3D1MC

Crystal structure of sonic hedgehog bound to the third fniii domain of cdo
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
87
Chain Sequence
GPHIAYTEAVSDTQIMLKWTYIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The mode of Hedgehog binding to Ihog homologues is not conserved across different phyla.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein / cell adhesion
molecule keywords Sonic hedgehog protein
total genus 17
structure length 87
sequence length 96
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d1mC00
4WWKA 1D5IH 5D7LA 2X7LB 4DKFH 1CZ8H 1R6VA 5C2BH 1JTTA 4DN4H 3TBSB 1RZGA 4CMHB 2BSSB 4PLOB 3SOBL 4HUXB 3T4AB 4PJBB 5C0GB 2W07A 4O2FA 4G6JL 3L3HA 4RAHA 4Z0XA 2HJKB 4DEPB 4L8SC 4RX4D 2GY5A 4P2QD 3UTZB 1DLHB 5C0CB 4KQ4H 2NY3B 4QRUA 3MUHL 1ZT1B 3F7QA 1XCTB 3EOAA 5I0ZA 4AEIL 1T7YA 4HQQH 4HPYL 1FJ1B 3HAEB 1IGYB 4XP9L 3QEUA 2IQAA 3J8F7 4UV7H 2R2EA 3D25A 1A7NL 4R2GC 2NY6D 2QHRL 4NO0A 3VXRE 4TOYH 1NBZB 2BNRE 4JE4B 4XCEA 4LCCA 3MV9B 4I2XA 4ZD3L 3M1BB 3WIFA 1BAFH 3CFKB 3DX8A 1KN2L 1XCQB 4KVCL 4NN5C 4YGVB 2VDNL 1NGZB 3CDGA 4Z7VF 4ZOCA 3MLTB 1SBSH 3AU1A 3BDXA 3EUUA 5EOQL 1K5NB 2QADD 2V2TA 2H2SC 5DVMA 4FFYH 1NGPL 4F9PC 3MV8E 1QRND 3IS1X 3LRGA 3S88L 4CN1A 3CXHK 2Q8BH 5GS0C 3G5YB 5IFHH 1VFAA 4NKMA 1P7HL 1T5XB 3EOYG 3VXOA 5IBLC 1HILB 4P5TD 2KDGA 4L8SB 3TZVC 3OXSA 3FO9A 1CT8B 4L8SA 5GS1A 3OR6B 1RIUL 2W0FA 4BH7B 35C8H 4NT6B 3QEQD 3OB0K 3DX9B 4YQXH 3FO2B 4GMTH 1MI5B 3JXAA 5ANME 5IEKB 1OGAD 1RZFL 3O3EB 4JGJA 1T03L 2WNGA 1C12A 1FNEA 2VXTL 1MCLA 1BFVH 4KROD 4MQSB 4GRMA 3U4EA 3PWVA 4MQ7A 4IOFD 4RFEB 1LO5A 5J1AA 4EDWL 1LDSA 4F7EA 3TH4T 4P4KD 1E28A 4ZTPH 2SEBA 4M7KL 5DD3L 2FECL 2R0ZH 3HNSL 4C56E 2I9LB 3MXVH 4OZIE 1EX0A 2H1PL 3F7VB 2AJSH 3S37X 5E2TH 3BX7C 5KVFH 5SWQB 5FV1L 5J9PA 5T33H 4HBCH 3IT8D 4L4TB 5EO0B 4K8RC 2NY7L 3O3AA 2ADIA 3EJYC 4F58L 4L4VB 3IXTA 2FZ3B 4WFGD 1EFXA 5FHBL 4MXVF 4NQSA 5I73B 1WSST 2C3VB 4D0CA 4RA3A 5LVEA 1CFSB 3L7FA 3RGVD 4EQ3A 3TBSA 3ZTNH 1HCFX 4H20H 3G6DL 3EGSB 1JL8A 3GIVA 5DUBB 3TO4C 5C0BE 3PGCB 1U8HB 1QSZA 1FNSH 4KTYA 2L4OA 4OM0H 4LLVA 5D1QC 2LAAA 1OW0C 3RL2A 2R2CA 5I66B 1XCTA 3DVGA 1ACYL 1WAAA 1QG3A 2IFFL 3DX7A 3OB0H 1KT2A 2YWYA 4G43B 1QR1B 3U46B 4OZHF 1KB5B 1JHTA 1KLFA 3D3VB 4NKDA 4RQQB 1WGOA 1GZPB 4JB9L 3UZEA 3QNZB 1OF2A 1XGRA 2VC2L 1IAIL 2VDOH 5C0AB 1B9ZA 1Z9LA 4PJ7A 5I71C 2VITB 3ES6B 2VLJB 3QQ4A 1ORQB 4JPWH 4NQED 1F6AA 4X7TB 4POZC 5KVEH 5IVZB 4JLRB 3W0WD 4G8GD 4KKCC 2LABA 3FHQA 5IVZA 1II4E 5H8DA 3SBWA 5DHVA 1FZKB 1BJ1J 2Q76B 4GLRH 1J05A 5L2KB 5HDBF 4A2LA 1DBKL 4FXLA 4LU5H 1IC5L 4PJCB 1Z0NA 4XMLH 1PZ5A 1QP1A 1F02I 4A6YH 3SCMB 3K1KC 4U0RB 2IH1A 4QXTB 3SE8H 4JANA 5E1AB 3IJYA 3LN9A 4QHUA 4OLUL 4CVZB 1A6VH 3DV4B 3UPRB 3VFVA 1K9TA 3X14A 5EWIH 3LN5A 3NABL 5DA0B 3WLBB 1L7TL 2XYCA 2X6MA 3HC3H 4WI9A 2F5AH 1ZT7A 4PLNC 1C7TA 2VDPL 3QBTB 3VWKB 1JV5B 2EXWC 3TCLA 3RWFA 4ZUSB 4U7SA 4N0RA 1BGXL 1UB6A 1DQQB 3KDMB 5CUSH 2WINB 3GJFH 1G7MA 2DD8L 5IT2H 4JO3H 3T65B 4M6OH 4Q2ZA 1B90A 3KJ6H 4MDJB 3OX8B 3ARBC 3WE6B 4DWHA 3I2CL 1FLTX 2E7CA 3RJDA 4Z7OE 3T1WA 1U8NA 4JQXC 4UOW1 4NQCE 3S37L 2FX9L 5C0CD 4Q9RL 3UYRH 4OCWL 3LSOA 3HZVA 2XTJC 5K33A 1J8HE 2ZZUT 3EDKA 3QJFA 4KC3B 4HULB 2BFVH 4FMKA 1FAKT 3TJEL 3QQ9C 1ORSB 4LHUA 3RGHA 4JRXE 2RGSA 4X6EA 1DSFL 3QPQD 5I1JH 4R4FH 1HNFA 1OTSD 1U58B 3VI4F 1KG0A 3ECBA 4HLZG 2J8UA 4O58L 1N6UA 5FK9A 1MELA 3C5JB 1HHHA 1KENL 1IE5A 3QULA 4AIZA 4EI5D 5C2UB 5ID1A 4IRJA 2FCBA 1CE1L 4M48H 5JW5B 1A6AB 1FPTH 3HLAA 5T3XH 5MERB 2I07B 1RZ8A 4J3OC 2VN4A 2JCCB 4MJID 1OOAA 4D0BB 2LQRA 5DD0H 4Y4HB 1JNJA 1MJJB 5CBEA 4GBXC 1FIGH 1KXQE 3VFVB 3C5ZC 5FO7A 5HGDA 3VFNB 4L8BB 3X3FL 3TM6A 1YEJH 1GGTA 3CFJA 4N8CH 4JFDB 1S7UB 2WZPD 3ARDC 1C08A 4NIKB 5C9KA 3ROLB 4GQPH 4PB0L 2W0LA 1D6EA 1YYMH 1ZT7B 4JN1H 4RZCB 4UU9B 1T03H 4I4WB 1OAUL 2WSKA 2ZSWA 3SKNA 2BVQA 4Y5YC 5C0DB 3BZFA 4F7PB 1FZKA 5EG6C 3MUGB 5FYJD 2IBZX 4NQCD 5IW1A 4W68A 5D7IB 4TSBH 1UM6H 1KACB 3LAFA 4IRSC 2EXYD 4ZAKD 4J6RH 1BZ7B 1NCUA 4IOIA 5D71L 4KMQA 1FORH 5C08B 2VITA 3ES6A 4CW1A 5E8OB 5JIKA 4L9LA 4YHIA 3AAZA 1N5AB 3MRBB 1Q72L 3MXVL 4PFEA 3MBEA 2A73A 4JLRA 3VXUA 4LSPH 5FHAH 1DN0A 4KV5F 2N56A 4PBVC 1UWXK 2APFA 5FCUL 1CIDA 5C0BD 4QY8A 1KYOK 1P84J 4KMTL 2CKBL 4PRBB 4X7CC 1QBML 3KXFE 3MGTB 4PR5B 5F3HB 2X70B 1IAMA 1AP2B 1QFHA 3QG7H 4DFIA 1F3DH 4Z0XB 5HDQH 1IC1A 2XQBH 1R24B 4AIZB 2I5YL 4WU7B 3VFTA 4HF5H 5KSBE 4G9FD 5JORB 5BO1H 2ATKA 3ARXA 5E6IC 4I9WD 2HA1A 4K7FB 5F7HA 5K9KB 1Q9OA 2ED9A 4LLAA 4OGAD 4ZQKA 4JFEA 2GAZB 1HIMH 4HKJA 3MV11 3QUML 1YQVL 2RBLA 4LLYA 3PGDA 1DBAL 4HLZH 4PRID 3QJFB 1AGFA 4JVUA 5E7FA 3HA0A 4NWUL 1V3MA 5GGUA 1U8JB 2X89A 1L7IL 3MRHA 4LLMA 1WAAE 1D5BB 4JFFA 4QNPF 3D85B 3U7YH 4MDJA 3OKKA 2I25N 1U3YA 2VLJD 5JOFB 4U31A 4Y0GA 1JGEB 4RGND 1ZXQA 5TQ0L 3TA3C 1I1RA 4NQEB 3KR3H 2CKBB 4ZSOA 1NMBH 4OCYL 5HYSA 3C6LB 3BIKA 4G8GB 2W0PA 3S98A 4CVXB 4MX7A 4RGNC 4BFGA 3UTTD 1CLCA 1OARH 2IAMA 4FXGA 4CADB 4F57H 1NFDB 4X7FC 2VNCA 4PJ9B 4KJQC 3TEUA 1R5IB 4LQFL 4ODWA 2HP4A 4IDJH 4HKZA 5DRWB 3ARGA 2XRAH 3F58L 1ND0A 1G1CA 4RX4A 5D70L 3EHBD 3PWUA 4N0UB 3FT4B 3CU7A 3DXAD 2OQJB 