3F85A

Structure of fusion complex of homo trimeric major pilin subunits cfab of cfa/i fimbirae from etec e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
456
structure length
456
Chain Sequence
b'MIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homo trimeric fusion of CFA/I fimbrial subunits B
publication title Structure of CFA/I fimbriae from enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 70
structure length 456
sequence length 456
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A03
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A02
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A01
4Y2NA 4HJIA 2HB0A 3F85A 4Y2LA 3F84A 3VACA 3F83A 4Y2OB
chains in the Genus database with same CATH superfamily
1LP9A 1TJXA 3K80A 3T2LA 1MFBH 1N0LA 5BO1H 1JRHH 3N5AA 3HBGA 3MLUH 1LP9B 1YEGH 4LPTA 5C1MB 1N0LB 4CC4A 2NR6C 4L4TD 3ATAA 2V7HA 3ESVF 3AS2A 3HI1A 5D1QE 1IGIH 3QS3A 2X4QA 4K7PH 5LB1A 3OF6D 5FHBH 2V7HB 4K2UL 3HI1B 3NRFA 1A7PL 2X4QB 3R8QA 4QHUA 1G0XA 4OGYL 2BDNH 3CVHB 5CJQL 3APFA 3FU5A 4P48A 4PJDE 5FPIA 4ZTOH 4QHUB 4DKDC 1EIBA 1XF3A 1VFOA 3MUJA 1SHWA 2Z4QA 2ZX7A 3GO1H 5JW4Q 1O75A 1XF3B 2FEEL 3DHMA 4A04A 3L4XA 1NMAL 1OAJA 4Y7OC 5I26A 1XCTA 2Z4QB 4Z7UF 1VERA 1N70A 4HJJL 4YN3A 4K3EL 1TDQA 3O0RH 1XCTB 4G6KH 5IMOB 4FXKC 3WE6A 2W88A 2YN5A 3DYMA 4G6JH 2BERA 2M2DA 4B53A 3WE6B 4C56E 3U4KA 4MD0A 1BMGA 2YQGA 3DHJA 1YEIL 4PJXE 5T5NF 5L6YH 4DFIA 3GI8L 1E5ZA 1LO0H 3TTSA 5F88A 2MPAH 4MD0B 5DJ6A 3WFBH 3S8FB 1CE1L 4XNQA 5J56B 3A23A 3O3EA 1ZVSA 5F88B 3R4DA 2D3JA 5EDSA 5DJ6B 4Z8FL 4XNQB 1HINL 4F8NA 3O3EB 1ZVSB 2ENQA 5KVDE 2F53E 2HLFD 4PGEA 2X1WL 4F91B 4Z95L 1ZMYA 1YEKL 1MJ8L 4PGEB 5A7EA 4KAQH 4MA8L 1R46A 1WTGT 4DKFH 1LO2L 2DWDA 1MCQA 1J1XL 5HHXH 4TLSA 4Y4HD 1NEUA 1U3ZA 4NQED 5IP4A 2DWDB 2FTAA 1C9SA 5FYJD 2BWQA 1N64L 1WG3A 3QPXL 2AK1H 4NIYE 2VC2L 2WQUA 3CU1A 3GJFH 1I8KA 4G1MA 3U83A 4X9BA 1HH9A 3OTTA 4QTIL 3TN0A 3LEYH 4G5ZL 2C4XA 4FXLA 4QHNA 1J0JA 1I8KB 2NY3D 2VCOA 4G1MB 1HH9B 2MWCA 5AVUB 3WXWL 2EDTA 3TN0B 3VH8G 3GKWL 2H32H 3UL4A 4QHNB 5AAPA 1YNTA 2CALA 2NX5A 3ZYZA 1VFUA 4JRXD 1F11A 2TSBA 2WXHA 1OB1A 1YNTB 2QSCL 1GCFA 2NX5B 1F11B 3UEQA 2CUHA 4OJYA 1OB1B 3ZL4H 1DSFH 4XCCL 3SDAC 5T8IA 2X3BA 3ZE1F 2WXRA 4JDVA 1JXKA 4ZDHA 1A6VL 5A2BA 1GIGH 3BPOC 4LMQE 1MCKA 2NY4B 2B14A 1ESOA 1GC1C 4JDVB 4XPBH 5DUMH 4ZDHB 3VXSA 3FAWA 4YDKH 4RDBA 3VGBA 3VXSB 1CT8A 1LJMA 4NRYA 4U7KA 1WUNT 4A7GA 4RA0C 4FKHA 4LNVA 1CT8B 2ZWNA 4NRYB 3NG5A 2FWOA 5D2NA 2WJ5A 5JR1L 1XGYH 4B50A 1H19A 2ZUSA 2OK0H 6TAAA 4UMGA 4TNWK 2D7TH 2XTSA 3F2LA 2FWOB 4LSTH 5D2NB 5GS1A 4IGBC 1MWOA 4NN6B 1J9QA 2CQVA 3L4UA 4P23D 3T0EC 1B4LA 5GS1B 3E7JA 4I0PD 1WSST 1IEBA 1D2PA 4KXBA 4H2CA 1RKRA 3LNHA 4JO1L 1HHIA 1WHOA 4TNVF 4DEUA 1IEBB 1D7FA 4JBSA 1SJVA 3V0GA 1HHIB 1HX0A 1SY6L 4HZ1A 5BPPA 2APBA 3N50A 5I1KH 1NANH 1KY6A 3TH4T 4HBCH 1D5IH 1CICD 3K8MA 3MLRH 1VB9A 3LVEA 1CWVA 1Q4NX 5MI0B 1NWPA 2H6OA 3QUHA 4LLUB 2VLME 3L1FA 5EC1A 1VA9A 2NCMA 1KJ2H 2QADC 1B0RA 3QDJA 4Y19E 3Q44A 3V0VA 1WWAX 4PJ9C 5EC1B 4KFMA 1B0RB 4CGTA 3QDJB 2H7WA 4LE8A 4N25A 5I71C 3V0VB 2CR0A 3L1OH 1X9UA 4F24A 5F9WB 4KHXL 2WXMA 1WZAA 4HLZG 4U0RB 3TGXA 1KGXA 2QELA 4P9MH 2DL2A 2OULB 2VR4A 3FFCD 4LRNH 4M1GH 3CLEH 3TYFA 1A64A 1RUQL 4PM1A 3L8QA 3VTAA 2AI0L 3TYFB 3CIQA 3VI4A 4JLRA 5CCGE 3UXFA 2AQRA 5HD8C 1NEPA 2EDNA 4AIZA 5TFSL 3VI4B 2HT3D 4JLRB 4L8BA 4GKOA 4Y5YA 4B9FA 1Q0XH 4GUPA 4YS4A 2EDXA 5SWSA 4BFEA 5KTEL 3MLVL 4Y2LA 4AIZB 3ALXA 2WXJA 4K5PA 1MFVA 4L8BB 4Y5YB 4XE5B 4GUPB 2DN7A 2GQHA 5KAQF 1JYWA 4LQFL 5SWSB 3GRWL 1ZK5A 2ERJC 3SOBH 3ZE2E 4H25A 4JG0L 5JIMA 3OLEA 4QJ4B 2R0KL 3GXIA 2OCJA 2F54A 4H25B 4XOEA 3UO1H 4HSCX 2ADFH 3G6JA 4CN4A 4ZW3A 3QG6A 5AZUA 1DQDH 1NCTA 1SBSL 1YO4A 2AV7A 2F54B 2GI7A 2YBGA 4JY4A 2ZKYA 5FM4A 2XN0A 3G6JB 3NCYP 1QR1A 2W81C 1NZRA 3CFTA 1FGVL 3QG6B 4TL5A 2NR6A 2AV7B 3CHOA 4Y4KD 4JY4B 2NZ9C 4G8GA 4F7CA 5KVDL 5IB5A 1QR1B 1HL8A 3C5ZC 4FTDA 1E42A 1S9WA 5CP3A 5A2CA 4G8GB 4F7CB 5IB5B 5L9DH 3LQAC 1JNLH 1I1YA 2F6AA 3WTTA 4JPVL 3MLYH 1BQKA 4N20A 4U33A 1S9WB 4A2FA 4JFZL 3W2DL 3GUTA 4K3DH 4NUJA 1I1YB 5TPWL 4OCXH 4YHLL 4J4PC 3WIHA 5MP6H 5GRUL 4UANA 3MOBH 1BECA 3GUTB 2Y25A 3FQRA 4NUJB 1QRNA 4F9LC 4N2MA 3GIZL 5GGQH 4YSEA 2VSKB 3FQRB 4FQ1L 3NIFE 1QRNB 1FH5H 3NJIA 1P7QA 2GJZA 3KLHC 1QKZH 3DX3A 2XN2A 3P02A 1I75A 2JB6A 4OZHA 2BVUA 3U6XS 1P7QB 1ZVNA 2GJZB 5F1IA 3VFRA 4AG4L 3TBCA 4JM0A 3OKEA 3Q13A 2W38A 1BVNP 2Q7YA 4FXKA 4OZHB 2EIDA 2CRYA 4HC1L 5F1IB 3WI9A 2ZJSL 3VFRB 3W82A 5DFVD 2VDPL 3OKEB 2Q7YB 3WEBA 3P3UA 4FXKB 1F13A 3IMVA 1U8KA 3C9NA 1KJ3L 3L2NA 4GUOA 4PRID 1V3LA 4HGMA 4TNGA 1U8KB 2BZDA 3WNJA 3C9NB 3H3PH 1WEJH 1T2QL 1QBMH 1XGTA 1PYWA 4L0YA 1QHQA 3U30C 2FNBA 1E28A 2I25N 2VYRE 2DRUA 2B59A 1OPGL 4FFVD 1XGTB 1Q8MA 1PYWB 1U8PA 1VIWA 2ZF8A 5F9OL 2BVPA 1E28B 2BSED 2B59B 2KHAA 1T1ZB 4MJIA 1U8PB 2XA8H 3ZX1A 3KS0J 2BVPB 2C9XA 1GS8A 2VDLB 3Q0HA 4S10A 3VRLF 3TS8A 4MJIB 4XWGH 3GMOA 1KV7A 3GSRA 4IRJA 1AE6H 1CE6A 1A6WL 3BESR 1MCRA 3VFMA 1F1DA 3GMOB 4M93C 1NGPH 3WMPA 2IMNA 3GSRB 4IRJB 4QRAA 3BPLB 1XTMA 4N6QA 3VFMB 1YEFL 4KRPD 1DVUA 2OL3H 3FT1A 3RJOA 3T6WA 