3TNMB

Crystal structure of a32 fab, an adcc mediating anti-hiv-1 antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
210
structure length
210
Chain Sequence
VLTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQHHPGKAPKLIISEVNNRPSGVPDRFSGSKSGNTASLTVSGLQAEDEAEYYCSSYTDIHNFVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain of human anti-HIV-1 Env antibody A32
publication title Diverse specificity and effector function among human antibodies to HIV-1 envelope glycoprotein epitopes exposed by CD4 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tnmB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tnmB02
4X6CE 3ULSB 2KZWA 5LGHL 2VAAB 3W9EB 5MP6L 4Z77B 3B9KA 4CVZA 4PJ8A 2HYMA 4NQDD 3RWHA 2BNRB 1P4LA 2PUQT 1PSKL 1JPTL 1UB6A 4P2QA 3QFDB 5EU6A 4I18A 2P45B 4N8VB 2YRZA 5K9OA 3N1MC 3BKCL 4XAWH 4L4JA 4HS6B 2GITB 4PJCE 3VFPA 4RMVA 2DQJH 3GSQB 3VD7A 2XWTA 2PW2A 4XVSL 1DFBH 3ARDD 3DGCR 5TDNB 5GS0H 3A6CH 3WUZA 3SKOB 5F89B 4MD0A 4PRHA 5TFSL 4DGYL 4OCYL 1VEPA 4WW2F 1Z3GH 3LHPL 4P9MH 2ED7A 4P2RE 1J05A 4WW1B 5CEZE 2VH5H 1KGCE 1RK0B 2CLZB 3QUXA 3QBTB 1JGUL 2NNAA 4XI5D 1T83A 5DC0A 3TNNA 4XCYB 2JB5H 5ILTL 5BVJA 3FHQA 4F9LC 5C2BL 5BZWB 5JMOC 1E4WL 3R8QA 4MLIA 1MCNA 4PJGF 5L8JB 1OP3H 3OKDA 4PJ7A 4X99B 3O2DL 4J3XA 4QYOA 2HFEA 3PL6A 3HUJE 3RY5A 4ZAKC 5K33A 3CPLB 3UYOD 1EV2E 3OWEA 3EGSA 1BF2A 3MV7D 1DANU 1QFHA 5FOBB 3P9LA 4WCYL 4LARL 3MJ6A 2A6DB 1A1OB 1GC1C 4PJAE 5DR5H 1S5HA 5E7FA 4HWBH 1ZA3B 3GSUB 4EOWL 3RDTC 1RVFL 3BYYA 2KH2B 3QUKB 4IOIB 3SE8L 4ZTOH 2FDBP 3HZYA 4R3SB 1A0QL 4OT1L 35C8L 1B2WL 4X8XA 5DTFA 3O6ML 3MROA 4NT6B 5HXMA 4P4KB 2VYRE 3KLAA 1GRWA 4ZNEE 4OZGF 1AHWB 4P5MB 3UJJL 3KJ6L 4X6DF 5IJVA 3SGEH 1UA6H 2X40A 2VZTA 4NN5C 4J8RB 1UCBH 3NABL 4FQ1L 3JUYA 4HIXH 1RZIA 5SX5H 4PY7A 4XVTH 1ZHKA 5HPMB 1ZT4A 2JIXB 5FDWB 4HEME 4WEBH 5EIVA 4PJ5E 3D39B 1VEOA 5D6DA 3S36L 3H7BB 3WFDL 43CAA 3PHSA 4RRPA 4GQ9H 4HF5L 4MJIA 5EBMB 3MODL 5HVGB 3EHBD 4R26H 3TBVA 2MSPA 4N0YH 2APFA 4LCCC 3CH1A 1TQCC 3SGKC 4Q0XL 4XXCA 4Y5XC 1QLEH 1HXYA 3NMEA 5CLTA 2ICWB 2PO6C 4PGJA 3IDYB 1DE4A 2WLZA 4U4BA 4H26B 1Y18A 4Y0GA 4E5XB 3MRGA 3O3BA 4JO1H 5GSVA 4B7LA 4XBPB 3I02A 4ISVA 5B38A 1ES0B 4JY4A 4QHUA 4Y19E 5E9DE 5MEND 3EOYG 3QDME 4NJAH 2B4CL 2GTZB 3EDFA 1RJZA 1F4WH 2VDOH 2YPLD 1FO0L 15C8H 1YMMA 1CGWA 1I9JL 2UWEB 3QDJD 1YC7A 1RURL 3BI9X 4PREA 3FO2B 4LL9A 5EOTA 1BD2E 1TTFA 5L88H 1W2KT 3PQYA 3PHOB 3QQ4A 4X6CB 4XZUB 3CZFB 4O58L 3G5XB 4M1GH 4ZAKD 5HYSG 1A7NL 4P4RB 5F1NA 5SV4A 4ODVH 2NX5A 1M1SA 5GISL 3O45A 3C8HA 1MCFA 4KDWA 5F8QC 4HSQA 1ZAGA 1KJMB 2J1KA 1JFQH 1L6XA 2ESVA 3GMNA 5I1HL 1T0MB 1N2RB 4U6HB 3CIQA 4KRNA 1J1XH 2CRIA 4PJCB 4Z7UF 3RDTD 3RGVB 3RWEB 12E8L 4ELKA 4Z0BH 4BZ1L 1I85A 5BQ7A 4GXVL 1DN0B 5JIPA 2YKLL 5HI4C 1XF5A 4WY7L 5DEGB 3EO1B 3N85H 1T4KA 2X44D 4M5ZL 1EEQA 4WI4A 3RNKA 1OT1A 3SKMA 2DOCA 4P2RB 2ADJA 5D93C 1IM3A 4I18C 5CEYB 4AG4H 3IXTB 4G6JH 1QP1A 2GT9B 1FBIH 4QXUH 4MQ7B 4MAYA 1J5OL 1F8TH 3C8KA 5IG7A 1NCBH 4MNHA 5FDYA 3VJ6A 3FTGB 5D7LA 1WTGT 1ZVSA 5DJ0A 5F6IB 4XPTL 1EJOL 1DP0A 2C3XA 1RULL 1NGQL 5FM8A 1ITBB 1G7PB 3HUJB 3KNBB 2YPKA 3KR3H 5IHBA 3HCVA 4UDTB 4YWGH 4CL7A 3QUXC 1T83C 3I84A 5LBSL 3QIBA 5D9SA 3RY4A 4Z8FH 4Y4KB 4M62H 4U1GC 2FGZA 2CDGA 1C7SA 1NAKL 1C5DA 1DSFH 5FF6A 3IFLL 5IMMB 4YR6A 3QEQD 3RGHA 4HULB 1KFAH 4XMPL 3PL6C 2VL5A 2Z91A 5C0BD 4P9HC 2BC4A 1RU9H 4PY8I 1GZPB 1DEEB 3PV6A 3T0EE 3JWOL 5KAQG 5FKAA 1QRNE 4LLVA 1AGDB 1FG2A 4ZUWB 5GGRA 4XCNB 3DO7A 1EJ6A 2RFXA 1S7RA 4FQJL 2A6JA 3ARSA 3RWIA 4G3YH 3TO2B 3QXAB 5DK2A 1R3KA 1U8KB 3DX9B 3VMPA 1MHPH 2VN4A 1RIUH 3HNTH 4PJ5B 2DBJA 3EJYC 3RZCB 4MZ3A 4LCYA 4NO2B 2GK0B 4L3CA 1F4AA 1H3XA 3HE7B 4L1DA 2YHGA 4JM2A 2B39A 2FR4B 1FAKT 4KRMB 3N0PB 4DEPC 4R4NC 4LKCA 3V5HA 4DKFH 1LO5B 3HZVA 3BXNA 3BO8B 4R90H 4JFYB 5JO5B 1JZ6A 1I7TA 5HI4D 1RZ8B 4GLRH 2X4UA 1IC5H 2G75B 5DMJB 1HHKB 3I3BA 2DICA 4JRYD 2IBGA 3GSWB 2VDLL 3MLWL 5D6DC 5SX4I 3LDBC 2Q86B 4MDJA 5E9DB 4Y19B 4R7NA 4PV8A 3CU1A 1FV1A 3QDMB 3MOAH 5T3XH 4YHOH 3MA7A 2JK5B 1GSMA 2BVPB 4A6YA 1Z2KA 1WEJH 2W9DL 4HJGA 2AKRA 1BD2B 5HY9A 4O2CA 3PWPE 5FYKL 2AJ3B 1IGMH 1RFDL 2X4PA 5E2UL 1YNTB 5ERWA 5AYQA 4FOMA 3TCLB 3R4DA 5CILL 5D70H 2Q76B 2EIBA 1WVZA 1CGYA 3NIGF 2AJVH 1FC2D 3DSNA 4Z95H 2DI9A 4U0QB 3QXUA 3M8OH 2VXSL 5JORB 1ZEAL 2GCYB 2ZNWA 3ARED 4TRPL 2C9AA 2NTFB 3FFDA 3BD3A 3T04D 2O5XL 1W0WB 3LVEA 4H25B 4M7ZB 1A6PA 4GKZA 3E3QE 1TVHB 2VLRA 1WZ1H 1Y6KR 3S5LA 3GBLA 3DBXB 1BZ7B 3UZQA 5FGSA 4KV5F 4LLYA 4YDVA 1EX0A 3FOMA 2DYPB 4X98B 4MS8D 5EORH 4X6BA 2PR4L 4RMUA 4H1LA 2VXVH 2L7UA 3BQUC 1I85C 4X5WB 1BAFL 3HZKB 1G9EA 2G2RA 3KLDA 5CP7B 5JW4N 3LRSA 1D6VH 4PP1C 3D9AH 4NRYB 3UYRL 4WFGE 5ETUA 3EJYD 2OM5A 4R97C 1E6JL 3NCFB 1I7RB 2XA8H 4MAYC 1JP5A 3G08A 4N9OB 4RDQG 2CQVA 4PJIA 5ICYB 4JREB 5J6HA 5EU7E 5KS9B 2JJSA 2UZIL 2XZQH 4RWHA 1MI5D 1FO0A 1RUAL 4CMHC 2EYTB 2ADFH 5B22A 1F11B 3RI5K 1EHXA 5E4EC 1AD0A 5TE6L 1FSKC 4MJID 1MFAH 3TLRA 4KRLB 4JO2H 3ZKXC 1IEAB 4F9PA 1A1NA 1DQDL 3T0EB 3MBEB 1HI6B 4PRNB 4LEXL 4RFEA 1G9MC 3GUTB 3EO0B 1U8QA 4G9DA 1DLFL 4WHYG 4BFIB 5C0NC 4YHLH 1PEZA 1MRFL 4O5LH 3FFCD 1R0AH 1I9IL 1VKXB 3QHTC 