1LO5B

Crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
188
structure length
188
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal Structure of a SEA Variant in Complex with MHC Class II Reveals the Ability of SEA to Crosslink MHC Molecules
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo5B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1lo5B01
4NQED 4OTXL 3WN5B 5E9DD 1JYWA 1X4ZA 3ZDZF 3VXMA 3PQYA 5T1LD 1A4KA 1KELH 3R8BB 5CZVL 2G2RB 1AH1A 5EU6B 1OAZH 3BDYH 4AG4H 3D18A 4JFYB 4S1SH 3KLHC 1KGCE 1XCQB 3CU1A 1OWRM 5CUSL 4M7LT 4WY7L 5IMMA 3MACL 1JPGB 5FUOL 1MCSA 3SKJH 4NHCL 4B50A 1AGDA 5DURB 1KIPB 5FHAL 4PJIE 3RQ3A 3ELAT 1FC2D 4NC1C 5IB5A 3INUH 2CRYA 4OZFH 3TLRA 5BZWB 5DQ9A 1I85A 1OL0A 2P8LA 5ICYB 5IGXH 5FYKE 1W2KT 4B41A 3FQTB 1E6JL 4U3CA 5F7HA 4ZFGL 2Q8BH 3DV6B 1B0WA 2NY2C 5IWLC 4OV5A 4R96A 5C2BH 1FAIL 1FVCA 1ETZB 1TZHA 5DD0L 5FHBL 4HT1L 2H2SC 5I2IA 4X98B 3DI2B 4JHZA 4LKCB 4EUPB 5DVNA 1EEYB 1UWXK 3ARQA 4I0PD 2OTUB 1AGEA 2F54A 3FKUS 4P9HC 1A7NH 2GT9B 5GGRY 4OZIB 4CN6A 5C70A 1Q0XH 3JWOH 4ONGL 2R0LH 1EJ6A 3U7AA 3OAUH 3OXRB 4I77H 3DSFH 2VRAA 4APQD 2GEEA 4K9EH 4MAYD 4L9LA 1ZGLP 4PRAB 1R3HA 2O61B 4U31A 4EI5B 3QISA 4PJGA 4BZ1H 2B5IB 3F7PC 2XV6B 1NGPH 1J0ZA 3CXDL 4MA3B 3TJEH 3VFVB 2YXMA 1VPOL 3HG1D 2XYCA 5IMOB 4M9PA 2FJFB 1M6OA 3BGMA 1KGCD 3HZMB 2HFGL 1YMMB 2HKHH 1J0IA 4DVRL 4NUGH 1DBBH 2WIMA 2AI0H 5KSBE 3RUGA 1J05A 1RVFH 1A4JB 4U3HA 1ZTXH 5BO1H 1RU9L 3TZVD 1ONQA 3KPSB 3UYPA 5IJKC 1AXSB 1RK1A 5DJCA 4QTHA 4HJJL 4UDUB 4OGXL 1WV7T 4YEFA 1R24B 5FYKD 3EHBC 4WFEE 2V7HA 5I6XC 4KJWD 4TVPE 1XCTA 3TCLB 5C3LD 4PRBB 1YEDB 4K2UL 3QDGB 2ZNXA 1F42A 3UTSA 5I1KH 3AMLA 5I8KH 2IWGA 5SWSA 4D0DA 2EDYA 2AABH 5E5UB 4R90L 2PXYC 1D5IL 5KW9L 4GG6B 3O8XB 1H0DB 3QDME 3ULVH 1VFBA 1FBIH 1DVFD 1QBML 3WJLC 2PW1B 2CK0L 1ZK9A 4GG8B 4RMQA 3WXVL 4X7TB 1A6AA 5DJAB 4PJ8D 4RFOH 2R8SL 1G7IA 2V6HA 4PP2A 4NT6B 4F7TA 5KSUB 4P3WA 2UYLA 1DBJH 2B20A 4OCWH 2YPLB 1QFWM 5D2LE 2P5WE 3IDXL 1TLKA 3KPMB 2VR4A 4GMSL 1ITCA 2COQA 3HHRB 5E6YA 5DHXB 4FQQA 4WW1A 4P3DA 1X6LA 1N5AB 2VDMH 2WBWB 3GMNA 4JZJA 4YQXL 3U46A 1VGEL 4XCCH 3PABA 1QLFA 4JZOB 2IQ9H 2W9LA 2VLJE 3QUMB 1A7QL 5D96B 1SJHB 4WWID 5KANI 4OQTL 3OGCA 3TEUA 4J3XA 3VGGA 4HWBH 4DTGL 4ZPVB 1PAMA 1A7PH 3FFDB 4LLVB 2FZ3B 5DD3H 1BIHA 3RX8A 1HXMA 2EZ0C 3UZVB 1A6PA 4RWHA 3E1F1 3QI9D 5HVHC 2ZCLL 1RFDL 2AXHA 3CFCL 2JELL 4WFED 4MDIA 1LEIA 4ZDHB 2J8HA 4KVCL 4TVPD 4OGAD 2VERN 2PW2A 4R4FL 5E6IC 5I8EB 1LP9E 3ARDB 4LKXB 1II4E 1KNOA 3VWJD 4DGVH 1L6ZA 4YBHA 5D7KE 1DCLA 5T1MB 4NKIH 1NL0L 1NBYB 4Y4KC 2XNAB 3OR7A 2DD8H 3TBTA 2UZXB 3FCTA 4ISVA 3ZTNH 5KTEH 1UKQA 4BQBA 3THMH 2Q76A 1G7PB 4KDWA 1TJHL 3H9SB 5JR1H 1WFNA 3DV4B 3RZCA 3GMOB 3MRMA 4WV1A 3QDMD 4OI7A 1Y18B 3SPVA 4XGZB 1S7UB 1AY1H 2FB4L 4LNRB 1G6RB 3RWDA 2WBJC 2DM3A 3G6JE 1TCRA 4N8VA 4R8WH 5JW5B 1ZLVH 4TULL 3TNNA 5GRJL 2ICWB 5BS0E 1T89C 2P5WD 5F7WC 4Y2OA 1HHJB 4O5LH 3UBXB 4JDTH 1QNZH 1YEJH 3LVEA 3L7EB 4PRIE 2HH0L 4PD4J 3U7YH 3DYOA 3PHSA 3JVGC 2VC2L 3F7VB 5TQ0H 4OLYL 1CFSA 3DRQB 5E8OA 4FNLH 1I1AB 4OD1H 4G8GE 1CVSC 1U58B 1U92A 2F58L 4P46A 4UBDC 1ZT4B 2VLJD 1P6FA 2FIKA 2FHBA 3REVA 1OB1A 4EXPX 1S5IH 4I0PC 2E8YA 3CC5B 1QHOA 1IGTB 4NUJB 5ANME 5HGHB 4HF5L 3AB0C 4LEXL 4LCCA 4JFEB 2NY7L 4NZRH 3HNTH 4ODUA 4JREC 4BK5A 4MJ6B 4OGYH 2AJSH 1BQHG 4MAYC 5GGVY 5D7KD 5FKAA 3CH1A 3LY6A 1CFVL 3GJFH 4JPIB 5LWYH 4YHYB 4X7CC 2HT2D 4BFEA 4O2EA 5IFAL 2ARJB 2RFXA 3KLAA 1LE9A 4X8JA 2EDFA 4TVPL 4W6XB 4G7YL 3RVTC 2OJZH 2PO6B 3ULVF 3BPLB 5EU7C 4JDZA 1LO4L 1L7IH 5FB8A 5B3JF 5DJDB 2X1WL 4E0RA 5JO5A 3D3VA 3KXFE 1MCCA 4LL9A 3W2DL 4X7SL 4GW5B 5BS0D 3TZVC 2GQHA 1N4XL 2OM5A 3PNWB 3EAKA 3G04B 1LWRA 1P9MA 1K8IB 4OF5A 3VG0H 1K4DA 2MCPL 5DQDL 3C6LB 1K8DB 4KJWC 5HYQA 3T3PF 1V3JA 1JPTL 15C8H 3R06A 4JAMB 1YUHA 4FZ8H 4OT1H 3OJDB 2ORBL 3HE7D 4G8GD 2WAHA 5DO2D 2OZ4L 1T6VN 4MA8H 3MLVL 5D71H 2VAAB 4YZFE 4NCDA 4MWFB 5BZDB 5EU6E 4ERSL 3GSVA 2DWDB 4U1IB 4HEME 4MNQA 3KGRA 5FKPB 5L7XL 3P77A 3DTXB 4Y1AA 1TQBB 3TJHD 3LIZL 2HT4C 4XPFH 4I48B 3IFLH 4I18C 4NFBA 1I8LA 2OL3H 2OXHA 1NUNB 4OM1H 2V2TA 1JF6A 3U1SL 2DJSA 3MRPA 5C0GB 1FNHA 1T4KB 1BIIA 3BKJL 1QQDB 4RNRB 4OB5L 3IDUA 3QXVA 2ZKHH 5TDNA 5J4MA 1KOAA 5CHNB 3H3PH 3LH2L 4E5XB 5F9OL 4GXUN 5MI0C 1U3HB 2R4RL 4F9PC 3K1KC 3MFFB 2Q86A 2CLVA 4ODWA 5KVEL 3LV3A 2HA1A 5ADOL 5F1KC 1PY9A 4NQSB 1KTLB 3KXFD 5FM8A 3HR6A 1P84J 1J18A 1Z9SA 2XTLA 4XC1H 3ZKND 3W11D 4N0UB 4HUWA 2V5RA 4OFDA 2ATKB 1KIRA 3GSQA 3ZYIA 4RMRA 1YMHA 1QEWA 1R3JA 2GIYA 4OZIE 4KHXH 2CRMA 2NY4B 3GSNA 4JFPA 2OTPA 3TCXA 3D0VB 3V6FB 4OGAC 2VITB 4NWTH 3CVHH 1HI6A 5T5FL 1F13A 3VWJC 4XCYA 1LDPH 1NPUA 4P5KA 1SY6L 2GTZA 3BAEL 4DEPB 5E7FA 3P0YL 2EYSA 5I1EH 3NIDF 1MCKA 1D6EB 3MCLH 5IMLA 5I19H 4K3DH 5EU6D 4NO0A 3V2AR 1KCKA 5BRZA 3SQOL 1WF5A 1YMME 4QHKJ 1CE1L 1MCJA 1SM3H 1IT9H 1UCTA 1KPVB 2Y7QA 3ILPB 4KI5F 2HJKB 4XCEB 2LV4A 4LARH 2B1HH 5HHXH 4P2OA 4HUUA 1BOGB 2XKNB 1OGAB 5DURD 3RIAK 35C8H 4HCRL 5CP3H 3TH4T 5C9JA 1WZKA 2JTDA 4JHAH 3BKMH 1K4CB 1XGQB 4H26A 4Q6IA 2ADFL 4PUBL 2DTML 4M6OH 2OK0L 4KH2A 3BPCB 1J9CT 3VFSA 4L3EB 1FORL 