4GG6E 5ISZA 2DMKA 5IHWA 1WIOA 5ETUA 3HI5H 5HDWA 1YAZA 4GP5B 4AEIH 4M1DH 5FYKE 2WWNA 2E5EA 5ISZB 3QA3A 5ETUB 3N42F 2AQQA 1G9NL 1HXMA 2EEFA 5E8OA 3QA3B 3RDTC 1WCQA 2C4FT 4FQ2H 1JGLH 3IMRA 3TL5A 3A6OA 3NGBB 4Z7WE 1FYTE 1FLRL 1K4CA 1HXMB 1QSFE 1P7BA 5E8OB 2HWZL 4LSRH 1R5WA 3LS4H 1OTSC 1ETA1 1K4CB 1GL4B 2ZQKA 5FO8A 3KJ6H 1QNZH 2X05A 1MRFL 1R5WB 4A7UA 1DHKA 3SDAA 3N55A 2P3YA 1M3IA 3A4AA 5FO8B 2EADA 3OHMB 4P8QA 3ZOAA 3K7UA 3GNMH 4TL4A 5EFIA 5TE6H 3SDAB 4PJ7F 3VQ1C 3CC5A 2G3XA 4JDTH 4NWTH 1WBXA 4S1SL 3BVWA 5EFIB 5T1LD 4HWBH 1A2YA 1L6ZA 3BPOB 4JJHA 3A21A 3CC5B 4XVJH 5F7LB 4S1QH 1WBXB 2GCYA 4NBXB 1OSPL 1QW9A 5DC0A 1A2YB 3PGCA 4FOMA 2Z65C 3Q8AA 4WWOA 1E7VA 4J3OD 5L88H 2AK4A 3CZGA 2GCYB 2WBKA 2GKIA 3PGCB 5LCVA 3GXMA 1ODUA 2AK4B 2LLGA 1TFPA 2I60L 2DTSA 4IGBA 3O6LH 3D30A 3T0DA 2LABA 3T0EA 3BKML 2X6AA 4FQIL 4A2EA 3HZ3A 3GMRA 3OZ9H 4IGBB 3HJ0A 4KROD 5CGTA 4UINH 3BH8A 3T0EB 2GBAA 2RR3A 3GMRB 2PP7A 1MIEH 3BH8B 3WMQA 1IGCH 1X4YA 8CGTA 4LSVL 1ZT7A 3D3VD 5BNXD 4U6TA 3RX9A 2R23A 2D0HA 4HIXH 3OHXC 3EUUA 3SDDC 1SVZA 1ZT7B 4LLVA 1UZ6F 2QQNH 3NCCB 2AJUH 2R23B 3AWGA 4XXDA 4O2CA 5D7JC 4XPGL 4H4NA 5JMRA 4LLVB 2E59A 3FQYA 2QVIA 4MLSA 2R1YA 4UT7L 1HC1A 4P5SA 4ODSL 4O2CB 4XXDB 4MQXC 3VFUA 4PJ9A 2QADB 6FABL 4XXCC 2MJWA 2R1YB 4IW4C 2Z7ZA 3H85A 4GW1A 1F3JA 5F93C 1UATA 3VFUB 5LN8A 4PJ9B 5K1JA 3TBSA 3K91A 5K59F 1KCRL 4GW1B 4K3GA 4E9QA 1F3JB 2H0FA 3ZT5A 5I71B 4KUZL 4RFNC 5AAMC 3VYOA 4AMKL 4JFOA 3TBSB 3LIZH 4P5KA 4Z7OB 5D7SL 4JFOB 1A7BA 1JZFA 4Z7VF 1HSBA 4P5KB 4PBWD 4ZZFA 3UIYA 4MB5A 1VRSA 2XXGA 2P5PA 5DJZA 1B2YA 1HSBB 1PY4A 4MKTA 2F74A 5H4ZA 5D1QD 5DSCA 2E7MA 5DJZB 3SEPA 3UPAA 2W8CA 3UYPA 2F74B 2X89D 5T3XE 5DSCB 3CHPA 1GOGA 3O11A 4X42A 1REIA 5D7IE 3BKYL 3UYPB 1WUZA 4KKBC 1ODAA 2DEYX 4WWNA 3RL1A 4K7PY 3O11B 3GS4A 4NNYA 3D05A 2J1ZA 5EU6A 2Y1YA 2EDFA 2ERJB 4WU5A 4XAKE 4QXWA 1NBQA 3RL1B 2Q2EB 3DYPA 4NNYB 2OCCB 4Z3TA 5J3HD 1XT5A 5EU6B 4WU5B 1QVOA 3EDEA 2TRYA 2XQ0A 5F70A 3SD2A 2H6PA 3VXME 2C4FU 1QVOB 3VXTA 1AMXA 25C8H 4QXVA 4KOCA 1BAFL 3FJTA 2NSMA 2H6PB 5EBWA 2HT4C 4RCAA 3VXTB 2CK0L 5PCYA 2EDLA 4GKLA 5EBWB 2UVEA 2CLRA 1G4RA 5AG8A 4YIQA 4WNSA 3U7WH 3ZIYA 4DZ8A 2CLRB 1MKFA 4J4PA 4KU1A 1G94A 4C56D 9CGTA 2EACA 4AM0A 3GXPA 4BM7A 4DZ8B 4F9LA 1XEDA 3Q2LA 4LSPH 4MQTB 4MA7H 4AM0B 2MFNA 2ITCA 5AOZA 2WLNA 3CPUA 3ZKSD 1GYUA 1TZ8A 1Y6NR 2ITCB 4UNUA 1AO7A 1I3UA 2JI3A 1XH2A 1DBBH 4YBLC 2F53D 1MCFA 2DJUA 3ZZ1A 1AO7B 3ULUC 1PLCA 5IV2A 1KULA 5E94A 4O9HL 3TONA 1V7ML 1N12A 1KF9B 2C9AA 5IV2B 1MCPL 2V9QA 5E94B 5GS2D 4BZ2L 4UOJA 2GJ6A 2O5XL 4B9PA 1ZCRA 3VG0L 4W9ZA 4AVIA 3RVWC 5BZWA 1CD1A 1SOSA 3OG6B 3FYEB 4HU8A 1HZHH 2GJ6B 5C3TA 2WZPA 4DPRA 3A24A 5DS1A 1DSYA 1A7RL 5BZWB 1CD1B 2Y6SD 2O61A 3MRJA 1CDJA 3LQMA 5KUMA 3U30B 2O61B 5C0BE 1V3KA 3MRJB 1A7PH 1O7SA 1SJHA 3PL6D 1T5XA 1KLGA 4OGYH 4Y89A 1INDH 2CLZA 1IKFL 1SJHB 4ACPA 3NP3A 1BIIA 2I85A 1M6OA 1T5XB 3JV4A 1KLGB 3RBSA 3PE9A 2GB2A 3CZSA 4M6NH 5HYJE 2CLZB 3RKDD 2E74C 2YXWA 3C87A 2FQFA 3O2VH 2DQEH 4YHKH 3ZQ9A 1BIIB 4N0UE 1M6OB 2OR7A 3JV4B 3MA9L 4NC1E 3CAFA 1ZLSL 5M95B 1NMAH 4UNTA 4R4FL 4NKQB 4M93B 4NCC1 2DZEA 3SGDI 4K3EH 3I9PA 5EBGA 4HQQH 3IMBA 3MCLL 3QAQA 3NRPA 2IF7A 4G8FA 5C0AA 3ZYOA 3PS6A 1GGCL 4GAGH 1YJDH 2IAAC 4CAGA 4FZEL 4G8FB 3HZKA 3RDTA 3BDYL 4N2HA 4Z3IA 5C0AB 4G11A 1ACYL 3LB6D 3RDTB 3HZKB 1TJMA 4O02A 2VLJD 3QDGA 3WGVB 5JHMA 1JZ6A 1Q0YH 2J8OA 2EAEA 2ZXWB 5FUCE 4O02B 3QDGB 4M29A 3EUDA 1CE1H 5KW9L 1FDLL 1NINA 4OCWL 3FTZA 3RURA 2PO6D 2PWEA 3OZLA 3MUZ1 4UV7H 2YJQA 4YQXH 4GQ9H 5E23A 3TA3A 4LT7A 1CN4A 2CHNA 1XB8A 1J1XH 4KK5D 3TA3B 4AVHA 5JW3L 3FU0A 4H40A 5CZVH 2V2XA 1CXEA 4KK6D 1TJGH 3KPRA 1HYRC 1J1OH 2DIEA 1QEXA 5ICZA 1EJOL 2ZX6A 3HZMA 2VLMD 2V2XB 1HCYA 2YD5A 4TN9A 5E7BA 3KPRB 5T5FL 1IQDA 5DO8A 5ICZB 1OAKH 1Z9OA 2F0CA 1K3ZA 2VC2H 4P59L 4Y19D 3HZMB 3K0YA 4FG2A 3KCWA 1IQDB 4QTIH 4ORZC 1E90A 4OB5H 1MFUA 2HVJA 3CQQA 4ZAKD 2YUZA 1M4KA 1OP9A 3S4SA 5I0VA 3GKWH 4KJWD 2HVJB 2BX5A 4GRMA 5CINL 3S4SB 1OW0C 3BRFA 1FWXA 3F7VA 2QSCH 3OHXA 1OB0A 1HHHA 4GRMB 5IJBC 3P9MA 3F7VB 3EBAA 3PWNA 4XCCH 3OHXB 5D7JA 1EVTC 3X3FL 5I0WA 2A6IA 1HHHB 1UWGL 3P9MB 4UAOB 4PJFA 5D7JB 1A6VH 1QFWI 3PWNB 5AOMA 1XF5A 3AG2B 3FUNA 4AM0Q 2A6IB 1AJ7L 1YPZF 4HEME 4XXCA 1E6JH 4PJFB 1TPXC 3RIFK 1MHEA 3VFTA 4YBQC 1XF5B 5F6HI 3ZTEA 4ABWA 1ZHKA 2OTUA 3O45A 1AANA 3J07A 1MHEB 1DZBA 2EC9U 3NZHL 2FL5A 2H1PL 3VFTB 5KBKA 1ZHKB 2DQDL 2E7DA 2OTUB 1OEZW 5AAMA 5I5MA 3O45B 5IEKA 4OJDH 1OARL 4TKWA 1YECH 1XB6A 2FL5B 4RFNB 3RVTD 5IEKB 1UCTA 4ZW5A 3WLWD 3QW9A 1BJ1H 3C08H 3IS1X 3PAVA 4OIIL 3GBLA 1T5WA 2WJ7A 2ZXEB 3IFPA 4N24A 3B9AA 2QKIC 3E9TA 4DH2A 4J6IA 1T5WB 2FO1A 3FO9A 1XF4A 3IFPB 3HAEG 3FO9B 3T77A 1ZDQA 1XF4B 5F9AC 1MFEH 1SY6H 2G3MA 2AQNA 2WTOA 4XC1L 4WCYH 5IMKA 3T77B 1X5ZA 3AABA 2ZXAA 4EZMA 5IMKB 1IAIH 1UGKA 1WRFA 5D1ZC 3TVMD 4NM8H 4XO3A 1G7MA 1MNNA 5I5JA 4QJ3B 3E2HC 5DJYA 3T6ZA 3GKZA 1BFOA 4KKLD 1KCUL 1G7MB 4HK3J 5DJYB 3CXHK 1FVEA 1X6NA 3KLAA 1BFOB 4PGBA 1PF3A 2VXTH 3CDGB 3FSZA 4N4YB 3FTGA 1DCLA 1FVEB 4WHDA 2C7FA 3KLAB 4PGBB 3FTGB 1SXAA 5GXBB 1RUQH 3BCDA 4YAQA 1EXUA 1KTCA 5AD0A 1FGNH 3AUWB 3NACH 1S3KH 1EHAA 4IBQA 3L5WA 