3K7UA 4YBQD 1TPXC 4DN4L 2W0FA 3W0WE 2A38A 3L95B 4ZFGH 1XF3B 3UPRA 5HHOD 2FIRT 4B50A 3GJEB 1DL7L 4PD4J 4XVUC 2GI7A 1ERNA 3WKML 4NQCD 3AAZA 3E8UL 3DSFL 4UDUA 4KQ4H 3J7HA 2R56H 5E00B 4KUZH 5DD0H 1HOCB 1SBSH 5IHUH 3VXUD 3K8MA 4KC3B 3GRWH 3IRZA 4LLMA 3BKJH 3D0LA 3BDYH 3QI9B 1S3KL 1LE9A 4OZFH 2VWEC 2FATL 5EO0B 1Z9LA 4CU8A 5CZKA 2VLMD 3CFJB 3BH8B 4ZO9A 1I9RH 3S37X 3SJVE 1N3NB 2E7CA 3QXDB 4MNGB 4LF3A 4YX2H 4UNUA 4IRJD 4NC1C 4JM2C 1Q0YL 1BWMA 1YEIH 3GSVB 4NJ9L 1B90A 2H32A 5HVFB 3BQUD 5CAYB 3HI6H 3HNVH 1NSNL 1A7RH 1J9CT 2A83A 3Q3GB 3BIBX 4JFHE 4QHNB 2X4TA 3OR7B 2PYEA 3GB7B 2VL4A 3C60C 4UT9H 3MMEA 3PWPB 4RSVA 3AS0A 1AI1H 5GJSH 4NBZB 4PJEA 1FGVL 2UZXB 1FGNH 3L7FB 4MSWB 3R06A 4MQTB 5HI3D 4XCCH 2KQMA 2VABB 4KMQA 4FFWC 4WUUE 3BP6B 4HFWB 3SDCC 2X9XA 1XGQB 3MRCA 5D1ZD 4ONFH 4NC0B 5DLML 1MWAH 3VFWA 2FJGB 4NZTL 4BA8A 1VADB 3MV8E 1DBKH 5KAQF 3ARVA 4KVCH 1DUYA 2VC2L 4G8FA 4CVUA 1NGWB 2FL5A 3O6FA 1BGXH 1OAYH 5INCA 4GXUM 4F7PA 3PDOA 5D7JA 1HINH 1S9WA 4MCZA 3MFGB 2PXYA 4DVBA 1BLNA 4L5FL 3QEGL 3SHSA 3QQ9C 4U49A 4JPVH 4ZNCD 2A2QT 4N0RA 1UC6A 3X14B 2EH8H 4RFNB 2FO4A 3BP4A 2XN9D 5C0ND 4ZUTB 4G43B 1XF4B 1CL7L 4Y4FA 3OZ9L 4MYWB 5D7KD 1YEJH 3BZFA 1A6VL 4YZFE 1T22B 1X44A 3L7EA 5DUBB 5F7KC 1DQTA 1AQKH 4IRSC 4XVUD 5BVPH 1KJ3L 3VI3E 4UI2A 4XB7A 5E1AA 4R96A 5T3XE 2I07A 2OSLA 5HDBE 1QPXA 3M1BA 4FFZL 2DTMH 1ZTXL 1NQBA 4FQ2L 5C0RH 3ULVF 1G6VK 3T1FA 3SDAA 4XNQA 1D5ZA 4YDJA 5FHAH 3O8XD 3DUSA 3MRLA 1K8DB 3BPCA 3FT4B 1J7VR 1EIBA 5JQ6H 3FKUS 3GNMH 3E6FA 4JHWH 1Q9OB 1S9VA 3GMLA 3FQTB 6FABL 3LH2L 3NGBC 4QHLA 1AXIB 1MJ8H 5FA3A 5GHWH 3TC9A 3TT1L 5ESQA 3QUYB 1MAKA 3X3FL 3BPOB 1UCTA 3C60D 4J3UA 2JJSC 1IE5A 1J12A 4ZQKA 4AIZA 4RZCB 5SWSD 3W0WB 2APXA 3W5NA 1CXIA 4M93C 2LTQC 4D3CL 2E7LA 3MV9E 1RIVH 3PWLB 4S1RH 1EK3A 3SDCD 5DJYB 1QNZL 3BWAA 2H6PB 3X11B 3RVWC 1MAMH 1CGXA 4HIJB 1BQHG 4I3RL 5D7SL 4J3SA 1ZANH 5ADOH 4LSQH 4LPYA 1YEKL 4HHAA 1S8DB 3S4SA 1INEL 4FQCH 2ZSWB 3CD4A 3MOQA 4JFZH 5I1KL 4HC1H 1X6LA 3FRPA 4LRNL 5DQDH 4Y89A 5SWZA 4GG6E 3DX8A 5CSGA 3OGOE 3RU8H 3E0GA 2BMKB 5TH2B 5D96C 1AY1H 4K7PY 2D31B 3K2UH 4KROB 1NCAH 4PBVC 4UTBL 1OHQA 3Q1SL 4RDQF 4OFKA 4WEUD 4D9QE 2WBJB 3IDUA 4IRSD 2FHFA 5DJDA 5EFIA 2IANA 5ITFB 5DHXB 5AAWA 4G8GD 4NWTL 3KYMA 3MRHB 5LWYL 4PJXF 3HG1E 4WUUB 1UKSA 2R4RH 1GL4B 3WO4B 1JN6A 4WI9A 1BEYH 4P3DA 4KDVA 4XBGA 1I8LA 3QIUA 3TM6A 4WFHE 1KPRB 4WU7B 3CC5B 2IQAA 4YLQT 5IF0B 3BRFA 4GRLA 4WHCA 3NA9H 2B1AH 2DIBA 1FNGA 5J6GA 1EHNA 1F4XH 3I50H 4NP4L 4HUVA 2XTJC 5C0AB 3TN0B 5TGBB 4JHAL 1EFXA 3QG6A 3F5WA 4NNYA 3RTQA 3U0WL 5I66A 3G6AA 2BOBB 2OR8A 5A16B 1NBYB 2W65A 4GBXB 2V2XB 3X13A 5J1TC 1KG0B 1B0RB 3LB6C 4ZUUB 4WRLA 4Z78B 3U2SB 1U3HA 4JB9H 3GBNL 4UU9B 4K8RL 3CMOH 2F9BT 3O6FC 5JW4Q 2NLJA 1I3VA 5CBAA 5JIIA 1MQ8A 3DTXA 1CU4H 5FO7A 2BVYA 2PXYC 2ATPB 3WUWG 1JV5A 1ORSA 1KXTB 5HGAA 3G04B 1C7TA 2Z93A 2ZUYA 3O6LL 5F7MC 3RI5F 3IF1A 2WWKO 1S7UB 1LE5B 2YEZB 3OKLB 1FFRA 4LOUD 3B9EA 3HFML 3KPMA 4PV9A 4K7FA 1RAMA 2IBZY 1XH3B 4H5SA 2C7UB 4N0UE 5DZNA 4WWKC 3RWGB 3V9FA 3ZL4H 1WIPA 4PJFA 1U9KA 3TYGH 2OJZH 4TNWK 5F7WC 5I74B 5DEFB 3O6KH 2Y7QA 5T1MA 4LMQI 3VXTA 4WENB 4PJGE 4M7LL 4JFDE 4U31A 3GO1H 1TCRB 3PE9A 4GG8B 4PY8J 4UV7H 3U79A 5I1IL 1FZJB 3MSPA 4JQIL 4YXHH 3DETD 3SDAC 4U7SA 4IHOA 5I1EH 1J0KA 1FN4B 3GBML 3L3IA 2COQA 1S7QA 1VGKA 4YQXH 2WUBH 5AWNH 3MV9B 2PTVA 1MFBL 1Q0XL 1IEHA 3C2AH 3KXFA 2CLRA 1MNUL 1OGTB 3BPLB 3OKNB 1G6RL 2VSCA 2PNDA 3HE6B 4Q6IB 3E1F1 4YO0B 1QKZH 4ODWA 4R4BA 3LD8C 2D9QB 1Q1JL 2Z35B 1QEWB 2V17L 5D7IF 4PRDB 5C6TL 3BHBA 4G8EB 4F7TA 5KVGL 4MA8H 1A6WL 1ZLWK 4U6VH 4OZGE 2WIIB 3MCLH 1T5XA 2CR3A 2ICEA 2E7LC 5ITBH 4NQSB 4X6DE 1U8HA 2X89A 2VE6A 2ZKHH 4PBXA 4QO1A 4GG6B 1N7ML 2W38A 1HHGA 2FSEA 2BJMH 2XNAA 1IAOA 4NRXA 3DYPA 3VXME 2AXJA 1DQQA 3FO1A 4O2FA 3QHFH 1WV7T 3SDXA 4GAGH 2O93L 1BZ9B 3ARGA 4IJ3B 2FD6H 3QQ3B 4WO4B 3CDYA 4NN7B 2VLJA 4ALAH 3HC3H 1I3UA 1QSFA 4BQ6A 3S37L 3KGRA 4W4OA 5FM5M 3C5SA 2EH7H 4JLRB 2WZPD 4KKAC 5L2JA 2WP3T 1H15A 2QQKL 3HG1B 3JBG7 4V1DA 3S35L 1V8HA 1U91A 1CZ8L 1RZJL 3BGMA 1PY9A 4KHTH 3P77B 1XR8B 4WWKD 4OF3A 3CFCH 4D9LH 1NDMB 4HUUA 1L7IH 1SQ2N 1TNNA 3RJQB 3D69B 2DQGL 1HH6B 1I7ZA 2H2PC 5IEHA 5J89A 4IEFB 3QAZC 5MEPB 4HUXB 1I4FB 3S34L 4XP5L 5L7XL 3OXRA 4ETQA 2CIIA 3EUUA 1I8LC 3QIUC 1K4DA 3WHXB 1HIML 1CDUA 4KVNH 3GK8H 2IQ9H 4HV8A 4OZFB 4GRLC 4P46D 4UBDC 4XNMB 5DJ2A 2FEDC 1EVTC 4B0MM 1NAML 3BH9A 1OGAE 2QTEA 5GGVL 4HQQH 5L9DL 5FYKD 4Z7UE 3RTQC 5FO9A 2P8LA 4JPIB 4HWEL 4Z7WA 3T3MF 3FB5A 4QRSA 3IRPX 5CJ8A 5EC1B 5E4IA 2AV7B 2QHLA 5JHDA 4WW2B 2NW3B 4IS6A 5ACLA 3MRIB 1Q9KA 2UZYB 2FX7L 1YECL 2HJKB 1PYWA 4N0UB 5DO2C 3NZ8A 2AK4A 2P8MA 4LLWA 1FRGL 3K74B 3MJ7B 4XH2A 1IARB 3T4AA 1IZKA 1CFTA 3HPJB 1MWAB 4PJGB 4QRPE 5DJCB 4JFDB 4LNRA 1W72L 2JJTA 2H8PB 4YK4B 3FT3A 2ZCKL 4HW6A 3MJ8A 5KVEH 3HI5H 1FIGH 2WMPA 3B5TA 2CJUL 4S2SA 3CDGA 5GRUL 4CUCA 2MFNA 1ETZA 1YUHB 1WWCA 2HFFB 3LS4L 2EO9A 4EI6B 3CX2A 4EI5D 4M7JL 3DVFA 2FBJL 1J1OH 4KJQC 3DVNA 4PRPA 1A14H 3DIFA 5C08E 4QTHA 1X4YA 5IR1B 1JNNL 4PYHA 1DANT 1ZSDA 1BJ1J 2LQRA 4RMTA 2GIYA 4NWUL 5DJ6B 2OZ4A 1WBZA 1KACB 5DJZB 3TFKC 4OZGB 5DMKB 5AAMA 2V7NA 1IAIL 