3D85A 5I9QC 3UJIL 3MGTA 3OX8B 1JHKH 3QDGE 5JIPA 2C9AA 1HZHH 1UEMA 1REIA 1TFHA 5ERWB 3VXRA 3FL7A 5MEOB 4GG6E 1MI5A 1WQVT 1MAJA 3UJJH 3WXWH 4GMTL 1T20A 3BP4A 5DUML 4HS8L 4GBXB 4NM4L 1CT8A 4YHIB 3S34L 3LKRB 3T2NL 2H9GB 1KXTB 5EA0L 3NCJH 2ATPB 4KUCF 1J1XH 4HKZB 2EKJA 1ZMYA 3DUUA 3D5OF 4HWBA 3U9PL 5FO8A 2VDRL 5JW4M 1KTDB 1SJVA 4PY8I 1YYMH 4EI5D 5D1QC 3UXFA 5L6YL 4WFGE 1ZS8B 2WV3A 3RWHB 2YPLE 4LLUA 2Z91A 2CH8A 2HT2C 4NO2A 1T0MB 1AC6A 4MXVE 5FYJH 1ADQA 4OSUL 7FABL 3KHOA 1I8MA 4H1LH 2DLEA 1JNHB 3MNVB 3PHQA 25C8H 4IOSD 4MNHB 5SWZB 5TFSH 2RGSA 3VD7A 2YKLL 4F37F 1YMMD 1ZA6B 3C8DA 1GAFH 1YNKL 1NLDH 5HJ3B 2IPTL 3O2DL 4TSCL 1K85A 2ICWI 3MYZA 4HLZH 4Q7DA 5AYQA 1BGXH 1UADC 3ZKXC 3QJHB 4GKNA 5DT1L 5CFHA 4R26H 5GGSA 2A6JA 1HK6A 5I1LA 1NCCL 1M7DB 5J12C 2I25N 3D25B 1E6OL 4N8VG 3VI4F 3OB0H 3HRZB 1DANT 3RL2A 1FLRL 4Y8AA 2P24A 1DN0A 2VAJA 1ZHBB 5C0DB 4YDKL 3IJSB 3GK8L 2VN7A 2VLKA 1OWWA 4MHHI 4Q9BA 1CN4A 5D8JL 2DQUL 1EAJA 4NZTH 5EZLB 1V8HA 2N7AA 3C60A 3A67H 3SGKC 3EOAB 3QDGD 5M95B 4ENED 3MOBH 4RIRA 5T5NG 1A1NA 2FX9L 3HE7C 3BP5A 5DJXB 4JHWL 5ACMA 1QSEA 2NY5H 3H9SE 5CGYD 1OP9A 2UZYB 4K8RD 1BQHB 4HDIB 3MA9H 5DMYA 3BD5A 3W39B 4WUKL 4A6YH 1JMXA 2VWEC 5KS9F 2X9XA 3E6HA 3SDDB 4NKMA 4FTVB 1GZQB 3C5SB 4PV8A 1SEQL 4XP9H 4R97B 3TJHC 1OAXH 2KBGA 4KQ4H 4KKLD 3UEZA 3ZYJA 2DQGH 3PQYB 3AREB 3MUJA 1A4KB 3ZZ1A 4WFGD 1RHHA 3DWTA 2YPLD 1NEUA 3D18B 4ZUTA 4TRPH 4QXWA 4P57B 4WUUA 1G7JA 1UWGL 4OIBA 2ICCA 2GHWB 4OI9A 2DLGA 2B8OT 1HSAB 4U6XA 5GS1A 3RWGA 4YJZL 1F3DJ 3EO1A 5HI5D 1EAPA 3SDAA 2R56H 3CU7A 2R2BA 2UUDH 4G3YH 5DJ8A 5EN2B 4M7ZB 2PN5A 4K07A 5LKNA 2X4RA 3UO1H 3GNML 2P8LB 3EOTH 2N7BA 2YD6A 3AS3A 1NGYB 5DRNB 3U0PA 4F33A 1WCQA 1L0XA 4OV5B 1QFOA 4R96B 1HHHA 3CSGA 3QIBA 1HWGB 4JFEE 3FQWB 2D03L 1I8IB 4PLJD 4HIXH 5GPRA 5LQBL 1JZ4A 3G6DH 1JN6B 2H32A 4KAQL 1JYXA 4BH8A 3ARDD 3CXHK 2P7TB 3C5ZB 5DRXB 1RULL 2F54B 2BHZA 3WN5C 4QXGL 1FCGA 2CQVA 5EIIB 4XNZB 3H9SD 2J4WH 1IGFH 3BMWA 5ITBH 3L3IA 4N1EA 1K3IA 3QCVH 2VR9A 2NY3C 1LE5A 2KPNA 3V4VH 1FPTH 1NDGA 1SYVB 2AGJH 3MREA 1U8PA 2E7CA 1MY5A 5H8DA 4N0FA 2HYMA 4K8RL 3U9UB 2XWBA 4ZS6D 4KGJA 1S7WB 5FO7B 5EG6C 4LCIH 1OLZA 4PJFB 1ZHLA 3SKMA 4WJ5A 4M5ZH 3OJMB 4FFZL 2OL3A 3I6GA 2FRGP 3GHEH 3P11L 3HS0B 1J05B 4QRTA 2HRPL 5I17B 1XF2A 5EO9A 2J6EH 4DGYL 4TVSa 4YE4H 3WHXA 5IBTL 1IAIL 3S88H 1ONQB 1I1AD 3D39B 3WMSA 2YN3A 5DJCB 1RK1B 1BPVA 1G9MH 4L9DA 1UB6B 4X9HA 1MOEA 2XTJB 1DQDL 1NFIB 4Y4FA 4E41B 4X80L 1AQDA 1XIWB 1A3RH 1I7UA 3HNVH 2BHYA 5ETUA 1ZANH 1OY3B 4NRXA 1KJVA 4JFED 3UTSB 2R4SH 1FGVL 3OKNA 4FQCH 5SWSB 3I50H 3VG9C 4QHLA 5KS9A 1BAFH 2EDTA 4Z0BH 1T2QH 2R1YA 1RJLA 4YBLC 1CDYA 4EI5C 4R7DB 2R69L 2B5IC 5HDOA 3ETBF 4TPRH 3EDFA 5DLMH 5E8DH 1CL7I 1JRHL 2P8MB 3AY4A 3RVWC 2DQHH 4JFDA 1KJ2H 3BRDA 1IGJA 5I1DB 3MRCA 4C83B 1BVKB 5HYSA 4PP2B 1AQKH 3KWWA 2UUDK 2XZQH 1RZFL 5J3HD 2UYLB 4LAQH 2WUCH 3SCMC 1P2CA 1CZ8H 2BVUA 3SKNA 1N59A 3QEGL 2W9EL 3ZL4L 2A6DB 3SY0A 1LO5A 3ESUF 3VA2C 3HZYA 5DK2B 3GIZH 4FQQB 1PYWB 4N0UE 4PJBB 1G6RL 2WUBL 1X5JA 5AWNL 1YEIL 5DD5H 2IQAA 4ZTOL 3ZMRA 1G9NL 4Z8FH 1IC1A 4IRSA 2VUYA 5GGTH 3PABB 2W38A 2YHGA 1RIVL 5CP3A 3C6LD 3OL2A 4YFLI 2CJUL 4U1GC 1JGEA 5I1HH 3OGCB 4JFFA 3C5JA 3B5GA 1W72L 3DMMC 2G9HA 3DROA 1J1OH 4XMKL 1HXMB 4WGWB 1ES0A 3KR3H 3VGFA 4L29A 4DKFL 2I9TA 4GQ9H 1V7ML 5CGYC 4K8RC 5CJOL 1AR1D 4MDIB 2H8PA 1UVQA 4NO5A 4EZMA 1JMZA 2PW2B 4V1DB 5IB3A 5CBAA 2I60H 2B1AH 3FO0L 2DLHA 3H8NA 3OR7B 2VIRA 4RFNB 5EOTA 4PLNC 1NCBH 4WDIA 5F6IC 2W92A 4QF1A 1OGAE 2Q76B 4KKLC 2H1PH 3RPIB 4PS4L 4WV1B 3LEXA 4CVXB 1EGJL 4HLJA 1MWAH 32C2A 2W9DL 3W82A 3VFPA 3HNSL 2Z4QA 5J9PA 3DVNA 3ZKMD 4GAJL 3ULUH 1MRFL 1BQLL 1FJ1B 5IROC 1D7FA 5SX4H 2WW8A 4L3EE 5D72L 1U3HD 4OCSL 3BIAX 4OAWA 3BH8A 4ZFZA 3RNKB 3TNNB 3S3JA 3MLZL 4KDTA 2ZG3A 2X4SA 1M1SA 2ZNWA 4H1LA 3BZEA 4JPWL 2GK2A 1A3QA 2BNRB 4QRSB 1A6TA 2RJMA 1TVHA 1FO0B 2ZUUA 2VSDA 5D96C 2IPUK 5DD1L 4QRPB 2AAVA 2MWCA 1VCAA 3MCKB 3GI9H 4WI4A 1CGTA 3D9AH 4J2XA 4YAQB 1CXHA 3MZGB 4LLQA 1B90A 1CFSB 2F5BL 5E8OB 1F00I 2NY4D 3IDJB 4PJ9D 1U92B 4O2CB 1NAML 4PLJC 4RAHA 2FIKB 4D0CA 1RJZA 1CBVL 5GISL 1OF2B 3ARDC 1ND0A 1EHXA 4K3GA 2CUMA 4LSRL 1V5JA 5J57B 3O3AA 1JUFB 4OFVA 5DRZA 2ZUQB 2G5RA 1MHCB 4ODUB 4GKZA 4KZEH 5SWZE 1S9KC 4X4MA 4TUJB 3ARYA 3U48A 3UJTL 2YSSA 1S7TB 2Q87A 4KZDH 1G9NC 1EFXA 1FRGL 4BSWA 3L3KA 1VFOA 1BF8A 4WI3A 1OGAD 1JWMA 2OQJA 1CGUA 4U1MB 3CUPA 1KEML 4Y88A 2HFEA 3PUCA 4IIQA 2BY2A 4JGJA 1UM4L 1AFVL 3KLAB 4ZS6C 5IBLD 4UQ2B 4LGSB 5JPNA 1P6AB 3TESA 1DL7H 2IMMA 1HE7A 5BW7C 3U4EA 3TVMA 4YHPB 3VXPA 3MV8B 2BDNH 1MF2L 1XGYH 3QHFH 4AEIH 4YEEA 2VKWA 4E0RB 4L3ED 5JO5B 3BGAA 4F57L 1Z9MA 1TTFA 4NKDA 2E7MA 3ARBC 1A0QL 4CU8A 1S7XB 3RI5F 1T1YB 4NP4L 4DGIH 2N56A 1DQQA 1N0XH 4JANB 4G7VL 4F7PA 3ILQC 2F53A 4OIIH 5FGBC 1ORSB 1K4DB 4TSBH 2VXSL 3HAEG 4LASL 4GBXD 3STZA 1K2DB 4FTVE 3TT3L 1JYVA 4Z7QF 1RZKL 5MP6L 4MJIE 1EUUA 4M93B 5CWSB 3D48R 2R9HC 3MV01 4WVRA 3RGHA 1UQSB 5LBSH 3PQYE 5AAMA 3D0LB 3L95B 1Z9LA 2ZZUT 3MRRA 5F7DB 5I66B 4YHKH 4WU7A 3GSVB 4MNQB 4RSVA 4YHYC 2MQ0A 4XPGL 1PKOA 3VFNA 5FDWA 4Y1AB 1RIUL 3O2VH 3S35H 1QFHA 