3F85A

Structure of fusion complex of homo trimeric major pilin subunits cfab of cfa/i fimbirae from etec e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
456
structure length
456
Chain Sequence
MIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homo trimeric fusion of CFA/I fimbrial subunits B
publication title Structure of CFA/I fimbriae from enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 70
structure length 456
sequence length 456
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A03
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A02
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A01
4Y2NA 3F84A 3VACA 3F83A 3F85A 4Y2OB 2HB0A 4Y2LA 4HJIA
chains in the Genus database with same CATH superfamily
3VI3A 3QRGH 4UNIA 2X6CA 4KKCD 2BNQE 4F2ME 1IC0A 1TJIH 4PRAB 1GTNA 2NXYB 2Q7YB 5F9JB 2PR4H 3W11D 4RGNE 1CIDA 2XPGA 2VH5L 2VSDA 3T3PE 3DX7A 1SHMA 3QAZB 4M1DL 3MLWH 1EXGA 4J6RL 3CN1A 2C9XA 3GLDA 3BUYA 1W9XA 3DOSA 3KDMB 3HE7A 4IGBC 4ODWA 2Y72A 5HDWA 3WKMH 2VM9A 3DDGA 3L08A 2FATL 4IRSD 4FFYA 4A2FA 3CK0H 1MVFA 5FC9A 3D85B 4LEOB 3CIQA 4GAFB 5ISZE 1A7PL 2IMMA 2VR9A 3Q1EA 4WY7L 2UYLA 3CU1A 3NJXA 5DJCB 3RZWA 5IOKA 2J8UE 3J7HA 2F1AA 2VN7A 3IFOB 1GR7A 1OTSC 3HCVA 1HHGA 3R19A 2IOIA 3S88H 5FGSA 4UYPA 3NUKA 4LQFH 3T2OA 3O6FC 3ARDA 3I3EA 3NFNA 3OJ2C 3EYQD 4OD3H 4RLDA 3KPQB 3REWA 2LW3A 3UGXA 4PVLA 3CD4A 5F7NC 4P5TB 4IOFD 2DN7A 3KG5A 3FULA 2UZPA 2P4AB 3OKDA 2E7CA 1FO0A 2KZ1B 2VLMD 2Q3ZA 4J1UB 6FABH 2UVFA 2DM4A 4XBGA 2AEOA 4TUUA 1OO2A 4PJGA 3FQ1A 3QFJD 5IHZA 1PY0A 4B9JA 4I48A 1OM9A 4MTMA 2VITA 5I1GL 3T3MF 4OJDH 2XBZA 3H3BC 1IFHH 3IDJA 1UG9A 1N5AB 3GZPA 1J1OL 1XGRA 3EYFA 2NUTB 4JDEA 4NNYB 2HKFH 3N50A 4Q7DA 4JY4A 4XPTL 2KT6A 1RZKC 1MWAL 4N6QA 1XF1A 5DRWA 4B3VA 1W8NA 2NDGA 2AV7A 4WFFD 4A37A 1FH5L 4IDJL 5LWYL 5CHNA 2OSXA 3T3MB 1NEZB 2A74A 5T1LB 4FYTA 5BV7C 5FWQA 2RR3A 1RK1A 1KDJA 1DN0B 3S3PA 1OF2A 5KANI 4LBAA 1OSPL 1S46A 5JW3H 1JZ7A 1RU9L 4DO4A 3ILQD 5D7LE 1INDL 4ZFGL 5C0IA 1CZ8H 1QR1B 1FQ9C 2EEXA 1F4AA 1UEMA 2EILB 3HG5A 3I75B 2BMKB 4N8VB 5CN2A 3EJJX 2VRKA 4C4BA 5L6YL 1LVEA 3P77A 4LEBA 5C09A 5ICYA 3MRDB 1NIBA 4APQC 2PCFB 3EJPA 3JWOH 3OWEA 2XVBA 4TVUA 4KFMA 4QJ5B 2Z6FA 4NUMA 3QQ9D 3ZYIA 3TWCH 5ALCL 1JHLH 4KMLB 3F7YA 1SLUA 5CP7A 3VFNB 1DL7L 3AG4B 4Y16C 1DQKA 4LEXH 5GSRA 4PW9A 2WXQA 3MNZA 3Q8BA 2X4QA 4NO3A 3FRPA 1KB9J 1KTDB 4PEEA 4YDNA 3PREA 2NNFA 2PO6D 3IDGB 4PG9A 2GUOB 5BNXD 2YAOA 1HHIA 2WTPA 4H1LH 1QRNB 1YEIL 4PJCF 4P4KA 1CLOH 4OCYH 4R2GB 1ZXQA 2VQUA 2X4PA 1QSED 1EGJA 1Q9LB 5EOCH 1E2WA 1AZZC 1TCRA 2WIIB 4U6HB 4K3HA 4RISH 4ZAKB 5C0NC 2BVEA 3K72A 4NYLB 3QI9A 3EJZC 1N0LB 4X4ME 4XP6L 4MGXA 4WUUD 1SY6A 1XF5A 3GMMB 3OPZL 5I2IA 5DVLA 4PJCB 4GP4B 3V2AR 4IEFB 1HFUA 2BH0A 1TJGL 3MRFB 1IE4A 2W0LA 1E28A 1TITA 1LHZA 3U4BH 1EFXD 1WC7A 3LNIA 2K6WA 2ZUYA 4LMQE 2XXFA 1OGSA 4GAGH 4F37K 4DP6X 2EXWC 2AXFB 1G7LB 4XNDA 5DS8A 1I8KA 1KC5L 2IBZY 2G2NA 1BZ8A 4DOHB 5HGBA 4WENB 2FEDD 2WGXA 4PREA 1CDYA 2FX8H 2I5YH 5CINH 2MNUA 3ZTNH 3RPBA 4GAJL 2JJUA 3O8XA 3L9RB 4ZSOB 3TIEA 3U4EA 3QUXB 4XCYA 2CGRH 3D4YA 3PWJA 5JXEA 1UURA 2HLFD 3B9KC 2IF7A 3NPSC 2N7BA 3MKKA 4PIRF 5F9OL 5I1IH 3D3VB 5CMAA 3UTSD 1F4XL 1UGNA 5AUMB 2WBWB 4E9WA 1EO8L 5J13C 4OI8A 1CDHA 3FO2B 4HDIB 1SEBB 3NZSA 4NXSA 1FIGL 1RUQL 5T3ZH 5I8KH 5KYYA 3UBGA 3C9NA 4TVPL 4W9IC 2XFGB 1R3KB 2NZ9D 2DD8L 2R29H 4EJ1C 1BG1A 4Y5VA 4PRNB 5KTEL 1UM6H 1UA7A 5AZEH 3OKKA 3SSGA 3KBFA 1B9ZA 4M7KL 5FW6A 5HGGS 5GS2H 3OAYK 3VXME 3AROA 3AG3B 3D52A 5ITFB 1F97A 4ZUSA 2NR6A 2F58H 1GW6A 3GI8H 4LASH 4QOKA 2OZ4L 3V4VH 5J11C 3CV5A 4G7SB 2APWA 3DRQB 3VWJB 4BUHA 1YPZA 1KYUA 1RK7A 3HG1D 3TYFA 4TQEL 1QSFE 4WGWB 5EN3A 5DRXA 2H32H 5BS0A 1MCRA 3DIVA 6PCYA 2QGBA 2VKWA 4D8OA 4FOMA 3BPLB 2YN3A 1R0AH 2ESVA 4QHPA 1MZZA 3L1FA 5EF0A 3V55A 1EFQA 2F2HA 3P0VL 2DBLL 2E5EA 2CXGA 4U0RB 1D2OA 4BQ9A 3VXUB 3LPFA 5JHDD 1XXDC 3HBPA 4KK9D 4OD2A 5GGRA 3GSNH 1ZCRA 3I3DA 5HI3D 4TSBL 4G7YH 1TENA 3AFLA 4FQHB 2BW5A 4M8QA 3TCLA 1F6LL 3WEXB 4ZZKA 4YDKL 4V2BA 2XN1A 2HFEA 4JPWH 3VU2A 3B7TA 2WLJA 1W0WA 1H9VA 4X2UA 3MOBL 3GYRA 1QLFB 4G2AA 1ACYL 2BY1A 3MNVA 3QCTH 4GY4A 5TH2A 4I4WA 1MNUH 5AAWC 2XFXA 1F3RB 4XO4A 4U6VL 1XGZA 3F3HA 5HHNA 2QKIA 1VEOA 5JMOC 1YEHL 1LP9A 3SDXE 3DUSB 1GY1A 3TPKA 1QPXA 3BRFA 2QQNH 3PJSB 5KBNC 2AKRA 1PD1A 3B9AA 1PYWB 4FZ8L 3QIWD 1AJ7H 4HAKA 3S4SG 4ADJA 5KSBA 1JS4A 1WAEA 3P9LB 4M6ML 4ZQTA 1QLEL 3GWJA 3HMXL 2YOAA 1N8ZA 5HTSA 4UNTA 1QSVA 3EJCA 3FT4A 3SPCA 5BW7A 4UT7L 1FVDB 4MXWH 1ID5I 2WKLA 4ODTL 2NOYA 1CXKA 2ZKYA 3SE3C 5ADOL 4KQ0A 4NM4L 1A4KB 1AI1H 3EJUA 3JXAA 5KW9H 3N3EA 1N59B 3ZDZE 4OGYH 5IBLD 3POCA 4HJGA 5EIIB 3JTTB 3OKYA 4EI5C 4GUPB 1U3HA 2XQYK 4QHMB 4P5RA 3GBNH 3A6CL 1MRCH 2OMYB 4KXDA 2V5RA 3MJ7A 5TE7H 4P2OA 2KBGA 1MREL 4DPAX 3B8SA 3K5SA 1MW1A 2WYZA 3MFGB 3M7OA 5DJAA 3BVUA 1I8IA 2FECI 4XNAA 3ZOAA 5CCKL 1AY1L 4QNPF 1BLIA 3QWRA 3TBTB 2LTQC 4WKXA 4Y1TA 5I6MA 4YR6B 2VWEE 2OR7A 3MC0A 4O58L 3A21A 1G9NL 2G2PA 2HKHH 2W95A 1IRAY 3D18B 3U36B 1NKGA 1Y1DA 1NQBA 2BSRB 5FUOL 2CPCA 2JB6B 4N0UB 4TN9A 2NY4B 3LEVH 5JNYA 1LO4H 4MAYA 3FH7A 2LLNA 2PP8A 4H20L 4JZNA 1CWVA 1SUJA 