5C0NC

Development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
216
Chain Sequence
QSVEESGGRLVTPGTPLTLTCTVSGFSLSTYYMSWVRQAPGKGLEWIGIIYPSGSTYCASWAKGRFTISKASTTVDLKITSPTTEDTATYFCARPDNDGTSGYLSGFGLWGQGTLVTVSSAKTTPPSVYPLAPGAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, adipocyte
publication title Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid transport
total genus 40
structure length 216
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nC01
3DTXA 4HFUH 5DMJB 2WV3A 3GSXA 2F58H 2OP4H 5T1KD 3GI8L 4L4TE 1D5IH 1C8PA 1FFOB 4L3CA 4YFLF 1RU9H 25C8L 1MUJA 3LB6D 4F9PC 5HI5C 2ZUVA 3KYMA 4JRYD 3IDNB 4OLYH 3DETD 1UZ8A 4MS8C 5D1ZD 1GHFH 1HHKB 3RWIA 3VJ6B 3QEUB 1NFDE 4HC1A 3HE6B 4HUVA 3H7BA 4IS6B 4ZD3L 1S5HB 1R3IL 2AJZA 3ARGC 2RB8A 3MRGA 1JRHI 2B8OT 2CUMA 1IAII 4PJEE 2YEZB 5C08A 3UJTL 3E1F1 4KKAC 3ZHDA 3QCUL 3RU8L 2JJTA 3TBWB 3G9VA 1LO0L 1LO5A 4KMLB 1WV7T 2IBZY 4LCCA 2HT4D 1FLTX 4HZLB 4GKZA 5F7DB 4ODTL 2BVYA 1F6AB 1R5VA 1XMWA 4H0HB 2JB6A 3KHOA 5C92A 4N8VA 3V5DA 3SN6N 4MB3A 1JGEB 4WUUB 2O5ZH 3AY4C 3B9KC 3UC0H 3OG4B 1WCBA 5FGBC 4PJGB 4EN3C 3MR9A 4L4VA 1E6JH 4NHCL 3MO1B 4NT6A 5E24E 2ZCKL 1A4JB 2J88H 2DTML 2YD9A 3BW9A 4JE4B 4M62H 2YD2A 1U91B 4TUJB 4U1KB 5IQ7H 1DUZA 3S88L 4LHUD 3U4AA 3SDXF 3IXAB 1MHPL 1U8MA 1ZGLM 1SYSB 2EDWA 3CFCL 1G7MA 5FYJL 5BS0D 6FABL 3T0XA 1ZT1B 3D3VB 4TVPE 1AXSA 3A6BH 4XC3H 1MCJA 3ARXA 1FZJB 3MNWB 4NQCE 5FYKH 5FECA 3HG1D 3REVA 4QXGH 4QHKI 4J6RL 4BZYA 4KKLD 3T0BA 2GJ6D 1PG7L 4AEHH 5HHVL 3SGEI 2DTSA 4R4BA 4MNQD 4P49A 1LDPH 4GAJL 4N90D 1RFDL 5AAMA 2OXHA 4F7MA 4NGHL 4Q9RL 4OCSL 1KEML 1NGZB 2ZSWB 3J7HA 3LKOA 4LFHG 1D6EA 3QDMA 5KSBB 1LK2B 1RZGA 5IEKB 2IQ9H 3ARDB 2IANB 1NGXB 3UBXB 5IVOA 4R97C 5H2BB 4KJYB 1T0MB 3SO3C 1NCWH 4ZFFA 1YEDB 3UYRL 2HLFC 4ELKB 4G8FA 2E7LA 3CD4A 3SCMD 3OZ9L 1CLCA 1J8KA 1RUMH 5KN5B 3D85A 4ZNCD 1ONQA 5AZEH 3D69B 4K55A 3EFDL 4JFZH 5CS7A 5ISZE 1U8OB 3HPJA 4I1NB 3WDJA 1K3ZA 1EERB 1U8KA 4ZUTB 3T3PF 3KLAA 2AVGA 2B2XH 5FGSA 4AEIL 4KKCD 4OI7A 2BC4A 2EDFA 1XIWD 2JELH 3DECA 4M1GH 3VW3L 3UDWC 2VDML 4JM2A 1KIRB 3WNLA 1R3KB 5T1DH 1J87A 2ADFH 4QWWD 1SEQL 2QQKH 3MRQB 3ARBB 4L8SB 1NSNL 4QRRA 3HRPA 3MYJA 3SHSA 3UJJH 2XPGA 3BKYL 2D31B 4QT5B 3AS0A 4JFDA 3QT2A 32C2A 1A7QH 4YO0A 3LD8B 5LCVH 1MFCH 2A73A 4J3SA 5CEYA 1WZKA 4I0PA 4WW1B 5CHNA 1AHWC 4XMKH 3PQYB 1T2JA 4QRRE 5CEZD 2Q7NA 4O9HH 4OLWL 1J5OL 3NFNA 3OXRA 4G42A 4M3JA 3PDOB 3T4AB 5T1MB 4JFDE 3PNWA 4L4TD 3QNXA 1EEZB 4J8RB 5D7SL 5IW6A 4FRWA 2VDPH 3LN9A 3TESA 3ALPA 4GMSL 4CMHB 5CJ8A 4JGMA 1MAJA 3DVNB 4KK8D 3QHZH 3JXAA 3S3JA 4NSKA 3DX6A 4M5YH 4GKSB 4JQXC 2X4SB 1S7VB 1PQZB 5CKGA 5FA3B 5DD6B 1RIVH 4DGIH 5I16B 1YPZE 5I8EA 1BQHG 1ZLWK 4RMRA 1N6QH 2ADJB 3IFLL 3WHXB 3RDTB 3L95B 4JR9L 3WFEL 4P23D 3VGHA 3GI9L 1M1SA 3EOAB 2YZ8A 3HI1B 3JV6A 3QH3A 2Z93A 3TIEB 4JKMA 3X11A 2EIZB 3QEQB 1KJVA 1K9TA 5C08D 1KENH 5JW4N 2QQQA 3L1OH 4IDJL 4P4KA 1S7XA 3OXSA 2ITCA 3AMKA 5D6DA 1MEXH 3ISWA 4PD4J 1GGIH 1UM6H 3G6DL 2J8UB 2J12B 4H5SB 3R1GH 5BJTB 4XP1L 4M00A 4IRSB 3ROOB 4K7PH 4PRNB 4WNQA 1T0PB 1QA9A 5DZOA 4L4VD 1IBGH 2YPKA 4JB9H 5F6HJ 3JUYA 4OCRL 1OP3H 5DUPH 4MA3B 5DHYB 4G8EA 2WP3T 3FB5A 5I8OL 1HHGB 4GRWE 4U1IA 3NCBB 4GXVH 3N1MC 1TCMA 4PJGF 1HNGA 5TH2B 2PW2A 2APVA 3F7PC 2R0KH 3SY0B 2FSEA 5HVWA 4LKXB 2MNUA 5DC4B 4JZNB 4O5LH 1BECA 1I8MA 4WTZG 1E4KA 1DTUA 1I8LC 3DXAE 3IDYC 4Q6IA 2NY1C 1IC5L 4PY8J 1F3DH 4CKVX 1XF5B 4DVRH 3ILQC 3PWVB 4HWBH 1G7JA 4U1HA 5E8DH 5SX5K 2P47B 4IHOA 1R3LB 3QDMD 1HHHB 5J8OA 4P3CL 4X4ME 1KIPB 2OR8A 3FN9A 4POZC 2FATH 2ADGA 2AKRB 4QCIB 1TPXC 2DKSA 2GT9B 2EDXA 3FQXA 2FNBA 2R0ZH 3D85D 4WV1B 1U8JB 1G6RB 5KSBF 5IF0B 2E7CA 4WCYL 3V79C 5FCUH 1REIA 2P5WB 3TNNB 3LN5B 4XP6L 1HWHB 4XMLL 4BZ1L 1S9VB 3JTTA 3QFJE 1UB5B 3OKYA 4M7LT 3WO4B 4CADA 2WM0A 3FT2B 3IJHA 2YPVH 1HCFX 4FFZH 4L4JA 4JM2D 5KZCB 3X13B 3MLYL 4ZO6A 1QSEE 5L7XH 4N68A 1CYGA 1YJDL 2P8PB 3CGTA 4W6WB 4FQXB 4QRRD 1I7UB 4YFLI 2FLRT 3IGAA 2MKWA 3HHRB 2RHEA 4PJBF 3EW3B 5E2TL 4O2CA 4JFDD 1NDMB 4CW1A 5EC2B 5I2IB 3D87B 3IB4A 5KVGH 1JPTH 1WAAE 5GGUB 3GBLA 4I0PD 5EDXA 4WO4B 1BQLL 2XG4A 1QRNA 1FNSH 3OR7A 5BQ7A 4OZIA 4NDMB 3GSNA 3ET9F 2B20A 4OZFH 4PTUB 3P40A 2CUHA 1NAMH 1ZT7A 3L3GB 5BOPA 2UUDH 2A6KA 3DURB 5C1MB 4MDIA 4Y4KC 1KB5B 4M8QB 1D5ZA 4M43L 5HYJA 1DUYB 4KKNA 2A1WH 1Z0NA 1BVLB 3CVIL 4AIZA 1AO7B 5EU5A 4K7PY 3RWFB 5F6IC 4PJDE 2X2YA 1ZMYA 3QJFB 4OZIE 5E9DB 4JFEA 4UB0H 3U7YH 3PGFL 4K7FA 4K71B 5CKAA 5IKCA 4PJFB 4P57A 2H45A 4U31A 2BSRA 1OF2B 1JGVL 3SDYH 3T4YB 4YR6B 3U9UA 3PWPB 4OF0A 1YN7A 4EDXA 1BWMA 