3F85A

Structure of fusion complex of homo trimeric major pilin subunits cfab of cfa/i fimbirae from etec e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
456
structure length
456
Chain Sequence
MIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CFA/I fimbriae from enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords homo trimeric fusion of CFA/I fimbrial subunits B
total genus 70
structure length 456
sequence length 456
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A03
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A02
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A01
3F84A 3F85A 2HB0A 4HJIA 4Y2LA 4Y2OB 3VACA 3F83A 4Y2NA
chains in the Genus database with same CATH superfamily
1MI5B 3GXNA 3U7YL 1BW8A 3OAYH 3VSVA 4APXB 4P5TB 3ZHFA 3NZHH 3BPOB 5E1AA 3FQRB 1OAJA 6PCYA 3BFWA 5ITBH 1VFOA 2AQQA 2IAAC 1HZHH 2RGSA 3ESVF 2HLFC 1N3NB 3FCTB 5LGJA 5C0BE 3CDZA 4PJDA 4S0HA 4U3XA 2QVFB 4Y9BA 3TH2T 3OHXB 4UCFA 3DV6A 2MWCA 1YEHH 1Y6MR 4X80H 3UTSE 5C0BD 4A6YB 3TX4A 3BXNA 1W16A 3G08A 4I2XE 3F7VA 4WO4C 3C5ZB 4Z3IA 5J1SC 4I18C 4ONHB 5GISL 1KC5H 2VLMD 2Y22A 2PCYA 4HH8A 1GKEA 2D7MA 3ESOA 2QEJA 3UTSD 5B7MA 1F5WA 2DY2A 3GNML 3FT2A 3KLKA 4NM8L 1RPKA 2HFEB 4FX5A 4N68A 3QDMB 5C07B 1DBKH 1AHWA 3PHAA 4Y5YB 4RDQF 1E6OL 4XNZB 2GEQA 4MTMA 5EU6A 3F7LA 3O3DA 1BGXH 2CDEA 3SGDI 1BPLB 1HYRC 1MRCH 2XJKA 3BAIA 3WNJA 3UROR 5F7WC 2OSYA 1KUMA 5E6IA 1S9XB 2K45A 3CZUB 4FQPA 1FAKT 5IMKB 2PR4H 4AYID 1PIFA 4G8IA 4R7NB 3HPJA 4LSPH 2V8LA 1HHIB 2OX5A 3KPSB 3SDCB 1J5OH 1F86A 1IKFH 2EH8L 2PWGA 4TLUA 2XNAB 3W2DH 3PL6A 3V79C 4ZPTB 3KWTA 1LDPH 1FORH 2OW6A 4JB9L 5A6LA 2GBTA 3AJ7A 2O5ZL 4LVHC 1E5AA 1Z2KA 4LE8A 1EVTC 4E5XB 3RE0A 2VLRE 4YDLC 4YHLL 3TV8A 2X1PA 2E0PA 2X7LB 3D2UD 2FX7H 4L18A 3NDZE 4R3SB 3MLRL 4R7XA 4UWQB 4LSVH 1U41A 4TQHA 2JELL 3WHE1 2VUYA 4GLRI 2B1HL 5T3ZH 3AROA 4BSWA 1PSKL 2A9AA 2EO9A 1Z3GL 2JTYA 1GR7A 4NJ9H 4XI5D 1RIUL 3GBNH 4AEIL 4UILH 1QTPA 3MNWA 4YMPA 1AAJA 5DVKA 5M7QA 2XQBH 1O9VA 2XPGA 4IS6A 3N85H 1SNRA 2ISDA 2YOAA 1AZUA 4HWZB 3WD5H 2V2XB 4HS3A 4MMZA 1HCVA 2EIZA 2J1ZA 4W9KC 3IJSA 4P3WA 3ZT7A 2I25N 4WTQA 3KWVA 5CZVL 1AR1D 4UINH 4UTBA 3CGTA 3I6GA 5CCKL 3TL5A 5JHLA 4WWID 4P5TD 1A2YB 3G9AB 4GQ9H 1OAUH 3OKYA 1WD9A 1PU0A 5F71A 5HI5D 1KPUA 3DGDA 3W0WA 5ELIA 3QCVL 3V0GA 3N85L 5FYJU 1MY7A 1WZ1L 2VZUA 3S34H 3IGAB 3UBXI 1G7PB 1I9RL 4Z7QE 3IJHA 4TUUA 2ZG2A 4TXVB 5MEOA 4CRPA 4E41B 3JV4B 3AAZA 3RYMA 3OAWA 2R56H 3RHWF 5HD8D 4M4RB 1I4FB 3T0XA 4N6RB 1L7TL 4D7BA 5EEUA 3KD4A 4U1NB 2OULB 2VN5A 3ZTJG 3AQXA 4NKMB 1U3NA 1QG3A 2YPLE 1BFVH 1H9VA 5LGHL 4HKJB 3AREA 2C3HA 2WYZA 3QAQA 4NRYB 3E6FB 1HXYA 3JWNE 1SHWA 2FL5B 2FJGA 4WKZB 5LCVA 3MRKB 3VGFA 1PLGL 4DGVH 4ZJ9A 2GIXA 5SWZE 1FGNH 4I48A 1JGDB 1L9TA 2AQ2A 2QSCH 3NEXA 4YK4C 1SJHA 4MHHG 3KYOB 3IT8D 5D9SA 5ECGA 1HJCA 1INDL 1DSFL 5AW0B 5E24E 1A7QL 1XSKA 1UWXH 3QULA 4AYFB 1EO5A 3UIZA 4TS6A 1JWUB 1CI5A 5DSCA 2CJTA 5C3TA 3SPJA 5BS0E 1NEUA 4GRWB 3B5GA 3HAEG 2QSCL 4F5CA 4HT1L 4M56A 1RZKL 4AK1A 1CDGA 4HMDA 1C08B 5CJQL 2B3RA 4PRAB 2A4ZA 3G6AB 1QSFE 1RK7A 3IMBA 2IJ0C 1XAUA 3P4MA 3X13A 3ZIMA 1W72L 4PP2B 4U7MA 5FA4B 3V5KA 3GDBA 1CQKA 3CVIH 3KLQA 5F88B 3AG3B 5I1GL 5IEHB 4E9QA 4YSEA 4XN5A 4EI5C 1XGZA 1RZKH 3TBTA 3MDJA 3VXRB 2W1NA 3AWFA 1XIWD 3ERXA 1S9WB 1WRFA 1BIIA 3B3IB 4KXBA 4RFEA 2ZOTA 3RL2A 2WXIA 4KFZC 4M8UA 3R1GL 4D9RE 2Y23A 2VDNH 4FYRA 4I13B 3EFFA 4AV5A 3PAYA 5I1GH 1I53A 2WNGA 2XWDA 3EDJA 4PJ5A 1PG7X 2CLRB 3MRKA 5ID1A 4E9RA 3C60A 4MRCA 1M05A 1QRNA 3CVHL 4JZNA 4XE5B 2VR4A 2H47C 1WFIA 4POZC 2WHVA 5CN2A 4L1BA 1IX2A 4ODWB 2VLJD 1AKPA 3LXUX 1I7ZB 2V17H 5JIKA 4JPWL 3T4AC 3HE7A 3MUJA 1JGUL 2EEDA 4S1QL 5E5MA 4TLTA 4JRYB 3NIFB 1JNJA 1RULH 2B2XH 4JRWA 4LCYA 5E5RB 4QGYA 3K5RA 3PWPA 1DDTA 3D05A 1T7XA 2PCFA 5KAQG 1F3RB 1T2QL 1U91B 1XT5A 2ZSVA 3VH8G 4L9LC 4AYDC 2H0PA 1FORL 3MRIB 4IBYA 5CXPA 2P24A 4YGAB 3ULSA 2ORBL 5L88H 3BP5A 5E95B 1TEGA 4CNIA 3Q2VA 2EADA 1LTXA 4M1CD 2C7UA 4E5XG 2DMBA 1KJMA 1J1XL 1QFWL 1X5AA 1S5IL 2VDML 3D18B 4UINL 1DVSA 3KDMB 4Z6AT 3U36A 2YSSA 3PQYE 4Y2DA 1DE4B 2VDQB 4HCGA 1E30A 5E0FA 4YXHH 3WFDL 5A2CA 2F54E 3BIKA 1AOZA 3HVDA 2EIDA 1CPUA 1QKZH 2JQMA 5ALCL 5IF0B 5BRQA 2P45B 2D7TL 3BP6B 5EU3B 3HAEH 4LHQB 1CBVL 5AVRB 2OZ4A 3FFCD 3WTSA 3P9LA 2ICEA 4DKDC 1BPVA 3BVTA 2FX8L 5GS0C 2IADB 35C8H 3TYGL 3FQ2A 4Z7NB 4PJDF 3UJTH 5TDPB 3ZL1A 2IMMA 5ICXA 1LEKA 3J7HA 5BOZG 4IJTA 4I0PD 5MERA 4PGCB 3A23A 1N2RA 1NEPA 1A7NL 4Z78B 5K9JH 4AH2A 1NCGA 2WV3A 4G2AA 1JGVH 2EIZB 3LH9A 3QK0A 1A21A 1A6AB 2XKSA 2DLHA 4N2DA 5DJXB 4DTGL 3QDAA 1NBVH 4GAJH 5HY9B 4EDWL 2NY4C 1RP9A 2K6ZA 3Q1SL 2DJUA 3O9WB 3OHMB 3FSVA 4PJFE 1BVKB 1U8HB 2H41A 4RFOL 5D1ZA 3WLBB 2XZZA 3FB5A 3I02A 2BSTB 4R2GD 1F11A 4WSGA 2W65A 2Z64C 2MOVA 4MBOA 4EAEA 1Z5YD 1HC1A 2Z31D 1QBLL 2ZZUT 4YHNA 3STBA 3OKOA 5IQLA 1VGKB 5IB1B 3S5YA 5FXCH 2R2HA 1H15B 4Y5YA 1E5YA 4N9OB 5FAAA 3SJVD 2CR6A 1PLGH 1UXLA 3L3KB 5E9DE 4DGVL 4U0RB 1MIEL 2YD6A 2G75B 2Z4QB 4GKOA 3OKOB 2E8YA 1U93A 5FM5O 3N55A 2A2QT 4KKBC 2GC7C 3GWJA 2ADIB 5H94B 3T0WA 1M7DB 1U91A 1QFWI 3JWOL 3ROLB 1K8DB 1XDTT 3TFKD 4OCRL 2PXYD 2JK5A 5IFHH 