3PXHA 4YDJB 2HMID 3V5HA 1KCKA 3NACH 4O51B 1J87A 3OL2A 3D1MC 4YWGL 3VXPA 3FMGH 2W9DL 3C60D 4PJ7B 3VXPB 1I9JL 1H3PH 3I02A 2ICWA 2PW1B 3LHPL 4M6OL 3WN5A 1KIQA 1RJCA 3STZB 4YHOL 1JPGB 1J0YA 2GTZB 2Z0BA 4HUMB 5JOPE 5IW6A 3GJFK 2A38A 3QWOA 1VSCA 3TBYA 3FN9A 4Q6IB 2WWMD 2HVJA 3VXQB 3VWJB 3REVB 1PEZA 3NCCB 5IKCB 1WWBX 4EI6A 1MIML 4QRUB 1XF1A 4WHDA 1S9KC 1W72L 3OV6A 4MS8C 5JOPD 3IRPX 4M6ML 3GMNB 5BS0A 4S1SL 4OIAA 5DD6A 2A9ML 3BO8B 4OZIA 3O8XA 3RTQB 1I4FA 4LDEB 4PY8I 4JGMA 4JDTL 3B6SA 3TH3T 4PG9A 4LFHD 3B8SA 4S0TD 4F7CB 1I8IB 1BBJA 4K3DL 2J88H 3GJFA 4RAVB 5D1ZB 2DQUH 5EWIL 3ZHDA 4MXWH 2FATH 1NGXA 5IB3B 5KANI 1B6DA 3SDCA 2XWTA 4FZ8H 3WD5L 3CNKA 1KTDA 4JY4A 5T33L 3WXWH 1FL5A 1XF2A 4LNVA 2NNAA 3TBVB 3MA9L 2HRPH 1JF1B 3V95A 3EOTH 5GGVY 1YEJL 4IIQB 5ESVB 5I9QB 1U91A 1MHHA 2AK4A 4ODTH 1FNGA 2DMCA 4PJFA 3U9PH 5E9DE 4LEOA 3NFPB 1HSBA 2MSPA 2G2RB 1BJ1H 5TDPB 1NC4A 4OIBA 4X4YB 3K81A 3LEVH 2BNUB 5I8OL 1ZHKA 5EH1A 4QXWA 2Y9RT 4JCMA 3ROOA 3VA2C 1S7XA 2EDTA 3WNKA 2O61B 1CFQA 1GGCL 1KIRA 2D4DA 3BI9X 5EZOH 4M48L 3MV01 1FH5L 2CDFB 3QI9A 3M45A 4XI5C 3T2PA 2ZKHL 5AAMA 4JZJA 3GSVA 4LVOB 3LN5B 1UA6H 4FQIL 5SV3A 4FABL 1R0AH 2YPLA 1NCWL 5L2KA 4ELMA 3BDBA 4DAGH 4JPKH 1ZHBB 3O6LH 5EU6D 1D7FA 5E8EA 3RBGA 4R6UA 1NAKL 3QIUA 3RWFB 3IJYB 4ZNEA 4PGCB 5AUMA 5IQ7H 4K2UH 5MENA 2MCPL 4HAGA 3NA4A 2IAMD 5I1CH 1ULVA 4F57L 5GGSB 5I1DB 4PBWD 3IVKA 5AEAA 2QQNL 3DIFB 2BVOB 5F3BB 3BQUB 3EKCA 4MJIA 4WTZG 2EC9T 4RGNE 1KBGH 4D94A 2QKIA 1ZEAL 4KUZH 1NUFA 3FFCB 1MRDL 2O5ZL 4UNVA 3V5HB 5DVLA 2Z4QB 4G9FA 1IARB 5LCVL 1YNLH 3T8XA 2P48B 3O2DA 3QH3B 4RWHA 1T1ZA 2V7HA 3LH2H 3E0GA 2MKWA 4HWBL 4OBSA 3NZHH 5DWUH 4PRIB 1K4CB 3BPLC 2UYLB 4LAJH 5L6YL 2BERA 2I07A 4PJ5A 4PLKD 3SO5A 3U7YL 1T2XA 2EDKA 2VIRA 1EHAA 1EUUA 5C0EA 2V5SA 2HTKD 1DBJH 2R4RL 5I1KH 2ED7A 4C83B 5ALBH 3MACL 4GH7B 2PW2B 3PWPB 1QYGL 5LXGH 2R69L 3HUJA 1JNLL 3HS0B 4MD4B 5GSRB 4O9HH 3KYOB 3NPZB 2V9QA 1AXTL 4H5SB 2Z31A 2B0SH 1KTRL 2CLVA 3DMMA 3G04B 2JLLA 1UENA 4M61A 1M7IA 1HHKA 4LVEA 1G7IB 2C4FU 4H0IA 1RVFH 1V05A 2DB8A 2FIKB 3JWDH 2K3TA 1H5BB 2AI0L 3QG7L 5DJZA 1V7MH 1RJZA 2R39A 4QOKA 2AABH 3PIQB 3DVFA 2Y6SC 4LSSL 2N7AA 3TN0C 5E5UB 4EBQL 3WDJA 4HWEL 1BX2B 2VN7A 2W1NA 4UAOC 3DXAB 1X7QA 3CUPA 2XN9B 5IJVA 3GMMA 5DJAA 2D31B 3PQYD 4FTVE 4JFQB 1I9JH 4GW4A 2EYSB 2R1YB 5D7JB 5C3LD 2ERJB 5HYJA 4TUKH 3TT1L 4DCQA 4R0LB 3RGVC 3UTPE 2RJMA 3NACL 2Y25A 4ZXBD 4QYOB 3U2SA 5E2UL 2IG2L 2HMIC 1AHWA 3BSZL 1AHWB 4XWOD 3RIFK 5CFHA 4AH2B 4G8GA 3FO9B 5F7EH 3TYFB 3ZT5A 2AXHA 1DBMH 3EFDH 3P4MB 3T0BA 5JZ7C 3RWCB 3SGDI 1HINL 2Q3AA 3K74B 4JO3L 5CHNA 5CILH 5DD0L 4JG1L 5FYJU 1WCBB 1T1YA 4FZEL 1I7ZA 2DI9A 4OAWB 3LY6A 3VGAB 2VH5H 4PJGE 2EIZB 4I48A 3MGOA 3HC4L 3AXLA 4DVBA 4LGSB 1KUMA 4JM4H 2C1PB 4P2OB 4KROC 3T09A 3V4PH 4OLXH 2HWZL 1KPUB 3FQUA 4JFEB 2XZQH 1N4XH 1E4XH 2GITA 5C0ND 4R4FL 2I60L 1OLLA 5ECJE 3G5YA 3L5JA 1KLGA 4EOWH 4YDLB 3EO0A 1U9KA 3MUZ1 3LRHA 1TENA 5IB1B 1ETZA 2EDLA 3MV8A 4JHWL 5TF1H 4HK0B 4P46A 1AO7A 5C1MB 2FEEL 5FXCH 3ULVL 3V79C 5JMRA 3RA7L 1Q9OB 1R3JB 2AW2A 3FO0L 2D7QA 3OHXA 3UBXB 1D9KB 2CIKB 2NY1C 1GGBL 3RIAK 2LVEA 3TNMA 2L7UA 4R4BA 4Y19E 3WFBH 2E3VA 2ICES 3PGFH 3X3GL 3OGOE 3FRPA 5DEFA 3U0TB 6FABH 3RZCC 3QG6B 3P0GB 3QO1A 4EI6B 3OG6B 3QO0B 3BN9D 4LBEB 4K3JH 5D9SB 2DYPB 1GGCH 2FZ3A 3P73B 2JELL 2FJFB 4XZUB 2R9HD 4XNZC 2PTTA 3O4LB 1H3XA 1JZ4A 3DHJA 2VR9A 5J9PB 2I5YH 4R2GD 4PJDE 4PBXA 3KYKL 3C8KB 2UUDK 5EZJA 5DXWA 4R8WH 2LTQB 5CJXA 2BJMH 5ITFA 1CR9H 2Z93A 4JPVL 5FM4A 1IMHC 4RIRB 5EU6B 4YE4L 1FFRA 5LAXB 3DHMA 3L5WB 2YEZA 5GS2D 1UZ6F 2JB6A 4G3YH 4R4ND 5JW4N 4HAFA 1HYRC 1N6QL 1ITBB 4DVBB 4BQ8A 3MCG1 4NQDB 4RGMB 4KKLD 4YHLL 1FC2D 5I1IH 1PX4A 2OSLA 1TTGA 2HLFC 3RNQB 1FV1A 3EYSH 4O5LH 2X9XA 4GQ9L 4F15B 3WJLA 1BBDH 4V1DB 4UIKL 5E24E 1KTLB 1DVFA 4GRWB 1AGCB 4FFWC 3VXTA 4GAGL 4KRMB 3KJ4B 4UINH 3WFCH 1EEZA 1WFTA 5F88B 1BOGA 3SKUD 1WBXA 5EUOB 3DSFH 1JGUH 4GRWH 3TPUA 1FFPA 3SDDB 2V2TB 4XVSL 1T0NB 1U3HD 1OAYL 1MCQA 1YC8A 1A7BA 3T0EB 1IGCL 3NIDE 5IB3A 5DFTA 1MQ8A 4HWNA 3RRQA 4LSQL 3QDJB 1BFOA 4NJAH 1MIEH 3O2WL 1R3HA 2WM0A 3FMGL 4XZUA 5TPWL 2ZUSA 2CIIA 3HR6A 3CFCH 4IRSB 3T2NL 3ARZA 1R3IH 3QEQE 1BM3L 1A14L 5MEND 1CWVA 2MQ3A 1R3JA 1UM5H 1F3DJ 4QRPB 3CC5A 4JPIB 3BE1L 3WXVL 2YSSB 3G5ZA 3MGAA 1FGNL 4Q74A 1MAMH 2I26N 4M7JL 1A7RH 1A4KA 1T04B 4GKZA 4XPAL 5IV2B 2GEEA 3SPVA 4ZS7H 1KXTB 1QSEE 2XZQL 4JAMB 2KL6A 4R4NC 5IEHB 4YX2L 4JFPB 4N90D 5HDOA 3FFDA 3OGCA 3MO1A 5DHVH 1UACH 3UAJD 1IGMH 2H1PH 5LQBH 2EDFA 1T21A 2AJSL 2GJ6E 4O51A 2NX5B 3VRJA 1LEKA 5H37G 1OGTB 3GSRB 1QPXA 5L88H 1CXFA 1S7RB 4JVWA 3MNZB 4OD3L 3FB8B 2BOBA 4NT6A 4GJTB 1KGCD 1ZLWH 5BRZB 1H3UA 1A6UH 1H0DA 1PAMA 2NY0B 4WO4D 5CWSA 2BVOA 3BGAA 3WN5B 5IM7B 1IQWH 3VFOB 2J3SA 1NDMA 3H9HB 5JPNB 1DQDH 3F7VA 4PJDF 2AS5M 1P7KB 5I1CL 4RBPK 5LGHH 1RY7B 5E99H 3GMRA 4A2MA 1NH6A 3SKNB 4YHZL 4GG6E 5HYQB 2DM4A 4W4OC 1CFVL 5HGAB 3C8HA 4KK6D 3AC0A 3QDGE 4ZS7L 1U93B 4WY7L 5JHDB 4TULH 5E2WL 2FEDC 1PLGH 1KB9J 4BH8B 1DANU 1K4DB 2ORBL 1MLCA 3JVGC 3FFCE 4EN3A 5I8CB 1KEGH 2NY3C 1A7PH 4KVCH 2RCSH 1AGBB 4MWFB 1FZMA 2J8UE 4DZBA 5EC2B 3REWB 5K9JL 3RFZC 3D9AL 3JWDC 