3F85A

Structure of fusion complex of homo trimeric major pilin subunits cfab of cfa/i fimbirae from etec e. coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
456
structure length
456
Chain Sequence
MIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords homo trimeric fusion of CFA/I fimbrial subunits B
publication title Structure of CFA/I fimbriae from enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 456
sequence length 456
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A03
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A02
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3f85A01
3F84A 2HB0A 3VACA 3F85A 4Y2NA 4HJIA 4Y2OB 3F83A 4Y2LA
chains in the Genus database with same CATH superfamily
2DQHH 1N9PA 1QR1B 1MFAL 3FSOA 4UI2A 3RI5K 1SXZA 3EJYC 1DANU 1TSHA 3IMRA 5I0ZA 1FORH 1OP3K 3L3DA 2QZQA 4F15C 4U1JA 1M3IA 2EDOA 1NPJA 1AR1C 2FSEA 1QBAA 3OKDA 3PDDA 1HL9A 1K8DA 2PWGA 4WO0A 1MWAL 2NR6C 3GKZA 3R8BB 3MTRA 2BHYA 3MRJB 5EU6D 4BM7A 4WI7A 4L2YA 5HDBB 1IO4C 4X5QA 3DPDA 3QIBA 3BPOC 4JFHD 1ZGLP 3MJGX 1P6AB 5ID1B 4QRAA 3B9KC 4LLDA 2NNCA 1FFTB 1XGPA 2NTSP 1BP3B 2DIJA 1OP5H 4AYDC 5DD5L 4JPVL 1GOGA 4OFDA 4RFOL 1ZHBA 3FSZA 4NCDA 2YD7A 5LGJB 1NCTA 4FZEL 4XCFH 3SE3A 3VFSB 4OZGF 3GZOA 1G9NH 5I1GL 1FZMA 3KNBB 4JB9L 3MOQA 4HJSA 4OV5A 5C0AD 3HUJB 5HPMA 1X5XA 1TU2A 2RD0A 3TVMD 1T4KA 4OCSL 5GZNA 1OP9A 5IWLA 5D70H 1SLUA 4ZOCA 4UT6L 3KBHE 2EYTA 2BVPB 4JPWL 1ZDSA 4QLRA 3ZDXE 4UQ2A 5B39B 1Z9MA 3OR6A 5CLZA 1WA0X 5KJ4A 1GGUA 2FNBA 4HKJB 3RJOA 1JPST 1PKOA 4FKHA 4U6VH 3VFNB 3LPOA 5I1IH 2FWOB 3P3RA 1DVFC 2GJRA 2ZNXA 3T4YB 1S9KC 2A6KB 2M2DA 3D9AL 3C60A 3DX8A 1TQCC 4UIKL 4KZEL 2X4PB 4M7KH 8PAZA 4LSQL 3OZ9H 2P43B 4JUTA 4NZTH 1W91A 3GLZA 1NCWH 2AQTA 4UOW1 4O9HH 3SBQA 1UD4A 1MVFA 4Z7OE 1ANUA 1MIEH 1PDKA 3LEYL 4XAWL 2CCVA 4J1UB 2I7SA 3CHRA 5D2NC 2ICEC 2JWYA 3UTTB 1GKEA 3MX0A 4KTYA 2Z1KA 1PEZA 5DJ0A 2WXRA 3VWJA 1JRHH 4DKFH 1A4AA 5AB0A 1HL8A 2AKRB 2ZWYA 2E5EA 2LU7A 5ESQB 2ICWA 5EZPA 1J8SA 3NIGB 4PLJC 4RMWA 4AYMC 3QCTL 4HT1H 3IJHB 1Y1DA 1WH0A 2CXKA 1J9QA 4F8PA 1N7MH 1R24A 4X83A 5KVDH 4ELDA 2BSTA 4H8QA 2H8PB 5FW6A 5B7FA 1UXSA 3ARUA 3GSOA 3ZYZA 5IKCB 4A04A 4LCUA 2X5PA 2CRIA 2EIDA 4BK5C 1MJJB 4CILA 2QV4A 1HINH 4NKDB 4YGAB 3WFEH 1RJLB 1TZGL 1Q94B 4O2CA 2AZAA 4R83A 3TCLA 3ZKQD 3H85A 4M7JL 4OVVA 3NZ8A 1MCWW 1XV8A 5FUCE 4P07A 2G5RA 3K0WA 3VI3A 2O5YH 3DJ9A 1O9VA 2A3TA 4R7DB 4RVBA 1LWRA 2Q1EA 3MLWH 1KCWA 1XF2B 3MLTB 1EUUA 2B15A 1FYTB 2ARJB 5EEWA 2P5EA 3LMJL 1VIWA 1P4IH 3EJZD 5HJBA 3PXHA 1D5ZA 4XNAA 3LQMA 4HJ1A 2WBWB 4N0UE 5GS1B 4FEIA 1L9TA 2CUHA 3GSNH 1U8JA 3FRPA 3QG7H 3MRCB 3BAEH 3UYRL 1P4BL 3CTTA 1MCEA 2X9WA 1PNCA 3GHEH 4UNUA 4IHBA 4KUZL 1KGUA 4XC3H 4OZIB 1Q9OA 3UTZB 2BP8A 3IU3B 3V4VL 1FSKB 4YQXL 2D0FA 1KIRA 4R2GB 1CFVL 2IAMA 4DERA 4RGOL 5JPNC 2C1PB 2BOCA 3O45A 4WFFD 1TMQA 4ABVA 3TZVB 2PPDA 4GNKB 1S46A 1HCFX 4S1SH 3NN8B 3SE9H 1V3LA 1E30A 4ERSL 2RIKA 2BO0A 1QLEH 4NQCA 1CXIA 3BW9B 2OTWB 5ALBH 3VVWA 2WCPA 3FYIB 3QQ9C 2JKXA 1JVLA 1PBYA 1MHHB 2AJSL 1RZJC 3ATBA 3TJHC 1J05A 4JFSA 1J12A 3SCMB 1C12A 1NC2A 1SOKA 4LLWB 2Z34A 5D1XE 5GGTH 4YX2L 5KVGL 1CD9B 5JIDA 4NM4H 3L95B 4WAFA 3FUKA 2XQYA 1D7FA 3NFSL 3QS2A 4DPRA 4PJDE 3OZKA 1TQUA 4H4NA 3TBCA 1L4IA 1LQSR 1IGCL 3EYQC 4FQLH 2VDQH 2OQJA 3M46A 1OCWL 2P8MB 4OCWH 5CGBA 5I28A 1C5BL 4QJ3B 1NFDE 4ZJ9A 5IMKA 3CNKA 2BSBA 2F08A 2ZPKL 4X6EB 3QXDB 2CKBH 2C9UA 5GZOA 4A68A 3E6FA 3ZPDA 2XLLA 3GSRB 4DN3L 3MOBH 1JVKA 1C16A 4XO4A 2VCOA 4Q0XH 3MRIA 3DTXB 1PSKL 5SV4A 3TTYA 1TNNA 3EZ8A 2VQ4A 4UZUA 2YPKA 4M61A 3VI4F 1UC6A 1A3LH 2Y2WA 3QUMH 1ZGLM 3HNVH 1ND0B 1IBGL 3MREA 3NFNB 1FL3A 2BW5A 3OF6D 5EU6A 3FZUC 3ZHFA 4LCCA 2OCFD 3ESOA 4P99A 2ILLA 5TF0A 1CGUA 4OZFB 1CDCA 4HIJA 2CDFB 4TQPA 5IJKC 2ENSA 4P59L 4K9JA 4LSRL 3I85A 3BIKA 1OGAD 5I1AB 2EECA 2EDXA 2CKNA 3LXCA 2N7SA 5ADOH 1M7XA 1Z0MA 2BP5M 3JWNE 3SBWC 4NCC2 3K4DA 4OZHF 4MYPA 4F20A 1S7QB 1B4JH 3PUUA 4NAQA 1IAKB 1SDAB 3V4LA 3QW9A 2FBJH 1TTGA 1UD2A 3C9NA 1E42A 5EPMA 2KPWA 3LPFA 1Z9NA 3DOHA 1OSPL 1AS8A 5C9JA 5DC2A 3EH1A 3BSZA 1K4CB 2DW5A 4I9XA 1AANA 4XXWA 4Y4HD 2QADD 4DESA 1XDTT 4YSUA 4BQBA 4JQIL 2DLTA 1NCCH 1O7DE 4X5RA 4XCCH 1PLCA 5D1ZB 1UT9A 1W8NA 4KMTH 2ZXCA 5MEPB 1E4KC 1L0XA 3BQUB 5CJQH 4U1NB 1KBGH 9PCYA 4FTDA 1A3QA 4JZOB 1PFCA 1D9KB 1B3IA 4XN7A 4ZTEA 3BAXA 4MA1C 2H32H 2ENPA 1M6OB 4RAVA 4GJTB 4IMKC 3A6BL 3F5WB 1GZPA 3BQVA 4FAAB 5JORB 4KFZC 1GW6A 4O4YL 4RBPH 4NQEE 1DCEA 1KGXA 3H9SA 2PWDA 4WTZG 4ZO7A 3S5LB 4LLUB 3TN0C 5FO8A 1OE1A 4N9GB 1P5VA 4KJWC 5KBKA 1OL0A 2X7LB 3CFJB 1JGLL 1YPZA 5KYXB 4KQ4H 4RDBA 4R7NB 1GRWA 2Z7UA 3RB5A 5JYMA 1QLRA 1T2XA 1CO1A 3FQTB 5IHUL 1F00I 3B2UC 2CA4A 2G9HA 4HHAA 3L1OL 3MJ7B 2EILB 3GI8H 3CVIH 3EG9A 5F1SA 3WD5H 1AXTH 4MNGE 5CSBA 1PIGA 3CVCA 3L3JA 5FO7B 3EHBB 3RGVA 3AWEA 1X9LA 1AJ7L 5I1LA 5K1VA 4ZYKA 4MZ2A 4JPKL 1JWSA 3VW3H 4LHUA 4HLEA 1MFEH 4F58L 1SXCA 1SHSA 3ARFB 1F4HA 2MCG1 1IIIA 1G7IB 4PQXA 3DX4A 3ZTEA 3F2LA 3F6IA 1K85A 5KSBB 1NEUA 2WNGA 4YLBA 1AY1H 3TS8A 1CURA 2ATPA 4OGQC 3U0WL 4HK3N 2OJZH 3G5WA 2PYEB 3NSDA 4JEGB 1SJEA 1BF8A 4ZFGL 4GKZA 3FHQA 1KIUA 4L4VD 1IQDB 3SPGA 