4PRBA 5HJBA 2AJZA 2FUQA 4YAQB 5AD0B 1EXUB 2GSMB 2YAEA 5BVPL 1SF5A 4K94C 3C5JA 4FHKA 3HE6C 3L5WB 4P2RE 4PRBB 2UWEE 1NC4A 2AJZB 3D8MA 3WSQL 3MOQA 2VZSA 2KUTA 3C5JB 2I5YL 5KTEH 5AZ2L 1NC4B 5C86A 4EI5D 3NJKA 3VYPA 4LQFH 3GRWH 5FCSH 4K55A 2XG5A 4GRWH 3T6QC 3JVFC 4I77L 4DN3H 4N22A 1U4EA 5DD6A 2R0KH 2XG5B 4FG0A 3E9UA 3GXTA 2E86A 4LCWA 3GLZA 1AYOA 5DD6B 2E4TA 2WZAA 2FCBA 4CU7A 1S9YA 3NJNA 4IM8A 1J0HA 3LRHA 3MBXH 1NOLA 4LCWB 4MMZC 4NQXA 3V0IA 4XN4A 5C08A 4KITB 5FFLA 3S88L 2VDNL 4I3SH 1CFTA 5E6RB 1S9YB 3GIVA 4I5BA 5KSBF 4NQXB 5I1IH 1QZ1A 1R34A 3ENEA 5C08B 1CFTB 3GIVB 4I5BB 1P7KA 1KELH 2DBLH 5FYKD 7FABL 3B5HA 1R6VA 1P7KB 4F7TA 5CILH 2BINA 1PY0A 4S2SA 5TPWH 4B0MM 4M6OH 1BBDL 1FYTD 4TM9A 5GRUH 4F7TB 3V6OC 2D9QB 2W59A 4NEHB 1JTPA 2XETA 4RIRA 4RAUA 4GAJH 4S2SB 3GIZH 4F5CA 2VJ8A 4JFWA 5CCHE 1U92A 4RIRB 4RAUB 4RFEA 3LKOA 3MLTA 2UZYA 4YGAB 4B95C 1U8QA 4DO4A 3IDGA 5DT1L 1RZKL 1U92B 4RFEB 4AIOA 2A77H 4PJ7A 2ENJA 3VXQA 4ABUA 3LKOB 3MLTB 2UZYB 1U8QB 3KLLA 3RWGA 3IDGB 1JDDA 3VRIA 4AG4H 3BVUA 4PJ7B 3S36X 3VXQB 3RWGB 1E50A 2J1KA 3VRIB 4ZSOE 4A38A 1OCWH 3FS9A 3KPOA 3VA2C 1DJYA 4NUQA 2BIQA 4P99A 4KMTH 3KPOB 5ILTL 3DO3A 1PAZA 1D7DA 3QQ4A 4F8PA 1T2QH 3VQ2C 4NJ9H 3QDHA 5J12B 4K8RC 4P2QA 3H7BA 4NS0A 3CZKA 2FBOJ 2VLRA 4WUKL 4YXHH 5HHVL 4BWWA 3CLFL 4P2QB 3H7BB 1WA1X 2VLRB 4NO2A 2WP3O 5EN3A 4BDVA 3VW3H 4FMKA 5LKNA 3B7RL 3S97C 3HB3C 4N6RA 2VZTA 4NO2B 4BDVB 3FSVA 4POZC 1UD3A 5DD5H 4P0DA 2XBTA 4N6RB 2GBTA 4MAYC 4N8PA 2ARWA 3QT2A 3WS3A 1N67A 3APNA 3L95A 4HHWA 1MLBA 3UJTH 2YN3A 1FNFA 3WS3B 4AW4A 1OIOA 1WZ1L 3VFPA 2YXFA 3SGEI 4OR1A 2Q8BL 3L95B 3U2IA 3ZTJH 1MLBB 3HMXL 1BAGA 3KM1A 2WLMA 2X28A 3VFPB 4BCZA 1E6OH 2B0SL 4XN5A 4NB7A 5IVXE 4X7CC 2VM4A 5BCAA 2N0MA 5DI8A 4NHUA 4ZNEE 1I8MA 4DUWA 5EIVA 4PFEA 1LE5A 5DI8B 1FLRH 1YDPA 2WXLA 4NHUB 1OW0A 4A55A 4XNAA 3CSPA 4IRSD 2AZUA 3GSVA 1I8MB 2DYPA 3ZRSA 1LE5B 4EVNA 5I2IA 1P84K 4R4BA 3MCYA 1MRFH 3GSVB 3CXDH 4AUJA 2DYPB 3SQOH 4EVNB 5K9KA 4ODUA 3UAEA 4JFHD 5I2IB 2UUDH 3KYNA 4R4BB 1BJ8A 2FHBA 3ABMB 3RAJH 5KJ4A 1TLKA 4JFDE 3KDPB 5K9KB 4ODUB 1XAUA 5CLTA 3KYNB 5T3XD 3GUFA 4K9EH 4S1SH 3P4MA 4L37A 2X44D 3LN4A 1I7TA 3H54A 4EXPX 2KYIA 3P4MB 1OSPH 1DVFC 1G5AA 1TPXB 3MC0A 1T66C 4L37B 1I9IL 1FZKA 3LN4B 1F02I 1I7TB 1M6UA 2N3JA 3OB0H 2QVFB 4XAKD 4WUUD 3NZ8A 1LQBC 4MVBC 1BVLA 1FZKB 5KYXA 1LE9A 2OI9C 4WI3A 1I8AA 4JNXA 3KG5A 1RZPA 3NZ8B 4JN1H 3KWVA 3NA4A 4KO5A 1BVNT 1BVLB 1CS6A 2I60H 5KYXB 2EYRA 1LE9B 3VXMD 2D03L 1BLIA 1NMCB 4FQIH 3PP3K 2EYRB 2C9RA 2QKIA 2G5UA 4HPHA 4ETQA 5CCJA 3N9GH 1D7BA 2HRHA 2PCXA 2IBGA 2QKIB 2VERN 4O58L 4U1JA 1OALA 4ETQB 4ETYA 2BS8A 4U1JB 2VDQB 3HIZA 2BP8A 1G6RL 2AJVH 1IC4L 5LGHH 1PLGH 4S0HA 1ED3A 2BY1A 2BP8B 3HE7D 2F15A 3ARGC 1TEYA 1X5FA 4CGUB 5C0EA 5D1ZA 1LEIA 4XPGH 1H3VA 2Z0BA 4FXGC 4CVZA 1ED3B 3N43F 4ENED 4FNLH 4ODSH 4PJAE 5C0EB 1SYVA 3K1DA 1LEIB 5D1ZB 3LH2H 4YDZA 2CRZA 3SYQA 4CVZB 1BX2B 3ISYA 2FR4A 2BVEA 1YUHA 3FUJA 3E2HB 2VZ3A 1SYVB 1U93A 2BNQE 5F8RC 2FR4B 4P4RA 2W60A 1YUHB 1KCRH 3UERA 1U93B 2EZ0C 1BYOA 4KUZH 4AMKH 3BX7C 1WBZA 3BUDA 4P4RB 2W60B 4BQ6A 5LDSA 1CFBA 3MJ7A 4GG6F 1D7CA 2G3NA 1G1OA 1WBZB 3BLBA 1CXKA 5F9DC 4YNYA 1T20A 4PLJC 3MJ7B 4MXWL 4TQEH 3VGAB 5IM7A 4HGWA 3HE6A 4JREC 4YNYB 1T20B 2ZCKL 5IM7B 4HGWB 5D6DC 3HE6B 4QTHA 3FT2A 1BMWA 1G84A 5C0BD 4CJ0A 2EXYD 3F7PC 1NAKL 4P3CL 4U6HA 2HX9A 5E6YA 4OLYH 4QTHB 3FT2B 2J56A 1CQYA 3FCUB 2FZ3A 3IM1A 3BQUC 1DLFH 4U6HB 2A6DA 5HYJD 3VWJC 3SBPA 4AC4A 2BHFA 2FZ3B 1Z0MA 2OMXA 4JKPH 1IU1A 3A4EA 4YC2C 4LLMA 2A6DB 1JPSH 2WZ5A 4NFCA 3ZTJG 1FRGH 4MMZA 4QYAA 1ZVYA 1B88A 5LBGA 2OMXB 4ZT1A 3T04D 3P77A 1WISA 1XF2A 4NOFA 4LLMB 3EFOA 4MMZB 1R3HA 3DPDA 1N18A 5L2KA 2WHVA 4ZRGA 3P77B 1XF2B 5AOIA 4KJPD 1E0OB 2CM6A 2R4RH 4HX1A 5EOCH 3KAAA 2NY6C 1A6AA 1R3HB 2CK0H 1AGBA 2O30A 2XPYA 3MKGA 4EQ3A 4PJBE 5L2KB 1EXHA 3SHSA 1N68A 5AW4B 2WWMD 4HX1B 3VTTA 5TJWK 2VMCA 1A6AB 2XWTA 2YPLA 1AGBB 1F6FB 3DPBA 4PJ8D 4RSVA 4YHOH 1JERA 1T7XA 4IYKA 3HOGA 1BREA 1UEYA 4LSQL 4NUPA 3V6OA 2XWTB 2YPLB 1TKWA 1XEUA 3DPBB 3VXUD 1MJ7L 1TMQA 2QVTA 4UT6H 3SKUD 3PWLA 4X4XA 3VMPA 1TKWB 2ZUTA 1GAFL 1M7DA 5CIPH 1D3CA 3IMWA 4LHUA 4ZMXA 1CZ8H 1RPQA 1RJLA 3PWLB 4X4XB 2H3NA 2OA9A 4XNYL 1TJHL 1BGXL 1M7DB 4ANKA 1XGPA 4C83A 4LHUB 3RIFF 3MYJA 3QWNA 2QFPA 1RJLB 2VXQH 1HYSD 2H3NB 2XA3A 1A65A 2ZKXA 5TF0A 4F1SA 1XGPB 4U6YA 4C83B 3VQMA 3MYJB 1SDAB 3SSGA 3QEUA 4O9HH 1V7MH 2Y06L 1MELA 4U6YB 4GIAA 4XB7A 2FLMA 1W8NA 5CJ8A 2BNRE 2BVQA 3QEUB 4JM2F 4BZ2H 2VLKA 3QEGL 4JPKL 3AQYA 2BVQB 4I13B 1IFHH 2VLKB 3X1BA 5IBTH 4MHHG 1A7RH 5KAQG 4G7QB 4FQJH 1QOKA 2VR5A 4WF7A 1A4BA 1PS3A 1U42A 3FB6A 5E70A 2JE8A 2WAHA 1A8JH 4NQQA 4Y8DC 1S78D 1S7TB 3HB3B 1X7QA 3FB6B 4X9FA 4HW6A 3ILQD 4MAYA 4NP9A 1JWUA 4Y5XC 3VMOA 1GYVA 2DF3A 3FONA 4G71B 1F18A 1X7QB 4ZO8A 5A6MA 4N0RA 4MAYB 1JWUB 3B2XA 1ZLSH 5JA8B 3FONB 4R4FH 2K8QA 1OP5H 1JZEA 2WOBA 3AXLA 1D5ZA 5DD0H 5E03A 3W0WA 4RFOL 3EJPA 1P69B 3D39E 4HALA 2D73A 3AXLB 1D5ZB 3W0WB 1EV2E 2VL4A 3TH3T 3MNDA 5IBLC 2V5YA 1EGJA 3WFHA 5CLWA 3OAZK 1CTNA 3ZHKA 3MRDA 4R7XA 3BDYH 3D50A 4XHQA 3TU6A 4GPVA 3WAKA 4JHVA 5I8CA 1WLHA 3WFHB 4H8WH 1ACYH 1HHJA 2IDUA 3CMGA 