4IRJC 2ESVB 4WCYH 1QRKA 3O9WA 5SWZD 4LSQL 4YHMH 2V2TB 4G6AD 4X6BA 3BPLC 1G7HA 1UM5L 3UTQA 4QY8B 4P3CH 3MJ9A 5FCSH 5J3HC 3MRPB 4XHJC 4HH8A 1D6VL 3T04D 2H2PD 1T6WA 3TA3A 5HGGS 2X4TA 4HPYL 2AJVH 5E4EB 1P4IL 2VQUA 1JE6A 4XT1C 1MRCH 1I8KA 4ODWB 2RCSL 5EWIH 3LV3B 3K8LA 3ULUF 5C71A 3FT3A 2EIZA 2ZG1A 1M71A 3C6LC 2OMBA 3HMXL 3GMRA 4DQOL 1MHPH 2F54E 3GGWA 2QLVB 3GSQB 1CLZH 8CGTA 3QWRA 1YMHB 5AEAA 3ZSTA 2WK2A 1H3PL 1QEWB 2EEAA 4P4KD 3ABZA 4F58L 3M1BB 3RIFF 1LQSR 4JFPB 3BW9A 3GSNB 5T1KB 1AR1C 5C0CA 2X6MA 3M45A 3DSNA 4FTVD 2R23B 3MTRA 1FL5A 3F5WB 3OG4B 5T33L 4XCYB 1TQBC 1VEOA 3GSUB 4Y16C 5E2JA 4MJID 1T03L 4Z18A 5I16A 2EYSB 4WEMB 5K59F 4QHKI 3PQYD 4J3OC 1QYGL 1YEHH 3ARED 4CVWA 4YXLH 4G80B 1MELA 1N64L 4PJFE 4O58H 2VQTA 5BRZB 2HFFA 4ODTL 2F9BT 5D6DA 2FLBT 1AD9A 4P49A 5EORH 3T77A 3CK0L 3EYFB 4GRWB 3ZKMC 1E4XH 1DEEA 4PJAF 3FB5A 3NPSC 4LEOB 2AW2A 1EEZB 1PZ5B 2A83B 4IOIB 4X4XA 2C3HA 5LGHL 4BZ2L 4XP1H 3H7BA 4JN1H 3EYUL 3D39E 1RZKC 4JZNB 4D3CH 4UQ3A 1YJDH 2XTJE 1Q9OA 2DTSA 4Y19E 1QRNA 3VRLE 4LRNH 4E41E 4XNXH 3BT2L 2QEJA 2C7UA 2NLJB 3D85B 5JW4Q 1JNLL 4Z7NE 3UX9B 2FHFA 2X70B 2E7HA 3FO2B 3UTSE 5C0EA 4PJ9C 3VXRB 3BYTA 5CD3B 1VFUA 3C5ZD 5KVGH 1QFPA 1MIEL 2F54D 3EZJB 2DRUA 4DVBA 5K9JL 3V6OC 3EYOA 1MFEL 4IDJH 2ZSVB 3GZKA 1WZLA 3LS5L 3O6KL 3NAAL 3AC0A 1MH5A 3IAPA 3MUHL 1NCWH 1YNTA 5F6HJ 4W4OA 3NVQA 1PG7H 5FO8B 3D6GA 1FL3A 3PWVA 3N9GL 3TFKD 2A9ML 3F12A 1D5XA 5IVXA 1J11A 2FECI 4BFGA 4XP5H 1IC5L 4ELMA 1OARL 5H2BA 4PIRF 1CLYL 3GSXA 5DDHA 1YEFH 4HEPG 1A9EB 3PXHA 5IBLC 4WW2F 4PJBE 1CICB 4LCUA 2DLFH 3ARPA 4U6VL 4J3SA 1FFRA 3CVIH 1VESA 3G5XB 3F8UB 3PL6C 3NBNA 4LLAA 2YOCA 3E8UL 5C7XH 2A6JB 3JTSA 5I1LB 3FQRA 1A6VL 3CXHJ 2ZCKH 3IFPA 3SE8L 1ZLWH 4JPKH 3FQXA 3D39D 5F9WB 3WYRA 4JRWA 1J88A 2ZUWA 4BFIA 4PG9A 2FO4A 1F90H 2XTJD 4LSSL 4Y19D 3NZHH 5HYEA 4LAJH 1HXYA 4E41D 3PWNB 3QDJA 1XIWD 2EH7L 4DKDC 3K80A 4NQDB 3DLQR 2W07A 4V1DE 3C60B 2IH1A 2FCBA 4GBXC 4HIHA 5FA3A 2DMKA 5HHQB 2AV1A 3GHBH 3MMEA 4M7JL 4NFCA 5DEZA 5CUSH 1QFUH 1DTUA 1CFQA 4ZAKA 3O6ML 1KB5B 3TO2A 4U6YA 1DUZA 3VD9A 4NHCH 3QQ4A 2N4IA 4XRCA 1LD9A 2EDDA 3E6HB 3SE4A 4PJXF 2CR3A 2CIIA 3SO3B 3STLB 3F7QA 1EO8H 5EOQL 1AHWC 3PHOA 1FDLH 1EHNA 5IB4A 3EW3B 3P9MB 1NFDF 1WFUA 3U7WL 3DO7A 3L5WA 1DANU 1FFPB 5EC1A 4GO6B 2QQLH 4ZUTB 4ZFGH 3I84A 2BNRE 4WUUB 2BSSA 3MO1A 2H2PC 2YRLA 1S5HA 3WLWD 3B9EA 1N5YL 5DD0H 1JHTA 5FHBH 4G8FA 4QRPE 2ZUYA 2EIEA 1U9KA 2ICEB 1A8JH 1MCNA 3S3SA 5FECB 3VFGL 4YDLB 3ARFC 5GS1B 1GGCH 2LU3A 3EO1B 3PV7A 1EAPB 3SDAB 3QA3B 2IADB 4W68A 4XPHH 5DJ8B 4OZGF 1OP5H 2EYRA 4UIKL 3SBWC 4M02A 3HAEB 3T65A 1QA9A 1UXWA 1LMKA 5I71C 1J87A 3OKEB 1F4AA 2FEDC 5INDA 1C08B 3HI5H 1CGVA 3AS2A 2GCYA 5C0IA 1U8KA 1HHHB 4P4KC 3TWCH 2DJUA 4GLRI 1JZ6A 4RAVA 4KY1L 2H32B 1NDMA 4V1DD 1DP0A 3KVQA 4XBEL 3S98A 4XWOD 1IJ9A 3UTZA 1RK0B 2PYFA 4R97C 3O3BA 3V52H 3OBAA 4JFOB 1GYAA 1EXUA 3TT1H 4KUZH 3L3JB 3WUWA 1FZMB 1IEAB 2CO6B 4QOKA 4XNQA 5DR5H 1HKFA 2OSLB 2V2WA 4M1DL 5TDPA 3RWJB 4BYHA 5IP4A 2HLFC 3HPLA 5JUEL 3Q1SH 1SEBB 1XEDA 1TDQA 4Y5YA 3MV8E 3JV6B 1EEUA 5TPWL 3BOVA 4YR6B 2MCG1 4HJJH 4N0FB 5ALCL 1ZLWK 1UZ6F 3VDBA 2XWBB 1OAUL 1JHLH 3MYJA 4NO3A 3FMGL 4AL8H 2ZUSA 2BERA 2NZ9D 2BNRD 2QBWA 2C5DC 1CFNB 3BGFB 1PG7W 4R4ND 1MAML 1JFQH 1JNJA 5D1ZA 3SKUD 1KN4L 3KYMA 1IAKB 1NMCB 4JKPL 4QRPD 4J3TA 2UWEF 5CSGA 1PFCA 5HXMA 3DX8B 4FZEH 5KW9H 3H9HA 1DFBH 1U8NA 4PGEA 3IAGC 3VJ6B 2E7LC 3MX0A 4OJFL 1EJOL 4D9LL 5L8KB 2CK0H 1ITBB 2C1OA 4H88H 4ONOA 3WD5L 3N1PC 4FFYL 4Y4FB 1AQDB 5K9KA 1R3IH 4X6FA 4MNQE 5ETUB 3BQUC 2WBKA 4UILH 4XNZC 4Y1AE 3Q3GB 1X5GA 1KJVB 2VZTA 2ESVE 3MNWB 1JF5A 2I5YL 3OKNB 3OB8A 1X3DA 2F8VA 3O3EB 4G5ZL 2MMXA 5IB2B 1KXQE 3IF1A 4FS0A 4PJXA 5JOEA 5DGRA 5CILH 3MRLB 3JV4A 1RJLB 3PP3H 5FM5M 1BBDH 4IS6A 4HKBB 4PRNB 5JW3H 1VENA 3RU8H 1FH5L 1U8MA 3MRHA 4EN3A 1HH9A 1VERA 4JFDB 5EUOF 5D93C 1N6QH 5HHVL 1MFDL 3VXTA 2IPUG 3MRCB 4M7LL 1XF5B 1KPUB 1NCAH 4OQTH 1P7HL 3DX9A 1OP5K 3MV8D 5DYOA 1P2CB 4WGVB 1N59B 3TBWA 5CEZE 5DEFA 3SY0B 3HC3H 5IEHA 1MJ8L 2LVCA 5INCA 5HYJD 2MHAB 3CFCH 2X1XR 4LBEA 2IQAB 3MQIA 1URLA 3BRGC 3KJ4C 1KV3A 3O81A 4JN2A 4QRRB 3VRIA 3TN0C 3OV6A 3HLAB 5I1IH 2A6KB 5BCAA 5FYKH 4KDVA 2O5YL 2I07B 3FQNB 2WINB 1U8HA 2G9HB 3DROB 3PE9A 5E95B 5E2UH 3QXDB 3BP7A 4PJ7A 2JJUA 5IHUL 2YUXA 1FO0L 3MV9A 2YMXH 2CLRB 2EH8L 3N85L 4L29B 3GI8L 5F7YC 4OFYA 1Q9KA 3FB8B 2NY0D 1GC1C 3QRFM 1RURH 1UVQB 2X44D 4XP4L 4MNQD 1E4KC 2AJYL 5BRZE 5IWLA 3BMVA 4HAGA 4Y1AD 5ITFB 4TULH 1GXEA 5TE4H 4P2QA 2ESVD 2XY1A 2Y06L 5L8JB 2R0ZL 4GRWE 5DUBA 4Y4HD 4P9ML 4FQ2L 3L5XH 2F74B 3UTTE 2W0FB 4QF1B 3IDNA 4WHTB 3QUXD 2C1PA 5C0FB 1YA5A 2BNQA 5L2JA 1HSBB 2LQRA 4ZG1A 2CIKA 5IW1A 4HKJB 1CD1A 5ISZB 4JPVL 2BVPA 3DJ9A 5J9PB 3QO1B 2BNUA 4H0GA 5JQ6L 3OKOB 3CZFA 5DMIL 5IIEA 1ZWIA 4OFKA 3OAZK 4ZUSA 4S2SA 1A14H 1UEYA 5JDJA 3C08H 1SBSL 4ZFZB 3BH8B 4H5SB 5CLTA 2X4SB 1GSMA 5HY9A 2UWEA 3BZEB 5FEBA 2YK1L 4RA3A 4HF5H 3DUSA 1YEGH 2WQ8A 3DGGA 3EFDL 3VXRE 2VB5A 1EMTL 2WLZA 3BHBA 2YC1A 1DLFH 4O4YL 5HGAA 3BH9B 4X6CF 3WL9A 3NZ8A 1D5MA 4O02H 3MV11 3QFJE 4OIAA 5AZEH 2J88H 1WAAE 3BFOA 5DK0B 2B39A 2VLME 