3DRTB 2H1LM 4NHCL 4WHTB 5J0BA 3LZNA 4BSVA 1BAFL 3PL6A 2FSEA 1AYRA 4JO2L 3BH8B 3OPUA 5LGKA 4NRZA 3UO8B 1FRGL 1S7SA 3WN5A 1RULH 5K1NA 4PJDE 3MLZL 2C9UA 1K4DB 5C0CD 3UMTA 3FPXA 4WV1B 3KYNB 3RGVD 1ZRUA 4ZMOA 4ZQKA 1WZLA 1BQHG 5F9WB 4K71B 4ZMWA 1S7RA 2YEZA 2ZUVA 3EFFA 3MLRH 2AK4A 3CFQA 3OMZA 2VXSH 2WXLA 3TO2B 1Z66A 2UWEF 2X53A 4GKNA 1AGEB 3ZPDA 4N2DA 3JV6B 3BQUD 4FFZL 5LBVA 3LNEA 3RWFB 5KJRL 1K4CB 2WYHA 3GLAA 5JHBA 5AAMC 1GYVA 2E9GA 3IDNA 5FHBL 1XH3A 3OKNA 4KZEL 4NKOB 5ETUB 4WO4D 2VUOA 4OW6A 1XBRA 3O6MH 3V5DA 1YVLA 1B0GB 1G7IA 2GSIB 3CVIL 4AGLA 2R56H 1FV1B 2BWDA 2ZKWA 4PRDA 4XVTL 1PLAA 3T6QC 1A4BA 2UWEB 3N40P 2VDQL 5FFGA 3GKWH 3N2JA 5EEVA 4DN4L 4FJZA 5HI4C 1JXDA 2D3VA 4OB5H 4QRSA 4X8JB 5DLMH 1X5YA 1M7DA 3FXIC 1TQVA 1A3ZA 5BZZA 4ZX4A 1XQ4A 3LIZA 3W56A 1XV8A 2XXGA 4B7IA 5IFAH 2AJSL 1F8TL 1S7QB 1UZ6E 2XZQL 4O02B 5FYKE 1PKOA 3C6LB 2HRGA 1JZEA 2PKDA 3KPSB 3Q6GH 3MMEB 3DXAB 4MZIA 2X70A 1AC0A 4I88A 3U25A 4DGYL 3ATDA 1OWWA 4M6AA 3BP5A 4UIKL 4UB0L 4CA4A 1NDGA 5GGTL 1VADA 1X5KA 1A3LH 1XD1A 5KZCB 1H3PH 4O2CA 1PX3A 3VM5A 3ZU8A 2A77H 5L4FA 4KITB 3I2CH 2GTZA 1WFMA 4FKHA 4PTUA 5D4HA 3R7RA 4UQDA 2VR3A 3ARSA 3QJZA 5SWQB 4N25A 2ZG3A 3BYYA 1MAMH 4A2HA 4MJ5A 2NY1D 1Q94B 4YHIA 4QKXB 5ADPL 4XCCH 2X6AA 4WFHD 3S5LG 2DQFB 3GRGA 3V6OA 3W39B 1MJ7H 4A7VA 1NBQA 3FTGB 4QF1A 2VLRA 4ZS7H 1T4WA 4N6RA 3KYKH 5C6PB 4EUPA 4FCHA 4TXVB 2CLRB 4FQ1H 4JB9H 4UNVA 5CD3B 1G7PA 4OM1L 4N87A 1WT5C 5GQBA 2D3JA 3B9VA 4G9FE 5AWNL 2O5NA 3HI5L 5TFSL 3V6ZA 2OLDA 5L4MA 4F3FA 1RVFL 1TZGL 1VFBA 2OPCA 4FP8L 4J3WA 5D2LF 5E94A 3HHSB 1SMOA 1FC1A 1NDMA 1T0NA 3REVA 4BK5A 1WG3A 2DQGH 5FYJH 2O26U 3WTSA 3QUML 5AQ0A 3GRWL 3BD3A 1YC8A 4KO9A 5DFAA 4LK4A 2WO3B 2X4NB 4XPHH 1S9YA 1KB5B 4QYOA 5AVVB 5I0YA 2FQGA 3ATEA 2R2CA 3F00A 2WANA 4OQTL 3S37H 4R4NC 1E8YA 5D2LB 3HC4H 3APMA 1JYXA 4KJPC 1FDLH 2W9EH 4Y4KD 3MREB 3Q06A 1FFPA 4ERSL 1P4UA 4PJGE 3CX5J 5I24A 3S4SB 1BWWA 5CGBA 5LCVL 1P2CA 1RJZA 4NNPL 5L7XL 1ZANL 4XMKH 5E08H 2C4FU 1YEEL 4HQQL 2AFNA 4GJTB 3HG0A 4JM2A 1A02N 4MNHA 1HHJA 1G7JA 4PJHE 3WE1A 3FO1B 4GRLD 2YXWA 1JTOA 4NZRL 4P57B 4Y2DB 4A1RA 5DGRA 2XKNA 2YO3A 4KTYA 5FM5M 1E6JL 2NY0D 4FNSA 1HI6B 4F9LA 5FECA 1JWSB 1KCSL 4A7GF 3X17A 1DJZA 3VACA 1DVFC 2WYTA 3QUZD 3QH3A 1ET5A 2FL5B 4JGUA 4UM8B 2Y25A 3RTQB 1U6AL 3PCYA 4JFEA 4I18A 2R7EB 2FJHA 1XCQA 1AE6H 4MXQC 4X5QA 2NQCA 3UAJC 1A14L 4GQ9H 3ZRSA 1UUSA 2CIKB 2I9LB 2CZNA 3VJ6A 4M7LL 3BAKA 2AJYH 2QELA 2FR4A 1U0QA 2A83A 4G6JH 4W93A 2VC2B 1KN4H 1TYJA 5D72H 2FH6A 2DRUA 3S2AA 3K80A 2NYYD 1GHFH 1RP9A 4UM9A 5F96H 4ETYA 2Y2WA 5KYUB 3S3SA 1MUJB 3RL2A 4LSVH 3L1OL 4JFPB 5ABZA 1KYFA 2KLSA 4MZ3A 4O9HL 3GM8A 4U6XB 3LV3A 3MNWA 4MJ2A 2WW8A 1UOVA 4FQPA 4U1IB 4K23H 5F8QC 4JR9H 3VMPA 3GXTA 3GSQA 1WCQA 4PGEA 4N5ED 4TVPD 1ZPUA 5EB9A 3CDCA 5AG9A 1EHAA 4R90H 4FG4A 3EH4B 1J0JA 2WV3A 3MRKB 5EF1A 3E6FA 2RD0A 4UOW1 1ZLVK 4I0PB 3G3LA 2L0DA 3VYPA 3MRLA 2DQIH 4XB7A 5IV2A 3CZLA 3LPGA 3VGAB 2YA2A 1N6QH 4Y88A 1NPNA 1GS7A 3LNFA 2E7LC 4PJEB 1IC4H 3HN3A 3F05A 2P24B 1YNKL 2F1EA 1QLRB 5DUPL 3DURB 3QJFB 3FQNA 2DYPA 4KVNL 1BOYA 4JFSA 1KB3A 4H8QA 3K2UH 1MDAA 4F8LA 2ZXEB 3IKKA 4UIMB 3BRDA 4HEPG 4YH6A 3BP6A 3B1UA 1E6OH 2FB4H 1QW9A 3D4ZA 4B9CA 3FO0L 4IRSA 1S5HB 4RZCA 2B1AL 5INDA 1HCFX 2IEPA 3C60D 4Y5YB 4F57H 1KLGB 3TA3D 1WBZA 1FZOA 3QEQB 4L3CA 1CVRA 3QRLA 5ICUA 4EZMA 2P5EB 1SEQH 1E27B 3QE5A 3WFDH 1MFBH 1XF2B 4ZFOL 2C1PB 4OFYD 2A9DA 2GUYA 4S10A 1S7XB 2OL3A 3H6AA 3FCTA 4HF5L 4B3EA 4NQSB 4CSTA 1MFEH 1IM3A 4N8CL 5E03A 2IFFL 1MJUH 1NOAA 1K85A 3BHBB 3DYPA 4NERA 2VN6A 5EO9B 5LB1A 1ZTXE 4HUUA 3AG1B 1IEBA 3B83A 4JY5H 2J7LA 3H2PA 4MZRA 2KMWA 3EW3B 5FYLE 1HSBA 1TZIB 2JKSA 2ADFL 1WGOA 3GZOA 4XPGL 4MSWB 3RVUD 5LBGA 5TD4A 4KRMB 3QIBA 4NENA 1RIHL 4JZOA 4M5YH 1YUKB 3T8XB 2AQRA 4PWJA 3P2TA 2WWKT 4XXCC 4KKCC 4LHQB 2UY7A 1HDMA 1F6FB 5ACZA 5AENA 4JCMA 4P23B 3NSYA 2BDNH 5HHQB 3RQ3A 3I02B 4ZO7A 1TO4A 4BZ1A 3S5LB 4KVPA 4W4OC 5IMOB 4LKCB 1RJLA 2OTWB 3S37X 4QHKI 4XOBA 5AW7B 2M26A 1A4JA 1YPZE 5C07E 3NJHA 1A65A 2YQ3A 1C5CH 1HNGA 4MJJA 2JJWA 5J12C 2J2ZB 3DGDA 2J5WA 2CJSA 4EN3B 3Q2CA 1QRNE 1YN6A 4E41D 4L3EB 3CBRA 2Z93B 4FX5A 4YGAB 1JNNH 2KUTA 3AGWA 5I1CL 4IBVA 2XJKA 5IROD 2ESVE 1P4BH 4MDIB 5IEKB 1JNHA 1AMYA 1MI5B 4PP1C 5F1IA 5IQMA 1OAYL 3TT3L 3L4TA 3U2JA 5E1AA 5CIPB 3RG1C 5B38G 4HU8A 3C2AL 4PJ9D 1WO2A 5AAPA 2VMFA 1PKQE 5FYKU 4L4TE 3UTTD 2AAAA 3ELQA 4PJCE 3F12A 2BVUA 2D7QA 1C8PA 4P3DA 3KLAA 4Y1AD 4ATTA 1CQKA 5PAZA 1IGMH 1ETB1 4PRBA 2OYMA 5DZOA 5I15H 4A6YB 5GJSH 43C9A 4G8FA 4H7VA 5H4ZA 1WEJL 1BEYL 1IBGL 5C0GB 1IC7L 4IOFC 1G1YA 1S8DB 4HWEL 2OXHA 2EUZA 4OGZA 1EO7A 3KWUA 3C5ZD 3KLHD 4D9RD 2PO6A 3UZVB 2NTFB 3MLSL 5IB5B 4KH9A 4PJ8B 4PJFF 4U05A 1XXFC 1X5IA 1LP9E 1G9EA 4OZFB 4HWNA 5D2NB 1ZGLP 5JO5B 3GMNB 4KH2A 1QSEA 4XPBL 1MHHB 3ABLB 3CZJA 3CXHJ 5I1DB 4RMWA 3RVXD 4XCFL 5H35A 1P5VB 4HW6A 3TBYB 1WDAA 3WMSA 4KV5F 2DWTA 3DX0A 5KSBE 2XN9A 3UC0H 2YS4A 4PJFB 4RAUA 1YEJL 2DTSA 4B50A 1U8PA 4QRRD 4N3UA 5LN8A 2CQVA 2L7EA 4OFIA 2R4SL 1WAAA 3NH7L 3U9UB 5I1EL 2YA0A 3OJMB 5HGHA 3WUWA 5DQDL 1JAEA 4JFQA 3RA7L 5C0AE 1EFXA 3MGTA 4Z95H 5J1AA 3RGBA 3OKMB 3BJ91 3RVVD 4TTDD 