1GZHC 5MEQB 3RWIB 2HVBA 3L2LA 4W9CC 8FABA 4IRZA 3DYOA 5T1KB 3UTOA 5I6MA 3U9PH 4X6DA 2WWKO 4YUEH 3Q3GB 5GGRB 2FLMA 4A55A 3DOSA 3E6HB 4HDIB 2X4UB 1WBXB 1FN4A 4WTXA 4APXA 2YOAA 2OZNA 2VERA 1J0ZA 2GTQA 1CE1L 3LZPA 5EUOE 1BQHB 5SWQB 1WCBB 1ZPLA 3QXTA 4P5KA 5AWNL 4AL8C 3ZHNA 2HFGH 3KYAA 4CKVX 4MDRA 1J9TA 4OF5A 3CH1A 3G9VA 1A14H 4YK4C 1Z9OA 3JWDL 3BP7B 5FO9B 4JFEE 3G5YB 2DYPB 3FFCD 1D5MA 3STLA 1DVZA 5AW2B 4ZUUA 5KANG 4YHIB 3UMTA 5HGHA 5EU3B 4MNHB 3ORJA 1GH7A 1V7NL 5AAMA 5CEZE 3ZL4H 2WWOA 1FFOA 4GLRI 3ASOB 5KSAD 4YXKH 3SY0B 3PPEA 3CFEB 2ZWNA 1B6UA 3IB4A 3BLKA 1T7VA 1IQWL 4O51A 4TNEA 3AT8A 1OWRM 3E1ZA 4NUQA 2E7CA 1ZE3H 1AGBA 1XF4A 5GHWL 4DQOL 1MFCH 5CSGA 1K5NB 4R26L 4PRIB 5DU7A 3QQXA 2FT6A 5EN2A 3RDTD 3P0YH 2TSBA 3BKJL 4NAJA 1YG9A 1YYMH 3JTSA 1GC1H 4GB9A 4UDTA 2WZPD 1I3RA 2J72A 5E2JA 3T3PE 4WFGD 1MCOL 3QWOA 2J1WA 2ZUWA 4N1EA 3TFKC 3QYNA 4KX8A 2OMWA 3L5HA 3Q5TA 5C08B 4P2RD 5DFTA 3UTSD 3ZXAC 4QHKJ 3BPNB 1EDQA 3O2DL 3FQNB 3TO4B 3ZKND 1WCQA 2NY2D 4GQ9L 3ZL2A 4JFED 3H53A 4LEBA 2OM5A 3MGOA 3L45A 1YJDH 3HJ0A 5BJTB 3MV7B 4ZPVA 5HDQH 4Z7QE 2OX5B 4YHML 4X5XB 2W0FB 1CD1B 3O4LE 4FYTA 2WBKA 1TO5A 5HPOA 3O2WH 1LO2H 1TTBA 3EYUH 1OGAA 1Z5HA 4NBYB 3M1OA 4EIGB 4OTXH 4C4BA 3INUL 2BX5A 4ZDHB 1R3HA 3K91A 1F6AA 3P77B 2AJYL 1PW3A 4R6UA 4RAUB 4LOUC 5FYLL 1IAMA 3L16A 3LPWA 4OZGA 4ZS7H 5C0RL 2J6EL 2WNWA 4P2OB 3VRIB 4YIQB 3V6FB 3GEWB 2CGZA 2VSCA 3MLXH 2BSRA 1XGUA 2XY2A 3UPCA 4N25A 5DD1H 2XX1A 4ELME 2YAMA 2XTJB 2R4RH 4RIRB 2Y7QA 1ONQB 2LV4A 2Z31C 2NY4B 1LJMA 5DRZB 5IW6B 1MW0A 2CJSA 4GH7B 2AJUH 2X6CA 3N85H 4I0PB 5GS0C 5DC4B 1RZIB 2VZVA 3U4EA 5EZJB 2R69H 2QELA 4AYFA 4CMHC 1OOAA 3QQ3B 4G80B 2FK9A 4ZXBC 1DUYA 4NWTH 5F89A 1DBKH 3D6GA 5CILH 1WWBX 1NGWB 1KYUA 2I5YH 3MACH 5D7JB 2FATH 4ZD3H 5JIQA 3PL6C 1ZA6B 2NRDA 2F53A 2PO6A 1MW1A 1CN4A 3HR5B 4M7ZB 2X4RB 3GMMA 1RQ5A 2X6BA 2MJWA 1QRND 4XNQB 4GAGH 4L29A 5FHBL 2EUVA 1G7PB 2GUOA 4KO6A 4L9LA 5DMGC 1Z3GL 2BNQB 3DUUB 2QMJA 2EDNA 2DIAA 5C6PB 1TZOA 3BVXA 3F7RA 3OLEA 2MNWA 2CAKA 1B2WH 2LLLA 4LKXB 4MD0B 4WU7A 5ELIA 1QACA 3JVGC 1PCXA 4DZBB 4J6RH 4G11A 4RGND 2C3GA 3BKCL 1J0IA 5I1JL 1N6QL 3ZDYE 5BRZA 4TNVF 4Z6AT 5EU5B 3PNWB 1G94A 3MBEA 1CLOL 1K2DB 4GOSA 5B1JC 4IRSC 4U1SB 1IGTA 1Z9SA 4GSDH 2YPLD 3MV9E 4KROD 5A2FA 2W1NA 5DUJA 1DUZA 5JZ7C 3TBYA 1AP2B 2PW2A 4Z5RA 4E0RA 4KJYB 5E5UB 1RD6A 4JKMA 4OZFH 1CDGA 2EDQA 3R1GH 1ULVA 2YEZA 3S3BB 4RSVA 2Q2LA 4MJ6B 2W94A 3KM1A 3OPZH 3M17A 3OKEB 4RRPA 5C07E 1F3RB 1OHZA 1H8NA 2QBWA 1I7TA 1WUNT 2VXUH 3N5AA 4YFLF 5AOLA 3SJVB 1DJXA 1P84J 1YEFH 4L4VA 1KBBA 4PY8I 2D0GA 5I66B 3A4AA 4NQVB 1PL3A 2P46B 3EADA 3J2PA 2GSMB 3EDKA 1MRCL 3AXLB 4KRPC 2WP3O 2XFGB 4G43B 2EYRA 4JFXB 1MAKA 1ZHKB 3NZUA 5J0BA 3ARXA 2BY2A 1JGUL 4PP1C 5HI5D 1AVAA 4B7LA 4FFVC 1R19A 3L54A 2AQNA 2HKHH 2MPAL 3FO2A 1T20B 3BCFA 3HRZB 5KVMC 4N8CL 3SYOA 1I53A 1UZ8B 1I7UA 4TN9A 3QRGH 4H20H 4NZDA 1FGNH 2WYTA 5AOMA 3GB7A 1U3ZA 3PHOA 1RULL 2H2SC 4NZUH 4M48L 4QWWC 4P46A 1MRDL 5GGSY 2XQYK 2WLNA 4A7GF 4HSQA 4NRYA 1DDHA 4FFYL 2O61B 3V6OA 4ORGB 2BNRB 4NN6C 4DO6A 3JWNG 2XN9B 1MWAB 2ZCHL 2PR4H 1Q8MA 4ONOA 3QJTB 1AE6L 1G7MA 3P3TA 3UYPA 3HZVA 3EO1B 2BC4A 1PQZB 4LDEB 5C07D 4U6YA 5KSAA 1IBDA 3CIAA 4JY5H 3KEHA 1J0JA 3HUJF 4PJGF 4XWGH 1OKEA 5DURB 3SPVA 5IROD 3BN9D 5I1EH 2XBDA 4HLZG 5M95B 1KTLA 4HIIA 4PS3A 4WKZB 1KXQE 1URIA 1RZ7L 4JJHA 3HMXH 3NA9H 3KGSA 5EBMB 5DMJB 2X4QB 3ABKB 3ARBD 4Y0GA 5FYJE 3CLEH 4K94C 3MA7A 5K59E 4B9PA 1R34A 1Q0XH 2ADJB 4XN1A 4OFKA 3H7LA 5C6TH 3Q43A 5CCKL 3K6DA 4JN1H 5F44A 5ICXA 3EDFA 2WZPA 4EN3C 4OIIH 1MZZA 3CZJA 4P9HH 4IIQA 4E5XB 3BH9B 3C09B 2VMDA 4HK0A 4NNXA 1J0HA 3UTSA 4P2RA 1EHXA 3UBXB 2B0SL 2C9PA 2J55A 4RRPG 1EGJH 1IFHL 1JV2B 5TDOB 4IKLA 1GMEA 1QBBA 5AW7B 2IQAA 1DQIA 1T1YB 3CVDA 3FH5A 3S35L 3VI4A 1MUJB 4HSAC 2D03H 4I4WB 5ALCH 2ICCA 5FUZH 4CSTA 3DVIA 1G7QA 3JWOL 4ODSH 5DCCA 1KTCA 4EDXB 4L8CA 5AW5B 4GO6B 3RL2B 4Z77A 4YNYA 4P2QB 1MREH 3IXAB 5DZAA 4EXPX 4ZO6A 4BUQA 1X5IA 1YHPA 5HHVL 2HLEB 1GCYA 4WV1C 1OAKH 2XPGB 1OV8A 2CBQA 4MDJA 1S8DB 2DBJA 2NNXA 4N90D 4J3OH 1MHPH 3HC4H 2F0CA 4GMSL 3MLYL 1IGFH 1BZ7B 4OZHA 4R4NC 4ZZKA 1Q9KB 1T04A 1RURL 2J71A 1CFMA 4N8VB 5IESL 1QTSA 2WXGA 3NJVA 3P54A 5TH2A 3IJ8A 2DQTL 2FJSA 4MZIA 3VGHA 3GUFA 1ZV5A 2CIIB 5F1IA 3MODL 1BM7A 4X4XA 1S5IL 4CGUB 5A16B 5I16B 4OCNC 3O11B 5EO1B 1BVLB 1LP9B 2WZ0A 5DT1L 1TJIL 3SKJL 3V52H 5AW3B 3TBSB 4CJ0A 1KBPA 4N2NA 4Y16D 1LDPH 1DQVA 5KBPA 1KT2A 3MRQA 3V9CA 1S9XA 2VC2H 3G5VB 4NN5B 4NJ9L 3CDZB 3WNKA 3IBEA 3NQIA 1XCXA 1SEQL 2A0LC 5CU5A 3K80A 4MXVE 5DS1A 4C56B 4FGMA 4NQDA 2DDQH 3D8MA 1CK0H 4K9EL 1JPTL 2ESVD 1OSEA 4MJ5B 1PZ5B 4X5WA 3FS9A 1U8NB 2BIQA 4WWID 2DQDH 4XH2A 3WJLA 1FGVH 5EZIH 1UACH 5L8LB 4NKIL 1QRNA 2NW2B 2QHRH 5IMLA 1EWHA 4NZRL 4NJAL 3X13B 2WLYA 1TQBC 3FPXA 3LRHA 1S7XB 2YXVA 4JREC 3WEMA 4LSUL 4MHHI 1LO5B 5I76A 1RK1B 2DQFA 4CKQA 3IJ9A 4I2XA 3WYRA 4XPTH 1ED3A 4HKZA 3HBPA 4FQXC 1WTGT 2JXMB 3L4YA 4WI9A 1JUFB 4TTGA 3RIFK 3SDXB 4LSSH 1J11A 2F7RA 3MOAH 2IAND 4FN0A 2Q8BL 3FT2A 1QLFA 1U3NA 4XE0A 5TFSH 5L9DH 1JZ7A 1PZAA 4LFHD 5CF3A 4JO4H 5CUSH 4YWGL 1KLGA 1HIMH 3U1PA 1GPOH 5JOFA 5DLMH 3GXIA 3QE5A 4OB5H 