1BFOA 4KPHH 1T2XA 5T1KD 2ARWA 5EU3A 5IFAH 1EERB 1RJZB 5E1AA 3E6FA 1HCFX 1G0YR 2L4OA 2VXQH 2MJWA 1NLBH 1GPOL 1MCQA 3KPRA 5IJKA 1FLTX 5F8RC 4RFNC 3VGBA 1NGWA 3MV7A 2FGWH 1UB5B 1QO3A 3B43A 1YDPA 4EVNA 4PV9A 4MZ2A 2EXWD 3PXJA 1NMBL 3JWNC 2YSSB 5EUOA 5GGQL 1LO2L 2OP4H 3UTTD 1B88A 3R1GH 2PXYA 3ES6A 1OSPL 5C0RH 2HFEB 4ODSH 1FNEA 1T22A 3OKYA 1PBYA 1IZJA 1BOYA 3DIFA 4W81A 3CDCA 3QZWB 4Z5RB 3WJLA 4NJAH 1F2XK 2NZ9C 3L7FB 1JPTH 3WS3B 1B6DA 3TVMB 3U4EB 4JRXA 4R4NC 3VI3E 2DF3A 4M43L 1C8PA 1JTOA 2LAAA 3O6LH 4NQDE 5IW6A 4HJGA 3D85D 4LNVA 4ZYKA 5I30H 4AIXA 4EOWL 3DHMA 2NY1B 4DKEH 4Y5VA 3VH8G 4JVPA 2A9NH 2GITA 3B9KB 3TV3H 1MAKA 3FTGA 5DGQA 1FGNH 4L5FL 1DQQB 2AV7A 4LGPB 3VXRD 4F7PB 3H2WA 2NX5E 4CW1B 1R3LA 3CMOL 1P69B 2F53B 2VE6B 1HQRA 3QRGL 3LQZA 5H35A 4FXGA 1MLCA 3TGXA 4X6EA 1M4KA 2FH8A 2BY1A 1I3GL 2ITDB 3QFJD 4KVNH 3GBNH 2NZIA 4G8EA 4WHCA 2VLMD 1TPXB 2MQ3A 2VDOL 1ZSDB 1NBZB 2DQIH 3AUVA 3HUJB 4HD9A 3UMTA 1LO3L 1DSFL 4WU7B 3V5HA 1ZEAH 5BXFA 3OR6B 4ONFH 1CDUA 3VFNB 2AJZB 4CGTA 3K8KA 2R0WL 1B6UA 2R4RH 3P9WB 3KNBB 3FN3A 1TJGH 1WIUA 4HXAL 4LQFH 1IAOA 3SOBH 5E6IA 1CICD 5HHNB 5HBBA 5EO0A 2HTKD 3WUWG 2WSKA 1QVOB 5I1AA 4Y4KA 3PJSA 3AROA 3RP1A 5HDBF 1UXSB 2V5SA 5IHZA 3TA3B 2ENYA 2XKSA 5T1LA 2EKSB 3UZQA 1IGIL 3K46A 3FFCB 2X4TB 4ZOAA 3ZDXE 2M8XA 2OYPA 2X4PA 4LDEB 4Q9QL 1I9RH 3MLTB 3QQ9D 4NQDD 4KHTH 4RGOH 3FT3B 4JFQB 1KYOK 4R3SA 2NQCA 3GSOA 5KSAC 1A22B 2Y36H 3GMRB 5J7CC 1T89A 4MQXD 3LDBC 3UPCA 5FUZH 1VACB 3IB4A 2NX5D 4HS6B 6FABL 1EDQA 4NN7B 5HYIA 5J6HB 2DYPB 5ESVA 4K3EL 5FUCE 5KSBF 3BW9B 2NY0C 1EIBA 2AKRB 5IEKA 3JVGA 4BA8A 4BH7B 3QHZL 2UY7A 3TH3T 2X2YA 3QT2A 1FL5B 3U30B 3ARVA 1ZXQA 2WANA 4Y4HC 3V8OA 3CH8A 2HJFA 4KJYA 3GFUA 3QUXC 1T3FA 2HKFH 3MOQA 2W0KA 4I0PA 1CK0H 4JY4A 5H94A 1I75A 5LCVH 2A73B 3IRPX 3D2UA 2HFFB 3T77B 3QPXL 2VN4A 3NOIA 1XGTA 3T0BA 3WE6A 5I8CB 4OCRL 3BVNB 1G0XA 4MAYA 3FB5B 4QYOA 4PBXA 4NZDA 5E4EC 4X4XB 5FCUL 5HYFA 4GMTH 1NEZG 1JTPA 4F9LC 1KTRL 2MFNA 5ICZA 5D7JC 2B0SH 3NCEB 4NHUB 5I8OH 3HG1A 2AEWA 3KPPA 4P23B 5EIVA 4OQTA 1WICA 1R0AH 4HKXA 2C7UB 1CU4H 1S9XA 4LLYA 4ZFFA 5L6YH 2R2CA 1JGUH 4MX7A 4TNVK 4XNYL 4J3VA 4TUKL 1S7RB 5D2LF 4PJIA 1NCNA 2F19L 3RPKA 4N5EC 5F6HI 4TTDD 3TZVA 1CXEA 4N9OB 5CINL 3CJJA 3IKCA 3S4SA 1ODAA 1WZ1H 4Z0XA 4HWZB 1QBAA 3MXVL 1I1CA 3CGTA 5GRUH 1YNTB 4JFDE 3SJVB 1BQUA 3QCUH 5B8CB 1FL3B 3GMLA 4OCXL 5IK3A 1D5XB 2I9LB 5IVXB 2BOBA 1MSPA 3ZDYE 3H7LA 3RRQA 3MR9B 2VZSA 4NZUL 1MCDA 2R0KL 5H2BB 1KB5L 1M05A 5IM7A 2M2DA 3GSXB 5JNYA 4PJEE 1UWEH 1WEJL 1LEGA 4MQSB 1DE4A 5D8JH 1QFWL 1T1WB 4LCUB 4PJCA 1LP9F 1KCLA 1U8IA 4QRRE 3KPNA 4U1HA 5IT2H 4I18A 4C57C 4PJ8A 5EIQA 2DS4A 3MLYL 3MLUH 1MFNA 3JTSB 3QG7L 3FQRB 5D7SL 4K71B 4DUXA 3AXLB 4J3UA 2VDKH 4NRZA 2ZOLB 3KJ6L 2Q7YA 1AIFA 2YUWA 4CU7A 4BFIB 5IJVA 4XTRC 1SEQH 4M9OA 3K4AA 3KYKL 1MCHA 1FIGH 3G6JF 4HIHB 4PRDB 3BD4A 1Y6KR 1IGCH 3SDYH 4F9PA 5FA3B 5IV2B 1JZ7A 3T0VA 5CZXC 3NTCH 5HGDA 5CJ5A 3MMEB 3B2UD 4U33A 3MODL 3OKDA 5DHVH 4ZAKB 4LLDB 4N90E 2VZUA 2Z0BA 5F89A 3ECBA 4UOJA 1GGIL 3TO2B 3UTPE 1DUZB 4ALAL 3QQ4B 5BVJA 5ISZE 4KRLB 3F65A 1WC7B 5ID1A 3QI9A 4MAUL 43C9A 1EVTC 5ECJE 3BSZH 2JF1A 1TZIA 3LKNB 1KCRL 3MLXH 3EUUA 4ZODA 4F7EA 2CKNA 3FT4B 4G6ML 5DJYA 4HZLB 4BQCA 3LS4H 1CICC 4HFUH 4NWUL 3VWJA 2HTKC 4U1SB 3TYGH 3DO7B 1W0WA 3L5WB 5EC1B 5F8QC 1CTNA 4K3HA 3D69A 1MCEA 3KDMB 3HB3D 2BSSB 4MA7H 1S5HB 1QSFB 1VGKA 2X4OB 4QHUB 3QDMA 5AZ2L 5IMKB 1N3NA 1JWSA 3NCFB 5F7LB 5LQBH 4L8SC 4UIMA 3WSQL 4JLRB 5F9WC 3T8XA 3VH8B 1MJJA 3BO8B 4N0RA 2BK8A 4QRRD 1VKXB 2EYTA 5CGMA 1AC0A 5C6TL 1P1ZA 5D5MA 2EYRB 4KTDL 1T7YA 4K7PH 1C16B 2AEQL 5HD8D 1UXWB 1JGVH 5F1IA 4ODVL 1HWHB 4S1QL 5CJQL 4JEGB 2P5WA 1U93B 3F62A 2OZ4A 3B5TA 2X1PA 1X5XA 2GCYB 4I13B 5C0IB 3HI1A 5FV2A 4XMLL 2DM7A 3BPOB 3QCTH 3QO0B 4Q2ZA 4X4ME 2XPGA 3P9LA 1CLCA 5GRXG 1YQVH 5EBMB 1UYWL 3ZTJH 3UTZB 5HI3D 2FD6L 2VL4A 2PYFB 3TIDA 3O3BB 4ZXBD 4LVHB 4M7KH 1WWWX 2VLJA 2Q8AL 1FFNB 1IE5A 5ALBH 3NABH 3RJQB 4MD0A 4Z6AT 3UTPD 3WUWB 1NUGA 2Q6WA 5IVOA 5ISZD 2V2WB 3PWUB 5GS0H 5C0JB 2H45A 1V3MA 4M00A 4DGYH 1CXKA 4KFZC 5IBTH 1IAIH 4AEHH 2DQTL 4ZPTA 4KQ3L 3FQUA 2AEPL 1LP9A 1WBZA 4PB0L 5D1QA 4NBZB 3SDCD 3TBSB 4YDLC 4WEBL 1YN6B 3RWIB 43CAB 5KJRH 4GUPA 3VXSA 3T1FB 1Y0LA 3EYSH 3X11B 4JKWA 3WKMH 4MSWA 3SE3C 4CRPA 4NC0B 1FGVH 2F53E 3VFOB 3HR5A 3QUMH 4I3RL 4I0KA 4Q9RL 1GL4B 3WIIH 1WUNT 2BOCA 2IBZY 4M6ML 3GKWH 4UINL 3G6JA 5FOBA 2C1OB 2X9YA 3HUJE 3T0EC 5DWUH 1WK0A 3LHPH 1A64A 2O5XH 5BS0A 4NCC2 5K9KB 3UP1A 1SY6A 3QEUA 4AEFA 5LAXA 4KRPB 3O4OB 5KG9A 1S7SB 1C12B 1X5AA 3QXUA 1ZT7A 5DC4B 4LOUD 3IF1B 1RY7B 3SGKA 2EC8A 2HVKA 4LPXA 4PTUB 1E0OB 3MRKB 1INQB 4IS6B 1KG0B 3HE7A 4R0LA 1ZA3A 2EDNA 4G8GA 4XNMA 4HC1H 5H37H 4ZTOH 1U8MB 1IFHH 2BSRA 5A3ID 1PG7X 1UENA 4UDTA 3QWOA 4HK0B 5GIRA 4EN3B 1RV6X 2DM4A 5FK9B 1R3KB 3FFCE 4NCC1 1CD0A 1B0GA 4CU6A 1NEZB 1YY9D 3DX9B 5A2KH 5DYOB 5TH2B 1NMCC 1ZLUK 4FXKB 3TBWB 2XA8H 3V0WL 5DEFB 2O26U 5IEHB 4U1LA 2WM0A 2O5ZH 2H3NA 3S3PA 4OCYH 1F58L 4D8PA 2NY1D 4Z77A 4LBEB 1A6ZB 5F96L 4W6YB 3B9KD 2F8XC 1FZJA 3IS1X 4MJ5B 2KL6A 4JN2B 1KN2H 4KK8D 2VXTL 5GZNC 5JHDA 