3F85A

Structure of fusion complex of homo trimeric major pilin subunits cfab of cfa/i fimbirae from etec e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
456
structure length
456
Chain Sequence
MIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CFA/I fimbriae from enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords homo trimeric fusion of CFA/I fimbrial subunits B
total genus 70
structure length 456
sequence length 456
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A03
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A02
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A01
4Y2NA 3F85A 4Y2LA 3F84A 4HJIA 2HB0A 3F83A 4Y2OB 3VACA
chains in the Genus database with same CATH superfamily
5C07E 1XR8B 1Q9OB 1S7WB 3Q1SL 4IMKA 4U1SA 3RDTC 3SJVB 2VZVA 3NK3A 2A6KA 5FFLA 3GD1C 5E00B 3QUYC 1H3GA 2DYSB 3QPQD 2VN3A 4LNVA 2XNAB 4HZLA 2UZPA 2OR9L 2G3NA 5J12C 1JMXA 4OCSL 2Q2LA 5J6GA 3NTCH 3RI5K 3GSOA 1R3IL 3MJ6A 5FO8B 4XMVA 1SHWA 3IDNB 1R5WA 4MB4A 4N8CL 5IHWA 4K5LA 1PZUB 3QHFH 1O7VA 3RFZA 3TTYA 3TEUA 1K6QH 2DJMA 4FFZL 4BCZA 3U6RB 4IM8A 1OL0A 4KTDL 1LE9A 1JG9A 5EU3A 4ZPVA 1GZPB 4OFDA 5D1ZI 1XF2B 3L1FA 2JKIS 4LLUA 4M6AA 3GS4A 3W81A 3T1FB 3ET9F 1ZLWH 2FR4B 4BELD 5TE6L 3WEOA 2WQVA 3FQWA 4G9DA 1JTPA 3WOVA 5LGHL 2BCKA 4KO9A 3NH7H 5TE4L 3GWJA 2J72A 3T0XA 5GRWA 1ED3A 4OI7A 5T1KB 3QUXA 1TJMA 2V17L 1G7MB 5T3ZL 1WZLA 3ULUC 3JTBA 2IH8A 2WQAA 4G8FA 3P2TA 3CMOL 4GLRI 4K7PH 4QT5A 5JORA 2IG2H 3FTZA 3UABA 2OI9C 3QDJE 5D2LE 1F8TH 1HFUA 3GSNA 3MNWA 5DYOA 1JHKH 5MP6L 2DYPB 5IFAL 1LMKA 1ZLEA 3CSBA 3ARFB 1R3IH 4KK6C 3WIIH 3KYMB 5A2FA 5J57B 1CFQB 4O5LH 3B1UA 3ATEA 4P23C 3PUUA 4RDQG 1IAIL 5EA0L 1LTXA 4EI6B 3WO3B 1DZ0A 4ODTH 2ZCLH 1AP2B 3QQ4B 3CX5J 1S9WA 2JI3A 2A9NL 3T6WA 4DVRL 4M7JH 5TE6H 3FT9A 3DROB 4L1SA 1KCRL 3U79A 1NSNL 1URIA 2W9DH 3TA3B 4NNYB 3DMMA 4PSPA 5ISZA 3F85A 1JS4A 1NMCC 1A6UH 1RKRA 1WE5A 3AG2B 4QF1A 1F1GA 2W0KA 3C5SA 3EGSA 3LDBC 2IQ9H 1URZA 5KBLA 2D0GA 3KDPB 2FHCA 1GSMA 3G5ZB 1KV7A 2NDGA 3IWVA 4UILL 4F24A 1JZEA 2OSYA 3ESNA 3CFNA 2FO8A 3LXCA 3SZKC 1CFTB 3WJMB 1P5UC 2EDNA 2A3TA 4JRYA 2V5YA 1ACZA 3OZKA 3S9DB 2WTPA 3V0VB 3BKCL 1YYML 3P4NB 5DLML 3EFOA 4FABH 2BVQA 4D3CH 2ICWB 2WINA 2ZXBA 2ZAGA 1L9QA 4AXWA 4IDJL 1QSVA 1E30A 3QUKB 4FI7A 4CJ1A 1I1AA 2DQIH 4JDVB 4DGVL 4HYTB 4KRPD 2XSKA 3QDGD 3ARZA 1JZHA 4AQ8C 2VLLA 2VN4A 5BVPL 2GY5A 4AEFA 2I69A 5FLVA 1QFUH 3AGVA 3BPNB 1KJ2H 2CO2A 1NAKL 3MBEC 4ZUWB 3WIHH 2Z7YA 5C0NC 1XT5A 5BS0E 3EJQA 4G59C 4WO4C 5E5UB 5SWZD 3G6AB 4J8RB 1D7BA 5LXGH 5FYKL 3G5YA 1L3WA 3UFIA 3EKCA 2NY2B 2VABB 2MCAA 4NQCE 5DD6A 1EAJA 3W9EA 1F4YH 2EVFA 1JGEA 5D1ZC 4F3FA 5KVEL 4R6UA 1NGZB 3L95B 3P73B 1P6FA 4I85A 4OD1H 4BUHA 2ZWZA 4CU8A 3KGTA 4BA8A 2X2YA 3EDJA 4JB9L 3MUGB 4D3CL 2W38A 3TJHC 3MJ8A 2EXYD 1KPUB 4YAQA 3FB7B 4FFTA 4XNZB 2VXVL 3ZT5A 3ZBMA 5EORL 3MOAL 4N3UA 5CCJA 2NY3C 4FTDA 1HC1A 1XF1A 2HLFD 2M1KA 4OM1H 2Q6WB 1NMBL 5E8EA 3UJIL 4ODSH 3LKRA 4TQPA 2I07A 3C5XA 4Y19D 3ZE2F 4QI3A 3VTAA 2D3LA 1N0LA 3MR9A 4F80A 2BSSA 3SDCC 1XGPB 4OCYL 1VEPA 3BWUF 2DMHA 5E9DB 3TU6A 4K71B 1XTLA 2B39A 5FYKH 2WVUA 1WFOA 2D0HA 4R9HA 4BIKA 4K7FA 4TULH 2DEWX 1A6TB 1XR9B 4MSWB 5BO1H 4X6BB 4E5XA 4QHMB 5E9DE 1YEDB 1S78D 5INCB 1CI5A 2NZ9C 4AUUA 3MO1B 2VR3A 1F18A 2K9UA 5HJ3A 2JKLA 4BD4A 4EF3A 5I71C 3C08L 4KBPA 2NSMA 4XBGA 4FKKA 3HNVH 5JW4Q 1CZ8L 1SFDA 2VXTH 4HULB 1WA0X 2P5WB 4HIHB 1IMHC 5IKCB 2IDCA 2VITA 3FDWA 4M56A 4QXGL 3A67L 3GMMA 1JPGA 1FBIH 2AJ3B 2VLMD 5AKSA 4AYFB 1JPST 3MV8D 4O4YH 5L6YL 4M4RA 4C58B 3K8KA 4QHNB 3M1BA 3ZTNL 1G7PA 4KKBC 5FGCE 1P6AB 2J8HA 4R2GD 3A24A 1NMAH 4Z7UE 1SXAA 3P3YA 2XKNA 4JL2A 1HHIA 1LWHA 2DD8L 2JB5H 5DWUH 4NQUA 5MENA 1TENA 1NOAA 3MMEA 4NNXB 4M62L 4TVPH 4CGUB 1WRFA 4LB8A 1NPNA 4Z7NF 1Q8MA 2YIHA 4Q89A 4Q9CA 2O5NA 3SD2A 4X7SH 1IKNC 4MJ5B 3SE4A 4XX1G 3W9EB 1NKRA 3U46B 3AG3B 2WUCH 2VR9A 4LXFA 3VW3H 2QLYA 4PY7B 4RVBA 2VAJA 3PAZA 1J0ZA 1KNOA 5FEBA 5I8EB 1GKEA 3FN9A 3QEQE 1BIIA 5B3NA 1CI3M 4EUPH 1FUNA 4PLJC 3OL2A 3TZVA 4CKQA 3FQRB 2BRRL 1CFVH 2I25N 1HKFA 5C9JA 1BZ7B 1FFNA 2ZUTA 1BJ1J 3PAUA 4N85A 5DLLA 3L3OC 4AL8H 4X4XB 5ILTL 2WMPB 3B9AA 3F3HA 3MRQB 3OM3B 4HBCL 5IT2L 3CVHL 4X2UA 2XWXA 3ZE0E 4XT1C 1U8MA 1MW1A 1J9TA 4L8DB 4PV9B 4L05A 1PBYA 3BZ5A 4QIRA 4LMQI 4Y2OB 4Z3JA 1HHGB 1IC1A 1GW0A 1CTMA 1NFDA 5AOMA 4WHCA 2Y7SA 2CA4A 1BQ5A 3R0MA 4NHCL 3BRGC 2DV6A 3SKNB 5J12B 4OIFA 2W07A 3BVDB 3PPSA 1GJIA 5DJDA 1GIGL 3EO9L 5I1CH 3MCYA 1CD1A 5E99L 2ZONA 3QEHA 1XCTA 4LLYB 3TL5A 3TN0A 1JZ6A 2Z35B 2AXFA 5JQIB 2H9GA 4BH7B 2J25A 3QISA 4G7SB 1INDH 4PWEA 5IMOB 3MCKB 5JIIA 1EK3A 4ZMXA 2WCPA 1MDTA 3KVPA 5EZIL 2AV7A 4LKXA 3TA3A 2BOCB 1T83C 3DGDA 3FF8A 4A39A 3RGHA 2LVCA 1XWVA 3CNKA 4L8SC 4NQCD 5D96B 4PN6A 3N06B 4FFYA 3NRQA 4Y88A 5TGBA 4NQEA 4ENEC 3WEXB 4PRIA 2CNZA 3P9MB 3Q3GB 4XBPB 3HMXA 5BRQA 3QG6B 2EQDA 3LJ3A 5A1AA 2FD6H 1M3JA 2OZNA 1FVCA 3N3EA 2R7EB 4OLXL 3CVDA 4OFQA 1T89C 3NSXA 2F19H 3ZO9A 3GSNB 1WBZB 3EOBB 3MNWB 3PJLA 4KPHL 4WVRA 5E99H 2FHBA 1AG6A 4K71C 1SDDA 5DEFB 1ZDQA 4C4UA 1RZJL 2AXHA 2Z93A 4JVWA 5AYUL 5DRWA 5D1ZD 3ZMEA 3QUXB 3G3LA 4L29A 5EO1B 4H25A 3BISA 1BMZA 