3MRDB 2Y23A 4BK5C 5I8CB 1L7TH 2Y1AA 3CMOH 4Z3EA 2FWUA 2XWBA 4LEBA 2GY5A 3CK0L 3UDWC 3KHQA 4CNIA 4D0BA 4YX2L 4PGCA 4J8RA 2XWBB 4HUWA 3RTQD 5I1HL 2L7EA 2ZOUA 4CNIB 4D0BB 3PNWA 2VNCA 1QWNA 4J8RB 4PGCB 4HUWB 2VDOH 1MRCL 1KT2A 3C2AL 2TAAA 3IAQA 1UWEH 2PPEA 3PNWB 3QWRD 1AXSA 2WKGA 2K45A 3K8KA 2YK1H 4GBXC 1DVFA 1E4XI 4U49A 2BS9A 5ESVA 3JWOH 3TJEL 1KT2B 2GJRA 4KTEL 1AXSB 2PWDA 5E8NA 3KYKL 4LSUH 2H8PA 5ESVB 1DVFB 5J11B 4ZYKA 1RZFL 4LK4A 5K39A 1MFMA 5E8NB 1EJOH 2FGZA 1S9KC 2H8PB 1P84J 5DJ0A 4ZYKB 5FKAA 4L29A 3T6XA 3IDYC 5K39B 2OI9B 3EH5B 4P59H 2FGWH 1NM4A 3FO1A 3HG1A 1Z3GL 4Q52A 5DJ0B 5FKAB 5INCA 1RZ7L 1EK3A 1F41A 3BEVA 3F7YA 4EXKA 4KGLA 1KCLA 1LD9A 2K0RA 3FO1B 3HG1B 4E41A 5D2LE 5INCB 1JPTL 2AC0A 3D09A 3BEVB 3F7YB 4NUMA 1LD9B 1OO2A 3PV7A 5IQ9A 4R96A 3RA7L 3UTTA 4E41B 4EDXA 2Y3AA 1O7VA 1V8HA 2Y5EA 3UTTB 5IQ9B 4R96B 3C60C 4EDXB 3EYVA 3X13A 1UM6H 2QTEA 4FQQA 5I0XA 3GM8A 3UABA 4XMTA 3ARGA 1LO3L 3EYVB 3X13B 4P2RD 1I8LC 1NCWL 1SLVA 4FQQB 4FXGA 3ARBD 3S98A 4DP1X 1ACZA 3ARGB 2DICA 4GRWE 1RUMH 4PRHA 3TX4A 1QFWL 3U1SL 4FXGB 2YD8A 2VXSH 1XIWD 1BM3L 3QR1A 4PRHB 4G9FD 4JFFE 4Y2DC 4XI5D 2FX8L 2DQDH 4EKXA 4H88H 4XMXA 5HGBA 2GJJA 1JD7A 3NCXA 3QRGH 4QD2E 4OJFH 4XNUL 5E95B 5EH1A 5HGBB 1FPTL 1IEHA 2XXFA 3CFCL 3JWDH 3N44F 1U2CA 1ZV9A 3TLRA 5KSBA 1KCSL 5HYEA 5ACLA 5DYOA 3VXRE 3L13A 5KSBB 2V8MA 1T0PB 5D6DA 4JREB 2C3GA 2G4GA 4UT9A 1OP3H 1EO7A 4WSGA 3DSNA 5DYOB 1A8ZA 4AV0A 4JANA 4CW1A 2AEIT 4GMTL 3X1EA 5BQ7A 4F20A 3OMAB 3S96A 3DSNB 3JQOB 4JANB 4CW1B 4JK0D 2ITDA 1NAMA 3BQUA 1SQMA 3WEAA 5BQ7B 4KPHL 3VWJA 2IAMC 3K81A 4YZFF 3S96B 1C7SA 1GC1L 1MREL 2ITDB 1NAMB 1I1RA 2CDGA 3BQUB 1ASQA 4YLBA 1IZJA 2HTLD 4E9SA 2JIXD 2ZYIA 3GLDA 3VWJB 2X09A 2CDGB 2FUTA 4YC2B 5K9JL 2YFNA 1TLMA 1JHLL 4G3YH 5HYFA 4KZEL 2R2HA 4M43H 5DFWH 2WVSA 5LCVL 5AW6B 1DLHA 3ETBJ 2R2HB 1KEGL 1CFNA 1UXWA 3P69A 3MJGX 2NY6B 1DLHB 4JPWH 3RUGF 2GHZA 1CFNB 5I1AA 2VSCA 1UXWB 1IL1A 2VGLM 4HZAA 4JX0A 4JM2C 3ZE1E 4DGIH 3L4CA 4M8QA 3IAPA 4OF7A 5CU9A 1T80A 4HUXA 4UB0L 3ZUNC 5I1AB 5GGTL 5GJSL 1IL1B 3BKCL 2Z3FA 4LSSL 4XPHL 4DOHB 1PGRB 2ZT9C 1X9QA 4M8QB 4NX0A 3NBNA 4HUXB 4PMFA 5BVPH 3NH7L 1F58H 2FQGA 5DJXA 4YWGH 4ATWA 5AZ2H 1J8SA 5D4HA 2PW1A 1MHHA 4IKKA 5DJXB 1OXYA 5AYUL 5B1KA 5D1ZI 3V0FA 1AHMA 2YIHA 1J9CT 4UBDC 2PW1B 1MHHB 4KJQC 4I77H 4NBZB 4XN7A 1PG7H 3FQUA 4OCYL 1NCIA 4CILA 4YDLC 2YAMA 3OR6A 4NZFA 1AS6A 3FQUB 5DMJB 4HJUA 3OR6B 4LU5H 5H37A 3GK8H 5F7YC 1VPOL 2B8OT 4Z7NF 2BW5A 3BUTA 3E3QC 3BSZL 5JQHC 1JCVA 3L7EA 3QUZC 4RLDA 3K2UH 3EOTL 4PJHA 5GGVH 3C6LC 3ZE0F 2V33A 3EBGA 1I9JH 2PR4H 3OKLA 3L7EB 3N04A 4PJHB 3II3A 2VM9A 1RURL 4U7SA 4D9RE 4AYID 3HUJA 3IGLA 2C3XA 4W81A 1A7NL 3SGKC 3OKLB 4XMVA 5TK4A 3L16A 1TQWA 4LVNC 3G5WA 4FQHA 4MXQD 3S36L 1BBJA 3O6FD 3HUJB 1BBDH 2NQ3A 1GHFL 5E9AA 3GI9H 4Q8BA 2VOTA 2VXUH 4RMBA 2ILLA 3QIWD 4N2EA 4FQHB 4Y5XA 3N85L 5KSUA 1BBJB 2J7LA 3ZKND 1O9VA 5AQ0A 2X2JA 2XWJA 3INOA 5KSUB 3ARUA 4Y5XB 1WD8A 4XHJC 4ZODA 2XWJB 4MAUL 3MNZA 5DT1H 3A4FA 2H26A 1RZKH 3ZDZB 4JRLA 5I76A 4PJ5E 1TYJA 4JFDD 3JSSA 2R29L 1AR1C 1DBJL 1OTUD 3MNZB 2H26B 5I76B 3D4CA 5CJ5A 1MCEA 1DFBL 1KTBA 4FNRA 4QRUA 2XPGA 1KN2L 5I1CH 4ONGL 1E2ZA 2D4DA 4QRUB 2FBJH 2XPGB 3QO0B 4BGDA 1DQJA 4HPYH 5ID1A 2LTQC 4KXCA 4BK5A 4FMFA 5IHZA 2APFA 3GXNA 3IN0A 3WO3B 3TCTA 1DQJB 5ID1B 1QBLH 4JPIA 4ZFOA 3V6FA 5I23A 3UDWA 5IHZB 1DP0A 1Z32X 2PN5A 5C6TL 2ZG2A 4JPIB 5HHVH 4ZFOB 3V6FB 3CLFH 4FTVA 4ZFQA 4MMYA 3C12A 1CGWA 1RCYA 4B9YA 3HMWH 2RFXA 3C09C 4FTVB 1H5BC 4MMYB 1ILSA 1URLA 2CR6A 3EJZD 2KT6A 4GBXA 1WH0A 2RFXB 2K6YA 3RZCA 4PW3A 2X4UA 1WFUA 4GBXB 5ABAA 3SY0A 1AGFA 4G6FD 2DAVA 5A3ID 3B7SA 2CBQA 3C6EA 4X7DC 1RJCA 5EWIH 1CI5A 3RZCB 1MG3C 2X4UB 4IOFD 3WN6A 3SY0B 3UX9B 1AGFB 4N86A 2WZ6A 4MSWA 2IV9A 4WHYG 3NIGF 2B0SH 2XZZA 3ML9A 4MSWB 1UUSA 3D0VA 4W4NA 2WQXA 3MJWA 3U46A 2BNQD 3LOWA 1JZ7A 2KS0A 4LQ1A 4YHYB 2GT9A 3D0VB 3U46B 5PAZA 3V95A 2AEPH 2BS71 2GT9B 2FX9H 2X70A 3P2BA 4DSYA 4NNPH 4ZQTA 3C60A 4ZD3H 4W9FC 3Q8CA 4XCFH 3CVHH 5HYSA 2R1XA 3QJUB 2X70B 2DQCL 3T8XA 1WFMA 4TVPH 2R27A 3C60B 5KYWA 4X8XA 4ANWA 3U4EA 2JELL 5HYSB 1I8LA 2R1XB 5HI4D 3T8XB 4KVCH 2HTKC 1MFCL 1MW3A 2AERT 4N5ED 4UZUA 5KBPA 1P6FA 2N59A 3P3TA 3U4EB 5HHPA 5KYWB 4JUSA 2K78A 4K23L 5DUPL 5I75C 4ODTL 5HHPB 4E5XG 4Y2DA 4P46C 3CSFA 3SBRA 3A0OA 4MZ2A 4GSQA 4UTAL 3QYMA 4Y2DB 1NIBA 2XV2A 1Y0LA 5HI5D 5FB8A 1J9RA 4B3VA 5I1JL 1R9FA 3B5TA 1XBDA 2QVMA 1U3JA 5C0IA 2EUZA 1Y0LB 5BZZA 1P6WA 2ARJA 3OKMA 1BW8A 1HOEA 3LZLA 4WFFE 4E9XA 2VMFA 1WT5C 4J3TA 5C0IB 1EERB 5HGHA 3DX7A 1CLOL 2ARJB 3OKMB 4CUCA 1JSYA 4CRPA 4ECNA 4O02L 2ZCLL 4JO8A 4ZOCA 5KYUA 3BE1H 4PJ6A 5HGHB 4A7TA 3DX7B 3EDKA 5JIIA 3F58H 2X1OA 2VWEC 2UVFA 3APMA 3UADA 5KYUB 4RBPK 4EI6A 3F6JA 4JZJC 1USQA 2WQSA 5DGRA 4B9IA 3M7FB 3WXVH 4JFXA 1QEWA 4EI6B 3K72A 2IAMA 1IC4H 5BZXA 1PNDA 1TQVA 2X2HA 2ZUQC 1J1PL 5JZ7D 4NPKA 4JFXB 1QEWB 3K72B 2IAMB 3KYAA 3WDIA 2R4SH 1B9KA 2LAGB 3MV8A 5C09E 2W9LA 1FL3A 2QQKL 2V2TA 5I19L 3MV8B 3TEWA 4FQPA 1FL3B 4ANVA 4KQ4H 1QNIA 1CYWA 2V2TB 5CZKA 2IXQA 4MQ7A 5DMGD 2NLJA 2WNKA 3U4BH 4JM2A 2BNRD 4ZTEA 5KSAD 2IXQB 4MQ7B 2QHLA 2APXA 2NLJB 2YGPA 4JM2B 4XPFH 