3DX7B 4DTGH 4X0KA 4OTXH 5LGJB 3DGGA 1NMAH 3IDNA 4DWHA 4X6DB 5D1XB 2QHRH 4Y1AE 2UY7A 3I9GL 5CP3H 4F7CB 4G6FD 4OAWA 4CN1A 1YEEH 3NBNA 3VXMB 4LP5A 3IKCA 2DLFL 1IBGH 3H42H 5IKCA 3O0RL 4NDMA 1YQVH 3T2OA 4GMTH 3S3PA 2FH8A 4YUEH 3S3JA 1ND0B 5DQ9B 4LVNC 1UXWB 5IB3B 4M1DL 2XWBA 4I2XA 1G0YR 3NPSC 4LASH 3IETB 5IP4A 1X5FA 5CWSB 2DQTL 2H1PL 4OLWL 2DL2A 1MRDH 1ONQA 1QFOA 2EICA 1CICB 3WD5H 3MRKA 3KYNB 3MACH 2AEPL 3SKNB 1HQ4A 1S7SB 4MJ6A 2XWJA 3ARGC 3LKOB 3RVVD 1OLLA 2XPGA 5DO2D 4LRIA 2J6EL 2ZJSH 1F00I 1QSZA 4HPOH 3T65A 2EZ0D 1T3FB 2MKLC 1CWVA 3H9YA 3KDMB 1IEBA 5MENE 3EOTH 3QDHA 5ADPL 3HMWH 5TE7L 2HVKB 3CCHA 3ULVH 4TYUA 4FQQA 2DQIL 4KJYA 4TSAL 3ZYIA 1IM9A 1JHLL 2YWYA 4Z7VF 1A3QA 1OF2B 2IFFH 1QQDA 1YEFH 3QNZB 4Y2DB 4Y7MA 4OLXH 3NIGE 3BT2H 1VFBB 1UG9A 3HR6A 5IROA 5J0BA 1MCHA 2FB4H 4JR9L 4LKXA 5F8RC 5DRWA 1KULA 2YPVH 2Q8BL 4Z7UB 3ULUF 1LK3H 2J8UF 4X7DC 2E7MA 4TNWF 1BVLA 3S6CA 4DFIA 3UO1L 5C8JB 3FB8A 1AE6H 2EE6A 4HFUH 5CIPA 3AMLA 3O11B 2ZZUT 1RZ7L 3U30B 4EN3A 2XKUA 2BSTA 2AGJL 4HZAA 4QRRD 3TFKD 1E28B 2PW1B 1JHTA 4KV5E 5I30H 4NO0A 1OAKH 1JHKH 5E5MB 4AEIL 4K94L 3QWOB 4S1SL 1EPFA 1KBGH 4GW1B 2EDJA 3P2TA 2EE9A 2QKIB 1IGCH 4UINL 2GJZA 1CDYA 4HGKC 5C70A 4QRPB 1KNOA 3DUHA 1G9NL 5AD0A 3HC4H 4GRMB 3IVKA 4LSDA 3ILQC 1U6AH 5E8PB 5ECJE 1NMCC 4I77L 5I8OL 4PLKD 4E41A 1RY7B 2NW2B 1INDL 2ARJQ 1JWUB 1BQLL 3FL7A 1JPGA 2V5MA 1GGIH 3EFFA 1A1MA 3DMMD 1KJ2A 4OGZA 4I0PB 2HH0H 3FT2A 2BDNL 2EDHA 4QY8A 3B8YA 3GSNH 1SEQL 4TVPH 5D2NA 2R0KH 1JZ4A 1T0NB 2FZ3A 5FHBH 3FZUD 5C08B 1MVUB 2E3VA 3NFSL 4YXLH 5CFHA 1OTTD 4G5ZL 4MD5A 4XPGH 1FJ1B 3PGDB 4TSCH 2W9EL 1JPFB 1BVKB 4ZPTA 4M7KL 2V5TA 2Y07L 2XACC 2NY4C 4OLEA 4Y1AB 5F7NC 3PGFH 4PGZA 5JXAL 1NAMA 3H3PH 5IB1B 5EU5B 1CDJA 3OB0K 3QNYB 5HHVL 2P4AB 3DYOA 3PV7A 3BKML 1FVEA 3OAUH 2DWDB 1Z0MA 3F7RA 1YJDH 3QA3B 5DA0B 2FLRT 2NY5H 1TETL 3D18B 2BVQB 3N9GL 4ZSOA 2HG5B 1O0VA 1I1YA 3WFZA 5IW1A 3GSOA 4KPHL 4C56A 3NCJH 3V0VB 2J88H 2ITDB 1H8NA 3I6GB 3LQZB 3RUGF 3CUPB 4M1CC 5HGDA 1CTNA 3MRQB 5J4MA 2WV3A 3U46B 3HTLX 1KPUA 1F6LL 4MCYA 2NY2B 1WCQA 4EXPX 4UQ2B 4TUKL 1NCUA 1WFOA 2FX8H 4AK1A 1NC2B 5E2WL 5SX4H 4DGVH 3IGAA 3RNQA 4L3EA 5BRZE 3SO3B 5MP6H 1AXSA 1IC4H 1HK6A 5MENB 1YA5A 4Y5VA 4IBLT 1G7MA 4XMLH 3VXSA 3T2QA 1E27A 3ZDXF 4UOW0 1JPTH 3LEXB 4LSTL 3IDXH 4G80A 2NR6C 3W11C 3JWDL 5IMLB 4U2YA 3EAKA 2XA3A 3LKRA 1FL6B 4BH8A 1PEWA 4FQXA 3O2WH 3QUMH 4GXUN 3ZE0F 4ZOBA 3F58L 5E70A 3SGDI 2R39A 2OTUB 1GIGH 2IWGA 4ZODA 5E2VH 4AENB 5E95B 4BSJA 4O2EA 4X6FA 1J8HE 2H3NB 3ECBB 3LN4B 3ROLA 2DS4A 3QO1A 5GGQL 4UUJA 1UZ6F 3HNSL 3LHPH 3QFJD 4Y8AA 1VFMA 4FABH 2AABH 5JPMB 2EE2A 3F12A 3MTRA 2BHZA 2ZPKH 1GZQB 3U1SH 3QZWA 5IHZA 1FCCA 5E1HB 4Z7QF 2YBRA 5ILTH 1PG7X 5C09E 1I1AC 5IROC 3DRTB 3FQRB 4EUPA 1NCNA 2NY4D 4YC2C 3VWJB 4LU5L 4N5EC 5DZLA 4WV1B 2OR9L 1T5WA 3KJ4C 2NYYD 2LAAA 5FYKU 1FFNB 4ZO8A 1IGIH 5DF0A 5F97E 2I60H 2O5ZH 3JV0A 1IGJB 1QSEE 4UT6L 3PJSA 5EC2B 5FCUL 1JK8A 4EN3C 4OV6F 4YDKH 4JZJB 2FHBA 3O4LE 4XMKH 4WCYH 1FYTE 1Z9SA 4NZRL 5IMKA 3U7WL 4F33B 2HTKC 1S9XA 1DUZA 4K8RD 4L4TA 4OM1H 5DD1H 5HGGS 3L5HA 5IHLB 3ULVE 2K7PA 1K4CA 3SE8H 1M4KA 4M1CD 1MH5A 1D9KA 1H5BA 3KPSA 4BJLA 3TJEL 4LHQB 3O6MH 5A2FA 1Z6JT 2DQEL 1IAII 4GMSL 1T7XA 4M6NH 5I19L 1EO8L 3DHMA 3RAJH 4HWZB 5EH1A 1MI5E 2VXUL 2X05A 4LPVA 3UC0L 2DQDH 4ZPVB 2VAAA 3W9EA 3OBAA 5GGSY 3FQWB 5DRXA 2BNRA 3B3IB 5FB8B 3GJFK 3QFDA 3KHOA 3UTSA 4UTAL 4KTDH 2VLKA 4XBEH 5D2NC 4N8VA 4OD3H 2NR6D 4MWFA 4KH2A 1NGZB 4HS6A 1ZK9A 1BMGA 3DRQB 3G5YB 4M8QA 3GSQA 1PJ9A 3MXWH 5J3HC 1IJ9A 4ZXBB 4DFHA 3MUGB 3SKOA 3FO9B 4NN6B 1A64A 3C87A 4KKLC 1ROWA 3V4UH 2ZUQC 5L2KD 3S88L 4YHZL 5E2TL 2I5YH 1J0IA 1OL0A 2HKHH 2YN3A 1RK0A 4QCIB 1BJ1H 1CGVA 2VO5A 5DGRA 2O5YL 4L3AA 5DURD 4XCYA 4LLQA 1TVDA 1U8IA 2Q8AL 5MEOA 3CX5K 3LRHA 4MNQA 2B4CH 1CDGA 3MYJB 1I1AD 1V3JA 2Q7YB 5ISZD 4MLSA 1I9JH 2F8VA 3GIVB 4X99A 3C9NB 3L5JA 4LGPB 5T5NG 5DS8A 4HS3B 4H20H 2F53E 4TVPE 5BRZB 1U58A 1OSPL 4J4PA 2DJUA 2A1WH 5JOPE 5ALCH 1R5VB 1YY9C 4HKBB 2P5EA 4EN3D 1MPAL 1U0QA 5H2BB 3BKYL 5I76B 5E08H 2VDRL 5DMGC 5T1KA 3D85A 3MJ9H 4PJXE 1C5BL 4I9WD 3LS5L 4PP2B 12E8H 1WC7A 1VFAA 1ACYL 4DKDC 2EDKA 3AGVA 1J8HB 4LIQH 3EYVB 4Y5VC 2XI9A 2N1KA 2MOVA 1X5AA 2CKNA 3O41B 1U8OB 2HT2C 4L8BA 2JKXA 4Y88A 5BV7H 3AREB 3AS3A 3VDAA 2QADD 4JN2A 2P5WE 3JWNC 1TJGL 2QQQA 1T04A 4FQXC 4J8RA 1DVFA 5GZOC 3EKCA 1J5OH 3U4BL 2AJUH 5C09B 5IQ9A 4IIQC 4ZD3L 4DN3H 3GI8L 5B38G 3H9SE 4A2LA 4NNPL 3VA2C 1UM5L 1RK1A 4L8SB 3D39A 3MRMA 5DMIH 4JZOA 1MJJB 1RULH 4MXVF 4OM0L 4U1HB 4YHYC 5DT1L 2VMFA 3UTQB 3QULB 1CFNB 2YC1A 1QSEB 4I8DA 2NY3D 5LBSH 1QA9A 5HHME 1FORL 4W70A 2MKWA 5I6XB 1LO4L 3O4LB 1FYTB 2ZG1A 2ICWA 3ROOA 1NAKH 1KCVH 2PTTA 1Q94B 1G7JB 3DX6B 3MREA 1SY6A 4H26A 3IU4L 2GSIB 4E5XA 3LPGA 3P4MA 2G60L 4TULL 1ES0A 4P23D 5E94A 2GTZA 3GDBA 1HSAB 3U36A 3VDBA 2A6IA 5EPMB 3ZTJG 3NCYS 5I16B 1FVCA 2UWEA 1HYSC 2VXQH 1OSZB 4GAYB 1XGTA 1MFDH 3FO2A 4HD9A 1MI5B 4Y16A 4JG0H 1KTLA 4XZUA 4XAWL 4HIIB 5I1LA 2HA1A 1NDGA 4NUGL 5K9QI 5DFVD 1DFBL 4E42B 4PB9H 5GS0L 3LN5A 3TYFB 1KJMA 3D87B 1JPST 5AUMB 1LP9F 1Z3GL 4BKLB 2BSSB 5E99H 3DV4B 4P9ML 1JYNA 4JEGB 2YUVA 2VH5L 3RWEA 