4L4VD 4F58L 1ZSHA 5I16A 3TBTB 1WEJL 1OO2A 3IM1A 4OLUL 4N6RA 2EACA 2Y9RT 3QCTH 1FN4B 3HHRB 4KQ3H 2Y6TE 1JZ5A 4ZPVB 4HH8A 5FM8A 1NCHA 3QUXC 3CFQA 5C0ND 4GKZA 4EI6A 3QFGA 1PY0A 4NO2A 1X5FA 4CSPA 2W9LA 1CFQA 1FAIL 3ETBJ 3WY4A 4AYGA 4CN6A 4CU6A 4F5CE 2N1TE 3FFCB 3IMRA 1I1FB 1U8NB 5DD5L 4BZ2A 5HYEA 2IDSA 3GKWL 4WSJA 1YMHA 5LBSL 3WNMA 1FFNB 4TL5A 2VH5H 2H8PA 4M93C 3VXOA 2KERA 2WO4A 2DIAA 5EIIA 4BFIB 3OAYH 5BV7L 4YHPA 4O5LL 5T5FA 3VGBA 1F90L 2MQCA 2APWA 3U4EB 1YDPA 4NQDA 1ZV5A 3MV11 4BFGA 1R1CA 1B3JA 4YSDA 2IQAA 2AJXH 2K6WA 1DQKA 4WI8A 3V7AG 2B8OT 2IWEA 3MROA 4RIRA 3LX9A 1PMYA 2OP4H 5E94B 1J1XH 4X6DE 1TQBB 3GEWB 1V3KA 2IALB 1BQSA 5FW8A 3DMMC 1EUUA 4QEGA 2WBKA 3MRPA 4BFOA 2WXNA 1VPOH 4ONGL 5GS0D 4NUJB 2HJKB 1OB0A 4ZS6D 3U4BH 3QEGL 4UMSA 5F7DB 3O8XB 4F1ZA 1JWMA 1SY6A 1NC2B 2Z8RA 4JKKA 3ZQWA 2YAFA 5FO8A 1OOWA 1Z6JT 1U42A 3PWPD 3QFJE 5E9AA 1YY8B 4P9HH 1AO7E 1UWXH 1WJ3A 1HN1A 5LQBL 2P8PA 4WHTB 1CU4H 3PFQA 3LKQA 1F42A 5IK3A 5AB1A 3VWKA 4LLAA 4PJCB 2VH5L 1MLBA 1NKOA 2XNAA 3D0VA 3B2MA 1HEJC 4A2MA 3PJSB 1KELH 1F90H 4R5VA 5CD5C 5I6NA 3LZNA 3DYPA 3DO7A 2PCPB 4NCDA 5ES4B 4JY4B 4R0LA 3WNJA 2YC1B 3PHAA 3EYFB 2DLFH 4X8GA 2VDPB 2ZPKH 2QKIA 3VNYA 1N26A 4DPCX 5AAWA 1C1EH 4OSUL 3RL1A 4O58H 3DUHA 4HZ1A 1KSRA 3BZ4A 4GSDL 1MZYA 4NQSB 1JWUB 4B9YA 5BZXA 2DKMA 2ZOWA 3OV6A 3KJ4C 3UC0H 2F2HA 2RIKA 1A6WL 3VD7A 5LWYH 4Y9GA 5JW4R 4NKMA 3UOAB 5KVFL 5GRYA 1A22B 4H44C 4K9EC 1IC7H 5AW3B 5IZ7A 3QPKA 1KIRA 3SE3A 4YLBA 5EEVA 5IESH 4JREC 3WEMA 1KCBA 3DPDA 2K1MA 2UXFA 3QI9D 4MA7H 5GZNA 1BLIA 4UIMA 2DBLH 2PCXA 3VFVA 1NIAA 1SM3L 3FTXA 3LEXA 1FVEA 3MDJA 1A9EB 1A6AB 4LHUA 2R0ZL 1CDBA 5E03A 4AUJA 2H5UA 5FGBC 3M8OH 2G4GA 3X11A 4ILDA 3LXBA 1JCKA 2K78A 2APFA 1MCWW 3QIWC 3VWKC 4CADB 1KGWA 3ZHNA 3IDYC 1I75A 3VYOA 1XGTB 3MAWA 3BP5A 3MNVB 5AALA 1KXTB 1ETB1 3II3A 4AQZA 3P3TA 5H2BB 2X7LB 4MA1C 5C0EB 5ADPL 3CGTA 4PJ9D 2AGJH 1WK0A 2BFVH 4S10A 2A6IB 3NPSB 1D5XA 3F5WA 4HCRA 4ZOCA 4NT6B 3SBWC 2J6WA 2PYFA 1KGXA 2Y5TA 3SDDD 4A6YL 5BRPA 5JMOC 3GTVA 2DWSA 1MFNA 1H6FA 1QBLH 4ZS7H 1DVSA 2FSDA 4AXWB 3BLPX 4RQQA 2XZZA 1IGTB 4M02A 3NIFF 1I8MB 2OMBA 4PJDA 1DLFL 3MLUH 1G1CA 1NDGA 4KQ4L 5G5DB 5DF0A 2P8MA 4PRNA 5CP3A 1S7SA 3JVGC 3GMPB 3QAZC 4JNXA 5EEXA 3MBEB 3N1PC 4ZPTA 3NTCL 4L8BB 1NGXA 1CFTA 4JZOA 2ZUQB 3BI9X 3JYCA 3WJMA 1JXGA 2ZX7A 1Y18A 4N8CH 5IJVA 1X9QA 3FUEA 1KGCE 1WO2A 4GBXC 4XNQB 1ZTXE 2DQMA 3GK8L 4P2CG 3CTTA 3KPPA 3VG0H 1HYSD 1P84J 4NQSA 4XE0A 3QJOA 4FXTA 2X4OB 4ZMPA 4MMYB 4BDVB 3K46A 4OCSH 2OMTB 4QD2E 3PQYB 2L0DA 1MRCH 5F0LB 2KPNA 3LNHA 4UQCA 3CVIL 4LEXH 4Y1AE 1H3VA 4JFOA 1RHHA 2XPZA 3NPZB 5E8NB 3SGEH 4E5XB 3T0EC 3UDWA 3R06A 2HVBA 1RZKC 4K7PL 5T3ZE 1DLFH 1G9NH 3D06A 3MLUL 4KQ4H 2I26N 4KTDH 5C97A 5DS2A 1I9JH 3MYJB 3RY5A 4AL8L 3UROR 3OQ3B 4IGBA 2ZJSL 4Z7UF 5C6TH 1YPZF 3PG2A 3VFWB 3OHXC 1UA7A 3LKSA 3QDJD 4J3XA 2CQVA 5DR5H 3FTGB 5F93C 2VSKB 3DRTB 4H4NA 1RUML 3FFCA 5KJRH 1EEZB 2W1NA 4XN8A 3T8MA 3OKYA 2EE9A 4GT7A 3K0YA 4JDTH 1DFXA 5F7DA 3T4AA 1XV8A 1YEWA 1MI5A 3H3KA 4H8VA 3UAJC 4CSTA 4KZEH 5E2VL 32C2A 5T1LA 3CZNA 4NAQA 1S9KC 4WY7L 5ACZB 1VZHA 1SYVB 2EINB 1ZTXL 1JFQH 1OAXL 4B7IA 5I1CL 1I8KB 4NXSA 1F6AA 3RUGB 4EI5D 4WV1A 4RETB 4H88H 4A7GA 3A4AA 4RISH 5KSAC 2H7WA 2Z4TA 2O5XH 4AK2A 4KJWD 1YNKL 1RAMA 1J8HD 3ZSTA 1KN2H 2CPUA 1O7DE 4WNQA 3MV01 1F4WH 1M1XB 1MUJA 3B7UX 2JTDA 5AD0B 2AEQL 3V0IA 4GIOA 3M17B 4L4VA 4PBVC 2QVFB 2XYCA 2B5IB 3NIGE 4P5TC 2Z31D 3L9EA 4PJEA 1NBQA 3JYBA 3QORC 5I75C 2H1XA 4WQOA 5I18L 3QG6A 3O3DB 1D5IH 2PABA 4AEHH 1V27A 4X6DB 4CKVX 4GKZB 3GIVA 3VA2C 1L0XA 1AKJB 5AVXB 4LLMA 4GKNB 1EFQA 1M7IB 1WUZA 4IRSA 2KMWA 2WLLA 2ZOLA 1UD5A 3V4UL 3HZKB 2EO9A 4GUOA 3ZW3A 1RZIB 4NFCA 2X9XA 3QXVA 5J6HA 4JM2F 5DUBA 4JJHA 1AQKH 3LZRA 3NZHL 1T04B 4PJCF 4YBQC 3K4AA 4NQED 1IKFH 1GH7A 2CAKA 2Z93B 3IMVA 1UVQA 3IB4A 4QKTA 5DXWA 2MCG1 2EIZB 5SWSE 4PJXE 1ML0A 2MQ0A 3R4RA 3PF2A 3NCYP 4X7EC 4HPYH 5FUCC 5ELIA 5EOQL 4LCVA 3FSZA 4EJ1C 3IE4A 4JS7A 4WDIA 2X87A 2FX7H 1F2XK 3NRPA 2UYLB 3WTWA 2E8ZA 5DJDB 4GUPB 2EUXA 1QFUL 5C0BD 1F3DJ 1KCVH 4UTCA 1HL9A 3SKNA 2IDUA 2WLMA 3TN0D 3NIGB 3Q3GA 2FRGP 4M1GL 5INDA 3VAEA 3ZVVA 5IM7B 1ZHKA 2BC4A 3M7OA 2HMIC 2VDQL 4BQ8A 1B9KA 5EF1A 3GS0A 4YDZA 4JFEB 3IRPX 4WHYH 4D7PA 1UTDA 3IJHB 1TPXC 3EO0B 2GW5A 2MKWA 3HZYA 4JGUA 5A43C 5I30H 1RURL 1NOLA 3LZLA 5EZOL 2X2HA 4U1NB 3VGAB 3KWTA 1MFDL 2JKSA 3C60A 1GOGA 5F7NC 4PG9B 4OLEA 5SWZB 3MCKA 1QBBA 3LKNB 4OD1L 5CCGE 5I8OL 2BMKB 2E86A 2F58L 5K39B 3FULA 3BRFA 4ZXBC 3FAXA 2G75A 1E4XH 1MF2H 4I5BA 5C0DA 3QFJD 3D6GA 3GRBA 1F0LA 1IJNA 2RCSL 5E8OB 4A7VA 3U36A 2V5MA 4LOFA 3FUMA 3K6SB 5KVDH 3B5HA 4X98A 3NN8B 3SD5A 1BXXA 1HXMA 3QNFA 4NOBA 3VI4A 4KAQH 3O2VL 4ENED 4RGNC 3C8KA 5GGSA 3WN5A 1I7TB 1KCSH 4ODUB 5FA4A 4ZMOA 3I9IA 4Z3HA 4HZAA 2GITB 4NFBA 1F45A 3QULB 4YGVB 4CJ0A 4ODVL 2WYTA 4HLZG 2ZX5A 5EC1B 5HI5C 2XT1B 4LRIC 2CO7B 2PCFA 4UYQA 3RTQC 2A9MH 3HTLX 4X5XB 4OT1H 3V0DA 3H9YA 4WFFD 5EZOH 3E1F1 3NZSA 4JFPA 5DMIL 4ES8A 4WEEA 1YNTF 1CR9L 1W8OA 1X9UA 1OGTB 1S7VB 2FATH 4P2RE 1KLFB 4UT9L 5D71H 1IE5A 1VACB 1RV6X 5DWUL 1MHHA 3CN2A 4Z7UA 1UCBH 4XHJC 3UPCA 1P4LB 3WDHA 4DQOH 1CZ8H 5I73C 