3D1MC

Crystal structure of sonic hedgehog bound to the third fniii domain of cdo
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
87
Chain Sequence
GPHIAYTEAVSDTQIMLKWTYIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein / cell adhesion
molecule keywords Sonic hedgehog protein
publication title The mode of Hedgehog binding to Ihog homologues is not conserved across different phyla.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 87
sequence length 96
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d1mC00
3ILQC 3U46A 5SWZD 2UV3A 1PZ5A 4Q6IA 5HYSG 4XWGL 4GLRI 2DWDA 1WICA 4Y4HB 2ZNWA 3RFZC 3Q5YA 3TO4B 3EYSL 4NSKA 2UWEE 1T0MA 3WNKA 5E5UB 3CFEA 2NX5A 3KPSA 5C8JB 3C5JA 4L4VE 2E3VA 5CLWA 2ATPB 4DFIA 1JGUH 1S78C 3UZVB 5FIEA 4UINL 4FFWC 3AB0C 2FO4A 1NGQH 4LL9A 4Z78B 3L3OB 4PLNC 1JNNH 2YKLH 5DT1L 1I9JL 2VDKH 1LP9E 1CDIA 3RVVC 4OB5L 4GH7B 4OD2B 3GSQA 3EOTH 1BECA 1S9VA 2Y5TA 4R26H 1FAKT 4NYLA 1ZLSL 1VKXA 3FRUA 3SCMB 1QFUH 5FKPB 2DQTH 1FZMB 2YRPA 4Z7WE 1U8KA 1IAIM 4GRWE 3JTSB 3SJVD 2X9WA 2YN5A 5GGSA 2Z31A 1XF3B 1R24A 3MRRB 5T3XL 1AGFB 1NGWB 3BGMB 3TBYB 1ZVYA 5J6HA 2XNAB 4P9ML 1VFUA 4BZ1H 5F89B 2QQNL 1JWSB 5D71H 3EHBC 3VWJC 5GIRA 4Y2DC 3O81A 3U46B 1Q0XL 1PZ5B 4F37K 5FUCE 1ES0B 5ECJE 2OTUA 5C08E 4LK4A 2GSIB 5DVMA 3W11C 1TPXC 1OSPH 5DMGD 4QRRD 3G5ZA 2J6EL 1GC1C 1T0MB 4R4BA 4Z0BH 3C87A 3AS3A 1AC6A 3MRKA 3CFEB 4ZFFA 4PJDA 2NX5B 4JG0L 5DHXB 4X5XA 1MPAL 3KPSB 1OAQH 1RZ8B 4M7KL 2ZCHL 4BSVB 1OGAE 3QPQD 4U7KA 1DQMH 3IF1A 1B6UA 5MI0C 3TBTA 4N8CH 1J8HD 3GSQB 4P3CH 4BKLA 1S9VB 4QRPD 2OJZL 4NYLB 3MA9H 1VKXB 3FRUB 3AMLA 2W07A 4XCEA 1U8KB 2EYRA 1AE6L 4ZYKA 5GGSB 1NAKH 2AK1L 3HE7D 2H32H 2J6EA 1CZ8L 1R24B 1MY5A 5ISZD 5J6HB 1KC5H 4XNUH 3ARDC 2FGZA 2YHGA 3CD4A 3QCTH 2WWKO 3LSOA 3LKPA 4KROC 5HVHC 4NNXA 1QFWH 4Y7MA 1KXVC 1JNJA 4XHJC 4WIQA 3MJ7A 3BSZH 5GGQH 1AKJA 2L7JA 5ITBH 4LVOB 3G5ZB 2FDBP 3LEVL 1QR1A 1R3LA 2VDRL 4PJEF 3MRKB 3K46A 3BDBA 5K9OB 4WFGD 1F2XK 3BWAA 3CZJA 5A2LH 3MRHA 1SQ2N 3VXPA 4DKEL 4ZFFB 2DDQL 4PJDB 5KVGH 4X5XB 3BQUD 1HHHA 1IC7L 1NGYB 3U48A 3H9SD 4RWYL 3MRDA 2RQ8A 3HI5H 2XQBL 3IF1B 3QIBC 3BEWB 3S5LA 3DYOA 5CHNB 1EVTC 3TBTB 4BKLB 4ENEC 1MREL 4IHOB 4HK3J 1OVZA 4TVSa 3V7AE 1I8KA 3DJ9A 4XNXL 4GUPB 2FIKA 3FOLA 3TWCL 1U8PA 4LEXH 4XCEB 5I1GH 3I6GA 4OZFG 4WI4A 3H9ZA 2Z93A 2EYRB 1E28B 3JSSA 4MA3A 1VDGA 1H8SA 4YEEA 4ZYKB 4HIJA 3T0EA 4OZHF 5K59F 2D7PA 4Z8FL 4UTBL 3O4LD 3MLUL 5L8KB 1U3JA 2P42B 4CVUA 4XNYL 5LBSH 1EBPA 3LKPB 3LSOB 4NNXB 4O4YL 4ACPA 2VERN 4J3SA 4U2YA 2ILLA 3MJ7B 1FV1B 1IARB 3O2VL 1AKJB 3PV6A 3H3BC 1QR1B 1R3LB 2L4OA 4QWWD 1S5IL 4KZEH 2V2XA 4AIXA 1N59A 4HWBH 3BWAB 2YOCA 3MRHB 3VXPB 4EN3A 3O3EA 2MMXA 1GAFL 3GSVA 1REIA 1HHHB 4U2ZA 4M8VA 3SDXE 4UT9L 4OT1H 4W6XB 1ACYH 2WLYA 3MRDB 4EIGB 1D7FA 3QIWC 4R8WH 2VDNL 3MLVH 4I2XE 1F90L 1G7JA 3VRJA 5A2KH 2DBLL 4P5TD 1N7ML 2FIKB 3IFNH 3FOLB 2YD5A 1U8PB 1O7SA 4H20H 3I6GB 5FK9B 2FHBA 5FCUL 4KUZH 1UWEH 3PP4L 1I9EA 3RX5A 3ULUC 1MIML 4Y4FD 4HIJB 3T0EB 1E4XH 3ROOA 4QKXB 5I1CL 1U91A 1CGYA 2KKQA 1UWXK 4KK6C 5JMRA 3C6LA 3QEGH 5A2FA 5GISL 4TTDC 3UJTL 2VDPH 3IU4L 5LXGL 5D1XC 1KELL 2OCFD 5ERWA 4XVSH 3ZE0F 5J1TC 4MD4A 2ZWLT 3PV6B 2GSGA 4R97C 1HNGA 1EVUA 2IALA 1I1YA 3D9AL 1FCCA 4PJ7E 1KIRA 2V2XB 3ZZ1A 4N0FA 4EN3B 4FXLA 3O3EB 2D7MA 3GSVB 2NY6C 4PJIE 5HDBF 3L5XH 5KSUA 4GG8A 2RB8A 1UZ6E 2CGRL 2IANB 3JWDH 5EUKA 3IKCA 4NQSA 4XVJL 5T5FL 3TFKD 2Q1EA 5AAMA 4TOYH 4UAOC 1YYML 2VC2H 3BH8A 1TENA 3GSRA 1EPFA 1G7JB 1MHHA 3X14A 3BZDA 4BQ9A 3VRJB 2E6PA 1GGCH 3TT3L 2F53D 1BQUA 1QKZH 1EJOH 1NFDA 5I1KL 2VZUA 2R0KH 4K7PL 4RGOL 4HPYL 4Q9CA 1CDUA 2HT4D 4XRCA 5E6ZA 1SYSA 1NC4B 3W0WD 5GQBA 5D9SA 5EBGA 3ROOB 2R2CA 4XP1H 4HLZH 5DGRA 5T1LD 3S36H 4NZDA 2G60L 4HT1L 5GS0H 3MQIA 4NBYB 3C6LB 5K9QI 3VXSB 4ZXBA 4NUGL 4X7TA 1RZGB 3EFDH 4LVNB 2C4FT 5EN2B 2EKSA 5ERWB 3O6LL 3EYSH 4JKWA 1BWWA 2BVEA 4F33A 4MD4B 6CGTA 3QXVA 2GSGB 4XTRD 1YN6B 4OV6F 2CO7B 2BY1A 5ICYA 4NQDD 5C6WH 4GKOA 4JRYD 4MXWH 4XPHL 4N0FB 1MF2H 2X09A 4ZS7H 3OMZA 5KSUB 4OFDA 2OXHA 3C5SA 2YBRA 4GG8B 2OMBA 5EUKB 1R3IL 1X9QA 1Z5LA 3IKCB 4NQSB 4GAJL 2PYEA 3BIAX 5JTWA 1B90A 2KL6A 4ELMA 4OB5H 5J13B 4BQCA 3FT2B 3X14B 1DEEA 5JMOC 4N9GB 3EFFA 3QAZC 4NQXB 3O9WA 5T33H 3WJJA 4UT7H 1SMAA 3GI8L 1NCTA 1AGBA 4V1DE 1CLCA 3BYTA 1NFDB 2ZPKH 4L9DA 4UNUA 4XRCB 4H0HB 2IADA 4X6EA 4IRSA 5E99H 3IFOA 1S7XB 1SYSB 4OM0H 5D9SB 5CS7A 5KS9A 4KTYA 5CD5C 5HYEA 1F6AA 2QQNH 2P24A 3WS3B 3RVXC 4PUBL 2F5AH 1FVCB 4PJ5A 1JGVL 4ZXBB 2KZ1B 4X7TB 1OPGH 5ADPH 2EKSB 4ZDHA 2OJEB 4XI5D 2J6EH 2IQAB 2W60A 4QNPF 5DJXA 1A6ZA 1D5ZA 4MZ3A 4QTHA 3D2UB 4X7FC 5ICYB 3FHAA 5HHQA 1MPAH 3KG5A 4R3SA 4HZAA 2CSPA 1FLTX 3C5SB 2YBRB 4M7KH 5IFJA 4ODVH 2G75A 1Z5LB 1X4XA 2PYEB 5T3ZH 4ELMB 3BPLC 2R4RL 3NA9L 2A0LC 1ROWA 1IM9B 3BRDA 2VXTL 4WUKL 1DEEB 3D0VA 3EFFB 3O9WB 4M5YL 3DVNA 1RJZB 1MCQA 2ZSWA 3PDOA 1AGBB 4DQOL 4FQIL 1SHMA 2MTPA 3WO4C 2IADB 4G6ML 2B1HL 4X6EB 4NT6A 4IRSB 3VGEA 3IFOB 1GPOL 3AU1A 3HMWL 1CZ8H 3HR5B 4MX7A 4P5MA 4XMLL 1OY3B 3TNMB 1LMKA 4KAQH 4K8RD 3QI9C 3QO0B 1BFVH 1F6AB 3RKDC 2P24B 5F7EH 1RUAL 5E95B 2B8OT 3G6DH 1T5WA 4DTGL 5ILTH 1RUMH 