3E1F1 3V4UL 1G4RA 1BVZA 5CN3A 5I1CL 5ILTL 3D18A 3ZTNH 5E0QA 3LKOB 5F9OH 3ROOB 1EAQA 2CALA 1H0DB 1OGTA 1TG8A 5K9OA 2JELL 3K5RA 1A7PH 4NFBA 2HVKA 3KXFD 3L5XH 3O6FD 1UB6B 3QFDA 1PY4A 3MNWA 5BV7L 3BDBA 1WA1X 4M1DL 2HT3C 5GISL 1SM3H 3EGXB 3B7UX 4D8OA 1NOLA 3OJDB 5DK2B 1FUNA 2A6IB 4OLYH 5CD3A 3EYSL 4J3BA 5CIPA 2V7NA 5C0CB 3GXPA 5EORH 2NY3D 5I75B 4XPFH 5JW4N 2NX5D 5G5DB 4P4KA 2N7BA 2YA1A 3WY4A 1UWXH 3IFPA 4OM0L 4QRRE 4AT6A 4QY8B 1HHKB 4K5MA 1F11A 2XN2A 5TQ0H 5A7EA 2XV3A 1PU0A 3EYOA 3T6QC 3Q1EA 3W9EB 3VXSB 1C7SA 4GRWE 1MEXL 2AEOA 1TDQA 3AY4A 2AV7B 2HRPL 3QPXL 1SBSH 3KH4A 3LEXB 5DC0A 1FFNB 1YMHB 2HUEA 1EFXB 2MKWA 4HGWA 3DSFL 1NEZG 2XNAA 3GSNA 2DQIL 1EPFA 3MBXL 1RK0B 3U46A 2LR4A 2KYIA 3LKSA 4RMRA 5FXCH 1T0OA 4A6YL 4FD0A 2WWMC 4FXGC 3ARBA 4L5FL 5F96L 3SEPA 2Z91B 4YPGA 2OW6A 3TOPA 4DAGH 4FQHA 4QXUH 2RBLA 4WI3A 3WOVA 3CBRA 1HFUA 1QFUL 3QNZA 4XVJL 4TLUA 5ACLA 5I30H 5T3XH 3BFOA 1FP5A 3HNTH 4HIQA 1UD8A 5GPRA 5IBLC 1QA9A 3PHAA 5C71A 2F54D 4J3XA 2UWEE 4M8RA 1KJ2B 4A1RA 3MRFB 1LE5A 4HEMA 2OL3L 3GUTA 1KB9J 1JWUB 4OT1L 3C5ZC 2AJZB 4H1LB 2A74B 4YDVB 1MN4A 2IDQA 3PGDB 4PWKA 4QRUB 5EO9B 5I23A 1LM8V 2J43A 1FH5H 4U3CA 1CFQA 2NSMA 5GGTA 2EXTA 2VH5H 3OHXC 3JV0A 5T3ZH 5H8DA 4RMVA 4TV3A 1X6LA 1J5HA 2Z8SA 3QVAA 3QUGA 4AGPA 1T0NB 3ZK0A 1O6SB 1I1AC 3AXIA 1C1EL 1XCQB 5L6YH 1CDJA 4FL4B 2NY6D 1NLDL 3BYYA 1CR9L 1JG9A 4KI5E 2VN7A 4QCIA 2RCSL 3NJFA 2O6CA 3GSQB 3BJLA 2MTPA 1F5WA 4XBGA 4G8IA 3QG6B 4OF6A 1INEH 1LO4L 2XPYA 2X2YA 4ZFQA 3V6BR 1CLVA 1MNUL 2HT2C 4D0CB 1YQ2A 5CEZL 3SDCD 5JR1L 1F2QA 5DZLA 1BFTA 3HZKB 1RZPA 1O5PA 2WLIA 4IMLB 4WWPA 5KSUA 4LCIL 3O3EB 3QJXA 4QUOA 2VLKE 4Y1AA 4IYKA 5KUKA 3QEQE 2NW3A 1TTRA 3HAEB 1OM3H 1UG9A 2X42A 1Y18A 1LYQA 5ICUA 4E42B 3QUMA 3A4FA 3S4SA 1ACYL 2VR9A 4Y16A 4YHZL 3JTTB 2YQBA 4YMPA 3KWUA 5FECB 1E65A 3UPRA 1HZKA 3L3HB 3FB7A 4XP9H 2H26A 4JHBA 2BVQA 3QUZD 3AG2B 1UJ3C 1C8QA 4CMMB 3I02A 4Q2ZA 3HI1A 5B1AB 1N8ZA 1EEUA 3GJEB 3DIVA 3Q6GL 5SX4H 2BM3A 4J3OF 5L2KA 5JYLA 4XMZA 4MGXA 4UUJB 1DP0A 5DQDL 4W81A 4DP0X 1NGPL 1QPPA 1WFMA 5C3IA 2J2ZA 3MROB 2MQGA 3NZHH 3TPKA 2NNRA 4FCHA 3QIUC 4JLRA 2JIXA 4KTDH 3FQWA 2WN2A 5DMIL 2AERT 3SDDD 4YHPA 2VDMB 1BPLB 4NHUB 4UINL 2XV6B 3MV8E 4MFHA 1GIGH 3LH9A 4ALAC 4DSYA 1Q0YH 3QNYA 1NBVH 2MQ0A 1LK2B 3BO8A 3VWKA 4YSCA 4JKKA 3CC5A 4HWBL 4U1HA 4GKSB 1IZKA 3P4LA 2H41A 1XR8B 5E2TL 5LAXB 4KAQH 1VAHA 2H6PA 4XP5H 1IAIL 5KBMA 3KBFA 2SEBA 1UD6A 2G3XA 2IANA 4BZ2H 5IFAH 2NYKA 4XBPA 2CLRA 3D39B 5GGSA 4Y4KD 2YQ2A 4PCSA 2CMRL 1X5HA 5J6HA 1WD8A 1Y1UA 1UKSA 1NC4B 2H32A 4TLKA 4YHNA 5IV2B 3ULVF 4X7FC 2Q3XA 4AGOA 3PGFH 3T3MB 1DLHB 4PB0L 4YBQD 3BWZA 4OCYH 5H35A 3ME0A 4M6MH 4ETQB 2E7MA 2Y2TA 4H8PA 2GIYA 4E9LA 4U7KA 1OT2A 1IC0A 1WA2X 4MB1A 4YZWA 4M43L 1MJ8H 1XWVA 3KXFA 3O6FA 4EKJA 1A1MB 3RTQD 1XSKA 4TULL 3NAAL 1I9JH 1H6FA 4WLCA 1BD2A 1RUAL 3F6LA 4P2YA 4OQ1A 3VYNA 2VITB 4HXBH 1SJMA 4N22A 4UTBL 4XCNA 4AYID 2VR6A 4Y5VC 1T21B 1N5YH 2XX0A 3MV8D 1NAKL 1S2EA 4JO5A 3M7OA 1RUKL 1ETJA 1NUNB 3KL5A 4EPSA 1BZOA 1M2VB 4UMSA 4BSVA 5JPNB 1LO3H 1CG9A 4CN6A 1MY7A 4KKAD 4GXVL 5E08L 3K46A 4KV5E 4LESA 1AMYA 3UROR 1UH2A 2CLZB 2FWUA 4ZI8A 1F45A 3O3BB 4I8DA 4DN4L 2WNXA 3NJIA 4NO2A 2HJFA 5ID1A 4GBXA 4OAWA 4EBQL 4A7GA 3LX9A 1WC7B 1SLVA 4AEHH 3HS8A 4NIKB 2P5WE 5MENE 2WIIB 5CBEB 4RSYA 3EDDA 4UQDA 2ZCKH 3C5XA 3C6LB 5KJRL 4HWNA 1P4LA 12E8H 3GBEA 2JK5A 1IM9A 1XCTB 3HUJA 3KYNA 4PJGA 1TT6A 3EFFB 1F1GA 2YHGA 5LGHH 4E36A 4M56A 4JKLA 1IT9H 1MXGA 2P5EE 4U7MA 4F2FA 2VSMB 3CH8A 4JQVC 3H2WA 1WGVA 4YFEA 3R0MA 5KG9B 4TRPL 2IH3A 4H26A 3QUKB 4LFHG 4YXHL 5F2FA 2DYSB 1I85A 4HBQA 2X53A 3BKYL 1AD0A 3N04A 3T4YA 1R3IL 2E4FA 4L05A 1PLGH 1E4XI 1J0YA 1E0OB 1U8IA 2YPVL 5D4IA 2F54A 1FRGH 2A1WL 3DURB 2FB4H 5CLTA 3L81A 4EI5D 3R7RA 1JK9B 3VQ1C 1FHGA 5I5JA 3F7PC 3RVXC 3JUZA 4K8RL 4W9IC 5EC1A 1JZ4A 1FFPB 1RHFA 3QQDA 2J6WA 3VQLA 2FUTA 4XXDB 2GQHA 4MB4A 1N5AA 4QRTA 5AG8A 3UIZA 1CLCA 3WKML 3O41B 4NQCE 3ZMRA 3FAXA 4KY2A 4GW1B 4PTUB 1KYOJ 3HLAB 3W2DH 1MHCB 1NBZB 2IADA 2AKRA 4M1CC 1JJUA 2E75C 1KGCE 1MFNA 2FO4B 2JB6B 2P5WD 3B3BA 3QIWD 2J8UE 2OTUA 4KGJA 3DX6B 2QV2A 3I2CH 3JT2A 3QRFM 4PGCB 4LRNL 2VDOB 2VM4A 1N18A 1M1XB 3E0GA 1F0LA 3T8VA 2XDHA 3BMVA 1ADQL 3IJHA 5E1HB 4OLUH 1QSVA 1KEML 3H4FA 5C0BE 1ACZA 2F7IA 1BLNB 3QORC 2NMSA 1IEHA 5SV3A 3D48R 2WJ5A 1U3HD 3LRKA 1QO3B 1WHOA 4I18A 4GKOA 5EOCL 2RA1A 3SDAC 3FPYA 5KN5B 1Q94A 4CU6A 3WMQA 3AAZA 4JRYE 1LL1A 4BELD 3BGMB 4BE6A 4MRBA 2EZ0C 2FJHA 3IJ7A 5FYJL 3U0TB 1D2OA 4U1IB 3TEZA 5IQOA 4XC1L 4NKMB 3F8UB 3DTDA 1HE8A 2O26U 2FWLB 1RUML 3NOIA 4IGBB 3PIQB 1OP5K 4R7DA 3LZOA 2YBRB 3O9WC 3SO3C 2GIMA 3P0VL 5LHDA 3GMNA 2VDKL 1X6NA 4G6KH 4CSZA 4F8QA 5IM7A 4D9RD 1FYTA 4C59B 4XP4L 3QUZA 1U8CA 4PJBF 2NTFA 3EGSB 4G9FD 1QQDB 4EUPA 5KVFH 3S98A 1BSIA 2AJ3B 4F9LA 4QO1A 3L1GA 5D1QC 4JN2A 3X1GA 2WXKA 3FSWA 3QNFA 2IPKA 4R5XA 5IQ9B 5DZ9A 3MRGA 4J3OD 3GSVB 1J1OH 1EA9C 4ANXA 4WHTA 3MCLH 2P4AB 5I6XC 3TYFA 3IU3A 2IV8A 1DBJH 1AFVH 3I6KA 3MLZH 3WIFB 5E2VH 1BFVL 5MHSD 3SDDA 4IEFB 4HA1A 3HS9A 5C0BD 1AGCB 3K72A 4RQQA 4WWKA 4B0MM 4F7CA 2WMPB 3OGOE 3KW8A 1Z6JT 5E7BA 1QEWB 3AADB 4WO4B 1HSBA 1J5OH 2C9VA 2FX8L 2LLNA 