1BWWA 2KZBA 2RCSH 3MZTA 4HKXB 4CILA 4YL4A 3T3ME 4DP8X 1PSKH 4F7CB 5LJYH 1ASPA 2ZE0A 1G9NC 1JL8A 1U6AL 4O02A 3C09B 1J5OH 4QRPB 3BOVA 4N5UA 2O6DA 5GRUH 3CZEA 4Z5RA 1IVTA 1M6OB 2JJSA 2KKQA 3IJ8A 1I7TA 2WSKA 2ENSA 1I3RB 3A6CH 1XBRA 3UCRA 3FSOA 4TVPL 2HJFB 2PXYC 1GTNA 2FEEL 1IFHL 3QUZA 4OQTL 1IEHA 4TSAL 5IY5B 3DX9A 1AC6A 3CHQA 4U1JA 4BWTA 4O51B 1NM4A 4PLKD 1P4UA 4Q7DA 3UMTA 2W59A 5I0ZA 4PS8A 1IX2A 4X99B 5B38A 1YNTA 1C12A 4N90E 5E08H 5IBLD 1DUZA 2NY6C 3BO8B 5FYLL 1WZ1H 3LHAA 1H8NA 4GRLA 1GIGH 4MTMA 2AFNA 3QRGL 1S46A 5FO9B 1BVNP 1CD0A 1G9HA 4D9LL 5I1GL 3B8YA 4G6MH 3RKPA 4OCWL 4MKTA 1XMWA 3QHZL 1CCZA 2VUKA 2CPCA 4OLWH 1NFDE 2C7FA 1IUZA 3GSXA 4LCWB 5F6HI 2WXFA 4JDZA 1XEUA 4LF3B 3EJYD 4M48L 5KSBF 4I9XA 3S3SA 4G8EA 1XCQB 4LLVA 2QR0B 1T03L 4C59B 1A14L 5JHLA 3ZRSA 4Y5VC 5HYJD 2VERN 3CZJA 4DTGL 4Q9QH 1F3RB 4UANA 2NXYB 1QBML 5L4JA 2JCCB 4XVSH 2N59A 4WWKA 2XV6B 4NN7B 3EH1A 4JPWH 2VN5A 3ZSSA 5C0BE 4NJAH 1QI5A 2R83A 3D2UD 3MLYH 2P9RA 5JOEA 5SV3A 1E65A 1FJ1B 1Q1JH 3EJRA 3FCBA 5DUBB 2ARJB 3N91A 4MCZB 5JOFB 4ZYKB 1JDCA 3DETD 1NCCL 1BIHA 2H1PL 3IXAA 4A2HA 5IP4A 4XXWA 2HFGH 4WWNA 5ITBH 1CICC 2XVBA 1WC7A 4PWFA 3T8XB 4OLWL 2NR6A 4NOFA 3ZE1B 2APSA 2VMJA 1TTUA 3ARDA 3A6OA 4IJ3B 4PJ7A 3T4AB 3VG0L 4UQ3B 1MRFH 4MQXD 3EGSB 4LP8A 2ZX6A 1C08B 4F58H 1BF2A 3B4NA 3P9LA 5DQJB 3FQNB 2EEAA 2G9KA 2OYKA 5ICZA 4LDCA 4AUYA 4WNJA 3CDCA 4J3WA 4IJ3C 3ZGHA 2VDNL 4OQ1A 3T0AA 1XCWA 5GGVY 5BRZA 1UZ6E 4BK4A 4M6MH 4E9TA 4JDEA 5FM4A 4OJDH 4MJ4A 4RGMC 1HINH 1KPVA 3NCBB 1HIML 4F5CA 1EHAA 2X6CA 1CUOA 2XZQH 3INOA 3TCTA 4OUUA 2NY3D 4FFWD 1TZOA 2PWFA 3R19A 4NX0A 4R7NB 2HJLB 5TE7L 4EUPG 1JYNA 2Y3NA 4KVCL 2QPUA 9CGTA 3VNZA 1PQZB 1EGJL 4OIIL 2AQSA 3U1SH 4X7CC 4X6CA 4OLZL 3L4UA 1BF5A 4NNYA 5AZEH 3TF7C 3FO1A 5ISZB 2LW3A 4IOFC 4KV5E 3RHWF 3H42H 5T1JA 4PW3A 4DUWA 5J13B 3W3BA 4RMUA 1DQVA 2M83A 5FGCB 5A2JH 4PRNB 4BH8B 4X9FA 1NCTA 3PDOB 4QCIA 1PD0A 2UWEB 4PJDB 2HG5A 4B96A 5JW5B 2J4WH 3QRBA 3RFZB 3V4LA 1AI1L 4Y0GA 3A21A 2DWEA 1I7ZA 3PHOA 3BP7A 4KK6D 4LSRL 4OZFG 1T89A 1RIVL 4TNVF 3L08A 4F57H 5ACLA 4HWBA 5BW7A 3BJ91 5GRJH 1XQ4A 5J6GB 1LVEA 4QYOB 3GJFK 2L7QA 2JKWA 2W8CA 5JOPD 1OKEA 2YJLA 4JRLA 4TYUA 3L5XH 4B5EA 4WAFA 1Y0LA 4N5ED 1ILSA 4LSUH 1L3NA 5LG1A 2A6KB 3SO5A 3IPBA 1UZ8A 2YAOA 5F7KC 3QFJA 3SJVA 1O5DT 2Z64C 1A6ZA 3N42F 5CSZB 1GCYA 2ZWYA 4TVPD 1I1RA 1EEUA 1NCAL 4ZO8A 5DVPA 4MAYC 4HS6B 5IMMA 2PN5A 3UPAA 2GBAA 5KSAD 4ZFOA 1EHNA 4PAZA 5C0JA 1RZ7H 3O3EB 3DOSB 3L4TA 4FYQA 3GMNA 4UNUA 2ZNXA 1ZA6B 2D31A 1TSHA 3BEVA 1YC7A 3QPXH 4MJIB 4Y7OC 1VGKB 5HXMA 2F8VA 2XBTA 1E3XA 2VISB 3H6JA 4HHGA 5FO2A 5JUEH 4ZSOA 5I28A 4NKIH 5I23A 3X17A 3HAEB 3I3BA 5EPMB 2VLJE 2FX7L 2FSEA 3TJEH 1ZHBB 1LP9B 3VFTA 4HD5A 4EAEA 5C0BA 5A2AA 1VA9A 3ZR5A 3NK4A 5L7XL 2FH6A 3WNPA 8FABA 3RWDA 2HKHL 3F6IA 2Z6FA 2CDGA 4Z0BH 3KD4A 3VD4A 4Q52A 1AZZC 4G7RB 1Q9OA 1S7WA 3EHBB 4MFHA 4PHZA 4U1SB 3PJNA 5FUZL 3DSFL 3FTYA 5KN5A 4RWHA 4AT6A 3VO0A 1OSZB 3ATFA 5FYKD 2EECA 2G3MA 4FG4A 4X9HA 3ZIMA 2D73A 4AOFA 2CO6A 1E27B 2VLJB 3EJCA 3CSYB 2X1XR 4NGHL 4JE4B 7PCYA 1UD8A 4WI9A 4UV4H 1KJMA 2F7PA 4Q6KA 1YN7A 5I8OH 2F54B 5KSBA 3ULVF 1EDHA 1P2CB 4V2BA 4X99A 1MWAB 4KZ0A 1SOXA 5B38B 5TFSH 3SB3A 3BQUA 1CLCA 4LPCA 4JPKH 3UZQA 2NX5B 2UZYA 3P2DA 1JNLH 4LESA 3PJSA 4LCCC 4LCYA 4OB5L 5AUMB 4MD5A 1ORQB 4L3EB 3RA7H 1J5IA 5DJXB 2EYRB 3LB6D 3R1GL 1YPZE 1J8RA 2JELH 4HMEA 3DVGB 1CGSL 3SKUD 1J0YA 1FDLL 2AI0H 4UI2A 3ZL4L 4BRJA 5IHBA 4FEIA 1MCWM 4PS3A 3V8CA 4NLHA 3GJFB 2R2HB 1AD9B 5EO0A 2A9ML 3UGEA 1OANA 4HDIB 3BUQA 2X6VA 4NQEE 1YMMD 4MXVE 5C3TA 1YQVH 4UV4L 5I2IB 4UAOC 5FYKU 1QBLL 2YSTA 1ACYH 2VDLH 2X4PA 5ECJE 3U9UB 1CE1H 1CDJA 2P5PA 1BJMA 3BX7C 4WFGE 2P49B 5EV7A 5HGHB 2X05A 1RZQA 4U6HB 3RGVD 2OYMA 3C60C 3DX7A 3PXHA 5T1LD 5KBPA 3E3QE 1BFSA 1L7TH 5L4MA 4EO5A 2ATAA 3TXAA 3AQYA 5I6LA 3GPSA 5HJGA 2ENQA 3ILPB 1OAZH 2XIIA 1HVXA 4GG8B 1J18A 1TOXA 3CD4A 3L5JA 2CLZA 4W4NA 3S36H 2W94A 4R8WL 3F7VB 3EYQD 5AEAA 1FYTB 4NBZB 1ZA6A 1A7OH 2CDEA 3QZMA 1TCRB 3G6JA 3ECBA 1W9XA 2GJJA 3VGAC 4MJIE 5D8JH 4BFNA 3UTTD 3WN5C 5KSVA 2F8IA 3V95A 3TC9A 3KW7A 4DEWA 3NMEA 4DFHA 5FKPA 3R18A 4YHLL 3RVWD 1YUHB 3FO1B 5C3IA 2IQAB 1PEZA 1MKFA 1LK2A 2DMBA 2AK4A 5E8OA 3VUAA 4MZ2A 2Z91A 4RMWA 5GQBA 4XMZA 5D1XE 3WV0A 3T3MF 1OT2A 1FGVH 3GRGA 4G80A 4IIZA 3I6LD 1ZHNB 5F3HB 1JZGA 1S9XA 2AVGA 4KJPD 2TRHA 4WY7H 2DLTA 3THMH 4D0CA 3HPLB 5TDOB 3HR6A 4XNUH 4R7NA 1UT2A 4OZIA 5D2NC 3BQVA 1XEDA 2WXGA 3EOTH 5ERWA 2JJWA 2K7QA 1WAAF 1D2PA 1DR9A 1AHWA 2CBMA 1UASA 4LKCB 1I1FA 1U8NA 4CVUA 4QRRD 1FVCB 4OCWH 3S34H 5HYQB 4R4FL 1OP9A 4R8WH 4PUBL 2ZOOA 1GOFA 3FQ1A 3OBAA 4HUCA 1NDMB 3VSTA 5I66A 1BDYA 1P1VA 3SCMA 4EI5C 3G08A 3KGUA 5DURB 1WAPA 2H6PB 4MAZA 4P4KB 5I16B 4J12A 1QHPA 3B83A 2AV7B 4J28A 1J1OL 1U8KA 3SBPA 5KAQG 3TS8A 2ZYIA 1KLGB 1L9NA 1P5UA 2HT2C 2NZ1A 2P80D 3M6DA 5D6DC 5ENWB 3G6DL 5I0XA 4HIEA 4ODHH 3MOBH 4AMKL 3NJJA 4DGUA 5C70A 3T8XA 4K8RD 5DEGB 4PJIB 1IEAB 1V54B 3G04B 4J3VA 5FR3A 2PF6A 2R29L 5JIDA 5CN3A 2WLHA 5KSBE 4ZNCD 3S48A 4XMUA 1XSJA 5I19L 2AEPL 5IROC 4H26A 1NANI 3ARBB 1MXDA 2WVVB 3HC0B 2OMUB 3VI3B 1RK1A 4X8JB 4APQA 5AW4B 5T5NF 1T20B 3PP4L 4LPWA 