3OB0K 1OF2B 1JHKL 2AJ3B 4G8EA 3QBTB 2FECI 1IT9L 1FBIL 5F7DA 1F4WL 4ZDHB 5F6IC 5SWSA 4MJID 3LEVH 2W60B 3MJ8A 5DJXB 1A6ZB 5DEFA 4QTHB 1J88A 2YWYA 4XC1L 4PJXA 4YE4L 1UVQA 4R3SB 5LWYH 5ANME 1HYRC 3N1MC 1JVKA 5IFJB 4E9LA 5HVGB 1RV6X 5GZOC 2G75B 3X17A 2FL5A 2XQBH 3CAFA 4U0RC 4WTXA 3JWOC 3I85A 1R0AL 3GB7B 1DBKH 3LRGA 3QQ3B 4XGZB 1MREH 2CRYA 3PJSA 3D0VB 5DQ9A 4XNXH 3G6AA 3ZE1E 3DVNB 4JDZB 1YQVL 4KDVA 3BN9D 3QUYC 1G7HA 5EFIA 4POZD 2ZSWB 3PDOB 4LCCC 3VD9A 2P45B 4MA7L 1DVFC 1EA9C 3DX8A 1FFNB 1MLBB 1DLHB 1NCWH 5DC9B 4MMXC 1QSFA 4LDLB 4PJGA 4NT6B 4ZO7A 2BOCA 2CD0A 3AU1B 4X6CF 4G5ZL 2YA0A 3B5GA 4P5MB 4MX7B 5C0AD 4XAWH 1JF1A 3P11L 4M9PA 3QH3A 1P9MC 2X10A 4Z8FH 3TVMB 3MLUH 4Y5YA 4JPWL 3VGAC 4DK6A 3BUYB 1X5ZA 2OI9B 1IKNA 4G8EB 4FQJL 3QIUC 2ADIA 2VLRA 3RQ3A 5F7DB 4FP8L 4ZQKA 3GMOB 3HTLX 5SWSB 1I3UA 4R90L 5DEFB 5C0IA 1YDPB 4JY5H 1GAFH 2XFXA 1C12A 2XZZA 4PJXB 1ZS8A 4MXVE 1UVQB 4JQVA 3RDTD 1IGML 4I3SL 1PDKA 3BFOA 1JE6A 5I71C 5ACMA 2FL5B 5DO2D 1DP0A 3OKLA 3UTSD 4OFVA 4W4OC 3PJSB 1GGBL 1IC5L 1N5YL 1TMCB 1Y6KR 2JELL 2Y23A 1G7HB 2HYMA 1QBLL 5EFIB 4CDHA 4OTXL 1IEHA 2HH0L 3QDGB 3A6BH 3VRLE 2XTJE 3DX8B 5FCUH 4LSVH 1OP3K 4NWUL 5BRZB 2DLHA 3SE4C 3P4OB 2X2YA 1QSFB 5E9DD 5F72S 5I1IH 4LAJH 2P5ED 2BOCB 2HFEB 4FFYL 4Y1AA 4S1RL 1GJIA 1A47A 3VI4F 5D7KD 4S1SL 4PRIE 4QRUB 2IWGA 1A7OL 3UJTH 2PR4L 2PO6C 2V9QA 3IU4H 1GZQA 4GMTH 2VLRB 4ZQKB 1YEDB 2W9EL 3HC4H 3KXFA 1GYAA 3TA3C 4O2CA 3U0WL 3RU8L 4JB9H 3RHWF 1KIPA 1UCTA 1TJGL 3MLPA 2XFXB 3SDDA 3ZKND 1C12B 1KJVA 2CGRH 1QD0A 4JZJC 4UZGA 5DUBA 3ZKQD 3IJSA 4IRJC 5EZJA 1CTOA 2WQ8A 2WWMD 4NQEA 5TDOA 5EU6D 3Q1SL 3OKLB 4GQ9L 3T2QA 3BXNB 1RVFL 2ICWJ 2XPGA 1FNEA 4L3EA 4WV1C 5ID0A 3TT3H 1QEWB 4I0PA 3VXNA 2HN7A 4HJGA 5E8DL 5TGBA 3V2AR 4XZUB 2CJUH 3SGJC 4RGOH 4HPYH 5CEZE 4KTDL 4XBEL 1HHIA 2PXYA 1X5GA 3KAAA 3FO0L 5DJZB 1K85A 1FNSL 4G8IA 4Y1AB 2EYSA 4M48L 5E4EC 2G60H 3ARUA 3IDMA 3MBEB 4HT1H 4PYGA 5F7NC 5AAWA 4OF6A 3TT1L 2GAZB 2VJXA 1K3IA 2EDHA 3F6IA 1DLFH 4EI6A 3RVUD 1MFNA 3CX2A 2XXMB 4LSQL 5HHMB 4O2CB 3U7YH 2JJTC 2XWBA 4X9FA 2LE9A 1KGCE 1C5DA 3QDHA 4DKAA 3FQXA 2GI7A 3SDDB 1KJVB 4HX1A 5DUBB 3IJSB 5EZJB 3TH3T 2GEEA 4GAJH 4QRSA 3N85H 5TDOB 1TVBA 1HQRA 3PWLA 1N6QL 1A6WL 3NN8A 5MEOA 3LKSA 2NNAA 3SO3C 4I0PB 4OZGA 4YHZH 3VXNB 4PLOB 1HILA 3P40A 5TGBB 3CSPA 2LABA 4XP9L 5FUZH 1HHIB 4JFPB 2PXYB 4OJFL 2D2OA 3PL6B 4GRLD 1LILA 3ARGA 5C0RL 3STBA 1BOGA 3LY6A 4B0MM 2EYSB 4LFHD 1TCMA 1WZ1H 1I1AC 4PRPE 5INDA 1JGVH 2D7TL 4GBXD 5DZOA 3VXRE 4EI6B 1N3NA 4K3JL 1JL8A 4KMTL 4MS8C 4LPUA 3DMMA 2ERJC 1JRHH 4D2NA 5B3NA 3HC3H 1C5DB 4W68A 3LH2L 5IK3A 2X4UB 5F7WC 4RGNC 5JA8B 4HX1B 3FQNA 1S3KL 3RJQB 4GO6B 3LQMA 3GIVA 3EUUA 4BUHA 4HLZG 3ROLB 1TQCC 4OIAA 4PRDB 3NA9H 4S1DC 3PWUA 2VXTH 3SQBA 1TVBB 2HVKA 4MCYB 4JLRA 2QADD 2XZAL 4GKSA 2WBWB 1INQA 3NN8B 5MEOB 4M5YH 3LKSB 2NNAB 3U0TA 4X7DC 4OZGB 4KV5E 1HILB 3DO7A 3QFDA 1I7ZA 1OAZH 4JDTL 1AI1H 1A4KA 4Y88A 2CO6B 5AYQA 4IBLT 4G6MH 5EZIL 3ILQD 1GPOH 3QUZD 1ONQA 3MRQA 3I6KB 5EUOE 4XMLH 3MUZ1 4R9HA 2FSEA 3ARGB 3TEUA 1NFIA 1NC2D 1BOGB 4HHAB 5SWZA 1QQDA 4GXUM 5E8EA 4BH8B 4HS8H 1Q1JL 5DD0H 4JY6A 1D9KC 1KN2L 5INDB 5I15L 3V7MA 3D5OF 1BLNA 4O51A 1J0JA 1IGTA 2XOTA 1IT9H 1FBIH 2FX7H 1N3NB 2R0WL 1F4WH 1S78D 1NJ9A 2VUYA 4FFWD 1VHPA 1RIUL 2FLRT 2VAAA 2F54D 4JFZL 3DMMB 4NCC1 4Z7VF 4UBDC 4PJCA 3EKCA 1AXTL 5IK3B 2QSCH 1S7VB 1PAMA 3NGBB 4LDOB 3QDJB 5E6YA 2NTFA 1A0QL 1QP1A 3UJJL 5JXAL 2HVKB 4LARL 1UWXH 4GKSB 1INQB 1J1XL 3K80A 5L0QC 1G7IA 3SJVA 4D0DA 4YBLB 1P1ZA 3GSUB 3NIFF 4JFYA 5H2BA 2I25N 3QFDB 5KN5B 1I7ZB 1JZ2A 1A4KB 4A2LA 3MLZH 3EHBD 3VWJD 3S35L 2FH6A 3DVIA 4Y2DD 1ONQB 3THMH 3MRQB 4NN7B 5D2NA 5KOVC 1HKLL 4P0DA 2FSEB 3P11H 3N9GL 1G0YR 2DF3A 5FUOL 1NFIB 2D7NA 3VGDA 3VFUA 3W11D 43CAB 5SWZB 5I1HL 1QQDB 1CDCA 5E8EB 1A6VL 3B3IA 2YD9A 4JY6B 1QHOA 4XBGA 4JFXA 5C0CD 4L9LC 3MLSL 3S98A 5FGCB 4QRRA 1BLNB 4FQJH 1WUNT 4FQLL 2VLME 4U3HA 1BGXL 3TBSB 3T4AA 4Q0XH 5T1DL 1AHWC 4F8QA 5IWLA 3FB6A 4G7VH 4ELKA 2VAAB 2B39A 1CI5A 1WAAF 3AMKA 1IC1A 1YJDH 3LIZH 3UCRA 4S2SA 1G1CA 3T4YA 4JHAH 3MLYH 1KCLA 5IQ9A 5BS0D 1QA9A 2NTFB 3UZQA 1BOYA 2EZ0C 3HR6A 4EXPX 2OZ4L 2VDMH 4XNZC 1A6UL 3RPIA 3GMRA 1TQBB 2YXFA 1KN4L 5D96B 2YUZA 2MJWA 3LDBC 1QBLH 4AJ0A 1QLFB 5F7FA 2HH0H 3HZYA 1G7IB 3F7VA 4D0DB 1OARL 3B9DA 1YC8A 5A3IC 5H2BB 4NWUH 1F3JA 3HE7A 4YHPA 3ARDD 5KZCB 1ADQL 2HRPL 3BJ91 4U1MB 4JKMA 4NZRL 4DOHB 3KS0J 2VLLA 2Y07L 3OR6A 4KROD 4PJHB 5TQ0L 3RTQC 3O11B 5D2NB 5DJ2B 1BQSA 4KHXL 1VB9A 1KCRH 1VPOH 4IJ3B 4S1RH 5TF1L 2X9XA 3VFUB 4S1SH 4IIQA 4JFXB 4R0LC 2UZYB 1OQOA 4QRRB 5EO9A 5FM5M 1ND0A 4WGWB 4LRNL 5FB8A 3VXUD 2W9EH 2APFA 3WNNA 3T4AB 3RU8H 1WCBA 1FH5L 3FB6B 4ELKB 2OZ4A 4X80L 2J5LC 1TJGH 3H9SA 3FTGB 4O2FB 4Z95L 1EEYA 1PG7W 3QIBD 2XA3A 3OKKA 4ENED 3H0TA 4S2SB 4XVUC 3T4YB 1CGSH 1F4HA 2R1YA 1ADQA 4PJAF 5IQ9B 1QA9B 2J1KA 3RIAF 3FN0H 4GQ9H 4AH2A 5HYQA 2QQKL 5DD1L 1YNLL 5I18L 4A2MA 3GMRB 2QQLH 2K7QA 2VLJE 3TCLB 4PREA 1M05A 3F7VB 4K55A 3RZWA 4N0CC 5GGTL 3HE7B 4YHPB 2NR6C 5GRJL 2VISA 3OR6B 3NFSH 3SKNA 1FNSH 3IDYC 1Q38A 3O4LA 1RAMA 5A2JH 3QP3A 5J8OA 2NY7H 3QHTC 4O02L 3OKMA 4MDJA 3IS0X 4NKMA 4G6AC 