4HWUA 3H55A 4PGDA 2A9CA 3BVXA 1H8OA 2OSXA 3KE0A 1K5WA 1PPIA 1SOXA 2Z93A 1NEZG 4PGDB 2EDWA 3LTVA 4G9DA 4LCCC 2CO2A 1LWHA 4AZUA 3FQNA 2Z93B 1JMZA 2PTUA 3DHPA 4QT5A 3RYMA 5JPMC 4G9DB 2QPUA 1UACL 5EHFA 1PMYA 3FQNB 4QT5B 5JHLL 2F1BA 4OLZL 4KC3B 3LXBA 4QTFA 5IQNA 2GIXA 4URTB 3S5YA 4FN0A 2CGRL 1U8HA 4AEEA 5LXVA 4NQDA 3TEYA 4N2LA 4YDLB 2B16A 4FXTA 3AROA 2V9UA 1LLAA 1YRKA 2WNXA 1O5PA 3ABKB 3GBDA 2E8YA 3QUZA 1KCBA 4NKIH 3C6LA 3CJJA 2A4CA 3V4UL 3D39D 1FF5A 4JR9H 4BK8A 5JTWA 2G2NA 4X6DA 3QUZB 1X6LA 5B1JC 3C6LB 2HKAA 4X9YA 1MAML 3EOBA 1S3RA 4X6DB 5EU7C 1J8HE 3QNFA 3FKUS 1EJ8A 1W9XA 1MCOL 3ZZQA 3EOBB 4H20L 3KBHE 3OPUA 3IE9A 5LVEA 4LVNB 2VR9A 5D7LE 1PJWA 1KYOK 2HG5A 4J3WA 4XBEH 4QYOA 15C8L 2DJMA 5FGSA 2HG5B 4FQCH 2OMUA 2J20A 5SV4A 1BGXH 3QDME 4JGMA 3CBRA 3SPVA 4LLYA 2OMUB 3DOHA 4ALAH 1SVBA 4M7LH 3EO9L 2B4CL 2FT6A 4AYSA 1LO4H 1E3ZA 4LLYB 4MB1A 3F85A 3SPVB 1AR1B 3CFMA 5D7EA 3PHAA 3ZKMD 5TDPA 2HLFC 4KO9A 4OLUH 1CGXA 3L3OC 3O6ML 1A3LL 4HFWA 1DL7H 2A73A 4OVUA 1RIHL 1Z6JT 5TDPB 2TRHA 5F0MB 4HFWB 1VLXA 1XL4A 2A73B 4M56A 1QWUA 3ISWA 1ASPA 2LTQB 1W8EA 3OJVC 4UQ3A 4KKPA 4Y4HC 5CWSA 1AKJD 4UI2A 2DQMA 3JV6A 2R2EA 3G5YA 1SHXA 4UQ3B 3TJHD 1N3NA 3FQ2A 3HNVL 5CWSB 1PVHA 4N9OB 2RCSL 3JV6B 2R2EB 2R39A 3O4LE 3G5YB 1ZLUH 5AB0A 1N3NB 2ARJQ 3ISRA 1SMOA 1LK3H 1H5BA 2HJKA 1MCNA 4QXUL 4PJGA 3LH8A 3ZPDA 3C09B 2NY3C 1H5BB 2HJKB 5EMYA 3P4LA 4PJGB 2XHNA 1AZVA 2G0LA 1PD6A 3AY4C 1WHPA 2WY3B 3ATBA 3ULUL 5DZPA 3MGAA 3SKOA 5E4OA 1IT9H 4Q56A 2N1TE 3H9YA 2BRRH 4A68A 3HG4A 3DI3B 1KPUA 1GJUA 2DLFH 4HH8A 3SKOB 3GQFA 5FUOH 1NFDF 3OAUL 1KPUB 1X7SA 4PS4H 4JFFD 3OGCA 3FT0A 4W9CC 1T0MA 2EXTA 1J5IA 2Y07H 1OGSA 4XE0A 5KYYA 3D85A 2K7QA 1NBYA 3MXWH 3OGCB 2OR9L 1T0MB 1MW0A 4GMSL 5KYYB 3D85B 1JAEA 5CP3H 3S2AA 3R19A 1NBYB 4FABL 3ROLA 4HMDA 1NTDA 4TPRL 2COVD 2MOGA 1OT1A 4KNQA 3ROLB 4KZDL 2J88L 3N44B 2P8MA 4YX2H 3H42L 1PKQA 3OJDA 3WIHH 3WV0A 1SFDA 5DQDH 4GIOA 5SV3A 3VXRD 1JFQL 3BEWA 5HDLA 2P8MB 1AVAA 1PKQB 3OJDB 3DNKA 4JFTA 3VTMA 3UJJL 5BRZE 5ADPH 3BEWB 3C2AH 3WCYA 3VM5A 2NSQA 4I0PC 2DI8A 1BEXA 5EBLA 5I75B 1E4XL 1E2VA 2OYMA 4TULH 3DX9A 1G9MH 4P46B 4D7PA 4DVRL 4MX7A 4PJIA 3DETD 5EBLB 1NJ9A 4N5UA 3IB4A 2L3BA 5D4JA 4OV5A 3I74A 1QSEA 3DX9B 3CN2A 3ARSA 4IS6A 4MX7B 4PJIB 1NJ9B 3WNMA 1KBGL 4H26A 4OV5B 1CICC 1OHZA 3QJZA 1QSEB 4IS6B 1WT5A 2JMRA 1UOVA 5I82A 4H26B 2CHDA 2RAMA 5I5IA 1O5DT 1S9XB 5ALBL 1JPTH 1I31A 4F8QA 1SN0A 2XBZA 4M62H 3FSWA 3HG2A 1FQ9C 1CLZL 4JZJA 4ODXA 1E27A 1VEPA 3RFRA 1HWWA 3VJ6A 4QAMB 5IHUL 3L48A 2XT1B 4OZGA 2VDLH 4ODXB 4JZJB 5JMOC 4MBRA 1E27B 1MFAL 2FHCA 2IGTA 4QRPA 3VJ6B 5D96C 4OZGB 2ZUQB 3H6JA 1E8WA 3F5WA 4QRPB 3S34L 4N0YH 4GSRA 3QXDA 5JHDA 2BNUA 4QHKJ 4TSBH 3U1SH 1GJIA 4XNZC 3F5WB 1H8SA 5E0QA 3A47A 3NSYA 3QXDB 5JHDB 2BNUB 2HT3C 4M7JL 12E8H 1ZV5A 2HKHL 1I1FB 1WFJA 3EDFA 5DRZA 3UG5A 4BXVA 2WC7A 5B7EA 1JGDA 3KEHA 4OAWA 1FV1A 3PXHA 5BV7C 5DRZB 1KYAA 5FK9A 1RP8A 1I1AD 1FPTH 2ZCHH 1JGDB 1QYGL 3HA0A 2FD6L 2Q7NA 1FV1B 4L1SA 4OAWB 1ULVA 2OX5A 4NXSA 3WIIH 2LFEA 3L1GA 5FK9B 1KCSH 1OCRB 1RUKH 3MODL 4RVBA 4KX7A 5CD5D 4GB9A 1F2QA 2OX5B 5EEVA 4YZWA 5CXPA 3V8OA 1EDHA 2WXFA 4LCCA 3ZE0B 1P53A 4L4TA 3F62A 5CR1A 1CTMA 3FSAA 1A4CA 4J3VA 4QO1A 4XMKH 4Y4KC 4WFGE 4ZS7L 4D9RD 3MCG1 5JPMA 4GMTH 3Q43A 4LCCB 5GGVY 2D7NA 4ODWA 5J57B 1KACB 4L4TB 3ZDWA 3FUKA 2WO3B 3OF6A 4QO1B 1IILE 5JPMB 4QCIA 5EF0A 1XR9A 5K69A 4ODWB 2CNZA 2XN9E 1NCHA 3ULVF 1MREH 3TZVD 4QCIB 1XR9B 1UEMA 4PJDF 2UXVA 1PD1A 3APCA 2CMRL 3IWUA 3KL5A 3L9RA 2CKBA 4N1EA 4FJ6A 4HJ1A 4LOFA 4PJ5D 3EJCA 1IE5A 1SMAA 1RU9L 1JVLA 3L9RB 2CKBB 4NZRL 3SE9H 5L2JA 4OM0H 4FQXC 2K6ZA 2BSRA 2ALAA 3ASOB 5B1JA 2X53A 1KEGH 1HJCA 5L2JB 2BSRB 4OD2A 3POCA 4IDLA 4XX5A 2JKTM 1SM3L 4OD2B 2E27L 4UB0H 5DFVC 1T03L 2KDGA 2WBWB 4BJLA 3BH9A 5IB1A 3KGUA 3H4FA 5I9QC 1R0AH 4PJXF 3BH9B 4C4KO 5IB1B 5FYLH 5J89A 1O6TA 1DE4A 1HQRA 1FFPA 3MCKA 5ICXA 4YHIA 3UMNA 1A1OA 4FFVC 2H9GA 1DE4B 1HQRB 1FFPB 4X7SH 1FVDA 3MCKB 5ICXB 4YHIB 3LXUX 5B38A 1A1OB 1M42A 2H9GB 2V5SA 4BCXA 5C3LD 3AT8A 1FVDB 3QDAA 4LGRB 3UGUA 4OLVH 5B38B 3GDCA 3L3OB 4WWID 1VPOH 3X1NA 4Y4HA 4UILH 1H6EA 4NQEA 5AW3B 3T2OA 3EOTH 2BSSA 2PLTA 4Y4HB 3IDUA 4NQEB 2YQ3A 4JJ5A 4KRPC 3FB7A 4CDHA 2BSSB 3TXAA 1GR7A 1RURH 1JXGA 1AY1L 2PP9A 5FA4A 2YMXH 4JJ5B 5HGDA 3FB7B 2Q76A 2LQRA 3U9PL 4YLQT 1SJEA 5GGRY 1TNMA 1IBYA 3NA9L 5FA4B 5HGDB 2VW4A 2Q76B 1SJEB 1DVYA 2Z8RA 3N85H 4LARL 5LWYL 3S6CA 4G7SB 2NY3B 3AY4A 4JRXA 3O6KH 1CFMA 4MA3A 1EBPA 1G7HA 1DUZA 1LTXA 2NCEA 5B39G 5GS0H 1I8IA 4JRXB 1F00I 3T3MF 1D6VL 4Q9QL 4MA3B 3VRJA 1ASOA 3QXAA 4HOMA 3SBWC 1G7HB 1DUZB 1MRDL 1DBJH 3B3BA 5JHBA 1I8IB 5CJBA 2WQRA 4MS6A 3VRJB 3QXAB 1TTFA 4XPAL 3CZNA 1FP5A 1KN2H 2EDYA 2FH6A 3EYFA 1E67A 4X6BA 3V4VL 1CBVL 1HNFA 2R69A 2JQZA 4P4KD 4JZOA 4PVBA 3TBYA 2NQDA 2YA1A 3GHEH 3M6DA 4X6BB 3EYFB 4FGMA 1FE8L 2R0LL 1D5MA 4JZOB 3LQAH 3TBYB 3CV5A 5TE7H 4J3OC 5DXWA 4L05A 4AH2A 2EJ1A 1D5MB 1DDTA 2D7MA 3I2CH 4WFFD 2R1WA 4I88A 2XX1A 2V4LA 4AH2B 2H3KA 1ZLVK 2R1WB 3ZJAA 4MRCA 1QTYT 2RJMA 4PJCA 2DPKA 3IVKA 4FP8L 1ZV2A 4P23A 5IHHA 2ZKMX 1IGFL 2XXCB 3IVKB 4PJCB 5LAPA 4KROC 4EN3D 3D1MC 4I0PA 4KUCF 1H3PL 4P23B 