1U2CA 2H3KA 1R46A 4JY6B 4IEFA 3T09A 1S7TA 1MCEA 2G2PA 4ODTL 5TGBB 1U8MB 1UKQA 2WNGA 4MVBC 4DN3L 1CL7I 4J3BA 3VFMB 3N5AA 5AKRA 4DVRH 3BC9A 2E5EA 1UACL 1S3RA 3I6KA 4F2ME 4NQCA 5IUSA 3QS3A 6TAAA 3O2DL 4W9HC 2BSCA 3V4PA 1UYWL 1JF1B 2ITCA 1D9KD 1I3GL 2BNRD 3LNGA 3QBTB 1HHJA 2JF1A 3E9UA 2DTMH 2ADFL 4XN7A 4F37F 4ENZA 4HBQA 2Z35A 5HSFA 2P7TB 5FIEA 4JDZB 4LF3A 5I8EA 4AMKH 5FB8B 1H19A 3QEHB 2IFFL 3VRLE 3TBCA 1JHLH 2WKLA 5F1SA 5FO9A 1SXNA 3BXNA 2XETA 4AYMC 3L3GB 1X5LA 4N0FB 1F58L 3CN4A 3WTSA 3MRRA 4U05A 2IH3B 2J5LC 1LO0L 3ZZLA 3HE7C 1AJ7L 4JKNA 2DM7A 1HILB 4APXB 1JTOA 2VC2H 2W88A 2G5UA 4P5KB 4DH2A 4N26A 4PJ9B 1OPOA 4BQ9A 4YXKH 1BAWA 2VZSA 3AUWB 2F7OA 1UEYA 2AEIT 4P5MB 5DK0A 5GRVK 4BZ1H 1CE6A 2ZXEB 4XCFH 4UYPA 1PZ5A 1XF5A 3B9KB 5E8DL 3NPSC 5F7AA 2H6PA 3HW7A 3IPFA 3SDXA 2EE3A 1KJ2L 3ARDD 5JNYB 3U4AA 5AZUA 4MMXC 3S8FB 1AAJA 3WIHL 2Q86B 1MFAH 2OL3B 5D6CA 4LVHB 3P4MA 3U7YL 3OXRA 2M2DA 4IRZH 5AYTA 3VSUA 4UQEA 3WS6C 1U3NA 3LSOA 1ZY9A 2BWQA 3UAAA 1C5CL 1Q9KA 4N5EC 1DQTA 3W9DA 5E95B 5KOMC 4LCWE 4BSWB 4B9IA 2WKGA 2A99A 2HAZA 3BIAX 3KPNA 3X13B 3SHSA 3BH8B 2XC8A 2GAZA 4MDIB 3DPBB 1MCRA 1FNEA 5CEYB 1N10A 1CR9H 3IFLL 1TQBC 1VERA 1HXYA 1NEUA 2WV3A 3ZRCC 5HVWA 4IIQC 4NUMA 4I0PC 5AOKA 3KPPB 3RWEA 4HW6A 4XP9H 4PPTA 4JQIL 4ZTOH 2BOBA 2XWBA 4Z95H 3AMKA 3FN0H 2D7MA 2VJ8A 1U0QA 4TNWF 3ZKND 1U2HA 2IGLA 1ET8A 4P3WA 2RB8A 3L81A 4NO3A 4LEOB 1Z9NA 1AR1B 1WSST 3TVMD 4X5XA 2ADJA 1LEIA 5DC0A 3QEQD 3L1OL 4R7LA 3Q8BA 1I1AD 3GMLB 1SJEA 4WWKD 5K93A 3JBG7 3FQUB 2CR0A 3T6XA 3LOWA 2H26B 4DP2X 5FF6A 2AC0A 3G5WA 4MA3B 4N87A 4TQIA 4DERA 3HUJB 1CDCA 4UNTA 1NGYB 4TULL 1JXFA 4RZCB 2AMUA 1IFRA 4JHAL 2EKSA 1UXLA 5AL0A 3K6SA 4UT9A 3P3UA 5H35B 2X28A 1S9VB 1JD9A 2ZKHL 5E9DA 3VE0B 2ILLA 2XWJB 3PIQA 4JFZL 1E2WA 3S2AA 3DHJA 4XE5B 2M8XA 5D1ZA 3JZYA 1ZDSA 4FJYA 5FYLH 5GHWH 3AXLA 4GRLD 3BIKA 1CMOA 3STBA 4LP5A 5HGGS 4JG9A 4P2RB 4FNTA 4LSPH 3QI9C 4Z78B 5A2KH 1U8HA 4AC4A 4O58L 2Q10A 4R3SB 4GSUA 3U1QA 3BWUC 1BJ8A 1A1OA 3MTXA 4FXKC 1KCUH 2IC2A 1KBGL 4X5WB 3WFDH 1G7IA 2Y22A 2XN9B 4JREB 3RAJH 4HWEH 1XGZA 1I7RA 4RSYA 1KIUA 2C1PB 3FCSA 1T1YB 1BVOA 1AMYA 3QI9B 4JPKL 3DVGA 2HTLD 1BQKA 1LK3H 4HXAL 3RNQA 4HV8A 3V4VH 2BP3A 2VDLB 4AQOA 5IB3A 3RE0A 1KGUA 4J6RH 4FCAA 5AOIA 1SOSA 5FCSH 1JGUL 3NDYE 3V6FA 2EUWA 4GSRA 3OKLA 4I87A 3TYFB 1LP9E 4I18A 2IBBA 2FB4H 2VLRA 1ZVSA 4NKMB 3C5JA 4HKJB 3QXUA 4K3DH 3TA3D 2DQHH 1XFPA 1S7QA 4K5NA 2DBLL 3VD0A 1FDLH 2AI0L 4BCXA 2WLIB 1O6TA 3TPUB 4XVTH 2IOIA 3C5SB 1KTDA 2NY6D 3AU0A 1ADWA 1KJMB 3E6HA 2F53E 1AZBA 3D87B 5HI4C 3TWYA 4YFEA 3TVMA 2DQCL 3QJFA 3E0GA 4DZBB 3CIQA 2OXHA 4FNUA 4NPYA 2GY7B 4GH7B 2WY3B 5HDBB 2BIQA 4J3UA 1GC1L 2R1YB 3Q1SH 1ZMYA 2WQXA 3VWJB 5KYXB 3H4FA 1J8SA 4JFFD 4B0MM 4NJAL 1E6JL 4F7EB 2ZP0T 3NDZE 1ZPLA 2X0VA 1P4IH 1FGNH 3HB3B 1ROCA 3K3QA 5C08D 4A63A 3PWUA 1UOLA 4UWQB 1PEWA 2I60L 3PY9A 1TTFA 3H9HB 3ZL1A 4FFYL 2WP3T 4ZAKB 2ZYSA 4Y2NA 3L48A 3S97C 1BF8A 1HZLA 1M71A 4PJIE 1M9WA 4HJ0D 1BYNA 4LLQB 3QDME 1PX8A 3IS1X 1NC2A 2R0KL 4AH2A 5HYJE 4Y8DC 5C0AD 1DLHB 2ODIA 1ZRUA 5C0AA 3N40P 2LR4A 4P5RA 2VMDA 3WDJA 5D8JL 1MIEL 4PJ8A 4PJHE 5E5LA 4QO1B 4N1EA 1I1AC 3BWSA 4MWFA 5MEPB 3PL6C 3ZZQA 1GA2A 2BLFA 4GSXA 3ZKMC 4HHWA 4YDKL 1FNHA 1NC4D 1YEEH 5I9QC 5CO1A 4EBQH 2EXYC 1IAIM 2GK2A 1LE9B 3E80A 4WJ5B 1ADQA 4M6ML 2HX8A 4DP7X 4DO6A 1ZAGA 3IDNA 5LN8A 4HIJB 2BSTB 5AZEL 3QCUL 5I6XC 3HI6L 2ICWI 1MCIA 1D5RA 3H42L 2J56A 2OJZL 3LEVL 1AC0A 3BFWA 4DF9A 1Q9KB 4F91B 3SKOA 1W16A 4JN2A 1AGEB 5I5JA 2AQRA 3DURB 4F8PA 3RX8A 1CFBA 4LAQH 4WNQB 5CFAA 5J06A 1KB5B 2BZDA 4K3JL 4AENB 3CLFL 3ULUH 1RZJH 4KO6A 1G4MA 4S0TD 3O2WH 5IVNA 2YQ2A 2YEVB 4WV1B 3ZL2A 4AGMA 1JNHA 4CVZA 3TEXA 4P5SA 3VM5A 4TTDC 2LU4A 3GBLA 4QGYA 2UXVA 4FQHA 2X9ZA 4S2SA 3MRLB 4DPAX 1PAMA 5E51A 4XPFH 3IGKA 2EJ1A 1UM5L 3P4OA 3QYMA 4EI0A 4WEBH 4CVWA 3ARDC 4HOWA 4YDKH 3KLAB 3A47A 5I6PA 3W5MA 4JDTL 4AGOA 5GIRB 5DRWB 1FFTB 5DGRA 1AY1H 4LT7A 3RB7A 4J39A 4I1NB 3VU2A 2XY2A 5DJ2A 2UVEA 5I5RA 5IW6B 4IMKC 1WYJA 3KPOA 4QPEA 4JK0D 5ID1A 5DEJA 4N2OA 2QFPA 3GMPA 4GO8A 3H3PH 4BWUA 2JJUA 4K2UL 4QAWA 3VXNB 2ZX9A 1SUJA 4K3JH 2YBRA 4UZGA 1KN2L 3DX8A 2AJZB 2YSSB 1IO4C 5JUEL 1GYUA 3WSQH 3UZVA 1JPSL 3HBQA 4DN3H 3HG4A 4NQCB 4F2FA 5BS0B 3JSSA 3VXTA 2WW8A 3EOAB 1H6UA 5EU7E 1A9BA 4YLQT 1TU2A 3I6GB 5ICZB 1MIML 3C09C 3BUPA 4WU7A 1VKXA 1TLMA 5BXFA 1X7TA 3CC1A 2NT1A 4JW3A 5CUSL 4TSCH 4F33B 1I8AA 2L7JA 3SCMD 3ZIYA 1XF4B 2NPLX 2EVHA 4TUJB 5EFIA 3HNSL 2XZAH 3N9GL 5IBUB 3WE6A 1GPOH 5HY9B 2W9EH 5FUZH 5K9QG 4TQ8A 5F9OL 4TOYL 4ZMWA 2XG4B 4PW9A 3OB8A 4KMTH 1KEGL 1NGXB 1RQ5A 4TPRL 5AW6B 1PX4A 3KL5A 2HRGA 3TFKC 1E7VA 1S7SB 4W4OC 3D39A 1MI5D 4PP2A 2Q8AH 5KS9A 1LO0H 1CN4A 1QSFA 2P24B 3A3YB 5C9KA 4AYID 4U1HB 4N0YL 4HKZB 5DTFB 5DFTA 4JUSA 1GS8A 4ZFGL 1QFWL 1DQDH 5ALCH 4KI5C 5F1IB 1AIFA 2NW2B 4UT7L 1PD1A 1U3HD 2CBOA 3B2PA 2Q8BL 2QDWA 4DKDC 5DHEA 1ES0A 2WOBA 4R3SA 1YCSA 4U3HA 1C1EL 4OSUH 4IRJC 2V2TB 3BT2H 4KUCD 3OWEA 4MQ7B 1BZ7A 3L3OA 4JRYD 5LO7A 1KZYA 4NBXB 2C4FT 1FC1A 5MHSE 4IRZL 4LQ1A 4G7YL 4NP9A 4YNYB 2VDQH 3TZVC 2ZT9C 4TOYH 4GI9A 2CUIA 3GSVA 5HGAA 5JPMC 3QUZD 4ZUSB 3RL1B 3MV9E 1YMMA 4DEPB 