4F7TA 1V3LA 3B2VL 3LHPH 4EDXB 4OCYL 1D5XB 5BJTA 3MLRL 3P77A 3T1FA 1WEJL 2EDNA 4M6NH 4M6OL 5EO9B 3IDUA 2D7OA 2YWZA 2ESVD 3PE9A 3JWNC 5FB8B 2BNRE 4LSQH 1JYWA 1AY1H 3VFGH 1FYHB 1CF8L 1WCBB 2QSVA 1H3GA 2Z91A 3L9RB 3QIWD 3P0GB 4GOSA 1NANH 2W9DH 4B41A 5CJXA 1EEYB 1CIUA 5DK2A 5ESQB 3AREC 4A6YL 1KJ3L 2B1AH 3OKKB 4IS6A 4B5EA 4F15B 3O0RL 3H0TB 5D8JH 4NN6B 4HLJA 3VH8B 5KG9B 1J18A 3V95A 4JPKL 5B21A 2R1YB 4P5TA 2DQDL 1N6QH 5DD3L 4TRPH 4ZSOA 3ULUD 1LD9B 3FO9B 3OB0H 3OJDA 4FHBD 4LSDA 4RFNB 3N06B 3WJLA 2APTA 4PREB 4YXKH 4Z76A 4KJYA 2EC9U 1QSEB 4Y4FA 1WTLA 4MAUL 4RWHA 4NKQB 4KK6D 4OJFH 1F42A 4FQXC 2BSED 2VISB 5CMAB 3SKNB 4TTDD 1RZKH 3BZ4A 3F5WA 2UWEA 5C0RH 1K9TA 3CFBA 5TJWK 3V9FA 4Z7UF 5D1XD 3OKMB 3IDNA 3PABA 4NKMB 4F7TB 3STLA 4NGHH 3BKJH 3T1FB 2D7TH 3P77B 4OCXL 4APQD 2CUHA 1UJ3C 4K3JH 2NY6D 4MJ5A 1LP9A 1T0NA 3Q3GA 4KMTH 3R8QA 5CILH 4F37F 1ED3A 3TESA 2AKRA 1YN7A 4TSBL 2R1WA 2Z91B 1QFHA 2X4NA 5KANI 5DHVA 2Z92A 1ZSDA 3LH2H 3MLTA 5DK2B 4FZ8L 4CL7A 1P2CA 2VRAA 3OSKA 4FOMA 1Z0NA 2FHCA 2CLZA 1UM6H 2Q3ZA 3C2AL 3HCVB 1VFBA 4P5TB 4I48B 2F53A 1GOFA 2N7BA 4OCRL 4P2QD 4MLSA 3PV7A 4RMRA 5FGBA 1AD9B 1PD6A 4Y5XC 4ZSOB 2P48B 4N0UA 1R5WB 4HJ0C 2OTWA 4Z76B 4EVNB 1FFQA 1Q9WA 4GXVL 3RWGA 4NZUL 1LEKA 1DBBL 1U93A 4PJ9C 5F8RC 3OGOE 5I9QC 1CGWA 1Z9SA 4B50A 3QUML 5ESAB 5T1LA 3WSQH 4MGXA 1X6NA 3VD7A 5DQDL 3BZ4B 3F5WB 4UTAH 2UWEB 4TNVK 3CFBB 3QDME 5F7HA 3S96A 1EO8H 3BH9A 4PS4H 2R9HC 3IDNB 3V0VA 4N5UA 1UM5L 4GAYA 3PNWA 3ULVE 1CLZL 1SY6H 5D72L 5C2BL 3RKPA 5JHDD 4XP4L 1EZVY 4U1LA 4MJ5B 4NQDA 1RIVL 1LP9B 3Q3GB 4CU6A 4JRYA 1RIUH 1ED3B 4HWZB 4LLVA 1YN7B 4JFZH 4HWEL 3CMGA 2X4NB 3HLAA 5DHVB 1AXTH 3PGFH 2Z92B 3MLTB 5EU4A 5CWSA 1OP3H 5CEXA 2E9BA 4Z7WB 1P2CB 2ICES 4P5KA 4GRWB 3HE6C 2CPCA 2CLZB 3MOQA 3PGCB 4PP2A 1WIUA 5IMLB 5JXAH 1VFBB 3GO1L 2F53B 3BIKA 4KXZH 3VMNA 3SPVA 5DJ0B 3TN0C 4N0UB 4JQIH 3C8KA 2OTWB 2EXYC 5CD5D 1LEKB 1U93B 3RVXD 2NY5H 4M4RA 4IDJL 1UYWL 1HH9B 4WUUE 5T1LB 1HKLH 1MWAL 4XMKL 4Q97A 5L88H 4RCAA 3K8KA 5I30H 3WN5C 4DGVL 3S96B 5I1HH 3CUPA 2CDFA 4HGKC 3V0VB 4Z5RA 4DEPB 2NW3A 4GAYB 1F2QA 3MLSH 5JA9A 3NAAL 4JCMA 3KJ6L 4RISL 1OGAB 4YBHA 1DBML 1VACA 4K8RL 4U1LB 4NQDB 1MELA 4LIQH 2EE9A 3D0LA 4JRYB 1TTUA 1H3TA 1ZE3C 4LLVB 3PQYE 4K9EL 1LDPH 3AUVA 3HLAB 2A0LD 5JQ6H 5EU4B 1FZJA 5CWSB 4DWHA 3OB8A 3L3IB 5FYJE 5CEXB 5DJCB 4P2CG 4P5KB 2ENSA 5L2JA 2Q8AH 1CE1L 1G9ML 4LASL 5D1ZC 2QV2A 2DMBA 4FG6C 4JHBA 2BVOB 2X7LA 5IHZA 2OZ4H 3BIKB 4OLUL 5LVEA 1A6UH 3V4UH 1KN4H 1PY9A 3BDYL 5CINH 2YA1A 3SPVB 1ODAA 4ZODA 3C8KB 32C2A 3CSGA 4KKNA 2PW2A 3C08L 3QI9D 2J8UE 3L3GA 3I02A 4N90D 3RKDD 3VDBA 2Y07H 2OR9L 1PSKL 3MMEA 3MOBL 1A3RL 3ZYIA 4F7PB 1MRFL 5TF1H 5E2TL 4ODTL 4MVBC 3CUPB 2DQUH 2CDFB 4DGYL 3NACL 4Z5RB 1ZAGA 2NW3B 4XCCL 1YEEL 1QBML 4P59L 4YDLB 5JOFA 1G7QB 4EBQL 2VL5B 4MJIA 2R2HA 3KPRE 3S35X 3RX7A 5B8CC 1H3VA 1RK1A 1U3ZA 1SM3L 4MWFB 4R6UA 3D0LB 1CL7L 1FH5H 5GZOD 3MV8E 4EI5B 4Z95H 4P99A 1BM3L 4HFUH 1T1WA 5C70A 5IW6A 4X5LA 5K9KA 3WXVL 3I50L 2XKUA 3CH1A 3VD5A 2ZUWA 2J88L 2V9TA 4QHNB 1FAIL 3QUYD 5L2JB 4AENA 1BREA 5DJAA 3ZHDA 1I8IA 2BVPA 2B5IB 4MHHI 1DVFD 1WGOA 3HMXL 5IHZB 4ZO6A 5GGUA 5FEBA 1A9EB 3D3VD 1SJXA 4RZCA 5TPWL 5MEND 1F11A 4M00A 32C2B 3RY5A 3M8OH 2BMKA 2PW2B 1CK0H 5FYKE 2FGWH 3L3GB 3I02B 1U8JA 5C0AA 1RUKH 3MROA 5LJYH 1KB5A 4ZTOL 3CLFL 3MMEB 1AO7E 4O2EA 2R4SL 2Y36L 4LLDA 3QIUD 4C55A 4J4PC 1K4CA 3GMMA 5LG1A 3TC9A 1QSZA 4MQ7A 3MLRH 3EJJX 1KV3A 4DZ8A 5JOFB 2DAVA 4MJIB 2R2HB 2HRLA 4Z7OE 1NLDL 4XNQA 4PY8I 1L7TH 3RY6C 1KCSL 1RK1B 3GI9H 4I2XB 4XP5H 3UPCA 1MSPA 5C92A 1IJ9A 4WEBL 3HMXA 1TCRA 5EC1A 4EZMA 4RRPG 4ZUTA 3CDFA 1XF5A 5IW6B 1FNAA 1T1WB 1WC7A 4ONHA 5JOPD 3O0RH 5MHSD 3UTSA 5K9KB 1XCTA 1GZPB 2HA1A 4AENB 1VEPA 4K94L 5DJAB 1I8IB 2BVPB 3MRCA 4J23A 3QXAA 1NCDH 2VR4A 1MJJB 1AQDA 1MFEL 5J11B 5J12C 3MXVL 3HI6H 5GGUB 5BW7C 5DHVH 2BDNH 4RZCB 5FXCH 1DFBL 1HIML 5BQ7B 1F11B 3SE9L 1F4XH 1KLUA 3QXWA 4AYFA 2AI0L 2RIKA 5E9DA 3ISWA 3MXWL 2BMKB 4GRWH 4BSWA 3G04A 5HGHA 3WXWL 5BZDA 1YEIH 2X4SA 3VJ6B 4K2UL 4X6DE 3PXJA 5C0AB 3JV6B 5IB4A 3MROB 4GXUN 1KB5B 5DLML 2PO6D 3ARFB 5JXED 2CK2A 4O2EB 1Z3GH 2FZ3A 4LLDB 2NXZC 4YFDB 4CU7A 3T65B 3NTCL 4Y19D 3GMMB 4J3WA 4CJ1A 4WENB 3TA3D 4PJIB 4MQ7B 1FGNH 2YN3A 6FABL 2ICWB 4DZ8B 1X5AA 5DS8A 5A16B 3X3GL 1BEYH 4AM0A 4LHJB 1MFCH 1G6RL 4XNQB 1XR8A 3M1BA 5GS2D 4NFCA 5J56B 2FEDC 4IRJD 2IMMA 3NZ8A 1NUGA 3BPOB 3QYCA 5EC1B 2GK0A 1PEZA 2VYRE 5TDNB 4ZUTB 4FZ8H 4HJJH 5D5ME 1XF5B 4V1DA 3S36X 2YZ1A 4G6KL 4WTWA 1ZGLA 2AGJH 5EU6A 1TVHA 4X4XB 3UTSB 1XCTB 4ONFH 5IHUL 4OGAC 5I6XC 2Y4SA 3PDDA 3MRCB 1MI5D 3LD8B 4Q9BA 4OLYL 3QXAB 3VI3E 3WDHA 1AQDB 4KRPB 4UUJA 2EH7H 4YHMH 3JV4B 3G6JF 2Y6SC 2DTML 4WU7B 1JV5A 4NZUH 1DBBH 5ALCL 5E9DB 1A7BA 5C6TH 4BSWB 3G04B 3ZDZF 5KTEL 4RMWA 4QOKD 1X5LA 2X4SB 2E7LC 5F9OH 2DLEA 1P7QD 4GQPH 5I16A 1KLGA 1XGUA 2FZ3B 1YZZA 2NLJA 4OZ4A 2NPLX 1K8IA 3EYFB 3W81A 1BMGA 5BV7L 2GJ6D 1C5BL 4HUWB 5DS8B 4AM0B 2VTFA 4NC0B 2VE6A 4KK5C 1MFDL 1XR8B 4GS7C 1FORL 2X1PA 5BOPA 4AEIL 1CDJA 3H9HA 4HWEH 2YD8A 5DQJA 2GK0B 1LEIA 3CX5J 4YBQC 1I1RA 4V1DB 3TYGH 1QVOA 1TVHB 2R2BA 1DJSA 1H15A 1G84A 5JIPA 3DGCR 3OJVC 