3BWAA 2ZJSL 3ILQC 2WZPA 3GJFA 4NZUH 4CN6A 2GC4C 1L6ZA 3FTZA 3OAUL 4MMXB 4IS6B 4M29A 5AVRB 3G6DH 4OD1H 5HPMB 4C4KO 3FB7B 4HKJA 1ROCA 4ZUVB 2DL9A 1DBJL 5J56B 2E3VA 2IWEA 3W2DH 1A7NL 4Z76B 4Y19D 1NKRA 1RSYA 2XLLA 3ES6A 3NTCH 4LAQL 1D5ZB 5ESQA 3ILEA 5E4IA 3ULAB 3KPLB 4HX1B 4Q97A 3UTSA 1C1EL 1KFAH 4AGPA 5A16B 2X4TA 3D39D 4XNYH 4N0YH 3VXUE 4IHOB 4UDUA 4KXZH 5D7IA 1AR1B 5E7BA 1KTCA 2D31A 4N9OB 5AL0A 2HTKC 4YHOH 3CZFB 3QPXH 4BD4A 2UVEA 3FQ4A 2VABB 5A6LA 1WGVA 1CFBA 4WWID 4UV7L 1BEXA 4GO6B 3JTSB 5FYKH 3CN0A 4HKXA 4LSQL 4C57C 1CFTB 3B9EA 5LAPA 3VG0H 5LO7A 1HWGB 3KGUA 4JDTL 1Q4NX 5FHAL 3U6RA 1U93B 4CKQA 1A7QH 4I2XE 4IYKA 2HX7A 5HHOD 4G8EA 2P44B 4IMLA 5F7DB 2OTUB 1ITCA 1M6OB 3HG1A 4Z3EA 5GGVL 1EZUA 4CC4C 2CA3A 2YGVA 2H2SD 1QEWA 3NIFE 4N0FB 4WGKA 3C5JB 3ZMNA 4D8PA 1CN4A 2G0KA 3KW7A 3MGOA 4JHVA 5AVTB 5CEXA 3WIHA 1J5IA 2BHYA 1WSST 3FQWB 2KERA 4P2RA 1WWWX 4PJ7A 3EG9A 4H26B 3O2DH 5K9OB 3CMOH 1KPVB 3ESOA 1KPUB 2EC8A 4XVJL 5CLYA 3ULUL 3FCSB 3U79A 3ZHNA 5JHDA 5JA9A 4FTVB 4GXUM 1JCKA 4Y5XC 1UM4L 1J87A 4NQCE 2Y5TB 5IGXL 1V55B 3LKQA 3LN4A 2P28B 4TL4A 1I75A 3O41A 4UANA 5JPNC 3EGDA 2J1KA 1M9SA 4R0LB 7PAZA 2VISB 3VFRB 4XX1E 3JVFC 5DHVA 3W5MA 1UJ3B 3N42B 3LKOB 2JIXD 4AKQA 4HJ1A 5D7EA 4LOUD 1U8QA 1W72B 5E9AA 4JRYD 1OANA 3OMAB 4Y4FD 1HOEA 3OXSA 1N0XH 1MPAL 4PFEA 1L4IA 3OKEB 1P7QB 3D25B 4YL9A 1A1NB 5D1QA 1UA3A 5IR1B 1EXUA 4ZNEE 2ATKA 4QRQA 2Z31D 1YZZA 1MHEB 4AC4A 3VDCA 5DEFA 3UOAB 5LVEA 2DQHH 3B37A 2NZ9C 4HK0A 4QRPB 3ZDXF 4IBWA 1T80A 1ZT4A 1ASPA 2PW1B 5D71L 4GT7A 3QIWA 5SWZE 5FUZL 4BFIA 2DMKA 3BUDA 2GAZB 4R5VA 4KKRA 2BS8A 5E95B 1AQDA 5CEYB 1YECL 1Q9OB 3SQBB 5FO8A 1J9CT 3RZCD 1AR2A 2A38A 2FWLB 3DV4A 5IHWA 4F33B 3GLZA 3TASA 1JGUH 2F54E 3H0TA 1H15B 3B5TA 5DJXB 3MXWL 1ZLUH 2VLLB 2WNXA 2FZ3A 4HS8H 3ZDXB 1G7QA 1KTRL 3A4EA 3G5WA 3QWOB 4U7SA 4N0UE 1XCTB 1HYSD 3ABGA 3S34H 1U8IB 2J4WL 3QDMB 3N9GL 5ERWB 4XGZB 1YYMH 3MA9L 5B38B 1FF5A 5I0XA 1PLGL 1V05A 4LSRL 4NQVA 1MY7A 3BEVB 2E9JA 3C8DA 4UTAL 5ECGA 1BMWA 3OR7B 4LBEA 1H19A 2BIQA 2R0LL 4E9YA 1KEML 3QT2A 1RQ5A 5GRUH 1PF3A 1O7VA 1VZIA 4KKPA 4L4JA 3IGKA 1C8QA 4J5VA 4N8PA 2B1OA 3ZZ1A 3LQZA 3ULVC 5HI3C 4AM0A 1JDAA 3Q43A 4RRPA 3ZMRA 3ECBA 4L5FE 1ZSHA 3FU3A 1SN5A 1TEGA 2AVGA 4NC1E 3RFZA 3LZLA 5H2BB 1H5BB 1UJTA 1KZYA 3KHQA 4MA1C 3UBXB 1ADQA 3GSVA 3B3IA 4YSCA 3FQRA 1JK8B 3GI9H 2IMNA 3V4UL 5IMKA 4YDJA 2ZNXA 4JL1A 3FCGA 3W5NA 4GNKB 3TM6A 1SVBA 1Z5HA 3QDJD 4YDVB 1SFDA 3GSUB 4DCQB 3BKML 4OFVA 1ZVSA 3SOBL 2W9LA 1UXMA 4LSTH 2BIIA 1G6RB 2WQRA 4OM0H 1L7IH 3W81A 4NC2B 3FT0A 5I6XC 5T33L 1J8HE 1VA9A 4NN5C 1BGXH 3VVVA 2BVQA 5KEZA 3TBWB 3VQ2C 3TNNB 2F8OA 4ONFL 4GAYA 5EC2A 5CFHA 3THMH 2ADJA 4U7KA 4CGTA 5MHSD 5C0CA 3G5ZA 3UIZA 4FQIH 5IJVB 1N64L 3IJHB 2F1BA 2DMBA 5DVNA 5T3XH 4BRVA 1HCVA 2G4GA 2XRAH 4YHNA 1MH5A 3ULSB 4UDTA 2IG2H 1IU1A 4A04A 4O51B 4AL8C 2APXA 2OA9A 2WOBA 2G75B 1X3DA 4QHLA 3V4LA 1Z0MA 1ZS2A 2X1WL 3ARGD 1CFNB 1RK0A 4K8RC 1UYWL 2YK1H 3ETTA 3FRPG 3DWTA 3DK0A 5C9JB 3FMGH 3T1WA 3ZTJH 3CFDB 3P4MA 3O3BB 2FBRA 4DHLA 3QULB 4LGRB 3L17A 4IGBB 5IQ9A 4JJ5B 3WV0A 4CSPA 4OLZH 3GMPA 4XMXA 2IANB 4QXTA 3VMNA 1CD1B 1MJ8H 3MRGB 2UV3A 1H0DA 5K59F 3TJEL 3MV7E 4JDZB 5LQBL 1NGZB 4XO9A 1F1DA 5I26A 1I85C 3FL7A 1T5WA 3L3JA 1Z5LB 4FNRA 2G9HB 1DYZA 5FYLH 3U1SH 3W9DA 4HIIB 1S5IL 4UINH 4J4PA 5LNEA 2V2TA 5I66B 1MWAA 3VFOB 5C6TL 2F8XC 3MV8A 2GVYA 3II1A 2BRQA 1RMFH 5J57B 2WBJC 2QQQA 4Q6KA 2GEEA 3LHPH 4BQ6A 4NQDB 1E67A 5FV2A 5BRZD 1X4XA 3V7MA 1A6UH 1KXTB 1C9SA 5DZVA 3KYOA 4RVBA 2BO0A 5AB2A 3L5XH 3RGVC 4U1SA 1J05B 1DSYA 1WITA 1X7TA 3ECUA 1CE6B 2OR8A 2MHAA 2OSLA 1JXKA 3RHWK 4ODHH 1OP4A 4I85A 3LS5H 2IH3A 2ZP9A 1FE8L 3UYRL 4R7DA 4GMSH 5CP3A 3CZSA 2XPGB 4LCCC 2FWUA 3IFPA 5CEZE 3DX7B 3UABA 3PP3K 4J3OG 3BQUC 1REIA 3IPEA 4NAMA 2OMXA 2OR9H 3UPCA 1H6EA 4AH2A 4QUOA 2DQCL 3VTMA 3DOSB 2XQYG 4ODWB 4WO4C 3SGJA 3VG9C 3P11L 1A7OL 1U4EA 4WLCA 4U1HA 3GXNA 1Y6KR 2BERA 1JPFA 1DQQA 3LX9A 3H9SE 4N2EA 4LRNH 2VDOL 3MO1A 1Q1JH 4KNSA 3RBSA 2D7OA 3T0XA 4DSYA 1XH0A 3TCTA 1UZGA 4Y4KA 1WWCA 2IOMA 4MA3A 5D7JC 4O5LL 4YHZH 3D34A 2MKLC 3S3DB 1FFRA 3HCVB 1HHGB 3WMQA 5KVFL 3FU0A 4H8WL 4JFOA 1BQKA 2BK8A 2WQWA 3O11B 1XH2A 5DC2A 5DHYB 3WO3B 4DP5X 4LHUD 1RUPH 2WXMA 4MMYA 4YXLL 1IGYA 3ARDB 4KHXL 4PS3A 3PHAA 4OJFH 5JHLL 4RMBA 5K1JA 4F37F 2Q87A 2XA3A 1QWUA 3JWDH 1OW0C 3BH4A 4WW2C 3SQOH 3VFPA 1TG8A 1R3JA 2BCMA 4XBGB 2XA8H 2YD7A 1NFDA 5IQOA 2OMWB 1AP2B 2JQAA 4JG0L 4PSPA 4I48B 2VITB 3C5XA 5HYEA 1T83A 2QADD 1PIGA 1QNZL 3FYEB 3PPEA 4KKLC 1XGRB 5IVZA 3D30A 4JDEB 2ID5A 1G9MC 3EYUH 5FO7A 5LBSH 2AP2A 4PVMA 4JY4B 5CBAB 5EZPA 1TETL 3BDYH 5E2TL 3SDDA 5DRWB 4DW2L 2B1HH 5JOEA 1OM3H 2AV7B 3HNVL 5DEJA 5EDXA 3IGFA 3NCJH 4CSZA 3ARFC 3E2HB 1MCNA 4CAGA 3NCYS 2J57A 3QARA 4CBPA 3NRQA 4HJEA 4MNQD 3BUTA 1RK1B 3HNTL 1OF2B 2NT1A 4RFNC 2G5UA 2N3JA 3RWCA 3A4AA 2CO7A 1GAFL 3JWOC 4NGHH 2VZVA 5C0IB 2PMZA 3ZE0E 2CG9X 1HHKA 1OPGL 4N2LA 5I5RA 1II4E 3EO1B 3QORA 3QRGL 1K2DA 4BA0A 2IQAA 1T66C 2A3TA 5C09B 1TJIL 2Y36L 3RFRA 3B2UD 5LGYA 1X5FA 2OZ4A 2PR4L 1YEDA 3B2XA 4XWOD 3OMNB 2EDDA 1NGQH 5JPMC 3NPSB 4Z7VF 4LLAA 2DI9A 4QKTA 3IK2A 5ESAA 1U8CB 3KPOB 1NCDL 3MLWL 