1HIMH 2WZ5A 1KCSL 4JRYD 1HH9B 4JLRB 2VDKB 3GJFH 1QSFB 4NZDA 2ZOLA 4JDEB 3BKYL 3MA9H 4KK6C 4NZTL 1ZHKA 2V7NB 5CKAA 2OSWA 4EBQL 2R2EA 2FEEI 3CC1A 3ET9F 4N3TA 3PWPE 3U25A 2F7RA 3FO9A 3ZDYE 4DK3A 1U58B 2OV0A 1EJOH 1BXAA 1GGTA 5CF3A 3F7YB 1MF2L 1MJ8L 1KBPA 4XI5C 1W6LA 1A7PH 4UV4L 3ZE1E 3L2LA 4M7ZC 2Q0ZX 4HD9A 5CZVH 4PJ8A 4NZTH 2EVGA 5DLML 4Y88A 1YPZF 1ROCA 4HPOH 3FC8A 3HE6A 2XWTB 3OZKA 5CJ5A 4P0DA 3H9SD 2BINA 3TBWB 1CFVH 2VLKA 1GHFH 3DJTA 4IDJL 2YKLL 1TQWA 3ATEA 4E9LA 3JWNG 1G9NL 3CLEH 2BY2A 1LEGA 4HALA 1VKXB 4PBWD 3EG9B 2ZUVA 4HAFA 2VDNL 3T0EC 2H1XA 2P5WA 2VAAB 3QRLA 2BY1A 1KGUA 3NCJL 4WEMB 2F19H 4Y19D 5DTFB 1A4AA 1YEDB 3MFFA 5ADOL 3ZTDC 5DHVA 3MLUH 3BDYH 4JR9H 2F08A 5T5FA 3ZMEA 3ES6A 4I0KA 5I28A 4RRPG 3LS4L 5CLWA 5E5UB 4FG2A 3GZOA 5ITFB 4N9GB 3P30H 4ZZKA 3SKMA 1Q1PA 1Z5LA 2X2YA 2O26U 4FLRA 3TA3C 1ZT4A 4YGVB 5HD8C 1ZLSH 4WHYH 2R0ZH 3QS2A 4X7EC 3NVQA 3G3LA 4C56E 2VXVH 4UT7H 3TT3L 2AXGB 3F83A 3V55A 3PG2A 4P2QA 4BH8B 4S1SH 4FFYA 4WJ5B 1EEYB 1KY6A 1Q9WB 1LDPL 4JFHD 1P4LB 3WSQH 5DEJA 1RU9H 3BX7C 4DP2X 3UAFA 1SXZA 4PJAE 5KVFE 4ZW8A 2O61B 3LVTA 3MV7E 2DYRB 2ZWKA 3V4VB 4EE2A 5J6GB 4QXTA 1CVSC 1FSKC 1AE6H 2AXGA 3MRPB 2ENJA 4TUJB 4AY0A 2IO5A 2JI3A 2HKAA 4YBHA 5DHYB 4FJYA 3WN5C 5JW4Q 3A3YB 2V2WB 3CK0H 3ZZLA 3KGTA 1NCWH 5SWZA 1PG7L 4D0BA 1DLFL 2CDFA 5HI4D 2AJ3B 3TYFB 3NACH 1JI2A 2FJGB 1AD9A 1KXQE 4MMYA 4P4KD 3ZN6A 4TUJA 2EYTB 4CJ1A 2Y7NA 1AO7B 2XA8H 4HWEH 4XP9H 3IMRA 3Q7JA 1TQTA 5F1KC 2NY2C 3MAWA 2RHEA 3DJ9A 1VFAB 4R26H 4RAVA 2NCMA 4RCAA 4I9XA 5TF0A 5I15L 3LZNA 4N2AA 3BESR 2E76C 3IJYA 1ORSB 2CO7B 1MAMH 3V4PA 2CUHA 2WUBH 1XH3B 1BFOA 5AOMA 2N7SA 4PMEA 3UTPD 5E03A 4R4FL 3VA2C 5CP3H 2A6KA 5I8CB 3LPGA 1ZLWH 2GY7B 5AOKA 1IM9B 1FLTX 1XZ0B 1LYQA 2CBPA 5AVTB 1JS4A 2X28A 4MXQD 4P59H 4CSPA 5DT1L 4S1RL 3KL3A 3UO8B 2R29H 4LAJH 3AS3A 3RWHB 4B0MB 5BCAA 5JOPE 2QHRL 1Q9LA 1KG0B 4MYPA 3TO4D 4IYKA 4MA3B 1UACL 2H2SD 4KJWC 3IJEB 1B2YA 1CB4A 2OMVA 4XNQB 5A16B 1YNTB 5ANMB 2AJVL 1ACCA 2HSIA 2FWLB 2Q6WB 3U46A 3P4LA 5FM5M 3MMEB 1J9SA 5EIIA 4GAGH 3VXUD 1R0AL 3WTUA 3AREC 3HN8A 1KPVA 1SYSA 2R15A 3JTBA 2ESVB 2E74C 3EJZD 1E50A 5GGSB 5EULV 1NCAL 2P5WE 4F80A 1W8NA 3LZPA 4NFDA 4L8CB 1WFMA 1TZGL 3QDME 2B59A 1VHPA 4A2DA 2GK0A 4YSPA 2DH2A 4N5EC 1UOLA 2P42B 2NUTA 5IKCA 2ID5A 2FUQA 3QPQD 4YHNB 1MF2H 2P5WD 3FS9A 3ULUH 1S7QB 5HYEA 5EB9A 4LP8A 2ZUSA 1TZOA 1S7XB 2BFVH 1D7BA 5B4MD 1NEZB 3MJ8A 3RNKB 3MUUA 3VXQB 3A6CH 1A65A 3HS8A 4FZEL 3RJOA 4G9DB 5KYUB 1DYZA 4R3SA 4XMPL 4NNXB 2GITB 1SYVA 1RUKH 1I7UB 1TZIB 3AS2A 1WFTA 1QP1A 4GG6E 4Y1AA 4XCCH 2G75A 3LQAC 4LLQA 1KTCA 2OTWA 2QL1A 4WI2A 5AALA 2KERA 1XF3B 2GUYA 5D7LE 5DFVD 1HINH 3PWJB 5KVDL 2VXSH 1T80A 2BMKB 2Q9OA 4LHJB 3O8XA 4F2ME 5EC2A 2YC1A 5I1LB 5C0BA 2OX5B 3KPSA 3SDCA 4HFUH 4ACPA 5SX5K 1ZLWK 3OPZL 3BWUC 2CJUH 2YJQA 1WDAA 5F97E 4K23L 4DW2L 3WO4C 1HNFA 3BCFA 4P57B 3RZCB 3EFDL 1B6UA 4F33A 3TA3B 4C83B 2IDQA 5JHDE 3S0PA 4HUWA 5LXGL 4G6AC 4HFUL 2WKOA 3AG1B 3TZVC 2NX5E 3UO1H 4HF5H 1AGFB 4AXWA 3FO0H 5FV1L 7PCYA 4GRWE 1G9ML 4PRID 3LIZA 3PGDB 2VN3A 2Z35B 4JKMA 4BFIA 1KLGA 2YA2A 4PJBA 3LN4B 3OC8A 5T1KD 1NGQL 3H9SA 4Q9RH 2UXVA 2W91A 2HT3C 3FH8A 2O6DA 4K8RL 3WN6A 5E23A 1SDYA 1P5VA 1V5JA 1N6QH 4B95C 4DEWA 2YGPA 4NAQA 4LRIC 4I9WE 2K4WA 4WUKL 5TDNA 3VFSB 2BCKB 2R29A 4NOBA 4YSRA 3IWVA 2WSDA 4IMKC 3ARQA 4XN8A 3WFEL 5D93B 4YDVA 1P5VB 4G5ZH 1TEYA 2CK2A 3TJEL 4CVUA 1TO4A 1PX4A 3PQYB 1JF5A 3BQUD 5E6IB 3L3JA 4M43H 4TMPA 3C6SB 1KIQA 4BQ6A 1C5BH 3WIHL 2XZAH 1FIEA 4PREB 2MEJB 3LD8C 1G9HA 3K74B 2ENQA 2P43B 4H1LA 3HCVA 4XNYL 2OMUB 3NIFF 2FYYA 5INDA 5I8OH 2AQRA 4MB3A 4U6HB 4Y5XC 1T6BX 4Y5XA 5J12B 4OV6F 1RUAH 4TVPH 3SIKA 8CGTA 1JXJA 5IR1A 4LHUD 1XSOA 5FCUH 5HDQL 2LV4A 4TRPH 4XXCA 3HMXL 5E9AA 3RAJH 5HYSB 4HP5A 4YHYC 1FZMA 1R5IA 2BOLA 4TULL 3PRZA 1ZPUA 1XGQB 1OT1A 4R4FH 5IROA 5IEHA 1FIGL 3L7FA 5BZDA 1G7MB 2E86A 4Q9BA 1ZJAA 4PVNA 5BXFB 4NHCL 1XH1A 3V4UL 5KS9E 4XX5A 4U0RC 5HYJE 1SGKA 4AQEB 4HFWB 1YY9D 3NJKA 3WFZA 5FDWA 1OAYL 4XPAL 1BZ9A 2UZPA 2H0JA 4S1RH 4L3EA 2HAZA 4G7VL 4PRIE 3MJWA 4JB9H 5DXWA 1IM9A 2I24N 4XCNA 4BINA 5HVHC 1J5HA 3QAZB 1JGIA 3ML8A 5DR5H 2EDQA 1FIGH 3O45A 1SOKA 5DYOA 1F13A 4WY7H 1U8PA 1CXHA 3AQZA 3L3OA 3MR9A 3OMAB 2BY0A 3POHA 1BXUA 4JQIH 2DIAA 3C2AL 3DYPA 3FUIA 3X2QB 2DKMA 5CSBA 4DESA 4GG8A 2AJZA 3C8KA 2R1WB 2VLRB 1MFDL 3A67L 3GRBA 3D39B 4FZ8L 3TA3D 3GBDA 3QJTB 4NQCE 5FA4A 2FATH 2VUOA 5CJXA 1S7XA 1FBIL 2HRHA 2WY3B 4K3JH 2HTLD 3GXMA 4BFNA 1MCOH 4B9JA 2JF1A 1E4KA 4LASL 2P5EB 1WFOA 1CU4L 3TASA 1YMME 3PAUA 4CADA 4GSXA 2EXWD 4AQAA 3FRPB 1Z6JT 4HGKC 4QRRB 2NTFA 1I9IL 1LD9B 1J8HE 1I1AB 4PJIB 4NM4H 1BYOA 3ULVL 1QLRA 1OAUL 4GG6B 1NCTA 4PJ5B 1YYML 4HLZH 3Q3GB 4XGZA 4NCC1 1BAFH 4KK8C 4CADB 3NJIA 3NIGB 4GBXD 4PGDA 2J12B 4JY4B 4YC2C 2K7PA 3ZE1B 1RLWA 4H2AA 5TQ0H 4WO4A 1T1WA 4LBAA 3GSQA 4WI9A 5IVXA 4ZPVB 1QOKA 2RFXA 3Q05A 4PPTA 2CIIA 3OKKB 4OJFL 5A2BA 2HVKB 4APQC 2EKSA 4GKNB 4UIKL 1MNNA 3FO1A 3TIDA 1QHPA 2BOCA 2FECL 3FO0L 4LCWE 4P59L 3MRLB 1OIOA 5KW9H 1HE8A 5AW9B 5J5EA 3H9HB 5KYXA 3N44F 4L5FL 5DS8A 2ETWA 1T0MA 2EDKA 2ZWZA 1P5UC 2AMGA 4F92B 2WAQA 5ADOH 1C08A 4JPSA 2UUDH 3E0GA 