4HQQH 2AEPL 1RZJL 1UH2A 3GO1H 4LPTA 2AQ2A 2EO9A 4J8RA 3EDJA 1CN4A 4RFEA 4CN4A 1D3CA 4JZOA 4NKDA 2QTEA 1JV5B 3PWJA 1FNGA 4IOFC 3HRZA 1LO2H 4L4TD 3STZA 4NKOA 2P8PA 1UYWH 1I1AD 3UTOA 4KFZC 4OF0A 2DBJA 2NX5E 4D3CH 3I75A 1C16A 3KPSE 1KJ2A 1RUQH 3G5YA 1KLGB 1XGUB 1MJ8L 3GSXA 5K9JL 2NLJB 4G6FD 4OZ4B 1K8IB 1U36A 1GGIH 4GBXA 4YR6B 1F45A 4MS8D 2EDQA 4HIHA 1H5BA 5ANMA 3KLAA 4JREB 3V0WH 1N4XH 3KJ6H 2FD6L 3QISA 3WFBL 4K8RH 4YQXL 1L9MA 3IJHA 2HTKC 4ZTPL 4Z18A 2G9HA 4RGND 4AT6B 1JGDA 2VE6B 3E2HB 2VKWA 4NNYB 4ZOEA 1DQJA 3RVWC 3V5KA 3H9HB 5D93B 1MCOL 1CG9A 2YRLA 4S1DD 2CR6A 1LEIB 5FHBL 4ZFGL 4PD4J 5BCAA 4HK3N 2NTSP 1QVOB 2VXQH 4YDKL 1CE1H 1G9MH 1H15B 1MNUL 3DTXA 4LASH 1NMBL 4WI9A 1OT1A 2BHUA 2QHLA 4G3YL 3LV3B 4FFZL 4HMEA 1VFAB 2NYYC 1JPSL 1TITA 1WFUA 2Y7QA 3BDYH 4J8RB 4RFEB 3FB8A 4PJHF 5BV7B 4KI5E 1AO7D 3T3ME 3C60C 4NNPL 4JZOB 4NKDB 3PWJB 2YK1H 1NBQA 5IT2H 3QUZA 3HRZB 4MB5A 5DI8A 1DUYB 2UZIL 2BOBA 1GIGL 3STZB 4NKOB 1NC2A 1D9KD 1OAKL 1HHKA 3ARYA 1RHHA 3ARZA 4JZNA 2BHYA 4OQTL 3I84A 4BM7A 3I75B 1C16B 1KJ2B 1XEDA 3G5YB 3U30B 3DRQA 2O5ZL 3GSXB 5GGRA 3RJDA 4GBXB 1QBMH 1RFDL 1H5BB 5ANMB 5CSZB 2EDLA 4UBDD 3KLAB 1Q8MA 4U1SA 2F54A 4LSRH 2XZCH 1KB5H 5F9JB 2NQCA 3IJHB 3IXAA 5IBUB 1JPST 3KNBB 2G9HB 1FSKB 5T3XE 1CL7H 2AEWA 3QZWA 4LP5A 1GC1L 4XPBH 1DQJB 3V5KB 4DGIH 4F7MA 8CGTA 1WJ3A 1CG9B 2OBGA 4PB9L 4LSUL 1UACL 3BKCL 4LPCA 2NZ9C 2G5BA 3I50H 2HFGH 1UGNA 2QKIA 1YEJH 2FX8L 1N64L 2QADB 5ID1A 2APXA 4KKBC 3DURB 2R15A 3AY4C 1BQHA 4IMKA 2WMPA 4OQTA 1JUFA 4HWUA 2GKIA 3C09B 4YZFF 1QTYT 3FB8B 5DUMH 4NC1C 3VWJA 4X98B 3RWEA 4Y2DA 3QUZB 5TE4L 1HHKB 2A6DA 1RHHB 4WDIB 4HS6A 4H8WH 5HGAA 1CGVA 1JNLH 5C0CA 4QRTA 5C2UB 5EZLB 3DRQB 4MA1C 5GGRB 1M6OA 1DZBA 1GOHA 2AJYH 1M7IA 1KTDA 2W1NA 1JHTA 2VOTA 1RULH 2EDTA 1JJUA 3AB0B 4PRHE 4HUKB 1KCSH 3IXAB 3DUHA 2EE3A 3CIQA 4J7RA 3ZSSA 2D9CA 4WEBH 2DMKA 4P2OC 1CDHA 3VH8G 3KPNA 2EIBA 2EZ0D 5I76A 5BS0A 3C5ZC 1FGVL 4ZPVA 1AD0A 5H94A 2XTJB 1YEKH 2XY2A 2QKIB 4NO5B 4KHTL 1WISA 3PIQA 5ID1B 3T0EE 1U8LA 5ABDE 1PBYA 3FCTA 5A3ID 2VWEC 1BQHB 1MFEH 2GQHA 4BZ2L 2CH8A 1DFBH 1I85C 1JUFB 4YIQA 1FL3B 1HIMH 2IBZY 3SE9H 5L8LB 3ARDA 3RTQD 4PRIB 3S34H 2ARJA 4GFTB 4Y2DB 2ATKA 4ZAKB 3WXWH 4OIIL 3CU7A 2XKNA 3BP5A 3QRGH 1INEH 2VN7A 4M43H 4YPJA 1CE6A 1BJ1H 2XY1A 1K2DA 2A6DB 4Q74A 4HS6B 1ZANH 3NTCH 4QRTB 2QSTA 4RBPK 4RA0C 1M6OB 1WITA 4I3GA 5JW3H 4HKXA 3UBXI 1Y6MR 1M7IB 2R23A 1KTDB 3VXUA 25C8L 4XPGH 4JKLA 1SBBA 4GAGL 3T09A 3QA3A 1CBVH 3QIBA 4XVUD 3KPNB 3EDKA 4JPVH 4HULB 1NLBL 3W9EA 2VZTA 4YHKL 5DD5H 5K33A 4ZPVB 2NXYC 1AD0B 2RR3A 3L3KB 2P1YA 4KPHL 5IHUH 2VN4A 3PIQB 3V5DA 2JB5H 1U8LB 4N0CD 3TGXA 4S0SD 4CADA 3HUJE 4E5XA 1OAUH 2NR6D 4G9DB 5DJDA 4YIQB 4S1QH 1MCSA 3K7UA 4KQ4H 5JR1H 3ARDB 1NKOA 4F58L 4NRZA 2J2ZA 5ALCH 2ARJB 4KROB 5HVHB 2JB6A 4G6AD 2VZVA 3LQZA 2XKNB 3GK8H 2YMXL 3BP5B 4E0RA 5DSCA 3ULUL 3CSYA 1CE6B 1CGUA 1K2DB 1P4LA 2AJUH 2A6KA 3NCJH 4OIBA 2YPLE 4L3CB 4BFEA 5BV7H 3DVGA 1RMFH 4GW4A 1C5BH 5E7FA 3H7BB 2ESVA 1SJHB 3NABL 4P2YA 5C9KA 4CMMB 2R23B 3VXUB 4AMKL 2HFFA 4JFDD 1BQLL 1VCAA 2F58H 3ARED 3QIWA 1A64A 1MJ7L 1UJTA 4Z7WF 5ACLA 4NQCD 1JZ7A 1W2KT 1FO0A 2AERT 5BZWA 1KJ2H 1V7NH 2M26A 5D7JC 4GRWF 1JWMA 1T2QL 1UB6A 1NFDE 3L3JA 4D9LL 5MEPA 1CD1A 1TXKA 4OLVL 3LZFL 1PLGL 1RIHH 3FB5A 2OM5A 3GMLB 3VDAA 4KVCL 5EUOA 3TNNA 3GJFK 2Z8SA 4CADB 1A7PH 1T0PB 3DX7A 4E5XB 1MUJA 4M8QA 4FQXD 5EA0L 5DJDB 4GT7A 1AQKL 1G6VK 1M4KA 4NBXB 4QTIL 1NBYA 4PRPB 2FBJL 4NRZB 4YXLH 3VFNA 4ISVB 1UCBL 5JW4M 3JVGC 2JB6B 5AZ2L 3K4DA 3VXRB 1H0DA 4E0RB 5D1XA 4Y16C 3CSYB 2AXJA 2R29H 1BJMA 1P4LB 3BPNC 2X4PB 3HAEB 2A6KB 3Q6FA 4FQ1L 3RWFA 3VU2A 3A67L 5L7XH 2AXFA 3L5JA 4HUMB 3I2CL 3ARXA 4K71C 4APQA 3DVGB 5IMKA 4GW4B 4MNQE 3WIFA 2M2DA 5AG8A 4WGVB 3SE3C 2HFFB 2PYEE 4L5FL 2FD6H 4BZYA 4ELME 1FDLL 1F3DH 4ZTPH 4NIKB 3SDCA 1GCFA 2MPAL 5BZWB 1FO0B 1KBGL 5IEHA 5IROC 4JM2B 4V2CB 1JWMB 5E2JA 3HNVH 1UB6B 1YEGH 2H6PA 3L3JB 5MEPB 1CD1B 2KZWA 2E6QA 4YDKH 1GGTA 5CKGA 1MNUH 2GY7B 4HJ0D 1WBYA 4TYUA 1UZ8A 3FB5B 3RUGE 1UB5A 4K3GA 2KQMA 4O5LH 1IAII 4GLRH 5D2LE 3NCYP 5E1AA 4LOUC 4MCZB 5KS9E 5EUOB 3TNNB 1JPSH 4PJ9D 3CX5K 2H9GA 3F8UB 3MLWH 3DX7B 3SDAC 4M8QB 1BWMA 4PJ5E 1R5VA 4AL8L 4MAYA 1NBYB 3OV6A 4WY7L 3EGSA 2R9HD 1GIGH 4WI2A 3T1WA 4M3JA 3U6RB 1H0DB 1OAKH 5D1XB 3TO4C 1A1OB 4QLRA 3QHFL 2UY7A 4OQTH 1BX2A 1B4JL 2DI8A 4PRHD 1QPXA 2YC1B 3Q6FB 1A6AA 3O3AA 2O5ZH 5GHWH 2I24N 3CVIH 5FV1L 4APQB 1NGZA 5IMKB 5JHDA 3WIFB 4HBCH 1FE8H 3HI1A 1HZHH 1JN6B 3B9KC 2BC4A 3V7AG 1OW0C 1NSNL 2J3SA 2MWCA 2JJSC 3SDCB 5LGJB 2E27H 4QHMA 1GC1H 3U9PL 1CR9L 3BO8B 3PP3K 2YD2A 2H6PB 2BRRL 4HS3A 1ULVA 3BP6B 5B39B 3PWPE 1KFAL 1U2HA 1WCQA 5I1DA 1OAYH 2IH3B 4ZUWA 1N64H 3TN0D 1WBYB 1UZ8B 5GGVH 1UB5B 2BY2A 5EORH 2EXYD 2IMNA 5E1AB 4NM4L 4UNTA 3MUJA 2H9GB 1K8DA 2VDOL 4NCC2 3V5HA 3P73B 4AY0A 5KVFL 4MAYB 1OAXL 3V6BR 3EGSB 4OCWL 5K59E 1KUMA 4PB0L 5IBTH 1E0OB 2AJSH 5SWSE 5TE4H 4YJZL 4XCFH 3BKYL 1CXHA 2EEAA 3LN4A 4RMTA 3SDXF 1NPUA 5M95B 3WFDH 1A6AB 4PJXE 3MCLH 3V4PH 1ZMYA 4OLXL 1NGZB 5GS1B 5JHDB 2OK0H 2RGSA 2BCKA 3EYQC 3HI1B 3KPMA 4MJ4A 3MNZA 1SEBA 2BC4B 1HSBA 3R06A 2C4XA 3GRWA 4LQ1A 