2L4OA 4NYLA 2R2HB 3C6LA 4LCUB 4X4YA 1DN0A 1C12A 2JB5L 4HX1B 1EAJA 5DEGA 1OTSD 3FCTB 4NCDA 1ZLUK 1TQBB 3PGCA 5D7IE 3Q5TA 3IXTA 3V6OA 3V79C 1WBXB 3RVTD 3MLWH 1GGTA 2IAMB 2R1YB 2MCG1 5GZOD 5I1AA 3FTGA 3TO4B 2PKDA 1NFKA 2B5IB 4C55A 1KCKA 2AV1B 2DRUA 3ULUH 4ELMA 5F7DA 1NH6A 4PJ9A 5DR5L 2E8ZA 3PABA 2F15A 4JANB 2XZAH 4HWBL 1G7PA 3HUJA 4PR5B 4X9IA 3RY6A 5FYKH 2CO6B 3GSNB 2F53B 5BO1H 5E0QA 4J1UB 2C4FU 1CBVH 2EC8A 2QQNL 4ZTOL 4OZIF 4XNXH 4AY0A 4Y4KA 3L3GB 1UEMA 5ESVB 3RHWK 4HIHA 4D8PA 3U6RB 1GOGA 2B7DT 2YSSB 3VMNA 4FA8A 1G9NC 3OF6A 4JFQB 4PJXB 3VGDA 3WCYA 4TRPH 1AKJA 3GMMB 3PHQA 2D4DA 4X7TA 1WAAE 4PPTA 2CXGA 4HKXA 4JPKH 2A6KB 4UIKH 1UCBL 4JFPB 2CH8A 3OR6B 1KCRH 1LEKB 2Q20A 4XVTL 1PW3A 5IOPB 2DD8L 4PG9B 1FL5B 1OB1A 2P5WB 4LCWD 4JN1H 4ZUWA 3KPPA 2ADGB 2IH1B 4GQ9L 3TGXA 1ZLWH 4G8IB 1U8MA 4KMLB 4I4WB 3NACH 2X4SA 4Q2ZB 2OCFD 1U8KA 5EN2B 3H9SB 5ENWB 3DUUA 4R26L 3WL9A 4N0YL 4BFGA 3RZCA 1QLEL 1MSPA 4JO4H 4S1DD 3VXRE 3HMXA 4KUCD 2GUOA 1B4JH 2XN9B 3B8SA 3Q6FA 4F7EB 5AZ2H 2PYFA 5I17B 1HDMB 1E6JH 4JO1L 4W68A 1MCIA 3BO8A 4MA7H 4NJAL 5LXGL 2R1XA 3P4NB 3T3ME 1F4WL 2VDOL 4CMMB 4U3CA 3QDGE 15C8L 2G75A 5DI8B 1BFOB 2XQBH 1TZGH 3V95A 4ZFFB 2GHWB 4RGMB 4NQXB 3GSWA 3TJHC 5L88L 3QHZH 4ONOA 4JVUA 5E9DA 3TBSB 5DVNA 4M1GL 2G9HA 4OFDA 4FG6D 4ODVL 2LVEA 2BVPA 3SPVA 5IMOB 3TIEA 5KJRH 3QUMB 4XCEA 1VFOA 3EOBA 3QXWA 3O8XB 3TPUA 4ONHA 1JFQL 3OKEB 1IC1A 2AJSH 3IDYC 1XGUA 1MRFH 2KZ1B 3IJYB 4WNQB 5K9QG 1J1XL 4LIQE 2M8XA 1EHLH 2Q76A 4CW1B 3VFUB 5CINH 4Z0BL 1VDGA 2V2WA 4H1LG 1DQJB 1BIIB 3UDWC 3P40A 3N85L 1TZHA 1HE7A 3V52H 1AGBB 4RISH 1T2QH 2GCYA 5FOJA 1TIUA 4KJWC 4X9FA 1PFCA 2HRLA 1YN6B 4OZHF 4XCFH 4QT5A 1LILA 1FBIL 4QXUL 2FH6A 2D0HA 3JWDC 2P44B 4H25A 1F8TL 1VENA 1WBYB 2AXFB 1NCBL 1TVHA 2HLAB 1WCBB 4S0SD 2JJUA 3BDXA 5C0CA 5D7IB 1SMOA 3RVUD 4P5TA 4OFPA 2A74B 4DCQA 4U7KA 4GH7B 3VGHA 4X98A 5JPNB 5J7CC 3KR3L 4OQTH 3WNLA 1WZLA 4X5WA 5EZOH 4NKMB 3C6LC 3I2CH 5CP7A 2HJLA 2LABA 4Z8FL 4M62L 1NSNH 4P4KD 1DSFL 5J12B 4TOYH 4KK8D 3KPQB 3V6OC 3JV6B 3KPRE 3BP7A 1E0OB 1FGVH 1KFAL 5IT2H 4Z5RA 2ICCA 4JE4B 1KLUB 5CJQL 1A5FH 5C0JB 5ACZB 3UAJD 4OF6A 1XGRB 4JJHA 3G5VB 5KS9A 1HEZB 1VACA 3M45A 3P3YA 3TH3T 2JIXD 1BVZA 4PJ9C 2EYTA 4OIAA 2NY7L 3TJHD 3W9DB 3RY6C 4Q6YA 1M6OB 1AIFA 4JFFD 4G3YL 3N50A 5JW5B 1DDHA 4OBSA 4Y4KC 5MEQB 1VA9A 2YD9A 4HIEA 5CBEA 2KKQA 4F80A 3MBEA 1RIUL 1WZKA 3QEGH 4I1NB 4U1KB 4BFIA 2VDQH 1SYVB 4S1QH 1XIWA 2GQHA 4ZYKB 5ICZA 3BZEA 1G1YA 3VXPA 4Z7VE 3GJEA 3RWFB 4DKFL 2BSRA 2WANA 4R90L 4UB0H 1D5BA 1YMHB 1N8ZB 4OFYD 1EGJA 5EO1B 1CYGA 3I85A 1SJEA 4YPGB 3VXRB 1P1ZB 1IC5L 1KJ3H 3EDDA 3MLVH 1LD9B 4I5BA 5E00A 1QRKA 4KJWD 5BZDB 1X4ZA 4PLJD 5JTWA 4X4XA 4OB5H 1NJ9B 2IEPA 2VN7A 4PJBA 3ULUE 1YDPB 2P7TA 2J8UE 3QI9A 4LGSB 5T3XL 3MOAL 4OCLC 3O81A 1R3IH 4YHOL 5B3JF 3QDGB 4CVXB 1RUQH 4WHTB 3UPAA 1WEJL 3RZCC 1CF8H 4MNGA 2IMMA 3VH8A 1FFQA 1MCOH 3HE7C 1RZKC 2AJZA 3RGVD 2YUXA 3WEXA 4LSRL 4HWBA 4Y8DC 1T20A 1OLZA 4YBHA 2YZ1A 3NFPB 2ZSVA 3RKDC 2BNUB 4FZ8H 2AJVL 3OR7A 5GRVL 3WJJA 3GB7A 1VFUA 4H88H 4Z95L 3L3OB 1UH3A 3M8OL 1R5IB 4P2RD 2X4NB 5DUML 5H35B 4HK0B 1KGCD 3MA9H 5BS0A 3LPWA 1G7LA 5DRZB 2VABA 3TH2T 4JM2F 1XGQA 5BV7B 2E8YA 5IBUB 3S96B 4Q7DA 2RGSA 1QFUH 4HMEA 3BEVB 3GMPA 1F3RB 5I8EA 4DUXA 1EMTL 2FJGA 4TVSa 4AL8H 1WZ1L 3MUHL 1K8IA 1QBMH 3SBWC 3LKSB 1PZ5B 2EDRA 4D0DA 4KZEH 1NGWA 2OQJB 3JZ7A 5EORL 4HLZG 4XC1H 1OT2A 3MRDA 1CXEA 5HYQB 3EOAB 1KOAA 2X4OA 1X4XA 5HJ3A 1MCBA 1Y0LA 1D6VL 2MHAB 3WSQH 5B4MC 4LRNH 3D9AL 3X14A 5FUZH 1OAQH 5KSUA 3MCG1 2FNBA 1U8LB 2FBOJ 1JWSB 4ZUSA 4TN9A 2QL1A 5F9AC 3T4YA 1VSCA 2GTWB 3RL2B 5C9JB 2X7LB 1A7QH 3FB6B 2D0FA 4LP4A 3IFOB 1NMBH 2XA8L 3RHWF 2AJXH 2EEDA 2EC9U 4M7ZC 4P2OA 3VXQB 5JOFB 5FYLE 4O51B 4PGEA 4U1MB 3JSSA 4F3FB 3MRNB 5DUPH 4JRWA 4RAVA 2DQUH 1I3RB 2XZQL 3KPRB 4HKJB 3H0TA 3NIDF 4Q97A 2I27N 1KIQB 2ADFL 3WLBB 5HD8C 3R1GL 5ANMA 3IDMB 2YXMA 3MNZA 3UPCA 2O61A 3MGTB 5EA0L 1GHFH 5CGYC 3QUZA 1A3RH 2FYYB 3RUGE 3BSZL 3L5WB 1NKRA 5DVKA 3FT4A 4PJ5D 3RZCD 4YHLL 2X1PA 1N4XH 3MLXH 1Q9OA 3VFTB 5I2IB 1R0AL 3NVQA 3FQTA 1UM4H 1X5KA 3HE7D 4Q74A 3KYAA 3VFRB 5I0DA 5JDSA 1DZBA 1NCCL 5HGHA 4ZFGL 4JKKA 3S4SG 1AD9B 1NBZB 1KXQE 1ODAA 3QUYA 1WJ3A 4J7RA 5F6HI 5FYJU 2YWZA 1I3GH 4JREC 3VCLB 4U3XA 4XT1C 4WUKH 3FRPG 5AEAA 2R56L 1INQB 1T80A 5FECA 1BOGA 4KUZL 1FZKB 5DD0L 1SBSL 2IPUK 3ZDXE 5GS1B 2EDLA 4Z7VB 1SJHB 4K8RH 3GRWL 5E9DD 3BKJL 4Y19D 3VWKA 4FTVA 3QDMD 4JFEE 4JVPA 5DJYA 1FVDB 1EEYB 1MLCB 1N59B 1LO3H 3HAEA 3ZE0E 5DD6B 4KAQH 3TBWB 3WIFA 1P7QA 3T0EC 4BELD 3MBEC 3OB0H 1JNJA 1EEZB 1I9RL 4PJIF 1T1XB 4I13B 5KSVA 5FK9A 1AFVH 3SCMD 1BD2D 3LRGA 2NY0C 3O9WA 4MDIA 5GS0C 3H8NA 4P46B 4YX2L 1UZ6E 2J8UB 4DZBB 4DZ8A 1YEIL 2ZOLB 5EO9B 1AGEA 1M71A 3HI6L 2BXZA 3STZA 3QPQC 1A7RL 2J5LC 3D3VE 4TUOB 5F9JB 4BSWA 4UT9L 4RCAA 4Z7QE 4RQQA 3NCCB 1CG9A 1AI1L 2C3VB 5GJSL 4XNYH 2BMKA 4C57C 4N5UA 1PAMA 1BOYA 4XCCL 2Z8WC 4OUUA 3QI9C 3QCUL 2DMBA 2WBJA 4L9DA 3ALXA 3OX8B 5D6CB 1DBKL 4YHIB 4NNXA 3WFHA 3MRHA 1V05A 4KVCL 3CFEA 1A8JH 2DYPD 4WUUA 5HD8D 1BGXL 1OAYL 5FGBC 1YY8B 1ORQB 1HINL 1T03H 4F57H 1MNUH 3MLSH 4CNIB 3EYSH 4JPVL 1EERB 3WJJC 4E0RA 3ABZA 