4L37A 1A6VH 3GRWL 4N24A 12E8H 3DRTB 2JB5H 5IESL 3MRMB 3S96A 1J8SA 1U8IB 4XVUC 2VLKB 1KLFA 1I9JH 4E9YA 5HDBE 3OWRA 3ARRA 2B5IB 4YFEA 3NIGE 3ZZSA 4KHTL 3UACA 2V7HA 5AB0A 3RB5A 4HOWA 4YS4A 2WCSA 3O2VH 3KPRA 4MBRA 1R0AH 5T5FL 1CWVA 3ZE1F 5AKTA 4QHNA 5CIPA 5C7XH 2ADGA 4JG1H 3RX7A 1ZAGA 3SCMB 2VR7A 1FRGL 2VR9A 4WW2B 1DQLL 3H2QA 4LLUB 1UCBH 5C0RH 2CA3A 4ZTEA 2XFGB 3MRJB 3IDJA 5DJ0B 2LU3A 3EJYD 5GRUL 3ZRCC 4ZMYA 3DROB 1VB9A 1PAMA 4ISVA 4YIQB 4GI8A 5LB1A 4PJ8C 3THMH 2R59A 4ZO8A 4A37A 4O51B 3WAKA 5EORH 5C86A 5E1IA 4J2QA 4K71C 4EF3A 4F9PA 1OAKH 5DUBB 4A7TA 2Y69B 4OVUA 2GIMA 4TRPL 5KBNC 5I1EH 4X8XA 5IZ7A 1F4WL 2Z4QA 4NWUH 4G7QB 2ZCZA 2RCSH 1QZNA 2CGRH 2FHCA 1RK0A 3TPKA 1EVUA 4IMLB 3HG2A 1A3LH 1BLNA 1TMQA 1XEUA 5F0LB 4BCZA 3RGHA 5EU6B 1DUZB 3W9DB 2Z8SA 4IBQA 4IW4C 3BGFB 3U9UB 1AGCB 4X99A 3CDYA 2EIMB 1UWEH 4TQEL 3CFTA 3V6ZA 1ZHKB 3SKNB 1JZHA 4J3VA 5LN8A 2YRZA 3FBKA 2EE0A 2Y7MA 5GRVK 4X0NA 3INUL 3F5WB 3ZL2A 4OLXH 4PFEA 5BQ7B 4FMVA 3P77A 3DX9B 1J7VR 2OA9A 4NNPL 3L81A 4FG6D 4UQDA 4N8VB 3E9UA 1BCIA 4UT9A 2C9UA 5B1CA 1MLBA 4ZW5A 3UG4A 4WCYL 1U8NB 3VGAB 4MNHB 3OL2A 3I9IA 3MLTA 2NY1B 2D3LA 2R29L 2CUMA 4Z5RB 1EHXA 7FABL 3DO7B 4N2BA 5HHQB 4WWKB 2KZ1B 5SV3A 4NO0D 2BWQA 3X12A 3R8BB 2AK1H 3IGKA 2MHAA 4U1SA 5GGTH 2YXMA 1AZZC 3MUY1 3QJQB 3LS5L 3X3FL 2CKBL 2D03L 4FP8H 2YFOA 3FU6A 3IE9A 4XWOC 5A2FA 1AR2A 4UIMA 1YQVH 3BPNC 3LZFH 3P3RA 3OB0K 4IRSA 1XGQA 2PNDA 4HCIA 3ZBMA 4IHBA 4TL5A 2NLJA 1USQA 5JHDB 3L7EA 2R2EB 3B9EA 4QKXB 4MVBD 3TV3H 5BMFH 2DF3A 4RX4D 1TZGH 2CM6A 3WKMH 3NGBB 1E4WH 1JDCA 2CHNA 4ADGA 4ACTA 3QZBA 2A9NH 3NZUA 4TUKH 4DAGH 2ZWYA 2QV2A 3NK4A 3RLSA 1GZPA 3HAEB 1GC1L 4GJTB 1QLEB 4B9GA 4F93B 3ZKND 1A4KA 3L95A 2WXGA 1YYLH 2ZJSH 1G4RA 4GRMB 1EDYA 1X4ZA 4L1DA 2VKWA 4G43A 4RGOL 4EJ1C 1KYAA 1QTYT 2ZYHA 3U48A 4DP8X 1XCWA 4CVWA 4ZRGA 3PDDA 1KFAH 5ESVB 1T7VA 4K5NA 4M8QA 3ARSA 1X9QA 1UJ3A 3ZKXC 2F7OA 3OMNB 4LMQE 1UM5H 3GMOA 1YA5A 4EI5A 4M5YL 1FAIH 1ULVA 3UC0L 4NZRH 3S5LB 2YGNA 2FIKA 4BFJA 4P2OA 5KN5A 1DN0B 1PZ5A 1EDHA 2VDRB 4UAOB 4MFHA 1UA7A 1A64A 5FYKU 3QIUB 3IU4L 4MXWL 4UQIM 3IGFA 5J11B 1OANA 3G6JF 3D25A 3KLDA 4N0FB 4OZHB 3S5ZA 5MENE 3GK8H 3TO2B 2NY6D 5EU6D 5MEPA 2ERJB 3BDXA 1QSEE 3CFBA 1J0JA 3LDBC 4AGLA 2IXQA 4ZUVA 4P5TC 2ZXEB 3T1FB 5CGYC 1WAAA 3U7WL 4ZO6A 3ZUCA 3KPOA 3Q44A 4GXUN 3FZUC 4UM9D 1E28A 3RFZC 4OZ4B 2AXFB 2A7BA 4IQHA 1DUYB 1N5AB 1OF2B 4FQLL 1UYWH 4RSYA 5JXEC 3ZDYF 2X42A 3RDTC 5I1HH 2QQQA 2OAAA 2GAZB 3U9WA 4GEIA 1KJ3L 1Q1JL 4RVBA 4NQEA 2XG4B 5J57B 4MJJA 1GMIA 1MUJA 1B4JL 4MDIA 4PRAA 3V7MA 3U30B 5M95B 1JHKH 1M3JA 1MZZA 4B9CA 2ZCLL 4NQDA 4XBEH 3P4MB 4FZ8H 1UM6L 1KXVC 1P2CB 2XWZA 5KZCD 2XPZA 3GJFK 4R0LB 1DJXA 4PJAF 3VFTB 2ROXA 5K93A 3HBQA 3QZLA 1WBZA 1E4KC 2YK1L 3RB7A 3P9WB 5JYLA 4AT6A 1PKQE 5BJTB 2CO7A 3DHUA 3N06B 1GGYA 3PP4H 1KDIA 3QQDB 5CBAA 1A8ZA 2DYPB 3MNZB 1BHGA 5BO1H 3F6JA 4K9JA 5T1LA 3IDIA 2JKNA 5D2LA 3QWQB 4BQBA 1GPOL 2Q8AH 2NY0D 5EBLA 3RL2B 4R5VA 3U0TB 4CW1A 3ZGIA 3CZJA 4OSUH 5ANME 1NGYB 2OJEB 5MEQA 3R4DA 1RHFA 2OZ4H 5D9SB 3RNQB 4YDIL 2J44A 3B6SB 5LG1A 2W92A 2AC0A 3NQKA 1NH6A 4L4TE 3F65A 3RWHA 4AL8L 1PLBA 3QIBA 2AERT 2YUXA 4M7JL 5EO0B 4PJEB 32C2A 4XVJH 1AIZA 3VXTB 1HHGA 1DEDA 1FSKB 2YD3A 3V4VA 2HTKC 4X6CF 1MFCH 5ILTL 2Y1YA 3Q5OA 1F6AA 4MMXC 4NI3A 1TEFA 2EJ1A 5HDLA 1IFRA 1BAWA 3IDXH 4HIQA 4G8GE 4JL1A 3S36L 4RAUB 3DX7B 1XF2B 1XF3A 4MXVF 3CFKB 4KY1H 3EOTH 4H1LH 5E56A 1TVDA 1KEML 4YNYA 1BVNT 3FFCB 3RY5A 4JHAL 4F7CA 1ZANL 4M6AA 3HC3L 5FGCB 4J7RA 3NSXA 1E4WL 3RVUD 4FQCH 3BCDA 4JFFA 4HJEA 4G1EB 4ALAH 3VXSA 4BH7A 5K9KA 3PL6C 4Z7WF 3E8VA 3QIUD 3JWNH 1I8MB 2YD5A 4BSVB 5A6MA 3WTVA 4P06A 2E7HA 4X5XB 4RISH 3V0DA 5HPOA 3DGGB 2GTWB 3FQTB 1KN4H 3QI9C 4C59B 2MKWA 1S9YB 1JV5B 3FUEA 1S9KC 2N1TE 4OV5A 4KOBA 4FCHA 4NQSA 3SPGA 1K4DB 5JIQA 5G4NA 3O9WD 4P2RA 1TXKA 4U7KA 3QJOA 4PS7A 3UEQA 2YPVH 2WXQA 4YR6A 1TQCB 1YO4A 3DVGA 4P4KB 1DP0A 1WJ3A 4R84A 2Y2WA 3THML 2BP0A 4M5YH 1FZJB 5EORL 5IBTH 3EOAA 2NYKA 4DO5A 1PZDA 3IF1A 5K39A 4LSSL 2GJJA 4G8FB 4PW9A 3JT0A 3I6GB 1Y1DA 2Y5QA 5ACZA 2IPUK 1A2YA 1A6ZA 2WVTA 2YD7A 1EZSA 4IRJA 4NM4L 1MRFL 2DQDL 2R39A 3B2VL 3ZIYA 4DF9A 5T3ZL 1UQSB 2VZOA 1TCRB 1MVUA 2JTDA 4FNPA 3VQ1C 1QEWB 5HHOE 3FSOA 3QQ9D 4FFWC 3OZLA 4CU6A 2ADIA 1O75A 3JVFC 4LOUD 1U92B 2YGOA 3V0IA 4FFZL 2EDNA 1M9WA 2BP5M 4U1NA 2JJSA 3GD1C 4UOW0 5DRWB 1Z5HA 1IBHA 3CSGA 5H2BA 3C75A 1P7BA 2PP7A 3S5LG 2LU5A 2B1OA 2YQBA 3RIAK 5BRZD 3V5HB 4HBCL 3CFJA 1KTDB 1VFUA 4GQ9L 5D7IA 1G1CA 4JK0D 1OPOA 2YEZA 4ABQA 3MBEB 4GINA 2IBZY 4O4YL 3EO1A 2EINB 3NSDA 4FA6A 2YD2A 1CLCA 1DBKL 1MJ8H 2B9BA 2JIXD 2N7BA 4U1JB 4AOFA 2VZSA 1SYVB 2GITA 2MPAH 1DQQA 2WTPA 3EYOB 1NJ9A 5E4AA 5LBVA 2XV3A 4G82A 1EHAA 1Q9OA 2F5AH 1MW0A 4NQDB 1BMWA 3N41B 1WA1X 3HG1D 4I5BA 3HFFA 1TJIH 2X38A 4MQTB 5IW1B 2O4EA 3K4DA 4DGIL 5C7XL 1QUPA 3MCKB 5DQJA 1OD7A 2ZKXA 3I9GH 1WGVA 3BE1L 3BKMH 1ONQA 5JPMA 5CO1A 1DUYA 1Z32X 4JM2B 4Z8FH 1AYOA 2WK2A 1BP3B 2Z31C 5F7BA 4QWWC 4PJHA 1VGEL 3FPXA 4Y4FA 4YDKL 3LKOB 4PGBA 3HKZA 3LJ3A 4XVTH 2YXWA 5CILL 5E6IC 5I6PA 5GGVL 2CLZA 4S1QH 4UTCA 4OF0A 4DO6A 5C08E 1CGYA 3NZ8B 4ONHA 2WWNA 2E9GA 4OLZL 1NGZB 3VX1A 1JF1A 