4PV1C 2F5AL 1PY9A 4NIKB 1NPNA 4CN6A 4I0PB 3ZXAC 3BAEL 3PF2A 1EEYA 3D9AL 3L4VA 4U4BA 2D3LA 4KTGA 2EUXA 3NCBB 5CUSL 1EEYB 3SGEH 1CICA 1E40A 4D3CL 4FA8A 3SKJL 1JZ5A 4R0LC 3E8VA 1ES0A 1CICB 4YVUA 4PB9L 5E6UB 5EDXA 4IK6A 4IRZA 1BCIA 5T3ZL 1ES0B 5I8KL 1KN4H 2XJLA 4N85A 3WY1A 3JTBA 5FDWA 5LBSA 5TK2A 1W72A 1X5MA 4YSUA 3HN5A 4R2GD 3S35H 5E5UB 5FDWB 1W72B 1FORL 3WFCL 3CBKB 5FO7A 2Q2LA 2M26A 3FH8A 1YY9D 2DQCH 3FW6A 3FFCA 4M00A 4HMEA 4QPEA 5F0JB 5FO7B 1G0DA 2XY2A 5DZAA 3FFCB 2A38A 4Q97A 4HEPA 1IGML 2DOCA 4S1RH 1BMZA 4GT0A 4ZUUA 3LN5A 4B3EA 3EYSH 3GT6A 4K23H 5D1QC 3HBZA 2DQ6A 2HZHA 4ODTH 1DANT 5JIQA 4XNZB 1CLVA 1HNYA 3LN5B 3AWFA 4ZUUB 1GW6A 2W9EH 1W8OA 2IFFH 1G5GA 2OMVA 3VD5A 3S3DB 4F8LA 4NC2B 4OBSA 3ZE2F 5GISL 1TIUA 2NTFA 1TETL 4LL4A 2WNGA 1ADQA 2EINB 2OMVB 1EGJL 5MEQA 5GIRA 1CURA 3UG3A 5BV7B 1TO5A 2NTFB 2LE9A 1SEBA 4ZMYA 5J3HC 3BKJL 1NUGA 2WO2B 5MEQB 5GIRB 1CLOH 3RX8A 4FFZL 3HG3A 1Z9PA 3NIDE 1SEBB 1CTOA 3KWTA 4Y4KA 3QK0A 1EDQA 3S2CA 1QRKA 4U2ZA 4ADJA 2C8NA 1LVEA 1J8HD 4Y4FD 1C16A 4Y4KB 2QEJA 2X3CA 3EAKA 2YC1A 4IK7A 2YOAA 1C16B 1IFRA 2HJFA 4AQOA 2KH2B 4AYBA 1X5JA 5D7LD 4OQTA 2DDQH 1J1PH 2YC1B 4K5LA 1OM3L 1KOAA 3QUMA 2HJFB 1HXYA 1SEQL 2QDVA 3QG7L 2Z0UA 2XWDA 4L3FA 3QUMB 2XZCL 3QDMD 1HXYB 4KH2A 1MI5D 2JJWA 3BVTA 1OANA 3DC0A 3NIFF 4FNUA 2P44B 3QQDA 5DHXB 4YOKA 5BOPA 5ES4B 5C0RH 3N06B 1LWRA 1GZPA 1XSKA 3O9WD 3QQDB 5F89A 3T3PF 2WNWA 3FQ4A 1G6VK 1GZPB 2X38A 4WI5A 3T8VA 4DW2H 1QG3A 1WBYA 3IKCA 2E47A 3QR0A 5F89B 4KRNA 2B2XL 3K2IA 3S8GB 3LKQA 4XMPH 1DJWA 1WBYB 3IKCB 4HK0A 5H2BA 3WY3A 2L0DA 5GRWA 3VUAA 3QZWA 4FKKA 4M6MH 2EDEA 4UQEA 3LKQB 2FX7H 4JY5L 4PRIA 2A3TA 4JQIA 5FLVA 4HK0B 2B1HH 2J25A 3HNTL 5H2BB 3S3SA 2FAUA 3P40A 3QZWB 2WLYA 4QHLA 5I9QB 2XLLA 3O4LD 4PRIB 1HEJC 2AXWA 3GRBA 2Y6SC 5D1XE 3WJMA 1MWAA 1QACA 4AJVA 4EBQL 2F8OA 1UACH 4QHLB 5E2VH 1U8MB 2QHRL 3LXAA 1MWAB 2BSEA 3WJMB 4F57H 3R0NA 4OLZH 4BH8A 1MXGA 3PL6C 3MLZL 4NFDA 3RY4A 3UAAA 4BZ1L 2CGRH 4NYLA 4P3DA 4JPQA 1MQKL 4BH8B 4EIBA 3SE8L 4RWYH 1HCZA 4UM8A 4NYLB 4P3DB 3RKDC 3C2SA 4UQIM 3LEVH 3U0PA 3UZEC 3BVDB 4R6UA 2WKOF 1BZ8A 3RNKA 1WK0A 4UM8B 2QMKA 4PVNA 5E8DL 3V4UH 1OWRM 1CDCA 4J5VA 3U0PB 1A14L 3BZEA 2X6MA 4JB9L 4OM1H 2FK9A 3RNKB 1Z9MA 5LNGA 1MAMH 3E8UH 2NPLX 4KO6A 4N87A 3QH3A 3QFJE 4NLAA 3DJZA 3FO0H 1OAUL 3SJVE 3BZEB 4M61A 5CBAA 4KRPB 5ABDE 4AMXA 3WN5C 4L1TA 2P5EE 3QH3B 2ORBL 2DIJA 3EH1A 4KQ3H 4H20H 4M61B 5CBAB 3WNKA 4OD3L 3OMIB 2ZE0A 1H8LA 3R1GL 3WAJA 5D4IA 3V4PA 4Z7WF 4Q9RH 2O93L 3LB6C 2G75A 3CX5J 3PAUA 4JVUA 4XVUD 5JOFA 4DERA 3RNQA 1GY1A 3NJMA 1NAML 1UH3A 2XPZA 3OSVA 3V4PB 1QSZA 1ZGLA 2G75B 5BS0E 2ZAHA 3SBWA 5JOFB 3RNQB 5EA0L 4JGUA 4X50A 3O8XD 2PWHA 3MLSL 4KK8C 2J4WL 4K7FA 5E2WH 1ZGLB 3PHQA 5BRZD 5C6PB 1T7VA 1R33A 2J6EL 2PO6C 3GSWA 4ONFL 4W9HC 3V7MA 1CG9A 3V8CA 4BUQA 1MW2A 4K7FB 1TO4A 1TZGL 3PHQB 3WFEL 1A4JA 3GSWB 2FATL 5T1LA 4ZUSA 1CG9B 4AJYV 3QZOA 1DQMH 1ETZA 1VGEH 4TVUA 1ECYA 1M1SA 1A4JB 1G9NC 5T1LB 4ZUSB 3N1PC 5C7XH 1OAQH 4UZGA 2AABH 1A7OL 1ETZB 3OMZA 1SHSA 4KK6C 1V55B 3FL7A 4JFEE 4N2IA 4PGZA 1D5RA 3GC3A 3FXIC 4UF7C 3ARED 4TF4A 3VSVA 3P11L 3FH5A 3NFPA 4FL4C 4XNDA 3BP6A 2LHAA 4MNQE 2OJZH 4GJTB 4DP7X 3NFPB 2Y36L 5DRXA 3BP6B 3T0WA 1OSZA 1A7QL 4HF5L 4F37K 5DRXB 4Y1TA 4ZAKC 4KROB 5AWNL 2IDFA 3FULA 2PWFA 4KJWC 1NCOA 1OSZB 2QPFA 1I1CA 3FO2B 1UHVA 2VABA 1FAIL 3OZKA 3TCXA 1NCDL 3D3VA 5DEJA 3ULUH 2ZWYA 1CDBA 3D48R 5DK2A 2EDQA 2OP4H 2VABB 5K9QI 1Y6MR 3D3VB 5DK2B 2ZSWA 1QSVA 4R0LA 3RX5A 1LL1A 1SUJA 1AHKA 5ISZE 1JGUH 1CD8A 2IPTH 2ZSWB 2G60L 4R0LB 4ZFGL 2CJUL 5F7NC 2GK0A 1A3RH 1PZAA 3FMGL 4W6WB 5HYIA 5KUKA 2D0GA 5DVKA 1KG0A 3FRPA 2GK0B 4OZIA 4GMSH 2PPFA 4WWKD 2COQA 5I74C 4NJAL 4HIPA 3DX0A 1L9QA 1C12A 1KG0B 3FRPB 4TPRH 4OZIB 1DBAH 3EFFA 3QEQE 5DJCA 4D9LH 4YDIH 4KZDH 3H53A 1C12B 2J88H 3RVTC 5AB2A 1RMFH 3H42H 3EFFB 5DJCB 4YXKL 3WTSA 4KKRA 3WLWC 4NM4H 3WTWA 2XOTA 4WFGD 3UJJH 5D1QA 1NWOA 2XI9A 3O3DB 3NK4A 3NEXA 5T3ZD 1KC5L 1CL7H 1UGNA 2X89A 4A7QA 4XVSL 5D1QB 3RI5F 4HSQA 4DVRH 2R0WL 2X9YA 2VSMB 3CHQA 4EIUA 2XN9D 3IPEA 8PAZA 3U4AA 1QTPA 1BXUA 1TMCB 4PJDA 2YS4A 4FERA 1WAEA 2XDHA 4DPAX 5A7BA 5HVHC 4L9LC 1KBPA 5KEZA 3ZSTA 4X9IA 1XGZA 4OKDA 4PJDB 2YMOA 4X5RA 2PNDA 3ML8A 3MMEA 3BAJA 1NPUA 4OI7A 3TVMC 4BEIA 4PB0H 1II4E 5KANI 2N4IA 1R19A 4HUMB 2MQ0A 2W9DH 2BP3A 4ZFOL 2DY2A 1YMME 4FEMA 2G5RA 3W81A 1OAXH 2A9NL 4DTGL 5GGUA 5IHUH 2P4AB 2MCPL 1GA2A 2BVYA 4LAQL 1ET8A 2WUCL 2EDHA 4N8VG 5FYLE 5GGUB 4C56A 3QCTL 4NKOA 2IOIA 1AKPA 1E5AA 3IBOA 3Q1EA 4PJXA 3RY5A 4C56B 4TTDC 4NKOB 5BUGA 1FLTX 5KVFE 4PJXB 4XBGA 5IESL 3NCJL 3S37H 3B1UA 3GSXA 5KVGH 5E4AA 3PPEA 1MY5A 4PSPA 4XBGB 1U2YA 4LBEA 2QQQA 2A74C 3L9EA 3GSXB 32C2A 4EI5C 2DQJL 2F53A 3PDGA 4HZLA 1N7ML 3L5XL 4LBEB 3TT1L 3KS0H 2FJFA 2EE3A 5LGKA 32C2B 2E4FA 2F53B 4FD0A 4MRBA 4HZLB 4ABQA 3HNSH 2FJFB 3CZUB 1QYGH 4AGNA 4L3EE 1A6ZA 1DJIA 1QFUL 3THML 3FDWA 5I6NA 1TFHA 4AYMC 5AYTA 1YYLH 3VNZA 1A6ZB 1ZK9A 2EVFA 3TV3H 2Z9TA 4J39A 3ULAB 4ZS7H 2VN3A 4KY1L 1W6WA 4PP2A 1F4XL 1Q9WA 3FUIA 2JWYA 5SX5H 4HJGA 4PP2B 3RGHA 1Q9WB 2NNFA 1OCZB 3G6DL 3PJSA 3BN9D 1F90L 3PL6A 4RGNE 1OPOA 1A47A 4HJGB 1BXAA 2J8HA 4QRRD 