1IGYA 4JG1L 4NQVA 5AD0B 1QKZL 3VA6A 1BREA 4YXHL 3MGAA 4ZO7A 3RKPA 5AG8A 3C2AH 3FAXA 2OX5A 4QGTA 2GYSA 4PB9L 1PQZA 3MRBA 1X5YA 4HIEA 5L2KB 5I0ZA 4HV8A 4NBYB 4NSKB 3CCHA 1XGRA 4PJ7B 4YNYA 3JWDL 4Q74A 3MV9B 3KXFA 3SE9L 1MJ7H 2DAVA 1MRFH 1BQLH 4CNIA 3DX7B 3KYOB 1UKTA 3E2HB 3QUYB 5EO1B 3WLBA 3MUY1 2BFVL 4JG0H 3ULSB 2NY2B 2PR4H 4RDQG 4P2QB 4PGDA 4WNQA 4Y5XB 4TSAL 4YXKL 1DBMH 1B0RB 1XT5A 1T5WA 5IESL 4D0BA 5BV7B 2D0GA 5TE6H 5CS7A 1IARB 2BNQB 2XZAL 4GG6F 3X14A 1CG9A 2D31A 3WN5A 2YBRB 1MFAH 1CD1B 3O2DA 3BDXA 2BVPB 3HB3C 4ZNEE 3Q5TA 1J5OH 2VTFA 2G2RA 1A7RL 3FFCD 4N0YH 5EU6A 4HW6A 4YDVA 1Y6MR 2AJUL 5EC2A 1ZWIB 4ZUSB 1OAYL 3QWQB 1XCQA 5MERA 3MCG1 4HJ0C 2VDLL 1TZGL 1JPGA 3JTTB 3UROR 4RGNC 3V4PH 3ZHLA 3WIHL 3L3HB 4ODXA 1KIPA 1DQLH 3DGGB 1LK3L 1I7RB 4MXVF 5JOFA 5SX4I 3BHBB 1CI5A 5HD8C 5E2TL 5HGAB 2ZJSL 1AGCB 4RMVA 3GBMH 4TQEH 3H6JA 2P5EA 4R2GB 5BZWA 3NZ8B 1D5MB 3UJTH 4OLZL 4DN4H 2Z9TA 4PRHB 3NA9H 3P4MB 5ICYA 2FL5B 1BFOB 1GVIA 2DYPD 3SJVE 3FQTA 4OFIA 3NACL 4U7KA 1XH3B 3DV6A 4XVSL 1IRAY 1I3VA 3MOAL 4FQLL 3E6FB 1UM4H 5LGKA 5IVXE 2J1KA 4K94L 1F8TH 4HXBH 1IKNC 5HI3C 5TF1H 2VXUL 1RZJL 4ZXBC 4X98A 4EUPA 4FQIH 1EEYA 3IU4H 5I6XB 5GGRB 2RBLA 1F11A 2OTUA 4P48A 4PV9B 1I7ZB 2YR3A 4F57H 2AK4B 2XICA 4YHOH 3K0WA 3VXNB 3OZ9H 4OZIA 4QEGA 1TNNA 5J0BA 1G1CA 3V5DA 5C9KA 2EDXA 1A0QH 1N7ML 3GMMA 1BF2A 4GAFB 3ES6B 4PRAA 2O61A 4G7VH 4EI5A 3SDCC 3Q6GL 4ZMAT 1T22B 4JFZH 3DIFB 2VXSH 4CJ1A 3MJ6A 4MA3A 3VFVA 5E24E 3NFPA 3TPKA 3JWDC 5IMOA 2FLRT 4P23D 3SEPA 2FJFA 1FG2A 4HG4K 3HZMA 4HJGB 1YMMA 2ZPKH 2JCCB 3I3DA 4BQ9A 5FYLE 1WIPA 4K7FB 3MLRL 4ACPA 2ZP0T 2GITB 2APFA 1A4JA 4M62L 3S5LB 4XPTH 3B6SB 3IGAB 4OM0L 5CSBA 1RIUH 4XP6L 3X3GL 1P7QB 5F1NA 2IFFH 3V4UH 1F4YL 4PJHA 4LSQH 3HMWH 4QT5A 3QQNA 1NAKH 1PSKL 1WWBX 1MQKH 3WFBH 1R24A 5BVPL 4FG6D 3SJVD 5IFHH 3EDKA 1LDSA 4KMTL 4LOUC 4ELKB 2IG2H 4PRBA 4LVEA 1YEDA 3ALXA 5IBUG 3IJHA 2BJMH 3F7RA 3DMMA 4S11A 2LU7A 2DQJL 1P4LA 2EICA 3RKDC 1KFAL 3CFIC 4GG6A 5A3IC 5KAQG 1QSFE 1H0DA 3QNZB 4MNGB 3OKLB 5HDQH 4F8QA 3VMPA 1IBGL 5E6IB 4NM8L 1H8SA 2PW1A 3ARXA 3HI6H 5GHWH 3HMXH 4ORGA 1YY9C 3PJSB 4FABL 3NH7H 4I8DA 3SQBA 2Y07L 2E9JA 5IHZB 2NYYD 5T1LB 3LN5A 4CL7A 4NT6A 1DBKL 4L4VA 5KSUA 1NGZB 2YPLA 4I3SL 2P43B 2HTLD 2VABB 1CE6A 2QSCL 1B4JH 4K94C 2W65A 2X4PB 3PGCB 1LILA 3B9KC 1WLHA 1RZJC 5IROA 5T33H 4KK8C 3IS0X 2WBJB 5E2WL 3MFGB 2YD8A 3W81A 2Y4SA 4R3SB 5FYLD 3VFUB 1TVBB 3HC4L 4H20L 4WI8A 4NJ9L 4ZFOB 3QUMA 1TPXC 4OF3A 3L3OA 1J1PL 4ZPVA 2GFBB 4LLVA 1WJ3A 3J7HA 5IEKB 5D7IB 5C8JA 3N06B 2YPVH 4M5YL 5I75C 4IRZL 2G75B 1F4XH 1RZ7H 3WJJC 3ARDA 2HJFB 4LKXA 4BELD 3IVKB 2C4XA 5JIKA 5F3HB 2E9BA 5T1MA 1A6WL 2CLZA 1NBYA 2XNAA 4LHQB 4JY4B 3MLWL 2GJ6B 3UTOA 2XI9A 3D2UB 3P3YA 4AM0B 5AG9A 4U0RC 1G7PA 1BFVH 2D4DA 4A2LA 3H9SA 1QSFD 3GMOA 4JREB 1Y18A 3A6BL 5IB1B 4OCNC 4LNRA 1G6RA 4NZJA 1QBLH 1R5IB 4S1DC 5DMKA 4YUEL 5A2JH 5K9JH 3CFKB 3B3IA 4FOMA 4EDWH 1E4XI 1IMHC 4UI2A 3DX6A 3HG1B 3KPPB 5E7BA 1H3VA 2PCPA 3MLSL 4ETQB 3W5MA 3SDXB 3PGFL 4HKXB 1W72A 4YIQB 1FVDA 4KTEL 1S9XB 2A9MH 4LLYB 2LABA 1HEZB 1HHJA 3UBXA 4MX7B 4FQJH 5CJXC 5I15L 4PTTA 1D9KB 3L7EA 3N50A 1RJCA 4HBCL 4OLXL 1MPAL 2QQNL 3ARBA 2R2HB 1NGQL 4OUOA 1I1AA 4UAOB 1U58A 4P4RB 1ZGLA 4LDLB 4RA0C 1NANI 1EO5A 4LSPL 4M6NH 5FGBA 1MRDL 1N8ZA 4JY6B 2E7BA 4BSVB 5HGHA 5FYLL 5FA4B 2X89D 3EJZD 4JFEA 4Y2DD 5IVZA 3BUYA 4MXWH 5DJ0A 1DDHA 2CDEB 4LLMA 3FOMB 2MPAH 2QSQA 3K1DA 3DARA 3QULB 4UU9A 4Z95L 1LEGB 4KXZI 4GFTB 4QHNB 1U36A 1ZHKA 2ARJA 4PJCB 1CGYA 3WCYA 2IGFL 1VDGA 2AERT 3KPNB 1KJ3H 3BESR 4I18B 1NMAL 4P23C 1FNSH 2Y6SD 2CGRL 2V9RA 4M4RA 1ZVYA 1QACA 5L2KE 4NC1E 4N1CA 2JK5B 5D6CB 2Q7YB 3BKCL 2JB6B 4IHOA 4PJ7E 4MXQD 3MV9E 1S9YB 1NAMA 1V7NH 2A77L 1HYSD 5F44A 4GW5A 3OAYK 2OTWB 4GRMB 5MI0B 3PNWA 3H3KA 4ZS7H 3I9GH 3G04A 4KRPD 5DUPH 1NJ9B 1Z6JT 4FHBD 1K8IA 3TC9A 2D9QB 3ARWA 4P2QE 1OVZA 1OOAA 3UCRA 3C6LA 4KMLB 3IDMB 4YFLF 5B8CC 3OKDB 1HHIA 1OPGH 3MRDA 5F89B 1KC5H 2BNQE 2A74B 3ARGB 3EO9L 3OJDA 1TJIH 5E03A 4H8WC 1AGFB 3CVHB 5ID1B 5A43C 43C9B 2VAAA 2VUOA 4EN3D 2K7QA 1JPFB 4HUMB 3O41B 4JY5L 1CGWA 4MWFA 5BZDA 4JKMA 4EUPG 4U1IA 1S7VA 5IHLB 2A1WH 5FKPA 4YX2H 4CKVX 2ZCHH 1GZPB 1KLFA 1SJEA 3IXAB 1I1FB 4L8CB 4Y0GA 4Y16A 1KT2A 3LZFL 2AK1L 2WNGA 1UJ3B 3NPZB 2BSTA 3EGSB 2NYYC 4HGWA 3LEVL 2BC4A 1G84A 4K71C 4CDGC 1Q0YL 1IC7H 1N3NB 4P5MA 1AJ7L 4UIMB 4Z7WA 5C0GA 1T4KA 1KIQB 3T8XB 1QQDA 4RNRA 4PRHE 3HFML 1F4WH 4MA1C 4L3AA 4KTYA 3LKOB 4UB0H 3S36H 1S9WB 3ZE1E 4M8QB 4F7MB 2QQKL 3CX2A 5D5MB 5HGBB 5CKAA 5CP7B 1U3HA 2V5YA 2RIKA 5L2KD 5E00B 4HH9B 5F1IB 1C7TA 2R2EA 2YD7A 2BRRH 4NQSA 2VQ1B 4F3FB 5JUEH 3MV9D 4WHDA 1KTLA 2W60B 4BKLA 4OGZA 4HFWA 4P5TD 1P4BL 4PY7A 4N0UA 3QUYD 1MHHA 2ATKA 4BFBD 1CR9H 3P0VL 3P9LB 2DL2A 2AK4E 1GC1H 3MROA 2L0DA 4X83A 1MJUL 2H2SD 3FMGH 4PJ9A 4AMKH 1G7MB 5CKGA 4UTBL 3D0VA 1RQ5A 4ESKA 2V17L 4XBPB 3V6FA 2VITA 2BNQD 2CKBL 2QV2A 4MVBD 1MIML 3T0AA 3V6OA 4OF6A 1KBGH 4LVNC 1INDH 1Z3GL 3QG6A 4C4KT 5ACZB 2AVGA 3BIBX 1BWWA 2BXYA 2G5BB 1CD9B 4CMHB 1AI1L 4EBQL 3FQUB 4CADA 4AH2A 5D1QB 2JCCE 4YWGH 2HJKA 5C0AB 2XKNA 4FQXC 1FQ9C 1OGAA 4GUPB 