1JXJA 3OBAA 2BNRB 2F5AH 3HKFA 1C5DA 2CO2A 4JHWH 1MCDA 2J12B 1CC3A 3L45A 4FHKA 4ZFZB 5J13B 4EAEA 4GRLC 1OWRM 3EO0B 3HEIB 5KYXB 5FUCE 3E1ZA 1EVTC 2NY0C 4BBWA 1ICTA 1KULA 3O6KH 3LZQA 4NO3B 2X4QB 5A6IA 3FRPB 1ASOA 1PTZA 1WAAE 3QUZC 4Z7VB 4PG9B 4TNVK 3ULUD 1HHIB 2IPTH 1M7XA 1NDTA 3CK0L 4PJBE 3T4YB 2CBTA 4R4BA 3S5YA 2XACC 4MBRA 2GPZA 2X4PB 3E9UA 3KHOA 2P5WD 3RY5A 3U1QA 3ZRCC 4L48A 5GGQH 4M62H 1I4FA 5BJTB 5JW4R 3NPZB 2HYMA 2R4RH 2K1MA 5FAAA 1RKRA 1T1ZB 5I17A 5INCA 3VD7A 3S88L 5SV4A 3D2UD 2YLKA 1T7VA 1OARL 3PDDA 1C7TA 4LQFL 1IC1A 3QI9B 5B4MC 2A4EA 4HOZA 2Z64C 1K3IA 2H2PD 1XF5B 5DJDB 4OD3L 3SDAD 5DA4A 5HGDA 2YFOA 3TU6A 2WINB 5I0VA 5IMMA 4QO1A 5IQ7H 1SJHB 4HHAA 2H3XC 4XAWL 2C9AA 4WKZA 1QFPA 1MI5E 6FABL 3NESA 4OLWH 4R97B 1DANU 4JFFA 1X5LA 1IKFH 3QEHB 1I8KB 1S78D 3ZQXA 1KJVA 2K3TA 4GSUA 4PREB 1T20B 5C08A 1LNUB 4PBXA 2OFQA 1IFHL 4LSDA 4X8GA 4GP5B 4F7MA 2EYSB 4L8BA 2Y7SA 5TF0A 3TIEB 3U4EB 4ZPTB 5GZNC 4XCYB 2FGWH 4PY8J 1EZVY 1UCBH 2C1OA 3PWJB 4F1ZA 2W8CA 4J3OF 2O4EA 4U3SA 4OU3A 3HMXA 4LLQA 5E8PA 3DOHA 8FABA 3CLWA 2IBGA 1AKJD 4MRBA 5CMAB 3EFDH 4K7FA 3WHE0 3GIZH 3I74A 5IW1A 2IDQA 4DEPC 2YRLA 1F45A 3E7JA 4LPWA 4OCNC 3QQXA 3OSKA 1A1MB 5KYYB 4NQXA 4X7TA 3DGGA 3QVAA 3FO9A 3NJGA 3US0A 1WWBX 2BSSA 1EHXA 4E41A 2FH8A 1NFIA 2DMGA 4JRWA 5JW3L 2JKTM 4HXAH 1PLBA 3L3GA 3C60C 4XE0A 4Y5VB 5D2NE 1QOKA 1SM3H 2JKXA 3OKKB 5IROA 3ASOB 3TA3C 1IM9A 1CZ8L 6CGTA 3GUTA 1VGKA 2ZT9C 4X50A 1ZVNA 3ARPA 4ZUSB 3NACH 2IXQB 4QOKB 2DQ6A 4PJ9A 3CCHA 4PGCA 4ANWA 3I84A 2NXYD 1N26A 3LN9A 3RE0A 2J88H 2PYEA 4NKMB 3ZYJA 2F8VA 1D5XB 2WOYA 3UTTA 2XX0A 1HINL 4EBQH 1U8NA 1E4KA 4Y1AA 4AY0A 3QNXA 3ETSA 3SPIA 3UTQA 3FTVA 3L5WA 5I75C 1JHLL 3LNHA 3A24A 4YGVA 4DPRA 1MW0A 2X1PA 5A2CA 2NY2B 1IFRA 4B0MB 4KV5E 1KG0A 2FGZA 3AAZA 4GEIA 2HJLA 2PTUA 5D1QE 3V0HA 1M05B 2Z8RA 4XPFH 2C3HA 2RCSH 4OD2B 5GGRB 2CO3A 3D85D 3PAZA 4EUPG 2QZQA 1BMGA 3FS9A 2NZ1A 4PRPA 3CDYA 1NCGA 3RJQB 4I89A 4OCYL 4EIZC 4UT6H 4IK7A 2FRGP 3V5HB 3FOMA 1S7VA 1P1ZA 4YBQD 5EOCL 3TCLB 4QJ3B 2QHRH 2V17L 3U1PA 1MIMH 2LTQB 3R0MA 4KX8A 3QXVA 5I6LA 3HZKB 2EUXA 2JV6A 3LVEA 1UA6H 4IRZL 1A4CA 1W0WB 1IZJA 3ALXA 1WS7A 2YD9A 1F4WL 2MCPL 3MNVB 4AK1A 3MJGX 3MRHB 5TH2B 3T2QA 4P5TD 3ZHDA 4MJIB 1TQSA 1INQA 5HJBA 4FFZA 2HFGL 2JE8A 1OGPA 5EZLA 1R3HA 4O02H 3U4BL 3UGUA 1D7FA 4JMNA 3ZZLA 3DX4A 4HUWA 3RX7A 4CL7A 1KJ3H 2FE0A 1HL8A 4GAGL 5AW9B 4X9HA 1FAIL 2IBZX 4GFXA 2AKRB 3FT2A 1VGEH 3PWNA 2A6KA 2P48B 4HV8A 4WWNA 4ZODA 2AHIA 4WK4B 3DPDA 4OV5A 1RFDH 3Q8CA 2OK0H 2FX8L 2I5YL 5CINL 2YD6A 1A6PA 3LZPA 3U2SA 1J5HA 3H4FA 3X11B 1JWUA 3PGCB 4BZYA 3D8MA 4MASA 1EJOH 2CGRL 1N8ZB 3PJNA 5F7BA 5EU5A 4WO0A 3BISA 3K1DA 2EH8H 3FT4B 2X6VA 2KS0A 3EDKA 1A6AA 4WI8A 1ITBB 4KFZC 4HP5A 5I1IL 5GS0D 4Z7AA 3ARXA 1ORSA 2GT9A 1VLXA 2D03L 2VDKB 5L9DH 3WKYA 3D39A 5EFIA 3NSCA 2UZIH 3LD8B 1U3HB 3NDYE 4FTVE 5AW3B 4L2YA 2XTJD 4IMKA 5GGTA 4PJXF 3HE6D 3GUFA 1GRWA 1C08A 3C5ZC 3MJ7B 4P2OB 3KLHC 1UM6L 5AZEL 2VDRB 4F8PA 2OMTA 3GHPA 4JFHD 4KMQA 1HK6A 2GTQA 1LD9A 4UI2A 1T03H 3TOPA 5DJAB 5TQ2L 4YHML 2F58L 4HPOL 4LASL 1ZLWH 3V4VL 4BE5A 2ZONA 1GIGH 3UXFA 5CGMA 3GSWB 4PH8A 1QTSA 3K46A 4LCYB 1KB5H 3AQDA 1VKXA 3RIAK 1P0SE 5GSVA 1NCUA 2VN4A 2HLEB 5KBKA 1OD9A 1QBMH 2EO9A 5I71C 2BOBA 2X2IA 3VFVA 3LH8A 3ZDYF 3KJ4B 1GYCA 1ZOXA 1R0AL 4B95C 5JNYB 4Z6AT 2HWZH 2QKSA 2R0ZH 1G7HB 2DLFL 2QHLA 2WY3B 1OPOA 2ZCZA 4HCRH 1QG3A 3PL6B 2JJSA 4FL4B 2FSEB 4ZUUA 1TFHA 2NY3B 3AG2B 4AEEA 2HP4A 3EYSL 4PLKD 3QUMA 4NRZB 4TTDC 3GRWA 1S7SB 5CEZH 4MDJA 5B3SB 2DB8A 2LQRA 2XIIA 5AZUA 3IDIA 1CICA 1FBIH 1E8ZA 3ZDYB 5KS9A 1G4MA 3B9DA 4ZQKB 2BNUA 2DZEA 4OQTA 2EINB 3GF8A 3R0NA 5JXAH 1LE5A 3DSFH 4BKLA 4J3XA 2YEZB 3GO1H 2JIXA 1HEZA 4KUCD 3LCYA 2AK4B 2EDKA 4HSCX 1HQ4B 4G43B 3OWRA 4GKNB 1WIOA 1MNUL 5LCVA 3VRLE 4ESKA 1N10A 3VXNA 1E40A 1LMIA 3EXJA 1SXSA 5FKPA 5C0RH 1MCPH 4NUJA 2VR6A 5CO1A 1BBJA 2VC2H 4K0OA 2EKSA 4NNXA 1RZ7L 5FDWA 1G7IB 2ALWA 5EA0H 5BQDA 1J5CA 2N1KA 6TAAA 1BHGA 3ARBA 4X0NA 3RRQA 3X13A 3UIYA 4IQHA 3BWUC 3PNRB 1KCUH 4D9QE 2YQGA 4ZO9A 3QUXD 3B2DC 3M45A 1DE4A 5AW6B 4D0DB 1M7DB 1K6QH 5JW4Q 2CMRH 3ROLA 5C3TA 2BPBA 3DHPA 1V8HA 4AZUA 5IHLB 2JXMA 2ZAGA 4MXWL 1VEPA 4S11A 3WFZA 5I74B 4YXKL 4XN4A 2PXYD 2H2SC 1BZDA 2BIMA 3RKDC 3SYPA 4AEIL 2Z1PA 1AI1L 1FI8C 5KW9L 5D7KE 2X70B 2ADIB 3B5HA 4OGYL 4QAMB 3R1GH 4CW1A 4HGWA 4BFFA 1FYTE 1MLCA 4WFEE 1I8UA 1NDGB 5MP6H 2LT9A 3N1MC 1NUFA 1OB1A 3R4DA 4GT0A 4WNQB 5E8NA 4ZDHA 2QT6A 3GIVB 3ROOB 2ZSVA 3K8LA 3HOGA 5TE7L 2ZWNA 4K73A 2F19H 4LF3A 2GTZB 4KI1A 4PTUB 1Q0YH 4U1KA 3PWVA 4G7VH 2XHNA 3GXDA 4KRPB 3GT6A 4F8OA 5KSAD 4OFKA 4QF1B 4BE6A 2D4FA 2OI9C 2VLRB 4JFXA 4DGIL 1EHLH 3QS3A 4N6RB 4EUPB 1CT8B 1G7PB 3K8MA 2JQZA 3LB6D 4Y4FC 1O5PA 1TJHL 5HDQH 4OGXH 2XKSA 3QIUD 4DO5A 3IKCB 4W9HC 1T7YA 2BIOA 4Q58C 3KPRB 4M5ZH 3V6ZB 3ZK0A 2PABA 2YPLB 3LEVL 3UADA 1VFBB 3W3BA 4F2EA 4F3FB 2EVHA 5E94B 3HC3H 1T22B 2Z31C 5DO2D 1NDMB 3REVB 3JUYA 5TTRA 3DVIA 4AC2A 4L29A 1U8MA 4HBCH 3MHZA 1T5KA 4GLRI 4A7TA 2W92A 1G4RA 1MCWW 1GYWA 4A55A 4IRJD 4ZD3H 1S9YB 1TTGA 2CAKA 1RULL 2V9TA 1OSYA 4HGMA 4LLWA 3INUL 5C71A 3RZCC 1BG9A 2Y69B 4Z3HA 1PZSA 1XGQB 5EBWA 2GFBA 2A6IA 