3QBTB 3PABA 5KWYC 2P52A 3MNWA 1INEL 5BUAA 4L5FL 1JXFA 3A22A 3PJSB 5IB3A 3PL6B 2KZBA 3PPSA 4HG4J 4JGNA 2AJSH 3PABB 1X5AA 2VRQA 3MNWB 5IB3B 3UZEA 4JRYE 1F8TH 4JGJA 1PBYA 4R9HA 2QV4A 5EOQL 3B34A 1J11A 2ENPA 3D4ZA 1FUNA 4JN2A 5TE4L 2LU7A 4AE1A 3K8LA 4Y5VC 3WN5A 1M57B 3HFML 3EH4B 4KJYA 4JN2B 3OG4B 4OTXL 4G82A 1Q72L 3D06A 4QAWA 2FB4L 3WN5B 4KJYB 3LN9A 1L7IL 4JO4L 5D70H 3Q01A 3MQIA 4BFFA 2VDQH 3L3DA 2VLJA 2AP2A 1RSYA 1DEDA 1UWYA 3JWNE 3W57A 4UU9A 1Z2KA 4G43A 1F1AA 3L3DB 4GT7A 2VLJB 3LKPA 2UY6A 1R3JA 1YEJL 4UU9B 4JO3L 3FB8A 4G43B 4FG6D 4R8WL 1N9PA 4FLHA 4R97C 2PO6A 3LKPB 3C5XA 1XD1A 3QJQB 2UY6B 1RJZA 2AEOA 1VFAA 2EKJA 1R3JB 4TUOA 3FB8B 4L4VE 4X9HA 2PO6B 1RJZB 1LDPH 1VFAB 3ET9F 2D2OA 2GIYA 4NOBA 5EPMA 4TUOB 3IRZA 1DJHA 3LPFA 3QXVA 1WJ3A 4EAEA 4Z7IA 2XC8A 3EYUL 2ICWA 4HHAA 5EPMB 1J0KA 3BT0A 3GLEA 5ITBL 1DQTA 5CEZL 5E6SB 2ICWB 4HHAB 2R8SL 4GSDH 3EYQD 2PXYD 2QV2A 1X3DA 4R7NA 1GMIA 5DGQA 4UTCA 3WUZA 4R7NB 4Y19A 5FLUA 1CK0H 4FL4B 5ESAA 2EC8A 4K94H 1VEOA 4C59B 4Y19B 1GJWA 4IEFA 5ESAB 5F96H 4WHCA 4QGYA 4ZAKA 1KB5A 3QHFL 3UAFA 4LARH 4TYUA 4IEFB 3L3HA 1JTOA 3MGOA 4NXKA 3WHE0 4ZAKB 1KB5B 5JIDA 3TEXA 4IRSC 4R90L 2X40A 3L3HB 3A5VA 3MGOB 3RUGE 4CSZA 5HHME 4Q9QH 2WPGA 3CN1A 4Q0XL 3EFDL 4X80L 1MRDH 4Y16D 1JVKA 2X1PA 1AGDA 5ALCL 1U3YA 6PAZA 1PLBA 4KI5E 3EOAA 3OKYA 3QRFM 4JUTA 1AGDB 2V5MA 1CBVH 5C0AE 2V5TA 1UT9A 2EE2A 4TRPH 3EOAB 2YD9A 1OAYL 1MF2L 3KYMA 1ND0B 3Q06A 1IFGA 2X4TA 2CLVA 1ZLWK 4BFOA 1QHPA 1J7VR 1L9SA 4WJ5A 3OQ3B 4R5TA 3ZE2B 1WPCA 2E6PA 2N0KA 3KYMB 2X4TB 2CLVB 5KVFL 4RAVA 4WJ5B 3WTXA 5DLML 3NFSL 3EYOA 4GKZA 1F2XK 3CHSA 4RAVB 2D2CC 1TU2A 4FP8H 4L2YA 4X98A 3EYOB 1YMHA 1IGFH 2DWEA 3CH1A 3B83A 4GKZB 2DQUH 1TU2B 4AY0A 4X98B 2AJYH 1YMHB 2B3IA 3CH1B 2DWEB 2XNAA 3ZIMA 3K1KC 3UG4A 3PP4H 2Y7NA 3BCFA 5IY5B 2XNAB 1G7PA 3UP1A 1X9LA 2C1PA 3E1ZA 4L9LA 5CUSH 1SOKA 1T2XA 1MFNA 1CIDA 2ZOOA 1G7PB 2UZPA 2PW2A 4GXUM 4IJTA 2C1PB 4L8DA 5HVHB 4YHPA 3HE7C 4L9LB 3TVMA 4PLNC 4DHLA 1W15A 2PW2B 4OLWH 4YO0A 4L8DB 4PB9H 1EBAA 4ENEC 4YHPB 1GRWA 3BUYA 5I8KH 2Z34A 2R0ZL 3NIFB 3TVMB 3WUWG 4YO0B 4K8RH 1CFVL 4QXGL 5BMFH 3LS5L 3BUYB 3IEAA 3L1EA 3P9WB 4P5TD 4DP5X 4YSTA 2R7EA 3A6BL 1NSNH 1G0YR 1WP6A 2Y72A 4UQBA 4HKXA 3HJEA 2R7EB 3H6AA 3D08A 2YEZA 2B77A 3QUGA 4V2BA 2W5PA 1ZA3A 2BOCA 4HKXB 1VACA 3IPBA 4G72B 3EZJB 2YEZB 1ZA3B 2BOCB 2CGZA 4UQAA 1VACB 1OZUA 3QZLA 4W6XB 4FS0A 4JKMA 3H3KA 4PJFE 5D1XD 4YFLF 2QSVA 2ENYA 4LHQB 1U6AH 2A74A 3O3UN 2ZNXA 3PRZA 4DEPC 1XXFC 4EI5A 2APSA 3QP3A 2EXYC 1COBA 2EECA 1U95A 2HRPL 1EH9A 2A74B 2Z91A 1S8DA 4EI5B 4QNPE 5MENE 1J86A 1TETH 1U95B 1IMHC 3HG0A 1EGJH 2JKWA 3BP7A 3L2LA 2Z91B 4G5AA 1S8DB 4GY4A 4BKSC 5CP7A 3L5IA 1NKRA 1YC8A 4IBTA 2W07A 3BP7B 4AJWA 1FL6A 1KIUA 1KGUA 4NC1C 5CP7B 3F7QA 5EEYA 3NSXA 5E08H 4ZOEA 1HDMA 2IH1A 2W07B 3UAJD 3MRCA 1K85A 4GG6A 4HH9A 1FL6B 1KIUB 4LP5A 3QFJD 2VJ0A 3SJVD 2AHIA 1JTTA 1HDMB 2IH1B 4KJPC 1VAHA 1MJUH 3MRCB 5B7MA 4HH9B 4GG6B 2P5ED 3IJ9A 4F37F 1TTRA 3V9CA 1S9VA 2V2WA 2WWMC 5GZOD 5KBNC 3NIGE 3ZQWA 5TF1H 2A1WH 2DTMH 4PJ8C 5DR5H 1OM3H 4EJ1C 4KMQA 1S9VB 1MFDL 2V2WB 1E2WA 1FYTA 4XOBA 3OC5A 4FEIA 5FV1L 3M46A 5I15L 3QG7H 1P4BL 1FYTB 3SYAA 2XZCH 3M1CA 4GP8B 3UC0H 2C9PA 1GS6X 4W9LC 5BS0D 2QGCA 3SB3A 1KUMA 3H9HA 4TQPA 2CPCA 2G4EA 1FL5A 5C07E 4CBPA 2UZIL 3X2QB 1EAPA 3H9HB 2AEQL 2E75C 4EQ2A 1JP5A 1FL5B 4U1GC 1HYSC 4Y5VA 1PZSA 2HXAA 4HUNB 1EAPB 5FM5O 4NPJA 1UH4A 1QPPA 4Y5VB 1GGIL 2HUEA 3DXAE 4DGYH 1OQOA 2E8ZA 1FA4A 1NICA 1EEUA 2E7LC 4UV4L 3DX1A 3GPEA 1EAOA 1EO8L 4JFED 1AACA 1RZGA 5SWZE 5C0DA 1TJIL 1HHKA 2AV1A 2HSIA 2O6DA 4PY8I 4OU3A 4JO2L 1JGEA 3HRPA 1A0QH 3QEHA 5F6IC 1RZGB 4L8SC 5C0DB 3IXAA 1HHKB 2AV1B 1YYCA 4MNQD 1NL0L 3UIZA 1JGEB 1CBJA 3QEHB 3LHPH 5GS3A 1UXSA 3HS9A 1RULH 3LZRA 3VGDA 4XVTH 2QHRH 3IXAB 4N8CH 3VH8A 4R97B 1UASA 1UXSB 2BOBA 4RDQF 4YSSA 2YXVA 1AC6A 4ZW6A 4ZW7A 3VH8B 2GTZA 1S78C 3NCEB 1WVZA 4OZFG 4GP4B 5C2UB 2GTZB 1ZA6A 2CO6A 2UXGA 3MACL 3W9EA 2EDKA 2Q0ZX 1TZHA 3DSFL 4Y2NA 2N56A 5E8DH 1ZA6B 3W9EB 1KBBA 2CD0A 1E30A 1TZHB 4AGMA 4K71C 5K1NA 4QHKI 4HXBH 1EZLA 1OAUH 1FVCA 1XWVA 4I4WA 1UM4H 2Q1EA 4APXA 1DTUA 2MMXA 4LEXL 1GYWA 5IVXF 4Q9CA 1BQLL 1FVCB 4I4WB 2Z1KA 3B7UX 2CM5A 3LRLA 4APXB 4I87A 4UT9H 5HHQA 2NT0A 3NQKA 4DKAA 3R1GH 4LESA 4PI2A 3SDXF 3N1FC 3QEQD 4KVNH 5IOPA 4QRSA 5HHQB 4IRSA 2K70A 4F5CE 1TENA 5IOPB 1NAMH 2ZWSA 4IHOA 4QRSB 5L8LB 5C0ND 4GQPH 4IRSB 5CEZD 3PLYA 5EA0H 1HEHC 2VUKA 3MLSH 3HBQA 4IHOB 2J4WH 4AIEA 1E8XA 5T5FA 4XPTL 5ECJE 3RTQC 4EOWH 4XP5L 3O3AA 2V3DA 3GINA 1OTTD 2F68X 3MV9E 2N1KA 1TZGH 3JBG7 1I9RH 1QI5A 5JYMA 4F8TA 3O3AB 2ZYRA 4HXAH 3DV6A 5D7IA 4C55A 3MJ9L 5EORL 1I3GL 4UTBA 3ZMNA 3DV6B 4LMQI 5D7IB 1QBBA 1A6UH 1JDCA 4WUUA 2XTJE 3FUDA 1PCSA 3RFZC 4N1HB 5F6HJ 2CIIA 1NMBH 4WUUB 3SGJC 3UYRL 1TQTA 4P2QE 1KTJA 1BF8A 2NY1D 3VXMA 4IMKC 2CIIB 1DBKL 4H1LG 3BGFC 4K3JL 5DJAA 2Y36H 4F58H 4TNVK 4UUJA 3T2NH 1YMMD 3VXMB 5E24E 5IT2H 5DWUL 1E5BA 2V17H 5B8CC 5DJAB 4GQZA 4UUJB 4LDLB 1B6DA 3F00A 2LVEA 4OSUL 7CGTA 1RK1A 3BJ91 4Q14A 2G9KA 2QZ5A 4OI8A 1FAIH 5FYLD 1WZKA 3FHAA 5I8OL 4FI6A 3TF7C 1WYJA 1RK1B 5BQDA 1S7UA 1CIUA 1S7XA 3EDJA 5KVGE 4X6FA 2OCFD 