4PP1D 5F9JA 3VXSB 1Y0LB 4FN0A 4K3JH 1DJSA 2APWA 4MSWB 5DS8B 5HHOA 1SMAA 1KENH 3OJVC 4EJ1C 3HMXA 1KELL 4IOFD 4M4PA 1K4CA 1IM9B 1XGQA 2W91A 3FHQA 4R2GD 3BDYL 4AG4L 3GB7A 1S9VB 4ZUUA 3GO1H 5B3NA 4PRHD 4S1SL 5GS3A 4Q97A 2NTFB 3PL6A 1RPQA 3ZKXB 3SKJL 5J12B 3B9DA 1OTTD 4M7LH 3QEUB 2P46B 5LAXB 5ERWA 3INUL 5MEOA 3GSRB 5KG9B 4XI5D 4MNGE 3MBXH 1HCVA 1N26A 4GBXA 5IGXL 1SMOA 2AK4D 3BIKB 3LKRA 4NQXB 3JV0A 2H9GA 1IILE 3EJZC 2ATPA 1D5ZA 1T2JA 4A6YB 4ZQKA 4XNMB 1W0VB 4Y2DC 3BP6A 5C2BL 1ZAGA 1KTDA 5HTSA 4DOHB 3QWOB 1MUJA 1NKRA 5C86A 4GW1B 3HE6B 1MY7A 1V3LA 3FRUA 3LSOA 4G6KH 1CYGA 1UWXH 5DA0B 1KCSH 4GH7B 4E9LA 1A7NL 1AHWA 1MREH 1JNHA 3MNVA 1BBJB 5SWZA 4MNHA 1Q0XL 3JWOL 5BV7L 12E8H 2R0LL 3OAUL 1DUYB 2Y6SC 4I77L 3DSFL 1ZA6A 5HJ3A 3GI8H 2H3NB 1MCFA 2D9CA 4LPVA 1AGBA 4BZ1L 4OBRA 2AJYH 2VLLB 4PJFF 4WI9A 1NGPL 4MXQC 1C5BH 1P7QD 2Z92A 3TJEL 5JHDB 1HYSC 4FQ2H 4NQVB 3RUGF 2P48B 4FQ1H 3HRZA 5D7IE 1RHFA 2C3GA 4HIEB 1ZHBA 3MRBB 5C0DA 3IJSA 2HKHL 1JI1A 1C1EH 3CCHB 4NUGL 1DBBL 3UBXG 4YNYB 2AI0L 5EZLA 3SBWA 1FVEA 1FAKT 1RVFL 5JQ6H 1RZGB 3EOAA 4HIJB 1ZTXL 2KH2B 5BO1L 2BVYA 2GJ6E 4GAYA 3VMOA 3WLBB 4QTIH 5FM4A 5J8OA 4P4KA 4HQQH 4PGDB 1LNUA 3CFBB 4Z7NF 4J4PD 4HDIA 5KVMC 1PDKA 3W39A 1GH7A 2MOVA 1I9IH 4KK5C 5I76A 1R5VB 1CG9B 1MCBA 2D31B 4MJIA 4UNUA 2MNUA 4IMKC 4LCWB 5E99H 3MXWL 3UAJD 5I1KL 5I8KL 1F3DH 4NDMB 3AREA 2AABL 3HG1E 1NBVH 2NY3B 4YDVB 2JB5H 3SDXE 5EC2B 1FFOB 3ULVL 5MERB 5EU7E 4P57A 3RJDA 3SGEI 5D70H 2WBJD 4CN4A 1L9MA 3VXOA 4ODXB 5LJYH 1GGBH 5D4QA 1HSAA 4RFOL 5JOFB 1BLNA 5CCKL 3OPZH 4PJBF 1DBJL 4OCWL 2P5EB 5EN2A 5DI8B 5C0BB 4BK4A 4GLRH 2Y23A 4MLIA 4OCMC 2IPKB 4P5TC 1NGYA 5DRNA 3E2HC 3QUYC 1F6AB 3GMPB 5KN5B 2UV3A 4X8XA 1WSST 2E7LA 3MSPA 2GSGA 2Y5EA 2ED8A 2VDML 3FQWA 1TETH 1I8IA 4UBDD 4Y5XC 1RD6A 4XCCL 1JN6A 3JWOC 5BV7C 2IQ9L 2P7TA 3C5ZA 4M43H 5DRXA 4MVBC 1F11B 3EBAA 5C07A 2BZDA 1PW3A 2GJ6D 4U1JB 2JIXB 3D2UD 4HWBL 5EIIA 5TQ2H 1I7TA 1A7PL 4PJCE 4X4YA 5DD3L 5I1GH 2R29H 3BZFA 3V5DB 3VG9B 2NW2A 1MCOH 5BMFL 3GMMB 4GS7C 3C8HA 4YBLB 5D1XC 4RCAA 1H3XA 1SYVA 3AAZB 3FB7B 1B3JA 2BVOA 4DGVL 1MVUB 2VNCA 4J6RH 1RUKH 4NKIL 3NGBC 4PP1C 2DD8L 3EFFB 3NFPB 3U9UA 5KTEL 3THML 2VKXA 3WFDH 5CEZH 5TE7L 1RSFA 3OMZA 1G7LB 4HUNB 1S7WA 5FO7A 3RVTD 5JR1L 1FG2B 4PJFA 2XZCH 3FN9A 4XMPH 4ZTPL 4IOFC 1KCUH 1AY1L 2FO1A 3W0WB 4R2GC 3SCMB 3T1WA 3HS0A 1D9KD 3IT8D 3TBVB 3V0VB 4AY0A 4OLWH 5I17A 2LU4A 1WWCA 5F1NB 3GSNH 3CFJA 4LQ1A 4XCFH 4PJHB 4R8WL 3V7MA 4QT5B 1OTTC 4CMMA 3D39A 5K9QG 2CR6A 1T21A 2QHRH 2WMPA 1OM3H 2HG5B 1UB6A 4Y19A 5T5NF 1Q9WA 1NFIA 4HWNA 3UPAA 4XI5C 4E41A 5J56B 1XIWA 4O5LL 4JDTL 2FX7H 1QNZL 4U1GB 1MEXH 5CAYB 1JGLL 3IJHB 1HQ4A 3N0PB 4S1RH 2XN9B 2X10A 2IAMB 3DMMB 3BN9D 4ZFOL 1P4LB 1VEPA 5TQ0L 3WDIA 3L5HA 2QL1A 2DDQH 4GRWH 4OD1L 3VD3A 2D7TH 4R7DA 4I2XB 1E4KA 4N9GB 4NYLB 2P8MA 3QNYB 1HOCB 1MWAB 4ORGB 2HT4D 3PDOA 5F6IB 1WITA 2BSED 5I1DA 5B39B 1UT9A 4C83A 4NZRL 1K6QH 1BVKA 3HNTL 5D5ME 5C09B 1QD0A 3LN5B 1FE8H 4D9RE 3O2WL 4OGYL 2AJSL 5GGSY 2J12B 4L4VB 2A6DA 1CE6B 4I1NB 3QHZH 3K8MA 4UOW1 2W65B 4JKLA 5JDSB 3DVGA 4PRPA 5L88H 4P2RE 2VLRA 3CDGB 5DK2A 2KZWA 1PYWA 4PJBA 1IAIM 5D7LB 2IBZX 4XBGB 5J1TC 4WI5A 4U2YA 1QHPA 4L3CB 1L7IL 2YZ1A 5FXCH 5DTFB 1F45A 3L3OB 4HIIA 4JO2H 5T1DH 3C2SA 2LFGA 1AKJB 3T4AA 3ARGD 2N1KA 3C09C 3L6FA 3ZYZA 5FGSA 1U3ZA 5C8JB 1U95A 5E56A 3Q0HA 5DHYB 2E9IA 4J4PC 4KKBD 1N6VA 1Q9LA 4V1DA 3VG0L 1ADQH 4M6AA 1JV5A 4M1CD 2XY2A 3BD3A 2CLZB 5HVWA 1XGPB 5C0AE 1VB9A 1CWVA 4FZ8L 4OT1L 3VXSE 1UZ8A 5EBWB 3UAJC 2CDFB 3RPIA 4NN5C 1JPSH 2FHCA 4MA8L 4CVXA 1MCIA 5D71L 5SV4A 5IR1B 4ZOBA 1ACYL 1MFCH 5GGVL 5DMKB 5L9DH 1JYNA 1FJ1A 2EDBA 3CFDA 3B3IB 4WO4B 4PJ5B 3AVEA 4XPFL 5MEQB 5DRWB 3DX6B 3IFLL 4D9RD 3RNKA 2OL3L 2PCPB 4OM1L 3LMJL 3X3FH 1W72B 4DAGH 1FVDB 2BNRA 4QRSA 4LPCA 1INEH 5CZKA 4P2RD 4QRQB 1FO0A 1AD0A 1OAKH 2IJ0C 1BZQK 4PTTB 1NCTA 4QRPA 1KPRB 2PTUA 1AO7D 4N0CC 5TGBB 3MCKA 2ZKHL 4GOSA 5TDOB 1KB5H 4F80A 3ARBB 4YAQA 3T2QA 3H3PL 5BJTA 1MCPL 4WIQA 3IDJA 4KI5C 4S10A 3UYOD 4O2CA 1ZGLB 4DOHE 1OF2A 2IFGA 3ROLA 4N8CH 1MCLA 4MCZB 1JK8B 1N8ZB 3A6OA 2P8PB 1S3KH 2VWEE 4XC1L 1JUFA 3PGDA 3IDGA 2EXYD 1MHCA 5IVZB 2QTEA 3BUYB 3MUZ1 3KJ6H 5DJ0B 1DDHB 4LLMB 4LHUB 4TUJA 1OT1A 5D1QD 1HH6B 1VSCA 4MCYB 5IFJB 3I3BA 4UU9B 1XZ0B 1FNAA 3KYKH 1S7TA 5C0AD 1EH9A 4NWTL 3CVHL 3QPQC 4HZAA 3IU3B 2VOTA 3T08A 1ZHKB 3VXSD 4U1MA 1XF1A 4IRJB 5I1EL 4FQPA 2VL5B 1GGUA 4UQ2A 4GRWF 3MCLL 5JHDE 3GBLA 5I19L 1IM9D 4MYWB 3HAEH 3QIBC 4YBQD 2AJXH 4AT6B 4LPYA 4ZD3H 3GRWH 1GGIH 4YHPA 2E27H 3MV8A 5CEYA 3CD4A 4Z7UA 5F7KC 1QTYT 1SM3L 4DW2H 1D9KC 2GK0A 2AXJA 3IFNH 4IHOB 3F6IA 1NAMB 3QUZB 5HYJA 1CDJA 2CD0A 3LB6D 4X0KB 2BMKA 2H32H 35C8L 1S7XA 4UAOC 1T1YA 4G42B 4JANA 5FGCB 4JHAL 3BKML 1O5DT 4UUJA 4M6OL 1ORSA 2DQDH 2XA3A 3KS0J 3EOYG 1QP1A 4UV7H 5KSAA 1K2DA 3MRDB 1HHIB 1CDCA 4JM2B 3LRGA 4JO3H 3OQ3B 1PVHA 3BN9C 3U0WH 1HIMH 2G60H 5CWSA 3VCLB 4LIQH 1JHKL 1R6VA 3WSQH 4LCWE 1UQSA 3U2SB 1HZHL 3D0LA 3KPTA 3L95A 4Q6YA 5F7DA 3HE6D 5I66A 1CDGA 1S7VB 2NNAB 3UJJL 3WXWL 1ZT1B 1VFMA 1KEGL 1SJEB 5K9OA 4NNPH 2ESVA 4Y16B 4BJLA 1YY8A 1KT2B 1Q8MA 