5DMJB 1GZPA 3MODH 4NP4H 3LPFA 3O2VL 1WITA 4P49A 4PJXF 4YDKL 4WEMB 1RK0B 25C8H 2VZVA 4P3DB 2IQ9H 3E2HB 4KWUA 2AV7B 1FLRL 2F53B 3WFZA 4JZOB 4UNUA 1AD9B 2GJ6D 2AXFA 4LCWE 3FTGA 1MFBH 5I1HL 5DVOA 5HXMA 4RNRB 4UOW0 2AJYL 2B1HL 4PP2A 3LS5L 4J4PC 2NW3A 2JIXA 2GK2A 1R24A 4XCYB 4CL7A 2ITDB 4AIXA 3K4DA 3UPCA 5DJDA 5BXFA 3NA9L 1TZIB 3V4VL 3VFUB 2E9JA 3ZYZA 3GMQB 4JQVA 4YHPA 4UV4H 4LVOC 2VAAA 3QHFH 1XGYH 3LIZL 3NABH 4LSTH 1HINH 3WJLC 5C7XL 4OM0L 2HYMA 3A6CL 3HRPA 4PJFF 2C1PA 1MF2L 1QFWI 3GFUA 2Y36H 1IAOB 1LDPH 5I6XB 1TJHH 1U36A 2Z31B 5GGUB 2Y5TB 43C9A 4Y88A 2D7TL 3VXUB 3IRZA 2ZG1A 1A9BB 5E8PB 2FEEI 1OTSC 2R8SL 1WT5A 3IFNH 2FX8H 3DV6B 4NFCA 4JPVH 1MQKH 1QD0A 3MPCA 5JW4Q 1I8KB 2X2YA 4AT6B 4GS7B 1OTUD 4N8CL 3HB3C 4HZLA 5GRVK 2GUOB 1HXMB 3C9NA 3AMLA 3IB4A 3CFDA 1NCCH 3QIBC 2PO6B 3IU4H 3H7BB 3UTOA 5JHDA 2VZTA 2G5RA 5GXBB 3U82B 4MB3A 4O00A 1WJ3A 5GGQH 5I30L 3DURB 3S96A 2FGWL 4Z7WF 1P7QD 4P3CL 1EV2E 3E8UH 5INDB 2UVFA 3KPRA 5DDHA 4ZFOA 4K2UL 3MV7A 4JFQA 4UDTB 2FH6A 5B39G 3A6CH 3DGGA 4QHNB 3TO2A 5I1JL 3LV3A 4Z7UE 3WFBL 3RVUD 3TO2B 1X5GA 1UCBL 2FR4A 1VENA 4LIQH 2X05A 3C08H 5KBNC 4LPWA 4GW1A 2XTLA 1I8LA 3MGOB 4XBPB 4KRNA 1UJ3B 2GJZA 3HG1D 3D39A 4H20L 3LRSB 4D9RD 3SE4C 3TIEB 1Z3GH 3FHAA 3BUTA 5FM5M 4PJCE 5J6HB 4YFLI 2H3NA 3SDDD 2WAHA 3VFOA 3PJSB 5EZIL 3UDWC 2F54B 3CDYA 3JBG7 4NZRL 3BZDA 1A6UL 4B50A 4MD0B 5DUPH 3MZTA 2VL5B 4JFHE 2IMMA 4Y4HA 5GZND 1P9MC 1YEHH 3ZT7A 1AXIB 3CH1A 5BZWA 2D3VA 2XY2A 3MBXL 2YK1H 5IB2A 4X98B 5GRWA 1D5ZA 4UV7L 4G9DB 1ZA6B 4PGJA 1BBDL 1KXVC 1FGVL 2QR0A 4L4TD 1PG7L 1EBPA 5GRZA 5T5NF 2FATL 2NW2A 3NCFB 3RWEA 4CBPA 3DBXB 4TSAH 5D7JC 2IQAB 4X5XA 5IB5B 3V0AC 1U91B 2LU4A 4GQ9H 1CZ8L 1MHEA 3NGBB 3I3BA 4DN4L 3VMOA 1VKXB 3FOLB 5HVHB 1JGVL 1GOFA 2XZZA 4HKBA 1KN4L 3L3HB 5T1MB 2VQTA 1NSNL 3RUGE 5DLML 1Q9LA 4PYGA 2RB8A 2LVCA 3U83A 4B5EA 3LKQB 3EJJX 3P0YL 4H1LB 2BSTB 2D0HA 4GRLA 1YDPA 3O8XB 3RTQA 1FV1B 3STBA 4RGOL 1RURH 4HH9A 5FOBA 1EMTL 1PYWA 4WJ5A 1IT9L 1T22A 3D39B 3LD8C 2G75B 3KPPA 2EYTA 1BIIB 2G60L 3IJHA 3HE7A 2IAMC 1MCSA 3RZCA 2X40A 2ORBH 4PRBA 1ONQA 2B4CL 3GGWA 3A67H 2CDFA 3QI9B 4NZDA 5DMKA 1N2RA 3H3PL 4XXDB 3ZDYF 2BVTA 4OCWH 5EFIA 2XNAA 2VO5A 5D7IA 1QBLL 3S35X 2NY2D 4XX1E 4XAKD 3PNWA 4PRPA 4YDVB 4N9GB 4J3SA 4M43H 4PRHE 5D7KE 4KU1A 3SKMA 4H26A 1F3RB 5FKAA 3A6BL 1U3ZA 1UXWB 5DR5H 1F11B 1CU4H 2OMBA 5E99L 3L3DB 3ULUD 4G8FB 1MCIA 4ODBD 3BMWA 3HE7D 3WO4C 5TE7H 1I3VA 1OVZA 3WNMA 4LQFH 3IAQA 1ZGLM 2DD8H 5IT2L 1CBVH 1YEGL 1S5HA 1CGSH 1LVEA 3FN0H 4KK6C 3TLRA 1BECA 1JHLL 5DK3A 1OB1A 5F97E 4KTDH 1J9CT 3I3DA 4BFEA 3PGCA 4QHKI 3W82A 3CC5B 1RUKL 4NRZB 2J6EH 1KCVH 1ZVSB 4MNQB 1BREA 1DTUA 2VLRD 1LNUB 3G6AB 3UTPD 1A1OA 1JZ8A 1ZOXA 4MNHB 3S3JA 4XXCA 5JNYA 2ZUXA 4M43L 3BGMA 4U0RC 2DDQH 3ZE0F 1QR1A 1EO5A 3GSUA 1VGKB 3PQYE 4R97B 5BV7L 4PRNB 3QUYB 5DQJA 5IG7A 5TDNB 1FG2A 3UTSD 4P99A 3CLFL 3WLWD 4IHOA 5I8EA 5GHWH 3VMNA 2BHUA 3UAJC 3BIAX 3NZ8A 4S2SB 1MCNA 1G6RH 5I15L 2CKBH 3C6SA 2HKFH 5FGCB 4GAJH 3LKOA 1UGNA 4ONFL 4U6YB 3BKML 3SKJL 4ONOA 4X80L 3DRQB 5EBMA 4RFOH 1CLOH 4RFEA 2D2OA 2UWEB 4LCUB 4LGRB 4ZD3H 4LPVA 2GYSA 3EOBA 3Q3GA 1U6AH 2PTVA 1RJYA 3VH8B 3C6LD 4X8JB 1A7NH 5IMLA 3X13A 2HKHL 3ZKMD 4KJYA 4FP8L 5DMIH 3TA3D 4S1QH 2DTML 3C60C 2E8YA 3HZKB 3PV7A 2XG4A 4X0KA 2D31A 3AY4A 2E7LA 4UILL 5FYJL 1DBBH 5ESQA 5T1KB 1IM3B 3MLUH 4ZPTA 4ZMAT 1PQZA 1YNKH 3R4DA 1VEMA 5D7LE 3VFPA 1NFDE 4XCCH 1UKQA 1HQ4A 2CXKA 2HFGL 5ICZB 3O9WA 1VDGA 1V3JA 2JJSC 4I0CC 1P4LB 5HGGS 4P23A 1MJ7L 2KQNA 3ZT6A 2FLRT 3FQNA 5EOCJ 5F9WC 3MFGB 4KTEL 2XPGA 4U6XB 4PV8B 1X7QB 4HWBH 4Y2OA 3RNKB 2G9HB 2VE6B 2PYEB 2YK1L 4PJBA 3V5KA 3W2DL 2XZCH 4XCEB 1NEZA 4Y5XA 1CE1H 2IFGA 1S9YA 2AJUH 4WNQB 3QXVA 4X7SL 4WUKL 1ZT1A 3QQ4B 1TIUA 5L8LB 5DVNA 4QRQA 4AT6A 3BYYA 3EYUH 1INEL 5FK9B 2W0KA 2P7TA 2ZUWA 1NDGB 3DUUA 1CYGA 3LQMA 5EBLA 4L8CB 2Z91A 5IHUL 3VXNA 2ZNXA 2KZ1B 4KHTL 2Q3ZA 1AO7B 1RULL 3SJVE 3VXNB 5DMGC 1ORSA 4G6AD 5F93C 3NPSC 4LCYB 2BP3A 1OGAE 1PZUB 2OI9B 5ISZE 2Z35A 3CSBA 4MA3B 5HYJD 3MLZH 4QT5A 5L8JB 4XCFL 3M07A 3PABA 4RRPA 3RUGA 1KJ2L 1OB1B 1QKZL 4NNXA 2QQKL 2ZJSH 1CFTA 3W9DB 4I3SL 3GUTB 1WISA 1EHNA 4S10A 2Q7NA 5FA4B 1JBJA 2AJUL 4X7SH 3TN0D 5I1AA 2E7LC 3CVHH 2F19L 4LVHB 4L4TA 5EO0A 3EYUL 1E28B 2AAVA 2P8MB 4NSKA 5F9AC 5E8EB 1SEQH 2ZCHH 2ZSVB 3JV5A 4QRRD 1QO3B 2E27L 2VXUL 4QXUL 3TBWB 5BS0E 1P4BL 3ALWA 2EDEA 3OKOA 3VD7A 5HHOA 3THML 2Y7QB 3MRBA 4GUPB 4KJYB 3IDYC 2WUBH 5FUZH 4BQ6A 4CJ1A 4UTBH 2YPLB 4GT7A 3CFJB 3DECA 3I6KB 5CD5D 4JG1H 5LBSH 4JDTH 3ILPB 1JPFB 3CIQA 4JHAL 5JHLL 1N8ZA 4CMHC 4Y16C 1DN2A 1E4KC 1QHOA 1AI1L 3OXRB 5IBTH 1VPOH 3AS2A 5FA3B 5E8OA 2VKWA 2X4UA 1JPSL 3HE6B 3V6OE 1ZWIA 4Q58C 2O5XL 3BD5A 1D5IL 3C6LC 2HFTA 3EIFA 1XGUB 2H26B 2VYRE 3FB6A 5ISZA 2VDQL 2NY1D 1ADQL 2A2QT 3I85A 4JJHA 1M7IB 5D72H 2F5BH 4EKXA 3ZSTA 3Q6GH 5JW4R 3WN5C 4ORZC 3N1QC 2J4WH 3O41A 4WIQA 5HGDB 3VFNA 2KZWA 1T1WA 2X4SB 5E8DH 4ELKA 3H42L 5DJYB 1EEUA 3KS0H 2D7OA 3N85L 1LO2L 2W91A 3UTSB 3MXWH 2RFXB 3F6LA 2BDNL 2HH0H 4ONHA 1IZJA 2EO9A 2OMNA 3BKMH 4PUBH 4P4KC 5IB4B 2W9DH 1BVLB 4PG2C 1C5DA 4IDJL 2WBWB 4X9BA 1BVLA 3FZUD 4MD4A 1UC6A 4NN6B 1IGIH 3PWLB 