3C6LB 1DLHA 3PWJA 5IJVA 4LCWA 1KV3A 1ZHKB 3VXMA 5JOFB 1T83C 4DKDC 3LRSA 2CRZA 4JFEE 5F3BB 4U3HA 2HH0H 4XPAH 2F8OA 1K5NA 4MA1C 5T33L 1NBZB 2F5AL 4FXGB 2RCSH 4X7CC 5C3TA 3H9SE 1FBIL 4YBQC 4LNVA 1U6AH 3RVTD 3MODH 3AMLA 5IBLD 5KS9E 1P4IL 3FT3A 4M3KB 4R0LA 4JLRB 2BOCB 2QBWA 3TT1H 4P4KD 4JY4B 1EHLH 5GISL 4Y2DB 4JVUA 4Z95L 2H2SD 4JANA 5L6YH 3U2SA 5DD1H 1DVFC 4UDTB 1QO3B 4X4XA 4APQB 3PE9A 3SE9L 1FVDA 3L5JA 1FFNA 3MREB 5HD8C 2HVKA 2XN9A 4OKVA 1I8KB 4P2OA 2R4SL 5I1HH 4H8WH 3E8UL 1UWGH 3U0PA 5I8KL 2EDYA 3X3FH 4G9FA 4ONGH 2J8UF 4CN1A 5CEXB 4X0KA 1YMMA 5GS0D 4P46A 1DEDA 2DQGL 1PSKH 2H9GA 3D25B 2OBGA 3M8OH 4JN1L 1YEHH 2O5XL 3WFDH 2AABH 4LRIC 4DW2H 5KVDH 2I5YH 3QEGH 4KJWD 5LBSH 3ZE0E 1EFQA 4IJ3B 4Z7VB 1ZLUK 5HYSA 2CMRH 3S34L 2RIKA 1YEJL 4F57H 5DS8B 5IM7B 1EDQA 4YE4H 2G60H 2BVOA 4HGKC 4JO4H 4NPYB 3U0WL 5LG1A 2RGSA 5FYJU 4MYWB 2CDGB 5KVFH 1JYWA 1I4FA 4I13B 4F7PA 3HLAA 1ZGLA 4HV8A 4KZDH 2ICCA 3O11B 3LKNB 4LCIH 3RX8A 1EZVX 4NQEA 1AIFB 3W0WE 3C5SA 4OLVL 2AS5M 5HI3C 5LXGL 3VCLB 1CFSA 3EDKA 5GGTL 3U46A 5DD0H 3S37L 2B0SH 1F6FB 1IGFL 3HNTL 2BJMH 2P8LA 1HKLH 1RZFH 1WCQA 1MIEL 3BP7B 5GS1B 1HHJB 3MRLA 1MI5B 2YOCA 4U1GB 1GIGL 1BX2B 2X89A 4GLRI 5TE6L 3WHE0 4G8GE 4TULH 4FXKA 5L0QC 1E6OH 4JVPA 1QUNA 5CBAB 3EYQD 1TQBB 4HXAH 3HCVA 1EPFA 4HWZB 4LPYA 4H8WC 3V0VB 4MMZC 4N0YL 1QRND 2Z92B 2YK1L 1TZIB 3GSQB 1I1AA 3ILPA 3EJZD 1HH6B 3E6FA 1GGBL 1F4YL 1ZTXH 5F7LB 2DLEA 3R8QA 2NXZD 1X5HA 4A6YB 3WJJC 2E6JA 3I50H 1F4XL 2APFA 2X09A 5HYJD 1T89A 5I1JL 3QIBC 5JHDB 2FZ3B 3K81A 4BSWB 4GW5A 3U30C 1FGNH 4MD5B 5SX4H 4CN4A 1UYWL 4GAGL 3JBG7 3IAPA 1S9XA 1GZQA 2ADIA 5DGRA 2R69H 2UV3A 2I9LB 2ZUQC 3TO4A 4JFED 4PRDA 5HGAA 2Y6SD 3DO3A 4NNPH 5DK3A 1CL7L 1UADC 5D2NA 4HUMB 5T3XD 4PG9B 4ZS6D 4X7TA 3C08L 3DMMC 4PB0L 4U49A 2QR0B 1JZ4A 2BRRL 1QFHA 4LCWD 1R5IB 3VXMD 2DLIA 3ULUF 4L9LC 3QQ3A 1IKFL 2PXYB 5KVEL 1I9RH 5DK0A 2VAAA 4WI2A 3I6GA 1DFBH 4PJFF 5CSBA 2N56A 3OV6A 1UEYA 3R0NA 3FMGL 2IFFH 2F5BH 5FHAL 3GUTA 4HQQL 3DUHA 4J3UA 5IWLA 2ZCHL 4MWFB 4TVPH 3C5ZB 4D0CB 5IT2H 2Q76B 5INDA 2E9BA 3MJ7B 4HXBH 5GS2D 3RY6C 3UJIL 4YEEA 4ZXBB 3F7QA 4DOHE 2PYEE 1NKRA 4NKIH 1TZGL 3H3BC 3S96B 2V7HB 2ENYA 2P48B 1ES0A 3F7VA 4Z7UA 3SDAB 1Q38A 3PGDA 1FZMA 1T1XA 2CH8A 4DAGL 1DL7H 5EBLA 4E42B 1HIML 1J0KA 4PJCA 2XN9D 4P2OD 5FO9A 2CKBL 2CDEA 1IGTA 3AREC 1YYML 3SE3A 5DMKB 4G9FD 3HAEG 5IHLB 3SGKC 1EXUB 1YMMD 2GK0B 3GSVB 4PLJC 4UQ2B 1FIGL 5I71B 3AM8A 3UBXI 4X80H 4G9DA 4PG2C 4NWTH 5TE4L 3HPLB 2GFBA 5JXAL 4JDZB 4OD3L 4Z7QF 2HYMA 3WS6A 1MAKA 2HTKC 3RZCC 2FR4A 1QFOA 3PL6B 3RX7A 3B9EA 3WV0A 4MX7A 4YNYA 3EYSH 3FN0H 3G5XA 3I85A 3O6FA 3RAJL 5B39G 3OWEA 4U1SB 4XVSH 4F33B 1F45A 1BJ1H 1NLBH 1N7ML 4WRLA 1KTLA 2DM2A 5JPMB 2CIKB 4QOKB 2HFEA 3AS1A 4Z7VF 4DK6A 2ZCLL 3VFRB 3CU1A 1JGLL 2HFTA 3QB7C 1RZIA 3DROB 4Y1AA 2OI9C 3LPGA 4ORGA 3BYYA 4HUKB 3I6KB 3EYUL 2YRLA 2XA8H 3JTSB 1KJ2A 1FHGA 4NQED 4KZEH 1IFHL 3T1FA 1U8LB 2JJVA 5AG9A 3PP4H 4OZHA 5D9SB 4NUJB 2VZSA 1AJ7L 5CEZL 5SV4A 1OT1A 1ED3B 5EIVA 2LFGA 4RGMC 3C8HA 4GAFB 1CD9B 4Z0BL 1HE7A 3L3HB 1HXYA 3MRRA 4RNRA 1ND0B 4EIZC 3VXSB 3L5WA 1YMHA 4H20L 3OKKB 2CUIA 2QKIB 3HMXH 2NY6C 4X8JB 2XWTA 4YHZH 4OZGB 1Z3GH 1FNAA 5DJAB 5ABDE 5F7UA 1NGWA 3GMPA 1V3JA 3QUZC 4PLNC 3O3AB 4HKZB 3QQ9C 5DC0A 4WW2B 3A6OA 4O02L 3FCTA 1OTTD 4WEBL 1AGEA 4QXUL 2F53A 5IK3A 4JREB 3ARYA 4X6CA 2FO1A 4NQTA 1B4RA 1KJMA 1NCCL 4TUOB 2C3WA 2DD8L 4P2YA 1AP2B 1CU4H 2J8OA 4YHNB 1I1AD 5IROC 5JW3H 1NC2A 2VQ1A 3WD5H 1VEOA 2EO9A 35C8H 2F53E 3QULA 5SWSA 1W0WB 3ZDYE 4PJAB 1TMCB 1DQML 4MJ2A 1PG7W 4JQIH 4FXLA 5IP4A 4LVOC 4X6DE 5IMMB 3K2UH 4L5FL 2R4RH 4LQ1A 4X4YB 2HAZA 3G04B 3TN0A 4GW4A 3MRFB 4M93B 1U3HC 3B4NA 4TPRH 1T1ZA 1PLGH 3TO4D 3VFVA 5FYKD 1HSAB 3QG6B 2H6PB 4XXDB 5DQJB 3QAZC 5HGGS 4O4YL 3W9DB 4RMWA 3LRHA 3NA9L 1MCKA 4PGBB 2HKHL 4TRPH 3QRGL 2BCKA 2B39A 1BFOA 4HWBA 1H3PH 3TZVA 2Y36H 4Z7WB 4LLUA 5CGYD 5BV7B 1P9MA 2XG5A 4RFEB 1IM9B 4WWKC 1KC5H 4FZ8L 2FX8L 1A6UL 1U93B 3E6HB 4ODBD 3GHBH 1OW0A 2AJYL 5I74C 2FJHB 5D7JC 2FYYB 5IB4B 3DUUB 1JNHB 4EVNB 4BA8A 4P0DA 1YNKL 5GRYA 5I1IL 2AXFB 3CFEA 1KLUB 4GXUN 4P23B 2FX9L 2C5DC 2HJKA 5EIIA 1JPGA 1TDQA 4HUVB 3H7BB 3KG5A 1JNNH 4NZDA 3RNQA 2LU7A 1HQRA 1HCVA 3QPXL 4E0RA 3MRGB 2V2TB 4PB9L 4XNQB 1W72H 3CVHB 3MZGB 3QDGA 2R0LL 2BVQA 1MJJB 3QFDA 4M9OA 3MV7A 5AUMB 1LO2H 1B0RB 1XZ0A 1U92B 1SY6L 3FONA 1YYLL 3BO8B 4N5UA 5E8PB 2ARJA 2F8XC 2R2HB 1R5VB 4G6MH 3MOBH 3LEYH 1LWRA 4JGUA 5FB8B 2W9EL 3BKMH 3GK8L 3GMMB 1KPVB 4GG8B 3LS4H 3MV7E 3GM8A 4IOFD 1VGEH 2ZSVA 4BFGA 1WT5A 1J0IA 5EO1A 5C0CE 