5EOCH 1UWGL 4M7JL 4QHMB 5EIIA 1CQYA 7CGTA 3CVHL 4JO4H 3QAZB 5D1ZD 2Q8BH 1FIEA 1FRGL 1EV2E 4FG6D 5GS0C 5E08L 2VLJA 3ETBF 1FGVH 4HS3B 1SVZA 5GSRA 2WUBL 5C6PB 5I1DB 4KHTH 4Z9KB 4PJGE 5CZXC 2MSPA 1IL1A 4H5SA 4K3DL 3JWOL 4LGRB 3CZFB 4JO3L 2FECL 2OP4L 3P9LA 1J7VR 3I6LD 3QI9A 1K8DB 3BE1H 3ZT5A 1MOEA 1AXSA 1PKQA 2EDKA 5HI4C 3V5HB 1S7UA 1B2WL 4MD5B 2YPLD 1CXFA 1ZA3A 4MVBD 4XC3H 4M62H 4PJ7F 3KR3L 3VFOA 5GS3A 2F8OA 5IEKA 1HXMB 1UG9A 5DFTA 4PJIF 4PGBA 3BAEL 4ONGL 2XACC 3LN4B 1UXWA 4OD3L 1D5IH 1UZ6F 4NJ9L 5J57B 3CVHA 2E9JA 3H6JA 3KDMA 3OQ3B 3VFTA 1DEDA 3F7QA 3ZE0E 1AH1A 4HXAL 4L8DA 4JRXE 4ZUUA 2BCKB 5IESL 3KPMB 3DROA 2A9ML 3MNZB 4U1NA 1QRND 1HSBB 3R06B 5EBLA 3DUUA 1A7NL 3HAEH 5EIIB 3SDYL 3GHBH 4EEEA 5DJ6A 4LVHC 3PGDA 2F19L 2RFXB 3OF6D 3T2NH 5DTFA 2VLJB 3QUYA 1UENA 4LCCA 1UH4A 5GSRB 1KCUL 1DVFA 1MCEA 1EUUA 3WIIL 4NZTL 1IL1B 1IGFL 3PXHA 1MHPL 3D3VA 4H5SB 3O45B 4GJTB 3RNKA 3TPUA 3WO4B 4Y1AE 5T5NG 5IMMA 4UV4H 5MENA 1FO0H 3V6FA 2X6MA 4LCWE 3O6KH 1V7MH 1P9MA 2K9UA 1Q72L 3QI9B 4JE4B 4LHUB 4ZFOB 4KUCF 3ZHKA 1AXSB 1PKQB 4L8SB 3ILPA 2DI7A 2X44D 3ECBB 3UAJC 4YUEL 1XR9A 4LLYA 5D70H 4J4PD 4YGAB 1ZA3B 1BVLB 3OBAA 4PPTA 4MNQD 3KXFE 5HHME 3VFOB 3QIUA 1V8HA 1VSCA 4PGBB 1UXWB 2UVFA 2GJZA 3MBXL 5EOQL 3RGVA 2ZUVA 3CVHB 3KDMB 3VFTB 1XF2A 3O6ML 5I8EA 1G9NH 4TNVF 5ACZA 4PJBE 4DVBB 1QNZH 4L8DB 4ZUUB 3BJLA 4AMKH 1BQLH 1Q9LA 3EYVA 1Q0YL 5CJOH 4Z7NF 3QJHA 3D39E 4NQEE 2X05A 5I1AA 5KW9L 5A43C 4U1NB 5DYOB 4W81A 4U0RB 3KYOA 3RA7H 3DUUB 3ZYZA 4L3EE 4UILH 4W4OA 4RDQF 4Z77A 4RDQG 5DJ6B 1A9BA 1S7QA 3DO3A 4MXQC 3FRPG 4D9LH 1AIFA 4JY4B 4DK3A 3QUYB 3P3YA 3N50A 5C3LD 4CGTA 1DVFB 1DE4A 2K3TA 1ZEAL 4CAGA 3SE4A 2XT1B 3D3VB 5C1MB 2ITDA 5MENB 4LQFL 1YMME 2Z4QA 5EC2A 4RQQA 1FFOA 4QTIH 2FBJH 3VGAB 2DQEH 2FB4H 4NKIL 1ZWIA 2NXZD 5TDPA 1L0YA 4GG6A 2PO6A 1S8DA 5JXEA 1UXSA 4DVRL 4J12A 2KH2B 2X4QA 3L95B 1EGJL 3GJFB 4DW2H 3QIUB 4XNMA 4Y19A 5MEQB 3TA3A 5CD3B 2CLVB 2GJZB 1CXIA 3DSFL 4JFQA 1T7XA 3RGVB 4WFED 3I2CH 4FN0A 3GGWA 2FEDD 5I8EB 5ACZB 2X1WL 1QYGL 1Q9LB 2N1KA 4JZJA 4L5FH 3QJHB 4IRJA 3PWNB 1DBAH 4KKCC 1F00I 3KYOB 5GRUH 3W9DA 5A1AA 4NQVA 1U2CA 4S10A 2DQIH 5IJKC 1W0VA 5C07E 4OZGE 1EO7A 4Z77B 4YHOL 1Z9OA 4OGAD 1A9BB 1KEGH 1WZLA 3GZKA 1P4IL 4WV1A 1AIFB 4JANB 3LKRA 1Q94A 3S9DB 1J05A 3L1OL 2C26A 3SGJA 1NUFA 1MI5A 2YPVL 1PG7H 4J6RL 2Y6SD 4I5BB 1YNTB 1LK3L 1EGJA 2A77L 4K9EC 2ITDB 1MCNA 3J7HA 4J3VA 3O3UN 3O8XC 5EC2B 3KYKL 4RQQB 1FFOB 1XGYH 2V17H 3C6LC 5DUPL 4QOKA 4ZUSA 5F1SA 3EJZC 4WY7H 1ZWIB 3IVKB 1P7QA 3IXTB 5TDPB 4LVNC 1A7QH 3SKOB 3VRIA 1UXSB 3JV0A 2X4QB 4ORGA 4WNQB 2EIZA 1B4JH 4FZEL 1NCBL 3TA3B 1NGPH 1DSFL 2JJTA 1D6VL 1BP3B 4KK5D 3GGWB 5IBUG 3LRSB 3AS2A 4NN5B 4FRWA 2Z8VC 3UO1L 5HYFA 4YHLH 4KY1H 1T3FB 4EOWL 4K07A 3X11A 4IRJB 1CXKA 3KPOA 3ZE1F 4YBQD 5J13C 4TUKH 3W9DB 4NQVB 3U9PH 3MACL 1YECH 3FJTA 3WFEL 1W0VB 3QQ4A 4KDTA 3UTPD 1FVEA 2P8MA 2PTTA 2DLFH 1Q94B 3FN9A 1J05B 1J0YA 1KPVA 4OF5A 4I77L 1MI5B 1NCAH 5I1JL 3GRWH 4WUUB 1RY7B 2VSDA 4LCIH 4IOFD 2VXVH 3NFPA 5SWZE 5E8NA 4HIXH 4RBPH 4YPGA 2OQJB 5GGSY 1T1ZB 3ARPA 3GBLA 1WK0A 1LHZA 1SBSL 1OM3L 4FMFA 4L4TA 2AJVH 5FGCE 4QOKB 1I1AA 1IZJA 2VLKD 4QEGA 4H1LA 4I9WE 4ZOAA 1P7QB 1S7TB 2OR7A 4XPAH 3P2TA 1X4YA 3KPRA 3VRIB 5J6GB 4YK4B 3OG4B 4TNWK 4JRXD 4MXVF 1QRKA 2DQGH 2BVTA 4ALAL 3MC0A 2IG2L 4PJCE 3PQYB 2HTKD 4HUUB 5LCVL 3MNVA 2XRAL 4H0GA 5I73B 4TVPD 1U8MB 3QRFM 3RVWD 4Q9RL 1BVZA 3X11B 1EH9A 3Q48A 3OKDA 4PY7A 3KPOB 5FHAH 5T1MB 4QY8B 2EDJA 3S3JA 1GH7A 1DTUA 4U1JA 2OL3A 1R3HA 4OGXH 4H26B 1YEHH 3CVHH 3VRLF 3LKNA 5TE7L 5L2KE 3QQ4B 3SJVE 5E08H 4PGJA 4DZBA 4LCWD 3ZTNL 3VFVA 4MA8L 2NYYD 2P8MB 2PTTB 5CBEB 5EO0A 1BQHG 4LSSL 2WUBH 4BK5A 3HRPA 3QHZL 1KPVB 5DRWA 3IRZA 4FQ2H 5D2NE 4K3DH 1HHJA 1IC4L 4IRSC 3C60D 1MCFA 1WBXA 4LSTH 4FXKB 2HKHH 3NFPB 4JO3H 1AO7A 3K2UL 5E8NB 3E8UH 4YPGB 5HGGS 3H3KA 4OZIA 3QO1A 5D7LD 5IV2A 2X4OA 3TP4A 5CP7A 1B2WH 1I1AB 4M5ZL 1D9KA 3LVEA 2B2XL 3QG6A 1AGCB 5C0NC 3KPRB 4OGZA 5EH1A 4ZUVA 4P2RD 5AWNL 4X83A 3CFDA 4WCYL 1Z0MA 4G6FB 5EOTA 1RJYA 1OD9A 3L3HA 2PETA 4W4NA 2ADJA 3HS0A 3MOAL 1VFOA 2ERJB 4WWKB 3MNVB 4KMQA 2VR9A 3PHQA 3B8SA 1VFMA 1J8HE 5IESH 2C3WA 4PJFA 4QRPE 5FDWB 2OTPA 1B0RB 3GJFH 3LMJH 3OKDB 4PY7B 3WD5L 3QWOA 3ARQA 5FCSH 2NZ9D 3TPKA 3GKZA 1TJHH 4U1JB 2R0LL 3ALPA 3SKUD 2OL3B 1R3HB 1T20A 1X44A 1LQSR 5FM8A 3LKNB 4KKBD 4RMQA 1P84K 1U95A 5JDJA 3CK0H 4DZBB 3VFVB 2RCSL 4HUVB 1HWHB 1YMMD 1KCUH 5EO0B 4TSAL 4MJ2A 2Z0BA 3WIIH 5ISZE 4J3OC 2BHZA 3VG9B 5DRWB 2E8ZA 1E6OH 2W38A 3QQNA 1KEML 4ODHL 3FT3A 4JO1L 4E42A 2IH1A 1WV7T 1B0WA 1KT2A 1R6VA 1WBXB 1EMTH 1XGTA 3P4MA 1AO7B 5CJQL 1YYLL 3TVMC 5JW4N 4RFOH 4OZIB 2Q76A 1T6VN 3QO1B 1JZ6A 2X4OB 2OI9C 5CP7B 1HK6A 4YUEH 3G5XA 1D9KB 1XGPB 4L9LA 2NY2B 4WFGE 3QNYA 4LU5L 2BZDA 4WI6A 4ZUVB 4Y0GA 1MQKL 1F4YL 3IFLH 4G80A 3H9SE 5EOTB 1AHWA 1RJYB 5TE6H 3L3HB 2CKBL 3MBXH 5EOQH 2ADJB 2X9YA 5IVZA 4RIRA 2NY0B 1RZFL 1I9RL 3HN3A 1YPZF 2P8LA 3PHQB 2DM3A 4P2OD 3ULSB 4E41D 4U1GC 2KBGA 1Q0YH 5KW9H 2H1PL 4QF1A 5DGQA 3FKUS 35C8H 3C5ZD 3BISA 5KSBA 3EIFA 3QWOB 5ADOH 4G6JH 3PDGA 4NOFA 2DJUA 1CFVL 1GRWA 2EIDA 4M7LH 5IB1A 2EEBA 4UIKL 4NWTL 4UDUA 5L0QB 