3IJHA 1HILA 2EH8L 3NH7L 4GKNA 2B0SH 1Q1JH 1MFCH 5DDHA 3LPFA 5C0AA 3IDIB 3QCTH 5A2IH 4P2CG 5TGBA 3TT3H 1I1RA 2E6QA 1YEJL 4PRIA 3WN5A 2BOBA 3WHE1 4U33A 3REWB 1JGLH 1H0DA 4GBXA 1AQKL 3KHQA 5BVPL 1B0RA 4ZUUA 4HG4J 1BQHA 5D1QD 4Z78A 3OG6B 3U2SA 2DQCH 4QHMB 4UU9A 4YFDB 2DLEA 5EU3A 3C6SB 1N5AA 1P7KB 2DTML 2VQTA 3EIFA 4PJEF 3SY0A 3RX5A 2CRMA 3LEYH 4R2GD 1H3PH 5C0RL 3BGAA 3E3QC 4JKPH 3G04A 3OAYK 3PIQB 5FHAL 3T0ED 1KEGL 1F6FB 4RFNC 1QRND 5JQ6L 3GMOB 5EULV 3GNML 1QLFA 4JHWL 4L9LA 1UEYA 3EDKA 5TF0A 4P9HH 3WHE0 1MJ8L 3ORJA 2C7UA 3FRUA 5C07E 4P2OC 5GHWL 3LEVH 1TJHH 1RZJH 3RUGB 3BISA 4ZFZA 4FQPA 5E6ZA 5BMFL 4IMKA 5IM7A 5CHNB 5DD5H 3SQBA 3NTCH 3QIWD 3IS1X 3EZ8A 3VXOB 2DLIA 1LK2B 3DXAA 3MFFA 1HHJB 2DQGH 2WUCH 4PG2A 4B41A 5KOMC 5CGMA 1MQKL 4GG8A 3ZYJA 1RIVL 4S1RL 3QI9D 3ESVF 4GJTB 4NZJA 3S34H 5DC4B 4OSUH 3QUZC 1REIA 4OD2B 1MAML 1ZS8B 2X1WL 1OAXH 3S97C 1ZANL 1L4IA 3GJFH 4LSQL 5ADOL 4S11A 4M61A 4JFEB 1TNMA 2X10A 4JKWA 5C0IA 4TQEL 4FQCL 4MXWH 1OGTA 3OKNA 3O3DB 5GGVH 2RAMA 3HE6A 4M00A 3QUYC 4HC1L 3GSRB 4YO0A 5DQDL 1KT2B 4HWEH 5KSBF 1KTKE 3SOBH 3CVHA 1IAKB 3SGDH 3PWPD 3WXWH 2D3VA 4NQEA 1KC5H 3RU8L 3F7YB 3ILPA 2H26B 1PKQA 1SEBB 2LU3A 3K2UL 2FX7H 5HVHB 3D3VB 2MCPH 1HNGA 1XR9B 2F54A 5GJTH 3P4LA 1AJ7H 5IB2B 4G9FE 2HFGL 4NKQB 4QXTB 3C5ZB 1RMFH 5EZLA 4MQSB 4MMXC 3QH3B 2F8XC 2J8OA 1XCQB 4L1HA 1S9KC 3VFVB 1D5IH 1BZ9A 1A4JA 3JTTA 4FFVC 4J6RH 4LVHC 1QR1B 2EEAA 2R4RL 4WO4A 1KCLA 4MXVE 5IBLD 1BEYL 3L3JB 5DQJA 2BY0A 3MYZA 3P11H 4CJ0A 4JLRA 3RX8A 4N1EA 2OP4H 1K6QH 3HG1A 3MRFB 2B1AL 3NA9L 4K9EL 1M7IB 3I50L 5DZOA 1NGXB 3BRDA 4HWUA 3GKWH 1BQSA 5TDPA 3LKPB 2FBJH 2RQ8A 1CR9H 4BQ8A 4MHHG 5LVEA 3MLUH 3UBXA 1HXMB 6CGTA 2WBJC 1D6EB 4WFGD 5TF1H 4IRZH 1NDMA 3T0WA 3TZVD 1OW0A 3GHEH 1HH9B 1MF2H 4CDGC 5HHQB 3TA3A 3D69A 4JB9L 4AH2B 4QF1A 1HH6A 4C83A 4U1JB 4QWWD 3CMOL 2XV6B 1KIPB 4YDLB 5DHYB 4HUXA 1IAIH 3WO4C 5DFTA 4PGBA 5FYJH 5IVZA 1GGCH 2QSVA 2Q3ZA 4O9HH 1CU4L 1ZHBA 1ZVYA 4MXQD 3GRWA 1CK0H 3I6LE 3NFNB 2WBKA 2DLFH 4FZEH 5I9QB 3UZVB 1VEMA 3LZFH 4K71B 4XNMA 1KJVA 3CFKB 1LP9E 4YGAB 2XG5A 1IKNA 4PTUA 4JPIA 3WN5C 1N6QH 2C1PB 3ZL4L 4GBXC 3TYGL 2OJZL 2A9MH 2NW3A 3QCVL 5EIIA 2YD7A 4U6YB 3W0WD 1II4E 1T2XA 1TJIH 4OCMC 1KLFA 4ORGA 4K3DH 3EYOA 1EXUA 4YGVB 3GO1L 5C07B 1MFEH 3BN3B 1NC4B 5IW6B 4UV7L 1XCTB 1ZHLB 1JIBA 2R0LH 4MGXA 4YXHL 4XRCB 5I1EL 1A2YA 1I8KB 3HPJA 1MWAA 4H8WL 4QRUB 4Y5YB 2RCSL 4MJ5A 3UMTA 1RJYB 5ID1A 1VB9A 2CUMA 3C5JA 4M02A 3BVNA 4FFVD 4P2QE 5EU6E 3I3EA 4BUHA 3C2AL 1ZT1A 1ZLSL 3IFPB 2YA1A 2DL9A 4JKMA 1KTRL 5GRXG 3ARFA 4OZIE 1KLGB 3SJVD 1V5JA 1QKZL 3SE4A 5I74C 2YN5A 2KL6A 3FQXA 2HFTA 3GMQB 1N0LA 4QGYA 4MA8L 3K4ZA 4U6VL 4PRHE 1FNHA 1MJ7L 1PY4A 3MCLL 5HHXH 1I9EA 4KROD 1PVHA 5ITBL 5J57B 4PYGA 4JFHD 2F19L 3B9DA 2ZKHL 3OGCB 2J8HA 4D0CB 1MRCL 1CE1H 2JELH 1C1EL 2BJML 4PJFF 3GKZA 1LWRA 5E6IB 3QHFL 5LGJA 1ZLUH 4OV5A 4GAGL 4XB8A 4OI8A 4YHMH 2FD6L 2X41A 1F90H 3U0TB 4YJZL 2CUHA 3BPLC 1X9QA 4ALAL 3HC3L 3HE6C 4G9FB 4L4VA 4Q6IC 4HDIA 4N68A 3VXMA 5DWUH 3HZMB 2B2XH 3MV8D 2JCCE 2EH7L 1QR4A 1JI2A 3MOBH 8FABB 4RIRB 1HWGB 2JB6B 4CADA 1AR1C 1P53A 3TN0D 4C58B 1INDH 3F7QA 3FHAA 1BQLH 3NN8B 3PNWB 1UXSB 5C0EA 4A6YH 1D5XB 1F3JB 4B53A 3CFCL 3ARBD 4D9LL 2VDMH 4U7MA 1JPSL 1L7IL 3KYNA 3AU1A 3JV4B 1W0VA 2N4IA 1SEQH 1PD6A 4KK5D 4WI2A 4LHUA 2GJ6A 4ACPA 3WNMA 3FONB 2Z31B 4WO4C 3OPZL 1K3ZA 4OFIA 1KYOK 2X4RA 3QXVA 4KI5D 1P7HL 3IDGB 1T3FA 3Q48A 3V6BR 2WINA 4YHNB 5T3XD 3U9UA 4LCCB 4KVNL 3GK8L 2IQ9L 2XKNA 5DRNB 3ALPA 4CRPA 3B83A 5GS3A 2HVKA 3BEWB 3MUZ1 4U1IB 4RAHA 2PO6B 1I1FB 2Q6WA 3S3SA 4HQQL 3SDXF 5HGBA 3DROB 2GFBB 2GYSA 4POZC 1QO3A 1FH5L 4B7IA 1IGFH 5I8KH 5IEKB 2K1MA 4NQDA 1P4BH 1S7TA 3TV3H 1I7UB 2YD1A 1LP9B 3TA3C 5H37G 4U05A 1AO7E 1MIEL 5DJXB 4OZHE 1I8IB 1P2CA 3L5XH 3K1DA 5CSZB 5EUOA 3ZYZA 3ZMRA 3ARDA 1WWAX 5HHPB 3HN3A 3QO0A 3EYQD 3LQAL 1KPVB 5I1GH 1YMME 3MV9D 3WNPA 1B6DA 3QWOA 4WDIA 4C59B 1IKNC 3CSPA 2EIZB 4GW1A 1RUPH 4TUKH 5KVEL 1Z5LA 3HI5L 1FIGL 3PQYE 5JLZA 1PKOA 3B9KB 4CVZB 4PJ8B 1J0ZA 4YHPB 3GI9L 4S0TD 2Z9TA 5E8OA 1P4LB 2NX5E 4WU5B 1UB6B 1JTTA 2VJXA 1Q9WB 5DK3A 1UACH 5EU6B 5F6HJ 3UTTD 1A14L 1MCCA 5LKNA 5K9OB 3L1OH 3MUJA 5HVWA 4OZIB 4NM8H 5KANG 3VFPB 4OIBA 2APTA 5CEXA 4Z7WF 4QXWA 2XWTB 2PW2B 4KK6D 3MV7A 3V6ZB 4YNYB 5FYJE 3IDJA 1ZV5A 1ACZA 3O3AA 2ILLA 4ENEC 4MD0B 4PRHB 4DTGL 1JRHI 4OTXL 1NMAL 1UFUA 1B9ZA 4OCRH 1YNLH 4WO4D 2VR9A 4D9QD 2PCPB 2NNAB 4OKDA 3TNNB 1YEEL 3ARFC 2H2SD 1IBGL 3H42L 5DXWA 3PGDA 1CLZH 1JPFA 5BVJB 4HMDA 3PP3K 4YHKH 2CKBA 1YQVL 4OKVB 3HG1D 3HB3C 5D7LE 4GMTL 2R23A 4YUEL 4DK6A 1XGPA 4LU5H 4NFCA 1ZKAA 2QADB 3K4DA 5C2UB 2HFEB 5EU5A 4LASL 3QPXH 4LCWE 4WFHD 4XHJC 2Y36H 1EUTA 1R3LA 2JCCB 5EU4B 5IIEA 3EGSB 5I1DA 3QA3A 3P4OB 1MRDL 5JIKA 4G6AC 2WM0A 3WD5L 3MACL 4HXAH 3N1GC 2H9GA 3MBXH 2BVQA 1S5HB 5D1XC 1FIEA 5T1DH 3CFDA 4YIQA 2P43B 4KKBD 2ZJSL 4HPOL 3LQZA 3CUPA 4LQFL 1CDBA 3QJFA 5I15H 1MHHA 3HZYB 5B39G 5B3JE 3ZE2F 3VGAB 4CKVX 5F9DC 4ESKA 4NUJA 5DTFB 3EOTL 5IJKA 4RMWA 3HMWL 1JNLL 3KLAB 3ULVL 3TJEH 4PTTA 2DQEH 2P42B 2ZUXA 3KAAA 4GMSH 2IFFL 1YEFL 3GJFB 2FHCA 5FKPA 1UZ8B 2ED9A 3SE9H 5IJVB 5AZEH 2VXUH 1FFOA 3UC0H 