3BEVA 1TQSA 3Q1SH 4HS8H 1OALA 3GIZH 2DQMA 5FFOA 1HX0A 4JRYD 7PCYA 3WFBL 1Q72L 3OKMB 1F3DH 3W0WB 4OFVA 1KENH 2Q76B 2GIXA 1KPVB 6FABL 4OD3H 4WRLA 1QNZL 2O6PA 4P8QA 4PS4H 3O6MH 2VLRE 3CZSA 4WHCA 5DEFA 3WTSA 4OI7A 3WKYA 3DROA 1JZJA 3IDIA 5DRXB 2P28B 3L95A 4A2FA 1ZT1A 4ENED 2YGQA 1T6VN 2R2HA 4B5ZA 1FCCA 3GMQA 4DCQA 2K3HA 4EN2A 1MKFA 3W38A 4XNYL 1YEJL 4L1DA 2P8MA 1YY9C 3MUGA 5SWSE 2R23A 35C8H 5DEZA 4OJAA 4FYRA 3RTQA 5I71C 3UEZA 5AZEH 3U9UB 1J5DA 4FXKA 3L3IA 3ZGIA 1AO7D 3I6GA 4LVOC 5H37H 4KXBA 3H9SE 1C08A 3RWCB 1ZHLB 3AWFA 4FP8L 1I1YB 4RETB 3QGVA 2AHIA 2K7PA 1BMGA 2DICA 4LCWD 3HAEH 1GYAA 5AQ0A 3MBWB 3TV8A 2R2EB 5I6OA 3PJNA 4MRCA 2WXOA 1QX1A 2R7EB 3RFZA 1I3UA 2ATKA 2CO4A 4NC2B 3FUNA 4I3SL 4M00A 1HHGB 4FHBD 4N0UB 5L4JA 1LNUA 2WUBH 3JYCA 3M1BA 1E6OL 3MRPA 4AMKL 3ZE2E 1KNOA 2VLRD 3VE0B 4YK4B 1MIML 5CZXD 3SKNB 3N50A 6PCYA 1FDLL 4WENB 3RE0A 4UTAL 4FQCL 4LSTH 5TPWH 1WWCA 4AGMA 4MHHG 4AVJA 4B60A 2M8XA 1TKWB 4JM2B 4MA3B 1BM3L 4CVXB 2Q20A 4HCRH 4LDLB 1NIDA 2D73A 4N5ED 2EXWD 1OCZB 3HG4A 4U1KA 1HWWA 4ESKA 4N28A 1XEUA 3AU1B 4NQSB 4M93C 1FL5B 3KE0A 4PGDB 2FT7A 2GFBA 2KERA 2ZG1A 1JZ3A 4Y2OA 2HTKC 1KJVA 1QFWM 1KGYE 3WNJA 4KRMB 1K4CA 1SYSB 2AF2A 4HGMA 4ZTPL 5IUSA 2NUPA 1I8MA 2KLRA 2EDLA 1TO4A 4PI2A 1WD9A 2Z0UA 2NNFA 1T03L 4KTEL 2YQGA 5HHOD 5E8DL 4XI5D 4Y9GA 3R4RA 2BZCA 2W07B 2H3NA 3HBGA 3D51A 5MEPA 1A65A 4QTFA 5HI4C 3CDCA 4U1NA 3TH2T 1P84K 3S2CA 4HQQL 1VEMA 2VAAB 3CE1A 3FOLB 4BQ6A 5EN3A 4H0HB 4AOFA 4MZ3A 1JXGA 5E70A 1Q4NX 1KEGH 1M6OA 3GIVA 1S6NA 2X9XA 2PNDA 5FPIA 2E6QA 4MWFA 4G7VH 4PRPA 4GPVA 3P4MA 4KI1A 5JW5B 5IFJA 3EZJB 3RG1C 3JWDC 4HJGA 1JSYA 4TUKH 3QIWA 4JFYA 2E0PA 2OR9H 4IRJD 4RNRA 1MF2H 5E9AA 3HMXA 2ITFA 4F3FB 2JB5L 4WFHE 5K1NA 4R7NA 3PV7A 3LKNB 5I17B 1T3FA 1UA6H 3EAKA 3O2VH 1JD7A 3VFWB 4DZ8B 3EDEA 1CBVH 2AQSA 3G6AB 4IBSA 1K72A 3GGWA 1QSEB 3C8KA 3VH8A 4A37A 3NIDE 3VYOA 4F7PA 2YC1A 1NDMB 3L3KB 1P6WA 3LQAL 4O58L 3TT1H 2BP3A 3UMNA 1MW2A 1F42A 5FAAA 3UTQA 1EGJA 2FUQA 4K2UH 3FO9A 2ZAIA 2ZSWB 4HOXA 4BH7A 3P9WB 1B88A 3BWUC 2EKSA 4U1LB 2D7NA 2X44D 4UT7H 2MCPL 2G5BB 3APCA 2JNZA 2ZUVA 5MI0C 3OR7B 5E1AB 2WXJA 3BP5A 1G9MH 4QRPA 1MQKH 4ZFFB 4ZXBB 2HG5B 3HPJB 3BRDA 4G9FA 3GS7A 3UAAA 4GSRA 3L3GA 3VFMB 2WQSA 4QHNB 2B08A 5CJ8A 5FM5O 5GGVH 4AIOA 4MAYD 3GHBL 4JO2H 5DHVB 5ISZE 2IEPA 4IBYA 3WFDH 3ZKXC 1TYEB 2DQEH 2A9MH 5JQ6H 1P7QA 5A3ID 1INQB 1U30A 4X4MA 4X80L 2UZXA 3VFGL 2BS8A 3U7AA 3G08A 4UIMB 5F9JB 1M9SA 3GM0A 2P3YA 2VLLB 3IFNH 2F7QA 3FT4B 4R90L 1HHIB 4G42A 4NYLB 2XWEA 4JVWA 2WJ7A 5ESAA 4F5CE 3FHEA 3VSTA 5IIEB 1RPQA 2NYYC 1D7DA 1Y6KR 4Y1TA 3QBTB 4B0MB 1XIWD 2K70A 4TPRH 1N0LA 1FNGB 1AGFA 1ZANL 3Q8FA 4NQEB 4XX5A 1JHKL 2X4NA 3QCVH 4HP5A 2BZDA 3K3QA 4RBPK 4UT9H 3VG0H 2FH8A 5CJXA 4DVBA 5JXEC 3D0LA 3WJMA 3TVMC 2AQQA 4AGNA 2IDCA 4BFFA 3ZHKA 5HYJB 1BYPA 2GJZA 5CEYA 3VXRB 1KCUL 4PBDA 1DANT 4YVUA 4YLQT 3NCFB 4Y5YA 5JUEH 1PD0A 4OJFL 2BS71 4JRXB 2F53E 4ZS6D 4PRIA 3FK3A 5KVEH 4JFFD 2TSAA 2FL5B 3ZE1F 4BA0A 3CFKA 2DWXA 4WJG3 3BGFB 2M83A 1Q38A 4PY7A 2A9NL 4A6YB 2DPKA 3A5VA 5J7CC 3GMLA 4NB7A 3Q8BA 3BUIA 2ZQKA 4LCWA 1SFHA 3K71A 3FKUS 5FCUH 3B7RL 3FULA 4XN9A 1T1ZA 4PJ5A 2GTWB 4F91B 3VD9A 1ETA1 2ADFL 2UYLA 3KR3L 3DMMC 3HHMA 4HX1A 4YAQB 2F1BA 1DN0A 3RU8H 1DYZA 1HN1A 1X4ZA 3Q6FB 4PG9B 4JO1H 3CMOL 3BRGC 4M8QB 1JHLL 2XHNA 5AB2A 1CF8H 2R2CA 1ZGLA 1X5GA 1CLYL 3WNIA 4KOBA 2EDHA 1OF2A 4PP2B 3ECUA 1JERA 1KTJA 4JM4L 2YARA 4NN6B 3P77A 5BOZG 1FHNA 1R5IB 2B14A 1XGQA 1YUKB 4W4NA 5EIIA 1VGKB 4P2OA 4MSWB 1KC5L 1FE8H 2YWZA 3VRIA 3DYPA 4Z76B 1AIZA 1LILA 3HTLX 4L3FA 4HFWB 2HPTA 5I8OL 1FNHA 1WISA 1Z2KA 5JHDE 5HHQA 2HMIC 3MTXA 2BMKB 2KKQA 4JCLA 1CFTA 4X6BA 3CXDL 4GG8B 4OCXL 3X2QB 1SUJA 4NNYA 5I0YA 3GDCA 4ZNEA 3FRUB 5TDPA 2FGWH 3S7GA 1ZRUA 1A6WL 3IAPA 5DSCB 5TQ2H 1S9WB 4FA8A 5ESVB 4A7SA 3D4YA 5E56A 5DRZA 3FO1A 4M6OH 5HHOA 4AJYV 4I0PA 1J9CT 3OJ2C 4L8SC 3PWVB 4AEEA 3DECA 3N1GC 4W6WB 1LD9A 1DJGA 1I7ZA 1W0YT 4V1DE 5L2JB 4OJCA 4CC4C 2APXA 4Y4FA 4WSKA 4P23B 2CR3A 4GRLD 4P5RA 3SKMB 4EQ3A 4JRFA 5FYJU 3D3VE 3D50A 4HGKC 3VB8A 5B8CB 3ULUD 3SOBH 1YN7B 1YUHB 5EF0A 1K8IB 4Y2LA 3UP1A 3QC5X 1IGML 4JO8A 4QHLB 3VD4A 2IQ9L 4CBZA 4GAFB 2DIEA 2H0PA 1WAAF 2EXYD 5J1AB 4GSXA 2R83A 2HJKB 4GG6B 4K3JH 4FYSA 1AOHA 4M6NH 2F15A 1FZJB 4AYEC 2A73B 3NCBB 1LHZA 3GSUB 3EJUA 4DZBA 1SJXA 2F5AL 1I1FA 2Z0BA 4HD9A 5DJ8A 4PJXB 2YN5A 4HZLB 1AHWB 5FUCC 4Z7QB 1B6DA 1CYWA 2OMBA 1IL1A 3REWB 1EEZA 1QBLL 2EDJA 3MNZA 2AABL 1JN6A 1GCFA 4KHTH 2AK4E 3KGTA 4X9FA 4ZSOE 4DOHE 1RJZA 4AL8H 3LKRA 5TDNB 2O4EA 4AY0A 4PJ8C 4BK4A 3HE6D 5FA4A 5LXGH 4FQJH 4YOKA 3T3MF 4HUKB 1JGEB 1AKPA 4DW2H 1F3DJ 3KPOA 1NGQL 2J8OA 1AS6A 3QA3B 4E41B 2UY6B 3P30H 3D3VD 2QLYA 1CDYA 3VXQA 3FHAA 1E8ZA 4KU1A 4MDIB 4X6FB 5F7YC 3VI4E 4XP1H 2D7TH 4UOQA 1PYWA 4R7LA 4PJBA 2OYPA 3DX1A 2QL1A 1FLRL 1GGYA 5DD0L 5B22A 3K7UA 4ILDA 3AXLA 3HZ3A 3JWOC 3PF2A 4IBUA 2HRHA 1KB3A 1M1SA 3RNKB 5TF1H 3KLDA 4X7SL 1S7RB 3GM8A 5D8JH 4UV4H 1HSAB 1RUPH 1T22B 2YN3A 1KB9K 2BIIA 1JFHA 4YDNA 3BOVA 2OR7A 1RKRA 1WZKA 3TBVB 3WS3A 3ULVH 3SD5A 1TPXC 1XT5A 3QI9B 2EICA 1DJSA 4JFDB 3OKLB 2KMWA 4RFNB 3SE8H 2XA8L 3VX1A 1VGEL 5C7XL 1J8HE 