJOL 1QYGL 4HS8H 3HMWL 1S5IL 1JUFB 1U6AH 1LD9B 4FFZH 1VERA 3IF1B 3GMQA 3MRFA 1DLHA 4PJXB 4PLNC 4J1UB 2N1KA 1AP2A 5JXEA 1BZ7A 2JF1A 1YEIL 3IDNA 3FQXA 3SJVA 2EDHA 4J6RL 3KPOA 2Q86B 2FBOJ 2K1MA 4HWUA 4NKMB 4ZFFB 3ARDB 5D4QA 4DN4L 3FJTA 3B2VH 1J0YA 1YPZB 4JDTL 5DI8A 1AXTH 3ZDYE 4PRIB 3U0PA 1IT9H 3BUTA 1WEJL 4XXCA 4Q9BA 5I15H 1UZ6E 4ODWA 4U0RB 5H35A 1A9EA 5E8OB 2GJZA 1F4WH 3RGVD 1T66D 2YKLH 4K07A 1BD2B 1OPGL 1ZLSH 4UNTA 1IM9B 4JFQB 2LAGB 3L5XL 3SO5A 4X8XA 4LPXA 5C9JB 4Q74A 1U58A 3AS0A 3MA9H 5D6DC 2CRZA 4IOIB 4LVOB 2FECI 5F9OL 4KHTH 3PL6D 3RDTD 3FQRA 2NY2D 4YE4L 4HUNB 1JVKA 3LKQA 4WWKB 1OTUC 1U42A 5I1LB 2HFFA 5J6GA 3OKOA 1NC4B 1MELA 2YC1A 3GMPA 5CBAA 1TQCC 1NGQH 1ZHBB 4JY5L 1A6TA 2J4WH 4JFFA 1WBXA 1F58L 3MLUH 4G8GB 5KW9H 2EDFA 4YBLC 5DJXA 5MENB 1K2DA 1RIUH 2VDPH 1JN6B 5IUSA 1CGSL 1N2RB 4RWYH 2GK0A 2NY1D 1AGBA 4F3FA 3U9PH 4Y5YA 4WGWB 5LBSH 4MNGB 3BKMH 4BH7B 3QDMB 1BX2A 2EDDA 4YQXL 4MCYB 3GSNA 1D5IL 3VI4E 2NY0C 4UQ3A 1WFNA 3UYOD 5CGMA 4GXVH 4DCQA 3AVEA 4OD2A 3EOYG 1WICA 4UILH 4BFIB 2RFXA 5IQ7L 1OGTA 3S5LA 2AJUL 1CK0H 1MJUL 4F7EB 5ITBH 1XIWD 4Q58C 4AT6A 2WMPA 4YXLH 5BV7L 2XWBA 4WTZA 1JJUA 3FN9A 1VFOA 1YDPB 1ACYH 4MNQE 1U8NB 4XI5D 3S97C 4FA8A 3JWOH 1NKRA 2BHZA 1QR4A 5MEPB 4G7YH 4PP1D 2EXWC 4P3CH 1B3JA 2FEDC 4LEOA 4W4OC 1S7WA 4PY8J 3W9EB 2ZG3A 5FUCE 1UQSA 3WIFB 3L7EB 4Y5XC 3H9SE 5E99H 5C8JA 4XCFL 4MJ4A 5I1EL 3HPLB 2B4CH 2NY7H 4JG0L 4MA3B 4XCCL 1CR9L 3GM0A 3QEHB 3O3DB 4G8EA 1HKLL 2NTSP 5TE7H 2VZ1A 5I8CA 1KPVA 4DK6A 3T0XA 2RHEA 3U0TB 1P9MC 4P4KC 1KJ3L 5CZKA 4QGYA 4YHZL 5C0AD 1KCSL 3OKKA 1CLZH 1DN0A 1FBIL 4GBXC 3UC0H 3ARBB 3L3HB 5IB4A 2CGRL 3EO9L 4NUJB 2Y06L 1CDYA 1EHXA 3B2UD 5DRWA 3WXVL 5EU6B 1WZ1H 5FYKH 2X10A 3VXSA 3HC3H 2F8OA 4R96A 2YD4A 3VXUD 1GPOH 4X4MA 5K9JH 1KLGA 5DTFA 1OP5H 3N9GH 1T0MB 4YK4B 1VENA 3B9VA 4TOYH 4U1KB 1IKNC 1CZ8L 5AG9A 2PO6A 4F58H 4KMTL 5CZXD 4CADA 4GUPB 4OV5B 4GRWF 3IDJA 4IOFD 5GZOC 4K9EH 5DRZB 4CAGA 2IPTH 4NZDA 1G7IB 1TCRA 1VB9A 2Z4QB 2DQFB 1TJHL 2ESVE 5SWSB 1YA5A 5J0BA 5ADOL 4PRPE 2R4RH 4Z7UA 1MRCH 1J0ZA 1HEZA 4L8DA 1WQVT 5EORL 3VXPA 1AGCB 5D5MF 1FGNH 3IFOA 3VH8A 4I4WB 4DGVH 5FF6B 4OTXL 1YYLL 3ZMRA 3QJFB 5ANMA 2N4IA 1GC1C 4PJIA 1PKQA 4M6NH 3D87B 1U3YA 3QSKB 4KV5E 2EYSB 1NCWL 5EH1A 4DUXA 3EYQD 4OCWL 1SJXA 3QPQC 1ONQA 2ENYA 5GS1C 5EZJB 2E6QA 4PRBA 3KPNB 3K2UH 4PJFE 3E8UL 3O6KL 4XNMB 4WU7B 4JPVH 5DS8A 2E8ZA 2VQ1B 3NIDE 2DQDH 4KAQL 2AJSL 3RHWF 1ETZA 1ZK9A 3ILPA 1YMME 2E9IA 5DWUH 3WIHL 4OLYH 5F7EL 4FFWD 3SKJL 5K33A 1KXVC 3C6SA 2IMNA 1WBYB 4AEIH 2QSCH 3C8KB 3WFHB 4P46D 2XN9E 5E95B 3SKUD 1Q9OA 2NX5E 3P77A 3AU1A 5FM8A 4JB9L 3C2AH 4KZEH 3E6HA 1XF4A 3I9GH 4Y4HD 2O5YH 2EECA 4LEXL 2I25N 2Y6SD 4I3SL 9CGTA 4DAGL 2EE9A 4PS4L 2MPAH 3MBEB 1FVCA 4PJXF 4OFVA 4KK8D 1HYSC 1CLYH 1FYTE 4MX7A 1G0DA 1PG7L 4LSRH 4EN3D 2AJZA 4NKQB 3WDIA 4X6CE 2YD3A 1RHHA 4P49A 1SJEB 2VLRB 1CN4A 4QHUA 4AZ8A 3IETB 3PQYD 4KHXL 5BZDA 4GMSH 2ICEA 4JO3H 4NFCA 3O4LB 3S3PA 3ZLQC 2BNQB 3T0DA 1S7TB 4CNIB 3QYCA 2JCCA 4M9OA 1KB5L 4JVUA 3MACH 3BP4B 3F7PC 1UADC 2EIDA 3LEYH 4XCYA 3FCTB 3WN5C 1RIVH 1IGTB 4G8IB 2CDEB 3L3IA 4MNQB 5LWYH 4L4VA 2AS5M 1ZGLA 1FFQA 1KFAH 1MHC