3FO0H 1MHEA 4QEGA 5MENA 4OLXL 1DQLH 1RZIB 3BT2L 5E8NA 5EBLA 4KI5F 4EBQL 2YPLA 4PY7B 1CICC 2FB4L 2F8OA 3QDJA 1ZT4B 2DJSA 2YPVL 1RJLA 5KVFH 4UTAH 5F7EL 1LK3L 1FL6A 3G9VA 1HYRC 43CAB 1G0DA 3F8UB 4NC1E 2RBLA 1AE6L 1PX4A 5H94A 5E56A 4ZAKA 4HFUL 1TITA 4N1HB 4AENA 3CK0H 5E8EB 2ZOKA 2HMIC 3TBVB 1NKOA 1AO7B 5IW3A 4JFDD 3S88H 2LE9A 4OI7A 1HXYB 2BVUA 4ENED 2O26U 4OZHB 43C9B 5I30L 3D2UB 4LEOB 1JHKL 5JPMA 2VZOA 4Z18A 1QSVA 3IYLW 1KBGL 3RDTA 2QQLH 1Y18B 3MRGB 1GZQA 5GSVB 4ISVB 4NO5B 1IGCL 5B38B 4QHUB 4Z6AT 4XPBH 2E9IA 3CLEH 3MCKA 3DRTA 3HI1A 4DVRH 1WISA 3HC4L 1YMMB 1U6AL 3OSKA 4XC3H 5F70A 4PREB 3HB3D 3M07A 1H3TA 5EOTB 2AEWA 1RUKH 3VRLF 4WV1A 3QQ4B 3PQYB 2KUTA 1E6OH 1GGIL 2HWZH 1TTGA 2BNQD 4XHJD 2R4SL 2VNCA 3V5DA 4CGTA 4TSBH 3CU7A 5F1NB 2HH0L 2NX5B 5EC2A 3U30C 1W0YT 3O45B 2EECA 1JGVL 2WK2A 2EIDA 4TVPL 5FHBL 3NIDE 5D1XD 4N8VG 3F7PC 32C2A 2BOCA 4OF8A 3VGEA 5BQ7B 1B88A 4XI5C 2RJMA 4D0BB 1JNHA 3LS5H 4YXLL 4NKIL 3L3KA 4YAQB 1R5WA 2AAVA 2FX9H 1XF5B 4TSCL 1NUNB 4LHJB 2VLRE 3SKMB 2P46B 5DVLA 3QEQA 1MCSA 4WI8A 3PGFL 4FN0A 4ZPVA 3BIKB 3H3PL 4BZYA 4I0PC 3B2UC 3AUVA 3FQWA 5CJBA 3LOWA 2MQ3A 3C8KB 5C0BA 5IG7B 1RHFA 4MNHB 3OAUL 3VJ6B 1YJDL 5D7LB 1CICD 1ZVSB 4XAKE 1UM5H 4HH8A 2R1WA 4LCWB 1FNAA 1FLTX 5E4EB 4UNVA 2YA2A 3HCVB 4MB5A 3NCJL 5C0FA 4UT7H 2J88L 2UUDH 4F58H 4U2ZA 1IQWH 1NEZA 2HT3C 3QIBB 3ZKXB 5D9SB 2CDGB 3AM8A 4PJIE 1FORH 1LO4H 1TVBA 1C5DB 4HPYL 5FF6B 2YR3A 1WWBX 2XXMB 5FIEA 3T8XA 4LQ1A 3RZWA 3KLHC 4OGAD 4U1LA 4Y2DD 2F74B 3OJMB 4DGVL 2Z91B 1IC4L 1CD1A 2BC4B 4LFHD 1U3YA 4PS4H 3MYJA 4RNRA 1O5DT 2Q7YA 4XMLL 1X5LA 2YXFA 1OGAD 3PV6B 3IDXL 3C9NA 4WHDA 5FKAB 4JRYA 2Q7NA 4LLVB 5GGRB 2W1NA 3BMVA 3DO7B 3O2WL 1ZMYA 3QUML 1ADQA 2A6JB 3ZKMD 1T1ZA 2BY3A 2ENSA 3RWIB 4QNPF 3IU3A 4NUGH 1GIGL 3MJGX 5DK2B 3EHBC 5E2VL 2B1HH 3RVXD 2VDKH 5I76A 5IJKC 3BGFC 3QWRD 5B21A 4LCYB 1MIMH 3PUCA 4I48A 1X7QB 4FABL 2AABL 4JM2B 4JY6A 4JDVA 4P5KA 2ZPKL 3U1SL 4LKCB 3V5HB 3FAXA 3SO3C 3GHBH 5CP3A 3WNNA 4QRPD 5D5MA 1OM3H 1I7TB 4FXKA 3D0VA 4K3GA 3O41A 4HUWA 3VFMA 2X4UB 1CXHA 3AREA 2Z8VC 1JZ5A 4M43H 3MLPA 5T3ZH 1JCKA 4MDJB 4PV8B 4I0PD 1FV1B 3B2UD 1IGIL 4XPAL 2AK1L 2I60L 2O5ZL 1BWWA 2MNUA 4AIOA 4FMFA 4WWID 4A6YB 4L8SA 1S5IH 5KW9H 4YDKL 2PYEE 5C1MB 2AKRB 3AS1A 3L9RB 4XMKL 5HY9B 1KYOJ 4O2CB 3WDJA 4NBYB 5C08D 4PJEE 1XGYH 2XTJE 4OM1L 2AI0H 5DD1L 2NY1B 4RA0C 1LDSA 2IPTH 2QQNH 2HT3D 4L29B 3GEWB 2X09A 1G7JA 3DX6A 3FFDB 5J06A 5BW7A 4M6NL 4Y1AD 3RAJL 4RA3A 2EC9T 4RFOH 4WV1C 3KLHD 5IGXH 2DQDL 2ZUVA 5E24E 3TBYA 2HN7A 5GXBB 1QTYT 1IFHH 1OSZA 2VLRB 1AP2A 3S5LB 1JGDA 2DD8H 2V9TA 2XXCB 1GPOH 1BBDL 1MI5A 4KTDL 4XBEL 4OD3L 4YDVB 3FOMB 4IDLA 4OCSL 4HIIA 2AS5M 4JFXB 3UROR 4OJFH 1OAUH 1DJSA 4JFFB 5CJ5A 3CVIH 3MXWL 1HKLH 3UX9B 2IPKA 3LRSB 2BZDA 5L0QB 4JQXA 3V4UL 5L8KB 4OUOA 1YZZA 5AUMA 5ETUB 3OJ2C 3DV4A 1SMAA 2NY2D 1BP3B 2I5YL 3DURB 4MA1C 3FFCA 2HKHL 3BJLA 3CSYA 3LKNA 4BQ9A 1M05B 2XFXA 4LCUA 5EBGA 1NC2D 2ZCLL 1I75A 3UEZA 5HHOA 4BQCA 1CFSB 3G08B 1U92B 2M1KA 2NXZD 2OX5A 1DBMH 1X5IA 2ICES 3I6KA 3RIFK 4PJIB 5LXGH 1VERA 5KSBE 4NQCA 5J6HB 3OAYH 1FYHB 1MCPH 2N7AA 4X4MA 1A4KA 3VXUA 5BCAA 4W6XB 2MMXA 2YA0A 4H20L 2OXGA 1AD0B 4FNLH 1QBBA 4LVOB 1T1WA 4MD4A 4U0RB 4APQB 5HTSA 5J8OA 1JGEB 2A1WL 5ALCL 3G5ZA 4ZXBC 3LSOA 2XYCA 4KJPD 4NN6C 1UQSA 1HQRA 4NRZB 4P48A 3AM8C 1U8QB 4G9DB 4GW5A 4JANA 4KFZC 5E08L 3WE6B 4P0DA 2P24A 1KCSL 4PR5A 3GSNA 3CAFA 3W2DH 3VD9A 3MJ9L 4IRJA 4J1UA 1FNSL 2W0FB 3UPRB 4ZS7H 3BQUA 5EBWA 1CLYH 3L3GA 4XGZA 2EE3A 1LMKA 4HUMB 4HGMA 2EDYA 4LIQL 5GIRB 5CKGA 3ARWA 4M4PA 4UDUB 2YSSA 1DLHA 2VISA 4PJXA 1SVCP 1GJIA 3VWJD 3T0XA 5BV7L 1TTUA 4K2UH 3BD5A 2A6KA 2ZUWA 3RWJA 4JFPA 2AJUL 4WVRA 2D7OA 5D1ZA 1LEKA 3TWCH 1LE9B 4DN3L 4PUBH 4NQTA 5A3ID 3SE3C 3WKNA 4P59L 5SWZE 5DMIL 3PXJA 5EZJB 2ADGA 2IH1A 5DEZA 4LF3B 4XVJH 3T0VA 4G8IA 3PP4H 5C86A 5EN2A 4Q2ZA 1UWGH 5LAXA 1YPZA 5ENWA 4KTYA 2A83B 2E5EA 2X4TB 4OLUH 3CGTA 2PYEB 3PWUA 3FJTA 3G6JF 3MMEB 3P73A 4PJAB 1KCVL 2XN9A 5F9WB 2IANE 3AREC 4GKSA 4PJEB 5I17A 2XTJB 5LGKA 3WV0A 1TZIA 4GQPH 3WLWD 1ED3B 3ZLQC 3MO1A 1T21A 5CJQH 2IGFH 5FAAA 3MRCB 3NOIA 4CMMA 3WO3B 2VXQL 3ELAT 1MFDL 4L8SC 2ADIB 3RIAK 4ZFFA 1DUYB 4JG0L 1HHIA 1V7ML 4JJ5B 4MS8C 2NY7H 2FL5B 5INCB 4F7PB 3PDOB 5D7JB 1NLDH 1GOHA 4MCZB 1LEIA 2PXYB 1QLRA 1BLNB 4JG1H 1YEGH 4ZXBD 1MCLA 2OJEA 2BFVH 4PB9L 3STLA 3WDIA 3O8XA 3OKEA 2FO4B 2WWMD 3BP4B 5F7YC 5E99L 4PJHA 4WNQA 5BW7C 5F3BB 4CW1A 4Y4FB 3BFOA 2CDEB 3VFUA 3U83A 3ULVC 4BUGA 3ME0A 2OZ4H 3BZ4B 4JKLA 4LK4A 3GZKA 4KKCD 2C26A 4R7DA 4LDEB 2VOTA 4NCC1 5T3ZE 3C60A 4R96B 1MCDA 2I07B 2V9QA 2OSLB 2J4WL 5DJAA 3M1BB 5CD3B 4ONGL 5SWSA 5FO8A 2G5RA 4NKDA 1P5VA 3D6GA 5BRZD 1WBYA 4Q9BA 1OQXA 2HLAA 3SDCA 1Y6MR 3O2DA 5KSBB 2CDFA 3T1FB 2GEEA 3SDAB 4XNQB 1LO2L 4JQXC 1FZOA 4YDJB 3ULUL 3DUSB 4PJFE 3MRLB 1TLKA 2ATKA 3BPCB 3SCMB 1QVOB 5JPNA 2XZAL 3QEHA 4NO3A 3E6FB 1S9VB 5LQBH 3AY4A 5BO1L 3GMLB 4NKMA 4YBQC 1CBVL 1BBJA 4LSRH 5GGUA 4XNXL 1CI5A 4GT7A 5ESQB 3TNMA 1J8HD 2BRRH 1M7DB 3KPQA 4ZQKB 5DUMH 4AIZB 3T0DA 3L6FA 1L0QA 2OK0H 1KLUA 1EEUA 3PG2A 2IAMC 1A9EA 3K3QA 3SQOH 4JPKL 4UIKL 5C09D 3KXFE 1KCRL 3FMGH 4NC2B 4IRSA 2B5IC 