3K6OA 5D1XC 2B7DT 4JDEA 4YSDA 1KLUB 2B2XL 2R0WH 2VNCA 1E5BA 2AK4D 4LIQH 2ZG2A 1IC4L 2X41A 2BVEA 1XIWA 4M8VA 3RWHA 3DX7A 2AS5M 1Z0NA 4HOWA 1PZBA 3PDOA 5IMMB 4MNQE 1KCLA 3ZMEA 4L1TA 1U93A 4XBEL 1MCNA 1CU4L 1E27A 2DB8A 3KPLA 1U92A 5ADPH 4NHCL 4XR8C 2WOBA 4OGXH 3L6FB 3T71A 5ICZB 1UWEH 4IBQA 4PR5A 4WKZA 1MCKA 4GINA 2JCCB 4KK5C 3ZKMC 2O6DA 2PW1B 4Y4HC 4DFIA 4AEFA 3HC2A 4XN5A 1XH0A 4JZJC 4TL4A 4HK3J 3TBTA 3T0AA 1P5UC 3PJSB 1QHQA 3ZTDC 4NQDE 3WBDA 1DBBL 4D3CL 5LVEA 3SY6A 3FQYA 1UWGL 2J44A 1JV5A 3MV9B 1HHHA 2WBJD 4FKEA 4PI0A 5E8EA 3WTTA 1C5DA 2DM4A 5IQ7L 3M86A 4HUUA 3G04B 4MQ7A 5EDSA 4FFTA 4G9DA 1ZAGA 3ZGHA 4BHUI 3RZCA 3S5YA 4DIXA 2ZOWA 1KXTB 4KKZA 3WFCH 1YEWA 4XMPH 5EOQL 2R8SH 3IDYB 3P9LA 2BP0B 3UBXA 3CQFA 4I2XE 1J8HD 4HH9A 4MMYB 3WN5C 5C0EA 2FJFA 4IDJH 1X4XA 2H1LM 1BZ9A 1UZGA 3NCYS 4JANA 4BZ2A 2WHVA 2PABA 4MX7B 4XX1G 4Y2DD 1KIQA 4FI8A 1AR1D 3L9YA 4WF7A 4GAYA 4GT0A 4PYHA 2AK1L 3JWNC 5GS0H 1VADB 3MLUH 2NR6D 2PTTB 4IS6A 3NACH 1TEFA 4P2QA 3J8F7 1CGSL 5AZ2L 1GL4B 2WQAA 5ICYB 1J86A 1KCSL 2Y7MA 2HFFA 3T1FB 1ZVSB 3B9KD 3QJVB 5HBBA 1NDTA 4X6CE 2VXQA 3BSZL 4M5ZL 5KW9H 2ITDA 4FFZL 5DXWA 1T89C 4L9DA 2F8XC 4QGYA 3KPRB 1VFAA 3NCWA 5ECGA 5C09A 3QH3A 1TUPA 4EOWL 2R1XA 1O7DC 2OSLA 1JHTB 4Z7VB 1ZVHA 3GRWH 3ARPA 4UU9B 1HWHB 4LSPL 4PV8B 3QJSB 5DJCA 4R5VA 5AVZB 5TE6H 2YD4A 4NENB 3VFPB 3NJLA 5DRWA 3ILDA 3RX8A 4Z78A 5C1MB 1Q0EA 1PY9A 3F7LA 4YGVB 3BPCB 5BV7C 2HWZH 2K9FB 1YMMD 1FL6A 5HHMD 4AE1A 1JNHA 4L37B 5KVDE 4GUQA 4KX9A 1LGVA 4I3RL 4EZJA 3AU0A 2R0KH 1CICA 5HHPB 1DVFD 1QEXA 4OLVL 2Q6WA 1DJIA 3MGTA 1BEYH 4HYTB 5AVXB 4XHJD 2ZYRA 4IKIA 4LU5L 1SFDA 3UDWA 2IAAC 3UGEA 3F12B 5DRNA 2I25N 3U0PB 3P4OB 3R19A 3TIDA 4C56A 2EDYA 1BWWA 1DVYA 3Q06A 2XWJB 1RJYA 2CCLA 2HFEA 4HKXA 1E4XL 3PGCA 4J3UA 3DRQB 2F61A 2IG2H 5I1HH 3P3SA 4H8UA 3K2UL 1TYJA 3BUTA 2WCSA 2VLJB 3V2AR 3X13A 2C4FU 1UVQB 3QDJA 1RVFL 1B0RA 2X0VA 2ZUUA 1NICA 1RK1A 1I1AB 2EE3A 1IM3D 3IDJA 4HMCA 3RPIB 5E8OA 3LS4H 3H7BB 3KLAA 5MEOA 3RFRA 4PLJD 1CJYA 3S37X 4ZNCD 3MR9B 1MJ7L 3ZDZB 4PRAB 4YFLI 4YXLL 5FB8B 4NRZA 5F9WC 3UAJC 5DUPH 1NMAL 43C9B 4GFXA 2WSKA 1NKRA 4MMZC 5D2LB 2GVYA 3C6SB 4TXVB 3U2SB 3FTUA 4BQ9A 1D5XB 1NL0L 2BVTA 4NS0A 3U83A 3LHAA 4S1DD 3MNVB 1TVDA 2UY7B 2YFOA 3QDME 1KJMA 3CCHB 1RL1A 1SN5A 4XP6L 3FONA 4L4TE 4W93A 3U82B 4PJCA 3LNHA 2G0KA 3TJPA 3ZHLA 4TOYL 4GEIA 5JIHA 3KVDD 4BFEA 3QHZL 5F7EH 3WHE0 5D71H 3BEWB 4C4UA 3MZGB 1AGEA 3KPSD 4Q9QL 4IRZL 2HAZA 4PJ9B 4L3EA 1B9ZA 2G2RA 4GKNA 2X2HA 3OB8A 1U8QB 4CC1A 3KPNA 1QSFA 1N64H 4AIZA 4XMWA 4LAQL 2PYFA 5DEGA 3RDTC 5HHNA 4ZMYA 3DPBA 4JFUA 3ARDB 4LK4A 4DPAX 4WI2A 2BY3A 4Z7UB 1DQDL 5PAZA 2HVJB 2A6DB 4HVBA 1NCDH 3O0LA 1D5IH 2OMXB 5FW7A 4P3CH 4MB5A 2DMGA 2WLZA 1HE7A 5F70A 2AXGA 3ZKNC 1OCOB 3VO0A 3PWJB 4K94H 2Z8WC 5JW3H 1JCVA 1DQTA 4O2EB 4G2AA 1KBKA 1QFWH 2VTFA 2YAHA 3KPMB 4G6FD 1KYOK 3VJ6A 1HHKA 2LFEA 3N3EA 4APQB 1HYSD 2YXWA 2OMZA 4L4TD 4PUBH 4Y1AE 5FFLA 5FHAH 3QQ9D 3G6JF 4HH8A 4WDIA 4OUUA 3MRNA 2AV7A 3WAJA 2YZ1A 5EO0A 4R8WL 4HPHA 1FNEA 4P2AA 1BV8A 4PJFB 1F86A 3T6VA 4MA7L 2YWYA 1QW8A 1MCRA 3OXRA 3SE4A 2N01B 3P73B 5FA3A 1OTUD 4UILH 2WO2B 1CUOA 2DM2A 4GIPD 5E5MB 3ZZQA 1KPUA 1WZMA 1HEZA 4TVPH 3EF4A 3N43F 2Z6FA 3HB3B 1NGXB 3H6AA 5C3TA 2IDTA 1M7DB 1NCAL 4FQQB 5JNYB 1T5XB 1GHFL 5D7EA 3BLPX 5BS0D 1A9EA 1FZOB 3VXMD 1GOFA 5L2KE 5FYKH 5L88H 4YN3A 1F41A 1X7QB 2Y5QA 4P3DB 5CGYD 3O4OC 5FF6B 5J3HD 2P24A 4MXQD 2ZUQB 3ZTJG 2EYSB 2X4SA 2GW5A 3N2JA 4GQRA 3N44F 3RVWC 4WEBL 1V05A 4RDQF 1MAML 3RY6C 3FTGB 3FU6A 1ETZA 4PW4A 4OLWL 3AUVA 3E9UA 2CK2A 2LFGA 2XVBA 3EJRA 1NUGA 1RZGB 4ODUB 5E00B 2NR6A 5BO0D 1S3KL 3FZUD 1HZHL 4YSSA 2ADIA 1XCQA 2R4SH 4NQQA 3S3CB 4BFRA 1EO5A 4I7ZC 4OD1H 1SRDA 2X9YA 4HCIA 4YR6B 1Q9WA 1BIIB 3B9KA 3IDGB 4G59C 3VGDA 4Z3FA 1OB1A 5KZCD 4MA8L 3T0EB 1ZJAA 1R75A 1NCNA 2KBGA 2WLLA 3Q2WA 4WW2C 2F58L 4JAMA 4H5SB 2E9IA 1NPNA 2MOQA 3MHZA 5H37A 1UWXK 3NJHA 3GNML 4QXGH 4U0QB 1Q90A 1FYHB 5CS7A 2J4WL 1DQLL 2VN6A 3BVWA 5FDWB 4WUUB 4KROC 2Y0SA 1A2YB 1MPAL 3EGDB 1MZYA 4XCEB 4Y1SA 2EDKA 5MERB 2FX9L 5E6IC 1BD2E 4BFGA 1HWGB 2W9EL 1OAXL 1D5BB 1YMMA 3GHPA 4E42A 5EEVA 2OFQA 1BMWA 1JZGA 1ZEAL 3DI2B 1A6PA 3UC0H 2DZEA 3EOBA 1E28A 1WZ1L 5DJZB 2GEQA 2AXHA 2WB1A 1PG7H 1AMXA 3OX8B 3U6XA 1XR9B 1ZK9A 4ICWA 4YLCA 1ASPA 3RY4A 5B1BB 4XNDA 1UT1A 3KDPB 3RWFB 1GYUA 3B5GA 3HI6H 1JZFA 5C2BH 4QXTB 2ED7A 2YK1L 5HI5C 4HCRA 4H40A 5I82A 3K8LA 5HDBE 4FG2A 3VFRA 5D2NA 2ICEA 4PLKD 3IMUA 2N59A 1U8OA 4PWJA 1YQVH 2LTQC 1IGIH 2R0ZL 3ARED 1AZCA 3QYCA 3V0EA 4BQCA 5DJDA 3UTPE 1IM3A 3L5WB 3D25B 4MD4B 3TN0D 1WAAA 4KJWD 1MLBB 1YEIH 3KPQB 3MO1A 3WE6A 3MCKB 2XI9A 5A40E 5C86A 5IVXB 4MS8C 1E9QA 5DO2D 2QQKH 1E9PB 1XGTB 3AT9A 3GS4A 2DN7A 3HUJE 1TJGL 1U8HA 4MJIB 2HRLA 3CMGA 4DUXA 2OJEB 3QORB 3C8HA 1AZNA 2LW3A 2B1HL 2J5WA 3RL1A 4GUOA 4RZCB 5DD3H 4BK5A 4ABUA 3UERA 3U2JA 1THCA 2XV0A 5KS9F 3QYMA 3MYJA 5C0FB 4J2QA 5IROC 5B38A 3VRLF 3QFJB 4N0FA 2MCAA 2X4OA 1BOYA 2W5PA 1DLHA 3KPSA 4LZKA 4TUOA 5EZOH 4ZTOH 1T2JA 5F7DB 5GRJH 2CXGA 3GEFA 3O9WB 3SO3B 5I6KA 3PNRB 32C2A 3TV3H 4PVMA 2KL6A 1XSIA 3GMOB 4FA7B 4TNFA 1HNYA 1CMOA 4XZUA 1GTFA 2FZ3A 2IH1B 2DJMA 1WIPA 1LEIA 