3G9VA 3MJ9L 1MHEA 5IFHH 3B9VA 1TZIA 2ADFL 1ZEAH 5TFSL 1QFWM 3O4LE 4D9RD 4X6DB 3IETB 3FT3B 1RURL 1WQVT 1KT2B 15C8L 4XP6L 1IM3A 3GFUA 5E03A 4JPIA 1XGTB 1TJIL 3P4MB 3BD4A 4JKPL 4P46C 2CKBA 1J1PL 1U8QA 1UKQA 3E3QE 5GXBB 3CCHA 4XVTL 3BGFB 4NKIH 2NY1C 2I9LB 4L9LB 3HAEG 2Y25A 4R0LA 3MRLA 3KYNA 3QNYB 4LEOA 3MTRA 2W0LA 3SQOL 3GMPA 4YO0A 1EGJH 4Z6AT 3PP3H 3MYZA 1AHWB 3GSWA 3BT2H 1A02N 1I1FA 3H8NA 3HHRB 4OCNC 5IVZB 5EU7C 4RIRB 2A38A 2P8LB 1IRAY 2DQHH 1QYGH 3MJ9A 4KJWC 2DKSA 3WHXA 4JM2F 3VXMD 4YH6A 1ZHNB 4QF1B 3O2WL 3REWB 1PQZA 2QLVB 4KV5F 5KSBB 1INDL 2NXYD 3SGEI 3M07A 1QLEH 3FQTA 2ADGA 1P4IH 1AR1C 5IB1B 3LDBB 5FYJH 4UDUB 1TETL 1H3WM 4W70A 1MHEB 1RJLA 2YPVH 3SN6N 4KC3B 5GJSL 4I9WD 4HUNB 2VQ1A 1AXIB 3RVTC 4JPIB 1S9YA 2CKBB 3UC0L 5CZVL 3MBEC 2WIIA 8FABB 2WV3A 5FKAA 4FTVE 1X6LA 4KK9C 1ZVSA 3FQWA 1FNLA 3JBG7 1YJDC 4BUGA 4OSUH 1TVDA 4R0LB 2H41A 4LEOB 3KYNB 4U33A 4WW2A 4C83A 3DETC 4DKFL 3GMPB 5IGXH 4C57C 5JIKA 1NCBH 1EK3A 1YY9C 3CH8A 3GSWB 1MRDH 4O9HH 1I1FB 1ORSB 2ARWA 2EDEA 4JFDA 4M93C 3T8XB 4WFFD 3S6CA 3AREA 2DOCA 3BKML 5DJYA 3WCYA 5D7JD 4EUPA 5L2KD 4ZS6C 3WNMA 1N5AA 3WHXB 2V7NB 4ODWA 3H42H 1VGEL 4UQ3A 4Z7VE 1PQZB 2F53E 3BRFA 1CDYA 4K7PY 3I3BA 5B39G 4N9OB 1PX3A 3IT8D 1CLOL 4N0UE 3VG0H 2WAHA 2ADGB 3GNML 5E2UL 2C3VB 3WIHL 4QXTA 3W0WE 2DD8L 4Q6IB 2I60H 2DWDB 1WIPA 1RJLB 1LO0L 4DAGL 5FECA 3JTTA 3NMEA 4HGMA 4NSKB 3PL6C 3UJIL 4ODXA 2WUCH 4FQXA 4WJ5A 2IEPA 3UPRA 2OL3H 3VA2C 3QEQD 1NBVL 1EO5A 1S9YB 1L9NA 3FFCE 3LEYL 2JK5A 3TIDA 3C5JB 4Y16D 1OM3H 2WIIB 5FKAB 3E1F1 3MNWA 5I8KL 1IGIL 1YMHA 5FYKH 2FO4B 5JUEL 1I9IH 4NQDE 4YX2H 1CFNA 4ZD3L 4JRYE 4WW2B 4C83B 3TYFA 2Y5TB 2EH8L 1RUPL 4F9LC 4X99A 4ALAH 1YY8A 2IG2H 2XA8L 5IVOA 1NCCL 1ZK9A 5DVNA 2XRAH 4C56D 4MB4A 3WIHA 3AM8C 4NRXA 5K9QG 4DN4H 5DJYB 3ORJA 1N5AB 3NPSB 2Z31B 1WAAE 4UQ3B 3DXAE 5AUMA 4ZMAT 2VKXA 1QFPA 1Y6NR 2FJFA 1WWWX 2AV1A 2NY4C 5TE7H 5GIRB 4Y5XA 4GW5A 4LOUD 4QXTB 4MA8H 2OTUB 3ME0A 5AYUL 2WW8A 1OL0A 3SDAD 3ZYOA 5FECB 2E7BA 3JTTB 3H3PL 2AEIT 1IKFH 4R4BB 2WINA 4ODXB 2O5XH 3ARGC 3UPRB 5H8DA 3K2UH 2LTQB 1CCZA 5I0DA 1S5HA 4XPTL 5MERA 2JK5B 3TIDB 4YHYB 1T80A 3TO4D 2A9NL 4HC1L 1B88A 3DARA 3MNWB 1TTGA 4M5ZH 1YMHB 4JO2L 4FQHA 2JCCA 1FFRA 4G8FA 2NW2A 4PRHA 1CFNB 4WEUD 2PTUA 1DN2A 4PBVC 4WCYH 1T2JA 4HPOL 2GJJA 1KCVL 3LKQA 1KLFA 4X99B 1OT2A 3B9KD 4JRWA 2VZOA 2R2EA 2BFVL 2AABH 3QPXL 4XBPA 1X5KA 4NRXB 2DI9A 3NGBC 1MAML 4LBEA 4P49A 3EDDA 1M71A 4F7CA 1FPTH 1MCKA 3CLEL 4JFED 5KSAA 4H25A 4LAQL 2AV1B 4ETQA 1IBGH 4Y5XB 3AS0A 4HC1A 1LDSA 1NL0L 2RCSH 2W59A 4U31A 4AZ8A 4TSAH 3V6OC 4TUJA 1H3UA 2P47B 4L4JA 3REVA 1MCPL 3IRPX 5SX4I 3T0AA 2E7CA 4LHUG 4N0YL 5I9QB 1RZ7L 3T3PE 3CDYA 4NN7C 2WINB 3O41A 1QG3A 5JZ7C 5CJQH 2CR3A 4HD9A 5CP3A 3WN5A 3X3FL 1S5HB 4X7EC 1CVRA 1HHGA 1MCDA 4MJIE 4UQ2A 1H3PL 4F57L 5I8OH 2E9IA 4QRQA 2JCCB 4G8FB 1F5WA 1SYVA 2NW2B 4PRHB 3S5LB 3S37H 4XH2A 2AXGA 2QBWA 4KGJA 5F96L 3EYQD 1I8KB 2CKBH 4FABL 1U92A 5IQ7L 3BP7A 2R2EB 1FLRL 4M03A 3DV4A 4CMHB 1DL7L 2Z93B 5TQ2L 4MA3B 4JGMA 2H1PH 3QUKA 4LBEB 5D6DA 5GS0D 1NDMA 1BBJA 4GKZA 4BSJA 1M71B 2WQRA 5D1ZA 3VGFA 4F7CB 3GBML 5KSAB 4H25B 4I13B 5CZXD 5CCKL 3HUJA 1TQBC 4YEFA 3OG6B 4ETQB 1JTTA 3L5IA 4UIKH 5H35A 5J9PA 2RHEA 3GHEL 1EZVX 2XWTA 3MJ9H 4X5WA 4XMPL 5C0AE 4TUJB 1LE9A 3S4SA 3REVB 4FTVD 5TFSH 4WI3A 5IM7A 5HI4D 1RURH 1W0WA 3JUYA 1BF8A 3O41B 4LGPB 4IJ3C 1N59B 1JGLH 3MV01 2X1XR 2YPLA 1HHGB 1OCWL 1N0XL 1XAUA 5C0GA 4KVNL 2YA2A 3UEZA 5JHLL 3ZKXC 4I4WA 4Z7UE 4QRQB 3SQOH 2IAMC 3I9GL 3DRTA 3F7RA 1C5CL 1SYVB 1RSFA 2E9WA 4XH2B 1IZKA 1B6DA 4IDLA 3RAJL 5CFHA 2CMRL 3LN5A 1U92B 1UA6L 3ZL4L 3MV9E 1QRNA 3UTSE 5HGDA 4R2GB 1Y0LA 1T1YA 3B4NA 3ALWA 3QUKB 3O2WH 5CEYA 2NY5C 1BBJB 1CU4H 4GKZB 5HVWA 1INDH 5DXWA 4RMUA 5D1ZB 2YEZA 3CJJA 5E2VL 1TZHA 1U91B 3OF6A 1E27A 3CFCL 3HUJB 3QUXC 4U1KA 1S9WA 1WFNA 4WEMB 5E9DE 4XWGH 3KHOA 3IDGA 1TETH 2P5EE 5J9PB 3FFCD 2XWTB 4X5WB 1C08A 2EDWA 5IF0A 1LE9B 4XPFL 5EIVA 4PG9A 5GJSH 1W0WB 5GRXG 3UAJD 5D7KE 1P7HL 2B20A 2O26U 3ULVF 2IALB 1I1YB 1FG9C 1KIRB 1S9XA 2ZCLL 2IQ9L 1ZV5A 1AKJD 2YPLB 4J4PA 5LQBL 4UINH 3MUGA 4MNQA 5C0GB 1QZ1A 2PNDA 4JFOA 4P9HL 4HXBL 3VFWA 4CJ0A 5DT1H 1I9JH 5CBAA 2X4RA 3BH8B 2WZPD 1FHGA 3GSRB 1MHHB 3DRTB 3CMOL 4PRNA 3RY6A 2F5BL 4FS0A 1ZLSH 1U8NA 3AC0A 3D48R 4LNVA 3DXAD 3LN5B 4Q9QL 3LKOA 5F7UA 4F15C 3BKMH 3KPLA 5EU6E 1CFSA 1MVFA 1QRNB 1I8LC 3OR7A 4YGVA 1Y0LB 1G7LA 1T1YB 2AEQL 4NN6C 5DZLA 5GSVA 3R1GL 4FQCL 5CEYB 1VGEH 3RUGA 2I27N 5GRWA 5IW1A 5T3XH 2HTLD 5D2LA 4P9MH 2YEZB 1CVSC 2LAGB 2P43B 1TZHB 4NP4L 4UI2A 3ARBC 3UYPA 3GNMH 1E27B 5E2UH 4FNLL 4U1KB 2D4DA 1Q0XH 2VABA 3V6ZA 1FVDA 3WDIA 1U3YA 5IF0B 1LO5A 3ARVA 1VEOA 3H2WA 3RWCA 3MRNA 2R69L 4F33B 1U0QA 2DL2A 3DX6A 1ERNA 4R4FL 2EKJA 2QEJA 4JG0H 1S9XB 3LEYH 4R4NC 2B0SL 2DICA 5C7XL 4P4KC 2ZCHH 2I5YL 4MNQB 5I8KH 5HI5C 4Q7DA 1KIUA 5JUEH 2VITA 4JFOB 3VFWB 1ZLWK 5D7IF 4PJEA 4LLUA 4CNIA 2X4RB 4QXUL 2D03L 3HG1E 3NCBB 4OCLC 4PG2C 2ZJSL 4WHDA 1KJMA 2IAND 4PRNB 2OJZH 5FO9A 2XA8H 2VB5A 1NCCH 4JDVA 4AIZA 1MRCL 4KKCD 2GIYA 3LKOB 3MLXL 4X6BA 1AE6H 1CFSB 3PWPA 3LS4L 3OR7B 4YGVB 1T5XA 3EDFA 3DGGA 2AK1H 1JTPA 3QJFA 1G9EA 3RUGB 