2A0LD 4BQ8A 4Y4HA 3W9EA 2GJJA 2BSTB 3QUXA 1J1XL 1A1OB 4HGWB 1N2RA 3P0GB 2BCKB 3G08B 4QY8A 4XMLH 2BC4B 2X09A 1BZ9A 3UYRH 4GSDH 2FJGB 1YYML 4P5MB 3NFSH 4Z7WB 2Z8SA 4KI1A 4QXTA 2VXVH 2P5EE 2HFTA 5C0BE 2NXYD 3A6CH 3C9NB 1RUPH 2D0HA 1A5FL 4HX1A 5A16A 5JHDD 4XWGH 3NPSB 5F1SA 5IG7A 25C8L 4M8VA 2PYEA 5TFSL 3P4NB 3TYFB 1M7IA 2R2EB 1VHPA 1NLDL 1T83C 4F9LA 5D7JA 2FEEL 4HUVA 4LSVL 4BKLB 3ZO0A 4HFWB 4PY7B 2DQTH 3ARGC 1MHHB 3CZJA 4R7NB 2P1YA 2AEPH 1CD8A 1H5BC 3ZE0E 3MROB 2YWZA 4Z7VB 1T66D 1IKFH 3M1BA 4PJ9B 5T1KA 2VYRE 1LHZA 4KKBC 5FM5O 2R15A 2R23A 4OZHA 2D7OA 3F5WA 2XWJB 1YEKL 4M1CC 4NZTL 4XXCC 3GIVA 2IF7A 5EBGA 3GSUA 3A67L 2XG4A 4LCWD 3QG6B 3MOBL 2HRLA 4I3RH 2Z31B 1UJ3C 4LF3A 4G80A 2NY3D 3RL1B 4POZD 1XF4B 3K2UH 4CADB 4AH2B 1A3LH 3MNZB 3W0WE 5JMRA 4A6YL 3EYFA 1KACB 4AYFA 3UTTA 4DZ8A 4XP9L 2FGZA 5F9JB 1IAII 3O45B 1MVFA 1HDMB 1OAXL 4LEOA 4L1DA 1EEZA 1PZ5A 5GS2D 2A83A 4IOIA 5HHOB 4KQ4L 2DQGL 2X9WA 1Z0NA 2DQFA 2W59A 4R4BA 4OD3H 4PJHE 1NCDH 4RZCB 4JZNA 2P5ED 4XB7A 5E8EB 5C0BD 3GB7B 2VISA 4NGHL 4ZUUB 2EDEA 4TRPL 3TPUB 3OG6B 4Q0XH 4NNYB 1ZLSH 4BSJA 1Q72H 3PL6B 1U3YA 4FRWA 5LXGL 1J8HE 2NLJA 2R1WB 4XPBH 3RVUC 2QKIB 2DI8A 3JUYA 5I1JL 2XN9E 2X70A 3FO2A 4X99A 3ZDXF 5HPMA 1V05A 4YK4B 5CD3A 2R56L 4G3YL 1PKQB 1TIUA 4I2XE 3UO1L 4E42B 3RIAF 2ZSVA 2JIXD 3QFJA 4YLQT 1WAAA 4WRLA 1D5ZB 4JE4B 2ZG2A 2EXYC 4ZQKB 5JZ7D 4XXDB 2XQYK 4CMHC 3BP6B 1ULVA 5E94B 3W9DB 5C09E 1MUJB 1UG9A 3NCYS 3G6DL 4L4VE 4HGKC 1Q1JH 3FRUB 1U6AH 3LSOB 1X4YA 4KJPC 3RVWD 3CFEB 4PB9H 5JXED 4L8DB 1AHWB 1S7QA 2P4AB 1A9EA 5JHLH 2J4WL 2NY6C 5GGUB 1IGFL 5ITBL 4ETYA 1CICA 3W0WD 4YBQC 5D7LE 4Q9CA 4IM8A 5JXAH 4WENB 3SCMD 1JBJA 3V4VL 1AGBB 2CDGA 5EPMB 1FPTL 1F4HA 2AGJL 2ICES 3G5XA 3VW3H 2XXCB 1DQJB 2Z92B 3UBXI 4YXKH 1KCVH 3LB6C 5L8LB 4L8SA 5DFTA 5IESH 1HNGA 5GXBB 3ARFB 4LCIL 1OTUC 4YFEA 3GSWA 1I3RA 4M5ZL 3PWNA 4NQDA 1JZ3A 3GHEL 1J8HD 5JQHC 4LSUH 3RY4A 5HSFA 5EDXA 4UTAH 4PJAE 1FVEB 2OR8A 4NOBA 5I71B 2XN9D 4PYGA 2IAMD 3DMMD 5HHQA 1A7RH 1X5KA 4GAYB 3EJYD 1UACL 2J6EL 4I5BB 1Q94B 4YE4L 3S88L 3QJFB 5D9SA 4P4KB 3RY5A 1UC6A 2NX5A 4OZ4A 1KB5A 1LNUB 1P53A 4PGZA 3HE6C 1IQWH 3WIHH 4I3GA 3UC0L 1QSZA 1A3RL 2Z93B 1F6FB 3HNVL 3MRJB 1BVLB 4Y89A 5I76B 3STLA 4MJIB 1ZANL 4YDIH 2A0LC 1XMWA 4XVUC 1GOGA 2R4SL 3P9MA 4PJ5E 4TNWK 4Y7MA 5IW3A 4FQCL 5C09D 4OLZH 2CRZA 2FIRT 1BAFL 4L4VD 4YHLH 4Z0BL 1EEQA 1FFPA 3KPLB 1T2QL 4WWKB 1NSNH 3EOBB 1A1MA 2XFXB 5BOPA 5L0QC 4TPRL 3L1OL 4LSTH 5HHPB 2NXYC 5E8DL 2HLAA 4JRYB 4NKOB 3ZDYF 2DQHL 3VXOB 3KG5A 1KJ2L 2ICEA 3WEXB 5JW4N 5D7LD 2PUQT 5FECA 1BLNB 1CGSH 4M1GH 3ESVF 1AQKL 3QA3A 2XZQL 2IADA 3BRFA 4CJ0A 4LAQL 4XC3H 3AFLA 4POUB 2C3VB 1LEKA 4WI7A 3SE3A 3RX7A 1CZ8L 4B53A 3HAEA 1QOKA 1MCWW 1QLEH 1AKJD 4NPYB 3GRWA 3OKEA 2E3VA 3PIQB 4LLWB 5EZOL 1PEWA 1DBAL 1C08A 5SWQA 4U7SA 4QO1A 3DOSA 3GIZL 4XPAH 3MGOB 2GSGB 3C6SA 5DD5L 3FN0H 1T66C 1YEEL 2XRAH 4NNXB 5E2VL 2GTWA 5GGTL 4WU5B 3HZKA 3T0EA 3HA0A 1IVLA 1RK0A 5C07B 1EHLH 1G9EA 5E8PA 5KVFH 3IETA 5I1HL 3BQUB 5F3BB 2ED9A 3PWPA 4JFOA 4YC2C 4JQIH 4F2MA 1I7TB 4GT7A 4X4YB 3MJ9H 4YDJA 3WDJA 2DQEH 3BZFB 3L3JA 4GRLC 4DZBB 3QIUC 1FZMA 2NW2B 1IEAA 3KR3L 4NN6B 3E3QE 2OSLA 4POZC 3RWJA 3VXQA 3X3GH 4GXVH 1SEBA 4M48H 1F4YH 1ORQA 4ODHH 4BUHA 1OTSD 2VDQH 2BVOB 2I60L 3JV6A 3O0RH 2B1AL 3BUTA 3K74B 4WO4D 4PJ5D 4YR6A 2VH5L 4CUCA 1PSKH 4Z7OE 3I2CH 4HK3J 3RTQC 3NFNB 3RY6C 5D93B 1FNGA 1JF1B 1OCWH 4XB8A 3WO4C 1CFNA 3MBEC 1MWAL 4HMCA 5FGCE 4GW4A 5I18H 1IAKA 5K9QI 3LEYL 1MNUL 3DX8A 4JR9H 2YS4A 2WP3O 1XF3B 1MFBH 4X9GA 2X1QA 3ARBD 1NFDE 3LQAH 3CFJB 3VJ6A 2P47B 4CMMB 3KJ4B 1T21B 4OBSA 4ZSOB 3ILQD 1JP5A 4Y19B 1A02N 3M8OH 4FABH 1Q9WB 4O9HH 3TN0B 4U1KA 3U0TB 1HQ4B 3Q3GA 5LVEA 4W70A 3L3GB 3VGHA 3GI9L 3MNWA 2HN7B 3D9AL 2OBGA 2R9HD 3O3EA 1GHFH 5JZ7C 5IB2A 5IUSA 2OR9H 3DRTB 4LHUD 3MRLA 1XR9B 5DZOA 1JWUB 5E2WH 4PREB 4HKBA 4PRNA 1S78C 4AENB 1VFAB 1ROWA 4Z7WE 1ZHNB 3TO4D 4URTB 4IRJD 5JXEC 3PDOB 4H20H 4HPOH 4OKVA 2DQCH 1XF5A 1KPUA 3PG2A 4KZEL 1CFTB 5BQ7B 4RWYH 4P59L 3RHWK 2OCFD 4XHJD 3RA7L 1RUQH 5M7QA 1C7SA 1JGDA 3RGVB 3DVGB 4PRPB 4KZDL 1BQSA 1YECL 5AYUH 5HI4D 2VLRB 3QUZD 5T3XH 2MHAA 3SKOB 4PJEA 3NN8B 2FJHA 3BWUC 3KYNB 2DIAA 1UCBH 2APXA 2Y1VA 1HN1A 4JQVC 4OF7A 4C59B 4QRRA 1DL7L 4FFVC 4YHZH 3WDHA 4Z7VE 3MLWH 2JE8A 3HLAA 4B7IA 2A6KA 5EZIH 2BDNL 1HHKB 1XGYL 3L5JA 3QHFL 4JM2D 4HIIB 2I07A 4KRMB 2NR6C 2F15A 3FQNA 3T4AB 4L4TA 2IAMC 2WINA 3V6OE 3L6FB 3QXDA 3EJYC 3H9YA 5IKCB 3RNQB 4NBXB 1U95B 3EYQC 2CLRA 3BEWB 4H8WH 5ENWB 4JVWA 3RHWF 3FB8A 1N0XL 3LPFA 1Q9LB 4OIIL 3WNLA 1CCZA 5ITFA 4TSBL 1JV5B 3HUJF 4J12A 4Y16D 1IKNA 2DMBA 4ZXBA 2F74A 2W0FA 4ODBD 4WHTA 1UZ8B 5C0FA 2B4CH 5HHOE 1U8LA 1HSBA 3QUKA 1R5WB 3S37X 5AAWA 4HKJA 4LPUA 5ISZA 4OLXH 2D7PA 5GSRB 4YHKL 2EDHA 2MSPA 3QO1A 3OKOA 3CFDB 2FBJH 3O2VL 3S35L 5GQBA 4WCYL 4JM4L 3L5IA 3SDCA 2KKQA 4H5SA 5KSVB 4HHAB 1U8JB 4X9FA 4P3CL 2WZPD 1RJYB 5GJSL 4EIGB 3QH3B 1AD0B 4HSQA 2X4UB 5F7FA 4TOYH 3LOWA 3BH9A 1PKQE 3RAJH 4YGAB 3FB6B 5DVLA 1T1XA 2IBGA 1E4WH 3SGJC 1ZE3C 5BJTB 4MMXC 5ACLA 5DK0A 1K3ZA 1MRCL 4N68A 5EWIL 2YD2A 1GRWA 5IQ9A 3ROLB 3VFTB 1NMAH 