1KBBA 3GHEL 1OSZA 4HUNB 5AG8A 4NO2A 1V54B 1PD6A 3TBCA 1YEDA 1RU9L 3MFFB 5TQ2L 2PXYC 2XC8A 4TVPD 4GP5B 2A77L 3QUML 4FXGB 4WI5A 1UB6B 5EIVA 5E4OA 3ARFC 4Z23A 3RURA 3EHBD 1CGTA 2JCCE 3ILQD 4KUCD 1NIEA 1IBZA 3F7KA 1KZYA 1MFEL 3G5VB 5D1XD 5FO7A 4KGJA 5IREA 4IOSD 4OJEH 3FQUA 3VD3A 1A9VA 2Y06L 1GXEA 1DJZA 3F6IA 4HW6A 4NCDA 1QR4A 4U6XA 3MNVB 4GSUA 4M6ML 3EFOB 2NUPB 4C4BA 3BZEA 4Z3HA 3G6JA 5EN2B 1D5MA 3NGBC 2P28B 5IP4A 1WA2X 1MN4A 2EYRB 2QVKA 4KKCD 2ZQKA 1OOAA 2UWEA 1XTMA 3K72B 5CEXA 3OG6B 4N8VA 5HVWA 4WEUD 5DS8B 4N25A 1TO5A 1EMTH 3MQIA 1UXSA 5HDBF 3PWJA 3NAAH 3L45A 1AS8A 4M48L 1M7DA 2GCYA 1Q1JH 1AXTH 1OLZA 4OI7A 3SGJA 4U2ZA 1IM3D 1C1EH 1A4JA 3MBED 1CDBA 5TE7L 5GS2H 1GAFH 4JY4A 1PQZB 5C09B 4ELMF 2DQIL 2A9NL 4TUKL 3PHOB 5IF0A 4MB1A 2R4RH 3CFIC 3QH3B 4HEMA 5FF6B 5GRZA 1NFIB 2KLTA 5AUMB 4NQQA 5F88A 2ZYSA 3VJ6B 4A2EA 1TETH 4A2LA 4CC4C 3BGAA 1UFUA 1EANA 2ZNWA 3I50H 1I82A 2AZAA 3ABLB 4ZBJA 1CFTB 4WFFD 1J5IA 2DEXX 1UD6A 3NPSB 2QVIA 4KZEL 1MPAL 5E2WH 4TULH 1AYRA 1ZLUK 5D2LF 1UM4H 2FSEB 3LZOA 2F8VA 3Q8CA 1CZ8H 1J86A 1Z9LA 2R1WA 1GGUA 4N8CH 2OMYB 5D4JA 2WXLA 5EV7A 4F2EA 1F2QA 3TN0B 5C71A 1R75A 2HWZL 1WD8A 5I0DA 3EOAB 5ANMA 4XZ4A 1HSBB 2BJMH 3NFNB 4LZKA 3WKQA 4DUVA 1YEGH 4Y9FA 1UM4L 1LHZA 4GW1A 5EEYA 2YD0A 3N42B 5BUAA 4QYOB 3JTSB 2XTJB 4ZOBA 4ZMZA 2Z7YA 1L9OA 4J12A 4X6CA 3DO3A 3QUKA 3GRWA 4J3TA 2EEAA 2NTFB 4YHKH 1SQMA 1I9RH 1A9EA 1SXSA 2DICA 3D07A 5KWYC 4JPQA 5CLXA 3I9GL 2KQMA 1ES0A 3WFHA 2F7QA 2Y6SD 2Y9RT 4NZ8A 2X6MA 3PJSB 2Y07H 4JEGB 1N19A 4ISVB 4YIQA 2K9FB 2MOGA 2B77A 3WE6A 2KMWA 1BA9A 3DTUB 1IVTA 4OFKA 4OGAC 3SOBL 3ZDXE 4E42A 4K3JL 3GZPA 2WUCH 2L4OA 1WIOA 2G3XA 2FJFB 2X1WL 4PYGA 1WBYB 4IBLT 2DWSA 2BZDA 4U7SA 3OKKA 1ECYA 1NGPH 3FFCE 5DD3H 1F00I 3TO4C 3B2DC 1L9RA 3FU7B 2IOIA 4F8LA 3VE0B 1HESA 4FABL 5EOTB 5KVFH 1HEJC 1BZ7A 1GS6X 2Y72A 3WMSA 1XBRA 3IDNB 5I23A 1D7DA 2WBJC 1NCDH 4PHXA 3U6XA 2H0EA 4G7SB 2PTUA 4TM9A 2BNRD 4JREC 1XX9C 4YE4H 1FVDA 2PYEE 2WXMA 2M83A 2YPKA 2B1AH 4PJ5D 2K1MA 3H9ZA 4M9PA 4MDIB 2CLVB 3T0VA 2HXAA 2O6CA 3SBWC 1JPTH 2QDWA 4FLHA 3N1PC 5TGBA 2A73A 3GSRB 4UT7L 3UBFA 4JHWH 2XYBA 3V4LA 3FUNA 3U0PA 3HZKB 4N0CD 4QT5B 3QPXL 5GZOA 1HIML 1U0QA 2QSTA 3DOHA 1PD1A 3DUHA 4ZO7A 2FQDA 3X1GA 3FU9A 3GIVB 1SY6L 5EWIL 3A6BL 1DO6A 4WUKH 4DSYA 1NUFA 4RFNC 3GMLB 1XR9A 1PKQA 1Q9KB 4FFZH 4G43B 1GYCA 2DB8A 3SGEI 3X11A 4ZS6D 4YVNA 4AQOA 3S9DB 4F8QA 5I16B 1MFCL 2ZXCA 2WIIB 5ALCH 1CFQA 4JVUA 2AXHA 2EP6A 3S8GB 3PV7A 3OSKA 1FNGB 2UVEA 3A0OA 4G8GB 1L0XA 5EUOA 3SD2A 4U3CA 3RJDA 1RPUA 1L5GA 2VW4A 3GBLA 4B3VA 4DKEL 1MQKL 4WTZG 5F7DB 4I1NB 5I8OL 5ALBL 4RGMB 3WCYA 4IBSA 4ZTPH 3QG7L 5FO7B 3OV6A 5AW4B 1NUDA 2X6AA 1PY0A 3HA0A 1IGYA 4BXSV 1VSCA 4P3DB 2QFRA 3M8OH 1MAML 5ABDE 2IH1B 4P99A 5I1CH 3D4CA 4MD5B 4DTGH 3CE1A 2R69L 1S7WB 3K81A 4JR9L 1T4WA 3NFPB 4HUUA 4KK5D 1RZ7L 2OR8A 1P1ZB 5LVEA 3HLAA 4C56A 4GMSL 4ZUVB 3PUCA 4GRMA 2J8UB 4K9EL 1G6VK 1YEIH 3T3MF 4AEHL 3V5DA 3AW5A 4NC1E 4K94H 5JW3L 2DW5A 3T0AA 1KCBA 3VMPA 3WIHA 1MXGA 3PDOB 3VB8A 4H4NA 1ZV2A 4NIYE 1UJTA 1UACH 2Q7AA 2R69A 3FFOA 3LKQA 4NCC2 3ULUE 2ZIDA 3ZKQD 5K9QG 2NT1A 1I1CA 3SO5A 3I74A 1ZHLB 3QA3A 4FNQA 2WP3O 4TSBH 3PWPB 2WQUA 3BFQG 3AY4A 4MJ6B 5GGQH 3Q2WA 4QCIA 3FCSA 5FHAH 2FGZA 1FO0B 1JWMA 1ZOXA 4G8EA 3INUH 2E5EA 2BSSA 1ZHLA 4GUPB 3BEWB 3WMPA 4HJTA 3B9KC 2YRBA 2F68X 2NCEA 4EIGB 4KWUA 1PX8A 2WJ7A 4FFYL 3HNSH 2AZUA 4HUMB 5TQ2H 3VW3L 1XCQA 4KZEH 4JVWA 3TXAA 4WIQA 3ZY7A 3BKYH 3MA9L 3STLA 1I8UA 1AMYA 3D1MC 1HVXA 2B4CH 5AW8B 3V10A 4KUCF 2ZOKA 2PYEA 3UPCA 5ID1B 2GJPA 1BZDA 1ETZA 2NY1D 5I15H 2X53A 1TVBA 1N26A 4G6JL 4QHUA 3DMMA 1CU4H 2CNYA 1TT6A 4NRXB 4XNBA 4BZ1A 1KEGH 5INDB 1LP9E 1MI5D 1DN2A 4JJ5A 5GRWA 3VFMA 3FMGL 3OZ9H 3UAEA 2LLLA 3HPJB 3MRQB 4HIXH 4M8VA 2D4FA 4G6JH 4PSRA 4KVPA 5D7JD 1BD2A 3LKNA 1XGTA 1ETA1 4EDXB 1VAHA 1S78C 4BKLB 1FL5B 3OJDB 1DFBL 4I3GA 1HTYA 3SE9L 1EGJL 1CVRA 2DLFL 4WFHD 4L3EE 4PRIA 3T3PB 1BWMA 1TTCA 4JHVA 4PRNB 1SOSA 2VDKL 1M7IB 3U4BH 1KIRA 1MG2C 2X7LA 4BA8A 4DFIA 2C9SA 4BDVB 5I1DB 1KACB 4PJEF 1T03L 3BVWA 3HRZC 1TQBC 4P9HL 3UCQA 4QOKE 2VWEE 1AD0A 5E8PB 2VXUH 3C8DA 1NGXA 2QVTA 3NABH 3VFWA 1AO7A 4ADIA 2ZCHH 2WW8A 5IJKA 3HZMB 1VFAA 2KLRA 2XV6B 4F24A 3HZKA 1QABA 2Q76B 1TETL 5B22A 4H1LG 3QXAA 2LVCA 3MV9E 1EXUB 3HPLA 1K4DA 4NZRL 5T33L 2C9XA 4ELMA 3D51A 2H3KA 1FYTA 2Q8BH 1NBCA 2JXMA 3EDDA 3VWJC 4EQ3A 3GMMB 2H26B 2YMXH 2OYPA 3NABL 5T1LD 2YAHA 4DZ8B 4L8BB 5F6HJ 4Y4FB 4OU3A 1SEBA 1PFOA 4KU1A 5AOLA 3OMZA 3FOMB 5FFOA 5AAMC 2G5BA 3O6KL 5D6DA 1SYSB 1ACYH 1PS3A 3GGWB 5J6GA 3KPPB 1PQZA 4ANXA 3P0VH 3QNZB 2XG5B 2FBRA 4V11A 4TSCL 3HZ3A 4UTBH 2YRPA 1BBDL 4AQAB 5FM4A 3I3DA 4WK0B 3FU5A 4ZAKD 5DC4B 3LIUA 4MA3A 2R0KH 2FQEA 1PY9A 3MRGB 3QIWC 1OV8A 4W4OA 1YNTA 1RZ7H 1Z5LB 2Q3AA 2EYTA 4JDZB 4HDIA 3CX5K 5C7ZA 3SCMC 3N50A 1B3JA 4FMKA 4J1UB 4N2FA 5IQNA 3HEIB 1MFBL 3RVWD 4OD1H 2BHUA 3T8XA 4D2NA 3B3BA 5FECA 1DJYA 1FF5A 4APQD 3C8KB 4N90E 4A7UA 2YD8A 3L1FA 3AS1A 5DMIL 2GEEA 4XBEL 3QQ3A 2OMTA 2DYSB 3NTCL 2KI6A 3EUDA 4JFPB 1Q90A 1XF5B 3BKCL 3O6ML 1WO2A 3FF7A 2ZOWA 4K71B 4XTRC 2AJYH 4PJAB 3QUZB 4WNSA 3DWTA 4CMHB 2IG2L 4A7QA 2NW2A 3VXSD 4QYOA 