4P5TC 5IW1B 1B9ZA 5D2LB 5KS9B 4OGYL 4OZFA 5DJ8A 2J8UF 5JNYA 1P5VA 1NC4D 3B43A 3NCFB 5FFLA 5L6YL 1N2RA 4HH9A 1K6QL 4PJ5B 2VABB 4U6HA 1K4DA 3DI3B 4JQXC 3RGHA 2DQCL 1I75A 2Z9TA 3V6ZB 1FVDB 2W0KA 3O8XD 1MCBA 4OZHA 1LO5B 4WFHD 1OTTC 3SKMA 3C6LD 3MRNB 1JFQL 3VXSD 2VDRH 3EJZD 2E7LA 3DX6B 1D5ZB 1XT5A 3MRBA 4JR9L 2MQ3A 1S9KC 4DKEH 1ZLVK 2DDQH 1A1NA 1T03L 5HHQB 5DK3A 4XPTH 5HDQL 4NM8L 3WKNA 1T7WA 2A9NH 1IC7H 1HSAA 3ESUF 3T77A 2NXZB 2C7UA 4RWYH 5HHXL 4RAUA 2VITB 5SV4A 4OCSL 4WTZA 4CNIB 1FYTE 1R3JA 4YDIL 4CU8A 5JQHC 5CSGA 1TZGL 1S7SA 2UZXB 1KJMB 4JM4L 2CXKA 3O2DL 4NRYA 1HINL 3DV6A 4UB0L 1KTLA 5CP3H 3L5HA 2BFVH 4AIZB 3TWCH 3SOBL 2EDYA 3ZDYE 1A7RL 3MV7D 4ZFZA 1DQQA 1JF5A 4X6BB 4UT6L 3PWPB 1MAMH 3MGTA 2DQFA 5BO1L 3DGGB 3T04D 1LO4L 1ZOXA 3OAUL 4K7FA 3QJFB 3IAGC 5I6XB 4ZO9A 3OWEA 4TVPL 2EDRA 3MFGB 4LAQH 4UTBH 5CLTA 1MCRA 5JNYB 4XNYH 5EG6C 2HT4C 1T5WB 3V52L 4O4YH 1N2RB 3ZYJA 1KXTB 3QFJE 4U6HB 5ETUA 1K4DB 5ICXA 2VDQL 5FUCC 3HFML 5DC0A 4UNVA 3O2VH 2X1QA 3SKMB 3NZHL 1RZ7H 1U9KA 3GIZL 3MJ8B 3NOIA 1S5IH 4P3DA 3MRBB 3O2DA 1A1NB 3X3FH 2H2PC 1U58A 3E6FA 4L8CA 4Z7OF 4UT9H 5FYLD 5F44A 2C7UB 3T77B 1G1YA 1MHCA 3D2UD 4JRXA 4RAUB 4X9GA 2F54E 4M6ML 2VDNH 1F90H 3MV9D 1R3JB 2IBGA 4DN3L 3FOMA 1S7SB 5DQ9B 2DBLH 4BK4A 1HH6A 3DV6B 3G6AB 1N7MH 1KTLB 4OF8A 5I19L 3W2DL 2W0PA 2BVUA 1IM9D 4ZFZB 2J8OA 3MR9A 3PP4H 4GSDL 1MIMH 2J4WL 4M3KB 4PJGB 3TCXA 1AP2A 1RU9L 3ZE2E 2M8XA 5I1CH 4YHIA 1JF1B 3DPBA 3QH3B 5E8PA 4LCWA 3DNKA 4Y5YB 3BVNA 4K23L 4X6DF 4XXDA 5GISH 5IB2A 3D69A 4KQ3L 3C60A 5LXGH 1KELH 5F9WC 2GY5A 4C58B 2ADIB 2VAJA 4JVUA 1NGXA 3BZFA 2V2TA 2BSTA 3RHWK 3D9AH 4P3DB 1I7RA 5C0CE 5C0IB 1QPPA 1KENL 5D7LA 5F7LB 5C0ND 3UX9B 5E2WL 5EWIL 5IIEA 1ZT7A 2ZUUA 1ZS8B 3E6FB 1OCWH 5C09D 4YDLC 4PJBA 4XVJH 5T5FH 5JHLH 1MHCB 4JRXB 4P2RA 4PJ8C 5F3BA 1YYMH 2YUVA 3D39A 5JPMA 3T08A 2ZCKL 4M9OA 4QHKJ 5C0JA 1HEZA 5D5MF 3VXOA 1PZUB 3GBNL 5FO8A 3KJ4B 3RAJH 4EI5C 2R0ZL 3ZL4H 1U6AL 5BS0E 4LCYA 5I1KH 4K7PH 3MA7A 2FX9L 4OKDA 3MR9B 1JZ8A 5BVPL 1MEXL 3VI3F 3BHBA 1JYXA 2DWEA 2B5IC 4N0RA 4YHIB 5E2VH 5HY9A 3AY4A 5E8PB 4LCWB 2BY3A 2H45A 1YMMA 4LPVA 3BVNB 2W91A 5GJTL 1A3LL 3IU3A 4NUGH 4XXDB 1M7DA 1C1EL 4GKNA 1WF5A 3P4NA 3C60B 3TVMD 1GZQB 1S7WA 3O6LH 2QQQA 2YRZA 3KXFB 4O58L 1NGXB 3BZFB 3G6JE 3QEUA 4G8GE 4P23A 2V2TB 1MCWW 2NY3C 1I3VA 2ZCLH 1I7RB 3QULA 1KIPB 4XPHH 1O5DT 3HG1D 1FP5A 2EYTA 5D7SL 5IIEB 4PRAA 3VXUE 1R3IH 1J10A 4PJBB 4Q2ZA 4HXBH 1T4KA 4P2RB 3BW9A 5F3BB 4NQEB 3D39B 3W5NA 5JPMB 2HMIC 5DMKA 5C0JB 3M17A 4U1IA 5DURD 2XPGB 1FNEB 2VDKL 1HEZB 3GI8H 4L3EB 5EBMA 5ID0B 3EOTL 5C07A 4P2OA 2HN7B 5HI3C 4E41A 4R26L 4HJGB 4JJHA 3WL9A 1N6UA 5IB3A 4EKXA 4LCYB 1P6FA 1QFUL 1GXEA 3C5ZA 5JO5A 4PTTA 5I75B 3R1GH 5CJ8A 1II4E 3BHBB 5E4IA 3QDGD 4D0BA 4G8IB 2DWEB 2W0FA 4NP4H 5BRZD 4AIOA 3IDMB 4PUBH 1YMMB 1BJ1J 1I85A 4BZ1L 3IU3B 3DHMA 3VXTA 4HFWA 5D71L 2Z35A 4P46D 5IVXE 3P4NB 2JJUA 3QWRD 1S7WB 2K7PA 2R69H 3UTTD 3B2UC 4BJLA 4P23B 1OSPL 2NY1D 3ARFC 2XWBB 3UDWC 4R4FH 1FYTD 4HGWA 4Z0BL 3GSNL 7FABL 2VLRD 3FQXB 2EYTB 2ESVE 2FWOA 4PRAB 4D0CA 1BFOA 1OAQL 4HWNA 4Q2ZB 4HDIA 4QRSB 3E6HA 2R4RH 4QXUH 2D03H 4WUKH 1HQRB 2ZJSH 3PWLB 5DMKB 4U1IB 3K0WA 3BPOC 4N8CL 4LDEB 5C07B 1MRCH 3MLXH 3D85D 5IB3B 3VXMA 3DX9A 2C5DC 4DQOH 4FQIH 1XCQA 3L7EA 4PTTB 2B1HH 1AR1D 4L8BA 3ULUE 4D8PA 3HMWH 3QFJD 4OBSA 3DBXA 4D0BB 3UBXA 1BZ9A 3T3MF 3G5VA 1NAKL 1XMWA 4KRPC 4H8WC 1RUAH 3GSNA 3VD3A 4DTGH 5L6YH 1KC5L 4XNUL 1JHKH 2Q6WA 1J0KA 3VXTB 4HFWB 3HPJA 4X6CA 3RVTD 3VXQA 3MBED 4PJDF 4NQUA 1CGXA 2CUMA 4KK9D 5IJVA 2DJSA 2H26A 3BSZL 1JZ5A 5FAAA 5GGQL 4DKDC 2YUWA 4XC1H 5HDQH 3JUZA 3RVVD 3QXUA 4YE4H 3DETD 2X70A 4G7YL 3BZEA 2FWOB 5FYJU 2IFGA 4D0CB 5KVGL 3IDXL 1BFOB 3FQNB 1YY9D 2A73A 3GIVB 5I1LA 1R0AH 3U9UA 3E6HB 2QL1A 4JEGB 2CK0L 3HI5L 3PWUB 1TZGH 4JLRB 3O2DH 4WI7A 3VMPA 4ZS6D 2IBZX 4UB0H 3IS1X 1YQVH 3R4DA 4XB7A 3U0TB 5D7JA 5L2KA 4MA7H 4KK8C 3DO7B 1BIIA 1HWGB 1XCQB 4P2QE 2BERA 4LEXL 3L7EB 5BO1H 2NXYB 3K8LA 5I0ZA 2YD4A 4D8PB 4G5ZH 1KXQE 3DBXB 5DD6A 3UBXB 1BZ9B 3N1PC 1RPQA 2YZ8A 5FO7A 3G5VB 3GEWB 4JPWH 1WVZA 4XCNA 5KANG 1U8IA 1ORQA 3GSNB 3PL6D 2LU7A 1PFCA 5B22A 3V52H 4HK0A 2Q6WB 3Q6GL 4I8DA 4O51B 1IGTB 3HPJB 4X6CB 3GJEA 5LBSL 1OP5H 3VXQB 1PYWA 4FP8H 3QEQA 3JVGA 1NJ9B 5E56A 4R90H 4Y16A 2H26B 2FNBA 5HPOA 2Q7YA 2YD1A 1F58L 1F3DJ 4PJCB 5IG7A 2YPKA 5JHDE 2X70B 3BZEB 2FR4A 1IGMH 4HWBL 3S5LG 4I3SH 3FO1A 1QLRA 3MX0A 1J8HA 2A73B 4XWOC 1F6FB 3WEXA 4YFLF 5I1LB 4QRPA 2CRMA 1ACYL 1CT8A 1JPGA 4R8WL 1MCIA 2HKFL 3E2HC 1RZIA 4RNRA 4C56A 5IB5A 4R96A 1GGBH 1IC5H 1N5YH 4PR5A 3HKFA 2JELH 4OTXH 5IROA 1LWRA 3W2DH 1TLKA 5D7JB 5L2KB 1IAIL 3SJVB 1P1ZB 2CIIA 1O7VA 5I74B 4JFYB 1I3GL 4EJ1C 3IFNL 2NY4D 4GSDH 5E8OA 5ISZA 3RIFF 5E6IC 1KYOJ 1GVIA 2R1XA 1RU9H 3WUWA 4FFYH 5DD6B 2I9TA 4XHJD 3VMOA 3OXSA 3ARWA 4NDMA 4WO4C 5KVDL 3QG7L 1E4XL 2BXYA 4XCNB 4G8GD 3HC0A 1U8IB 1ORQB 3B3IB 1A7OH 4XBGB 3SDAA 2PR4H 3ARGD 4HK0B 1EX0A 2EC9T 2BX5A 3QEGL 1VENA 2JE8A 1PYWB 3QEQB 4MZ2A 4CKVX 1GL4B 2J12B 4ETYA 3U0WH 4RGMC 3BQUA 3TO4A 4XVSL 4Y16B 4AG4L 1BD2D 4H88L 1ZT1A 5D1QC 3RWHA 2XKSA 2Q7YB 3BPNB 2CIKA 5IG7B 4PBXA 1JMXA 4X9BA 3MO1A 