1QA9A 2A77L 2EDKA 5EULV 2C3HA 3L3KA 2LOEA 3QJUB 2F68X 3K2MC 3V5HA 1J8HA 3HNTH 2X3BA 3QZWA 5BCAA 1NUNB 4Y4HB 1RLWA 1JYVA 2YOCA 2X40A 2VW6A 3QJVB 4UTAH 1CGYA 1THAA 2RACA 4OZHE 5LBVA 4BE6A 3I50H 3FO2A 1JN6B 2RBLA 2YWYA 2ZUYA 3UYPB 1UXWA 4YQXL 2BSED 3APDA 3RG1C 1X5KA 3SOTA 3B3BA 3EFFB 4DK6A 4GXVL 4NAJA 2O4EA 3NZ8A 4YSCA 4WTZA 1BVZA 2DL9A 1IB5A 2QSTA 3BT2L 4G7VL 5DJ8B 4UOQA 5C1MB 1T5WB 1TCRA 3RTQD 5IWLA 2ZAHA 4ZFQA 1HEZB 2NDFA 4BGDA 3WIFA 4ZXBA 1CFNA 2Q7NA 3GSNH 1WBXB 2Q76B 3MRPB 4PS4H 5GGVH 2EADA 1A6VL 3DBXA 4UNIA 1HXYB 1SDYA 3EOYG 3PV6B 2Y24A 3DX3A 3X13A 5LGJA 1K9TA 3U6XS 1UG9A 2A77H 3QSKB 1UC6A 4L2YA 3WEBA 4A37A 3LIZL 5GZOD 2I24N 5CLZA 4A66A 1D5BA 1BM7A 2F18A 3BQUD 1U91B 3RILA 3CFBB 2D7TH 4XMLH 5CSGA 1ETA1 3T2QA 3GXDA 3NJFA 3UYRH 3MX0B 2MQGA 2NUTB 1ND0B 4NLAA 2ZXGA 3ML9A 2Q7YB 3GXFA 3UL4A 1PCXA 3WTUA 2GJRA 2VDOL 1MAJA 4PCTA 3K0WA 1BEYL 3HG0A 3SE8L 4LVEA 1E5AA 3N1MC 3UBXB 3GBNH 5I74C 5TH2A 4PVBA 3IU4H 3I75A 3KBPA 4FZ8L 3THML 5IQOA 3NQKA 3MV7E 1WHOA 1PIFA 4WO4D 4H0HB 1IFHH 4XCNB 4ZD3L 4QNPE 4ZW6A 4TLSA 2HUHA 2NY1C 5AAPA 3T2NL 1QR1B 4ZUTA 2CHXA 2J44A 4X0NA 5CF3A 1Y6MR 3IFOA 3JWDH 2MPAH 4J27A 2WWMC 3BE1L 2HKFH 1JGIA 1AG0A 4JKLA 3PGCA 4R4FH 4XP4L 5C7ZA 1LP9F 3P1VA 1DJWA 1RL1A 4Y7MA 1U58B 3AQDA 1P5VA 4L3CB 3L3IA 4KXAA 3A6BH 4LSVL 4M7ZB 1Z0NA 2CO6B 4TQHA 4DP5X 1BQHB 3ROOB 3WXVL 3HI5H 3T2PA 5BV7C 4F1SA 1ITBB 2WCGA 4K9JA 2H3NB 4IBYA 2VJXA 1QEWA 3GRWH 2Y6SC 2C3WA 2Z4QA 3IGUA 2FWSA 4MCYA 2NSQA 2XA8L 2AZAA 4ZMYA 1E4XI 5B4MC 3P9MA 1LEKB 2F15A 1KGCD 2CHDA 1FGNL 4MD4B 1BGXL 5KBKA 5KTEL 2UUDK 4WUUB 1T03H 3R4DA 3AACA 3RKDD 1O7SA 2BOCA 2C9UA 4LU5L 2XV3A 4LKXB 3GIZH 2EYTB 2C1OA 3FBQA 3JWDL 1JV5A 1W72B 3MCG1 3TH2T 3S3CB 3IFPA 4I3SH 4U7SA 4DZ8A 5DD1H 1DQMH 2IDQA 3OZ9H 2F54D 3F6JA 2QGEA 3HN8A 1U8OA 3ARUA 4X4YB 1B0WA 1MAML 2HKAA 3VI3E 3T3PB 5HHNB 2P80A 2A6DA 4KV5F 2R7EA 5DK3A 2X9WA 5B4MD 1BECA 2WB1A 1IGIL 4YHZL 3U0WL 4J23A 4ZQTA 4ADJA 1NQBA 4UU9A 2ZKWA 5FHAL 1YN6B 2VUYA 3EHBD 4RAHA 3RTQA 2Y3AA 4N2GA 5I15L 4CRPA 1WCBA 3HLKA 4AZ8A 1QEWB 5DHVH 3VI4E 3AB0C 2FYVA 4G3YH 4HOZA 4M7KL 4MB3A 4FTVB 5IMKB 4PMEA 1T0MB 4PG2A 2WMPA 4U1GC 4P2OC 2WPGA 3GGWA 3MBWA 4MNHB 4P49A 4YK4C 4FLRA 1ONQA 3PHOB 2CKBB 2DWEB 2AJZA 2YSSA 4YDJA 1U30A 3RQ3A 1I8IA 4LCIH 3CLFH 2VT0A 1BOYA 5FECB 4I3SL 3PGCB 2CE6A 1JUFB 3GXIA 1BOGA 3A5VA 3LRMA 3LAFA 3OKMB 4LOUD 4C4KT 3C5ZB 5J9PB 2QT6A 3S8GB 4PJ7E 5AVSB 4DKEH 2XZQL 4PJGB 3GHBL 2J1KA 1RY7B 2CJTA 2YMOA 4JPSA 1PQZA 2X4RA 1W91A 1VFBA 2OJ1A 2YPLE 4JJOA 2NY0B 4HUXA 4YHOL 5ANHA 4WCYH 4LSDA 3JWDC 4PJCE 1IBBA 5F3BA 2OULB 4QRQA 3QUYD 2B14A 5D7IE 2KPWA 5B3SB 4PJGF 3O3UN 5F89A 3GS7A 2Y5QA 3RWIB 3C8DA 1PGRB 3K5SA 3L1OH 4GNKB 3O8XD 3FS9A 4POZC 1CYGA 5FHBL 4YHIA 2RR3A 3ULVD 2IGFH 2OLDA 2VDPL 2F58H 2FJSA 1CBJA 5B21A 2QQKH 2WANA 5I1IH 1Q38A 1KCWA 5I2IA 4R7XA 5HDLA 4FFWC 4UT6H 1QHQA 4FXGA 5B1AB 4OZFH 4FDWA 5JHDE 1EDYA 3DSNA 1SQMA 4TSCL 2EP6A 2JCWA 1ZJBA 1KXVC 4GAFB 1ZT1A 4JZJC 1CTNA 5DZ9A 5FUOL 4PW4A 1DQJA 5GGRB 5DHYB 5E2UL 2WBWB 2UX7A 3AY4A 4NO0D 5IHHA 1OM3L 3CFTA 2YN3A 3MLZL 5GSVB 2NNRA 5E6UB 4KMTL 4TTDD 4B97A 5HBBA 4JFVA 3QDAA 2JSFA 1EXUA 4CVXA 2E8YA 5CHNA 1MCNA 4LPYA 3L45A 4K5OA 5AUMA 3FCTB 1H9DA 1BVKB 3KPMA 4YDNA 1O9WA 2P8MB 2IGFL 1MCQA 3ECWA 4JY5L 3U2SB 1QFWM 1P2CA 1QSEB 5DVKA 1OP4A 1G9EA 4BXSV 3PUCA 3RVTD 3WJJC 5C08A 1NIEA 4F92B 1S7UB 2PYFB 2BNQE 3QHTC 1KBVA 4BFRA 5CIPA 2KBGA 2GPZA 2X89A 2YMTA 3OJ2C 4AT6B 1UM6L 3PWLA 3L16A 1NCJA 3NFPB 3X1FA 1MCBA 1SJHB 2JFCA 4TUKL 3UTSB 5GZND 4XP6L 4EOWH 2ZOKA 2B3IA 4FN0A 1PG7X 3X1GA 4NENB 2I7SA 1W6WA 2BFGA 1N9PA 8FABB 3LQAL 1B6DA 1NEPA 4XVUD 2V2WB 1F6LL 1CD8A 4HJJH 1H5BB 2V2TA 1DJXA 2FSEB 3X11B 3MRIB 2OTUB 2WUBL 1KPUA 2W80C 4ZQKB 2FB4L 4XPHH 5KUKA 4LBEA 3NBNA 1CDGA 1QHOA 5E0QA 4Z3GA 4MNQE 1DANU 2VDRH 3TFKD 4IHBA 3CK0L 1YEFH 2WKOF 4YE4H 3SCMC 7TAAA 3STZB 7PAZA 5KANI 5GXBB 2E7DA 5IB5B 5I75B 5K59E 2AABL 4WU5B 2NXZB 2VDMH 2MNUA 4JO3L 1BBDL 2X6UA 4D8OA 5C0JB 4HS8L 1W0YT 2FX9H 3MLXH 1CGVA 3IDMA 6PCYA 4HOXA 4IKLA 4HH9A 5KSAA 1CGSH 5JIPA 4LOVA 2DBJA 5HY9A 3MRHB 3NCJH 4NM8H 3IKKA 2L04A 3WE6B 3ME0A 4AVJA 3QAZB 3SJVD 5I1AB 1OSYA 3DMMB 2EIDA 1A14H 4WU7B 4K9EH 1VKXB 3UBXG 4AIOA 2W60A 2JI2A 4Y5VB 1YQVL 4MZIA 4YVUA 4JFFA 2X4TA 3FTUA 4LEXL 1G84A 2VLME 3UEQA 3LN5A 3CN3A 4KJQD 4UOW1 2NLJB 3DX6B 4R96A 1JZIA 4ELDA 2WIMA 3BH9A 2DM2A 2YARA 3Q13A 3H9SE 4FQCH 3EG9A 1T22B 2DIEA 2AABH 2DYPA 2E6JA 1HT6A 3UMNA 2COVD 5C6TL 3S4SA 2VOTA 4PJ5B 1Z9LA 2WTRB 3PABA 2HT4C 4H8WL 1LO4L 5T5FL 3X1BA 1XSIA 2PR9A 4Z7VA 4G9FE 1HHKA 4HUNB 3LN9A 1VFBB 1SJEB 1NMAL 4KZEL 2WQUA 2ATKB 3ULAB 3ZRFC 2HJKA 5F9WB 4GIPD 1U8CB 4Y16A 1TFHA 3UO8B 3VJ6B 1I8LA 2QELA 1UKTA 1Z5HA 1P1ZA 3FQWB 3LPGA 1N64L 4LVHC 2E9GA 4KHXL 3VW3L 4FEMA 4JGMA 1UZGA 2G75B 4I5BB 1JE6A 5ISZE 2VZOA 4IIQB 1K5NA 1K3ZA 2WLYA 1U8IA 3CLEH 3GSWA 4D0DB 1TXKA 1SPDA 4NC1C 3V6BR 3LNFA 4PRDA 2ZKMX 3KPNB 3MJ7A 4RGNB 4WENB 4B9ZA 3ULVL 2QPEB 3QQNA 4KKAC 4XPFL 3A4FA 4OZGE 1JVOA 3O41A 3GO1L 2Z31A 4NQDE 3KLHD 1AR1C 2HFFA 3QQ3B 4HZLB 1FFOB 5DMKA 4FZEL 2ADIB 1OP5H 1NGPH 1J0JA 2FT7A 5E00A 3B9VA 4LLWB 2FECI 5KUMA 1CXLA 5F96H 4MMZA 4UM9B 