4OCRH 4XWGH 1PSKH 1WBYB 4GAYA 4PGDA 5CBAA 3D48R 4Y8DC 2HJLA 1R5VB 4F2MA 4OZFB 1BVKB 2MPAH 5D6CA 4OFVA 4XCNA 1YECL 4TNVK 2NTSP 4GBXA 1U8IB 2G9HA 3PDOA 1NC2B 4CMMA 4G42B 1MIMH 1KBGL 1S7TA 4E41D 1LD9B 4QRPA 3KXFD 4NKIL 4N9OB 4MZ3A 4R96B 5DFVD 3LVEA 5SWZA 3ZL4L 2Y06L 4OUUA 4OLEA 4RBPH 1HN1A 4YBLB 5F9JA 2XTJE 3OSKA 3ULVC 3T65A 4UUJB 1TJIL 1T0MB 1BFOB 1UG9A 5K9QI 1MCJA 4PY7A 2GQHA 4PRPB 3WEXA 3JV4A 4L3EA 1DBAH 4HXBL 1XH3B 4RFNC 3VD3A 4RFOL 3PWUB 4N0UA 4DFHA 4RMUA 5EZIH 1OW0A 3EYFB 4Y89A 4AL8L 4BK4A 1PY9A 3Q5TA 2FD6L 1NKRA 4AH2A 3JZ7A 3MRFB 4P46D 2OK0L 1JNHA 5EO1B 5K9OB 4KKCD 4L4VD 4ZUVA 2YWZA 3VG9B 2ICWI 2FO4A 4Q0XL 1OQOA 3EJZC 2FO4B 1CGVA 3FKUS 3KLAA 3T0EE 1M4KA 1GZQA 4J7RA 4FQQB 1GC1L 2EYRA 4MCYA 5HHOB 5A16A 4AEEA 3IDGB 2PTTB 5SWZD 2J6EA 1IGCH 5FCUH 1AJ7L 3V4PL 1MNUH 4KVNH 4AM0A 2P8MA 5GS0H 2OXHA 3OQ3B 2WIIA 2ADFH 4KMTH 1G0YR 5C8JB 1BZ9A 3UXFA 3FOMB 2Z93B 1F00I 1Y6KR 2P45B 2FO1A 1JPTH 3RI5F 1U95B 2F8OA 5DK0B 4I5BB 1YYLL 5D1QD 5TGBA 3K1DA 4XP1H 4MA1C 2DICA 5C0AD 2V7NA 5C86A 1VPOL 5F6IC 4JFED 1JK8B 3G9VA 4CVWA 2Q1EA 2YZ1A 3GNMH 4JM2C 1UWGL 4I18B 1N0XL 1EUTA 1UQSA 2OLDA 2O5XH 4OIIH 5F1OB 4FQPA 4R0LC 1RHHA 2VSCA 5FF6B 5EUOF 2P5WE 5ALCL 3V6OC 5IB4A 1HZHH 2B5IB 5GJSH 2UY7A 2GW5A 3K4AA 4K7PY 4RNRA 1NLBH 5DFVC 4P3WA 2AJZB 3OJVC 4P5MB 3Q1SL 4PTTB 4OF0A 2X1OA 3FT3A 1C16B 4LBEA 5M94B 3QA3B 4HIXL 3N50A 5D5MF 4XMLL 3GMQA 2HKHH 1OL0A 3LPGA 3FO1A 2YD5A 3PWJB 2DM7A 2Z91B 2ZUUA 5A43C 3VI4E 4I77L 4U1SA 1K85A 1M7DB 1K8DA 1N5YH 5IKCA 4HKXB 4K07A 2P5EE 1HILA 1L9MA 2QQKH 1J88A 2NXZB 4XPHL 1NJ9B 1F4YL 4KV5E 3FQNB 2F8XC 1B4JH 4FQQA 2A77L 3EDJA 2C3XA 5AD0A 5IB1A 5F8QC 1DL7H 1ERNA 3RU8H 1RZFH 2JF1A 3WS3B 4O2EA 3CSYA 2DLFH 1XR9B 3NGBC 3ETBF 1FO0A 2WUCL 4GKSA 2VQUA 5DD1L 1F13A 3A6OA 1PVHA 1WC7B 2CXGA 3X12B 5IBLD 5F1SA 1EO8H 1MIEL 1HQRB 3O2WH 3O6LL 4ZPTB 1MLBB 4OGAC 2J2ZA 4PJCF 4WHYH 1WFUA 2PO6A 4RISL 5CKGA 3O3BA 4U1JA 1C12B 1FNEB 1JWSB 1MPAH 2QQLL 4LLUB 5KVGL 3QAZB 3NMEA 4YPGA 4J3TA 3T04D 1FYTB 1RUKH 3IF1A 2MOVA 1KCVL 3N1MC 4F7TB 1CL7H 3SDCC 2B8OT 5FGRA 4C4KT 1J11A 2O5YL 1TTFA 1FFOB 2J8OA 2X44D 5C6PB 5HHXH 1ZLUH 3H2WA 3UJIL 4U1KA 5B8CB 3TV3L 3P11H 1NQBA 5K93A 2IADA 3IYLW 2EICA 3VH8G 1CICB 3O9WC 1KIPA 7FABL 1U8JA 4NKQB 2AGJL 2ERJC 2D03L 1SM3L 1A6PA 1IKNC 2DQDL 4XCCL 4PLJC 4I0PB 2XKUA 4FQXC 5TE4L 3OG4B 1G7IA 1C5BH 1G7PB 1MY5A 2A1WH 5B3JF 4P23D 5FA4A 2APBA 2OR8A 5HYIA 4LMQI 3VRJB 3QEHB 1TNNA 3QXAB 5DJZB 5DJ2B 2A6IB 1AP2A 4PB0H 4HGWA 2P5ED 4FTVB 3RUGB 3VWKC 2LU7A 3ARDD 2UUDH 3VFMB 1H8SA 3B83A 3TIDA 3IDGA 2ATKB 2V7NB 1DJSA 2ZPKH 4AQOA 4HJGA 5F6HJ 2H2PD 2G60H 2EH7H 1LP9F 2H32A 4JKKA 3QRGH 3ESVF 3KYOA 3P30H 2HTLD 4NQVA 2IPUK 3W5NA 1KIUA 5EBWB 2HVJB 3D39E 3H42H 4OGXL 4ZUSA 1U3JA 4OLVH 1MWAB 1V7ML 4GW5A 2FGWH 4DOHE 3FAWA 4WU5B 4XP9H 4WI4A 4EI5C 3ARSA 1SVZA 3P3YA 2FJHA 4LFHG 4LCCC 3SCMA 1FLRH 3QUZD 1JK8A 4D8PA 2P5WD 5AYUL 2IC2A 1KIQB 4KI5D 4XBGB 1K4CA 2IALB 1ZT4B 4WFGE 5IESL 1NLBL 2EH8H 4WHCA 4OB5L 4WO4B 2ZUTA 4TULL 5E2WH 1JHKL 3JUZA 4JANB 1PYWB 4WJ5B 4V1DD 2YUWA 3MV7E 1QNZL 3QQ3B 4NO2B 1DBKH 4LU5L 1FHGA 2A9NL 4Z76B 1ZKAA 1FFNB 1OCWH 4OF8A 1BIHA 4HKZB 5DRWA 3DGCR 1BIIA 2DBLH 1YDPB 3D0LB 1T89C 1RJLA 1FNGB 2NZIA 3HLAB 2R1XB 3QDMA 4FQHB 2Q6WA 1T5WA 2R29H 4BUHA 4DGIL 4AEHH 3UJJL 2VH5L 3DYMA 4LEXL 1R3KA 3BEWB 4G6AC 3MBXH 5DHYB 3T0ED 4K71B 4GG6A 4RGNB 4L3ED 1JNNH 3KPOB 4OZ4A 4HGWB 1NGWA 3MJ6A 2EO1A 5J56B 4NO0D 5DEFB 4ODUA 4XCNB 5J06A 4PJEF 2H9GA 5I8KH 3PL6A 5JIHA 4GXUM 5D5MB 3ILQD 4Y7MA 4PJFB 1U8QB 4NKOA 4DOHB 2FLBT 1ZHLB 2OTUB 1IM9A 1VEOA 1U8QA 4NKOB 4I0PA 8CGTA 4PTUB 4N0FA 4GBXD 1SYVB 2BRQA 3PP3K 3ME0A 1HH6A 3KPSA 4CDHA 1SYVA 1MCPL 4ELME 3R0MA 4P2CG 3V2AR 5ERWB 1KIPB 2BNQE 2ARJB 4F58H 2BDNH 4XNQB 1QLRB 1SJEA 4YHML 2EECA 3SKOB 4ZFFB 1MHPL 4DKDC 4Z7VA 2GFBB 1LO3L 3FN3A 5HPOA 3PWVB 1YC7A 4MQ7B 2J4WL 3PHOA 5SX4I 1NL0L 5KJRL 4XPTL 3RWJA 2I60H 4W6YB 2UYLA 1MH5B 3RHWF 3SE3A 4JO1H 4XPGH 5E9DB 5FB8A 4KK8C 4ODXA 4XHJC 3S5LB 4RMWA 3HI5H 1XF5B 3QQ9D 4Z76A 1J86A 4WV1C 3AROA 3DNKA 1D5MA 3LRSA 2FBJL 3KPMA 2FECI 4Q97A 2Y07H 1LMKA 5E00B 2D7PA 1G9NC 4TVPL 2H3NB 2AXJA 4F7PA 1TJHL 3P4NB 2F53E 1JPGA 4MLIA 4JFXB 5INCA 5SV4A 1MFEH 4UU9A 2VZSA 4PV8A 1FYTD 3NAAH 4KKLC 1REIA 1QSVA 4WFED 3TNNA 4LSTL 3EFDL 1K8DB 3HNTH 4K8RD 1VACA 3VJ6A 1A4JA 2J8HA 3ZDZF 4MVBD 1CXLA 1A14H 3BISA 4ELMF 1S7WB 4Y4FB 2B39A 3GB7A 4CNIB 3HG1B 2L7JA 4XBGA 1HEZA 3EYOA 5EPMA 3D69B 4X6DB 2DQEH 4ELMB 2C3WA 2F53D 3P9LA 2VDKH 1IGJA 3VXSD 1T7ZA 3BRDA 1ACYH 4I2XB 4IM8A 3SE4A 4IOFC 5D7IF 2DI8A 1NCDH 5HY9B 1ES0A 2IWGA 1J5OL 4XAWL 5DUMH 5T3ZE 3PP4L 5EOCL 4OQ1A 4OLWL 4R8WL 1T22B 3CLFH 2XI9A 1P4IL 2DQHL 1U8KB 2CH8A 3GSQA 3O11B 5JDSA 5A2JH 1G9EA 5CEZE 5DS8A 3UP1A 3ARDB 2WV3A 3UTZA 4CAGA 5ETUA 1ZANH 1S9XB 1W2KT 3FRUA 1Q9WB 5ANMA 3T0WA 4PGBB 4ZSOB 5TF1L 4PR5A 4PGBA 4HKBB 4LKCB 5C0RH 4U2ZA 1N0XH 1NDGA 4NWTL 1WFNA 3INUL 1WVZA 3IXAA 4M6NH 3BW9A 4UZGA 5DZOA 4PJ7F 4P5TB 5TE4H 3IXAB 3E6HB 3QUMB 1YEGH 3HUJF 4HXBH 3O3DA 5IHZB 1K8IA 1PG7H 4BKLA 1MREL 4QLRA 4O02L 1YEDA 2Z35B 3KPNB 1C1EH 2HFFB 3L3IB 5HGAA 1DUYA 1RU9H 1UZ8B 4R26L 4X99B 3VXRA 4LLUA 2AEQH 