1OWRM 1YNKL 1J8HB 2J8HA 4M6AA 2Q86A 3EO0A 4X0KA 3WEXB 4IEFB 3JWDL 4QRPB 1CT8B 1JPGB 3Q1SH 1LVEA 3B9KA 1RVFH 1OW0A 1NBZA 1QFOA 4XX1G 4TOYL 3DOSA 1J1OL 1RZIB 2WNGA 3QDJD 2VC2L 5HSFA 3RPIB 3N1QC 4UU9A 5DFWH 4G43A 5E8DH 1CD8A 2IBBA 4GRMA 3HZYB 2DLTA 1GGCL 3CDGA 4KTDH 4XBEH 1F3JB 1V5JA 1MEXH 1E4JA 1IQWL 4HBQA 1QKZL 1OD7A 3HUJF 5E8OB 5ISZB 3FO0H 4X6FA 4JFEA 2VLLB 2X89D 2R1XB 3KVQA 3WUWB 3QEHA 2I9TB 3OXSB 2CDEA 2RJMA 4M48H 1XF3A 4NDMB 3MRRA 3BIBX 1NGWA 1MCCA 4N90E 1PKQE 2XNAA 3TT1H 5ITFA 3HC0B 3C09C 4XP1L 5F89A 2P7TA 3S36L 2A6IA 1ZLWH 3SDAB 1BVKA 4IIQB 5GS0L 5JZ7D 3MREA 1UT9A 3C8HA 3WNLA 3QUZC 3S3PA 5C71A 1ND0B 1ES0A 5C0DA 3TV3L 2GSIA 3EFDL 4O58H 3BQUB 4M7ZC 4KRMB 3RL1A 1ZT1B 1RJCA 3H9SB 2A1WL 4FQQA 4OD1L 4TPRL 3RWHB 3KGRA 5D7SH 2CIKB 5EOCJ 3MO1B 2D3VA 4MXWL 1MF2L 4ZS7L 5GGTA 1RZ8A 3U1SL 4X0KB 3EO0B 2Q86B 2BXZA 4BSVA 2O61A 5DF0A 1AGDA 2MKLC 2F9BT 3B9KB 1NBZB 4AH2B 1NFDF 1A6WH 3A0OA 5HYQB 4MD0A 3B5TA 1SEQL 4XT1C 3KWWA 1HDMA 1IGJA 3KYAA 3OHXA 5J06A 4UU9B 4G43B 1CDBA 5T33L 4GRMB 4UT7L 3GUTA 1M05B 2X4TA 3CDGB 4XP9H 4YXHL 4NC2B 2XTJC 4I18C 4DUVA 2FYYA 3D3VE 3LB6C 2DL9A 2ZPKL 2M1KA 3QT2A 4JFEB 4X6FB 5DEGA 5JIHA 3O4LB 5MENE 1ZLVH 3QEHB 5E99L 3GKWL 4IMKC 2V5YA 4OM0L 5KZCD 2CDEB 4MDJB 3PHSA 4CVXA 4JFFD 4A6YA 5ITFB 3C2SA 4FTVA 2P7TB 2A6IB 3OKOA 1BVKB 5BJTB 2GITA 3MREB 2F5AL 4ZAKC 3SGDI 3D87B 1QBBA 3VFRA 1OPGL 1HOCA 5C0DB 4MHHG 3D25A 5ADPL 3BOVA 2RBLA 3RL1B 4FQQB 3GSNH 7FABH 1OOAA 2IAMD 4Z0XA 5K9OA 4ELMF 3TIEA 2YUXA 4IS6B 1S3KH 5I2IA 1NGYA 4Z7QE 1CD9B 2DKMA 4ODVL 2O61B 4Z7VA 1AGDB 4J3UA 2DIJA 4TSCL 2XZAH 2V5SA 2D7QA 5T3ZL 3BEWA 4MD0B 5JOPE 3KWWB 5CHNA 1HDMB 5MHSE 1L7IL 1IGJB 3OHXB 4IHOA 3TZVC 4WWID 3OJDB 5EU5A 3OPZL 3GUTB 3RUGF 1EAJA 4GUPA 2X4TB 4JDTH 4KJYB 3W0WA 2BJML 5D2LF 4Y4FB 5KS9F 4KJQC 1C8PA 3TLRA 3QUXD 5EZIH 3OJ2C 2FYYB 3OAZK 3IAQA 1JYVA 1E28A 4PTUA 1WTGT 5DEGB 3UP1A 3IGAA 2PKDA 3PABB 4CVXB 3MUHL 3QSKB 4PGZA 4LHQB 1Q1JH 2IFFL 3FFCA 4KAQL 3STLB 5DVLA 4A6YB 1KTKE 1KN2H 1BFVL 5I15H 3EYUL 4FTVB 3Q5TA 5F7EL 3OKOB 2GITB 2GYSA 4GG6E 2ID5A 3G6DL 5ILTL 2R0WH 1RUML 2FATL 3VFRB 1WBZA 2WBJC 1T0NB 1HOCB 4Y19E 1FV1A 1ZHKA 2AKRB 2HT2C 3D25B 1A2YA 2R1WB 4BQ8A 1CICC 1ZSDB 4Z0XB 4G7YH 3TIEB 3IDXH 5I2IB 4OKVA 2OYPA 5LWYL 3O4OC 3HB3C 1MCHA 1A0QH 3QUMA 2CK0H 1WAAA 3B83A 3UJJH 4Z7VB 3DXAA 4LARH 1DBKL 1J1XH 4M61A 1HXYA 3AAZA 5EU5B 2P4AB 2AQ3A 4LVHB 1Q9WB 3RWGB 3W0WB 1MI5E 3ARBD 5F7KC 5FK9A 3S35H 4BFIA 1C7TA 3CDCA 4PTUB 4QHUA 1NCWL 3N9GH 1QSED 5FUOH 3IGAB 2BNQE 2IPUG 3UROR 3U79A 3BH9B 3FFCB 1A6VH 4XAWL 3S88L 4QOKE 4WVRA 3PNWB 3U4BL 3Q6GH 1OB1A 4R4ND 4FQLH 5HYJD 3L6FA 3S97C 1BGXH 1WBZB 5JORA 4PJXF 4P4KD 5T1DH 3QDAA 5HI5D 2GJ6E 1ZHKB 1A2YB 1F58H 4L29A 4WTZG 4KZDL 4JY5L 4LRIC 2Y5EA 2AJXL 4OKVB 3CFJA 2IANA 4I0KA 4PP2B 1CLYL 3QUMB 2HKFH 1MWAA 3DXAB 3KPQA 4PLJC 1PKOA 1NFKA 3DVFA 1I8MA 5DC4B 3ZT7A 4JM2C 3WS6C 4M61B 1HXYB 5IJKA 1IAIH 4PJGF 3AAZB 4PJAA 1OARH 3MRJA 2OLDA 2VMFA 1I3GH 4MB3A 1ADQH 2HRPH 5J3HC 3RNQA 4NZRH 4UOJA 3A6BL 4BFIB 4KKAC 4LSVL 5TQ0H 1LNUA 2HWZL 1UEYA 2E7HA 4QHUB 2KUTA 4KHXH 1NC4A 3G9AB 4KI1A 5KVDH 5I1IL 3QG7H 3MV11 1OTTD 3CNKA 4L4TE 1T89C 3N1GC 3O8XA 1OTUC 2E5EA 3F7PC 4QGTA 1OB1B 5B38A 1G9NC 4OLZL 1QO3A 3VXSA 1E6JL 1G0XA 1T21A 3L6FB 4LRNH 3V4VL 1VACB 1RZGA 3RP1A 5JORB 4L4VD 3NIDE 4NJAL 5EN2A 4GMTL 2E6JA 4AG4H 1MY7A 4H88H 4X80H 3MZGB 4OF3A 5SWQA 4B7LA 3HC4L 3WHE1 1OGTA 1YN6A 4L29B 1U3HC 2D0GA 2J7LA 4MQTB 4JB9L 1Z6JT 1FZJB 1NUNB 1OHQA 4APQC 4RGNE 1YNKH 4UOW1 1H8OA 3W5MA 1JPFA 5GGRY 2NZIA 3CFJB 4N5EC 3CFIC 3PUCA 5BVJA 3SDCC 1MWAB 3O6FC 2X7LB 1J1OH 2QQKH 3KPQB 5DD1H 1YNLH 3ZLQC 5I18H 1Q9KA 3HZMA 3FT2A 5EPMA 5FYLL 3UPAA 3MV7A 1I8MB 4N9GA 4NQXA 4XXCC 4PJAB 3MRJB 5GGTH 3U0PA 1IQWH 4TULL 2CJUL 3RNQB 5GRJH 5F6HI 1CTNA 1LNUB 1GHFL 1VA9A 1HN1A 1S7XA 4O02H 43C9A 4PV9A 3H9YA 5E1HB 3S37X 5C08D 3B2VH 4OZIE 4K3EL 4OCYH 1V05A 4F9PA 3O8XB 3WS3A 1PJ9A 1WEJH 3FQRA 1KYOK 4MAYC 3JV5A 1FVCA 4M6OH 5B38B 2H2PD 1QO3B 1EHXA 1T21B 4Z7UA 4OM1L 5A2IH 1DLFL 3KLDA 3TV3H 2B4CC 3KLHC 4KU1A 1JMZA 3VW3L 1CF8H 4Q6YA 2OJEA 3RDTA 2IQAA 4PJBF 5SWQB 2A1WH 4OD1H 4TPRH 4JVWA 2MCG1 1OGAD 3U7YL 1OGTB 1KJ3H 4A6YH 1EHLL 3D2UA 1XIWC 1IQDA 3ARRA 4HEPG 5GS1C 5IW3A 2XZQL 3MV9A 4PJFE 4JPKH 3U1SH 3CH1B 1JPFB 1Q9OA 4AEHL 1XGQA 1UADC 2DQDH 5BVJB 4Y4KC 2HJKA 3Q5OA 5DD3H 1SEQH 3N85L 1Q9KB 1IM9A 3HZMB 5EPMB 3MV7B 4MSWA 4Z7NE 5GGVY 3NBNA 3WFHA 1A1MA 4ZNCD 4P9HC 1RJZA 5TF0A 4YHZL 2P5EA 4MAUH 4YXHH 2DQJL 3U0PB 4CN1A 4LLQA 1U8JB 4PLKC 5FUZL 1JCKA 3U2SA 5JIIA 3GKWH 1ZHBA 43C9B 3I3DA 5FOJA 2EXWC 1EFXD 3HR5A 4PV9B 3TNMA 1K4CB 4I3RL 3QO0A 1IILE 1QBAA 4OCXH 1WZ1L 3FQRB 3BP4A 1OF2A 2V7HA 3TF7C 2EICA 4Z7UB 2YD6A 2AJ3A 3NIGE 4TSBH 1TCRB 4PJ8D 3RDTB 5C09A 1HCVA 2C3XA 1NCUA 2AJZA 3CSBA 2ZUXA 3FMGL 1JRHL 1NKRA 1IQDB 1WC7B 3HC3L 4ONHB 3MV9B 3P9MA 3T0DA 4EI5D 1MIEL 3C2AH 2VH5L 2V5TA 1ZGLP 1Q9OB 1XGQB 4OZGF 5KSBE 2FCBA 4TSCH 4PP1C 4OCRH 2HJKB 3GB7A 2KQNA 4LLWA 3MFFA 3QQ3A 2OX5A 3VDCA 1L7IH 4XGZA 3D1MC 4MSWB 3OPZH 1OSZA 1KLUB 3WFHB 1A1MB 2BNQD 2D0FA 4GXVH 4JDZA 2BJMH 3LQAC 2P5EB 5HGHB 3RZCC 3V8CA 5BZDB 3DUSA 4LLQB 1FFNA 3QUMH 1MLB