1UM5L 2ZYIA 1NFDE 2ZXCA 5E2UH 3GSOA 4DVBA 1XGYH 2PUQT 3IBEA 2VAJA 3BEWA 4FLHA 1X5GA 2EIJB 3O4LB 4Y9CA 1P2CB 1RJZB 4QTIH 5GS3A 4ZFOA 1VAHA 3IJEB 1MQKH 1HVXA 1CG9A 3ARGA 1BZ7A 4C83B 3P0GB 1T2XA 3NFPA 4JM2B 1PEZA 4NQDE 4HSQA 2GEQA 4HBQA 1V3KA 4M4PA 5CD5D 4LVOC 4Y0GA 2XKNB 1NMCC 3AB0B 5FECB 3E8UH 2R56L 4ZYKA 1ZMYA 5MEND 5B1KA 2B4CH 3GMLA 4NHUA 3QH3B 4K4KA 1E4XI 3MYJB 1HE7A 3TBSA 5IOPA 4EVNB 2X88A 1WFNA 2XN2A 1CU4H 1MCQA 2CALA 4JFEB 3G5XA 4I18B 3I6LE 2FJHB 4OB5L 1RV6X 5EU7C 2O1AA 3AY4A 1Z2KA 4V1DD 2DDQH 4JRXD 3VRJA 3VJ6B 4YHKH 3C8KA 4AVJA 5IFAL 2FR4B 2A83B 3IMVA 3WUWG 3LQMA 3QJXA 2F15A 4B9ZA 5DF0A 2C26A 2E59A 2HB0A 3DX8A 3CFKA 3Q6GL 4NUGH 5CIPH 4UM9B 5KG9A 3MACL 4H8HA 5K39A 2YGPA 5IBUG 1IBBA 3VGHA 3RL2B 2J8OA 1A7RH 2PN5A 3KEDA 2GJZA 2J44A 1GW0A 3KD4A 4P5MB 1A3LL 1T1YA 3LV3B 3MNWB 1T7XA 3BDBA 1H3PL 3BVXA 5HHPA 1RHHB 2A77L 3W38A 4WF7A 4U3CA 1SXAA 2X3AA 3GSQB 3IWVA 5H37A 4A6YH 1OP9A 2PPDA 2R1XA 3TURA 4UTBA 5JOPE 4UOZA 5EZIL 4DGWC 1UTDA 1MAML 3WS3A 2Q10A 4MKMA 1N2RA 3E6FB 4XN7A 3QR0A 4MD4B 1CFMA 4NZJA 3FHAA 3NGBB 1WVZA 3MRLB 4ZS7L 3MDJA 5C0JB 1K3ZA 1OXYA 3ARRA 3KYKL 5K33A 5IV2B 3QJSB 4M00A 3HBZA 4FQ1L 9PCYA 4JFWA 1EUUA 5C0BE 4BWUA 2WXJA 4YC2B 5IB4A 4MRCA 4AX3A 4OZFH 2VAAA 4PV8B 2J1XA 4EIUA 5A7EA 3MLVH 4R96A 4IU2A 1SXBA 1I1AC 4JN2A 2CRIA 3GTNA 4OT1L 1KJMA 3ISYA 4WK2B 1FFOA 3AVEA 5GGSY 2DQGL 4ZOCA 5FYJL 5IKCA 5JDSA 1SYVA 3KNBA 1FVCA 4YSQA 3C08H 1LEGA 2HFTA 3ZDWA 3SPJA 4IRSB 3SQRA 4XPHL 3WJLC 5C6WH 3VXSE 4PV9A 1AQHA 4XNMA 1OAQH 2FQFA 4PJAE 3S37L 1FZOB 2JELH 5E8OA 2VW6A 4JREC 3VXQA 4LZKA 3HC4L 1LDPH 1FDLL 2W9EL 2A9NL 4TRPH 1E5UI 3KLKA 3ASWA 4Q9RH 1P5UA 4JFFE 4Z8FL 3AMLA 5IJKC 1ZK9A 3ZTCC 3CX2A 4XPAH 2BHUA 2VIRB 3KVQA 3ML8A 3NP3A 5CXPA 3T77A 3UG5A 5AL8A 4HIHB 3TBCA 2X44D 1OAZH 1OK8A 1TQUA 3FCTB 4XMKL 5E08L 1BM3H 1EEZB 1IFGA 1G6VK 3MA7B 2LU3A 3A6BH 1THAA 2Y5EA 5FXCH 4DH2A 1F4HA 5T1JA 3RWDA 5F3BA 3QDAA 5AYTA 3QB7C 4KK6C 4HUUB 1SF3A 1O7DC 1CTNA 1JF1A 4ADGA 1ZHKB 5KYWA 4PJ5E 3G6JE 2HVJA 3U7WH 3BD5A 2APTA 2Z4TA 1IGTB 1AC6A 1WAPA 1HSBB 1NGXB 2AANA 3JT0A 4MAZA 3KPPB 4JM0A 3VAEA 5IHHA 4NENB 1AE6L 1UD5A 4DQAA 4H8UA 1GA2A 5I8EA 4FJYA 4JFZH 4K94C 4Z0XA 3EGSA 4KNTA 1OOWA 4GW1B 5ACZB 1CTOA 5E6UB 2AJYL 1WICA 2NYZA 1BF8A 4G6JL 2BNRE 1U2HA 1IC5H 4UV4H 4U33A 3STLB 4H4NA 5D72L 5F96L 3SDCD 1RJLB 1A66A 2ICEC 4QXUH 1D9KD 1A4JB 1NCBH 3VYNA 1GGIH 4OAWA 4ALAL 4LSPL 1RZJH 4Z7VE 7PCYA 4K23L 4JR9L 1ACCA 3PQYA 4MNQA 2DH3A 4EDWH 5JUEH 4KO7A 3A3YB 2OCJA 1J18A 4BKTC 1JUFB 1TJMA 1YN6B 3MRBB 2HCZX 3F5WB 1SFHA 3BO8B 1HAUA 1E5AA 2WKOF 2XWTA 3IF1A 2QFPA 4R90L 1N6VA 12E8L 1OT4A 5F1IB 2LAAA 3EOBA 3VD1A 1EEYA 3L3DA 4PV1C 1VFUA 2HSIA 3GHEL 4X99A 5E1AB 4U1JA 4U3XA 5B8CA 5AYUH 1N6QL 3ZE2F 2FVNA 3BN3B 3ELAT 2QSVA 4FQXD 3MXVH 5I1KH 4DZBA 1JTPA 1GZHC 1IC4L 5F3FA 2YEQA 2DQMA 1DSWA 4P3DB 3KLAB 2R2EA 4I3RH 1KOAA 5HP5A 1UWFA 3LIUA 4PRBB 3VFGL 43C9B 4G8FB 3K2UL 3VNYA 1Z3RA 4YEEA 4F2FA 4GQRA 1HHHA 4H13C 4RRPG 3HBQA 2MPAH 3ZE2B 4OCWH 5IB3A 1TNNA 1E6OL 2OXHB 2FB4L 5JW5A 2VRAA 4X7CC 5JMRA 1ND0B 2HLAA 1J1XH 2MTAA 1P9MC 2BZCA 2PO6B 1R5VB 4F57L 2Q86A 3QDGE 2AV1A 3IN2A 2PTVA 3X1FA 5M7QA 1UH3A 4PCTA 2EIZA 3T0ED 2DBJA 2QADC 1CYWA 1PMYA 2CE6A 2EC9T 4WEBL 2P5WA 1QSEB 4L8SC 4R8WH 3GKZA 1Y1UA 3RLSA 3WFDL 1MFBL 1AGDA 2ZSWA 3IMUA 3L7EA 3WAJA 3QYMA 4HC1H 4QWWD 3D2UA 5E1QA 4GUOA 1I8MA 3KR3H 1MCBA 3SDAA 1U8PB 2D3LA 3W57A 4PR5A 1AO7A 4MD0A 5HJDA 4X6EB 1QWHA 5J89A 1ZD6A 2EIMB 3WUWB 5HGHB 4JFQB 5L2KD 2GCYA 3FQTA 1EFXB 3MGTB 1NSNL 4JY5L 5J1AB 1GTFA 1KT2A 2L7QA 5IBUB 3RWJB 2GIXA 4A38A 3VCLA 3BWAB 4F7CB 2Y7QA 1PZAA 3NA9L 4Y5XB 3EDFA 3HBGA 3GZKA 5EIQA 1TQBC 4J12A 4Z23A 4NO2A 3BAEL 4M5YL 4N4YB 4NKDA 3T6VA 3E9TA 5C8JA 5CJXA 5D7IF 5GGSA 3WNIA 1GZPA 2VLKE 3B2UC 3H9ZA 4KTGA 1I9IH 3VFUA 2GHWB 4XWOC 3QXDB 3IEAA 1JZ3A 1WCBA 3CDZB 2MQ0A 2AMUA 4BFJA 1AKJA 2D7MA 1J0KA 5IVNA 3UTSB 3D0LA 5CZVH 3OGOE 2QMKA 4RBPH 2K4AA 4M93B 1QFWM 2X4TB 1NZRA 4QTHA 1C5CL 2ITCA 2NW2B 4P2QD 5D7IB 5CZXD 2AJZA 2D31B 4CGUB 3VSVA 4OZIF 1VJSA 4J3BA 4CADB 1JNNL 1IGCH 1G6RH 4HKXB 4HEMA 1P4BL 2V7HA 1CDIA 1FJ1A 5DJ6A 1D7BA 3EF7A 1Z5YD 4A2MA 3HB3D 3U6RB 3SHSA 3BZDA 1SVCP 1I9RL 4NBYB 2VZTA 2BINA 1HE8A 3FN3A 4LMQI 2BS9A 2DQEH 4PUBH 5TPWH 4IMLB 1XL4A 2J5LC 4N2CA 4OZIB 1GMIA 1N67A 1GH7A 5B22A 4WI3A 3HG1B 3TTYA 2WSKA 1IGML 4LCIH 1QEWB 5I15L 1T1WA 5GJSL 3N04A 1MAKA 4EN3D 3MGOB 2OSYA 4I13B 5CEXB 1U8KA 1F13A 5EBMA 4N1HB 4LVNB 4FQLH 2NNXA 4GP8B 4I3SH 4OLYL 3SE8H 3UERA 4R7NA 1JVOA 4UILH 2BNQD 5JHDB 4FXGC 1I1FA 1ZHLA 4HZLA 2QSQA 2OMUB 1Y7VA 4RGND 1OGAE 3QEGH 4Z9KB 3UTZA 3NJIA 3O41B 1KPRA 1DQIA 2P5ED 3EGDB 3FUNA 4MA1B 4P2YA 2ZUTA 1UWXK 3BSGA 4WGVB 5DHVB 1SF5A 2YHGA 1YN7B 3H53A 3OD3A 1U8QB 3ATAA 3UC0L 5MERA 1AQ8A 4X83A 4UAOC 1EEQA 3D06A 3QEUA 4K55A 2BRRH 1EXUB 2R0KH 1W0VB 2ATKB 4QRQB 2P8MA 1BZOA 4QDGA 4R5XA 4Z95L 3GPSA 5ISZD 4JW3A 5DEFB 2XETA 1V27A 5DCCA 3KGSA 4A2EA 3S6CA 3QIWB 4HKZA 4EXKA 4F7TA 3R8QA 1BBDH 3U0WH 4HIPA 3N6YA 3Q44A 4A2LA 4MB1A 1AQDB 1IKNC 4N26A 3U0TA 3DPBA 3Q6FA 4F91B 1CTMA 5FO8B 1J7VR 3DV4B 3G6DL 4PJXE 2ZQKA 4U1MA 4E9VA 2VZSA 3H0TB 3K91A 1QFWI 2NXYC 4LDLB 4PCYA 3VXRD 