2A74A 1CG9B 15C8H 4YO0B 3FFCD 2AK4D 3Q2CA 1MEXL 4HW6A 5ISZD 5HHPA 3H9HA 2BSRB 4EIGB 5JO5B 5FKAB 5DSCB 4P4KB 2DTSA 4OFDA 5F6IB 4PJAE 1JRHH 4Z7WB 4DEPC 1NCTA 4R7DA 1YJDC 1NANH 2PCPA 5HVFB 1S7RA 2EIBA 3K8MA 5IROA 2A6DB 3PIQA 4DGVH 1A6WH 2DQTL 1JYVA 4NZTL 4KZDH 1C5CH 5DJ0B 1YQVH 1R3IL 4EZMA 4MD5B 5JMOC 1IEAA 1J1PL 5IR1A 3DUSA 3FONA 2DN7A 1NCWH 1FN4A 1MWAH 3SDCD 3SY0B 2BNQD 4W81A 1B0RA 5D96B 3NCBB 4R3SA 5HYQA 4YHIB 2YPVL 5AZ2L 4I1NB 3BKCH 3QZWA 3S88H 4MCZA 4QRSB 4O2CB 1J12A 4NP4L 2OS7A 3OKNB 4NYLA 2WMPA 3C2AH 1KELH 1OF2B 1XGRB 3MRGA 3VD5A 2VXQL 3EOAB 1RIVH 4M03A 3KYMA 3HE7B 1NBZA 3IJHB 1ZHKB 5F96H 3IU4L 2CDGA 3QXAA 4PRPE 4LLWA 4TSCL 4OV6F 3BT2H 3QEUB 2EDBA 3GIZL 5IW3A 1LNUA 4WY7H 4W6WB 3GMLA 3MRLB 3QEQA 2HJLB 2YD6A 3DRTA 1T6WA 1U8PB 2Z8WC 3CXDH 4Z7VE 5IMOA 2HN7B 2QADC 2XN9D 3EGSA 3PQYB 4N5ED 5KSVA 1XF3B 2BZDA 4HHAB 3I6LE 3GHBL 1S7TB 2BNQA 3BVNB 5J12B 4WUUE 1F2XK 2NY6B 1HSBB 4YUEH 3O4OB 5IMKB 2GITB 5KOMC 5ACLA 1C8PA 3SQOH 1UT9A 1OP3H 4OZ4B 5C09E 3QIBA 5L2KD 4NQDE 5ESVA 5JDJA 1AGCA 3NN8B 5FYKH 4JDVA 2Y07L 2MQCA 2Y23A 2E7BA 1JI2A 1MUJA 3HC0A 1TPXB 4JZJC 5TH2A 3VGAC 3DO3A 3OKEA 1P7QA 2MNUA 3WO4B 1SY6A 4YHYB 2ZCHL 3CDCA 4PTUA 3PUCA 2V2XA 8FABA 4NZRH 1FFNA 3L3JB 25C8L 4PJDB 3FONB 4XNYL 3E1F1 3RVWC 1VGEH 2MCPH 1UJTA 4HWZB 5J6HA 2DIAA 3L1OL 4NNYB 4PJIE 3CX2A 2Q6WB 1GZQB 2J7LA 1RK1A 2HT4D 1KJ2H 1QKZH 4GW1B 2WWKT 2VSDA 2NY6C 4LIQL 5JOEA 1VFUA 5BO1L 3X14B 3VXMD 1D6VH 1MVUA 2R0WH 2C4FT 3MRFA 4H25B 1UA6L 1SQ2N 3FQXA 3JV6B 1CFBA 1I1AA 1T80A 1JZ2A 3FQXB 3CK0L 3ROOB 1CG9A 4UDTA 1TVDA 3L9RA 4U49A 4JHWH 4PGZA 4FFYL 1BWWA 3PF2A 1YY8A 1EXUB 1H0DB 2ICWB 1G7LB 5CWSB 1IAII 1ITCA 3ZTJH 5IHLB 1T0MA 3RVXC 1RUML 1X5LA 3N1GC 1HSAB 2E6QA 5F70A 3RWIB 2AVGA 1PKQA 4JJ5B 3GMOB 4ODSH 4Y5XC 1L0QA 4OFIA 2PO6C 3QIBB 4WUUD 5I8OH 3QG6A 4LK4A 2DBLL 4J4PD 3H6JA 4JRYE 3VFWB 3X17A 5IJKC 5EC1A 4F9LC 4XWGL 4DZ8A 3CXHJ 5HHME 2N7BA 3RWEB 2BMKA 3DUUB 4KDWA 1GHFH 4DQOH 5EN2B 4XVUC 2WP3T 5FAAA 4ZYKA 1BEYH 1N59A 4I18A 1I1AD 3O45B 1N59B 3W11D 4H1LA 3U7AA 4XCFH 2GFBA 5B3NA 1TETL 4WO4C 1ZA6A 1AKJD 1ZK9A 5FF6A 3DUHA 3GHEL 4XPBL 4WRLA 3X11A 4WW1A 5I2IA 5C6TH 2GY7B 4QXGH 3V6BR 4PY8J 2KUTA 5DC9B 4URTB 3MOBH 4YNYA 3MSPA 3LIZH 5H2BA 1F6FB 3S3SA 5F96L 4K94L 1TQCB 5DZNA 5J89A 3OKLA 4JDZA 3QWOB 3GSQB 3O11A 3VFGH 5JDSB 4OJFH 1BD2D 1IQDB 5E8DL 1XGUA 3LB6C 1DL7L 4HUNB 1GXEA 4P3DA 5EOCH 5BZWB 5FOJA 4XBEH 3D3VE 3GMPB 4KI1A 3ALXA 3W2DH 4IBLT 5GGQL 1QPPA 3GKZA 5MEQB 3BKYH 4HCRL 1S7VB 4Z5RB 2AJ3B 3MNWB 4HT1L 4NUJB 3HNTL 2N1KA 4PGEA 4FQLH 4JG0L 3HB3D 3VXTB 3T3PF 4PGEB 4QRRB 4NDMB 3GK8L 2X42A 2X89D 3HG1A 1IBGH 5HY9A 4GG8A 2I9TA 1JPSH 4XVJH 1WUNT 2YPLD 2NPLX 4QYOA 5LGHL 2FJGA 3QFJD 5FYLD 1NJ9A 2YMXH 1MJUH 3MLTA 2XXCB 1QFUL 4I3RL 4RMRA 3UYOD 4PJDA 4Z9KB 4HFUL 1RIHH 3NIGE 1DN0B 2HTLC 4GG6F 1XR9A 1SEQL 2X4OA 4LNRB 3MRIA 1LO0H 2E6PA 1XGPA 1HDMA 1FVEB 3KPRD 1RU9L 5F7FA 2QSTA 3SQBA 4BFIA 4PJEA 1Q9WA 4OUUB 3SE9L 2J5LC 4JR9L 3CSGA 5TQ0H 4I8DA 4ETYA 2FR4B 3PWLA 2MQ0A 2NY0C 1J0HA 4AK1A 1A1OB 3K8LA 2CUIA 2RIKA 3VFWA 1IGML 3QNYA 3KGRA 3BKCL 3CK0H 1U3HC 3BKJL 5BVJB 1PX3A 1MHPH 1MOEA 4E42B 2NY0D 1NEZG 2OYPA 4IRJB 4Z95H 2PR4L 1GGIL 4UDUA 4MJ6A 1ZLWK 4U1HA 5IIEB 5JQ6L 3CLEH 1EVUA 1VGKA 1W0VB 5DRNB 3KYMB 1Q0XL 2WANA 1F45A 5CCKL 3HI1A 5I1DA 4ZXBA 5JHDD 2AK4E 2IPKA 4TUKL 2ZOLA 3I2CH 1N64H 1MFCH 3J7HA 1I3GL 2XOTA 5DK2B 4JJ5A 2X41A 5D72L 5DLMH 4YK4C 5DK0A 5TGBB 3WDHA 5JPMB 3I6LD 5SWSD 4FQ1L 4YAQA 2WIMA 1FZOA 4WFEE 2EXWD 5FYKL 3AGVA 2MKLC 4XP5H 2ESVA 4LNRA 5A2FA 4O02H 1PSKL 1ODAA 3G5VA 3E6FA 3T3MF 1IGJB 1QEWA 5CKAA 2CGRL 4GRMB 5GS2H 4PRPD 2OSLB 3ABZA 5DYOA 1M6OA 5FM5O 5HHVL 1BQSA 4WHYG 1HQ4B 3SGEI 2ZG3A 1BLNA 3O6KL 4NQDA 4G3YL 2Y6SD 3NH7H 2BVPB 1R3KB 3U2SB 2J88L 4ZUWB 1ORQA 1OWWA 1O0VA 4K9EH 4KJPD 2QEJA 2GT9B 1UXSA 2NY1B 2WQRA 5C0BA 1W8NA 5BRZE 4U1GC 1IC5H 1JF1A 1BFTA 2DOCA 1Q9LB 4QRTB 1QA9A 3RZCB 2IAND 3GKWH 3S6CA 1Q94B 3GBNL 5JR1L 1EDQA 5GGRA 3LKNA 4ESKA 2IALA 1QVOA 1FP5A 2V5TA 3RWHB 1INQA 1B3JA 3CX5K 3TJHC 1F58H 5SWZB 1P2CB 4XNMB 5AWNL 5J57B 3HI6H 1AR2A 3RUGF 3QCUL 2YD7A 1RZIB 5IFAL 5BW7C 1RFDL 4NN7B 1YEHL 4LPCA 3QUXA 1UB5A 3BUYA 3OPZL 4HK3N 4KRLB 4RRPG 5J1TC 1WK0A 2H9GB 3GUTA 2PXYD 2LTQC 3DVNB 4HC1A 5D1ZA 3QPQC 1P7QB 4LPUA 2C9AA 5DK2A 1KJ2B 3GI8H 1NGXB 5E2VH 3BD4A 2OTUA 4JPIA 2P7TB 5FUCC 4PJ7E 3UMTA 1KENH 3PE9A 4UDUB 2VABB 3TC9A 3TBVA 3SPVB 3OKDA 3HFML 4LSQH 1S5HB 1TQBB 3UTTB 5KN5A 4WI7A 4P0DA 4Q6IC 1KJVA 5HGHB 3RP1A 1U8OB 2C7UB 4LP5A 4F15C 3NTCH 4KXZH 1HKLH 3SDXA 3RX5A 4KQ3L 1UEYA 4LPXA 3UBXG 4TPRL 1BF2A 1Z9MA 3O3EA 4OLYH 2V5YA 3MR9A 1HI6B 1CS6A 3U7WH 3O3BB 3TV3H 1MCKA 2NXYC 1YUHB 3UPRA 1VACB 3TO4A 4JM4L 2DIBA 4GAGH 5HYJE 1QNZH 4WENB 3MJ9A 5D1ZC 2DQFA 1XR8B 3RPIA 1OD7A 4OD2B 2PETA 2QHLA 1DCLA 2VKXA 3MA9H 5GGRB 4P59L 1CQYA 3G5XA 5L2JA 1K2DA 4RMQA 1P2CA 4I3SH 4H88H 1VFBB 1HHIA 1TFHA 4K7PL 4OF3A 3QNZA 4XGZB 1QRNA 3T2NH 1D5XB 1M6OB 4HFUH 2YUVA 1IKFH 2YRZA 3HE6A 4IIQC 3W9EA 2WWKO 3ILPA 2R23B 3CVHA 1XGYL 2FDBP 1IGTB 4P5TC 2ZOKA 1ZLVH 4FQLL 1XFPA 5GJTH 1CD1A 4TVPD 3RVUC 1T2QH 4ZUTB 2IEPA 4LASH 4M9OA 1NC4D 4D9QE 3OKMB 1CXIA 1QBMH 4HZLB 