3O0RL 2FLRT 1T21A 3BDYL 3DK2A 2GSGA 2KDYA 3NIGE 3SGJC 1CL7I 4Z7AA 5JMOC 2HYMA 1IGYA 1XX9C 4M7LH 3L3DB 1DFBH 1A0QL 1L0PA 4G70B 4U1JB 2IGFL 1UXLA 1SF5A 3K8MA 5D4JA 5JPNA 2FSEB 4MMXC 3OKDB 2N4IA 4Z7NF 5GGQL 1K8DB 1DQML 1VSCA 5JOPD 5CHNA 4EZKA 1TZHA 3KYMA 3HZYA 4PS8A 1XO8A 3SGKC 1KTBA 2E8YA 3F58H 2WVTA 3WHE1 3QEGH 3ZT5A 3BPLC 3LH2H 1WG3A 3QIBB 3FUJA 4NXKA 1F18A 5D1ZI 4FHJA 3KYKL 4LLDB 1XGPB 5DWUL 4PIBA 1ZHBB 1E50A 3IJEA 4Y89A 5I8KH 3FCTA 3K6FA 4GP8B 3EFOA 3L48A 4LLYA 4KC3B 7CGTA 1FZMB 4YSRA 4NGHL 3HPLB 1C5CL 1N19A 3O8XC 4OV5B 2ZXEB 2IMMA 4UQ9A 4RWYH 1R4XA 2VISA 5HPMB 1BGXH 4F57L 1T4KB 3VXNA 5FEBA 4YHLL 3T6WA 1FYTE 5HDWA 4MXWH 2EYTB 3UTTD 4Z0BL 2B3RA 4UQ2B 4F93B 4R5TA 3OR6B 1P6FA 2B9BA 2E9BA 2OXHA 3RURA 4DUWA 5BS0A 3O6LH 4QI3A 2ADYA 3VXMA 1ZXKA 2L7UA 4LGSB 1F4YL 4P5MA 3WY2A 4OSUL 3C60B 3DX8B 4OZIE 2B4CL 1H3GA 3MRHA 1RFDL 3OLIA 3TFKD 2DF3A 3K74B 1RZ8A 2Z92A 2XT1B 2L8AA 1A6UH 3TYGH 3MX0B 4Y19A 5DJ0B 4H2AA 4UT9A 3VWJB 4YSTA 2QQQA 4KFMA 1IC7H 1MHCA 2MRYA 3U4BL 4OIBA 4PJEF 4HUNB 2ICWB 4HWEL 1I8LC 3DX6A 3GXTA 1WFOA 3LN5A 3INOA 5IJKA 4Z0XA 2DQHL 1LMIA 3OMNB 3NUKA 3NPSC 1R24B 5JDJA 3E2HB 3HRPA 4X7DC 4QOKB 5T1LD 1FORL 2WOYA 1UXSB 3SBWA 3GSOB 4DEUA 4LCUB 4PJXF 5L8KB 3NIFB 4LOUD 4JUSA 3TA3D 4JK0D 1TJMA 5BZWA 5TE4H 3RGHA 5BXFA 3VGFA 5F72S 3ALXA 4O2CB 3TCLB 3RRQA 2EDDA 5DD5H 1A6VH 1ORQA 3NZ8B 1EX0A 3DK0A 4R2GD 5KYYB 4ALAH 3DA0A 4E9TA 3S3SA 1IILE 5I1GH 3D12B 3ZTCC 1ZT4A 2B1AH 2DKUA 2EE9A 3VI3B 1I82A 3HC0A 4PB9H 1VFUA 3TZVD 5TJWK 4XCFL 1G0XA 4OCSH 1H8LA 1G9NL 1E4KA 2R29L 2YRPA 3B9EA 3MV01 4NPYA 2P5EB 1CVRA 3GLAA 4JPWH 2CM5A 3U6RA 5LN4A 2F19H 3WIHH 1D5ZB 3PY9A 2G3ZA 1SQMA 4NO0D 4AW4A 2QVFB 3T77A 2YD5A 3FRPB 5HDRA 6TAAA 3IFOA 1NCHA 2XQBH 2VUKA 4IMKA 1FH2A 5B7EA 1RY7B 1AZUA 4UIKH 1Q9OB 4KZEH 2BP8B 2NY3C 3AB0C 5GJSH 1QD0A 1KIRB 3DO4A 3IYLW 5I1IL 4PIRF 2BHZA 2BOCB 2NNAA 2RR3A 3QAZB 3TN0A 3T4AC 3V4PL 5DMGD 3UJTH 2H9GA 3LOWA 1PJ9A 2FIRT 4M7KL 3OZ9L 3VM7A 3HA0A 3L4VA 4NZTL 4ZOAA 5KBDA 3EYVA 1JP5A 2P9RA 2QGEA 5AVWB 1NCWL 3TM6A 2WXNA 4NQCB 4O9HL 2Q3ZA 4OLXH 5AKTA 1ZTXE 2YD8A 5DI8A 3QZBA 2GCYA 1MIEL 2CCWA 5IBTL 2DL9A 3QZLA 4GS7C 5LJYH 1J05B 1PG7X 3CQQA 4DK6A 1C12B 1NC2B 2FLBT 4IBVA 1SLWA 3COOA 1JRHL 4DKFL 3VCLA 2UXVA 2W81C 3BD5A 2WVVA 2X1QA 4U3SA 3KBPA 3UOAB 2QGCA 1N7ML 5KVDL 3TURA 2EC8A 3H3PH 2OQJB 3W39A 5HY9A 4M7JH 2VO5A 3L4CA 1TYRA 4FOMA 5IMKB 2NDGA 4JZNA 2WSPA 1GZHA 3PYCA 1HINL 4OKDA 3OGCA 3E6FB 2HJLA 3MC0A 3A6CH 1OF0A 4NERA 1VZIA 2CU9A 3RIKA 3Q8AA 2YPKB 4FFVD 1DSFH 2FCBA 4M61B 4KNTA 1PZ3A 2R2EA 2JV6A 5KTEL 3MLWL 4WKXA 3DX3A 2V5TA 4DEPC 3MJ8A 4IJ3B 4G7RB 3MREB 1FL3B 1DBMH 5EU6B 4LCCB 5DYFA 4M5SA 1TR7A 2NY6C 1P4IL 4KUZH 4BKSC 4HIJB 4QWWD 3KHQA 5I19L 5HYEA 4DTGH 3GSNL 3BIKB 5D1ZD 4XGZA 1S7VA 1GS6X 4L0ZA 3GHEL 5D6CB 5FWQA 4HW6A 2IGLA 2V9TA 4GEJA 3G6JA 1B0WA 4NRXA 5EUKA 4P57A 4FERA 3SDCC 1N70A 4NQXA 5D55A 3TT3H 1TTUA 1OARH 1H6UA 5IEKA 5KSBE 1D9KD 1EBPA 5AD0B 1DVXA 3C9NB 5FM5M 4PGEA 5LDUA 4Z7VF 5EPMB 3TVMB 1A4KA 4QRPE 1YAIA 2PYEE 4GKLA 1D7CA 3D30A 5IOPA 1ZLSH 3VNYA 1QLEL 4W1TA 3H55A 1U36A 3QAQA 2ZKWA 4LVNC 4XOBA 3L7FA 1VF5C 3B9VA 3QUXC 5DGQA 1R3LA 4IW4C 3R06A 4M3KB 1JMXA 4KY1H 5SWZD 2BSED 4X4ME 4DP1X 4NM4L 5A1AA 2BY1A 1TEGA 3VGBA 1EAPA 2DRUA 1JS4A 3LCYA 1CLZH 3OPUA 4QRSB 4E9RA 3FOLA 1G43A 5FKAA 1AQKH 1R6VA 1C5BH 4RAVB 4XE5B 3CZFA 5AW4B 4KI5C 2QTEA 2OMVA 3FU9A 1MFBH 2DI9A 4FQLL 4I88A 1GZPB 2VDQL 3EFDH 3S48A 4KTGA 4OCWL 3W82A 1MVUA 1U8KA 1RIUH 3D85D 2UVEA 2NQCA 2NYZA 1EERB 2ZKXA 3H9SB 4Y5XC 3SKOA 4ZG1A 5FO8B 3BHBA 2CKBL 4TVPD 1YPZB 9CGTA 5M7QA 1BMZA 3BD3A 1BXXA 2H47C 3MOBL 1QLRB 2J57A 2VSDA 2AXFA 5T1LA 4GP5B 1GAFH 4YC2C 4HHAB 1UASA 4UV7L 5EU4A 3GT6A 3ULVE 2BCKA 2Z4QA 3QUML 5D7IF 5D2LF 3PQYD 3T04D 4R4ND 4WI0A 3UO1L 1NTDA 3HNVL 5B39G 5HVHB 1N59A 2Z9TA 3L3JB 4Y4KC 5CINH 4LSRH 1N26A 3RGVB 5HYSA 3KW7A 3LYRA 4RRPM 1PG7W 2NY1C 3NCJH 5LB1A 1U21A 5I1LB 2A99A 4PRIE 4ZYKB 2YAFA 4LHUB 2Z7YA 4B7IA 4HAKA 1IC1A 3GBLA 3QJFA 4YBQC 1F8TL 4RWHA 4YL4A 2V2WA 2V33A 1PKQA 3SQOL 1E5ZA 2Z31A 1LK3H 5ADOL 2ATPB 5C08E 4Q9RH 3E8UL 4J3VA 3OR7A 2FBOJ 1B4JL 1OSPH 1SJEB 2BJMH 4M5YH 2OS7A 4GKZB 1KIUB 1VA9A 2FBJL 2HG0A 3GO1H 4R97B 4ZXBA 3TEXA 1V3MA 3P2BA 1F58L 8FABB 3ARYA 2NXZB 3VFMA 4QHNA 4NO0A 1NAMH 1PTZA 4X6DB 2XPZA 1TTCA 3QARA 1U4FA 1ZDQA 2FO8A 3PL6A 3VXUD 3DOSB 4RMTA 1FO0L 2V5SA 4JFWA 3MV7E 3HG1D 4OF3A 2B5IC 2GK2A 1FN4B 1AKJA 4APXB 3WKPA 1NCCL 1MDTA 3CZLA 4J27A 1TETL 2ZXWB 1MCSA 4XCCL 3SBPA 4CBPA 1UZ6E 3LNFA 4KMTL 3GRWA 3GJFA 3ESVF 3UBFA 4P5KB 1HJCA 1WP6A 2B77A 5CJQL 3S8FB 4G6AD 1KBGL 1HHIA 2W65A 3PS6A 3CH1B 3QK0A 4K23L 1S5HA 2FD6L 1DJYA 2HCZX 2B59A 3JVGA 2WUCL 4IU2A 1D5MB 4FQXD 3SBRA 3STLB 5A7BA 4WHYG 4ZUUB 2PWFA 5HGHB 3I3EA 1XF5A 4ZNEE 3II3A 3ZL1A 2PMZA 5B1JA 4IRSA 3VXTB 3TTSA 3AMKA 5KS9A 1FFOB 4V2CB 4WWOA 3UBXI 2VABA 2VAJA 3L1OH 3CGTA 1NCUA 3ZE0B 5E1QA 4KQ4L 1HAUA 3TO4D 1PMYA 2VDNH 1AYOA 1KWGA 4O51B 3VXRA 5CXPA 1YNLH 1AGBB 1XF4B 4GI6A 3TONA 4YBLC 3M1CA 2J5LB 3GI8L 3CVIL 4IKJA 3L4UA 3F64A 3N9GH 4JPKH 5EN2B 1TJXA 3MV7D 3FOMA 5LDSA 1USZA 3L4ZA 3JTSB 4JFQA 4UDTB 1I3RB 5F7BA 1ZLVH 4ANKA 2A6JA 3HC3H 