2ESVE 1TEGA 1WZAA 5TDPA 1XF3A 1T2XA 5DRXA 1ZE3C 4E0RA 4ORGB 43CAA 2A9NH 3SQBB 4XH2A 4A68A 4HLZH 4LU5H 1NSNH 2QDVA 4KX8A 3C12A 1NIFA 3HZVB 5E9DD 5EIQA 1R33A 5M94B 2V3EA 5T3XE 4KDWA 1CDHA 5C7XH 2QKIC 3IFPB 5HHMB 2QVMA 4WJG3 5G4OA 2GEQA 3MOBL 4M61A 2X70B 2H2PD 5L88L 2R1WB 1IAKB 5E2WH 1UADC 2BHZA 4PI0A 5CILL 1RZIA 1MAMH 4F7TA 3NOIA 3FU9A 5J6SA 4F57L 1P53A 2H0JA 4FXKA 3JT2A 3GO1H 5TDNB 1NFKA 1MHCB 2R0WL 2UY6B 2IANA 3U0WH 2KC0A 3O3AB 3HVDA 3GLEA 3L5XL 2GIMA 3PNRB 2MTAA 3TFBA 4CW1A 5HHOA 4GW5B 4OGXL 5GZNC 4FZEH 2EDYA 4MCYB 4ZFGH 3QXTA 4Z7WB 1K4DA 5HI4D 3X12A 1T7ZA 1R5IB 2WN2A 5GPRA 3LN4B 3SPGA 4UQDA 3EGDA 3H7LA 5HDWA 3L9RB 4F7KA 5I1EL 2Y1VA 1MLCB 3OR6A 4ZMAT 1C16A 1A9VA 2PW1A 4FA6A 4KPHH 1RFDL 2CLVB 1OWRM 1P0SE 3EBGA 2FZ3B 2FQGA 3SGKA 5IBTH 3HE7B 3PHSA 1JZFA 5BUPA 5CBEB 4FQ1H 3VDBA 4JN1L 4HSCX 3KM1A 5ALCL 4H26B 4C4BA 3V79C 2GSIB 2XXCB 4PJ8D 3RKDC 1MH5A 3ZTEA 4KUZH 4R7DA 2DWDB 3TJEL 5KVEH 1A7PH 1J9SA 1SFHA 3D08A 3U30B 5L7XH 4H2AA 1QLEB 1SMOA 3CXDH 4K3EH 4B60A 3QJRB 4YE0A 5I1LA 2Y6SD 4EN3C 4DVBA 2HKHH 2WXHA 4GS7C 4PTUA 5IVXF 2ADIA 1FNGA 4RLDA 4WCYL 5C71A 1MCLA 1LEGB 2CWRA 2QGDA 3BSZH 1FV1B 1U92B 5IFJA 5FPIA 5EORH 1UA6H 2BNUB 3KXFA 3WFCL 3DTDA 4LL1A 2VO8A 5D7EA 5TQ2H 1SEQL 1WIUA 4WWID 4RGND 1Q9LA 5E6RB 3ARSA 1U8IB 5BV7H 1Q9WA 3QQXA 5SX4I 2DJUA 2P47B 1RPQA 3QUYB 3VFNA 4TMPA 1WIPA 3SYCA 3GNML 1MAKA 2QVIA 4QRPE 4KKRA 4QTHA 3U46A 4FLSA 1JPTH 1G9MC 3BAYA 4XB3A 3NIFB 3SDDA 4NB7A 2E0PA 1OCZB 3K72B 4WWKC 5FV2A 2IAND 3N04A 5D7LB 3SDXF 1GZQB 2EVJA 1U6AH 4QXTB 2GJ6E 3L6FA 3OMAB 5GRUL 1YVLA 5FUOH 2YPVL 2HTKC 3ME0B 3U83A 4S1SH 1FPTL 1NFIB 3GMLA 1HHKB 5GGSY 3QWNA 3MU3A 1TO4A 3QP3A 1A6VH 1JI2A 2IAAC 4DQAA 1FQ9C 1TKWA 4LDLB 1X5IA 1LWRA 1WS7A 2BVPA 5J3HC 3ULVC 1RZGB 2YKLH 4KITB 3AG1B 3RIFF 5IREA 4NZFA 3QO1B 1YYLL 1TZGL 4HUKB 2Q0ZX 4YH6A 5HVGB 3UPRB 1J10A 4H40A 5F7YC 3H85A 4ZXBD 1UQSB 4YC2C 1QKZH 4LSTH 3S6CA 2LGNA 3AQXA 3TLRA 5JQ6L 3LKNA 3DRQA 5T33H 1CFSB 2ZAIA 4O9HL 4ZQKA 5D96C 5EOCL 5CJ5A 3GZOA 4J2QA 3C60B 4JGNA 5CEZD 2VKWA 3HCVA 5LBGA 3KLLA 5E6IA 4JRXA 1RK0A 2J5WA 2ITFA 4MAUH 1S9YB 4Q74A 1IILE 2E6PA 1OAYL 3OXRB 4U3SB 4KXCA 1Y1UA 4S1SL 1B2YA 4HT1H 2OL3A 4Y5XA 1RUPH 2Y1YA 2YK1L 3MR9B 3RUGE 4BK5A 4NRZB 1LO2L 3BJLA 4FYTA 5DJAA 5K9KA 2Q6WA 5LGKA 3RIAK 1NUFA 1XGQA 1A1NB 3O0RL 3PRZA 5I0WA 4YUEL 2JB6B 2BHFA 3KHQA 3GRWL 2D7NA 2XWCA 3CVHB 5DTFA 4JVUA 1SM3H 3U2SA 4M8QB 4HP5A 2YXWA 3NJVA 4J3TA 1UOVA 2J20A 1VJSA 1HILA 3OAUL 5L2JA 2FK9A 4G42A 3N1QC 5A2LH 4WFGD 2OZ4L 2VMFA 4IRZA 3N1GC 4XN1A 5I8KH 2WIIA 5JW3L 4GQQA 3D18B 4YSEA 2P5EE 3MLXL 2GTWA 3OXSB 2GIXA 2HSIA 1JP5A 2Y36L 4NENA 2BIPA 2L4OA 4XB7A 4P2YA 3QG7H 1NFAA 2DQJL 5AB2A 4WUKL 3RTLA 2EIJB 4NSKA 2XA8H 2BO0A 3O4OC 4L5FH 5JR1L 5EDXA 5H4YA 3SPVA 4F9PC 4MA8H 2CCWA 4S1QH 2W65B 3TH4T 1RJYB 4UIKL 2Z0UA 1B0RB 2ESVB 1CXHA 3D25B 2W91A 3BHBB 5DFWH 4Z1PA 3UTTE 4A6YH 3MUY1 1OAUH 2FT6A 2XIDA 1BZ9B 5T3XL 5IVOA 1N68A 3CFKB 2BP5M 3MREA 5LNGA 4OZHF 3O3AA 5CXPA 3ISRA 3H9ZA 1WLHA 5FOJA 3D2UB 4NN6B 5CHNB 3E6FB 1BD2A 4HKBB 4XP5H 4HG4J 1NCGA 5D5ME 3NGBC 2FQEA 3SDAA 1EEYA 1TVHA 4GPVA 4F7TB 1ODAA 4JRYB 3G9VA 2VDQB 5F97E 2WWOA 5HJBA 2VDMB 4YHZH 1ADQH 3WMPA 3BD5A 3L3JB 3PHQA 3GZPA 5DEGA 1H3TA 3TNNA 1SLUA 5T1DH 4GRWE 4DESA 1U3HB 4FYSA 5AL8A 3RGBA 2C9QA 5IJKA 1MREH 4UM8B 2VR4A 4XNZC 5FX3A 3LZFH 2R51A 3O3EA 4PRPD 4NI6A 4KOCA 2ADGB 4X42A 1JV2A 1YC8A 2VE6A 3IRZA 1MCPL 3AC0A 1S7RB 1QYGL 4W9EC 1EO5A 3B1TA 4HA1A 3GHBH 3MRLA 4ORGA 43CAB 2E59A 3GI8L 3PWNB 4PWJA 4QOKB 1MHPH 3SGJC 1JNHB 1G1OA 2R23B 1M1SA 3TBSB 4F2MA 3II2A 1Q94B 5D7KE 1S6NA 3QUXD 1KB5A 4JM2A 4PGCB 1FAIH 1DJHA 3HJ0A 1AGEA 4G5ZL 4QHLB 2Z31B 5KW9H 3NJGA 2VR8A 2NY5H 3PP3H 3F64A 2FHFA 5HJDA 4ZFOB 4XO8A 4JM2D 2QEJA 4OZIB 4HCIA 8PAZA 5H4ZA 3D69A 4IIQA 4OZHA 1UWGL 2P44B 3O2WL 1AE6L 4N24A 3VH8G 4ZZKA 3SO3C 3OJMB 2VM4A 3P54A 2VSMB 3PREA 3MACH 5C86A 5L2KA 4OJEH 1JFQL 3EUDA 3O6LH 3FW6A 3K2IA 3VXUA 3FO9B 3HIZA 2Z65C 4NO5A 3E1ZA 4ETQB 2KUTA 4R84A 3MC0A 4H88L 5K9QI 4A67A 4B9GA 4DZ8B 4PJBE 2GHZA 3LRKA 2CKBA 1BD2D 2OKMA 1NC4A 4JG0L 1TNMA 3H54A 2CLRB 3KM2A 4YOKA 2YEZB 2YPLB 3L5WB 3QFDA 2Z1PA 2APTA 4X4ZA 2Q3AA 4RFNC 3F2LA 3MA9H 1FH5H 1V7ML 4X6EA 5G4MA 1Y6KR 1KELL 1I31A 4Z0BL 5IBTL 4IKKA 1JPFA 1H8OA 3EGXB 2X4PB 1PFOA 1X5ZA 1RZFL 3HMXL 1UEMA 3AY2A 3C8HA 2QQLH 1IIKA 2Y1AA 3H3BC 1U41A 1JZ4A 1KCKA 3H56A 5A7BA 4HFWB 3PV7A 3QC5X 4FQ2L 3OJDB 4UM8A 5AQ0A 4UM9D 1UA3A 2WLIA 3KL0A 2XYBA 1OCRB 1X5JA 2XZAL 4F15C 1PLGH 2F53D 3MLSL 4NDMA 1Z9SA 2IWGA 3BESR 2OFQA 1WQVT 2EYRA 1YECL 4NUPA 3WNOA 3UTTA 1K85A 4ONHA 4RGNE 4MD5B 3LQAC 3ZKMD 2ED6A 5LAXA 3RU8L 4P48A 3GB7A 2OMZA 2UZYB 5JO5A 3EJUA 3ZL4H 2HLAB 1KIUB 2C1PA 4XOCA 4XN9A 2KLSA 5I1JH 3R0NA 3VGGA 1S5IH 1JWUA 2PNDA 5L4IA 4LRIA 4JO3H 4Y2DC 2FX9L 4MNGB 5K9KB 3TBVB 1SEQH 5DEZA 1U58A 2CUMA 2QKIB 2WVTA 2X10A 4NSKB 4JM4L 1PDKA 2E9BA 3TYGH 1YEFL 4KX9A 4YE4L 2OCCB 3SKMB 3FJTA 4DWHA 4GW1A 2QHLA 2RA1A 1IM9D 4OI9A 4U49A 3K6OA 4B3VA 3QIBC 4JRXB 3O9WD 3ZT6A 5E6IB 2W0LA 5ADOL 3D18A 1A5FL 1EXHA 3GTNA 3WEAA 2XHNA 3KR3L 5EN3A 4WKZA 3UP6A 1HQRB 1PU0A 4ZSOB 2YA0A 1R3JA 3P3SA 4JPQA 2YXVA 1VGKA 4RDBA 