1A1MB 3ROOB 4ERSL 5DSCB 1M6UA 5HGHB 4FNUA 3UP1A 2DYPD 3ALWA 4OR1A 2AVFA 2CRZA 5CBEA 3RQ3A 3QVAA 4YQXH 4QRRA 4IDLA 3P9MB 4WCYH 3NCMA 4ZUWA 3B7YA 1JBJA 2D7QA 2EDFA 4UNTA 5DD5H 4EEEA 5B8CA 4W1TA 2K8MA 2Q3ZA 3FO9B 1EXHA 3QXDA 3VD5A 3CBRA 1WTGT 2EE3A 2JK5B 3D69A 3FQWA 3QUXC 2HG5A 3A4EA 1NBZA 2I27N 2X4NB 1BLIA 4U1LA 4M6OH 4NOFA 3QJSB 4UV7L 1IGJB 5I73C 5IHLB 5F7FA 2AGJH 5F8QC 5IMMB 1A6UH 3PHOA 4BZ2A 5GSVB 5JMOC 1UTDA 3N1MC 3RFZA 3PYCA 1FBIH 1T0NA 3ATDA 3ZQXA 5T3XL 3EOTL 1M2VA 1O0VA 3TZVA 4LSUH 5D2NA 1SEBB 5AZEH 4WF7A 1D3CA 4QHKI 2ZSWB 5KSUB 3MV11 1IAOB 4BWUA 3OAZH 4JGMA 3UAJD 1LGVA 3D30A 4GBXA 2K3HA 2IBBA 3VM5A 3MV9A 3FRUA 3ECQA 4HPOL 2DM4A 2Z8WC 1BD2B 3B4NA 5F9WC 2IQAB 3BAXA 1G5AA 1X5KA 2R7EB 3MCKA 1K2DB 5GRYA 5HY9A 3BO8A 3QYMA 3HS0B 2CGYA 1X3DA 5DHVB 4ZW7A 3G04B 1DQJA 4B97A 5ESQB 1O7SA 1U8PB 3L3OB 2X40A 1LK3L 2X4RA 3ZRFC 4C4KT 1RZPA 2J5WA 5J12C 4NENB 3O41B 2CUIA 3BZDA 1S7TB 4X99B 1T22A 1TSHA 1XCTB 3LEXB 3A5VA 3BZEB 4UOW1 1A0QL 4LSDA 4Y1TA 1I7RA 3NSYA 5BV7L 1HWGB 1U8LB 2J1WA 2X05A 1A02N 5CUSL 2H7WA 2NY6B 2OI9B 4GAGL 3DHJA 4X7CC 4Q6IA 5C3IA 5IJVB 3C6SA 1YECL 4P57A 4OJDH 3BUDA 4QRPE 4APQB 4WENB 4KK5C 4JFDB 4OGYH 4L9LB 1NCDL 4XMUA 3EGSB 3H4FA 3CZEA 3NIDE 4P3DA 5J56B 3VWKC 4B5EA 3FHEA 4O02H 1RKRA 1VPOL 3FQYA 3GSNL 2A9MH 4K8RH 1KLUA 2CMRL 1GY1A 2NTSP 3EYQC 1P5UB 2YPVA 3WHE0 5FO8A 3WELA 5ABZA 3AM8C 4E9TA 3M1BB 1SBBA 2VLJB 2Z92A 1V7NH 4GRLD 4BXVA 2Z35A 1YPZA 4PLJC 3QJXA 15C8L 5E1AB 2YWYA 5SWSD 1AG0A 3H85A 2CK0L 4LO9A 1MJ7L 1WCBA 4OZGF 2VQTA 3CVCA 3EGDB 3OR6A 3P54A 4LF3B 3S36X 4Z7VE 5IOKA 2PWEA 2VE6B 3ULVH 5CGMA 1H5BB 2BSEA 3GTVA 5IT2L 4G9FE 3OGOE 4GQQA 1MW2A 2ZX8A 4QXWA 1E27B 3PUUA 5HHQA 4IHOB 2APFA 3MRBA 4G1MB 1LJMA 2ZUTA 1HQRA 1IV8A 1WFNA 2XN1A 1XQ4A 4MCZA 3O41A 3NIDB 1TYEB 2DIJA 1W80A 2GY5A 3ETTA 3SYQA 1M1SA 3TTSA 3MGTA 1N8OE 1A7OH 1I7ZA 2G9HB 1ZVHA 3KYAA 3VFUB 2WXJA 3UZVA 4YJZL 1JWSB 4JJHA 5IB2B 1P53A 1MCCA 4FQQA 1QPXA 1KGJA 1RIHL 4RRPA 4X2UA 2VZ3A 3HG1B 4HC1L 4LCIH 4XAKD 2G60L 4QOKB 4RMQA 5DZJA 5I1IL 5ES4B 5DO2D 3QXWA 2C3VA 4UV4H 2VDPB 3WTXA 3RFRA 2BP8A 4RBPK 3VTTA 1T66C 4ZMXA 2NY6C 5GQBA 4JM2D 3AG2B 4ZUSB 2XKNA 4MJ2A 1OCZB 2YIHA 5EUOE 4RAUA 5C07E 3UH8A 3VRJA 4U1MB 5M94B 2QGCA 4P2OB 5D7HA 1EHKB 2FH8A 4HV8B 4ZOAA 3ZHDA 2J21A 2YAQA 4I0PB 2E7CA 5IHZB 5T5FH 2F53A 3S3PA 3BYTA 2C1OA 43CAB 3ZSSA 2EDXA 2NY7L 3QUXB 4U31A 1R1CA 3N43B 2X9ZA 1NC2B 3DVNA 3WN5A 3IPFA 4NLAA 2KLSA 4ODWA 3SDDC 2CRIA 3E8UL 5HYJD 4PJEA 1E2VA 4C55A 2F8XC 4M1CC 5E00B 2CKBH 4GG6F 1AC0A 2QKSA 4GQPH 4RX4A 5JQIB 1XL4A 5J9PB 5EHFA 2WB7A 1BG1A 5L0QC 1WQVT 2OTWB 3IDNA 5FGRA 4JFDE 2X1OA 1ZSDA 2EYSB 1ASQA 1WZLA 4N2LA 2WLHA 3KGUA 1OTUD 1FP5A 5LBSH 3KYOA 3GSOB 4H25B 3W57A 4JFDD 3PXJA 1RUQL 4JFYA 4Z76B 4ENED 4KRMB 4H8VA 1E4JA 4KVNL 4XO3A 3SJVB 2UX6A 1JZ6A 5IJKC 1BBJA 1P7QA 5EU4B 3BP7B 1XB6A 2JJSC 1GZQB 3QZNA 2XWEA 4AKPA 5GGUA 1XXFC 5DVPA 3FH5A 3MGAA 3NRPA 4NZUL 3GXTA 1E8ZA 4K55A 4Y4HA 5FWRA 4X4YB 2Y7LA 4X4XB 1UCTA 3DECA 4Y2DB 3Q5YA 1IVLA 4XCYA 3UGEA 1RHHA 3Q2NA 4MB4A 2ZXWB 3KS0H 3FO2B 3OG4B 3P0YH 3FMGH 3TNMA 1QSFD 3TBSB 4C54A 2H5UA 4LSQH 2XIBA 4ANUA 2RTTA 2WIIA 2XQ0A 3GJEA 3IKCA 2ICCA 3L5HA 4G8GA 5AW6B 3W1ZA 5AAWA 1M1XA 4PV8B 2NX5A 4F2MB 4MJ5A 3MGOB 3ZE2B 3QFDB 4OIBA 5K39B 5AL8A 2DQEH 1FLRL 1T0OA 5JUEL 4IM8A 4UU9B 1JDDA 2W9EH 5MHSD 3TBVA 4XN2A 1CDUA 3DYOA 5BV7C 3FRUB 1INQA 4Q9QL 4MMZC 1C8QA 4EZMA 4HH9B 4XP4H 2FB4H 4NPJA 4MZ3A 3PL6D 4N8PA 2R51A 2VCOA 3QIUC 4PS4L 5I8EA 1BQHB 1UKSA 1LMIA 1D5MB 2Y5TB 3O11B 5IOPB 1I8AA 1AC6A 4BSVA 4PWGA 1DANU 1R46A 3GUFA 4YLQT 1ZTXL 4ZD3L 2XWJB 4NQDD 1KB5H 2AJVH 4K0OA 3BKJH 2VLRA 4QIRA 3ZOAA 1QUNB 4LB8A 4M6OL 3UZEC 3BQUA 2ZT9C 5TE6H 2IPKA 5L9DH 4TNWF 3F05A 2WM0A 1C12A 5AW1B 3PXLA 3UZQB 3I84A 1EJ6A 1T7YA 1XF2A 3AFLA 3MRJA 2CGRL 1CL7L 1HKLH 1IGCH 4LT7A 2HN7A 4ANVA 4JGUA 1YY8B 1P4UA 1TLKA 1BF8A 5D1ZD 5AVXB 4V1DD 2EDBA 2XQYG 4MA7L 1BZ9B 1Q8MA 3FF8A 3QORA 2TAAA 1B0RB 2J73A 1EEUA 2F2HA 2XFXA 3QWRA 2IFGA 3VJ6A 1R19A 2AP2A 2BS9A 2JCWA 1YEKL 3SDXE 4NB7A 1URLA 3JV0A 4MZ2A 1DBAH 2XZCL 1NL0L 3W0WD 4RDBA 1SHSA 3POCA 1D6EA 2J20A 2F58L 25C8H 3KYNA 3B8SA 5IMKA 5LNEA 4IHOA 5E6RB 3SY0B 1QAWA 4GFXA 5C70A 5KTEH 4KAQL 5AVWB 5EUKA 5F44A 4TPRH 2MH4A 3VRJB 4G80A 3DX3A 3G5VA 3MX0B 2JB5L 5IESH 2D3JA 5F1IB 3CSYA 2PW1B 2DQUH 4D0CB 5KVMC 1ZXQA 5F93C 4AJYV 1M57B 4X7TA 3DI3B 1G0YR 2XYCA 3GO1L 3I75B 1JGDA 5EOQH 3HOGA 4FQQB 1B2WL 1IARB 4JRXE 2VLJE 4B9ZA 2I32A 1T3FB 4ERSH 1JGUH 1OSZB 2R7EA 3REVA 1DFXA 1LMKA 2DWTA 4FLOA 3VFUA 1DZ0A 1VCAA 3FFDA 3MOBL 3O2DA 1FN4B 2QJDA 5TDOB 1KULA 4M8QB 3MV7B 3N1FC 4PJIA 3GLDA 5LXGH 3LVEA 3TC9A 1R3LB 1SDDB 1GOGA 2QLVB 2JKRM 1IILE 4EI5B 1JV2A 4L4JA 1X5GA 2AK4D 3CU7A 5F7AA 1ICTA 4MNQE 1K6QL 4JPKH 2V5SA 2HLAB 4KJPC 4OCMC 1FA4A 2Z3FA 3TEXA 1NAMB 2DWEA 3MJ9A 1ND0B 3FCUB 5C0FB 3U83A 2WQVA 1A4BA 4PWJA 2R1YB 3B2MA 4WZ9A 2ZX9A 5IBLD 2XDHA 3BEVB 3PL6B 1GGCL 4ZMVA 1BOYA 4XP6H 4O51A 3D25B 2XN9D 3L4ZA 4N0FA 4OTXL 4F5CE 4JMNA 4D0DA 2Y0SA 5IT2H 3L3OC 4OFYA 1SRDA 3ZYOA 3NH7L 3KYKH 2R4SH 4OZFA 2FBJH 1K8DA 2VISB 3FB6A 3UTSB 1KTBA 2BFGA 3PV6A 2XOTA 1YPZE 1MJJA 4OB5L 5I5JA 1CS6A 3LKQB 3S37X 