2OJEA 1ZEAL 2DYPB 2IPUG 3UYPA 2R2EB 3S5LA 3QUXB 3O3EA 4KTEH 1BAFL 3O6LL 5HXMA 2EO1A 5D93C 5IB2B 3O6FD 4OI9A 4OTXL 2NTSP 4S1QH 5IMLB 1UWEH 2F54A 3HB3C 1JRHH 1KPRB 3KVQA 5JOPD 1AXSB 2CLZB 1QPPA 4C4KO 5C0GB 4RAUA 1TNNA 2VDNL 3CFBB 1FV1A 2KZ1B 2JJSA 2FEEI 2BNQB 3OB0H 1XR9B 3V52H 1KB9J 4Y1AD 4PGEA 3AGVA 5DDHB 5AZ2H 2R2BA 4JM4H 3EGSB 4XAWL 5DFTA 1RZJL 1VADA 4NZTH 4QRUA 4RGNE 3MXVH 2AJUH 2SEBB 5GS3A 3WIIH 5IBUG 4GS7B 3TJEL 3AU1B 5HBBA 1I7RB 2FJGA 3BPCB 3EO0B 2VLJD 1VEMA 1KN2L 4UILL 4XVJL 4KK6D 1QLRB 4M7ZB 4XI5D 1GGCH 3EJYD 3UPCA 4O58H 1JNJA 2VKXA 1GYAA 5E4EB 3WNKA 4YBLC 3A0OA 4TSAL 1A14L 3VI3E 4NN5C 4ODVH 2IBBA 4LEXL 1IGJA 2BOBA 4UUJB 2F53D 3OX8A 5TGBA 2DJUA 5GRUH 3SGEH 3WUWA 5IIEA 4QRSB 4X7SH 4AENB 4JG0H 4OZGF 1G7LA 4ZUSB 5JTWA 3IS0X 4RIRA 3VFOB 1IAIM 4PTTB 4I77L 1NC2D 4ZFZA 1U58B 3U9PH 4WW2F 3ESUF 1C5DB 2R8SH 3FFCB 4JFXA 3NACH 5C0AE 5SWSD 3ULVE 2PKDA 5AYUL 3RGVB 2XZAL 1MOEA 3G6JA 5I15H 3B5HA 3QZWB 3I3EA 3BN9D 1KCSH 4LLWB 1ZHLB 4G5ZL 5J11C 1MIMH 1CR9H 2X42A 3W39A 3TN0D 4KUZL 4J12A 3H42L 3SGDI 4J3XA 4MCZB 1GPOL 4R26L 2FL5B 4FTVE 5HGDB 4KV5F 1RIHL 4PJAF 3FHAA 2G5RA 5JUEL 3W2DL 2XTJE 4L8CB 4LP4A 5I6XC 3DRTA 5D2LB 4U6HB 3SKUD 3TZVD 1DEEB 3HE7C 2X44D 4KI5F 1JYVA 5FV2A 1IT9L 4ZQKA 3BHBB 4PRAA 4RCAA 5FEBA 4NSKB 5I30H 1JWSA 3QUMA 4K3EL 4LPWA 5GS0L 4X98A 3BZDA 3IDMB 3FO1A 4JQVC 4KVCH 3C2AH 4Z7WF 1NDGB 1EMTL 2LABA 3I02B 2EZ0C 3MBEA 1INDH 1ETZA 3F5WA 1G0YR 4QF1A 5BXFA 3N50A 4H88L 3KLHD 2QADD 1NBYB 2R39A 3RUGE 1U8HA 2OXGA 3OQ3B 4NM4L 3JV6B 1EUUA 3OKLB 1Q72L 3QH3B 3TBSA 4KQ4L 1AR1C 1AC0A 2VXVH 3K4ZA 3QDGD 3NTCL 4WU7A 2QHLA 5IVNA 3NIDF 4I5BB 2Y7QB 3MV7D 4HGWA 5C07E 1A3RH 4Q74A 3DO7A 1RUKH 3VWKA 1QFUH 2VXSL 1BEYL 3S35X 1AGDB 2H26B 3W9EB 4HF5L 5EZIL 5CILL 3UBXG 3BZFB 4MQ7A 3LS5L 4JZJB 1UXWA 4MD4B 2A0LD 5ANME 1I8IB 4TSBL 2JKXA 3RL2B 4HKXB 1HILB 1NGQH 4XAKE 2EXWC 4LLMB 2Q8AH 1INEH 2HLAB 3NCEB 2C7UB 4UTBH 1MQ8A 4G8EB 3F8UB 5F1OB 3RP1A 4RGOH 4KRPB 2F54D 3D39B 1T04A 1AE6L 2OCFD 4I4WA 4YHLL 3VFGL 5F7NC 4AM0A 1YQ2A 5MHSD 3DVFA 4WY7L 3TP4A 1G9NC 3B3IA 4XGZB 3T0EA 1OLZA 2ICWB 4MNGA 5M95B 2OK0H 2QSVA 2VDLH 4WGWB 1N4XL 3MV11 1GZPA 1ZLVH 4MB4A 4PV8A 2V5SA 3OGCA 1QD0A 4R0LC 4CNIB 3EJJX 1GGYA 4DVBB 1ITCA 2IALA 1A6VH 3NZHL 4L8BA 5A43C 1TCRA 2IGFL 4GQ9H 3O6MH 3ZYZA 1NBQA 1T1YA 3P0GB 3GSNL 3ZTJG 5D1XB 3IFNL 4NHUA 3I6LE 3QIUD 3Q0HA 5ICYB 4Y8DC 3H3PL 5E2VH 3D0LB 5HHOB 2X7LA 5GGQH 3FB7B 1A6AB 3V6OA 4OZ4A 1IEAA 3F6LA 3OL2A 3ALWA 4KDTC 4LSVL 4QTHB 3ZHKA 3F58L 3C2SA 3CCHB 4P46C 3GSOA 3PHQB 1DBBL 1QFWL 3QHFL 1EAPB 5C0EA 2JIXB 4I9WD 1MCEA 4OGXL 3ULVD 4RA0C 1FAKT 5I66A 5C6TL 1TJGL 3V6OE 3ARFA 1D6VL 3B2VL 5HHPB 2FX7H 3GFUA 5DC9B 5TDPB 2P7TA 3REWB 4HWEL 4HG4K 1OHQA 1LE5A 1UCTA 4XXCC 3RIAF 1OP9A 4MXQC 5I9QC 3P4OB 5FUOH 4CBPA 1G9NL 4MAYB 2W0KA 4S1SH 5IMKB 2X1OA 4HH9A 1AR2A 1EFXB 1QKZL 5HGHB 1RUPH 2WLZA 1EZVY 5DRZA 5GSVA 5EWIL 3I2CH 1OB1B 4XPTH 1EO7A 2HG5A 5IQ9B 1BQHA 4KGJA 1K6QH 4MCYA 1NL0L 1DDHB 4Q2ZB 4UT6L 5A40E 1KBGH 2MMXA 1KELL 4BFIB 2A6DA 3GIVB 2NXZB 4X5WA 3VFUA 1YN6A 5BRZE 5L2KD 3JWDH 1C08B 3HZVA 1MFAH 3L3DA 5F7EH 3WKNA 4TUKH 1QZ1A 3JVGA 5HDQH 4EXPX 3L3OB 1YEIH 3PDGA 1UM4H 1UB6B 3FRUB 3U4BH 2C3XA 3GJFK 4HK3J 1A64A 5J6GB 4X6FA 3L3JB 4R4ND 5DRNA 5GZND 3QDJE 5EU6A 4I8DA 3TBYB 2VLKA 2FD6L 5D2LF 5EO9B 1X5YA 1WZMA 4JHBA 4ODXA 2XY1A 5EULV 3MBED 5DT1L 4LPUA 1DLHB 4LCWB 5DQDL 2ED9A 2PYFA 4P2QA 1U3YA 2ZG3A 1I85C 4KY1H 1KYOJ 5EU6E 3IDGA 1INQB 4R7NA 1KG0B 5EZLA 3KPPB 3HMXA 4S2SB 2VJXA 4WUKH 2YC1A 2QSQA 5DXWA 4BUHA 1IILE 5JLZB 3VWKD 3V4PL 1A0QL 2YA2A 2IMMA 3EYFB 4XAKD 5D7LE 4ZDHB 4N8CH 4YPGB 2OP4L 2AQ2A 5HHQA 4CU7A 1VFAA 3DLQR 1SJEB 4WTZA 4G6KL 1QR4A 3NFPA 4LGSB 8FABA 3IT8D 4XX1G 5ID0A 5DWUH 2X1PA 1OWRM 2V5RA 4TNWF 4BUGA 5TE7H 1PAMA 3B9KB 4OKVB 4UAOC 4EUPB 5F7FA 4LFHD 1AY1L 4EN3B 5CGYC 1YMMB 3BDXA 3HUJB 3WNNA 2G75B 4WHCA 2VOTA 1FNEB 3H8NA 5KW9L 3AB0C 3FN3A 3V5HA 4ELMB 3SJVA 3T0ED 3HR5B 5J4MA 3K1DA 5MENE 3VG0L 3JWDC 1XGTA 5KOVC 1HEZB 4URTB 1UJ3B 2Y5EA 5DFVD 1MAML 4GRLA 3MA7A 1JMZA 2LAAA 3BWUC 3BEWB 4EOWH 4WHYH 1JF1A 2DBJA 5IB1A 5LGHL 3P30H 4HH8A 1AI1L 4OLXL 1QOKA 3NPZB 3CMOL 1L7TL 5F88A 1A4KB 1KEGL 2HKFL 1F42A 1I4FB 4ZPVB 5J12C 5C0DA 4N0UA 2QL1A 4ZUWB 4OQTA 1MCRA 5D1QC 3MLSL 4F7PB 3MCKA 5B4MD 1MCPL 3ETBF 3C6SA 4KKBC 2JCCA 5TJWK 3TV3H 5SWZE 4R97B 3MLUH 5A16A 4HUWB 5JNYA 3SO3B 1A7OL 3AM8C 4OCXL 2KUTA 3WS3A 5KSAC 1LHZA 5C0IA 1RI8A 3H9HB 3M1BB 4E41A 1EK3A 3ARFD 1T4KB 1NEUA 4NQDB 3WJLC 1AD9A 2Y25A 1FFPB 4DCQA 3GMLB 3EFFA 3O8XA 1FNGB 4LU5L 4Q9CA 5C0RH 2YRPA 