3QWOB 3QQ4B 4EI5C 5BRPA 3EH3B 2CNYA 3SGDH 1KCVH 1T2QH 2DQ6A 2OMWB 2ZOLA 3F84A 1MFEL 4KH2A 3DO3A 5FW8A 3VW3L 3U0WH 3D08A 5CEXA 2HLFC 1TMCB 2ITCA 5BZZA 4ZFGH 3GI9H 1NFAA 1OAUH 5G4NA 1AY1L 4Z3TA 1KZQA 4YDKL 3QR1A 3B5HA 2XXFA 2LHAA 1CFNA 5D72H 4MD5A 2OJZL 1L9OA 3MGOB 5T5NF 4XOEA 3ZJAA 4XNUH 5C9KA 5T3XE 2DM3A 2XTJD 5CWSA 4PG9A 4ZPVB 2DQGH 1VKXA 4KHXH 1T0MA 4K7FB 5D6DC 3QO1A 4X42A 3U9PL 1XMWA 1A9BA 4PW9A 2BPBA 1OGAB 4KDTC 5AW1B 1R3HB 5AWNH 1O6TA 5F71A 2DWYA 5AVVB 2OSWA 4OZGB 4X7EC 1T1XA 2BDNH 1U3HC 1IGJA 4MSWA 4HBCH 4OI8A 3LRGA 2LU4A 3FYEB 4F37F 4N6RA 1OVZA 3AACA 4HFWA 5BMFL 2BSRB 1B2YA 2HFGL 3SJVE 3BZFB 2WVSA 1KXHA 1XGUB 1H3VA 2AW2A 3MFFA 4NO3A 4DT2A 4ZX3A 2KPNA 4LOVA 2ZUXA 3LDBC 5D7LD 1A14L 2CH8A 2Y7QB 4P5TC 2QADB 3RB7A 1AIFA 2VQTA 1S7SA 4FMVA 1UQSA 1OAYH 3B2PA 2BNQD 1EXUA 3U4EB 4EN3A 5IBLD 5SWZA 4AYFB 3ZL4L 1JGIA 1DUYB 1IQWH 4LSDA 5F89B 1GOHA 4YXKL 2ZKHH 4ODXA 4LDCA 3VXPA 3IWUA 1ZJBA 4R26H 2R1YA 2K45A 2PO6B 1T7YA 3C5ZD 5IB5A 1ZT7A 1UB5A 3N91A 3GMMB 1JXJA 1W0WA 4OZFG 1I4FA 4DP7X 2ETWA 3OD3A 1MFCL 3QO0A 1F1DA 4L18A 3K1KC 3N06B 5I0DA 2GUOB 4ZW3A 5IY5B 1YYML 1GC1L 4L9LB 3ZUCA 4PJEA 3BT2H 2XN9E 2OMNA 4S1RL 5L0QC 3O2DH 4KKBD 2ADGA 1FZJA 2QVMA 4GQ9H 4WV1A 3KPPA 4ANWA 4WU7B 1L6ZA 4GXUN 5FGSA 1P53A 4KK6D 1DEDA 4HMDA 1ZWIA 5IK3A 2I9LA 5BRZB 1Y07A 3PQYA 3WNMA 1K3IA 4YHMH 2HT2D 2J1KA 3MBEB 2EAEA 3RKPA 3QEUA 4PMFA 3VGAC 3OAUH 3LZFH 1YJDL 3INUH 2XYCA 3CPLA 3FUFA 1IGTB 1Z9SB 4IBLT 4F9PC 5HDQL 2OYLA 4ENEC 3DX9A 1DUZB 4Y9FA 3TBYB 2PW2B 4Z5RB 3UX9B 4XOAA 1LO2L 3EYUL 1OLZA 2YEZB 4U1MA 3CHPA 4OTXL 5DMYA 5LXVA 1DR9A 1BZQK 3FB8B 4TQEL 1I7TB 1U2YA 5DHXB 3PWPA 4ZS7L 3C2AL 3W56A 1BFOA 4L4VB 2BFVH 1IKNC 4LPCA 2A83A 2YGOA 4IK6A 1RPUA 4WNQA 3MLXL 1S78D 1MCBA 4LCVA 4RMSA 4GQQA 2BNRD 4POZD 5DD1L 4KKPA 3T6ZA 5GRWA 3CPUA 3IDNA 2R4RL 3MCYA 3S5LG 1ZMYA 4TF4A 5CCHE 3HG1A 1JGVL 2RFXA 2VYRE 3PHQA 4P2QE 4WTQA 1YLBB 4HD5A 4JMXA 4J4PD 5KBLA 3FO2B 3VGGA 3PAVA 2ZE0A 2AJUL 3N85L 2P80A 2EACA 3IKCA 3QIUD 1I7UB 2XKUA 1M05A 1Y6NR 2R69L 3EBIA 3OKLA 3GB7B 4Z3HA 1IKOP 4KNUA 1HEHC 3PHOB 1DBKL 2CGRH 4WI8A 4G1EA 4BFIA 2EVIA 4PRDA 3PV6B 5CILL 5C09E 2I5YL 3MACL 4P46B 4EF3A 2FATL 4KO9A 4ZD3L 5CZXC 4B3VA 2QKIC 3BFQG 3RWGA 5F9WB 4NRYB 3WTYA 1DDHB 1G7JA 4FQXA 1HKFA 3T6XA 4XMKL 1Z3GH 4MAUH 3TA4D 3ZUNC 2EXWC 4MCZA 2D2OA 3G3LA 4GAGL 1G7MB 4ZMWA 3UYPB 3HZVB 2EE0A 1LP9E 4OCLC 2BC4B 1J8KA 5DK0A 4U6YB 5KSAB 1JXKA 4NM8L 3U79A 3KJ6L 1Q1PA 3SPVB 3CFIC 1IEBA 2EEFA 3BKCH 1KTLB 4HIIB 2IPUK 1G7LA 3NSFA 4K71C 4WNJA 3VDAA 2UX6A 3A67H 1U91A 4PJAF 5FGBC 1B2WL 1CLOH 4BFOA 2FWSA 3CHXA 1O7SA 2Q7NA 4KVCH 2DLGA 3PAUA 4J6RL 4C56E 3PJSA 4XI5C 4DOHB 4U7SA 2F74A 5JIKA 5ICXB 3OHMB 3H0TA 1X5JA 2HXAA 4IIQB 5DUMH 4AV4A 2X09A 3F00A 4X8GA 2B1OA 4GSDL 3DXAA 4HK0B 4S11A 1O9WA 2IWKA 4NNXB 1NLBH 4P2RB 3MPCA 5AVUB 5DQ9A 1BQHG 1JMZA 4LEXL 3RWJA 3K6NA 3P40A 3F7VA 1ZIAA 3R1GL 3IWVA 3QUYC 3VI4B 3MXVL 4XB7A 5AOKA 2VXTL 3OPZL 1WT5C 2NY2B 4G8GA 1RZFL 3Q44A 4BRVA 2VXUL 5E1IA 3I75A 3QDGD 4YDLC 1G7QB 4YDIH 1YEFL 4FNQA 4L8CB 4QYAA 5IHZA 2QSVA 4X4KA 2P1YA 3JZ7A 4IKKA 4Z77B 1JGUH 4IRJC 4YNYB 4ZMTA 2VQUA 4ICXA 3SKUD 1A8JH 3N1QC 3NRPA 5D5MF 1ROCA 1ZTXL 3S3DB 3D87B 2V3DA 1M7UA 4Q58C 1RV6X 4MDJB 4K3DL 3N55A 3SN6N 1RU9H 4OZHB 1RULH 2BWDA 3HVNA 1GYCA 1FVDA 1HOCA 5GSVA 3IRPX 1T04B 2WWKT 4YO0A 4ISVA 4MBRA 5CMAA 3QRGL 4H20L 3SZ6A 1A7BA 2VIRA 1FGNL 5TH2B 5EBLA 4Z7VA 2PXYD 4NC0B 6CGTA 5KVGE 4FFYH 3UZVA 2A9CA 1IRAY 3X3FL 2NDFA 5D7LA 4QNPE 3THML 4X4XB 2ZCHH 3VFPA 1CZ8H 1LMKA 4FXGA 3KEDA 2GABA 4E2OA 5I9QC 4X99A 4XO8A 3F65A 5BVPL 1M71B 2OMUA 2W8CA 4J23A 3WUWG 5DC9B 3QHFH 2PR4L 1KT2B 5AVRB 1JZHA 2BLFA 5C0CE 1HDMA 1LVEA 3MRQB 4R0LC 1RZ7H 4JY5L 1S9XB 4KDVA 5FK9A 3R4DA 4HZ1A 5I1EL 3F12A 5HVWA 2ZWLT 2H0FA 3ES6A 4HPYL 4MAYC 3C5ZA 3RVXD 1XFPA 4JVUA 4NN7C 4X5WB 2LABA 3NA9L 4XH2B 1OAZH 3RX5A 3CLEL 2P7TA 4IOSD 5A3IC 1QRNB 4LQFH 5IMLB 3OHXA 1Q0XL 2QPDB 4F33B 4WFEE 3TH3T 3ARGC 1EEYA 4FFWC 5I76B 4JN1L 3VXSE 5DJAA 4OIIL 2B0SH 4P9HL 1I1AA 4A38A 4I2XB 4XRCA 3S35H 4YHYB 2XWXA 2EIJB 1ED3B 5AUMA 5KVFE 2A38A 3PP4H 2PUQT 1NEZB 3KBEA 5IEHA 3VD2A 3HS0C 2FX7H 2VDLH 4N0CC 3JWOH 5DR5H 3S34L 4HKZB 5FB8A 5I1KL 4RGNB 5DGRA 5F3FA 5DJXA 1BREA 3TU6A 2D03L 5ALCL 5D7IA 5D2LA 4UF7C 2Z7ZA 5FUZL 3C6SA 3U2SA 4AMWA 5AKSA 3F7YA 1D5XA 4P2CG 3FT2B 5A6IA 2EEBA 2CJUH 4ODSL 4U33A 3KGUA 2UY7A 3SDAD 1NIBA 4PVNA 1T83C 5JOFB 4X7TA 4PRHA 2IH9A 4QRBA 4JE4B 1A7RL 4GMSH 1E43A 2EZ0D 1WZLA 1OAKL 2NCMA 3BWUF 4JS7A 2Y5TA 1RURH 3ZHDA 4OIFA 4FQIH 4GW4A 4IHOA 4Q6IC 3HC4L 1T1WA 4BRJA 4KZCA 5K9OB 1OGTB 1OAQH 1IGFL 3T0BA 2HVKB 3MODH 3QFDB 3OB0K 1EXGA 4L3CA 3MNWB 3EH2A 4HU8A 4PRBA 1I1RA 1UJ3A 2F68X 1S7TA 3GJFK 1L5GB 1TJIH 1KG0A 2ZUSA 1K6QH 3QR0A 1NPUA 4HU2A 2E27H 5CD3B 5CIPB 2V7NB 3WTVA 3MRKA 1R46A 1EFXD 1M56B 1R3JA 3WLBA 4O5LH 2ZXQA 4KXZI 3LRSA 3QIUA 4P4KB 4WW1A 3RAJH 3IFPB 1JPTH 3CZGA 4AT6B 2A9BA 2VC2L 4FDWA 3UG4A 5HGGS 1TQTA 1F11B 4OFPA 5TE7H 1VCBC 4JRLA 2V7HB 3EYOB 3ULVL 3RUGF 15C8H 2DQDL 1FGVL 4MASA 4P4RA 1UACL 5EZIL 2YEQA 3OC8A 2QHRL 3QZNA 1QATA 4Z18A 3MAWA 1ACXA 1BZEA 3MRBB 4W4OC 3WIHA 1QP1A 4HGWB 4OJEH 2W88A 4P5SA 3IGAA 