1B4JL 2OZ4A 3ZHKA 5EIIA 2ARJQ 2M1KA 4P9MH 3E3QC 4DUVA 2HLAA 2C5DC 4HJGB 1H5BA 4XX1G 5BVPL 1N6VA 4JKPH 2HTKC 1INDH 4LSDA 4YFLF 3RDTB 2OXGA 3I75A 1TNMA 4N90E 5EU4A 4IRJD 2BXYA 4N5EC 5ESAB 5F1NB 2DQCH 3W39A 2CRYA 1MWAA 5C0IA 2GK0B 3L5WA 4Y4KA 4ZFOB 2Q86A 5CJOH 1SJHB 1Q0XH 3QI9C 2G2RA 4JRYA 5LGJA 2FYYA 1TVBA 3LQAH 4HPYH 2I27N 2F5AL 1G7HA 5F7MC 2ITDA 4XNXL 3VG9C 4MVBC 3CZJA 3EYVA 1RIHL 3M1BA 3VI3F 3IDYB 5FEBA 3EYVB 5JHLH 3SHSA 4HS3A 4M62L 2OR9H 4M1DH 4WU7A 3BO8A 3VFTB 1I9IH 2IJ0C 3PHQA 3QAZC 4XCYA 2HG5A 1F8TH 1MI5A 2AGJH 5IEKA 4TTDC 3TCLB 1RUAL 4JKWA 2BY2A 4Y16A 4M93B 1MEXH 1SYSB 4ZFZB 1I3UA 5FCSH 4E42A 4XPGL 3GDBA 3BWAA 3LQZB 4LRIC 1YQ2A 4G6FB 4XC1H 3T4AA 1I1FA 4IRZL 4MAUH 1KCRH 4GG8B 1WTLA 1G0XA 4N9GA 2K1MA 5KSAA 5T3XL 3C87A 3DX9A 4NO2A 3DIFA 2CR6A 1YEKL 5F3BA 4EUPA 2VLKB 3TVMB 1FFQA 1HDMB 2OBGA 3SE3C 3U0WL 35C8L 1KLGB 5K9JH 3IS0X 4ZUTA 2GI7A 5HD8D 4KRPD 4LCWB 4OCXH 3HMXA 5FUCE 4ZG1A 5HHNB 5HI4D 4GSDH 4PRDA 3RNKA 1OAKH 3U4EB 2P5WB 4Y19A 2F74B 3RPIB 4PREB 5FDWA 4LPYA 1UH4A 3QNXB 1H3VA 5DJXB 2NTFA 5C09D 2QQLH 5KVGH 3BFOA 4K7PX 2B1HH 1WCBA 4C59B 5IFAH 4OTXL 3G6JB 4PLKC 1AQKH 5DO2D 4XNQA 4A6YA 4K23L 3OGCB 3OPZH 1P4IH 1BAFL 1TJIH 4H1LH 4PD4J 5K9OA 4D0BA 3Q6FB 2ATPA 4QNPE 5DEGB 1HHHB 2FIKA 3G6JF 1A0QL 4L8BA 3HHRB 2D7TH 1QO3A 3EOTL 3PWPD 5JW5A 2PUQT 1G6RA 2VDRH 4NOFA 5D2NE 5D5MA 4Z77B 3ARGC 2JCCA 2EDJA 4KI5E 4PJ8C 1S5IH 5EBMB 3ZKXB 3O6FA 3QWRA 1OGAB 5C0FB 1JGDB 3QJHB 1WLHA 4K9EL 2YD8A 2IH3A 3ELAT 1AO7E 4TUJA 4CN6A 2R1WB 2NY5L 5C0CA 1FRGH 3HCVB 3FQTB 1MCRA 4YBHA 4MJ4A 4G8IB 1DDHB 3L5XL 4POYA 4Z7UA 1XEDA 2EYRB 4ALAL 4DN3H 1N0LA 3SDXE 2ITCA 4NRXA 3E3QE 2Q86B 3B5GA 5F9WB 3B9VA 1JPTL 5ITBH 2P44B 2XQBL 4GXUN 2HN7A 3HRZB 5EIIB 1A0QH 1Z5LB 1U8MB 5SWZE 2AABL 2FL5A 4LSSH 5JXED 2HT2C 3HZMB 3OJ2C 1W0WA 3ULUH 1AJ7H 3STLB 1TCRA 2F53A 4YDLC 5E95B 2GCYA 3RIFF 2AEWA 1WTGT 4L4TE 2XWBB 5C0AE 3RHWK 3LPWA 2K9UA 1AC6A 1U95A 4HUKB 1AXSB 2JKXA 2PYED 4LOUC 4NO5B 3TJHD 3FQWB 1LO4L 3MRDB 2WINA 2F8VA 2JE8A 1J1PH 4U1NB 4XVTL 1Y18A 4RDQF 1ZVSA 3B5TA 3L9RB 2RQ8A 3HPJB 1WC7A 3MYJB 3X12A 1GRWA 1PZ5B 2N4IA 3MYJA 3SDAD 4L29B 3ARBA 1FNAA 1O7VA 1CK0L 4Q6YA 3LDBB 4JGUA 4X4YA 1OAXH 4XHJD 2XRAL 1FVCB 5LG1A 1A5FH 2AEPL 5H37H 1RUQL 4ENEC 4Q0XH 4ZPVB 1VFOA 2EYTB 2VOTA 2G5BB 4JHAH 1JGVH 3T3ME 5HHQB 4H0GA 4ODWB 4DKEL 4RMSA 3P9MB 1F4AA 1RFDH 4X7TA 3V6OA 2R4RH 5I1KL 3NCEB 4POUB 3MROA 3DPBA 1NUGA 4G42A 1G1YA 3HNSH 5EA0H 4CVXA 3WFEH 4YR6B 5FB8B 2F15A 3UJIH 1FDLL 1OGTA 4NO3B 4ZO6A 2DWEA 3BAEH 1D9KA 2CIKA 4BQCA 4FFZL 5FGCE 1T83C 4OV5B 1R5WB 2IGFL 2A0LC 3HTLX 2X4RB 4HEPG 2NX5D 4TUOA 4YQXL 1Z5LA 4CMMB 2HLFD 5MERA 5I75B 3O2DH 1FE8L 1Z9OA 3V52H 3QEHA 2GCYB 1YPZF 5IESH 1NAMH 1OT1A 1ZVYA 1T1XA 1YMMB 3REVA 1YY9D 4FG6C 5FO9B 1EO8L 2ZNWA 1MHEB 3O81A 1K6QL 4MGXA 5DMGD 4YXKH 3FOLA 2EDWA 3OMZA 5EO9A 5CJOL 3KXFA 4X4XB 6CGTA 2A6IA 2VMFA 3BQUC 4N1HB 4WGVB 5F9OL 3WFDH 1YEFH 1FN4B 2VL5A 4WVRA 4TVPE 5TE6L 3BGMB 5T5FL 3NVQA 2EH7L 4RA0C 3LSOB 4U1LA 4X6CE 3MRGB 3VWJA 1CDUA 2EDDA 5MP6L 1KJ3L 3F6IA 2E9BA 3SJVA 2DQGH 1A7QL 4K9EC 4LDLB 2BNRB 2XZCL 2FJGB 3BH8A 4APQC 1I9IL 3MRLA 5C92A 1CF8L 4NCDA 1RVFL 3UPAA 4MXVE 3OAUL 2NW2B 4PRHB 3MREA 3WXWL 4XB8A 4MAYC 1FSKB 4Q6IA 1IM3A 2EE6A 2XA3A 3BZEB 4JFEE 3P0VH 5ISZB 1MCOH 3QZWB 5JW4M 1RZ7H 2EC8A 2GJ6B 4OLUH 1AH1A 4RAUA 4PJGB 1HHIB 4M1DL 3VXSE 3OR7A 3N9GH 4S11A 3DXAA 4CW1B 4F80A 4UUJA 4EOWL 4X8JA 1D9KC 4ERSH 4R97C 1IGYA 1CR9L 3QP3A 3T0DA 2HT2D 3K0WA 3ZKQD 3FT3B 5F7LB 1ZMYA 1CL7I 1CXHA 2HVKA 2DKUA 3VXOB 1HXMA 3C9NB 4JM2A 5ID0B 4YGVA 3PWJA 2ZSWB 1DQML 1H5BC 5IEHA 1ZLSL 1UZ8A 3HPLB 1MFNA 3BMVA 4U1SB 3S3PA 3TWCH 1T7XA 3VXUD 5FGBA 5M7QA 4MA8L 4OKDA 3FQWA 2IANA 4KVNL 1JZ7A 4H5SA 4TQEH 3L3KA 5SX5K 4WI2A 3LB6D 3QA3A 4YHKH 4QRPD 2NXYB 4PV9B 2JELH 1TMCB 5C08D 3GSNH 2GSGA 3B2VL 5E70A 3CCHB 2FYYB 4RWYL 2WLYA 5KS9E 5CP7A 3CCHA 3L5HA 1AHWC 4MNHA 4L8CA 1I1FB 1GGYA 3GHEH 4QHKJ 5A1AA 2NZ9D 2FHFA 3W5MA 4U1GB 4KRPC 1NMCB 4LLMB 3T8XB 1INEH 5E6ZA 4MHHG 4E9LA 2DDQL 5HJ3B 2X9YA 3RKDC 3K80A 1G7LA 4V1DE 1ETZB 3E2HC 1E4KA 4HV8B 1YEKH 4PB9H 5FFLA 5BRZD 3ULUL 2WUBL 3SJVD 1VESA 4WWKB 5T3ZD 3REWA 3C5ZD 2J1KA 3UBXI 4PJGA 4G9FB 3X3FH 1CU4L 4JFFD 1YJDL 3GRWH 4FA8A 3UX9B 3S36X 2VDKL 4LRNL 3VCLB 4OT1H 5T1DL 3ARFD 3HE7C 2XKSA 4LHQB 2E7HA 1TDQA 5EORL 4DGYL 3HZYA 4EVNB 3B2UD 4Y4FA 1YZZA 3KPSD 1WEJH 2XTJB 3VA6A 4D9LH 5AZEH 5MENE 2W9LA 5E00A 3E6FB 4NN6C 5SX5H 4F8QA 3GEWB 3P9LB 2ID5A 4GMSH 1AD0B 3D85D 1MSPA 3RDTA 1NMCC 1CDCA 3QUYC 1BQHA 1MJUL 1ZAGA 1XGQB 4I3RH 1RK0A 3GHBH 1X5AA 1LO4H 3DV4A 3MA7A 4CNIA 5F7DA 5JPNA 1U3HA 1FZMB 4OZGB 1OSPH 1QBAA 2NY4C 4PJCA 1NKOA 2UZIL 4P2RB 4F3FA 3KJ6L 1B6UA 1UH2A 3H9SE 1QLFB 1UWEL 5MI0B 3RKPA 4L3AA 1RURL 3HUJE 3WIHL 3ZE0E 1QZ1A 3RL1A 5I1GL 4LEXH 2GKIA 1I4FB 1CGWA 1C16A 1CGXA 4P2QA 5H2BB 2NY4D 2FL5B 4O5LL 4PG9B 4QGYA 4YBQC 5A2KH 3O6FB 3D39D 3I6GB 1L6XA 2ITCB 4NRXB 5BS0D 3D18B 4QXGL 4PJXA 1BMGA 1MFEL 4YR6A 5HYSG 1JN6B 4UT9H 2IPTH 2ZCLH 3BEWA 3HKFA 1I7UB 1AY1H 4G5ZL 2FD6H 4G9FE 5D71H 4JKMA 5CLTA 5IWLC 3D6GA 1DLHA 1QTYT 4ISVB 3VWJD 5E5MA 3DVNA 2DLEA 3AFLA 5E8NB 1OM3H 3V4UL 5MEOA 3F5WB 1U8LB 