4B0MM 2VDNH 3PGDB 2Z31D 4NFDA 4KJQD 3IDGB 1UB5A 3SGDI 4PG2C 4YPGA 3H42H 1CLZL 4UV4H 5ILTH 1GJIA 2YA0A 1A6UH 4N8PA 1OTSC 3OHXB 4WFFE 3C87A 3WNPA 4WO4C 3WIHA 1YNLH 4OLUL 3ARSA 1AXTL 5HHOD 2UVFA 2YEZB 2H26A 4JB9L 3QZWA 4Z5RA 4YXLL 4JKKA 3L7FA 4EEEA 3WS3A 3QXAB 4O58L 5CEYB 4Z7UB 5I1CH 5EORL 3PL6D 2GK0B 3PP4H 5HYJB 5MENB 4P2CG 2BMKB 3MRIB 3B9KA 4XP1L 4NQTA 4X6DA 1WTGT 4JN1L 4CW1A 4UUJB 2VE6A 3LZFH 4D3CL 1OGTB 1YJDL 3IFOA 4WW2C 5KSAB 4JHBA 2ITDA 4XNXL 3LEVH 3LDBB 4J1UA 5B4MD 4L8BA 2ZSWA 1A7OH 4X5WA 2OI9C 1ZSDA 1NBZA 3HUJA 3DETD 3HFMH 2NY0B 4PY8J 1QR1B 3OR6A 3RVXC 5KVGL 5CEXB 3P40A 5K9OB 1HKLH 2AJZA 1U0QA 3TO4C 3KNBA 4IDJL 4JCMA 1YY8B 5IVXF 5EU4A 4Y4HB 1X5FA 3W9EB 4JRYE 1KJMB 3WJJA 1NCWL 3E3QC 3QUXB 5HHNA 4PJDB 1N2RB 1QVOA 4ELMF 1PG7L 4YFDB 2DIJA 3MUGB 3O6FB 4WHYG 1BZ9B 2EDWA 4XX1G 4WFFD 1UXSA 4DCQA 1PLGH 4QXTB 5E08H 2EKSA 4XP5L 5I0DA 5DA4A 1CDIA 5HI4C 3QUZC 3FFCA 4HX1B 4XNUL 3B2VL 5A16B 4LMQE 1E28B 5IG7B 2VO5A 2PYEB 3ARFD 4XAWH 4UT9H 1CXIA 3FOLA 1M7IB 3MLTA 5MEPA 5D2NB 1Z3GH 5GJTH 5D7JB 2D2OA 2RQ8A 4JFQA 1FN4B 4HUVB 2XQYG 2X7LB 4JM2C 4MHHG 4ZUVA 3K2MC 1S8DB 5C07E 2FEDD 4RMSA 5C7XL 3LAFA 2ZCKL 2Z8VC 1VACA 4OLVH 5CJXA 4HS6A 5J6HA 3WFCH 1OAQH 2DYPA 4QRUB 1I3UA 1F90L 1IGML 2AKRA 2EDRA 1UJTA 2VZ1A 4BH7A 1FZOB 1C5CH 5B38G 1BEYL 3R4DA 4OZHB 1I1YB 2GKIA 3GIVB 1NGXB 3GHBL 3G9VA 4LF3B 1QFUL 4D94A 4WWKD 2NMSA 4M03A 2HLFD 2A73A 4NKQB 1CVRA 3P30H 2K7PA 4DKAA 1W8OA 3WFEH 4LP4A 5I8CA 4JRYD 3UTTB 5F7EH 4DZ8B 3BVNA 3F58H 3BE1H 1EO8L 1FDLL 1YJDC 1I1RA 3NCBB 2LVEA 1HINH 3RZWA 2DQFB 3BYYA 3BKYH 4R4BB 4JO4H 2FWOB 4XCNB 2VISB 2QQLL 4ZSOE 4ZNEA 3WV0A 1Q38A 4NHUA 1OD7A 4YO0A 3V9FA 1T0PB 4P23A 1OP3K 4D2NA 1YQ2A 1NANH 4X99B 3TBYB 5EUKB 5HPMB 1K5NA 3EO0A 1S7RA 2YUVA 1GGCL 1BM3H 2H6PA 5HDBE 3DHJA 5KVDL 4XPHL 4GAGL 2APVA 4PGCA 5C07D 5BV7H 1FYTB 5DHVB 3BQUD 2FX8H 4HWZA 1OSZB 1E27B 4C56B 3QFJB 2F5AL 2Z31C 4KJQC 4P9HH 2AQ2A 3HI5L 3SJVA 1CGXA 1EPFA 5KOMC 4FMKA 1F6LL 5B8CA 2JJTC 3TWCL 3PWLB 3WBDA 4KXZH 2I9LA 2VDPH 4RBPK 3U4BL 2HVJB 5DEGB 3MR9A 1U8QB 1I9JH 4PRPE 1RMFH 1TQCB 3V52L 2JKXA 4DUVA 1S7QB 1PEZA 2VLRE 5F70A 3S6CA 3TT1L 4KUZL 1KLUA 1T1WA 4L4JA 3WNKA 5DR5L 2OS7A 1T80A 3Q1SL 2CDGB 4DFHA 3PF2A 4JDVB 1JNNL 4QLRA 3VXUE 3KPQB 3AXLA 4L8SB 2ZOLA 3MC0A 1JHLL 4HMEA 2BXZA 3LKSB 3BDBA 4YK4C 4AL8L 3GSWB 1I3RB 4OTXH 3TN0D 1JFQL 3MXWH 3LPGA 4PRDA 2P44B 1IQDB 2XT1B 5CZVH 1FV1B 5IV2A 3R0MA 3GUTA 4FZEL 1X44A 1I9EA 5B4MC 4PGJA 2EE9A 1DFBL 4P2YA 5D9SB 4WY7H 4LLDA 7CGTA 1DQML 3G6AB 2NX5B 4OZ4B 3MACH 4O00A 5DFVD 5CD5C 5FUOH 4P0DA 4H88L 1TITA 3DETC 5A1AA 3QHTC 5FHAH 4M61B 1WC7A 3RWCA 1R3IL 3CLEL 5EFIA 3LKNA 1BVZA 5CCKH 3U83A 4UILL 3FT4A 4HZLA 2PTTA 1PD6A 3IDYC 4Y5VC 4U1SA 5CILL 1E6JH 1H9VA 1BD2B 1A1MB 3ET9F 3KDMA 3O3DB 1BBDL 4O51B 3VWKB 3RGVD 4PRPD 5JW3L 3QIWC 1QSFA 1EHAA 2X4OA 4QHUA 1FAIH 2VLRD 3RU8L 2LAGB 4ZOCA 5IMKA 4QGYA 2HLAB 3NIFE 4HT1H 6CGTA 1I4FA 2J8UB 4JLRA 3VH8A 1N6QL 2FSEB 1Z2KA 3BO8A 3QZWG 1VKXA 1NCAL 3L3DA 4FQXA 3WIFB 2E6JA 1LEKB 3B83A 3QQ3A 1C16A 5K33A 2EE3A 3VXUD 4UMGA 4ONGH 3BJLA 3HC3L 1V3KA 2DBJA 5CBEB 3FO9A 5BMFH 2EO9A 1RZ8A 4JFXB 5SWQB 1U93A 5J1SC 1SJXA 3C6SB 4QHMA 1QLRA 3CXDH 3QO0A 2GTWB 5DQJA 1CF8L 4PJ7F 3HZKB 3T0EB 2FATL 5EBMA 1VPOH 5I1IL 3EZ8A 5TE7H 4C58B 5FYKL 5E8PB 4WTZG 3IETB 5CJ8A 5F88A 4ZTPH 3PWPB 2HFGH 4KROB 4F2MB 1FFNA 3MJ8A 5JIIA 4DVRH 4YDJB 5E2UL 5F71A 1NFKA 1P7KB 4PYHA 5F7UA 3B9AA 2YMXL 4WWKC 3PWUA 3VXQB 1RU9H 5C0JA 2X89A 1RURL 4AQ1B 3O4LB 1ORQB 5ADPL 4Y2DA 2SEBB 4Z7UE 3ZE2E 3QP3A 5TE4L 3EKCA 4OGXH 3P4LA 3L5XL 2WIIA 3VD5A 1FNGB 4J23A 3TBSA 5HYJE 5MENE 1YN6A 3RWIA 43CAA 2JJSC 2BRQA 3T1FA 1NC2B 5EBLB 3X11A 1JGLH 4K2UH 2ZOKB 4GW4B 4MB5A 1EZVY 3VFOA 5HPOA 4R90H 1D5IH 1KSRA 5JLZA 3OAZH 4LRIC 1A14L 3C08L 5DMJB 4J3WA 5E8NB 3W5NA 1QBMH 3DVFA 4ZO8A 1G7QA 2FYYA 1YC8A 3WXVH 4U1KB 5DSCB 1AR2A 5B38B 2CKBA 1YEGL 2C3XA 3ZE1F 2QR0A 1Z9OA 2R8SH 1DLFL 3O2WH 4NOFA 2YA2A 4GXUM 4APQC 3U6RA 1S7SA 3KLDA 1C12A 3CX5K 4O02L 5AZEL 2J88L 3IDXH 4NN6C 1L9NA 4GMSH 4PJDE 4KPHL 1W0YT 4PTUA 5AUMA 2I26N 3MRKA 1INQA 4MGXA 5C08B 1KG0A 3RDTB 1FHGA 2X4QA 2VXQL 3HC0A 1NLBL 4YQXH 4HK0A 1J10A 1VGEH 2EDJA 3LQMA 5FK9A 1R3KA 4KKCD 4DWHA 4OKVB 2FGWL 1TNMA 2MQCA 1A7QH 1NEZA 3CLFL 2PYEE 3F7YA 4DTGH 5TH2A 3ARRA 4IMKA 4FXKA 1JGDB 5D2NE 5T3ZE 2NPLX 3K81A 2OP4L 2ZCLH 1RFDH 2V5MA 3R1GL 5MEND 4PJEB 2JELH 3N1FC 5CMAB 2X4NB 3GJEB 5C0RL 2FJHB 1A6ZA 4KVCH 4ODSL 2Z8WC 1W8NA 4R4FH 1KLGA 2ITCB 4PRID 4MJ5A 1JPST 4RMUA 3RWEB 3QNXB 1NL0H 4NJAL 4RGNB 4UOW0 2JCCF 5MHSE 1MCWM 1EBPA 4OZFA 1WBXA 5AD0A 1JZ8A 4X5XB 4ORZC 1TJHH 5KSAD 5CIPB 3O6LL 4I0CC 4OZHE 5L2KA 3BPNC 3C8KB 4L4TB 3G5YA 1BJ1J 3U82B 2FB4H 4NSKA 5JPMB 5I30L 2GAZB 1ACYH 4DKEL 2GW5A 2KZ1B 5KOVC 2A9NL 5GGVH 1DVFC 1EFQA 3TV3L 4P5TA 3DX7A 1FGNL 5DFVC 3KYOA 3QUYA 5EO1A 1RZIB 1LK2B 3ULSA 1ZLVK 2O93L 4MQ7B 5GRJH 1SBBA 4PJ8C 4Y5XA 3LMJH 4ZXBB 1B0RA 3QDHA 4KVNL 3GBNL 2EDOA 1CDHA 1T0NB 4IMLA 5EOCL 1U8LB 3QUKB 4QXUL 3O6FD 3VGEA 2DQIL 2HH0H 3SGEH 4UT7L 2BX5A 2YBRA 2B7DT 2J3SA 2VC2H 3BZ4B 2QHLA 1ZEAL 3LD8B 3RGVC 4OLYH 4ONFL 1MCPH 4NRYB 1ACZ