2VM3A 4KQ3H 1UWYA 3NTCL 4FNUA 3QAZC 1FFNA 1TQCC 1J9QA 2B16A 4HMEA 5DUJA 4LB8A 2JNZA 2VB5A 3I9GH 4G3YL 2JK5B 2RH0A 2VDPB 4NQVB 2IALA 4OCSL 4XNYL 1BQLH 4N0YL 5CJBA 3ZT7A 3PHOA 2IJ0C 4TQ8A 1KJ2B 1RZKH 3W0WA 4G8GE 4KWUA 3QPXL 4Y2NA 4NT6B 3K3QA 4LBEB 4HUMB 4OCMC 4PQXA 4S2SB 3TF7C 1ACZA 2GYSA 3LNDA 4S0TD 4M1GH 1Z9NA 2EVFA 1J9RA 3QYCA 3OVUB 4WQOA 5FYKL 5DK0A 2NT0A 2OTPA 3LQZB 2W81C 4Z7WA 3ECBB 4X9BA 3CFNA 4GBXD 1B0RA 4LOFA 2XI9A 5K9KB 5T5NG 3RHWF 3RFZB 3OMIB 3TTSA 3SKOA 1O5DT 1U95B 1RUMH 5JIHA 1A7QL 1R6VA 3AY2A 5EO0B 4YBQC 4QR7A 4WTWA 1F11A 2JWYA 3IU3B 2APVA 2EDJA 4A68A 5F89B 3FQRB 3OB8A 5IMKB 1T1XB 1AHKA 3HLAA 3HW7A 3V9CA 3PFUA 1J11A 4NAQA 4Y8DC 1TSHA 1ZVSB 5MEPA 4GH7B 4P5TC 2D2CC 4AE0A 5ICZA 1NCJA 4XH2A 3PHSA 3MBWB 5F7YC 5DQ9A 4Z7NE 3CMOL 4Q9QH 4CMMB 1IQWH 1Q38A 2O30A 3KYAA 5KAQG 2BVQB 3AWFA 4L4VE 2F53A 2OP4H 4NQED 4XCNB 5HYJA 2JLPA 4GAYB 2OSWA 5HI5D 3DV6B 2RQ8A 3CUPA 2ADJB 3LSOA 3V7AE 5CJQL 3MBEA 1UXWA 2GJPA 5C0CB 3G5ZB 1YAZA 5GZOA 3RGVB 5TQ0L 3K6SB 1KBKA 4AXWA 4MAUL 1BSIA 4K7PH 1CLYH 4X6CE 2Q7AA 1MH5B 3N85H 4YHNB 4UDTB 1EJ8A 5GS0C 1PJ9A 4QHLB 4LCCB 4W81A 5A3ID 3N44F 2P1YA 4PRHD 5DR5H 3BQUB 4LLYA 2JB5H 2VSKB 2CCWA 3EH2A 1B4RA 2QPUA 4MZ2A 4JQXC 3IJSB 5HDBF 5IESH 5IQ9B 5JHLA 2DQHL 4WO4B 2EVJA 1A2YB 4OVVA 3UJIH 3UYPA 3VG9B 3HE6C 1EJ6A 3GMPB 3NAAH 1DO6A 3LRHA 6PAZA 5DC0A 3N44B 3U0PA 3IAQA 2XWBA 3L4UA 4NZDA 4IKIA 4JKWA 2W60A 1HEJC 3VE0A 2QEJA 4D3CL 1UH2A 1JGUL 2H3NA 2BSTA 4EZJA 3AREA 4WDIA 2ZCHL 5D8JH 4WW2F 2Z9TA 4XAKE 1T5WB 3L3JB 3OHXA 2YPLE 2YSSB 2BVYA 3S34L 3N43F 2PXYA 1DLFH 3FF7A 1DVXA 5I9QB 1Z0NA 3FTWA 4TUJA 4R83A 5CCHE 5DHEA 4Z18A 1AR1D 3NIGF 4HWBL 2ZP0T 4Z78A 3OAYH 4C4KT 2R2HB 3QHFH 3ESVF 5GRUL 3UAFA 4WW2B 3EZ8A 4PLKC 4JANA 4WJ5B 4MQ7A 3N43B 4H40A 1AGCA 2LU7A 3KYOB 4IOSA 4X6DE 4FRWA 3QJVB 4R2GC 3KXFD 2M2DA 2NY1B 4RMUA 4U1SB 3M7FB 2V0AA 1BXXA 2YQ2A 4X5LA 3ZSSA 5KVDH 3NIGB 5C9KA 2XTLA 3WNKA 1AKPA 2OSLB 1MIEL 1CLCA 3GB7A 4NB7A 2NLJB 3GBMH 4I3GA 4ZAKC 2O61A 4AYGA 5F6IC 4MWFA 4R7DB 2VJ8A 4KY1L 5F3HB 1R17A 4NM8L 2R39A 3IFPB 3FHEA 2J8HA 3FT3A 3PV6A 4LSTL 3EH5B 3WY1A 4NKIH 4ZUWB 4WTZA 1OSEA 1L7IL 4AH2B 2Y07L 5B7EA 3VXMD 3N91A 1ZKAA 1BGXL 3O3DA 4M43H 4TNVF 4QRUB 1E3XA 1KLUA 2ZKHH 2P8PA 4WHYH 4D2NA 4IRJA 5KJ4A 1Z9OA 3BKJH 1OVZA 1JPFB 1DQQB 2K70A 1FNEA 3ARYA 3MO1B 4LSSH 1QSFD 2I60H 3QUXC 4RAVA 3L7FA 3BVWA 4Y4KB 3SBWA 4MA3B 4BSWA 3FKUS 1BVKB 2IG2L 1QNIA 2BS71 3QQ3B 4XX5A 1KTKE 2H6PA 3R4RA 2FSDA 3NSDA 1W6LA 5IZ7A 1RZFH 3B6SA 1A6ZA 4MMYB 1IGYB 4KK8D 5AD0A 2YK1L 3NK3A 5I1LB 1RZGA 3FMGL 2CO4A 4ISVA 1HSAB 4ACPA 5I1AA 5J06A 1M7UA 3IJYA 1D2PA 3CHRA 1DJIA 2XIBA 3LMJH 5FKAA 2V3FA 5E2VH 5SX5K 2VT0A 4NP9A 4IU3A 4OLZL 2NY0B 3CN2A 3VXTA 3VFPB 3SJVE 1R3JB 5T5NF 1WZMA 5MENA 1V3LA 2LGNA 3QUZB 1MJ8L 2AI0H 5ABDE 1AGFA 3WJJA 4IIQA 2MIZA 4P04A 5HJ3A 1G1CA 3T0DA 3TWYA 4NQQA 1XEUA 5KSAC 4DK6A 4J3OH 3VWJC 1YHPA 2EQDA 4LVHB 5IVZB 1ZTXL 3UTPE 5C2UB 5I28A 1KXVC 5FO7B 3O9WD 4DESA 4JQIH 1GY2A 5DMYA 3U1SL 4JKKA 5FYLL 3QIUC 4UINL 2AQ1A 3JVGC 2CM5A 2ADGA 1SLWA 2VERN 5SWSA 1ZSDB 5I8OH 1E9PA 2W0KA 1QPPA 3BPLC 2VXQL 4KHTL 2PWEA 4K7PX 1LK3H 1L9SA 5D93B 3A5VA 5F1KC 5F70A 3LHPL 1DBKL 1JHTA 1WH0A 4LCUB 3RWCB 3D07A 4WI4A 4EO5A 1I8AA 1U3YA 1GJUA 3L3OA 4WSKA 2CO7B 3S5ZA 4H0HB 4OZ4A 3A4FA 2AQNA 3HNSH 3L5XL 2H45A 4ABVA 4KDTC 3FAXA 4Q6YA 5IM7A 1AHWA 4PLJD 2I69A 5AOZA 4GS7C 5EPMA 1K2DB 2IQAB 1FHNA 5K69A 4ODHL 1J48A 3EGXA 3LS5L 3K6IA 2G5RA 1YEDB 3P9MB 2ZP8A 1HH9A 1A8ZA 4J27A 4WWKA 1TZHA 4OKVA 4UZGA 4YO0B 5ESAB 2CK2A 1PU0A 5D1XD 2M1KA 1IX2A 1MFVA 4K9JA 1M6UA 2OR9L 1KWGA 3GSXA 3DHJA 5DEGA 2VLME 4ZZFA 3V0VB 1DQVA 1E3ZA 2BIPA 3ATFA 3LRSA 1KFGA 4WI5A 3PGFH 3X14A 4JCWA 1K8IA 3QFJE 4DZ8A 2VNCA 2IDFA 1EIBA 1AO7E 4LFHD 4AQZA 1QI3A 1PFOA 3C60B 3T08A 4JZJA 3FCBA 3TA3B 5CJ5A 5AB1A 4LRNL 1Q1JL 1QFUL 2HG5B 4R4BB 3JV0A 4ODVH 4H1LA 5G4MA 3I9AA 4AYDC 4YHZL 2QV4A 2W0FA 1I4FB 4PN6A 5KSVA 1FG2B 3Q2VA 2WVVA 2Q1EA 2AEQH 4LCWE 3A47A 3TESA 1RUPL 1QKZH 4P2CG 3G04A 5E56A 1JZ5A 1ANUA 1ONQA 3MV9A 3TEUA 3IU4H 4IRZA 4S1RL 1SQ2N 2RTTA 2WWKO 4OJFL 1LEIA 1W91A 5IVXA 1OCZB 4YSSA 3HA0A 3IE9A 1NGYA 2ICWA 5LGJB 4L1HA 2VE6A 3JWDL 3ESNA 4AT6B 2C9VA 3EBGA 2QLVB 4WKZB 2IAND 1XIWA 3L4YA 1L7TH 4ZXBD 3BLKA 4G42A 1Q90A 2VDKH 2QGDA 4YE4H 4C56E 4PIBA 4BGDA 1QWNA 2PTTA 3SO3C 2X7LA 1NWPA 1ZLSH 5AVWB 3VXPA 1OHQA 4JVPA 5C08B 4F7MB 4JFDA 4IK6A 4Y8AA 3NCBB 4D7PA 4FTDA 3MR9B 2VDRH 3EYUL 4YHYC 3GS7A 5LBSL 5I73B 2C1OB 3VQLA 1LQSR 4MMZA 3CFIC 1NGWB 2J25A 3BDYL 1U33A 2CR3A 4A66A 5E8PB 4ZW3A 1URLA 8FABB 3QG6A 2B1HL 1OM3L 4LL1A 4FQJH 3NCJL 1JZ4A 3M1BB 2O6FA 5C0FB 4M1CD 1UT2A 1F6AA 2C9PA 1XZ0B 3IDMB 4RFEA 2QTVA 5IWLA 4YEFA 4NQXB 3DGGB 4IOIA 3FO9B 1KY7A 5I18H 1KCVH 2ZUWA 4ZS6C 3TYGH 1LK2A 4E41B 2WXPA 1ERNA 1NFIB 1ODAA 2NUPB 3NIDE 4FKKA 3FQUA 3L3GB 4NGHL 1XGPB 1H6TA 1L6XA 3GUTB 5F97E 1DEDA 3JZYA 3QHZH 3Q8EA 2ERJB 2VKXA 3UG3A 5DD5H 4XMPH 3BWSA 3RIAF 5F9WC 4AVIA 4WFGD 2AGJH 4CUCA 2HVBA 4PJ9B 3CCHB 5LDSA 1DDTA 4FQXA 4WUUE 3WKQA 2EVIA 3V4VA 5F0PB 1NGQL 3UTTB 1JDDA 4DKFH 3AC0A 1U8NB 4MJHA 4Y1AB 4YJZL 3S97C 5EZJA 2DL2A 2F5AL 4JHWL 2FO1A 2HJKA 3L5WB 1PW3A 5F21B 