2X4OA 2YA1A 1JGUL 4NRXA 5DYOA 1F3JA 5DR5H 3WKMH 3PDDA 1JHTA 2AJXH 5FV1L 1RZKC 3QXUA 1CD1A 5EU4A 3MRNB 1RZ7L 2HRPL 4R2GD 4BQBA 1C5BL 1LEKB 1IQDB 4Q0XH 4G6JL 2X4PB 3B9DA 3BKCH 3Q2CA 1D5MA 4K3DH 5B8CA 5FM5O 4RFNB 4Y4HA 1EAJA 2Y1VA 1M7IA 1KLGA 1K8DB 4ETQA 1AHWB 1EA9C 3ECBA 2W38A 1LEGA 4XC1H 1BF8A 2X4RA 3OG6B 3BP6A 4QKXB 4NNYA 4J1UA 1Q0YH 1T6VN 3Q3GA 1GZQB 5BZWB 1EGJA 4L3EA 5ADPH 4HKBA 4PJHB 1CG9A 1V7NH 3C60C 2X5PA 4LP5A 4UINH 2VLKD 2VDKL 1P84K 1XF2B 2EC9T 5LCVL 3WFHB 1L0XA 3MUY1 4ZO8A 3ABZA 3KPRB 1HOCA 1HYSD 2A2QT 4P2QD 2R0WH 4L3EE 1JE6A 4FQHA 4QRTB 3LIZH 5FUZH 5HI4D 3VDAA 4NN7B 1QBBA 2HFGL 5FUCE 4ZUVA 1RZKL 1A1NB 1PFCA 4LPCA 2JB5L 5FGRA 5B38A 4BSVA 5GJSH 4P5KA 2XZZA 1G1YA 3QXDB 4I0KA 3HZKA 4LL9A 3PG2A 4ODUA 1G7IA 3IDXL 43C9B 4JAMB 2XV6B 3FB8A 4IMLA 1IL1A 2HMIC 4EBQH 1DBAH 3MRPA 5DRXA 2RFXA 1E27A 4YDKH 3WDHA 1KJ2L 3BD5A 2VXUL 3T2PA 2ESVB 5IR1A 1T66C 1JN6A 3KAAA 1OAYL 1M7DA 1ZT4A 5ILTH 1MHEB 3VXUE 1F97A 3H0TB 2OX5A 1J1OH 1PKQA 5E2JA 3P4NB 5JHLH 1KCUL 3K8KA 2WQRA 3BE1H 3RI5F 4LIQH 2CDEB 5TPWH 2FCBA 3TZVC 5B3NA 1WFTA 1CLZL 5FM5M 4F3FA 3TVMD 2J1KA 2BZDA 1PZ5B 2NCMA 3SJVD 2CRIA 1PKQE 4PRHA 1RJYA 1RHHA 3QQ4A 4N0CD 5ICXB 4P2RB 3X12A 4YHMH 4GRLD 5K9QG 5K9KA 2HT3D 4FG6C 4UIKH 3HUJF 5KBNC 5AD0A 3TH3T 1I7TB 4LSQH 3KPNB 5ESAA 1CFNB 2N1KA 1EJOH 3IDYB 4ELMF 2OM5A 3A6CH 2Q20A 1WBXB 4CL7A 4PRHE 2DQJL 5HPOA 4PD4K 4ONHA 1B88A 3PV6B 1QLFA 4ONFL 4M4PA 3SDCD 5IOPA 1LO4L 3DRQA 4HS6B 3KPSE 1QYGH 5ADOH 4N0RA 4PJ7B 2Q86B 5E1AB 2Z31C 3L3IA 1XGQB 2H3NB 4RWHA 4DN4H 4XVUD 4R6UA 3UO1H 4MQXD 1A5FL 4OF5A 3LQMA 3VXNB 1TPXB 4DUXA 2L0DA 1P5UA 5E6YA 5BVPL 5D6CB 1LP9B 5FO7A 1A7PH 4G3YL 3RWEB 4XMPL 4E41D 1A9BA 4JHAH 4CVZA 2VLJB 4UTAH 3LH2H 3L5WB 2A0LC 5D8JL 1QQDB 4KU1A 5IG7A 3O41B 5DJ0B 4WFFD 4JO2H 3O8XD 2XZCH 4RWYL 3BRGC 1A3LH 1IKNA 1MCIA 4PGJA 5E5MA 1RJLB 3LVEA 4RGNC 3BISA 4DKEL 1AGEB 4X7DC 3ME0A 4G7YL 1MCQA 3QG7L 1BD2E 2EDBA 4EI6A 2DJSA 2DMCA 5IB3B 3NAAL 3LEXA 2JJSC 3S36L 1KJMB 1A7RH 4M1CC 3VXPB 3IFPB 1A6WH 3S35H 4HJGA 2DQUL 3RPKA 1XCQB 2W0FA 4Y4HD 3WEXB 1J12A 2ZOKB 5CD3B 2CK0H 5DJ6A 4WWID 1JPSH 2HJFB 1CFQA 3V4VH 3FQRB 4BZ2L 5TQ0L 3OKMA 4Y5XC 2Y06H 1ZA3A 2EEDA 1CFBA 5LWYL 2GEEA 2A77L 1FORH 1ZS8A 1B0GA 1FRGL 3V8OA 4Y4KB 4L3ED 2IAMC 4UOW1 2DIAA 3BWAB 5FKAA 1GXEA 4R3SB 1BPVA 4HIIA 5F6IB 2EDHA 5DJ8B 3VD9A 4PJIF 1CGTA 5E00B 2YPLB 1TJHH 3RNKB 2GCYA 2DWDA 5CJQL 2E27L 2B1HL 4NM8L 1A7NH 1PYWA 3VH8B 5C3LD 3H7LA 1CE6B 5F1IB 3OAUL 2MHAA 1YNLL 4PJHF 2NQCA 5EZOL 4WDIB 3VXRA 1KOAA 5I1DA 2XIDA 1DN0B 3BQUA 1L9NA 4G8IA 3M45A 2V17L 4KUCD 3HAEA 2W65B 2VDQL 4LHUG 2YRZA 1HH9A 5IHUH 4KAQL 4MA1B 2YN3A 3C5JA 1W8NA 4JHWH 3MBXH 2MCPL 3GKWL 4PS4L 2MPAH 1MVUB 1MWAA 2XTJC 4MA8L 3JWNC 2CGRH 4MJIA 3OJDB 2ICWI 1SVZA 4A2MA 3NH7L 1BOGA 2VC2H 1T20A 1UXSA 4QTIL 1MFEL 3MNZA 3PWNA 3BUYB 3E2HC 4Y4FC 3T1WA 4LPTA 2FLBT 4K94C 4LVNC 5JA8B 2ARJB 4PJ9A 5D96B 4ZYKA 4LLDB 3P77A 2VLMD 5IBTH 1IM3A 1WBYA 4YHPB 4I48B 1PVHA 5F70A 1MF2L 1JWUB 4GBXC 5FYLE 3MGOB 3TT1L 4PRHD 4LGPB 5ENWB 5C0ND 2C4FT 5FCSH 2R56H 5E0QA 5TF1H 3WBDA 3TWCH 2FWOA 3NCMA 5EO1B 2J8HA 3ULVL 4F9LC 5ITBL 3U7AA 3OAYK 1CBVL 4OZFB 5EZJA 2AGJH 1NAMB 1N5YH 1CS6A 4OLZH 4Y19E 1T80A 2HWZL 5KG9A 3BGMB 3RWJB 4JN2A 4YXKH 1WC7A 4R90H 1SJHB 2X1WL 1C1EH 3CFDA 3TCXA 4RMVA 1K2DB 2VXTL 3QIWA 4HBCL 5DJZB 1CD0A 1PZUB 4OGYH 1C16A 5DUML 5MP6H 4LLVB 4P59L 4M7JH 4PGEB 1CDJA 4NKDB 3U7WH 2VAJA 4KQ3L 5ALCL 4NO3B 2Q3AA 2Z35A 4YHKH 5IVXB 5ACLA 3MLPA 3UTPD 4NQSB 4HKJA 3PWLB 5H35A 1HSBB 1CGUA 1V7MH 4JPVH 5A2IH 4XNYL 2MKLC 3QIUB 1OGAE 2UY6A 4RFOL 5BZDB 4K94L 3WXVL 2I27N 1J1XL 5F1NA 4HBQA 3ZDZE 3FQNA 4MAUL 4I3GA 4QXWA 3T8XB 2DB8A 3QUML 4KTDL 5DJXB 1H3UA 3MRIB 5DURD 3QWOA 4HIJA 3QJHB 4X7FC 4HMEA 3MRHB 5D72L 4KHXH 2CJUL 2EH7H 4ZSOE 4Z0XA 5F8RC 1Y18A 3BEVB 4QHMB 4NO2B 1DZBA 4DGYL 4XB8A 1A6ZB 4L9DA 5F9OL 4JFYB 4XBEL 2VO5A 2O61A 1FL6B 1WBZA 4LAJH 4NZUH 4TOYH 2NY7L 1Q9OB 4U0QB 5IHZA 4CJ0A 5JORA 3UTZB 3RIFF 2UWEE 4ZFOB 3BOVA 2C4XA 3O3DB 2I07B 4KRMB 4I2XB 1BM3L 1KB5H 1KTRL 1FSKC 1YNTB 4XCEA 3QIBB 2WBWB 4B53A 1AFVL 4Y5VA 3U30B 2AEQH 2D7TL 2CKBB 5HHXL 1ZANL 2ZUUA 3G5ZA 3CX5J 2XRAH 5L2KB 3QXTA 5T5FL 2WP3O 2ZUQB 3DBXB 1MREH 4V2BA 4WGVB 1GAFL 3AS3A 4HD9A 2BHUA 1J0HA 3U36B 1CVRA 2HVJA 5EC1A 3WLWC 3DMMB 5L2JB 5TDNB 3VXRD 2D0GA 3SKMA 3BQUD 4DUWA 2YD7A 5GJTL 1OT2A 4EDWL 5ITFA 3U6RB 3BRFA 4L9LB 5CCKH 1PY4A 3VWJA 1P7QA 1ZWIA 2VR9A 5KAQF 3SGDH 1L6ZA 1KN4L 3SPVB 1JPFA 3KPLA 4MJID 3B83A 5INCB 4JRXA 4OAWB 1U9KA 2P5EA 5J9PB 3W5NA 4RDQG 2AJVL 4GUPA 2F9BT 4P5MB 1UZ6E 