1T4KA 2UUDK 3INUL 1D9KD 3HE7A 3MROA 1S7UB 1S7XB 4WWPA 3TBTA 2ICWI 4X6FB 1FBIL 1K6QH 2LAAA 3ARBC 1T4KB 3QCVL 3RL2A 5H37H 3HE7B 5A2IH 2ICEC 3HG5A 4NUGL 3MROB 1N0XL 5DD1L 3TBTB 5D72H 5B21A 2AQPA 3RL2B 3WD5L 1XIWC 1BPVA 1QZNA 4O00A 4X8JA 1BDYA 1OE1A 1AFVL 5FYJL 4M9OA 4XI5C 4HLEA 3OB0K 4UIMB 2OMNA 1L9NA 3NMEA 2OW7A 3CNKA 4X8JB 4XP1H 3MRFA 1FCCA 4L3ED 1OSEA 2L7JA 1C08A 3MRFB 2I9TA 2QGDA 4G6AD 4L0ZA 3UTSE 1ORSA 2RQ8A 5HD8D 3QUXD 1C08B 5DHVA 2I9TB 3DROA 2H2PD 4LHJB 1ORSB 2LFGA 1JBJA 2DQGL 4U7MA 3ELQA 2H47C 4K9JA 4TUKL 5DHVB 2O6FA 1G9HA 3DROB 1KC5H 4AC2A 1RVFH 5C0BA 1HKLL 3D25A 1QHOA 4LVOC 4RGND 4B97A 3LIUA 4M7KH 3BHBA 3UPCA 2YXMA 1JI1A 5C0BB 4DEPB 5GS0D 5IMMA 1NC2D 3D25B 4XCNA 1A6PA 3BHBB 1G1CA 4FNSA 5HYJA 5IMMB 5AW7B 4XCNB 4N0UA 4JRYD 5IROD 1A25A 5HYJB 4Z7QE 1T1XA 3L9BA 1B4JH 3V0EA 4N0UB 3IXTA 4FE9A 3LKNA 3C5ZD 1T1XB 4MQSB 2Q8AH 3VCLA 5SWQA 2JKSA 3IXTB 1WIUA 5EEZA 3LKNB 3U9UA 2JCCF 2P5WD 4OF3A 2ODHA 3CE1A 3VCLB 5SWQB 1BEYL 4DTGH 5ADOH 4PJBF 5I17A 3U9UB 2ALWA 4QR7A 3AW5A 1KGJA 1QTSA 3HHMA 2V37A 4PJ8A 1NFDE 2WUCH 3ARFD 4GLRI 2HMID 5AG9A 4GXVH 5I17B 4AT6A 4KZ0A 4HAGA 1FFTB 4PJ8B 5IHLB 3VXUA 1H0DA 3JTSA 1JNJA 4AT6B 3KGRA 3ZL2A 3VXUB 1H0DB 3JTSB 1IVLA 2WXGA 4CC0A 3QIBD 4YGVA 2QTVA 3P0YL 2CAKA 3NN8A 1TSRA 4O5LL 2TSAA 4YGVB 1Q1JL 1XFPA 1U41A 4L4VD 2DQJH 2VXVL 1N7MH 2VDNB 3NN8B 3CFUA 5KVEH 4U1GB 5K33A 1IBBA 3QJVB 4IRZL 4GNKB 3I84A 1SXCA 3NJVA 1CXLA 4XNXL 3V5DA 2E7LA 1Z5LA 4IBWA 5LBSL 2SODB 1JHTA 2XICA 3M7OA 3M88A 3RWCA 3KZ8A 3V5DB 1SJXA 2DIAA 1Z5LB 2FRGP 5JW4M 2CUMA 1JHTB 4LKCA 3VX0A 4X4ME 3RWCB 3IETA 3RIKA 2OYKA 1YNKL 4M5YH 4U3SA 4LKCB 5F6IB 1AQKL 3NFNA 4M3JA 3IETB 3P30H 4PBXA 2XG4A 5CZXD 2G5BA 2XQBH 3U1QA 4HT1H 4HS8H 1WS7A 3G6DH 4U3SB 4A39A 1F90H 2LVCA 3NFNB 4GFTB 4N3TA 2XG4B 2G5BB 2VZVA 2VLLA 3SIKA 4MXQC 4L5FH 3O6FC 1WD9A 5I18L 1E4KC 2WYZA 2FVNA 2VLLB 3QIWC 3M86A 4JS7A 3ZKNC 5IZ7A 4M48H 5HHMD 5F9WC 2PCYA 4DGVL 2MPVA 5DRNA 5H37G 5BV7L 5F7EH 2CXKA 3VMNA 4U1NA 4KI5D 5TE4H 5DRNB 1E65A 1OL0A 4K71B 4HEMA 1OTUC 3PQYE 1ID5I 5GJTL 4OTXH 1KFAL 4U1NB 1HQ4A 5FW8A 1VZHA 4FZ8L 4QF1A 2DQTL 1VFMA 1C1EL 1HQ4B 4HAFA 3HVDA 5HXMA 3IU4L 4QF1B 1ZIAA 3VD0A 1OTSD 4XO4A 5JO5A 2GIMA 2FDBP 1N6QL 2CE6A 3ELAT 3SQBA 2YOCA 2IQ9L 3NSDA 3KJ4B 1SRDA 4IQHA 5JO5B 2ED7A 1UA3A 3VI3B 2EDRA 2GG1A 1YEJH 3SQBB 3V52L 4R4ND 2OAAA 2KDYA 3QUML 4PJEE 3RTQA 1BD2E 5ECGA 2ESVE 5DZLA 2EH7H 3MNVA 4PUBH 1UVQA 1BQUA 3RTQB 3ZTNH 4PN6A 3QWRA 3MNVB 3IAGC 2E7BA 3EJZC 1UVQB 1FAKT 4JM4L 1M2OA 4JJOA 5D4QA 2AGJL 1CGSH 5CCKL 3EYUH 3IJEA 2IDSA 5CFHA 1FG9C 3UTPE 3TIDA 2I07A 5A3IC 2ZONA 3IJEB 1V7NH 3RFZA 2BWDA 4IOFC 1P4IH 4H44C 3SGJA 2I07B 5FXCH 3SYPA 3TIDB 5LXGH 2HRGA 3EW3B 3RFZB 4JVWA 4ICWA 4IMKA 3EH2A 3NOIA 4FI8A 3ULVE 4KKQA 3GHBL 5C2BH 5I28A 3EGDA 5B7FA 3WY2A 3BGFB 4GINA 4JQIL 4IJ3C 1ML0A 5B8CA 4NHCH 5CD3A 4R83A 5D2LF 3EGDB 4MZ3A 4S0TD 5FHAL 2DI7A 3QORD 4WFEE 1E5YA 2YPVA 3V9EA 5B8CB 4DCQA 3TO2A 5CD3B 1MWAL 4LCUA 1JG9A 1E9PA 1Z1WA 5EZOL 5FFOA 1VJSA 3SDDD 4PLOB 4R90H 2BY0A 1JMXA 3TO2B 4DCQB 1NIEA 2GBUA 4LCUB 1E9PB 2VH5H 1EVUA 4G7YL 1ZE3C 4H5SA 1KBKA 4KKAD 3W0WE 4P2RA 2LOEA 2J43A 5HI4C 2UWEA 3ARBA 3D52A 4H5SB 3S5LA 4MQXD 1RUPL 2ICEA 5CU5A 4N5EC 1B0GA 5KYNA 4P2RB 3TT3L 2Y7MA 2UWEB 4GRWF 3ARBB 1UYWL 3S5LB 1XIWA 3DBXA 2ICEB 3WENA 2HH0L 1B0GB 2LW3A 4G9FA 4BQ8A 4A6YL 1XIWB 3DBXB 4HPOH 5MEND 2D8KA 2AXGA 5JXED 3BSGA 4G9FB 2O5YL 5F3BA 1E4WL 1JYNA 5HI5C 3H0TA 2AXGB 2OL3A 1HH6A 2MNUA 2YO3A 4MMXC 3ZO0A 5IQ7H 5CN3A 4LSDA 2ZOTA 1T21A 4X2UA 5DLMH 5F3BB 5LHDA 1G6RA 3H0TB 3PJNA 2KPWA 2X2YA 5IGXL 2OL3B 1HH6B 4UNIA 2NRDA 2XFGB 5DVMA 5J8OA 1T21B 2XVLA 5K5YA 2BY2A 1G6RB 1NH6A 5ID0A 2EDDA 5LLIC 3V4PL 1YJDC 1XX9C 3VB8A 3PWJA 4IRJC 5ID0B 3C5SA 2VDRH 2XZQL 4N2OA 3BPLC 3PWJB 1BF2A 3DTDA 4YHMH 3C5SB 1MCHA 1R5VA 2X6UA 2BPBA 3QZPA 4J3XA 5HDQL 3W5NA 3DMMD 5AVQB 4LVOB 4PY7A 1ITCA 4XRCA 3F7RA 3REVA 1R5VB 3V9FA 4YJZL 1AQ8A 4PY7B 5JZ7C 1M7IA 4HJSA 4OGAC 2JIXA 4XRCB 3REVB 2XV0A 2ZNWA 1CVRA 3BD3A 5I73B 4F7EA 2ZYSA 1O6SA 4Z9KB 1M7IB 2OXHA 4FNTA 5C07D 2J6WA 3NGBC 1E5CA 3LVTA 4JQXA 4OQ1A 1F4YL 4GXFA 2NOYA 4BRVA 4F7EB 1GXEA 1O6SB 2IGFH 2OXHB 3JYBA 4QXGH 4K7PX 4W4OA 5EOTA 3QXTA 4AYEC 1JXJA 3A6BH 3T3ME 1KLUA 1F56A 3UTTE 4ZSOA 5EOTB 2HFFA 2CA3A 3DXAD 2VRKA 4P9HL 2KMWA 5DMGC 3GMMA 4XWOD 3T9WA 4WK0B 4BRJA 1KLUB 5T33H 4ZSOB 5KSAC 2HFFB 4XAWH 3DLQR 3CDFA 3DVGA 4DWHA 1EJFA 1B4RA 3L4TA 3GMMB 5SWZD 5A2KH 2QKSA 2A4ZA 4JO5A 5DVLA 1OGAE 3DVGB 2G9HA 3QARA 5FYJU 4I85A 1E3FA 4P07A 1FZOA 1VADA 3D7PA 4S0SD 2WWKO 4WENB 3BQVA 2G9HB 3S5ZA 4PRHE 1OP3K 1FZOB 3KVQA 5G5DA 3KW8A 4AQEA 3RWDA 3QQ3A 4RZCA 5G5DB 4WTZG 1MDTA 4AQEB 2WLIA 1R47A 4XMLH 3RWDB 4BQ9A 1HXKA 4MJHA 3LMJL 4WEBH 1YYML 3QQ3B 4RZCB 1TNNA 2YJLA 1KB9K 3RP1A 5DS8A 2WLIB 2P45B 2Q3AA 4PRAA 2XYCA 4YDVA 3L3KA 4X7FC 5DS8B 2R2BA 1NCBL 4UYQA 3KBPA 1QUNA 2PKDA 1NIFA 3QJFA 4PRAB 4HAKA 4ODVH 2YD3A 4YDVB 3L3KB 3GEWB 2R2BB 3OB8A 1QUNB 3QJFB 1WWCA 5E5RB 3EJQA 4HWEL 5IVXA 4L2LA 2Y2TA 2Q20A 3STLA 3OWRA 1CI3M 3NJGA 4KOBA 4Y1AE 5IVXB 4ZNEA 1HU8A 2VN6A 3TBVA 2P8PA 1V3JA 3STLB 3O6FA 5ESQA 1ZHLA 1E4KA 4WEUD 2MNWA 4MJ4A 3TNMA 3TBVB 1O