2VWEC 3BP7B 4I3GA 4QF1B 5AAWA 1E6JL 1OAZH 4TUOB 5D2NB 3QUZA 4X7EC 4Y4FC 3QYCA 1RZIA 2VR5A 3BEVB 3LS4L 3C09C 5AG8A 1HXYB 2VLRA 4XT1C 1BD2B 5GS0D 2A83B 5GS0L 1U8NB 1HE7A 1G7MB 1LDPL 4PG2A 3WYRA 4U1NA 4YPJA 3CLEL 1OSZB 5KAQF 1EEZB 1T5WB 1K3ZA 4LKXB 2FHBA 2W9EH 4O4YL 3H0TA 3SDYH 3QZWG 5DEGA 4GW5B 2AK1H 2DQTH 4PJEE 4MNQD 3DTXA 1H15A 2C26A 5BV7C 2ICCA 5INDA 5L7XL 4ZPVA 3IJSB 3RY4A 2P8LA 2R23A 1MFDH 5I30H 4Z7WA 4M5YH 3QEGH 2AJVL 3EJYD 1EGJL 4J3VA 3LN4A 4M93C 4UIMB 2HH0L 4Y1AA 5L2JB 5CUSL 1ZA3A 3LD8B 15C8L 3WKML 5DVKA 1DE4A 1KPRB 3CSPA 2VLKE 3A67L 1D3CA 1DLFH 2EDHA 1DUYB 3K3QA 3EZJB 4G6MH 3ET9F 3IDIB 1G9MC 1EAPA 2RAMA 2MHAA 2DF3A 3L95A 2VXSL 4NM4H 3VE0B 5JO5A 3F5WA 3TIDB 1YECH 1QFUH 3NN8A 5E08L 4QWWC 3T2OA 1B2WL 4U1IB 3QUZB 3FFDB 3N9GL 5ITBL 1CGYA 1DR9A 2KH2B 4G8GE 2HRLA 3L5IA 3QEQB 3HS0A 5GSRA 1CIUA 5JXAL 4M5ZH 4LLYB 3VGFA 2JTDA 1UWGH 1JHTB 3H9ZA 3TZVD 3PQYA 3MJGX 2X10A 2FWOA 2DWDB 1I7UA 1U8PA 3V7AE 5T1KD 3LCYA 1NAMA 1B0GA 5CP3A 3VFUA 5IB5A 4PJEB 4EQ2A 4XTRD 5KVMC 3QRFM 2QSQA 5I1GH 5J6GA 2YD1A 4TPRH 4M6MH 2X7LA 1DQTA 4UQ3B 2OTWB 1MNUL 3GSXA 1QLFA 3CFBB 2BY3A 2A6KB 3TNNB 2VZ1A 2YD3A 4PREA 5FDWB 4Y16D 4D9RE 5T5NG 2AQ3A 4FQXB 5AYQA 1CLZH 4L1HA 4OZFG 3CFEB 1FO0B 1LHZA 1S8DB 3WHE1 4PRAB 5BZDA 1UKSA 1FNSL 3P30L 4K94C 2ZUQC 4JFYA 4PRAA 4XP4L 4U1JB 1F4XH 4KKNA 1EIBA 1LO5B 5J1AB 4KPHL 2R69H 5AG9A 4A6YB 1KCUL 1WF5A 2FX9H 2E7MA 1MVUB 1E27B 3ARQA 3TYFA 3S5LA 5T3XE 4WTWA 1E27A 4HKXA 2CRZA 1NBQA 2EXYC 2R4SH 4ZAKC 3TJEH 4PJ9A 2OJEA 5E6ID 4C56D 4GFTB 2CK2A 4JQIH 1VB9A 5CJQL 4ZOBA 2EDNA 4U05A 3W0WE 1H15B 2DLFL 2WBJC 5EO1A 5AZEL 3L3GA 2BVEA 3HZYB 4EVNA 1J0JA 2IGFH 2X1WL 3C6LA 5DJAB 1C08B 1BWMA 2F74A 1F58L 2BSRA 3GJEA 1MHHB 4DCQB 1X5IA 5IG7B 1HXYA 2VLRB 3ZE1F 3ULVE 2ZCKL 3RZCD 2DQEL 4XAKE 4HK3J 2BOBB 3OAYK 1WWAX 5CEZH 2AJXL 4M1GL 1OWRM 5IOPB 1S7SB 2DI7A 3BJLA 2MMXA 3EDEA 4AMKL 5I71B 3TN0B 1XR8A 1YPZE 1AY1L 5ID1B 1NDMB 1HYSD 4MNQA 5CLWA 5ENWA 3QUMA 4UAOB 4ZNCD 5CD5C 3U1SH 4J6RL 5I1LA 1BQLL 3GZKA 4HJJL 1A2YA 2DM2A 4QT5B 3TZVA 2YR3A 3PG2A 2FB4H 2A6KA 4PRNA 2CUHA 3X11B 3KNBA 3MV8D 3PXJA 1UJ3C 4HJ0D 1CLYH 1UM4L 4ZS6D 3GRWA 2HJFB 2R0WL 3DJ9A 2BJML 1WZLA 1JTPA 1KOAA 5F7YC 3RL1B 2B4CC 4QKXB 4YDIL 4HUXA 4LLWB 5FYKE 1T3FA 5IUSA 5DD1H 3GSUB 3WDIA 2JJUA 5FKPA 4OCXL 4DUXA 3GBNH 3TA3A 1HKFA 3BPNB 4WW1B 3OKMA 4P4RA 1VFBA 2VERN 3GMOA 1RZGB 4XGZA 4Y2DD 4XBEL 3IDMB 2VE6A 4XNYH 2E9WA 4YLQT 3VDCA 5CEXA 3S9DB 5AWNH 2DS4A 4I5BA 3O41B 2VDNH 1FFPB 5B8CC 2XPGB 3BZ4B 2RCSL 3EYSL 1OTTC 3NFSH 1GIGH 1S9YB 3NPSB 3SY0A 4IJ3C 1F5WA 2J12B 5L0QB 4X83A 4JY6A 4P2RA 5I73C 4XXCC 3O2VH 1ZGLB 4N1EA 4AEFA 3OXRA 4WI3A 3V6ZB 4C56A 4S1RL 4HGKC 2DYPD 3OAZH 3CAFA 4Y1AD 5GJTL 5LXGL 2R1XA 4TVPH 5CSGA 5J0BA 4F9LA 2ZOKB 3IDNA 5B21A 5ITFB 2V2XB 1KC5L 5HGHA 1LEGB 2CSPA 4HIIA 5GGSA 1N26A 5CGTA 2DKMA 1CBVL 5IV2A 4LVNB 4NO5A 3V4VH 4I13B 5I19H 4OD1L 3GSNA 4L3CA 5SX4H 4EEEA 3PHOB 3MRJA 2JJSA 3GM8A 3RVVD 3TGXA 3MC0A 5EIVA 4XNUL 1CFQB 5E9DA 2HAZA 5D8JL 2VWEE 5ILTL 2V17H 3D0VA 5DUPL 5FYKD 4L9LC 1KGCE 4X6FB 1A1NA 3MNZA 1YN6A 2A6JB 4Z0BL 5GZNC 3FRPG 4NUGH 3SKJH 3JV4B 4OQTA 1Z3GL 3KXFB 4X4XA 1QLEH 3MRHB 1QLRA 1LO3H 2EDYA 5F44A 5GHWL 4MNGE 3B9KC 4LARH 6FABL 3S37H 3HR5A 3CH1B 1HH9B 2XFXB 4M5YL 4PJBF 4X4ZA 4ODHL 2CDGB 3KPLA 4JFOB 1IEBA 4QHMB 4PJGF 1DVFC 1HHGB 4NJ9H 2ZOLB 2HWZH 2PNDA 1WCQA 3CPLB 2BCKB 5HBBA 4FQXD 1DANT 4OV5A 1GC1C 5C0EB 4HPOH 4XVTH 5HD8C 5D7IE 1LK3H 1KCRL 4Z0BH 4UTAH 5CD3A 5I1EH 2CJUH 3MOQA 3U7WL 1T1ZB 1I85C 2NY2C 4GKNB 3BGFC 1T7VA 1RHFA 3IDNB 5GGTA 1FYTE 4XP6H 5HI3C 5LWYL 1QSED 2VLLA 1NUDA 1Y6NR 3EYQC 4WTZA 2HT4C 2PYFB 5DC4B 3MQIA 1H8NA 4PJFE 1ZWIB 4TTDD 4LLDA 3HE6D 1FZOB 5DYOB 4OGZA 5F9DC 1AI1H 3MCLH 5JPMA 3WV0A 5E4EB 4KRPB 4LCWD 3LZFH 3ZE2F 5T3ZL 1A9EB 4ZOEA 4UQ2B 3UTSE 4BSWB 1ZS8A 4IMLA 2UY6A 2XY1A 4ZXBC 3FQRB 4GUPA 4PJIA 3CZFA 2AEIT 5BMFL 3WIHH 4PJ8A 4KHTH 2PW1A 2BNRA 3SGKA 3RWDA 3R06B 2H32B 4DK6A 4UB0H 2XICA 4ZFZA 4HIJB 1K8IB 1GIGL 2H6PB 5I74C 3WSQH 4QRRA 3GSVB 5IGXH 4YHKL 2P49B 3AREB 1XCQA 3BGFB 4PJ5D 3IDMA 3B9KA 5FECA 4EBQH 4X6CA 5HDQL 5JA9A 3L3IA 5GRJH 1P6FA 1MCFA 4QHMA 1G9NH 4H8WH 3S8WA 3RKDD 1UQSB 1CLYL 5CJ5A 1Z0MA 4MJIE 4Y4HD 1IRAY 1YA5A 1BP3B 3EO0B 5GSVA 3OKKB 4DK3A 1NGYA 2OL3L 5HJ3A 3RVTD 3NFPA 2FB4L 5FYLE 2VAAB 1GGBH 1MUJB 3RX8A 4WI5A 1H3GA 2D0GA 1MJ7H 1K3IA 4FABH 4LHUB 2D4FA 5C0GA 12E8H 1FVDA 1NBYA 4FXKB 1A47A 4AMKH 4G8IA 4JN1L 1VA9A 1A3RH 2KKQA 3O3DB 5IHZA 3WBDA 5BV7H 1X5FA 4NQXB 4QCIB 5C71A 1J8HD 4LRNH 1RJLB 3HNVL 3ORJA 3KLAB 2R2BB 3CD4A 4K7FA 3HMWL 3QDGB 1EZVY 3B9DA 3U0PB 1TITA 3QNYB 4OAWA 1GGUA 4WFHD 2VLKD 3TVMD 2M26A 1S9XA 4CRPA 3U9UA 3VFPB 1LK2B 4IS6A 5CP7B 5T3XD 3IJSA 4OCYH 4DVRH 3RTQD 1A6ZA 4GMTL 2V9TA 1QACA 1IGTA 3BPOB 4X5WB 5T1LA 1E6OH 1IGFL 1P5VA 3QIUD 4NM8H 1CD1B 4JZNB 5EU5B 3QFDB 5FUOL 5C09A 4OGYH 2QKIB 3ZSSA 1YUHA 1ED3A 5F1IB 2Z31D 3QHFL 1OAXL 2BVYA 1YEIL 4E5XB 4Q9QH 4KJQD 3JTSB 4AM0B 4JFDA 1VGEL 4G6KL 1Q9KB 1JYNA 4NPYA 1S7QA 1TZGL 1UWXH 3N1PC 2QSVA 2HT3C 4U6YA 3LKRB 3B9EA 2PYFA 2E8ZA 4PJIB 1KB5A 2IQ9L 2VUYA 3JWNC 2AXGB 1L0XA 2DL2A 4Y4KC 3RU8L 3P73A 1TCRB 3UTQB 5CSZB 4JB9H 4F7MB 