1FWXA 2G4EA 1Q9LB 4PP1C 3S37H 5CD3B 5IM7B 5SV4A 3ZL4L 2H6PA 1T4KA 5F9JB 1JZFA 3U4EA 4D8OA 2GPZA 2WXRA 4M1GL 5AYUH 3MV01 4XXWC 2OYMA 5E6ZA 5FYLE 2IMNA 3GSNA 1YNLH 3IU4H 1JHTA 4JRLA 5CCKH 1P69B 1Z3RA 3GM8A 3KPRB 1ORQB 3RWFB 2ZXDA 2IF7A 2V33A 3ZMRA 1D5BB 1K3IA 1E7UA 4W6YB 4FN0A 2OMXA 4NUPA 2A1WH 4HZLA 4CSTA 5KOMC 1SUJA 1RSFA 3AT0A 4P8QA 1D5IH 4NKDA 3JWDH 1AY1L 1NC4D 4JG0H 4NQCB 4EN3C 5I73B 5GJSL 4JHUA 4PRHA 3P3TA 4EXPX 4LLYB 4EPSA 4XOEA 2HLEB 4A6YA 4ADJA 3HRZB 1E67A 2NXZD 4BUQA 3QORD 4KBPA 5I5MA 3V4UH 1T66D 2VDRL 4ODVH 4OI9A 3S8FB 1UEYA 4CNIB 2JKXA 3D2UB 4NKIL 3GEFA 3T6VA 2COQA 3D39E 5AKRA 1HE7A 1NAMH 2B14A 1JNLL 2HB0A 4HJJL 1XGPB 2R0WL 3C8HA 4YSUA 4F2MA 1RZJC 4XXDB 4PB9L 3AY4C 4Y9CA 3ZZ1A 1LD9A 4JG5A 1KGWA 4PJ7B 2GFBA 1OAXL 3TWCH 1RV6X 3SDDD 4GG6A 1W91A 1SMAA 1QVOB 3NP3A 3OAZK 3QO1B 3VH8B 5SWQB 2X89A 5LBSA 3DMMC 3MN8A 4OGXH 2C4XA 2NNAA 2FLBT 3FQWB 1MCHA 1QA9A 1GTNA 2NY5H 4P9MH 3LXCA 2LTQB 1FVCA 1S9YA 1E8XA 2Z0UA 5KOVC 2AJXH 3UDWC 4UBDC 1RZ8B 1HKLL 1IGCL 4FQHB 1NANI 3ZR6A 4PYHA 3AABA 5FOBB 1E5BA 4IOSA 2X6UA 3BLKA 4PY8J 5CLZA 5T5NG 1A6AA 4N6QA 2VRQA 4PWIA 3U0TA 4KHXH 4CW1B 2W0PA 4M61A 4BFOA 2JNZA 1U6AH 3HG0A 4DK6A 1IC4L 1TSRA 4JKPL 2XUWA 4K5PA 4NQUA 1NUNB 4X7DC 4NNPH 4YHOH 4J3WA 2AANA 3II3A 1UC6A 4FNSA 1YUKB 4X9HA 2WXKA 2QTVA 3SBQA 1AP2A 4MQ7A 1PBYA 4ETQA 1CLYH 4G9FA 4Z7AA 3CQQA 4NQSB 1EO8L 1T03H 3WUWB 3UC2A 1P4BH 4KKLD 1JCKA 3VGDA 5FLUA 2X4QB 1IQDB 4JKPH 1OARH 3QDJE 3ZK0A 4JO1L 1MREL 3TN0A 2H9GB 3NCYP 5A2IH 5E4EC 5JW4M 2HG5B 4FKKA 2OJ1A 3B34A 3KLAB 1JGLH 1IEBA 3E3QC 4ZI8A 1PYWA 4L5FH 4U1KB 4CC0A 1DTUA 3K2MC 3C2SA 3VM7A 5JW5B 1NGYA 2OJEA 2R0ZL 3JV4A 3KHQA 2ZWSA 4GH7B 4JFEB 3H53A 4NUGH 4ZMWA 2YGQA 2JV6A 3T5WA 4JY6B 4ZUSA 2X6VA 4AM0A 2NYYC 3RDTB 1SHXA 3H42L 2WLIA 3KYKL 2EDOA 2FEJA 3NAAL 3M1OA 4R5XA 3FSZA 1I1YB 5LLIC 3CVHB 3MLZH 1HXYB 4AG4H 2IAMB 2P8PB 5GGVY 3VXPA 4UM8A 5KAQF 2IQ9H 3QPKA 2X2HA 2YLHA 2R0KL 2ZD0A 3DVNB 5DHVH 4RGOH 1VACA 4LOVA 4HKXB 5DVOA 4HEPG 3NIFE 2BSRA 4JFQA 4PWFA 3NUKA 4G3YL 4K7PX 5HJ3B 3QO1A 1G7MA 2AQSA 4XP9L 4Y7MA 5SWQA 1OSPH 4YDZA 4XPGL 2BZCA 5FOJA 4Y16C 3QISA 4GKZA 2ZG1A 1CXIA 5AZ2H 2EZ0D 5FA3A 5CEXB 2H8PB 4QO1B 4P2RD 4UNVA 3IMSA 5GGQL 3BJLA 5FUOH 3UTPE 2WUBL 3S35X 2QQKH 1P7HL 4GXUM 4FADA 1ZVYA 2BXYA 4L05A 4LSVL 4D7PA 5T1KA 3OBAA 5D8JH 5F7EH 5HHXH 1ZV5A 3NSFA 4U1KA 4JQIL 2Q86B 4H8QA 2FHFA 3DX8A 1JVKA 4YDMA 1F6LL 5C8JB 2WWMC 3FOMA 4OGQC 4UDTA 3MGTB 4YZFE 3TEYA 2F74A 3P69A 4KKCC 4OFYD 2BVQA 4AQ8A 1MCPH 1F0LA 1MH5A 3D09A 4IRSB 4JN1H 2XVBA 5IM7A 1P4IH 3EXJA 3B2UC 4I7ZC 3LRKA 2CA4A 1E0OB 1SJEA 3WHXB 1Q0EA 1G7PA 5CEZH 5D2LB 1A5FL 1U33A 3K71A 5DQDL 1TCMA 5F9WB 2VXQH 3LN9A 4J4PD 2IDCA 2QT6A 1YC8A 2WQ8A 4MAZA 2YPVL 4JKNA 4KNUA 3MLXL 2WLMA 2IANA 1XB8A 4LPTA 1J48A 1T2JA 1MFAL 1ETZB 4H26A 4U6YA 4PW3A 3C60C 4NUMA 3D2UA 1NEZA 3MJ8B 4G42A 4PM1A 3G5XB 4XHJD 3APMA 2XPGB 1P1ZA 1UOWA 1KIUB 5HGAB 5FHBH 3S88H 2I9TA 2PYFA 3HJEA 4P4KA 2V9QA 4I3RL 3T6ZA 4YPGA 1FJ1A 2VR6A 4UQ2A 1MFAH 2CDGA 3K6IA 4UT9H 4I9WD 3BQVA 2G2RA 3KH4A 4OGXL 4G42B 2YD9A 4QTIH 4NBZB 4DAGL 5CEYB 1I8IA 3K6FA 5GISH 1GMEA 2YUZA 3FUFA 1N9PA 4GKSA 4KMTH 2E46A 1WAAF 2SEBB 4AVJA 2Z9TA 4N8CL 4P23C 3B9KD 4FTVD 4F9LC 2ITDB 4WRLA 1G1KA 4EI6A 3LNHA 3WIAA 3Q6GH 3QEUA 4Y4FD 5EDSA 1NFAA 2W88A 4PI2A 2CWRA 5MEPB 4Y5XB 1UA6L 1S46A 3ES6B 2ADYA 1CC3A 4HOMA 4ZODA 3CXHK 4C56B 1NUGA 3S36H 1CLZH 2NY1C 5C6TL 1TPXC 4CBPA 3NPSC 3O6KH 4F33B 4R2GB 4TPRL 1XH0A 2G9KA 1VADA 5E8EB 5DZ9A 4H40A 4J8RA 4LCWA 1CLYL 5HDWA 4YHYB 3OSVA 1J05A 3KCPA 4Q4IA 4LNRB 1JGEA 4JFFD 4WHTA 2BDNH 5DJCB 5KUMA 2WBWB 5IVXB 2XWTA 3QYCA 4MXWH 3U2IA 2TSAA 1TU2B 3QUYC 4U1GC 4GO6B 3BSGA 4G1MA 3GIZL 4U6XB 2EDWA 3SOBH 3GSRA 1SZNA 1R9FA 1Y07A 2IADA 4PBXA 4JKWA 3GSNB 4RMVA 4YBQC 2PETA 5HGGS 4TOYH 3PP4L 5T3ZD 3L95B 5I1EL 3KZ8A 1WIUA 2YD1A 2WXOA 2Q20A 2JQZA 5DRXB 3W82A 1H6FA 1A6ZB 5FEBA 1J9QA 3O0RH 4PJ8D 5KBKA 1AMXA 3CNKA 5KG9B 3K6SB 2FZ3B 2NXZC 1WISA 1CFMA 1XR9B 2XWBA 2E56A 3IFPA 5A7BA 3Q6FB 3X3GL 4G9FD 3WJLA 4DN4L 4KQ3L 3KL5A 2WO4A 4K9EC 5HYJA 4RAVB 4WSKA 4R5TA 4LEXL 3QG6A 2YN5A 3FU8A 1XV8A 1OP3K 3PGCA 2V9TA 3PABB 1JHKL 4Y16B 5B4MC 2Y3NA 3A24A 4QAMB 3GFUA 4PAZA 4LGPB 2GK0B 3TT1H 4XWGH 5GGRA 5B8CB 5JHDD 1DLFH 4H8PA 4E9XA 1LQSR 2GTQA 1WK0A 2HLAA 2IAMA 2P8PA 2ZG3A 4X5PA 3IDXL 5F7MC 1SHMA 4EKJA 4OFPA 5C0CD 3CWGA 3DMMD 3NCBB 4MCNA 4Z5RA 5TE4H 2K6WA 1WTLA 1ET5A 1YMMB 3R18A 4RGNC 4PJAA 3SPCA 3VQLA 3RHWK 1FVDB 5BNXD 5FM8A 3QJZA 3TBVB 1U6AL 1EZVY 1K5NB 3MJ9H 3HMXH 3KPOB 4HK3N 3BMVA 3QQNA 2ALWA 3R0NA 3ARBB 4G6FB 4GIOA 5GGTL 3EH2A 4XX1E 5JO5A 3GB7A 3PJLA 4KTEL 1Q9OB 3GMMA 3MOAL 5FO9A 1XR8B 3SEPA 2NW3B 5DZNA 1A5FH 3IDGB 4WFEE 2WNKA 4XO5A 4DGWC 1BQKA 3MKGA 3SE8H 3V6ZB 1G1YA 2AITA 3QIWD 5DK3A 3V0WL 4EUPB 1KB5B 2AQNA 1BV8A 4Z3EA 5JQHC 4XCEB 4ZX4A 1EFXB 2FIRT 2E3VA 5JR1L 5LQBH 1HK6A 4D9LH 1EMTL 1FH5L 3WJLC 3DETC 1XSIA 3IRPX 1KENH 3BDBA 1XZ0A 3S3BB 1R3JB 3TWYA 1KXTA 3BAEH 4OJAA 5C0GB 2BNUA 2GB2A 5L2KE 4X6FA 2BW4A 4AKQA 1OAQL 4I3RH 4WI0B 3TBWA 1T0NB 1AANA 1PCXA 2D9CA 1R3JA 2G5BB 3T2OA 2FWUA 1N4XL 4HHGA 1L7TH 1UZ8B 2FATL 2WGXA 3K1DA 1HOCB 1E5ZA 3IYLW 1R3IL 