3BWAB 1EMTH 3HRZA 4G8GA 1WAAA 4JN1L 3AXLA 2ZUUA 3Q5YA 4IRJC 4HHAB 3S4SB 1B0WA 1CD9B 3NACL 5JW5A 1QSED 5MEQA 3WFEH 3VFNB 1U8NB 3DLQR 5SWZB 1RZGB 3O4LD 3VFSA 1FYTD 3SN6N 1SYVA 3DX8B 7CGTA 4JO4L 4LCIH 1B4JL 5FCSH 2D7QA 1JF1A 4ELMF 5AZ2L 1DTUA 3VH8G 4G42A 5CIPH 3ULVD 4UV4H 5HI3C 3SDXE 2ZUTA 2XRAH 4ZG1A 4HGWB 1YMHA 1N8ZA 2HTLC 4MA7L 5D1ZC 2VLJE 25C8H 5E5RB 1QSFE 5DJDB 5TDOA 5EFIB 2IANB 2CK0H 2XQBL 5D1QB 1TZGL 3B2VH 1YJDC 5FYLL 3UJTH 3KYMB 3QHZL 1QBAA 2NY5C 1YDPA 3R1GH 2CIKA 4V1DE 2XTLA 2EYRB 3KPLA 4YEFA 4I3SH 1JN6B 1UWXH 4R2GB 3V7MA 3MRRB 4CVXA 2X70B 4OLZL 4XBGB 2D7TH 3VGGA 3QIUB 4WHTA 5KJRL 5EA0H 4QOKE 1CVRA 2IQAB 3BSZH 2AJSL 1QRNB 1L7TH 1FNGB 3NPZB 4MA3A 3HPLA 1EHLL 1KJ2H 5CINL 1EFXB 3QG6B 3F5WB 1NCCH 4NNYB 4PGDA 4R8WH 3WMSA 3G6AB 5I66B 3RPIA 2BNUA 3ZT5A 2XOTA 3V52L 3V8CA 3X13B 4RISL 1T2QL 1R5IA 2X4NA 1U3HB 3QIWB 4MVBD 4XCFL 1AQDA 3RIFF 4BM7A 1FNLA 2NLJB 2IAMD 4O02L 1U3ZA 5CBAB 5D8JH 3B6SA 3BEVA 3N1PC 1B0GA 5FO7B 3TO4D 1JV5B 1ORSB 5HGAB 2Z93B 4GO6B 4Z7WE 1UB5A 3IF1B 3O8XC 3WDHA 3LKSA 1PZ5A 1NGPH 1SVZA 1KB5H 2OQJA 1NUGA 4TTGA 1AXTL 2Y5EA 2BVOA 2F53D 4OQTL 4TVPD 4E9LA 3KPMB 5JOPD 2CPCA 4K7FB 5EZOL 4QRTA 1FLRH 3I2CL 4F7MA 3OKKA 1IGTA 2AK4E 3S35X 1ZGLP 1U42A 4PJFB 2OL3L 1VCAA 3M17B 4DQOH 2X7LA 2Y7QB 3FB6A 4TOYL 3U7YL 3CFIC 4AYFA 2IC2A 1D5MB 5IT2L 3BZDA 1NL0L 1A5FL 3VXQA 4QLRA 5JOFA 5ESAB 1VGEH 3LY6A 4I0KA 3RRQA 3QCUH 3NCMA 2HTLD 4F3FA 4XWOD 4IHOB 2FJHA 3DNKA 1KIQA 1S7QB 1VGKB 2P5WD 2DI7A 3UTPE 4AEEA 2YZ8A 3AY4C 1A6AA 5MHSE 5ICXB 5GGTL 2X1OA 5GSRA 3KXFB 3VE0A 2CLRB 3MGTA 4PRPE 3H9SD 4EEEA 3HAEG 3ZE2E 3SO5A 2AERT 2AQ1A 4HT1H 4HAGA 4ODWB 4R4BB 5J12C 4U6TA 2VDQL 3NH7H 4S1QL 1S7VA 5I8CA 2ARWA 3BHBB 2AW2A 3V2AR 4F7TB 2BHUA 2D03H 5I73B 3A6OA 4LVNB 4WFEE 1T5XB 1NBZA 2ICEB 3BOVA 5HHMD 5FXCH 2VE6B 4UB0L 1KELL 4Y4HD 1RD6A 4WWKA 3GMRB 3TBTB 2FSEB 1HZHH 2XNAB 1INQA 4KI5E 3MLVL 4NRXB 4OQ1A 3TZVB 1FZKA 1DQQB 3FO1B 1EBPA 4O2FB 4ZTPL 3PP3H 4LPXA 3KG5A 3SDXB 4OB5L 5KZCB 3ARGB 2M26A 3TPKA 2ARJA 4DGIH 1ZA6A 1EEYA 1MLCA 1N59A 1R3IL 2VLJB 3P0VH 3RIAF 1MCEA 3QG7L 4HS8H 3TBWA 1QSFB 4I2XE 4WTZG 1RUQL 4EUPH 3N1FC 5LJYH 3C5SB 3KWWA 3K4AA 1KEGH 1OD9A 1CF8L 1NGYB 2DDQH 5KS9F 1T1YA 5L2JB 4P46A 1MCOL 2J8UA 1F58H 2P8PA 1FG9C 2ZOLA 2EDNA 2XG4A 3FAWA 4QOKB 4UOJA 4FZ8L 5JZ7C 4H88L 5GGSA 2MTPA 3OJDB 2C3VA 2EKSB 4ODUA 5BMFH 4HUUB 2B4CC 3MA9L 2QR0A 1I7ZB 1MELA 3MLZH 3VRLE 4UAOB 3I75A 1MQKH 1QFUL 1JMZA 4J2XA 2CXKA 4ETQB 4AL8L 2CIIB 3OX8A 1QBML 2CMRH 3MUY1 4HV8B 4KRPD 4HUKB 5F44A 4KZEL 2DQHH 2EDTA 2YUZA 5DJ2B 4LOUC 4XC1L 1ORQA 3BH9B 4FXGB 2YOCA 4PJBF 4TQEH 4CNIA 2P8LB 1OAZH 3UTTE 3EYUH 3UCRA 1JYXA 3WSQL 4Z7WB 5AG9A 4C4KO 5FUZL 1OAQL 1RIHH 3BP5A 2ZG3A 3SJVB 4NSKA 5D72H 4L8CA 3LIZL 5HI5C 3IDIA 4EI5A 1MCWW 1WZMA 1A7QL 1Q9KB 3E6HA 1NMBL 1JRHH 1BM3H 3LKQA 2FWOA 2AJXL 3A0OA 3TCXA 3REWA 3NZ8B 2AK4B 4DOHE 2P8MB 1PQZA 2FJFA 4NQVB 5T33H 3WXVH 1WFNA 3DETC 2HFGH 4XH2B 4PBWD 5DUPL 2DQUL 5CS7A 1CFVH 3OKOA 2EYSA 4ODXA 4LNRB 5KVMC 5L8LB 2LVCA 4K07A 5HDLA 3FT3B 4E41E 4KTEL 2Y5TA 3MJ8B 1GYAA 1F02I 2APWA 4S2SB 3CDGB 3PIQA 1GHFL 1X5ZA 3TIDB 1A3RL 5DA4A 1ETZB 1HKFA 1YNKL 2V5YA 4QKXB 3MV8B 3GMOA 1HNFA 1N4XL 3DVGA 3MLXL 1UM4L 4K9EH 4HCRL 2X1XR 5DJ8B 1P9MA 5JXED 5D2NE 4KZDH 4PRPB 5B8CA 1MHCA 4FRWA 1EVUA 2RR3A 4RBPK 4U1SA 3DIFB 4QTHB 2AEQL 3AROA 3NZHH 4EQ2A 1I3GL 1ZSDB 4OGYH 5JZ7D 3BJ91 2A0LD 4WUKL 1KIRB 2D9CA 3FB7A 3VXRD 3SDDD 1WBZB 3ARBB 5MERA 3W5MA 2DIJA 1C08A 2V7NB 4X0KB 5HDOA 4OCNC 5DHVH 4PB0H 3N1QC 4BFBD 5FEBA 3JWOC 2Z8RA 4N8CH 1G7HA 4EVNA 2DKSA 1LO3L 3QDGD 4OAWB 1XF2B 2RIKA 2F5BH 4KAQL 4QNPE 4H0GA 2IG2L 1AFVL 4NDMB 3VG9B 2C3WA 5GS2H 3EJZD 2FO1A 4HXBH 2IF7A 3VRJA 3DV6B 1GAFH 4QRQA 3FQNA 2XWBB 4I2XB 3PWJB 3GSRA 4ZSOE 3X12A 4OLVH 4JDZA 1KT2A 1IAIM 4C56E 3MLTA 1IAKA 5MI0B 3F7YA 4AIXA 4XNYL 5HSFA 5GS1C 5HI5D 2WW8A 3EFDH 4ZDHB 4DUVA 3QCVH 2KDGA 4F8QA 1HQ4B 4EKXA 4MJ6B 2XWJB 1FPTL 4Q9RH 3D3VA 5SWQA 2VDNH 2XPGB 1XR9A 1OD7A 1LDPL 4L8DA 5IB2A 5K9JH 5JR1L 3T65B 3UBXG 1IKFH 3QH3A 4L3EE 1IEBB 3T77A 1SY6H 1EDQA 3VFVA 1X3DA 4RX4A 1DBAH 4H8WH 4P46C 4QRRA 3ULUC 3CCHB 4FQQB 2RCSH 4KJYB 3VXSE 1IM9B 2I9TA 1QQDB 1T03L 2WSKA 4F57L 5GZNC 3MLSL 1ZLSH 3EYSL 4D2NA 1GH7A 2BNQE 5K59F 4X7EC 1OWWA 2B0SL 1M7IA 3EO9H 3G6DH 4XNUH 1MFCL 3QCTL 3LKPA 5EWIH 2AXGB 3TT3L 1EO7A 2GKIA 3MXVH 1MJ7H 4NKOA 3UTTB 2CSPA 1HXMA 1JGLL 3DMMA 5KG9B 3FB8B 2F19H 5CIPB 3C08L 1MRCH 5HHNB 5IFHH 5HHQA 4HBCL 1C1EH 2DQCL 3V6FB 2GK2A 3HA0A 3KPRD 2BSTB 4G6ML 4U1JA 1KIPA 1BPVA 1YN7B 1JHTB 4NO0B 1BX2B 1KTDB 3LEYL 4DOHB 3WIIL 1H3PL 2UYLB 2K7QA 2X6MA 4PJDF 1DQMH 4JKPL 1SJXA 1QBLH 3DYMA 3F7VA 3CJJA 4WJ5A 2GJZB 2IH3B 1R3HA 2VB5A 3QR2A 4POYA 3MR9A 3IVKB 4EI5C 2A77H 2YRLA 4E41B 5FUCE 1I1CA 5DGQA 4P9HL 3GSXB 2HVJB 2C1PA 5TJWK 1RUMH 3ZSSA 3LEVL 1TJHL 4N0FA 1A1MB 5D4QA 3ZKSD 1KJ2B 4KU1A 1IRAY 1AGFB 4L4TE 1ZVHA 4MZ2A 5DD5L 3OKMB 2BCKA 1F6AB 2GW5A 1JPSH 4QY8B 1I8MA 3NTCL 3BN9C 5D2NB 2WNGA 2FZ3B 4YGVA 3ZHDA 5J11B 2WUCL 4F2MA 3HC0A 5IW6A 4TNVK 5TQ0H 1U93A 2HRPL 3OPZH 3MRBA 1FE8L 4OSUL 4YFEA 1GXEA 1I8KA 1YEDA 4MD5B 5IVXA 1L6ZA 2ZUQB 1IC7H 4ZPTB 1OAXL 1F42A 4OZ4B 3ULUD 3JTSA 