4QEGA 5I8CB 3HNSH 5FYLD 3UPRB 4YHOL 5JW5A 3KYNA 3LAFA 5GRZA 3O0RL 4DQOH 1QHOA 2IPTH 3OKNB 4JFQB 3ZYJA 2Y9RT 3EHBD 3VXQB 5IB5A 1AQKL 2APWA 4IRZH 4PJ9D 3MUGB 3THML 2FEDC 2P5EE 3D18B 4UBDC 5B22A 4LSRL 1U8QA 2P24A 3BKJL 3DX8B 3AREB 2NY0D 1JZ2A 2FGWL 4F7EA 2VISB 4TTGA 5IGXH 4KTYA 4CVWA 4G43A 1P4LA 1NFDB 1OQOA 2Q7YB 1C12A 2VYRE 1OTUD 2LU4A 3RZCB 3X17A 2R1YB 3P9MB 4HS3A 4PJEB 5CMAB 3MGTB 4PRBA 3RTQD 3QIWD 3ZZ1A 1PGRB 4QRPE 5DZNA 1TTUA 4ZUUA 4LARH 4UDUB 1VGKB 1WIPA 1G1CA 1SHMA 2PTTA 5JO5B 5ACZA 1UGNA 5ALBL 2VDOL 4PYHA 2AEPL 4Y16C 2EC9U 2Z8VC 3QZWG 3BPLC 2OI9B 4V1DB 3F65A 1TVDA 1EO8H 3KNBB 4LDLB 1FFOA 4H25B 2VUYA 4PY7B 4YHYB 3FQTB 4KDVA 1J1PH 4AT6B 3IDNA 1FO0H 3R8BB 3FO0L 4RGMB 3TGXA 1ZLUH 1HHKA 3QEUA 4U6VH 3HE6A 4IS6A 4NZRH 4ODWB 1S5HA 4IOSD 1OD7A 3NCCB 4MJ5B 2NY6B 3MLTB 3GIZL 4YIQB 2YEZA 4NQCB 2DKMA 4OIAA 5JZ7C 5C0JB 3TBWA 3RHWK 4M6OL 2IG2L 1MRCL 2NY2C 1AKJA 3T2QA 1ORSB 5A3ID 3ZT6A 3QUZB 4HZLA 3LQZB 5F7DA 4ZFGL 1F6AA 4GRLC 3FO9B 3TLRA 2GSGB 3IKKA 1JGEA 4WUUA 3GRWH 5DVLA 4N0FB 4LSTL 4PJGA 4KJQC 3PJSB 1CLYL 1MQKH 3S4SB 2H8PB 3MLVH 3MO1A 4XNUH 1A4JA 3HI5L 1JF6A 1T2QH 2VMFA 5ETUB 1IC1A 1U91A 4D8PB 4TUJA 4U1KA 2B4CC 4XP9H 4XCFL 4LQFH 4LOUC 4XVTH 3IXAA 1RMFH 4LRNL 3U48A 1AC6A 1SYSA 4J4PC 4HCRH 4MCYB 1HI6B 1VKXB 5ISZB 4ERSH 4PJGE 2R9HC 1LEIB 1OARH 4XWOD 5HHMD 1S78D 2WIIB 4OKDA 1ZT1A 1E4JA 1PJ9A 5E2WH 1IARB 3QUKB 2Z8WC 1GRWA 3MNWA 1FZJA 1U3HB 4RISL 4XNXH 4WFEE 3WFCL 3MJ9H 4OIIH 1M05B 3QAZB 2VERN 3QPQD 3G6AB 5TDOB 1HQ4B 5LVEA 1T7ZA 2CDFB 1I1CA 4K2UL 35C8L 2AV1B 4IOIB 1JHKH 3D3VE 2DAVA 1EHXA 1DQLH 2YBRB 1NGZA 1C5CH 5E95B 1UH4A 5KSBA 4WWKB 1LK2A 4QHKJ 2NY4C 3VWJD 1P7QD 3WXWH 5IEKA 3ARDA 2IANA 1NGXA 3UBXA 1RVFL 3EOYG 5H2BA 4KJYA 1T0MA 2Y07L 4LSPH 5I74B 5D7JB 1YEDA 4ELKA 3LN4B 4YAQB 3J8F7 5J3HD 5D7KD 5KN5A 4JRXD 3D69A 4HUUB 5KSBE 2OQJB 1TJIH 1OSPL 4PUBH 1U8OA 1CZ8H 4Z77B 2VIRB 1LQSR 3T77B 2YC1B 4ZUTA 2WANA 2FBJH 3BAEH 4K3JL 4YC2C 3FQWB 1YEGL 3OPZL 2B4CL 2DQIH 3ZSSA 4OQTL 1KIRA 5EUOF 2AI0H 1R3KA 2AXGB 2ZOLB 4BYHA 1GC1L 3MRQA 3ARBA 1YPZB 4FQJL 2D31A 4QT5A 5C0BD 3ZTNL 4M1DH 4Q9QH 4LASH 3T65B 4G7VH 5FUCC 4NP4L 5ESQB 1J11A 5FYJE 4WW1A 4OT1L 1QSFE 3JV0A 5L8LB 4JFFE 3PQYA 1YZZA 3HZYB 3TVMB 5LJYH 2NY5H 5CIPH 1Q94B 1F13A 4HPYL 4QYOB 2VH5H 4NFBA 4ZOCA 3PDOA 4PP1D 3T4AA 5CJXA 1CDUA 5T1MA 4ZOAA 3K4AA 4XP5L 4WEMB 4I18C 2DM4A 4OBRA 5D93B 1EEZA 4J8RA 4Z7OE 2ZJSL 1FPTH 1NFDF 5JXEC 2XQYK 3KPMB 3MCG1 3V8CA 5FXCH 2OYPA 3DVNA 3HMWL 4ZG1A 4JKKA 1GJIA 4ZTPH 1JF1B 3K0WA 4GKSA 4PJEF 2X4SA 3SQOL 1S7VA 1PQZA 1X6LA 2IBZX 4F80A 5FA3A 1YDPB 5DD6A 5I16A 3EO9H 2K3TA 4YZFE 5IV2B 1ZLSH 4MVBD 3O4LE 4P9MH 2OR9H 1VA9A 2ADJA 5F1SA 3WHXA 1DSFL 1PG7X 5IJKC 4KK9D 3RDTA 3SDCB 4RBPK 4YHIB 4YX2H 4GRWB 1IAIL 3HE6D 3EOAA 3OAZH 4YUEH 2Y72A 1AH1A 1TXKA 3HI1A 4NWUH 1NAKH 1RQ5A 1EGJL 1F4WL 3TIEA 2EIZA 1N2RB 3QEQA 2DQTL 2NR6D 4D9LL 3DXAB 4AIXA 2X10A 3N06B 3RRQA 1JP5A 3DUSB 1AKJD 2VDRH 4NN5B 2YA0A 4BM7A 4U6XB 1W72B 5CZXD 1QSZA 4L8DB 5BW7C 2J8UA 1BZ7B 4H5SA 4WUUD 3QEQE 4NBXB 5KANG 5BJTA 1KB9K 4IRSA 4IM8A 3ROOA 2R1WB 4PRNA 1G7PB 2G5BB 5EU7E 4FHBD 1G9EA 5BO1L 4EZMA 2EYSB 2ORBH 4MA3A 4AJ0A 2F8VA 5F96H 3KJ6H 1R24B 5DHYA 3TYGL 2G2RB 1F00I 3U1SH 4NUGH 1HHGA 1QSVA 2VXQH 2NY3B 3SE8L 4DUVA 2WUBH 2NY5C 4UI2A 5TH2A 3T2NH 5J11B 5I73C 3SY0A 3SOBL 4LKXA 3QFJB 4JZNA 4OGAD 5CJOH 5DI8B 1S5IH 5DHVH 1Q1JL 4DKFL 4NO0B 1RHFA 1QSEB 4B0MM 4MZ2A 1FP5A 1WFNA 5I6XB 1XF5A 4RX4A 3PWVA 4JKLA 2CO6B 3BP5B 2R8SL 3HE7B 3WO3B 1UA6L 4TQEH 4KJPD 1JFQL 3LHPL 1NGPH 1R3LA 2DI9A 1HHHA 3F7YB 2EXYD 2BFVL 3ZKND 3EDJA 1KIPA 5C2BL 2IQAB 3DVGA 1YY9D 3ARDD 2IAND 3L5XL 4YWGL 2ICEB 4F15C 1HOCB 2AKRA 4QCIA 2IFGA 2GT9A 2D7MA 1KXVC 4WV1A 4OI8A 1G6RA 5IF0A 4PRPB 2P5WA 3TNNA 2G9HB 3LN5A 4NN6B 5FIEA 5BMFL 1S9VA 1UG9A 1UB5A 2VQTA 1U8NB 2PO6C 4L29B 3L5IA 3FT2A 4XRCB 4PJDB 5GZOD 1OM3H 3CVHH 1F90L 4M7KH 4XX1E 5FM8A 3X13A 3GMRB 4R4FL 2D03L 1EIBA 2FH6A 2P5WE 3T3ME 3RVVD 2P8PA 4HWNA 5JMOC 3ARBD 4FQXA 1I7UA 2IH3B 3WN5C 2ZWLT 1R3HB 5GSRB 4HMCA 3BPOB 2O5YH 1FGVL 3Q1SL 4RQQB 1NDMA 5EC2A 4KROC 2DQDL 1CGYA 5I2IA 1CDYA 2FH8A 3AAZB 5GGUA 1OAZH 2C3VB 4WO4A 3C8KB 3VA2C 2Z4QB 3PQYD 1YPZF 4P9HC 5JIHA 3QWQB 4WFGD 1DQQB 3H9SB 4NDMA 5KS9B 4PTUA 3HC3H 1CL7I 3L3GA 4Y5YC 3DURA 1RJYB 5FKPB 5I1GH 1JNLL 1KB5A 4JKPH 4M8QA 1XGUB 1DUYA 4JO3H 4OCWL 5TFSL 1O0VA 1BVLA 1AO7A 1OSZB 4LVEA 3D5OF 1RIUH 3RWFA 1YECH 4OUUB 1T22B 3Q6GL 1XGYL 2B1AH 4HX1B 1L0QA 3CLFH 3QJFA 5E9DA 3RVUD 2ZKHH 4UU9B 1CGSH 4EI5C 4IBLT 1RK1B 4PJFA 4MD0B 1OF2A 2Y4SA 4Z8FH 3T4YA 3K7UA 