2YSSB 4XNQA 5D72H 1TNMA 1CGXA 4EKXA 3IPEA 2FJFA 4XR8C 4ZFOL 5IQ9B 4L3CA 3TONA 4ZX6A 5D96B 3ARTA 2Y7QA 3DC0A 4EI0A 4ORGA 1BVNP 2CO3A 4XP1L 1F1DA 1UZ8A 3MRGA 1O7DE 4R90L 3CVIL 3RI5F 4FQIH 5EC1A 2ZSVB 4PGDB 3H55A 5GS0H 4Q6KA 4Y2DD 4V2CB 4PG2A 1N10A 3FNKA 3A6CL 2C9QA 4I88A 1S3KL 4NO0A 2YBGA 1F3DJ 3EZ8A 1WITA 4LHUA 1RIUH 3GBNL 4M5ZH 3BSZA 4EN3B 3RTQA 4OY9A 2NY4B 3SKOB 1P4LA 4FL4C 5TK2A 4ES9A 4QRQA 1UD3A 3NJFA 4KHXL 1OE2A 2BDNL 1A6WL 1CG9B 5TK4A 3MRLA 4Y16D 1IAIH 1F45A 4HCFA 4YSTA 5KVDH 2HFGH 3LKNB 4GMTH 3FUHA 4KXZI 5FFGA 1KEGL 2QQLL 5FGBC 3T65B 4AV0A 3KCPB 1FO0A 4QRUB 1MFVA 3FU3A 2DJ4A 4XBGA 1GYWA 2CPUA 2FB4L 1F11B 1PAZA 2UWEB 4GSDL 3ASWA 5D70H 2QMKA 4DZBB 5F8RC 4ODSL 3WIIH 2AW2A 2PR9A 3AWEA 5BQ7A 1AQ8A 4FTDA 1SEQH 4FYSA 3OGCA 1U8MB 1MREH 1WHPA 1F4XL 2F0CA 2K7QA 2OL3H 4LDEB 3LNIA 4QUOA 1KYDA 4ZFZA 3VXRA 3DDFA 2AABL 1MSPA 2PYEB 3PJNA 2AEPL 4EI6B 3TO2A 4HIPA 5AUMA 4QHUB 2WLKA 3ARDC 2R1YA 4CL7A 4PJCB 3IFLL 2XWXA 3N9GH 3BT2H 3RPIA 4A6YL 2K3TA 1KTLA 1TJGL 2VE6A 1G4MA 3TA3A 4LVOC 3UCRA 3G6AA 3HVNA 1XCQB 5D7IF 1QLEH 4JE4B 5H35A 1CL7H 4UNUA 4QRPA 1RFDH 1N6QL 2ZOLB 5GZND 4P2OD 2TRHA 3H6JA 1AZCA 5EH1A 1OHQA 1RJYB 3EYVB 2W9DH 4K8RD 4PCYA 5DZVA 5EIQA 2O6PA 3RTQC 1JK8B 4BM7A 1FFQA 2EXWC 4B9YA 3U6XS 3VYPA 4EVNB 4QDGA 1YJDC 4JN2A 1TVHB 1M4KA 2F1BA 1QHQA 2FZ3A 2VOTA 3FQ4A 3BE1H 3WXVH 4GUCA 1LO4H 4HS6B 3TJEH 2E7BA 4N2GA 1LVEA 4HZ1A 1DBBL 2WTRA 3QC5X 4PRPA 4QXUH 1KIRB 1IAKA 2HJKA 4PRBA 4AT6B 1ROWA 2RH0A 2NZ1A 1MWAL 3TEZA 3UJTL 1TQVA 2EIBA 3RKDC 4AW4A 3HE6B 4KAQH 3KVPA 4RWYH 4XNMA 1HS6A 2NZIA 3F12B 4IGBB 2YMTA 3QR1A 3S6CA 5ID0A 2UWEF 4XPBH 4AQEA 1LEIB 1R3LA 1SDDA 3BAJA 5IJDC 1ILUA 1ASPA 3SPVB 4OLZH 3LV3A 3LEXA 2DEWX 1IFGA 1UA6H 4NDMB 4R97B 1YEJL 3MA7A 4FI6A 4YPGB 4EN2A 3F62A 4QY8A 2Q87A 1MRDH 4FI8A 3RAJL 1PLAA 4NN7C 3RILA 4Z9KB 3U2SA 3KJ4B 4UTAA 4QJ3B 2OL3B 3KVDD 3RVXD 1OQXA 5IW1A 2O72A 1JYXA 5KVEH 1D6VL 1NCJA 3MJ7B 3R1GH 3S7GA 3NK3A 1X9LA 4PY7A 4PWKA 2B0SL 3HNTH 3OHXA 4NHCH 3FSAA 2C1PB 4D0DB 4K2UH 2Y07L 5DMIH 1N4XH 1Q0YH 4MA1B 2K9UA 5T1KB 1AZVA 3QI9B 1X5JA 4Y1AB 4EUPG 1HNYA 2VQ1A 3DX2A 3G9VA 1AQDA 4N28A 5TDPA 5B3SB 4DVRL 4QRRE 2Z7ZA 4LVEA 3DRQA 4XP1H 3MNMA 2EVIA 3BEWA 3F01A 1D6EB 2X10A 2FK9A 1KYFA 1HX0A 4WI7A 2L04A 3LSOB 3RFZB 1HEHC 1RZIB 4QT5A 5IVXE 2J25A 2EC9U 1IC7L 2E9JA 4UQAA 1O7VA 3WUZA 3P4NA 1HDMA 3WXWH 4M7ZB 4UB0L 2XN9B 3CZGA 4H8HA 1PD0A 3FB5B 1IAOA 2G0KA 4DO4A 1HNGA 1T2QH 4LMQI 1CZ8L 2VC2B 3LSOA 3WDHA 1N5YL 1CXEA 4NC1C 2P44B 1JYNA 5HYSG 5J11C 1LWRA 2IANB 1IAIL 5G4MA 2FT7A 4AMXA 2PABA 1AGFA 2Q8BL 2OMZA 4UMGA 4AXWB 4AEFA 1ORSA 3LEYH 4H26B 1J1XH 4L4VE 4LFHG 4LOUC 1K4CB 3LYRA 4ZFGL 2RQ8A 4NXKA 3X11B 1GJWA 5D7IB 1DVYA 3EJSA 4F8PA 5TE4L 1HHHB 1JZ7A 3CFDA 1U2HA 2EUZA 2PCFB 3V8OA 2YLKA 3JTTB 1ZY9A 2IH1A 3RBGA 2CDFB 4L3CB 3KBFA 1YEHL 4X80L 3NCJH 2QLYA 2W0FB 4YXLH 2HVJB 4MXVE 2XKUA 4GIAA 1JZ5A 3D85A 4NRZA 3EYSL 3BVUA 2FYVA 3PE9A 4OCWH 5C97A 1MQKH 1THAA 2KBGA 2EIEA 3ZHLA 4J6IA 5CBEB 2R8SL 5IHZA 1EJOL 4NJAL 4LOEA 2C8NA 1VZHA 2H6UA 4X7SH 2VN6A 5GXBB 2CJSA 1TYJA 1CDCA 1QBML 5CWSB 3NRQA 1EEYA 1JGVL 1Q9WA 1SMOA 2M1KA 2F61A 1FZMB 4NP4H 4Y7OC 1M56B 3SKOA 1NM9A 1UGKA 3OWEA 2WO2B 4N85A 3PWNB 1MCWW 3CAFA 4FQLH 4XVTL 4FJ6A 4IDJH 1PZBA 4K9EH 2ILLA 2FNBA 4QTHB 4U1LB 2FR4A 5EF3A 3FO2A 4DKFL 4L3AA 2BSRB 4JFQB 5FW8A 2AQPA 2P5ED 4AZUA 2XY1A 1KZQA 3HZVB 1F41A 2A99A 2IOOA 1IZKA 1U95B 1PCSA 2HKFH 2XTJE 3RWDA 3W39A 2GTWA 2YARA 3FT9A 1AI1L 1AG6A 4NKMA 2QMJA 1E4XH 5ITBL 3GMOB 3WNIA 4YHLH 4JHZA 3F3HA 1DBML 3Q13A 4TLKA 2GUOB 4HF5L 3F7RA 2F6AA 5JHMA 4KTYA 4YVUA 3RX5A 3QB7C 2MPVA 4F7TB 1EK3A 4Z7VA 4MCMA 4O2FB 4MJIA 3M17B 3ATFA 1S9VB 3LQMA 4EI5D 1NMBL 5CJOH 1A6UL 3WU1A 3US1A 5ACMA 3O4OC 2HJLA 3S4SB 1HL4A 2APSA 4FNLH 5IB5B 3NCCB 3RP1A 3CFCH 3NIGF 5T3XH 1X7TA 4HBQA 3CH1B 3FYEB 5CWSA 3MRNA 4NQTA 3TBYB 1AXSA 4KZDL 3EDKA 3HG1A 3HRPA 4WEBH 3MBXH 5EEXA 4BFKA 4BKLA 5KBPA 1BFSA 1G7QA 3WBDA 3B43A 5D5ME 3VYOA 5J0BA 5HGHA 2LLNA 3RIKA 4MQXC 4Z95L 2R69H 4DEPB 1ZS8A 5C0JB 4Q6IB 1YEEL 2FNWA 4POZD 4XNYH 5DWUH 3QT2A 5EU7E 5I82A 5IG7A 4L0YA 1XVSA 1EHLL 4ZFFB 2DQHH 4HC1H 4YHPA 5D1QA 3ETBJ 5ENWB 4EN3A 1LP9B 3IETB 5ICYA 4BE6A 4FXTA 3WXWL 4OQ1A 4OJYA 3Q1EA 1EAPB 1WAAE 1IQWH 2AJYL 1S8DA 2DLFH 2WQWA 3RDTD 5ETUA 3DJRA 1HU8A 1T6WA 1WIPA 3R06B 4G11A 4M1GH 2JJWA 3MBEC 1MLBB 3OLEA 1WWAX 5L4FA 3MZGB 3DHPA 1J05B 2Z1PA 2B3IA 5CP7A 4QI3A 3NPZB 2GW5A 3EBGA 1XGUB 3TYFA 3KEHA 2MTAA 3L3IA 3ZGHA 2ATKA 5DJXA 4ZMAT 5E2UH 3D85D 3PQYA 5KBLA 3DDGA 3VXOA 3FAXA 2ED7A 1NC4B 1EV2E 3O3EB 2GAZA 1AGBA 2R9HD 4G8EB 4OCYL 1DVFA 5JNYB 1FO0L 1OTSC 2A74A 3CSFA 4AEHH 2FYYB 2FSDA 1QR1A 2PWFA 2FT6A 2JI1A 2YSTA 3X1BA 5CCJA 4PS4H 5EO9A 4Z18A 5E2UL 3MFGB 1YEGL 1WEJL 2G30A 4UT6H 2VLRD 3LKOA 3JWOH 4YSQA 5I0ZA 1A6TB 1JNHB 2KDYA 4GW4B 1H15A 3WLWD 5GGSA 4WI3A 5D7LA 2D3VA 4A1RA 5JHLH 1DVUA 1GYVA 1DVTA 3KNBA 1UD2A 2X4NA 4BKSC 2J8UE 3D9AL 1QPPA 4XVOA 5FO8B 1G9NC 2X4RB 4XPBL 5DMYA 3V4PL 2E9BA 2VIRA 3VI3A 3JSSA 1D5XA 4X42A 2XTJC 4A38A 2DV6A 5JPNA 3LHPL 4HIXL 1C5CL 2UZXA 1WP6A 1YQ2A 3D18A 2ARJA 2RIKA 4V1DA 4AYBA 4XOBA 4TUOA 2DWXA 2F5BH 4FRWA 1T3FA 2WUCL 4TNWK 