2DMKA 5F3HB 3UTSE 2Z0BA 1P9MC 3KYKH 2VLKE 4MXWL 5FM5O 1KB5B 3IFPA 5FUOH 5B8CC 3V7AE 5JHLL 1S7WB 4HBQA 1BFVH 5CUSH 4NCC2 5GZND 1KLGA 1SHMA 3KPOA 1FH5H 2GAZA 4ZMAT 3K2MC 3SOBL 2DWEA 3WXWL 1FVEB 1W8OA 3GMQA 3MC0A 1KC5L 4WGVB 3H7LA 4HAFA 2I9LB 2Y1VA 4K3JH 4ZSOB 1MIEH 3RVVC 3AFLA 3C2SA 1I1YB 3BYTA 5IW1B 3GSOB 5F88B 2MCPL 4C56B 4D0CA 5GJTL 1TMCB 1AJ7L 1DEDA 5T1LD 4BH7A 2EZ0C 4FQIH 3HMXH 1RMFL 4N9GA 5F1IB 1AC0A 4U3HA 5TE4H 3FOLB 4Z0XA 4MNQE 1D5IL 3LQAH 5C6WH 4J6RL 2C1OA 4AEHH 2Q1EA 3QFJA 1EAPA 1U2HA 1ZGLB 4LHUG 3QP3A 1H9VA 3EZJB 3QRFM 2BY2A 3IGAB 4L3EB 3P11L 1LNUA 1AXSB 3F62A 3WS6A 1E4JA 2OP4L 3GI9H 4Y5VB 1K6QL 4WTWA 1G7MB 1UYWH 2JB6A 3G6JE 3VXSB 1SYSB 2WAHA 2P5EE 4G80B 3GKWL 2R2EA 1CR9L 1FQ9C 3SDYH 3X17A 5HVHC 4FS0A 3MLUL 4BH8B 1U95B 2BNQB 2DM3A 2ZNXA 2VERN 5I75C 5TF1L 2OTWB 4IRZL 2ORBH 4X6FB 3GHEL 5E2JA 1MF2L 4GSDH 3ROLB 4DKEH 3QO1B 4UQ3A 3BN9D 4UUJB 3MRJA 5FYJL 1YYLH 3P30H 1GGCL 5FYLD 4IOSD 4O9HL 3IXAA 3F12B 4LLUA 1CK0L 2OS7A 3IJSA 3IDGA 1XMWA 3QZWB 4YHNA 1KCUL 2Z92A 5IHZB 2XIDA 2Z8SA 1AR2A 2VZSA 4FZEL 3BEWA 3LZFL 4EUPB 4PLKC 4W6WB 5HDQH 4XPFH 3D39E 4BSVA 1NCWH 1N6QL 3HS0A 4LAQL 1T5WB 3DMMC 4LAJH 4OBRA 2NY6B 4UIMA 2A9ML 1JK8B 3QRGH 2DTSA 1TJIL 2J12B 2N56A 4K3DL 5IMKB 2Y6SC 3FZUC 1MFEL 1S9XB 1DUZB 5CSZA 2R0LL 4L4TB 4EJ1C 1K4CB 1T2JA 3IFNH 1YC8A 4LQFH 4ZUVB 1MH5B 1OTTC 5I9QC 1D9KB 1H5BB 5L2KA 4LVEA 4QHKI 1MLBA 1JNLH 2EIZA 4JFED 1B6UA 5BXFA 1HHHA 3L3DB 2DI8A 4CDHA 1BREA 2PN5A 3MNWB 3CFBB 4YHPA 1BJ8A 5DRXB 3Q6GH 4KDTC 4NHUA 4WU5A 1G6RA 1IILE 1UJ3A 3QEUA 4EBQH 1I1AA 5ISZA 3MQIA 1Q9WA 3ES6B 3BUTA 3UTSB 1NBVH 2VLKB 1OGAB 3A67L 4NM4L 4R0LB 5HHXL 4MWFB 4RGND 5F7EH 4OZIA 4D9RE 2X1QA 3D3VD 2APVA 2XY1A 4X5XA 4M8QB 3V6ZA 1CE1L 2JELL 3CXDH 1H3GA 3P9MB 4RMRA 4YH6A 3F6IA 4YNYA 3C5ZD 3OHXA 1CGSH 4KWUA 2JF1A 4P99A 3NCBB 4Y5YC 1CDHA 2NCMA 2XT1B 1C5CH 4RX4D 4YHML 3MRPA 1F90L 1YEHH 2PCPA 4NQUA 3V6OE 1EGJH 4ODBD 4LLQB 4M8VA 5DWUL 5EIQA 3ARYA 1ZT7A 2B2XL 1U8IB 5MEOB 1K3IA 4MNQB 4OKVA 4PD4K 3MOBL 5BJTA 2YS4A 1U8JA 5D2LA 3UTZB 1V7NH 4N8PA 4ELME 2W59A 5DS8B 2YMXH 1Q8MA 3K81A 3REVA 5CKAA 4ZO7A 1U58B 5EU4A 2JCCA 4A6YL 4K3EH 1S9YB 3P4OA 2R4SH 2VDML 2P1YA 3G6JB 5F96H 3U7AA 1C16A 5E6IC 1MEXH 1JGVH 2P5EB 4YE4H 2WWKT 2R29L 4M6AA 5HYFA 4JM4L 1X5XA 3ALWA 1M7XA 4JPWH 5T1KB 3D85B 2Y6SD 1CLOL 5IESH 5DHVB 1P4IH 1WC7B 3RWDA 1VFAB 2IALA 1NUDA 4NKIH 3WS6C 3LAFA 2AQ2A 4GUPB 4KHXH 3FN3A 4WFFE 2V7HA 3WNOA 4L8BB 1EBAA 3DECA 4MB3A 4HLJA 3GJFA 1UZ8A 4JN2B 1T04B 4P23A 1DVFB 2NYYC 1IGFL 4HWNA 4WHYH 2BX5A 5I8KL 1P4BL 5IQ9B 1FNEA 2VQ1A 4FXLA 1A9BA 3RWCA 3TV3L 1KN4L 1R24A 4LLDA 1RK1B 4ODSH 3MRMB 2XZCH 1MJUH 4JZOB 1JZ8A 2Z31C 4UOW1 5C07D 3OXSB 1NC4D 3IAQA 3L5XL 4K8RC 4DW2H 1FZMA 5E8EA 1FNFA 2YC1B 1PG7W 1QFWI 1QA9B 4YFLF 3SEPA 1AO7A 3BIAX 4TNVF 1XZ0B 2YD8A 2DF3A 4X8JA 5IK3B 5C0DA 3LV3A 4OZHA 3ROOB 43C9A 3D2UA 4LEOA 5I1GL 4IMLA 4HPYH 2PTTB 5J1AA 3MREB 1LEGA 1DR9A 1RUPL 2SEBA 3P4MB 4HKZA 4YBLB 5EDXA 1W72A 1PG7H 4NO5A 5E94B 4ODTL 3PWVA 3U36B 2NXZB 2A6IB 1VPOH 4AM0A 1FVCB 2IJ0C 5E7BA 1XGTB 3FQUA 1UACL 4PGCA 1A7PH 4HH9A 4X6EB 4Y16B 3V5KA 3K8LA 1P6AB 1KTLB 3L1OL 1UH4A 1ZWIA 5I1LB 4NM8L 1NDGB 3O3EA 1IVLA 1JUFA 5B39A 1IQDA 3VU2A 3T3PF 4IIQA 3BPNC 3WFBH 5HYJD 3RL1A 3LN5B 5E6ID 5IB5B 1K2DB 4UZGA 3P9WB 4Z7NF 5ID0B 4OCRL 1YNLL 2YD5A 3BUYA 4NYLB 3C6LB 4G9FD 5F71A 4D0BA 4OIIH 4X4YB 4JY5H 4YAQA 3B9KC 1C12B 4PJ8C 5EUOF 1CLZL 1NEZG 1NFDA 4YHKL 1UJ3C 5C0CE 2ID5A 3PGCB 4QGTA 3DI3B 2GSGA 3HAEH 4JZNA 3BIKA 2HKFH 3QPXL 1MCRA 3QSKB 2Y36L 2VR4A 3BW9A 1QUNA 4HJJH 3BAEH 5I1AB 4XPAH 2AK1H 4FQHB 1F3DJ 4LBEB 3VFOB 2DN7A 1JI1A 4HXAL 4ELMB 4ETYA 4XHQA 5F7DB 3MBXL 4PJ9B 5EUKB 4AMKH 3PABB 1A7OH 3KPNA 4LCWA 3CXHK 2V6HA 1OPGH 5FA4A 2Z31D 3UJIH 3DJ9A 5AYUL 5T1DL 2NXYB 4HK3J 4GW4B 5I15L 4JFOB 3MPCA 4JRXD 2OMBA 4U6XB 1FDLL 5IV2A 3GGWA 2J6EA 2F5AH 4WI6A 4HIHB 1MUJA 4D8PB 4PRAA 2PO6D 5KS9E 3VRIB 5EB9A 3PDGA 5IB4A 1AKJB 3PHQB 2QADC 3SE9L 1S78C 2F74A 4X80L 1SJVA 4X7TB 2DQFA 1CE6A 5AZEL 2P49B 2VLLB 3FO0L 3I6LD 3ULSA 4HKXB 5HYSB 4Z77A 1PLGH 1MY5A 1DQLL 1RZJC 4G7VH 4PRBB 4M48H 2BHYA 4KK9C 1OB1B 4H0HB 5KVFL 1BBDH 1FC1A 4JDTH 3KPPB 4OCSH 1U8MB 5DK0B 2GITA 3WS3B 3RJDA 1CGUA 2X4SB 3VGAC 2C3HA 3CK0L 3DUUB 5CD5C 3WL9B 2J2ZA 2NY3C 3H9ZA 5TDNA 5F89A 4QTIH 2VSDA 3UTOA 2GUOB 1X7QA 4X7SH 3Q6FB 4WW1A 3B4NA 4XP9H 2PYFB 2QQLL 4F37K 2CLZA 4OLYH 2ZCLH 4P23C 4PJBE 4EQ3A 4XPBL 3B9KD 4LSPL 5C7XH 4PJ8D 3CLEL 1N0XH 4RAUB 2R1XB 3H3KA 4XXDB 4DVRL 5A40E 1KENH 5C6PB 5BZWA 4XC3L 2AVGA 3BE1L 4P2QD 1N64H 1EUUA 4P3WA 4RGOL 1CFBA 5EU6D 3UZEA 1RUKL 4MNGE 4EDXB 1E6OL 2HWZL 3MGAA 3CPLA 2G9HB 4TSBL 5DFVC 3SPVB 3TIEB 3RFZC 4XCEB 1UWEL 3EOBB 3PWNB 4XXCC 5FOBA 4AT6B 3L9RA 3TPUB 4PRHD 2A6DA 1A1OA 4ONHB 4GAJH 1ZA3A 3GSUA 1FL3B 1KCSH 1XGUB 2ERJB 5BS0E 3QUXD 2JJWA 1FNSH 3QUKA 4IOIA 2V2WB 4NFBA 4R3SA 1FFPB 1D3CA 2FX9L 1OTSC 2ZWLT 5IQ7H 2VAJA 1TZHB 4L29A 4NT6A 4P4KA 4IM8A 4KXZI 4MX7B 5F7HA 1AHWA 4P5MA 1S78D 3RVTC 4QT5B 3PL6D 5GPRA 2BY1A 2C3GA 4Y2OA 4J3WA 4G6KL 3ARXA 3F6LA 5C0CB 3NCYP 3UXFA 4Z76B 3ZHLA 5HPMA 4LPUA 4P5TB 3ZDYF 2JIXA 4DCQB 5FDWA 4KK9D 4P59H 1EA9C 3MX0A 3H7BA 2LV4A</