3MLWH 4YR6A 1MJ7L 3PWPA 2YXFA 1PY9A 2V9QA 3MSPA 1IGYB 3RDTD 2NYYD 1S7TB 3C6LA 3K80A 2OTPA 3MRJB 5E6IC 1ZHKA 5JOFA 3R0MA 3BH9B 3O81A 5E9DE 4BQ6A 1U2HA 4HJ0D 5F3BA 1KGCE 7FABH 3VFPB 3C9NB 1NBZA 5DEFB 4FXGA 2FRGP 4LEOB 1I9IL 3QEQD 4N1EA 4CVUA 3PWPE 2YSSB 4J3OC 1KJ3L 4JLRA 2BOCA 2ZUWA 4GRWF 2J6EA 4JY4A 3V7AG 4P9HL 3IS1X 1Y6MR 4YDLC 4Y2DA 3JWOH 4F58L 2CR6A 3JV5A 4X6EB 4UDTA 1QO3A 4EKXA 2OTWB 4APQA 1KCRL 3O6KL 1VPOL 1K4DB 4IRSD 1X4ZA 4K23L 1BBDH 4UV4L 5E99L 3MREA 3BX7C 5DD5H 5I9QB 2Q6WB 1I8KA 4OSUH 1YEKL 2V5TA 3GZKA 1ZXQA 1MNUL 3V4UL 5L9DL 2VL5B 4C83B 1NC4B 5CEXA 1E4XL 1MWAL 4FFYL 5CSZB 1WEJL 3VDBA 3D25A 3U83A 2AXJA 3IFOB 2R29H 3MLXH 1CIUA 4PREB 2ZZUT 4M6NH 4YDIH 1MJ8L 5FYLL 1VACB 4Z7VA 2HFFB 3V7MA 4PJ5E 5DLML 1O7VA 1MCFA 4CMMB 5HYIA 2WWKO 3CFJB 4RX4D 2DLFL 5DS8A 1NUGA 5IM7A 4NRYB 1UFUA 2WK2A 4POUB 3LEVH 4JFOA 4V2CB 4NPYA 1J8HE 4G8GB 4H0GA 1RD6A 2CDGA 1WZ1H 1FDLL 1AXTH 3B8YA 4P5TC 1ZV5A 3O11A 3LKNA 2DIJA 5IFHH 5D70H 2ZUSA 1AIFA 1B90A 3P73B 5IMOB 2BDNH 2VR5A 2P5WD 1D9KC 5GQBA 5HGBB 3VCLA 1FG2B 1N5AB 2DQEH 4UT7H 3V95A 1WAAF 1TTGA 2VLRE 1NCBL 4ZAKC 1YEFH 3STLB 2QQNH 3MUZ1 5HYFA 4QGTA 3D9AH 3DSNA 5KZCD 4F2MB 4N5EC 3BP7A 3BSZL 2XZQL 4MJIB 2ZUTA 5GS1A 1XT5A 1HHJA 2X1QA 3MCLH 1MI5A 5J57B 1BOGB 3JWOC 1BX2A 1DBKL 4FQXD 1T20B 2MQ0A 3BXNB 2BX5A 1IC7H 3UTTE 2C1OB 3PP3H 1JK8A 1VFUA 5CINL 4PJDF 4OZIF 5CBAA 3GRWA 5I18H 5E8NB 1BGXH 3OR6B 2UZXB 2E6PA 4GH7B 2VZTA 4IMKC 4HWZA 2FB4H 4U3CA 4WO4D 5EOCH 3SGJC 1B4JH 4W68A 3V0VA 3IKCB 5EOQL 3ZHLA 2Z92A 1TZIA 2V2XB 1IM3B 4L3AA 3O3UN 4UAOB 3GSQA 5ESVB 1HH6A 4FABL 2NY0B 4A6YA 2FO4A 3MUJA 3NCJH 1KYOK 1ZKAA 4G6FB 4W81A 4HCRA 5JHDA 2FZ3A 3ZKXC 3VWJC 4BSWA 1AO7D 3G08B 4KK5D 4MD5A 1F02I 5H94B 1T3FB 3OSKA 4K8RH 1MPAH 1TQCC 4DOHB 3BRDA 2PUQT 2PYEB 3F6IA 4XHJD 5E9DD 4GG6E 2I9LA 4YXLH 3ULUD 5KS9F 3C09C 5F7HA 1KGCD 3MJ9A 1DBJH 4JN2B 3CDCA 2A74B 3JV4B 3JSSA 3PWUB 1B0WA 1MHHB 4XCCH 4PG9A 3GBNH 3RTQB 1IZJA 3PWPD 1C16B 1C7TA 2QR0A 2ATKB 3DV4B 3C6LD 3NVQA 3QCVH 3CFKB 2CIIB 5EFIB 1R5IA 2EIEA 5F93C 2AERT 2PXYA 2NX5D 4HS8H 3BT2H 3ZL4H 1CF8H 5D1QB 1OAQL 2J5LC 5D7IE 4X5XA 1FYTE 4TTDC 4P4RB 5H8DA 2WLYA 3OGOE 3W81A 4MWFA 4H1LB 3VRJB 4AL8L 3C5ZA 4D0CA 3LRGA 2Q76A 4DTGH 3WSQH 3MJ7A 5KSAB 3BDBA 4BKLB 4Y2DD 3T08A 4ZXBA 1UC6A 3IU4L 4IRJC 5DRWB 5F44A 3S96A 3VH8G 3LKQB 4APQD 2E9IA 3GI8H 2V7HA 4GXUM 3ZE0F 2OZ4A 1Z9OA 3C8DA 3BGAA 3SDAA 3HTLX 4RZCB 5ELIA 3VDCA 3TYFB 4NO5B 4E42A 5CP3H 1PDKA 4JRYE 4AMKL 4MXWL 5KSUB 2K9UA 3G5VB 2VNCA 3KR3L 1FIEA 5DMKA 3T0VA 4DZ8B 1JTOA 1EXUA 2GK0A 3GSVA 3RZWA 4UQ2A 4ZD3H 2W92A 3FKUS 1R3IH 3SDXB 5D5ME 8CGTA 4X83A 1OY3B 3HPLA 1OVZA 1BFVL 1BOYA 4JDZA 1I9JL 3UJTH 3VRLE 3RWGB 3QCUH 3RU8H 1G7HB 1LO0H 3QA3B 2F15A 1BF2A 3TH4T 1TETL 3PL6A 2E7HA 3WFBL 4A2LA 4ODTH 5I1AB 4NRZB 3O2DA 4U1SA 2D3VA 1OP3K 3I75B 4F33A 1DJSA 4X6BB 5JPMA 2CIKA 4QOKA 4U3XA 3D6GA 1CK0L 4JCMA 1QLEL 3F12B 4NHCH 3VFRA 5HSFA 2ZCKH 2DTMH 2BVUA 3DROA 2EEAA 2AK1L 3S88H 2BY2A 3I6KA 1OTSD 3JTSA 1MHPH 3CDYA 4LF3B 3CFCH 5BS0E 5I1CL 1U8LA 5FYJH 6FABH 5K9JL 5D9SA 4NUJA 5CZXC 3HC4L 3PIQB 1ED3A 4OZFG 4LLYB 3W11D 3HG1E 4W6YB 3L3HA 4X6DB 3OKEB 3TFKC 4JCLA 3O3BB 1ND0A 4J6RH 2GJ6E 3VXSA 3ZT7A 5MEOB 3WE6B 3OKKA 1PG7H 4N8PA 1ZWIB 2QKIA 1SMOA 3CSBA 4MNQE 5HHVH 1SEBB 4N90E 1JPFB 1IQWH 4GAJH 1RFDH 4X8JA 1MI5D 5CP7B 3CX2A 2D0HA 4NGHH 3L7EB 4OZGA 4OCSH 2OLDA 4Q9RH 3EYVB 1KEMH 3GJFH 5DJAA 2FECL 4KHTL 3B2UD 3VGBA 1B6UA 1TITA 3O3AA 1EV2E 4BJLA 4HKZA 4WW2A 3EOTL 1S9WB 4OFDA 3UYRH 4TUOA 3KHQA 3OZ9H 2P49B 3TA3C 2DMKA 3ZKMC 4EUPH 1AP2A 1H0DB 2D9QB 4YHNA 1J9CT 3EFDH 3TJHC 5GJSL 4Z76B 2WW8A 3F62A 4UNVA 4QHLB 2ID5A 4I3SL 1W0WA 4PJAA 5C0BB 4AEIH 5IMMA 1CLOL 5JHDD 5J1AB 3VW3H 4FQCL 2VDMH 4AG4L 4X4YA 4LSSL 3G04A 4UV7L 3MRFA 3SE4A 2NW3A 1HSAA 1SEQH 2OJZL 2H6PA 3QG6A 5DQJA 5IUSA 1NSNH 4C58B 1KNOB 1CDGA 2YMXL 1B2WL 3W9DA 5KJRL 3BKYH 3RWCB 1XF3B 4PGBA 5TQ2L 3N9GL 3P0VL 1OAKL 3CSPA 4Z7WA 4RFEA 1IGML 1IM9A 1NCDL 2PXYD 5ACZB 5CEZE 2UUDK 1U93A 3E6HA 2B5IC 4OLWH 1J5OH 1NMAL 2I60L 4C56B 4S1RL 1EVUA 2Z31B 2W9DL 2FJHA 3OTTA 2FYYA 5IB4A 1DQDL 3DUUA 1NH6A 4L8SC 5D7SH 1JNHA 1D5BB 3LKPB 5C0CB 4EVNA 4AH2B 4GMSH 3C5ZD 2AJSL 3CDGB 2AXFA 3MLRL 4C57C 1KLUA 4P23A 3TO2B 1UCBL 3LD8C 5C6PB 4NZJA 2LTQC 1IMHC 5IESL 3A6CL 3WIHA 4ZXBD 3VFWB 1RUQL 1N8ZB 4TNVK 3VGFA 1VFOA 4PFEA 3TIDB 2WINB 4OM1L 3SDAD 1KCVL 2V2TA 5ERWB 3CPLB 3CVHA 4XNQA 1T5XB 3RY5A 1T7YA 1MJJA 5CJXC 3IFLH 5AUMA 1B0RA 1U92A 3R06B 4JR9H 3WFEH 3ELAT 1B9ZA 1AKJB 5CGMA 3BO8A 5E8PA 1V8HA 3ZDXE 3GI9H 1IC4L 4CMHC 2R2HA 