4Q8BA 3FQYA 1WT5C 2LVEA 4OY9A 3JTTB 2EDLA 4UDUA 4AMWA 3T3MB 3GXNA 2Q7YA 3ORJA 1A1NA 4PR5A 3GC3A 4LIQH 3RWCB 3C9NB 4XVJL 43C9B 3L4VA 4OT1L 4CA4A 4J3OD 5DC9B 4F27A 5DO2C 3ABLB 2DQCH 3N0PB 3FXIC 3MV7B 3OVUB 5FK9A 3IJYA 2OJEA 4S1DD 4C55A 1AGBA 2WYIA 3QFJB 3GUTA 4GQZA 4QRPA 1AOHA 1YDPB 4FXLA 4NQDB 4KGJA 4XCYA 4KKBD 4TUUA 1J8HB 1TITA 4G82A 1GZQA 4MSWA 2JTYA 1VSCA 3V6OC 1A7NH 2PYEB 3D39D 1EANA 1EZLA 1NLDH 1PS3A 3CLWA 5DHXB 5GGQL 4HC1A 3BP7B 4PIBA 3RVXD 1KLFA 2WJ5A 2WSDA 2TSAA 1MI5E 4FNRA 1RIUL 4ZSOE 3ZK0A 3REVB 3QDMA 1IARB 3QO1A 4QTIL 3IDGB 1ZSDB 2Y23A 1E6OH 4QJ3B 1JXDA 2XWZA 1FNAA 4RAUA 1BX2B 1WA2X 4M7LH 3L7FB 2R0LH 2I5YL 1T5KA 5DZPA 5EN2B 5IFJB 2VXUH 2YAPA 2OR8A 2ZUQC 4KHXH 1VENA 3IXTB 3O8XC 3QCVH 3RNKA 1VEOA 3GBNL 3FB6A 3TIEB 3U25A 3L54A 3EYOA 3MRRB 4H13C 5HHMD 2YLKA 2XQYK 1HOEA 4PJFF 1DEEA 1J88A 3ESMA 4TV3A 4R7VA 2HN7A 3CHOA 5C0CD 4PVLA 4P59L 2A9AA 4OI8A 1PG7W 2IF7A 2WUCL 2PR4H 5MERA 4LHQB 4WW1A 4B9CA 3IRCA 3QHZH 2DQ6A 2P7TA 1UWYA 2HKFL 3JV6A 1KZQA 4NQXB 4YNYA 4S11A 5D7LD 4DEPC 4Z3TA 4H1LB 5BUAA 5AW8B 3UIYA 3VA6A 3NT0A 3QO0B 4KTGA 1YEJL 4BJLA 4H8UA 2WWKO 1FLRH 2E6QA 2PO6C 1T2QH 4MGXA 4X7DC 2FEDC 1A0QL 4FLOA 5I9QB 4Z77B 2GUOB 3FBKA 4UUJA 3KWUA 3VFMA 5ISZD 1NEZB 2VKXA 1CGWA 5D72H 5IB1B 2ITDB 2DI7A 4AZ8B 5H37G 2A83A 4GUQA 1S7TB 3DIFB 4H5SA 1OALA 2NOYA 4BFFA 3OKEA 2WINB 1KG0A 3BSZA 1DP0A 1YAZA 2OMNA 2Z9TA 4HKZA 3TCXA 4UU9B 2WVVA 2UXGA 4GQRA 4AGLA 5AW2B 4IJTA 4X8CA 5A7EA 3ZT7A 3WS3B 2IV9A 4U4IA 2O5ZL 2Y06L 1CD1B 1U8LA 5JDSA 2EC8A 1DEEB 3BKYL 1DJYA 3POCA 2EDDA 3T6QC 4KJQC 1QPXA 4KNUA 4P2QB 4KROB 5DJYB 1AXIB 2NY4C 2JV6A 4PIRF 1JVLA 1HSBB 1KXVA 2C7UA 2J8UE 3FO0H 3G5VB 2FGWL 3IDIA 4G1EB 4JRXE 3VYPA 2ETWA 4QRBA 3O9WC 2BIHA 1B6UA 2DPKA 3QNYA 3MVSA 1RULH 1IM3B 1JCVA 3SQBA 4QHKI 1S9WB 2VM3A 3HE7D 3GEFA 1BM3L 5D7JC 5DRXB 1ZLVK 4AK1A 5I66B 5KG9A 1E4KA 1MFAL 4HUUB 2A73B 5LKNA 2VZ1A 4DAGL 5IB2B 5SWQA 4KXBA 3CMOH 3KYMA 4XZUA 2R4RL 4ODXA 3FRPB 4OD3L 3MJWA 2CSPA 4U1LA 4JG1H 4DKFL 2PXYB 3CG8A 2I9TB 3H0TB 1AKPA 2EDWA 4L3CA 5AD0A 1QQDA 4P2AA 1M1XA 3HPLA 5TDOA 3EYOB 3CFMA 3QEUB 1S78C 3WUWG 1DE4B 4D0CB 2CRZA 2NR6D 3APMA 9PCYA 3ESOA 4MDJA 3QNXB 3UG4A 2C5DC 3PWJB 5CP7A 1KDIA 4MS8C 5IQ9A 2BHUA 5KZCB 4I89A 1Z3GL 2V7NA 2YXMA 4M4RB 5KVDL 4NZ8A 4KNQA 4DKEL 3COOA 1MFEH 2N56A 3ZU8A 4S0SD 1D6VH 3IDXL 1BM3H 4IBVA 1LDPH 5FFGA 1WWAX 1NMCB 3CC5A 3KPSB 2HPOA 7FABL 2IAMD 4XMPL 2J4WL 4ANKA 4K15A 1KYUA 3G9AB 5JPNC 2KLRA 3RWJB 4Z7QB 4JN2B 2DOCA 2XTJC 3LKSB 4G5AA 1BWMA 1RIVH 5FGSA 1CG9B 2DYPD 1ND0A 3WY1A 3WJLA 2XI9A 5GRJL 5EU5A 3MYJA 1A6TA 2KH2B 1NBVH 1OZUA 1YYMH 3PWUB 3DX7B 3BVXA 3NCWA 2E75C 4K7FB 3HNTL 2OX5B 2XWTB 5I0DA 1IRAY 4PJBA 1EMTL 2VW4A 5H37H 4E41B 3VWJA 5KYXA 1SVCP 2J1XA 4HAGA 3RVTC 1W15A 4MD0A 3O6KL 3QGVA 2HWZH 5EOCH 3RBGA 2AAAA 1OP3K 3BPLC 1PSKL 1XB3A 4XPTH 4PR5B 4GG6F 4OF7A 1V5JA 4HX1A 4ECNA 4U6YA 1RZ7L 3QIUB 4NQQA 3US9A 5CJOL 3CFEA 5ANMA 4HU2A 4GAYB 4U6XA 2YD1A 4X5QA 4L48A 3ISWA 3MRKB 3MRHA 4G8AC 4CMMA 3ZHDA 3MLSH 1NCUA 2KT6A 2JLPA 4GAGH 3QJQB 3RJOA 2C9RA 2OMZB 2J7LA 4HH9B 1QO3B 5KSAB 2BJMH 1M71B 2XPYA 4HJ1A 5AAMA 4KZDL 3VXME 3H9HA 4O02H 2JQZA 4F3FB 4IHOA 2DQFA 2DN7A 2FX8L 2O6FA 2CGZA 3P9WB 4WU5A 4AVKA 5JHAA 1NBVL 3VD1A 5DD6B 4AIZA 1AS8A 1BQHG 4A2DA 5CU5A 3SKMA 3T4AC 5D6DA 4F7EA 4CMHB 4EI5A 4RQQB 3FFCD 2V5RA 4KKQA 1Q90A 3OR7A 1HJBC 2GABA 3L3DA 5I1JL 4LSSL 2B1OA 2W60B 3TBVA 5IJBC 4KXZH 1A7BA 5SWZA 5K1VA 4TLTA 3BN9C 3N85H 5DGQA 1SNRA 3HPJB 3CCHB 1AZVA 2WNKA 4PJ9C 1R24A 1TR7A 4DKAA 2K8MA 4OU3A 3QG7L 4W9JC 3TEWA 1L0PA 2CR3A 2JE8A 3NEXA 5EF3A 1QATA 2WGNB 2WLJA 4X6EB 3IDMB 3E8UL 3B9KC 4HFUL 1A4CA 3MNZB 3QIBA 4QRAA 5HPMB 2B9AA 5IWLC 2LABA 3A0OA 4FS0A 2D03L 4WK4B 4WDIB 3T2NH 5IB5A 3MRJB 3QI9A 1N6UA 4X80L 2YRPA 2B59B 3UADA 2Q2EB 3MLYL 3VACA 3OLIA 4LASH 2YQ3A 2R4SL 3FT2A 1VHPA 2BVEA 3BKMH 4OGYH 3OJDA 3CHPA 3TESA 1M05B 3B7RL 3ULVE 2DF3A 4NNPH 4S1QL 1KT2A 4XVJH 5IVXB 4QRRB 2IPUK 1EXUB 2BPBA 2OQJA 2X4QB 3FUKA 1KULA 2XWBB 4E36A 4BK5C 4NM8L 2OR7A 4R83A 3VQMA 3IU3B 4XNAA 5FFOA 4X6DA 5E56A 1O75A 5IQLA 1MRFL 1MW2A 3GSUB 5TJWK 1PF3A 2NY1B 3WE1A 3NYKA 1BGXH 5KTEH 1GGIH 4OTXL 4ZNEA 3DPBA 5CEYA 1IGYB 2VSCA 1L5GB 3MV7D 4FQXB 4B3EA 1JNNH 2VDKB 5C08B 2P4AB 5F8QC 3S3JA 3GLZA 4KMLB 1CF1A 4JFYA 4JY4A 2DS4A 3VRJB 3D85B 2UWEA 3K4DA 2JI1A 3TO4A 1BW8A 5IV2B 3FB5A 1Z5YD 2VR7A 1MCDA 2AV1B 2BRRH 5EZJA 5BZWB 3LZFL 2OSXA 1HIMH 1LEIB 3W56A 1SXSA 2ZCZA 4ZI8A 1D9KA 3CSFA 5F7EH 1Z32X 5D70H 2C3VA 5IW6A 2O61B 2AANA 2GJ6B 4AGPA 4AYEC 3MV9D 1TQWA 1LQSR 5GZOA 4P5MA 3CPLB 2BOBB 3H7BA 5ACZA 3K6NA 1DL7H 2AHIA 3HN3A 32C2B 5T1LB 3UBHA 1UB5B 4P4RB 2HFEB 2ORBH 1GJWA 3ATDA 4UDTB 3OD3A 2VERA 4Y2LA 4UOW0 4G3YL 2IBZY 3LVTA 2BIIA 3TCLB 3KG5A 1ZT4B 4G9FB 4LIQE 1K4CB 1MDAA 1NM9A 2CIIB 2LE9A 5GJSH 1A65A 4A38A 1NLBL 4EXKA 5F9JB 4A2EA 4DSYA 3K8LA 5ANME 1G9NL 4PV8A 3MLWL 4RFEA 3LNIA 3GDBA 1FLRL 4EZLA 5EEWA 4YXHL 4L23A 3WD5L 4DT2A 1F11A 4Q97A 5FUCE 1R3LA 3V0HA 1WFJA 2PETA 3QNYB 1ZKAA 2BSTA 1C08A 1IZKA 5B3JF 2B15A 3ARTA 5D1QB 1RP8A 1XGRA 2QKSA 1KWKA 2VL4A 1L7IL 3I9GL 3IMWA 3TF4A 3DUUA 1DCEA 3OKKA 3TGXA 2FBRA 4YBLB 2W9EL 1N5YL 3MFFB 