3HE7D 4AK2A 2HT4C 2NY5C 2XV2A 3DX6A 2DEXX 3NN8B 3V0GA 3DHUA 2KZKA 4PS4L 3SY0B 3O6KL 3FYIB 3P4NA 2V4LA 3BGMB 2K7QA 1GOFA 1SUHA 2VDNB 4O2FA 7TAAA 1M57B 1FL3B 2IPTL 2CUMA 1E2VA 1ETA1 2MJWA 4LPTA 3P02A 2XNAA 4G9FD 3PABA 1HKLH 3FOMB 1S7VB 4M62L 4MA8H 5EU3A 5M95B 3KLSA 4XO3A 1BVNP 1TU2B 1PY4A 2R4RL 2VZ1A 5HBBA 3C6SA 1H3VA 3RY6A 2DM2A 3C6LC 5DU7A 3GNMH 3HHMA 5EU6A 3SDCC 1YC7A 1D9KC 4MCZB 4QRRB 3TF4A 1INQB 2W80C 2ITDA 4GSDH 5E2JA 1P53A 1Q9WB 5EULV 5IQ7L 1R3HB 5L2KA 3WNNA 4HUWB 3DMMD 4WHDA 4OLWL 4H0LC 1I8LC 3I3BA 3OHMB 1BW8A 2BFVH 4QPEA 3AM8C 4HV8B 2V8LA 2A6KB 3CSYA 3IJ9A 2D8KA 5CF3A 4ZMAT 5DXWA 3LEXB 5HHME 3U2SB 4OZIE 2ARJQ 4WI2A 3D08A 3D0AA 4DEWA 1IV8A 1P7HL 4XE5B 3LS4L 5EU5B 4Y19B 5T5FA 1DQDH 1UT1A 2R1YA 4FYSA 4PGJA 1A6AB 2EYRB 3FB5A 3P2BA 3EFDL 1MN4A 4GRWF 1ZVYA 4ZW5A 2GT9B 4YX2H 2ZYHA 3D39B 4EUPH 3MLXH 3CZKA 5EFIB 4EQ3A 15C8H 2YKKA 4XNXH 4P2QA 4XXWA 5E5LA 4Q4EA 4NPYA 2VXTH 2CO6A 1ZLVH 3ULVE 1I1RA 3Q3GA 4AMWA 4W9GC 1TEYA 2N7AA 4U7MA 1C08B 4WK0B 1DUYA 2WC7A 1SM3L 3JWNG 4FG6C 2XPYA 4L9LA 2FIRT 4GRWB 2JI3A 3FH5A 1QBLH 2IWKA 2CUIA 3IDUA 3O3EB 4TUKH 4KROD 2HT3C 4G80A 3MYZA 3T0EC 3Q8FA 2B8OT 2F53E 4NJ9H 3NACL 5DVMA 3VWKA 4YSEA 3V6FB 4GIPD 5HHOB 2C9QA 2J88L 4Q6IC 4GG6A 1E8XA 3AQZA 3BVDB 1NANH 2XIDA 2HAZA 4EBQL 1JMXA 2B59A 1BX2A 2OV0A 4LLVB 5DZLA 5EZOH 2FJSA 1WIPA 4PLNC 4Z1PA 4MQXD 3HUJE 3D4CA 2VDLB 4L5FL 5F7EH 5H37G 4ODBD 1X6LA 1KIRA 2AEIT 3BD4A 3PS6A 5KS9F 4Y2DC 3DARA 3HS0A 4PGZA 5D7SH 3OKOA 2ZXAA 4MA7H 2JKLA 3ZY7A 2IDCA 1MFUA 4G5AA 3GTVA 4ZUUB 5JIDA 3BZ4A 2OJEA 5DYOB 4XPFL 3QUMB 4F2MA 2RCSL 2VZOA 3BAYA 1N5YH 2X9XA 4TYUA 4QIRA 4F92B 2COQA 4P4KD 1R75A 3MJ9L 1NICA 3IDIB 1CICB 1BQRA 4UT6L 5KS9B 5ABAA 5MEQA 2BNUB 4OF0A 2AK1H 3FONA 4GSQA 4NWTH 5D1ZA 3D05A 5H94A 3GHBH 4L8CA 2FJFB 2JIXB 1HEZB 1UA6L 3QI9D 1IAIM 1WA2X 4Y4FB 1SN0A 3WS6C 4JGMA 4NO5A 1Y6MR 2XDHA 2RFXA 1RUAH 3VXNB 4TSAL 3RUGA 4MBOA 5FKPB 2XG4A 4NUJB 4O02L 2Z31B 2H3KA 1BBJB 1KJ3L 2EKSB 5CSBA 5ISZA 4NWUH 1U91B 5FDWB 2DIEA 4DT2A 1G0DA 2IBBA 4QCIB 2J8UA 4K5PA 4KZCA 1MCHA 3QR1A 5EMYA 1JZ2A 3X13B 4TM9A 3MODH 1ACXA 1ZHNA 2MCAA 3O8XD 3HB3C 3RZCB 1LE9A 1OE1A 4K3JH 5HDOA 3U7YH 1EJOL 3WENA 4LPCA 4NN6B 5JXED 1SVZA 2EH8L 2G3NA 2JXMB 5SX4H 3SE9H 2XV0A 1CFVH 2ZG1A 3DO3A 3LOWA 2R15A 4EN3C 5T3ZE 4CW1B 3UEQA 4HGWB 4JHAL 2PWFA 1MCJA 1MLCB 1ZAGA 4GKZA 4X4XB 1F1AA 2AZAA 3BLBA 4APXA 1OB1B 3GD1C 1PQZA 4XNQA 2ZSVB 5IB1B 1T04A 4DAGH 5FM5O 4LF3B 4Y5YC 2VL5A 4YLQT 2IPKA 4U1KB 1PAZA 2XQBL 3PWVB 3VFSA 2DMHA 1JE6A 3BXNB 3GSRA 3NRPA 3M17A 3D9AH 4GBXA 1T03L 2NR6D 3V0EA 3JT2A 4QOKD 3RDTA 1GIGL 4HOXA 5AB0A 3OLGA 3G5VA 4JFXB 3GEFA 3NJMA 3LXUX 1KB5L 3TVMD 2KKQA 4MFHA 3N40F 3DVFA 5CAYB 3JV4A 3RIFK 1U30A 3S96A 5BS0D 3QDJB 2NMSA 1GXEA 2YD5A 2ZX7A 3CDGA 5IW6A 4K3DH 2VLJE 3WNMA 1HZLA 1BD2E 4GUQA 5D7LA 2ESVD 2YPKA 2HWZL 2YD4A 1LO5B 3QFGA 5DJ0A 2PYFA 1RAMA 1M2VA 4HCRL 1QP1A 1U8HA 3L3HA 4N2MA 4L29B 1U8MB 1JF5A 4M61B 1BFVL 3PDOB 1HZHH 1PGRB 3LRLA 5CEZL 3PJLA 2J1WA 1EANA 4JQVA 3QC6X 4L4TD 2VYRE 4XZUB 1IAII 5HDBE 1FBIL 2UY6A 1WTLA 2VTFA 2CRYA 2Y23A 2EDQA 4RDQG 3X12A 3ASNB 1SMAA 5JXAL 3FSZA 5KN5A 3EO9H 2GFBB 3UACA 2A6IB 1B4TA 1R3LA 3CNKA 3D87B 3GO1L 4DP9X 5FA4B 2CBQA 3H4HA 3BEWB 4UU9A 2CNYA 3WFEL 4ZFOB 2ARJB 3ARGB 3OZ9H 2CJTA 1CB4A 2B4CC 2MSPA 4XOAA 4JHBA 1RIVH 5E24E 4QRBA 1MCPL 5JYLA 3E3QC 5F7LB 1R46A 3SKJH 5EWIH 5KSUB 4N2BA 4BZ1H 4LCVA 3JBG7 3CC1A 5EEWA 5EA0L 1SXCA 1T2QH 3L6FA 3K8KA 5D5MF 3B2VH 1IKOP 1YG9A 1V54B 4NHUB 1GSKA 5JZ7D 4HIXH 4EI6A 2NCEA 1KCUL 3TBSB 5IOPB 4L9DA 4YFEA 4X4MA 3V10A 3G5XB 3AJ7A 2Y06L 3OJDA 2APBA 2Y4SA 2HZHA 3KJ6H 3MRIA 4F24A 1K6QL 1XF3A 1SBBA 1ETZA 3VRJB 4XBEH 3RVTD 4K2UH 5FA3B 5ACMA 5IIEA 3C8KB 4HIEA 2H1XA 2LE9A 4L3AA 4LARH 5D5MB 3SPVA 1ULVA 2Y1AA 3CFKB 5KG9B 1E9OB 2H8PB 5K39B 3DI2B 2Y7NA 1CYGA 2FEEI 1RH8A 3R1GL 1SBSL 5JW4M 3EBHA 1DO5A 1EA9C 4JRLA 1U3HD 4RNRA 1KV7A 4QEGA 4YBLB 1WLHA 4PY8I 4DP1X 2CJ3A 3MLYH 3WJMA 3CHOA 4BUQA 3TZVA 5HHPB 3HS9A 2YD1A 4P2OD 2BP8B 2F19L 4TNWK 5BRZB 3EJYD 2YD2A 1TVBA 1AYOA 2NX5E 4PJ8C 5HI5C 4NSKA 4ODUA 4FEMA 1RHFA 4RA0C 3WS3B 4M7JH 1N2RB 2EZ0C 4ODSH 4WEUD 4NIKB 2QDVA 2IV9A 2EADA 4FNLH 4F9PC 1A3RH 3EKCA 1NUGA 1EHLL 2VN5A 3EXLA 3NT0A 5DRZA 3FUIA 2Q8BH 4RFOL 4UOQA 2CHNA 5HDQL 1EDQA 4OGXL 4KTEH 5F0MB 5EH1A 2WIMA 4MNGA 5FV1L 4M5ZL 4R96B 3RGHA 4IU2B 2X4SB 5GGUB 1YEFH 4D9LH 4KRNA 2R9HC 2BW4A 4Y2OA 5CS7A 2NY6B 1UB5A 3HC3L 4IBSA 4MAYD 5HGAA 1FFOB 1VCBC 5GRVL 5SX4I 4LE8A 4DKTA 3GINA 5GS1C 5B1JA 1YYCA 2O5XH 2ZYRA 3KNBB 3ZUNC 5JDSB 1ZA3A 3MV9E 3HR5A 1FVCB 1OLZA 2NXZD 4GSXA 2Y0SA 1MRFH 5J1SC 2QR0A 2MOVA 1OCCB 3GLEA 2SODB 4ZD3L 1Z9SB 3PXHA 3FQXB 1FHGA 4XNMB 1D5RA 5DMJB 1KBWA 3BVVA 2VN3A 2LVCA 5E8OB 3RWGA 3CFEA 5BXFA 5HVWA 4M5TA 4E0RA 1P5UB 5E2UL 3CLEH 1XGYL 4G8IA 3QUYA 3RURA 2HKAA 3APDA 3T65A 1JIBA 3IGAA 4AYSA 3ZIYA 5JA8B 2VW7A 5DZ9A 3ORJA 4GRMA 4P9MH 4R4FL 2P8LB 3FZUC 2R0WH 1SOQA 2BSBA 1AR1C 2XV3A 1HU8A 3F7QA 4MCMA 4F8NA 3RWDB 5CFAA 2OW6A 3WL9B 5F3BB 5FPIA 4FF9A 2UZXA 4F7KA 3BAXA 1E4WL 3OLIA 5KYWB 2N4IA 1JPGA 3KPNB 3P30H 2HVJB 3E8UL 4C8XA 2JSFA 3WDIA 3OXRA 2KDYA 5E23A 1QASA 3EDDA 3ZQ9A 3FOLA 1X7QA 1WBXA 