2APXA 3L6FB 4RGNB 3TNMB 4XBGB 2BVTA 3E0GA 4DZBB 5K93A 5FB8A 5C08E 1YUHB 3GMMA 1KPVA 4GG8A 2HTLC 3CMGA 3ZKSD 4IDJH 3N85L 4KGLA 4B41A 1QEWB 3PL6D 2DYPA 4MB5A 2R2EA 3QUXA 4KPHL 3PUCA 2EYTB 5IB2A 3U4EB 5IMLA 1CICC 3G6DH 3TCLA 3C87A 1I1RA 4Y5XB 4K9EL 4XP1H 1KPRA 4QO1A 5F7MC 4QOKD 1F6LL 4L4VE 2CLZA 5C0GA 5DJCB 1P4BL 2IAMB 3CFBA 4OCRH 1ZVYA 2BNQA 3DI2B 5DD3L 1XR9A 1T03L 1ULVA 5EU7C 5DDHA 2VABB 5F9JB 5I8OH 3EGSA 3RVWD 4O2FB 1OD9A 4D94A 2SEBA 5FO8B 3FTGB 4PPTA 5C0AB 1E0OB 3AU1A 4UOJA 1H5BB 4D9QD 1RAMA 1I7RA 3BPCA 4WJ5B 4IRSC 3EO0A 3L3KB 2Z91B 3VXSD 2XY2A 1F8TL 1K85A 1IC5H 5IFJB 1YEEL 1QLRA 1H8SA 2PTVA 3DYPA 1SVCP 1NCAL 4FTVB 5C8JA 2XYCA 2Z8SA 4XTRC 1A02N 3ZDYF 4PP2B 2AXHA 3QDME 5FF6B 2O93L 2XTJB 4X6DF 1XR8B 1R5WB 4P3CH 1KFAL 3IXTB 4WI7A 2IMNA 5GHWL 4UUJA 4H26B 4PJBB 2YWYA 3MA9L 3WYRA 4QRSA 1XGRB 1HINL 4AENA 2I25N 1RJZB 4GSDL 4ZUSA 3E2HB 3QNZB 5FK9B 1QR1B 4Y4FB 3VFOA 4PTTA 1NGYB 4WCYH 4PGCB 1U58A 3OHXB 3NMEA 3P9WB 3K3QA 4LVNB 1C5DA 4XT1C 5FDWB 4XP6H 3B6SB 3FFCA 4XMLH 4BZ1H 4D0BB 3Q6FB 2LU3A 2VQUA 4JFHD 3RGVA 4G6AC 1NFKA 3BIAX 3QEHB 3QZWA 2GJZB 4GBXB 1ZHLA 4LLWA 3MLYH 4O51B 4GRMB 3RUGB 5KVMC 4KI5D 1CXIA 1Q0XL 5JW4R 5DMGC 2BNRD 3VRIB 4MCZA 5A2JH 1U95B 5F3HB 1YJDH 2FL5A 4ODSL 5HGDA 3STZB 1RK0B 2NPLX 3BZ4B 4L8CA 5E2TH 5C07B 3FZUC 5GRVK 5D2LA 1I3GL 4U6HA 5BVJB 5MERB 1DEEA 2DI7A 3GGWB 3BHBA 1IM9D 2ZP0T 5E70A 1BQLH 1B6DA 3CK0L 3KS0H 3MJ6A 3S4SG 5ID1B 3BDYL 3Q5YA 3IDMA 5ANMB 4FQ2L 1OLLA 3ROLB 1NDGA 5EA0L 3I02A 4YH6A 1Y0LB 4M43H 4U7MA 1FVEB 4JDVB 2IBGA 3CVIH 5HDOA 1CFVL 3KPQB 4LSUL 5J1TC 4PJ8C 1NBYA 1CXHA 1FC2D 1MRFL 4OF7A 3VFMA 5LQBL 3O45B 3OKLA 3VMNA 3PGFH 1BMGA 1NEZA 1FLRL 2UZIL 3ARQA 4FOMA 1JGVH 4I5BA 2Y7QA 2OL3L 5L88L 3CJJA 1P6FA 2IEPA 1F58L 5IFAL 1AGDA 2H26A 3W9EA 3SDDC 2HN7A 3BZFA 2F5AH 4JZJA 5E8EB 2YXMA 3IYLW 3QUYC 1FBIH 1G6RL 3NN8B 3QCTL 4MD4A 1I8IA 1P4IH 3RL2A 4HKXA 1HILA 3LKRB 3D2UB 2WBJA 4B5EA 4LLMA 4P2CG 3LQAC 3INUL 4JRWA 2HLAA 2C7UA 2DYPD 3QI9C 1MLCA 1LO3L 3QUXD 5GISH 4Z95H 4MXVE 3D39A 5I19L 1YJDC 5SWQB 4ETYA 3SE9H 5E2UL 4XGZA 2ICWA 1V3MA 5F89B 4DKAA 1FSKB 1OAXL 4OLUL 1XH3B 1WVZA 4XZUB 5EO0B 2BNQD 1IEHA 2R4SH 2XWBB 3E8UH 5I8KH 1XF1A 4CNIA 3RBGA 4DVBA 1TNMA 2H1PL 3VI3F 4F7CB 4HLZH 2DQGH 1M71B 3AXLB 1AD0B 4JN1H 1X3DA 2L7JA 3QDAA 2O5XH 3IRPX 4HHAB 3WLBB 1T1WB 4NQXB 5D1XA 4XPBL 3DVGB 5ICYA 2UZYB 5DJDB 3HS0B 3D0LA 1KB5L 5HHOA 3S34H 2XT1B 3FB7A 1IAOB 1A6AA 1YEJH 1EEYB 3LKSB 2ED7A 4QTHA 3UAJC 2GHWB 3MZTA 3U0WH 3CCHA 4IIQB 5BRZB 3ULUL 3PHQA 1MJUL 1MREL 1EAPA 2JIXA 5JPNB 4LAQL 2NMSA 4JPKL 1KT2B 2OS7A 5F72S 4M48L 5HHOE 3LQAL 1S7RB 1A1MB 1U3ZA 4OFVA 5FGCE 5HHPA 1RPQA 2GSIB 1EEQA 5DUBB 3CX5K 5TDPA 4XWGL 3REWA 2DLHA 1J05B 2ENSA 4OLVH 3ZT5A 3GJEB 1H3VA 3QDJB 4UQ3B 3P4OA 4MAYA 5LXGH 3MUHL 3FFCD 5IMKA 5GGTH 1EFXA 5HGHA 3S37H 4Z6AT 3RGVD 2DL9A 3EUUA 4C55A 1DANT 1IGFH 1CGVA 4ENED 3HNTH 4EIGB 5CBEB 1OB1A 5IW1B 5IQ9A 5JR1L 1MIEH 2J6EL 5CUSL 3FFDB 4XCNB 1DDHA 4KVNL 1DQJB 1GIGH 4Q2ZA 3WL9A 4Y0GA 3LMJL 5JQ6L 4BFIA 5E03A 3GIVA 5TE6H 5KTEH 3CH1B 1Z5LB 2W60B 2X1XR 3S8WA 3DX9B 1C08A 4JHZA 5C86A 2EDOA 1R0AL 3RUGF 5D7LB 1NJ9B 3L3OA 1IZKA 1Z0MA 3RA7L 5CSGA 1UB6A 3FRUA 2X40A 3DJ9A 1QRNE 4N0YH 5J6GA 2YK1H 3L3JA 1E4WL 2NXYC 4JPWL 1GGBH 1F4YH 5GS1C 3TBYA 5EH1A 3RVXD 5EO9A 2CK2A 1F4XH 5HPMB 5HYJE 4Y16B 5I1JH 4Q9BA 3BPLB 3RKDC 1UYWH 2DMBA 2AEIT 4GAGH 4M7LL 3WCYA 2XACC 3K46A 2NX5B 1TQBC 1TVBB 2GTWB 5DK2B 5C09D 4F9PA 3DSFL 4ISVB 2KH2B 1INQA 1CL7H 5T3XE 4UIMB 1FZKB 1KG0A 3HR6A 1OCWL 2HJLB 3KPPA 4Q6YA 4S2SA 2E8YA 4JG1L 5MENB 2N7BA 3C08H 2EDLA 2BRRH 4HPOL 4LCWE 5JLZA 3VXME 4R96B 3RBSA 1CGXA 1P1ZB 3EYFA 4ZDHA 5I1KL 2C1PA 4YPGA 1IKFH 5KVEH 4M6AA 2VZ1A 2VSDA 1SJEA 2NY2B 2H41A 2BRQA 5DF0A 2V2WB 5AEAA 3AS2A 4O2EB 1B3JA 3FMGH 1QNZL 4QLRA 5FHAH 4HQQH 2ZCHH 3P0YL 4HK0B 4FQIL 1IGCL 4LHQB 4XBPB 3AY4A 1ZVHA 2WBJD 3B9KA 3NPSC 2ARJQ 4BH8B 2KBGA 4EUPA 4PV9B 3O9WC 3ARTA 5FGBA 5TF0A 3KDMB 4PYGA 4EN3A 5B38G 5SWZB 3UJIH 5CD5C 1QVOB 3HUJA 4KRPD 4BSJA 3D39D 2DBLL 2G75A 1FNEA 1W2KT 1TZGH 4FFVD 5T3ZD 4YGVB 4ELMA 3HR5A 4DAGH 4K8RD 5GGVL 2XN9E 4NCC1 1HIMH 1FQ9C 1HEZA 1UJ3A 2CKBH 4G9FE 4LLQB 1YYMH 4FFWD 1YMME 2BK8A 3LB6C 3BEWA 4LBEB 1CN4A 5FA4A 1FIGH 3IDIB 3DETC 4JFOB 5D1ZC 1XGPB 5J6HB 5TE4H 1L7IL 5JXAH 4OD3H 5D1XD 4YFEA 2Q87A 1A4KA 2FDBP 2E9JA 4CVXB 4A6YL 4ZPVA 4ZUWA 4NQVB 5HHOD 5EOTB 2NY4B 4KFZC 3QP3A 3RAJH 4JJ5B 3NZ8B 2HT4C 1S9YB 1N7MH 4HUWA 2NLJB 5I71C 3VMOA 2JIXD 3MJGX 4FQPA 1FO0B 2R1XB 4YLQT 15C8L 2X4UB 2ZCLH 5LGJA 1N64L 3H9HA 3M1BA 1JGLH 2DQHL 1T4KA 4NQDA 