3HR5A 5BRZD 1FWXA 4K7PX 3BEWA 3W2DH 4BQCA 4EEEA 1EO8H 1HL4A 2AK4D 1Y07A 3KYKH 3ARGB 4QRRA 5DZAA 3FRUA 3K1KC 3D33A 5GS2H 2ZCHH 1E9OB 1FZMB 3OKDB 5CKAA 1O7DC 4QGTA 5DO8A 1JIBA 1FJ1A 3QRLA 5KOVC 4ZG1A 4YWGL 4WI2A 4ELKB 5LNEA 1P6WA 2PTVA 4LP4A 2IEPA 3VRJA 3X14B 2B59A 4IDJH 4W1TA 3Q6FA 3N43F 4CSSA 3VWKD 3ARGC 3NAAL 4UCFA 3FO0L 2YZ8A 2NCMA 4IGBD 4DNLA 4UT6L 1ZLSL 2FJFB 3QUGA 1B0RA 2ESVA 3D25A 3LPFA 4NN5B 4DGIL 1G6RA 4EIZC 3LB6C 4FQ2H 4WO0A 1UYWH 4HXBL 3GSUA 3K71B 4OF5A 4X4MA 2DJ4A 2QADD 3QVAA 5HHME 1T20A 2F5AH 1PLGL 2WB7A 5AVVB 3BP5B 3HC0A 3RGVA 2XKUA 4AL8C 2IFFH 4DFIA 3IGLA 2BY1A 1XH2A 3FCUB 1TZIA 2EIKB 3C75A 2WBJC 3K2UH 3OX8A 3KYKL 2AJSL 1I53A 2DLEA 1HL8A 4ABQA 2BSRA 2LV4A 5FYJU 4QRRE 1SBSH 1S9XB 2VC2L 2XWRA 4RH4A 2NQCA 3NIFE 4GXUM 2PO6B 1P5UB 3MRJA 3I50L 1QFWI 3FAWA 2DIBA 3IXTA 3TYFA 1SOKA 4WO4A 3AGWA 2OP4L 2X2IA 3JTSB 4HMDA 5JZ7D 1KJVA 1A7RH 3S37L 2Y1ZA 3MODH 4PJFA 1OTUD 1A3RH 1PG7H 4OM1L 4WUUA 4NRZA 1KCVL 1PZ3A 1AHWC 4RAVB 5DD0L 3MTRA 1HHGA 1JERA 4B6ZA 4BM7A 3S96A 2V8LA 1FYTA 4MS8D 2H3NA 1BBJB 3GSNL 4WTZG 2J2ZB 5HDBF 4LNRB 4EDWH 3A4DA 1L9SA 2WGXA 3QWOB 3LQAH 4U6YB 1M57B 3AAZB 1N5AB 2NNAB 4XX1E 4TNEA 3TZVD 5ADOH 3CHSA 1YHPA 2XN0A 1MFDH 1CFSA 3L3IB 1G0XA 1GAFL 2WUBH 2XVGA 3BKJL 4D8PB 4Z7UB 2KI6A 1H5BC 3OR7B 1ZHNA 2P26A 5F3HA 2LFEA 5JHDB 4RDQF 3LS4L 3WFEH 1QG3A 1CLZH 1J1PL 2AXJA 1QD0A 3HRPA 3KWXA 4HMCA 4IS6B 2K6YA 2X44D 4ZW8A 1U3HC 2K3HA 2VXTL 2WOYA 5F0MB 2Z7ZA 3UBXI 3WNNA 4Z7NB 4LGRB 4W9GC 4XCNA 1NGYA 3IBOA 3BVUA 4TM9A 3VMNA 3C9NA 1R19A 43C9A 4EXPX 1KGIA 3DBXB 1U92A 4QR7A 4NC2B 2R2HA 1KCSL 1L4IA 4A7SA 2HVKB 3LIUA 3JWOC 3F7VA 4YO0B 1CO1A 1XTMA 3FUNA 4RRPG 1KTLB 3RUGF 1MFMA 2IXQB 4X0KB 4GP4B 1NIDA 4QXTA 5FM5O 1LM8V 2CKBH 2PPDA 2PW2A 1KB5L 1IGFH 4HEPA 2FNBA 4NO3B 5D93C 4ETYA 1TQCC 3C6LD 5E94A 4L4TA 5IESL 1NANH 2GSIA 3UYPA 1RPKA 3FFDA 5B1BB 2E7HA 5I74B 3CAFA 1Z9PA 4PJBB 4M43H 2CHNA 2APXA 2OI9B 3V4PL 1EV2E 4PREA 4GMTH 3WL9A 2MHAB 3BGFC 1G7QA 1DE4A 4E41E 3JUZA 4W9DC 2FIKB 4JG5A 2WXRA 1V7NL 5GS0C 4PG2C 3A6BL 4KHTL 4HDIA 4UOZA 1C16B 1QA9B 2BNUA 4EZJA 3CSYA 3ISYA 4PJGE 3PWPA 2J71A 5F7HA 3S35L 1NBYA 4M6NL 4FAAB 4BUQA 4U1LB 4QHPA 2F74B 3NCXA 2SODB 1TUPA 5DQDH 3RVUD 1JGDB 1W0VA 1JVKA 3CZFB 2IWKA 4PJHF 1DFBL 3IDJA 1VDGA 4G70B 4HT1L 3SGJA 3TBBA 3CDGB 4UNVA 2P52A 5JOPE 4GUPA 3V4VL 1DVFC 1XF5B 3NZ8B 1KBWA 3MLTA 1YQ2A 1A21A 1JOIA 3FKUS 4HK3N 3SGDH 3T3PF 4TNFA 5HGBB 1QLFA 2Y07H 3ZKXC 3QE5A 1UXMA 4KNSA 3FPYA 4NQDD 4PB0H 4B27A 4IOIB 4AIXA 5CR1A 3HBGA 3LH8A 3Q1EA 2ENPA 2VDKH 5HHVL 5C2BH 5AKVA 3QEUA 2NSXA 3KH3A 5E08L 5DT1L 4X5RA 2DI9A 2FEEI 3AFLA 2ZOLB 4U1IA 1SXZA 3S8WA 3OGOE 5KYUB 4NZTH 3EYVA 5ACMA 3HC3H 1T4KA 2DH3A 3AU1B 4HISA 3W39A 1N4XH 4I48B 4PRAA 5TPWL 5ESQA 3OKNA 4P06A 4JO2H 1D6EA 5EBLA 1RUAL 3EGXA 4GRWB 5I15H 5MEOA 4I0PB 3OKEB 3L2MA 2BNRB 4YSPA 2CJSA 3DNKA 2DAVA 2ZCKL 4UB0H 2WQWA 1PYWB 5HDQL 2HFFB 3X3FL 1TTGA 2EYSA 2G4EA 2OS7A 3RWHA 4BFBD 2CIKB 1GYAA 2BSEA 4I3GA 4OLXH 4L4VB 1DQIA 1E90A 1JK8A 2Y7QA 4FC3E 3Q7JA 4M1CD 2R56L 4XO9A 4JRXD 4OAWB 5CMAB 4PVMA 4Q0XL 1F5WA 3KYOB 5E8PB 2GHWB 4JPIA 2ICWA 3Q6FB 3X14A 2D31B 3VI3A 2V3DA 3F62A 4NQXA 2VDKL 4X50A 3NCYS 5HTSA 3GMNB 2WXLA 3OSVA 5KS9B 4ZUVB 1KXQA 4ODBD 3VXRB 4OGAD 4DW2H 4R26H 3KYNA 4NZTL 3VFGH 1IEAA 4D9QE 1OARL 3F7LA 1IL1B 4JEGB 4MASA 4Z7AA 1DL7L 2EXWC 1MI5B 4M5SA 1MFCL 5I1HL 2GEEA 3ZDZF 1ZLUH 1EEZA 5EIIG 2YFOA 2BDNH 4L8DA 4PV9A 1AZRA 2QHRL 3HI6H 3VFWA 3S36X 2YRZA 5ICXA 3IE9A 3MA7B 3QNZA 5L8JB 4QRSA 3TBYA 4M8RA 3SCMB 4GY4A 4JUTA 1EO7A 2J55A 2BRQA 3B43A 4JVPA 4Q0XH 4LAQL 2B1HL 4HALA 4YX2H 1EVUA 4FERA 1RU9L 2QQNH 2DQEH 3HB3D 3U7YH 2YPKA 3GSQA 5K9JL 2QQKL 3IK2A 4G8IA 3FQ2A 5E6IC 1OE1A 1YEGL 3Q2WA 1IFGA 2X1QA 5EU7C 2R23A 1UT1A 4XMKH 1FO0L 3MJ9H 1MPAL 5FC9A 5I76A 4M4PA 1MFEL 5DUML 4LSQH 1OTUC 1T0PB 4HVBA 5LCVH 1D6VL 4PI2A 4WEBL 2ADGA 5FV1L 3NIGF 2OCFD 3N41B 2FQDA 3WMQA 2ADYA 3B5GA 3I2CH 5MENB 4PJ7B 2GT9A 4HCFA 1U33A 1UB5A 4P4RA 4PLJD 3U30C 3KYAA 4NWTL 4XPGL 4KDVA 4F7MA 3M1BB 3R7QA 4Z18A 3MACL 4NQVB 1FIGH 3INUL 3QDGA 4ATTA 1EEYB 3KVDD 2Z8VC 1WBYB 4E9RA 5IEKA 4OZIE 3MXVH 4J3OF 1BD2B 5IFAH 2ZCHL 3TVMC 1BXUA 3QDMB 1UATA 5BZWA 5IB4B 1NDTA 2OMVB 2NLJA 3BMVA 2ARJA 3VFRB 4YWGH 1TEFA 1DZBA 3NSJA 4DN4L 4XBGB 3WLBA 2X4TB 2BK8A 5A16B 3RPIA 2BJML 4HPYL 1CF8H 4BZ2L 2PUQT 3CQQA 4FYRA 2PYEA 5EB9A 3I9PA 2LAGB 4LO9A 4M29A 1Z2KA 2P45B 4LL4A 1RJYA 3BPNC 4BBWA 3RDTB 3B2UC 3ARYA 3UGXA 1XCQA 4M5ZL 5SWSA 5BNXD 4M5YL 4UQAA 5AVTB 2J1YA 1T1WA 3KPRB 4RESB 4JZNB 4YIQB 3V4VB 3GSXB 4I48A 5FK9B 1A7QL 4YPGA 4GBXA 1FNLA 2ZG2A 3EBIA 3Q8FA 1LNUB 3RWCA 4OFVA 1S7UA 4M03A 4NWUL 3QR2A 3MXVL 4KJYB 1TZGH 1BP3B 4PRHE 4Z7IA 1QI4A 3LQMA 3ML8A 3QZPA 4XNMB 2Y4SA 1FFRA 4FQQA 4IOIA 4MB5A 5FO7A 5F71A 3FOMA 1IBFA 3DX2A 5C6WH 2XICA 5KSUA 3E8UH 4UT7H 4KRMB 4WGVB 1C7TA 3HA0A 2VLRB 4WKZB 4WWKB 4YC2B 4I18B 4BE5A 4ZAKA 4AE0A 4N9OB 3X3GL 3MLTB 3V8OA 3HLAB 1R6VA 5E4EC 2V2WA 4HS8H 1A3RL 1VESA 2EH8H 2N7BA 1FCCA 1T4WA 2X89D 3QUZB 1WIOA 5DHVB 3O2VH 1MJ7L 4Z76A 4K3DL 1XGUB 4KKCD 4MYPA 4Z8FL 1DJSA 5JW4M 3VXMB 5C0FA 3CZFA 3G5YB 5IW3A 2RALA 5I6XB 3T71A 3FCSB 4UAOB 3P4LA 1H15A 1J0HA