2NMSA 4NQEE 3QRGL 1KPVA 3ARRA 4KZEH 2CRIA 4QHLA 1VCAA 3ISWA 3QWQB 4FQCH 1AGEA 2YRLA 4ZDHA 1JN6A 2XG5A 3ZDYE 5CIPA 3FJTA 3HZKA 2HKFL 1U0QA 4ETQA 2VB5A 4HWZA 3BH8B 5E5MB 4PTTA 4PJ9D 5EU3B 3OB8A 1BZQK 5D7LB 4PPTA 2XKNA 1RJYB 3T2QA 3RWGA 2OCFD 3DETD 2UWEF 4KTEH 1QYGH 4M61B 5A3ID 2OR7A 5HGBB 3LEYH 4J12A 4NZUL 2VDLH 1JHKH 5KZCB 5E5RB 2YN3A 4F3FB 4K7PH 3SOBH 43C9B 5D93B 3R8QA 3BVNA 4GXVL 4PJAA 5DURB 5ANMB 1QQDB 3BHBB 1EK3A 3QDME 3ULUF 1TETH 4ZUUB 3RX7A 2NXZD 4UILH 3GO1L 5FYJH 4IRSA 3DWTA 1BJMA 2GHWB 3DBXA 1OPGL 5GRUH 2YPVH 5AZ2H 3QIWD 3IF1B 5F88A 4V2BA 4ZTPL 1QFPA 5C70A 3T4YB 1DQQA 3LOWA 3WFEL 1JWSA 2NY5C 3MCKA 2OX5A 1KELL 1U92B 2MPAL 3BD3A 5E1AA 2VXTH 3FTGB 5DQDH 3Q0HA 2LAGB 1UVQA 5D1XB 3C5ZA 4YPGB 3MRJB 4HMEA 1X3DA 3LN4B 3SO3B 3FT4A 3H3KA 3MOAL 2Z8VC 4R0LA 3MRKA 2H41A 2WLZA 1A5FL 1KTKE 4HUWA 1EXUA 5C0JB 3V52L 4PJHF 4NSKB 1JUFB 1AFVH 3PL6C 2W60A 2GTWB 4QHUB 4H26B 5J8OA 1DUZA 2W60B 4JO4L 4EN3B 1FAIL 3O8XD 1L6ZA 5DJ0A 1WICA 3V7MA 4MA7H 5I8CA 5MHSD 2CLRB 1F11A 4H8WL 5DD5H 5B39B 4RIRA 5EU6A 4DTGL 3MNVB 4MAUL 1NMBL 5I1AB 3U46A 3H9SB 1G6VK 1OAQH 1CE6A 2YPKB 1FDLH 1N2RB 5DQ9A 2NY3D 1JVKA 4OD2A 3U0WH 3BYTA 1N8ZB 3H7BA 4U1HB 1AQDB 5IIEA 2D03H 4ONGH 5D2LA 2W59A 4C58B 4OI8A 3QUXC 4UBDD 3K2MC 2VQ1B 4Z7UF 5I19L 2O5ZH 3VMPA 1OLZA 2Y7QA 1KJVB 1T7WA 3HI1B 4UT7H 3QQNA 4FQJL 4G7VH 1QBBA 2CKBA 1JRHI 2P5EB 4FTVD 4D8PB 5L0QC 3O4LA 4F7CA 3O3AB 3U30C 1U8MA 1MAML 4IEFB 3TPKA 3CPLA 5EU3A 4NC0B 2R8SH 1WAAF 2O26U 1W0WB 5CSZA 2IPTL 2ZCLL 3L7FB 4ZSOE 2BSSA 4HIHB 2WBJB 4G5ZH 5DRZA 3VD4A 5GISL 3MLYL 4KI5C 4PUBL 2DQIH 3LKRA 2P4AB 3P9WB 3S35H 4JY5H 1SMAA 5K59E 3G08A 4LSUL 4JG0H 2J5LB 3W39B 3T0EA 5ID0A 1QSEA 1N3NB 3H7LA 1IT9H 4O2CA 4Y1AE 3S36L 4LCIH 2E9IA 1G7QB 4QGTA 1FPTL 3QCVL 1A7QH 2HLAB 1WV7T 2A77H 4FQ2L 5ADPH 1QSFE 4PP2B 1VADA 3P77A 4ZDHB 4DJMA 5ICZA 4JO2H 3VGBA 4KROB 4X6BB 1Y0LB 4WCYH 4Z7NE 4JZOA 4NDMA 1DEEA 3RAJH 4JFHD 3PGFL 3X3GH 5JORA 3C2AL 5BQ7B 1I9EA 5FM8A 1I7TB 5KOVC 1R3LB 4NUJA 4BZ1H 2I9TB 4V1DA 1PLGL 5EDXA 4HUVB 4FN0A 2EIZA 4I48B 1OAUH 1K6QH 1FVEA 3BKJH 4ALAH 4DN3L 3TFKD 3MUY1 5JLZA 1V3LA 4QY8B 1KIRB 3Q3GB 2Y36L 1RSFA 3DMMC 5CZXC 3UJTL 1OAKL 2ADJB 4CVZA 3VH8A 1FE8H 5CGYC 3BDYH 1A6ZB 2GUOA 4HUUA 1SJVA 5DC0A 4O2EB 3MBEB 3BW9B 4L3EB 1KB5H 1UYWH 1NBVL 4NNPL 3ZHLA 4YJZL 1RV6X 5E2JA 1E0OB 3HAEG 5GS3A 4UQ3A 4EUPB 4NO0B 1IILE 4OFYA 1FBIL 5TH2B 3NOIA 2EZ0D 5IVNA 2P1YA 4LGPB 4V2CB 1UACL 1S3KH 3BWAB 1CT8A 4C4KO 5CBAB 1IGFH 1MRDH 1FG9C 1OAZL 1E6JH 1FIGL 5FO7B 1GCFA 4K23H 1A1MA 1MAJA 2W92A 1AC0A 5T5FH 5KW9L 4ORGB 1BFSA 1S9WA 1RUMH 5F89A 1ADQA 2VLME 3F65A 5BVPH 5L88L 4GBXB 4R26H 4P23C 4FXKA 2HG5B 4L5FH 2OM5A 5ETUB 1N7MH 3KR3L 3D3VA 4MA7L 1W72A 3M17B 2Q7YA 1SYSA 1MPAL 1NANI 1JGEA 3HZVB 4ZQKB 2R56H 1BM3H 3BDYL 1A7PL 2X4RA 3HUJB 4AG4L 4MA3A 3SGEH 3I75B 3B9AA 2ICEA 2CD0A 3IDUA 1MH5A 3KYNA 4LRIA 1G7JA 2AERT 4KFZC 2OL3H 3MBEC 4Z95L 1R0AL 4NZTH 4KZDL 2VQ1A 1UCTA 5B39A 2A73B 3KHOA 3C5SA 5HTSA 1J5OH 1UXWA 4XAWH 5DUML 1XZ0A 3PWPA 4OGXH 1KPRA 3ZDXF 3SCMD 1WIOA 1G7PA 2ADIB 1TLKA 5FO9A 4K3HA 5I1LB 3JSSA 2XXMB 3B8YA 4KY1H 3EDDA 3FOMA 3GKWL 3KWWA 4WUKH 4BH8A 4F33A 4ZFOL 5JR1H 4NHUA 4YDKH 3TN0A 3W0WA 1S7QB 1OCWL 2X70A 3WO3B 4K8RL 1V8HA 4IOSD 1OARL 5ADOL 1ZLSH 4U6VH 1KJMA 5CEYB 1MI5E 4DZBB 2V5MA 2NYYC 1D6EB 3MRPB 4YFEA 3GGWB 3CU1A 4XMKH 3I6KA 4KUCF 3ULUC 2H6PA 3MACH 5CSBA 2Q8AH 2Z8SA 4MQXD 2BVPA 4EUPH 1HEZB 1J05B 3EYOB 5EPMB 1KC5H 4Y4KD 5MEPA 2DQUL 2EKSB 5AYUH 1MFAL 1Q0YH 2Z92B 5IWLA 1AKJA 4MNGB 3MRMA 3QUKA 4TSBL 2K7QA 1OY3B 1WZ1L 2ESVB 3AMKA 1CGUA 1EH9A 1LEGA 4PP1C 3GM0A 1CGSL 1MCHA 1TQCC 3WIIH 4WO4A 4OZHB 2Q76A 4POZD 3HRZA 1QEWB 2Z9TA 1YEFL 3GMPA 2QQNH 3GJFB 4RAVA 3STLA 3PP4H 1RMFH 3CFEA 1L4IA 1U6AL 2XWJA 4D3CL 4EI5B 5I1HH 1QQDA 5J4MA 2J8UB 2AJ3A 3MNWA 5MP6H 3QIUC 5CCKH 1M05A 4JY6B 1IEBB 3B2UC 3LMJH 3PP3H 3RGVA 4OCSH 3GMNA 5BS0B 2CUMA 5JW3H 3GSWA 3BH9A 3IETB 4PJAB 5KSVB 2CO7B 3G6JE 4OLZH 3O2DL 3ZYIA 4AYFA 1I3RA 2MJWA 3QXTA 3BE1H 3FCTA 4HWBA 5GISH 4GG6B 1GH7A 2Y1VA 4YHMH 4Z78A 3SDYL 1QUNA 2EZ0C 1UM4H 3L3KB 4P59H 3TPUB 3CFCL 4GAYB 5GGSY 1VHPA 5HDBE 2YXMA 3NH7L 3ZYJA 1DBJL 5FV2A 5IB2B 2NR6C 3JWOH 1UFUA 2DWEB 5ACMA 5HSFA 3G6AA 4N68A 2D9QB 1IM9B 4NBYB 4NCC2 5TE7L 1JE6A 4ONHB 3MRQA 2CIIB 4FNLL 5D2LE 4HK0A 3TFKC 3ZYOA 1MCWW 4L5FL 3VW3H 3MLSL 2LU3A 2APWA 2ZG2A 1P1ZB 2EKSA 5CAYB 3KPQB 1JZ3A 1QOKA 3NTCL 5JUEH 3L95B 5MHSE 5D6DA 4LAQL 4JKLA 2R15A 2F9BT 1Q1JH 4XRCB 4JR9H 4LPTA 2F54A 1U3HB 3MV7B 4OQTH 4FFVC 2NLJA 1Z2KA 4S1RH 4UT9L 1MCCA 5IQ9B 3MBED 1I9RH 2PYEE 1IGIL 2ATPB 2SEBB 4Z7OF 1NFIA 5HYEA 4F33B 5KVDL 4RQQA 2VXVH 2NYYD 3P0VL 3AU1B 3MLWH 4H8WC 1CK0H 4PGCA 4P2RE 1WT5C 4X0KB 1X9QA 1P69B 4YHYC 1AKJB 3CVIL 2GT9A 4Q7DA 1RZ8B 2WBKA 2PCPB 2VUOA 1OP5H 3RNQA 3WNOA 4QOKB 1JF6A 4IMKA 4HX1B 3PHSA 1CFSA 3KNBB 3RAJL 5KW9H 3IDJA 2V5RA 1YEEH 4WV1B 4FQXA 4WI8A 5ABDE 4J8RA 4QTHA 1KJMB 5ICXB 2CPCA 1S7VA 3G08B 4JRYB 5LGJB 1VKXA 3L3JA 3MLYH 1NMAH 4BSVA 3RY5A 1FBIH 1IJ9A 3FO1B 3G6DH 2PTUA 2VDPH 4XI5D 4AEIH 4HIXH 4TVSa 3HMXH 4HJ0C 5B38G 1MAKA 1EVTC 4YUEL 4B53A 3IDXH 2Q20A 2X1PA 4YXHH 1LE9B 5L6YH 5HYFA 5F7EL 3PABB 1WBYA