1CU4L 5AVYB 5HD8C 3GPEA 2QADB 3MTXA 3P3YA 4Z0XB 2P49B 3EGSB 2DDQL 2AJUH 4L8SB 3T9WA 4BYHA 1HT6A 4FN0A 4YHKL 3HTLX 2CSPA 1MQ8A 3O9WA 4WNSA 5DTFB 3F7PC 4FZEH 1U41A 4P46A 4BH7A 3LEYL 1DUZA 4W70A 2LLGA 4IJ3B 4NUGL 3SDXA 4AGMA 3MJWA 4AQ1A 2DJSA 1BJ1J 5J6HA 1A7RL 5SWZD 2N0MA 4BH8B 4XODA 3M88A 4UQ9A 1XTMA 1TUPA 1NCHA 4ODXB 3QUGA 4MNQB 2Y5QA 4FKEA 2YFNA 5FB8B 5AKVA 2WYIA 3L2LA 1N3NA 2F54D 3IPFA 1KYAA 1BZ9A 4ANKA 3VFTA 1INEL 4RDQF 3WIFB 1AQKH 3LQAH 3FFDB 3IF1B 3ZBMA 3MRQA 3NZ8A 4KRPD 3ZHLA 4PB9H 3EOBB 1TQBB 1EEYB 2EDEA 2FX7L 4R0LC 4XP9H 3SE4C 4X99B 4JG1H 1ZDSA 1U8OA 2KHAA 1CL7H 1UJ3C 4PG2C 4EN2A 1TNMA 1QHPA 4AVHA 5CR1A 5A2LH 4DZBB 3ZE1F 4AG4H 4KKZA 3HPLA 2XKUA 3T8MA 1WUNT 4HPYH 2Q9OA 1NM9A 3ULUF 4KK8C 4YN3A 5FGCB 1U92B 4FG0A 1WFTA 1I9EA 4JE4B 5DHVH 1DQJB 2DICA 5DURD 1HHHB 1T6WA 2MQCA 4XVUC 3KPMB 1A6TA 2NNRA 4HPHA 1MAJA 5EU6E 4BCYA 5IB3B 1XBDA 2SEBA 5JW5B 3ZE1B 3C08L 4FMKA 2HLAB 4W4NA 1OAQL 3NCMA 4L23A 4QRTB 2Q86B 2AV1B 3BRGC 4RQQA 2VUYA 2WXNA 3IBOA 2JELL 4YIQA 5BUPA 2VJ0A 1A3QA 1OAXH 1LDPL 1YJDC 3CH8A 4TRPL 1EK3A 3N41F 4Z7OE 1D6VL 1QO3A 2ARWA 2E9BA 2P5WB 5HPOA 4Q9RL 2ZSWB 1DVTA 4XPAL 1N7MH 1T21A 4BZ2H 3L7EB 1J8HD 3QJUB 2IAMA 2L8AA 1QFOA 3D2UB 3MRCA 4DTGL 4GXVL 1BM3L 3ISWA 4N20A 5D9SB 2EDWA 3ALWA 3VMOA 4JM2D 3A6BL 5ALBL 3SDAB 1DDHA 1CLZL 3QZWA 2RMNA 4GEJA 5E9DE 4PR5B 5CN3A 4MD0B 3ZKND 4JEGB 3N41B 4PJDA 4J28A 4LL4A 4O4YH 3IDXL 3JUZA 2Y3NA 4TOYL 4DP2X 2GCYB 3FQTB 4NZ8A 2ZOKA 3U7WL 1JVLA 3R7QA 4ZXBA 5JOPD 1KT2B 4JUTA 2FWOB 2P5PA 4F15B 1JPTH 2G2RA 3QJRB 3WKPA 1U58B 2Y7QB 2D0GA 1RL1A 4JFED 1KJ2H 4KY2A 3J07A 2R8SH 4XBPA 1NJ9A 4DF9A 1R34A 4PLJC 4NKDB 4JFZL 5IP4A 4JAMA 2JCCF 5C8JB 4IBUA 4WW1A 3CHSA 1X5MA 3O2VH 4XC1H 1A1OB 2DIBA 4F5CE 1GZPB 4OIAA 3VFUB 1IC5L 1T7WA 3D51A 3G5YA 1WCBB 3M86A 2Y1YA 3ALPA 4UM9D 2Y6SC 1AKJB 3IFNH 5TF1L 1P69B 5DDHA 5D1XC 4QXUL 1Y0LA 2BFGA 1NCBL 1GGIL 4QTHB 1KGYE 3FHQA 1RZJL 2R83A 1ZA6A 2IGFL 2JCCB 1AXTH 1MF2H 1OF0A 3CZNA 5IHBA 5JUEL 2AJZB 2XICA 3V8CA 3BUQA 3HFMH 3MV7D 4RIRB 1FYHB 3AXIA 3SGKC 2MNWA 2BOCB 2YSTA 4KKQA 1LQBC 1ZGLB 1NLDL 4M1DH 5LGHL 1KBGH 4WI0A 1FJ1B 3IMBA 3O45A 1F2QA 4J6RH 2X2YA 4FC3E 2BCKA 3PP3H 5AYUL 3BIKB 4O2EA 3IVKB 5I1KL 3MXVL 3D33A 4K5LA 4J8QA 1L9MA 5D96B 2X4UA 2DEWX 2FATH 2Z35A 3BE1H 4Z7UF 2F18A 1AGBB 4YHPA 4I3RL 2DYPD 1TQCB 4TNEA 5DT1H 1T1WB 3FUMA 2HFFB 3MN8A 3TN0D 2K3HA 1OE3A 4H88H 1AACA 2WXHA 4OIFA 4TL5A 3VFMA 1AZCA 5EF3A 4XP1H 5ESVB 4OCWL 1OALA 4CN1A 4PD4K 4DN3L 2EE9A 2ORBH 4ES8A 4LLDA 4MD5B 4R7NB 4RWHA 4Z7UB 5HVFB 3RNQA 2WSDA 4E9TA 1J1XL 5HHVH 3RUGE 4YDLB 2R1WA 2Z7UA 4QHUA 3MV11 5FF6A 3MUZ1 4RRPM 4FLSA 2WNWA 5C0DB 2GSGA 3WLBB 4R84A 4G9FA 3HN8A 5T1KD 3QXTA 1W6WA 5HVGB 4PB0H 3KYMA 1WHPA 3US1A 3NOIA 1AXIB 3HG3A 4ZBJA 4Y1SA 2JJTA 2DIJA 1XD0A 1IM3D 5T8IA 5D6DA 3KR3L 3ABKB 1CL7I 3QEUB 4YZFE 2CLVA 3DJ9A 3LKNB 2QPFA 2FK9A 3H9SD 1WD9A 2P8MB 3HZVB 5KBMA 1NPJA 1MFMA 4MX7A 1MJJB 2FIKA 1ID2A 2ITEA 5KVGE 3DMMA 25C8H 3K1KC 4M6NH 4XPTH 3HHRB 3UZQB 4XCEA 3UX9B 2YR3A 5HYSG 2ZXQA 4PP2A 2EDMA 2N59A 4F7TB 4HKZB 4AEFA 3QIBD 1EPFA 5HHOE 3VI4F 1FH5H 3DPBB 3PHQA 1VHPA 3MRJA 3Q6FB 5LWYH 5EEYA 2O72A 3FJTA 2WLMA 4L1LA 3I6SA 1HXMA 1RIUH 2I32A 1C5BH 3EDJA 4PJHA 1P4LB 5CBEB 4FFTA 5G5DA 5IF0A 1L3WA 1OSPH 3A0OA 1I3RB 1RU9H 1INDH 3ABMB 3D09A 3LDBB 4FNTA 5CZVL 1MCWM 3HRZA 4M3KB 3VI4B 5DYFA 1AIFB 3TXAA 1G9MH 2EXTA 2XZZA 3HE7C 3NCFB 2VJXA 3TBVA 1CGSH 3PHOB 4AQ8A 4EE2A 3WMPA 4Y9BA 5F93C 5CP3H 3MCLH 3UDWA 2Q7YA 1E4JA 1U3NA 2XTJB 4HWBA 2GJ6E 5D70H 1HOCA 1IGCL 3HE6B 1BVNT 4KKBD 1G6RL 1JSYA 4PCKA 8CGTA 1JPSH 5KVEE 1Q0XH 3QXWA 1B0RB 1IEAA 1KGXA 3V5KA 3SKOB 1A0QL 5FYJE 4P5SA 2F61A 1F11B 2X1XR 1MHCA 4JRYE 4PUBL 5TPWL 4ANUA 3KH4A 5AVSB 1THCA 4TSCL 5A1AA 4J8RB 4M8RA 3ARDC 3OKLB 3HLAB 4LCIL 3V0WH 3DTXB 2CDEA 4PRIE 2QJDA 2AEWA 4G72B 4LEOA 3FAWA 5D6CB 5MEPB 5ICZB 4JGNA 1YSOA 3C12A 4RWYH 4DO6A 2LABA 4Q0XH 5DJCA 3P4OA 2O93L 5BZXA 5DQ9B 1L6PA 3U6XA 4I3SL 3F8UB 3SE8L 5FS5A 1NAMB 4GYBA 3V79C 4KUCF 5HYJB 2ZPKH 3EBAA 3E1F1 1FL6A 1NCAH 1UVQA 2A6DA 3A6OA 5DI8B 1GMEA 5F0LB 4U49A 3OPZH 3QEGL 1CVSC 3HI6L 1UXWB 2P43B 2PW2A 1TJGH 4LU5H 1FL5A 1N68A 5ACLA 2WMPB 3PWPE 3FUKA 4WSJA 4J1UA 3L2NA 5DFTA 2XN9D 3MX0A 5F6IB 2MOQA 4FFVD 1P1VA 3JZ7A 1NFAA 1H3TA 1KC5H 1PD0A 5K9JL 3E2HC 4X98B 2A74C 2HRHA 2BRRL 4HCFA 4Z3FA 2OX5A 2R0KL 4U1GB 4IIZA 1BMZA 4NIYE 3OLDA 5E0FA 5EORH 2QTEA 3C75A 4XNBA 1OCWH 4IM8A 3UYPB 4H1LG 1I7ZB 1B0WA 2OMBA 3BSZH 4LNRA 5J3HD 3GMOA 4OJEH 2WZPD 5DD0H 4Z3IA 3DJSA 1BBDL 3IAPA 4PMFA 3U0WL 1CDUA 5EU7E 3U0PB 1S9WB 4RMQA 5K5YA 2N0KA 1LL1A 1QVOA 2W60B 1RUQH 3GDBA 1S7TA 1KTJA 4X7DC 2FT8A 2H3NB 3HPJA 4TVPH 4ZNCD 1RJCA 3VB9A 1TZAA 1DN0A 4WDIB 4NEHB 3OHXB 4H5SB 2A0LD 2PXYB 2GBAA 3CVCA 4MQXC 2DJMA 1QR1A 2ZWZA 1H9DA 3CLFL 1X7SA 4TUJB 1CGUA 7CGTA 4N8VA 4QXWA 4F80A 2CR0A 1BQLL 1I1YB 5EEXA 1AOHA 4OZHF 1HCZA 4PYGA 1UHVA 1RZKL 2VXQA 5EBGA 2YN5A 5ES4B 3GZQA 3MRDA 4MNGE 5GIRB 1OB0A 4M1GL 1UB6A 5CLXA 1U21A 3VSUA 1GPOH 1PZ5A 4MQ7B 5J6GB 3VM7A 1AGCB 1CGTA 4YDIL 5ANHA 2C8NA 3WE6B 4AIZA 1X44A 4P4KC 4XMTA 2IFGA 2F7OA 5EUOF 3PWUA 5BUGA 5BV7L 1G1KA 1RUML 3VFNA 2QQKH 4OR1A 2EO7A 4OZHB 5KSAB<