5B4MC 1UEMA 1DEEA 4AQAA 1CGYA 2XNAB 5E8PA 3GSNB 3JWNH 3CLWA 3BRFA 3U46B 3NP3A 4PAZA 4XPTL 5L7XH 3LKSB 2R0LL 3ARBB 1SJHA 5GRVL 4FQHB 1M2OA 1E3XA 4QLWA 1F90L 4HLZH 3BKMH 4TSCH 3QNZB 3SQBA 4ZMXA 1YY9D 1HS6A 4ZUWA 3D33A 1FZOA 5I8CA 5E9DD 4G7QB 1RHHA 3MOAL 4MQXD 1FG2A 5L9DL 5TFSL 1QA9B 1PAMA 2AV1B 1A3RL 1NCJA 3ABGA 3DIFB 4JO4L 5CUSL 3CIQA 5ILTH 1HIML 1TF4A 1GPOL 1QLEB 4F2MA 1RXLA 2ERJB 5DLML 1LE5B 3CDYA 4GRLC 4OB5L 4Y5VA 4EMZA 3GUTB 1MDAA 3LXUX 1ZSDA 4JJ5A 4M03A 4NUMA 1WAAE 3ULUC 5FOBA 3ZTNL 1RJCA 4TSAH 1OPGL 4UDUA 1CFQB 1YYLL 1MI5D 3FU8A 2APFA 5F9OL 3QDGA 3B34A 4G3YH 4M1DH 4Z9KB 1A7PL 1JF5A 1GW0A 1B4RA 2D4DA 4ENZA 2XN1A 3NCXA 1YPZF 1TNMA 1V8HA 1UWFA 4QCIB 1SM3L 3NCCB 3QP3A 1VFBA 4M4RA 4UQAA 5BW7C 2JJUA 4OLYL 1RPKA 4XBGB 4G8IB 2N1KA 2Y7LA 5EORL 3Q2VA 3WNLA 2CIKA 3T3ME 3ROLA 3ZDXF 4XPFL 2R56H 4GXUM 3HE7D 4PYGA 1AI1H 5KSUB 2WLIB 5T5FH 4G5ZL 3VDCA 4A2LA 2W60A 5FDWA 2JKWA 4F1ZA 4ZOBA 2NW3B 2C1OA 4QKTA 3HE6C 3ENEA 4B53A 2DD8H 3QPXH 1Y18B 5TQ0L 4JQVA 1OLLA 3AS0A 1FIEA 4JPSA 3RIFF 4E5XG 3S4SB 3GYRA 3U4KA 3DSFH 5T1DL 4AQ1C 1IB5A 4Y16B 4AKPA 2DQIH 1SBSL 3MBXH 3T8MA 3UPRB 4YJZL 3FB7B 5I0VA 4PJHA 3V0IA 2H26B 5JIMA 5HI4D 4Q7DA 1UCTA 3V4VA 2BVQB 2CO7A 4QTHA 5I73C 3FH8A 3I02B 3F7QA 4Q2ZB 3WUZA 3HI1B 3OC5A 1PLBA 5EV7A 4UQBA 1EO8L 1U95A 4JHUA 4DAGL 3D39D 4QXUL 3PE9A 3B6SA 4FTVA 4XVTH 3NP4A 1HHJA 2J2ZB 2XXCB 3VA6A 1NWOA 4JLRB 2JIXB 3HVDA 3FQWB 5T3XL 5I30L 2OL3H 1A8ZA 1PIFA 3HNTL 5KYUA 4UAHA 4YHPB 2DS4A 5KEZA 5ERWA 4MD4A 2DH3A 1NFIA 3KPQA 1W8OA 2EABA 4M8UA 2CLVA 3QNYB 1NM4A 3VWKB 3BO8B 4N8VG 2EIKB 3SQRA 4MJ4A 2GJ6A 1URLA 1IVLA 1GGCH 3CC5B 4OFQA 4JPIA 4U1HB 5CD5C 4MJIA 2ZX6A 3AC0A 3ELAT 1FH5L 3GBMH 3QORA 4WU5A 3SGEI 2H6PB 4FJ6A 2VUYA 3H9YA 1NLDH 2IANB 4XBPB 2BY0A 2CLRB 5GGSB 4AEIH 2VW7A 3SDAA 5CM1A 2BSCA 5J6HB 1IC5H 5C0FA 5L6YL 1VPOH 2H32B 5CP3H 3FF7A 3FN9A 4LEOA 3ZE0F 3JBG7 1R5WA 2VDRB 3OAYH 4XNXL 3ME0B 3O3AA 2B4CC 5ANMB 2AJVH 5H35B 3U30B 4ZZFA 1CS6A 2NXYC 5ETUB 4NLHA 3ML8A 3SPHA 1INEL 1E7UA 3ARSA 3O9WA 1XH3A 3KCPA 4BWTA 1T0PB 2WBJC 3KXFB 3O6FB 2AJXH 4NDMA 5DHEA 3PJLA 4K5OA 4XVSH 1PS3A 1QRKA 1W16A 3S35X 4AQZA 2XJLA 5DFVC 4Y19E 3FU7A 4XCNB 1CBJA 1ACYH 2EDRA 3I6LD 5D1QA 2ZSVA 1TFPA 5CJOH 1IIKA 3MJ9H 4KK9C 3LNDA 2JI1A 3A6OA 3C6LD 2ZXBA 4BSVB 3MXWL 2D3VA 4Y2DC 1NCOA 1CG9B 4XP9L 5IBUB 5KVEE 1BJ1H 3L3OC 1MCPH 3RYMA 5FYLD 3FU3A 4NO2B 2HJFB 2NYYD 4GBXB 3EXJA 3US0A 2CZNA 1LWHA 4OAWB 5DMIH 5GRUH 3VD5A 4ADGA 4D0BA 4GQPH 4PWIA 4UINH 2VR5A 3NZHL 1A7NH 2IBZX 1JDAA 2OK0H 4KTDL 4DUVA 1EVTC 3HPLA 5FLUA 2GC4C 4ZQTA 4UCFA 1P4LB 1NAMA 4PHXA 1NFDF 2JK5B 1IM9B 2M1KA 3KYNB 4PJGB 3WIIH 5JXED 5E2TH 1KFAH 1CYXA 1SN2A 2BZ7A 1Q0YL 1G9NC 2HA1A 4JX0A 5JOEA 5CP7A 2JI2A 1ZHNA 4CAGA 1S9YB 4PJAA 5E4EB 4G71B 3TLRA 4IIZA 2GTZB 5AOZA 1I8IA 2AANA 1UA3A 2V2TA 3DV4B 2IH3B 4H26B 2RACA 4KAQL 1THAA 1AXSA 2AZUA 1AD0B 5IJDC 4BZ2L 5IFAL 2PCFB 6PAZA 1U8IB 1WBZA 2F54B 1E90A 4IBZA 2WC7A 4XHJC 3MUY1 3LKPA 3TPUA 4DP5X 1XBRA 2R39A 3EO9L 4FXLA 4WNSA 3PGFL 1HH9A 4H2CA 4HC1H 5EC1B 2LT9A 4OCYL 4C54A 1BVOA 4JY4A 3WHXA 3QQDB 2GITA 3IVKB 4QRTB 1N5AB 2DEYX 4YDJA 3SOTA 3FXIC 4UNTA 2F7OA 5E7FA 1A4JB 3A0OA 3MLSL 1BAWA 3DMMD 1HCVA 3GSWA 2D9CA 2IADB 5LN8A 3L4TA 1NAKH 3W0WE 2YXFA 2OTUB 3IFLH 4ZAKD 1J0KA 4LDOB 2IBZY 2NLJA 4HXBL 3IDMA 3ILPA 1X9QA 5D5MA 5DTFA 3WEXA 5J6GA 2KQMA 3I9GH 1BIHA 1X5AA 4QOKA 1WIUA 4FI6A 4F7KA 3X1NA 5CIPH 3CHSA 2CPCA 3BUYA 5FX3A 3AW5A 1QPXA 4KXCA 4I18B 4NP4H 4S1DC 1O0VA 5IB3A 2ZJSL 2O5XH 3H9HA 4ZFOB 4EBQH 1QTYT 3AAZB 2HMID 5F21B 4LP5A 1F6LL 2V9UA 5FDYA 2ODIA 2FJHB 5KYYA 2OI9C 3IE4A 5HYIA 3OG4B 4PGZA 3O3DA 2QTVA 3HHSA 3ET9F 2D3LA 1MJUH 1TZIB 4UM9D 3VAEA 2Y25A 4AEHL 3BAJA 5FOJA 3QRBA 5LAPA 3GMNB 4NOFA 3V0VA 4H1LG 3C5JA 2C4FT 3PRZA 5IM7B 4JGJA 1CQYA 3T0WA 5F1NA 3KCWA 3QUZB 1U8CB 2NTFB 12E8L 4EUPB 1WTLA 3T2NH 4GLRH 1CT8A 1HH6A 4QO1B 4L0PB 4TQHA 2W59A 5LGHL 1Q1JH 4JN2B 3OLDA 5FUOH 1IT9L 1QFPA 2IPKB 4HFUH 3TF7C 2Q86A 1R3IH 3G6DH 3MRGB 2D3NA 2GBUA 1N6VA 4WHTB 2YPVH 3FTVA 3TYFB 2Y24A 3BX7C 3FBQA 3I6KB 1NMCB 2IF7A 3AS3A 3SD2A 1JTOA 3SDDB 1LO0H 2HKFH 3MRMA 3K72B 4RQQB 4WWKB 1MCCA 1BCIA 2ODHA 4F7CB 1FRGL 1BYOA 2FB4L 3UP6A 3CFDA 1ZA3A 4TMPA 1HSBB 1H5BC 5JIIA 2AEPH 3WKMH 4DK5A 3BEVB 1HYSC 3QJHA 3TBWA 5IW1A 2EP6A 4HHGA 3N40P 4YC2B 3X12A 2K8QA 2X1PA 5IR1A 3HAEG 5F6HJ 5CJBA 4KKLD 4DP6X 2PP7A 3W2DL 5DEFB 1ADQH 3DROB 1HYRC 4WUKH 1OTUC 4EE2A 3IDIB 3UPAA 1C8PA 3I2CL 5DFWH 1ZT1B 4PJ8D 5DVNA 4GAJL 4U1GC 3LB6C 2R2HB 3GMQB 5ENWA 4DCQB 1S4IA 4KMLB 2DMHA 4OQTL 4OLUL 1URZA 3GMRA 3MUGB 4UB0H 2R23B 4PJIA 5C0IA 3RTQB 4G8EA 2RHEA 3MLRH 3O2DA 4FXKB 5CJ5A 3L3IB 3I6GB 5CGYC 3VA2C 1JL8A 4FLOA 5EUOF 5J3HC 5BNXD 5J13C 4MXQC 4WTZA 4TL5A 2HT4D 4H8HA 2WINA 4JM2D 1C08B 4DK3A 3HFFA 3L17A 4PJ7A 2ZYSA 4LVHC 2M26A 2X0UA 3MKGA 5KOMC 2IFGA 3NH7L 4H8WC 4RCAA 4GIAA 2Q87A 2J56A 1AH1A 4G6KL 5F7MC 2XACC 1SBBA 3RFZB 2ATKB 5CO1A 2WXMA 3GPEA 1AG0A 3A47A 4H44C 1SLXA 3LRMA 1QSEE 1LNUB 3E9TA 3FT0A 3M1BB 3VX0A 5CBAA 2HP4A 5KVFL 3MRPB 2UVFA 5D1XD 2J6EA 3BAWA 3CG8A 1KNOB 5HGDA 1JWMA 2WQVA 2EXSA 3D69A 4A39A 1A66A 4A2GA 3RUGA 1QFWI 3DVNA 5D6CA 3PLYA 3QS3A 1YRKA <