1DSWA 5TPWL 3MBEA 3FQNA 3BAWA 3QJFB 4PP1D 4J3SA 3F64A 1XHHA 3QNXA 4MAYD 3AWGA 5FGCE 4GBXB 4X6DE 4XNZC 4ZFQA 3V5DB 1IZJA 2AJXL 3OKMA 4XBMA 3CFEA 4B50A 1IT9H 1CG9A 1OM3L 4IKJA 5I71B 2JKTM 3ME0A 4HEPA 5ABAA 5ID0B 1WC7A 1H3PL 4K7FB 2X0VA 5DUMH 1MW1A 5D93C 2YWZA 2E8ZA 5E9DA 1WAPA 4F37K 5D1QB 1OAZL 4WU5B 4B60A 6TAAA 1AVAA 3G08B 4FYQA 1WGOA 2O5YH 1ANUA 2XXMB 3AADB 4FHKA 5KJRL 4PEEA 2GTZB 3ARDA 3BT2L 3F5WA 4HHAA 4J28A 1NBZB 5I66A 3MODL 1W0YT 5T3XD 1AACA 1P9MC 1KMGA 2W0LA 2XV2A 4G1EA 4BH7B 1QEXA 4KK9D 1I3GL 3AMLA 1Y6NR 5CP7B 5LBGA 2CLZB 3NA9H 4S1SL 1TTUA 1J8RA 3VFGL 1C12B 3LXAA 3HHRB 3WIFA 4UIMB 3V6FB 4W4NA 2CNZA 1T04B 5DHMC 2FO4A 3HZYA 1AI1H 4XGZB 3ZDZE 1WWBX 1A1NA 1T1YB 3ETBF 3B9KB 1UWGH 4L1HA 4MWFB 1JDAA 5AAWC 4JZJC 4XN9A 5B38B 1GPOH 4Y2OA 4AI7A 1AZRA 1F6AB 1CR9H 4WJ5A 1AGDA 1JSYA 3T3PE 2OZ4L 4LSTL 1V55B 2PO6A 2H3XC 3LN5A 1K6QH 3KAAA 2A77H 3QUMH 3BMWA 5TGBB 3P3SA 3NCEB 2IAMD 3UXFA 2DI8A 3UAJA 1QW9A 3W39B 4A63A 1XF4B 1SF3A 5KYWA 3E2HB 2F54A 1FGVH 4U6YB 1U2CA 3AB0C 4DP4X 5INCA 1FNSL 4WFFE 2G3ZA 2ICES 3IK2A 2VN7A 5CMAB 2X4PB 1OCRB 3PS6A 5DLMH 1S7VB 2AQ1A 3GSWA 4JFFB 4WO0A 2ZKHL 4X4ZA 4PIBA 4UM9B 2QFPA 1GHFL 1JTPA 5ICYB 2IPKB 4NJAH 43C9B 1CUOA 1U3HD 3P0VL 3LKRB 3G5YA 4FF9A 5K59F 3VG0H 4BDVA 5HHNB 2ITCA 1J5OL 2X2UA 2O5NA 3QIWA 2HJFB 4P46A 4PJ8B 3GI8H 5T3XE 2VT0A 1NWOA 3I6SA 3K91A 4WFGE 3WE1A 1E8WA 5KZCB 4D9QD 1CLOL 5LHDA 1E8YA 1MJUH 1A3ZA 1FUNA 3BPCB 3VSTA 1U36A 3OQ3B 3FKUS 4H0LC 4PUBL 4HKXA 1MFNA 5D6DC 2B20A 1FPTL 4PTUA 4X6BB 3O2WL 4ZTOH 4F8NA 1H3VA 5EZJA 3MLPA 2A83A 1OAYH 1EWHA 2NXYC 1T21B 2VDLH 1E28B 3T0EE 4LIQE 2Q10A 4NO0B 1QSFA 4KROC 4Z7OE 5MEOB 3R06A 4Q9RL 3BP7A 4E41D 3QUMA 4YAQA 3VW3H 4TKWA 4J5VA 1J1OH 3RZCC 2ZX6A 1I3UA 5D1QD 1YHPA 2RA1A 3MR9B 3PU7A 4RWHA 3CFMA 3SYCA 3QUMB 4YAQB 2BHYA 4B9FA 2ZPKL 1ZA3A 4AENA 2HG0A 4O2CA 1YMHB 2H2PD 1IC1A 3B2XA 5J89A 2X3CA 4BZ2L 3DA0A 4O9HL 1BJ1H 1FDLH 3SOTA 5FECB 1DZBA 1EA9C 4Z0XA 4FQXD 4LQ1A 2WKLA 5FIEA 3AAZB 2AEQH 3OB8A 3GBMH 4UU9A 4ODTL 4I1RA 5D1ZI 4X6CB 1BVKA 3S2AA 4D9RD 1FH5H 2WGNB 4N5UA 4JUTA 5F6IB 5DJ8A 1GVIA 3QQ4A 5T1LB 4R7DA 1YUHA 2P8LB 4U1MA 2PPAA 5EA0L 3KHOA 1NM4A 3SPHA 3AITA 5CMAA 2KZBA 4PJXE 3FTYA 1FG2A 2F1EA 4YWGL 1QLFA 1VEOA 4WKZA 5C3LD 2HFFB 3BWSA 3DHMA 1FG9C 5DF0A 2PP8A 2VZTA 1PZ5B 2WKOF 5AFAA 1XAKA 1N67A 2LTQC 3NRFA 4HJ1A 3K5SA 4K3GA 1V3KA 2FEEL 1MVFA 4G7VH 4X98A 2WWMD 2VDLB 3SZ6A 4U1IA 5MP6L 4X4ME 1JI1A 1AO7E 1RPQA 1E7VA 2Y7OA 3MJ7A 5D72L 3KR3L 1FHGA 5DEZA 3VXTA 4QYAA 4YC2B 1D9KA 3VXRD 4YWGH 3VWKA 3SQBA 2ZXQA 3AT8A 2NY3D 5C0EA 2F54D 2CDGB 3HFML 1U3HB 3BOVA 3LMJL 4MA8L 1ACXA 3MYZA 4ODHH 4B7LA 2Z91B 4R96A 4NPKA 5I1AB 3KL0A 4LKCB 4JLRA 3IJHB 3KE0A 5DRZB 5F89B 1GL4B 1IIIA 3HG5A 3GSOA 3MLYL 4H25A 1CYXA 3RL1A 3RU8L 3ABKB 5CHNA 2IFFH 1I9JL 1KCSH 3E3QE 2F9BT 2MQCA 5BRZA 1FO0H 4H44C 2CO4A 4IBZA 1RMFH 3L4YA 4NYLA 4DOHB 1PZAA 2X2IA 1NAKH 2BIQA 2P80D 1PF3A 4HSAC 3ZDYB 5DMJB 2AV7A 4OVVA 4P05A 1KJ2L 3CN0A 5IVNA 1MKFA 5L8LB 3ZT6A 5I5RA 1WEJH 2JFCA 2A0LC 5G2NA 3DV6B 5IBUG 2WIMA 2GTZA 1HCFX 3ARDB 4HHAB 3C5ZD 4P9HC 5E2JA 1NGWA 5A43C 5I17B 4N2HA 1P7QD 3FB8B 4BFFA 5I19L 4Y4KD 5IW6B 1FL3A 1OB1A 1JPST 4IIQC 2COVD 1OHZA 3WLWC 4WUUB 3G7TA 3CVDA 2BIMA 3G6JB 1P1VA 1X5YA 2OMXB 4QRPB 2F74B 5B7FA 5F7HA 5E1GA 3NTCH 4PJ6A 3X12B 3N6YA 5AW5B 2P52A 5D2NC 1XCTA 3AM8A 3T1FA 1NIFA 1E6JL 5D7SH 3ATBA 5DJZA 4ANKA 2PKDA 1YN7B 2CJUL 1HCYA 1UKTA 1VCBC 4YL9A 3ECVA 1NKGA 4HWZA 4K5LA 5BQDA 3QG7H 4PRPB 5LAXA 5KN5B 3OKEA 4HK0A 2WCGA 1MOEA 4R9HA 2WP3T 4AJVA 2AXJA 5EU3A 1P7KB 1MNUH 4NNYB 5HPMA 1DJWA 1OARL 4X9IA 4FA8A 1J0KA 4JMXA 5I0YA 3UO1L 2JB6A 3BGFC 1CICB 1RIHH 3L9RB 2UVFA 3F7QA 4L1TA 4D0CA 4NDMA 4TNEA 3VI4E 4PJGE 2QR0B 3ZKXB 3GZKA 4JY5H 1DL7H 2XWCA 3N3EA 4GIPD 3OD3A 4WY7L 3SE8L 5J4MA 3N0PB 7FABH 2NRDA 1EFXD 5EZPA 3CHXA 5FYKL 2W07B 3QEGL 4UM8B 3PIQA 1OCCB 1S3RA 4K3EL 2ZAIA 1M2VB 2DQ6A 5A3ID 1KBGH 4AMKL 1OZTG 3BIKB 4S2SB 4XE0A 4LEOA 4UAOC 1QFWM 2WQAA 3UJIH 2J5LC 4TSBL 4AGQA 1BXVA 1FN4A 3VXME 5HVFB 4XN7A 2NY3B 1NICA 2VABB 3IAPA 4RRPM 5I1JL 2UV3A 4RGMC 1CR9L 5I66B 4BGDA 35C8L 4ZSOA 3BH8A 4MKMA 1NIBA 4ZUUA 4GW5A 3LDBB 2A83B 2H3NB 4NT6A 5FYJD 3TM6A 3QUHA 4G3YH 5C0FA 4N2NA 5JPMC 3FUJA 2W59A 3SDXA 4KVCH 2XBDA 3HTLX 4OZIE 2NYZA 3QDGE 2V3DA 3ZX1A 3LXBA 4TLSA 3NDYE 3QDMA 3WFCH 2PWHA 5C8JA 1S7TA 2J71A 3JV6A 1CBJA 3CFUA 3EZJB 2NSQA 4W9JC 3QDGD 1I7RB 3ZMNA 2BNQB 1H9DA 2L3BA 2OSLA 4QTIL 4UT6A 4J39A 1GYAA 4H88H 1EDQA 3OZ9L 3PWLB 4FA7B 4ELME 1F56A 4F3FB 1NQBA 1I1RA 4OQTA 3HC2A 2WSKA 4Y4KB 4DWHA 3O6FB 1IGIL 1AFVH 2J56A 3QEHB 4LVNC 2ZXAA 1K9TA 3P3UA 4HMCA 1SLWA 4PJDE 2X88A 1MZYA 4BHUA 4LPWA 2RQEA 4L48A 1ZVSB 2UXGA 4BZYA 2AI0L 3NSCA 2Q5BA 4NO5A 4JZOA 3L1EA 3JWDL 4XVSH 4Y19E 3VRLF 5DR5L 3W9DA 2EKSB 1BZEA 3EFFB 3MYJB 1ZXKA 1L3NA 3C12A 4IK6A 2FQGA 5HGDA 2J4WL 1IGIH 1PX3A 2VDRH 2XJLA 3IETA 3QQ4B 4JFHE 5EN2A 2DMKA 2KKQA 5LAPA 4F7TA 1ZGLA 4Q6YA 4OFQA 1J9TA 4ZFOA 3EFOA 2UZIL 4PTTA 4HJJH 4FABH 1EJ8A 1P6FA 2WBXA 2NDFA 2XICA 2D31A 3HI5L 4OSUL 5F0PB 5IQ7L 1SLVA 2DWDB 4JVPA 3VQ2C 4PJXF 3EJQA 4KO7A 1DVQA 1FE8H 1YLBB 5E08L 3RDJA 3LB6C 1QEWA 4LDLB 5TF1L 4DZ8A 4PS3A 3RWEA