5K33A 1FFPA 3GMLA 4NQEE 3RWDB 3OMZA 5HVGB 2R23B 3EYUH 4NNXB 3GB7B 1ADQL 4U1LB 2P8MB 1IFHH 4PGZA 1FNGA 3NGBB 1WTLA 1JGDB 1TENA 4YC2B 1HHIB 1RURL 3DNKA 4MAYD 1AJ7H 4KMTL 1EFXD 4FQQB 4HIXL 4Z0BH 1JK8B 3MRNA 4D0DB 4H20H 2VZVA 3RL1B 2ZPKL 1LEKA 1IQDA 5DEZA 1JL8A 4MSWB 2X4PA 3HC0B 1U41A 3EAKA 4KKLC 1Z9SA 1AGCB 5DSCB 2HT2D 1UACL 1K8DA 4R7DB 3KPTA 4ZS7L 1AHWA 2ICES 1G9MC 2FO4B 4O02H 2OZ4L 3U82B 4XPGL 4WEBH 4QXUH 3PF2A 3SBWC 4S0TD 1NCCH 3DVIA 4I18B 2BVEA 1RY7B 5BZWA 2DD8H 1CCZA 3H6JA 1S7QB 4DGVL 4PJHA 1TTFA 1TVHB 1XF4B 3SCMC 5K9OB 3VXUB 1X44A 5DO2D 3U0TB 1RZ8A 1DQMH 2MCG1 1XF2A 3WFHA 2V7NB 4JQXA 2GTZB 4NJAL 5H37G 4FA8A 5E7BA 1L6XA 3KPRA 3V6ZB 4L5FH 2X41A 2XKUA 3SO5A 4KH2A 2GAZB 3QO0B 4JREC 4KKCC 4I3RL 1A22B 4QRTA 1XIWC 5FYKE 5HI5D 4DFIA 5D2NE 3O2DL 2ERJB 4O4YH 1AXIB 1A1NA 3HNVL 3V7AE 4MS8D 4QWWC 3K2MC 3NA9H 4GMTL 4X5XB 2HKHH 1JV5B 4R8WL 3QRGH 3KPRE 1FFRA 2EH8L 3B9VA 1H3XA 1QBML 3PABB 3QXDA 3ARGD 1LK3L 43C9A 4JAMA 3IVKB 4FZ8H 2FX8H 1A6UH 4KKAD 3BVNB 5DEGB 1LNUB 4ACPA 2ESVA 5B3JE 1A9EB 2AJYH 1G9ML 5DMIL 5HJ3B 1MHEA 4JDTL 3H0TA 1RULL 1YNKH 3P4NA 3ORJA 4OB5L 3B9KD 3KPSB 2VL4A 5I1IH 2FJFB 1S3KL 2JE8A 2FX9H 4U1NB 3KPOB 1DLFL 4EN3D 3BFOA 5MEQB 3FB6B 4KK8C 2ESVE 1NLDL 4Z7UE 1ORQB 3QPXH 1II4E 1PZ5A 1JCKA 4PB9H 3KJ4C 2R0LH 4PJCE 5ICXA 4P2RA 2BMKB 1GL4B 2R2CA 3RWHB 5CIPB 1SY6H 1YYLH 5I73B 1PW3A 1H9VA 1I7TA 1K4CB 1MCDA 3KPNA 3QWRA 1CFNA 1JTPA 4P23C 1I8LA 2V5MA 4E5XB 2W9EH 1XAUA 2DICA 1WBXA 3GK8H 1WWAX 1X5KA 4XNMB 1LE9B 1OAUH 1IAMA 1F11A 3PV6A 1BD2B 1ZSDB 2J2ZA 1ZEAH 4HS6A 1LD9B 4RAVB 2JJTC 4PJ7A 2Q86A 5CWSB 1BAFH 5E1AA 3O6LH 1XGQA 2H3NA 5GRJL 4WI3A 4OTXH 4LCCC 2VWEE 1LMKA 4F8TA 4F15B 2ATPB 5JOPE 2PR4L 3VXNA 2HLFD 5D6CA 1LP9A 3O4OC 2VDNH 3MLZL 3RWEA 1UQSB 2VLJA 4Y1AE 4FP8L 4PJ7E 1QQDA 2XNAB 4NQDD 4F37K 3O41A 5DJ0A 5F7WC 1OP5K 5BV7L 4XAWH 1RZJH 2H32B 2PO6B 2X4TB 4U0RB 4OZHE 4FZEL 1EHAA 2IADB 4UT9L 3IJSB 4OCYL 1LP9E 3TJEH 3BN3B 2VLJE 1RJLA 4KC3B 4OUOA 1HDMB 1KN2H 1ACYL 4UILH 4JO1L 4KWUA 4XVJH 3WN5B 3TPUB 2XOTA 3ULSB 5IB3A 1CXKA 3ZE1E 4X8XA 3O2WL 2YZ1A 3VXPA 3IFPA 1S7SB 4NC0B 4KROB 1XCQA 1SBSH 4HC1L 4KI1A 3WIHL 4TSAH 3WEXA 1A14H 2ZOKA 5CD3A 4LEXH 1W0YT 1SYVB 2HJFA 3MRBB 5BCAA 4P3DB 2F19L 3FQRA 4X6CE 3WNMA 4JFPB 3IDUA 3BPNC 5HYEA 2N7AA 5K59E 4Y5YB 2OR7A 4Y4KA 2BNRB 4XCYA 4LNRB 3BWAA 5DHVB 2NW3B 5I1LB 4I77H 1EH9A 3W82A 4R3SA 2E7LC 5SWSE 5DJ8A 4OM0L 3HFML 5E00A 2YPLA 5AYUH 1ODAA 1A6TB 2XZAH 4X9BA 3RNKA 2OTUB 2AJ3B 1OL0A 1FG9C 1FE8L 3KPRD 3VH8A 1I9EA 4EI5B 4G5ZH 1CE6A 5F1IA 4KUZH 2CKNA 3H42H 3MRDA 1GPOH 4R26H 4JM2C 4WDIA 1DN0A 1CFTB 1RIHH 4GRWH 1FH5L 5JUEH 5E6IB 3W2DH 5B39B 1T83A 2OMNA 2W65A 1FAIL 5L8KB 1I1YB 3NABL 4U7KA 2BHYA 3BZEB 1X4XA 1Z9LA 1IT9H 4M5ZL 3SKNB 4Z7NE 2WUCL 1J0ZA 3RGVC 5EOCJ 1I7ZB 1MVUA 2W59A 1WIUA 1ZGLP 1MCCA 3OJDA 1F2QA 4Y19B 5E5UB 4K3EH 4WHYG 3TT3L 1RZJC 4I0PC 4Y89A 1J86A 1CDHA 2ESVD 3WIFB 3T0DA 2MOVA 1FL3B 1S7WB 3X3GL 5HYQB 1BIIB 3MXWL 1EMTH 3BUYA 2ED8A 5CZVL 2EYRB 4H88H 3NIGE 1YQVL 4N9GB 2ICWJ 3B9AA 4HIEB 7FABL 1SQ2N 1JYNA 1RUAL 4LLDA 5GGTA 4NM4H 4CJ1A 4YHPA 4OD1L 4I48A 1NBVL 1Q72H 4KQ4H 1JWUA 2WWKT 3QDGE 3MGOA 3ARPA 1OGAB 4GW1B 2DS4A 3NTCH 5ENWA 5FHBL 2VUOA 2WMPA 4P2RD 1SJXA 2D7NA 3IU3B 4LRIA 3NCYP 1NUDA 2VXSH 1BEYH 4MGXA 3AFLA 3ZE2E 4OZFA 2BSSB 3QWRD 4HF5H 5EZIH 5CILH 3TCLB 1NAMA 3LDBC 3ZYOA 3LS5H 3BGMA 2NY1D 3RWJA 4D2NA 5M94B 3KLSA 5T1LB 1SJHA 4JY5L 4UNUA 3VFNB 1K2DA 4TSBH 5DJZA 3ILQD 2AV7B 4ZSOB 3VFSB 1S8DB 3FHQA 1F4AA 3RVTC 4LLVA 5IBLC 4QNPE 1BZ9B 3DI3B 4NKDA 4KDWA 4NO3A 2F54E 4P4KC 5IVXA 4P5TB 1AE6H 2X70B 4YHLH 4OGZA 4POZD 5D6DC 3VFGH 3X14B 5MHSE 3O2VL 1MRDL 3Q5OA 4WY7H 4NQSA 3PWLA 1HSBA 2H2SC 2Q8BL 2WWMD 1LDSA 4CDHA 2GI7A 3QIUA 4MNHB 1N4XH 4RRPG 3QQNA 5BZDA 1D9KB 1P7KB 1XEDA 1DBML 5IVXE 1FJ1B 3VD3A 5I75C 3GO1L 1KCLA 3NZHH 4B7LA 5C8JB 4ZAKB 3T8XA 3KXFA 2IGFH 5C0FB 2YKLL 5GS0C 3V0AC 4ALAL 2XQBL 5DJXA 3GSNH 3MRIA 3IFNH 3U79A 3QJHA 3FL7A 3CDFA 3MRHA 4KJWC 4NIKB 3H3PH 3CIQA 1MCWM 2CXKA 3BEVA 1E4KC 2J3SA 4QHMA 4NO2A 4LSVH 4Q6IC 3CXDL 1A6ZA 3F58H 4FQ1L 4JFYA 1HWGB 2IPUK 1DBBH 1QFWH 3QHFH 4I9WE 1FL6A 4OGXH 1JWMB 1IJ9A 1JF5A 1Q9OA 3B5TA 4M6ML 4OJFL 3UTZA 4AEEA 3EOBB 5C6TH 1TJGH 1D6VH 1FVCB 3B2VH 4ZFOA 4Z5RB 2YUXA 2I07A 3O3DA 5EORL 3WJJA 1H3WM 4I2XA 5D71L 3V0WL 4HWEH 2BXYA 3BESR 3AROA 1YNTA 4MMXC 4Y4KD 3MV9B 3QIBA 1FN4B 3ZKXB 1G9NH 1VHPA 2CKBA 1X5XA 2A9ML 1QKZH 5L2KA 2YPLD 1YC8A 3G6JE 5HHNB 3FOLB 3DBXA 3HN3A 3C09B 3GHEL 3MACL 5EWIH 3U36A 2QHRL 2XFXB 2ZNWA 5EPMB 5GS2H 3MOAL 3DMMA 5L2JA 1NL0H 3V5KB 5TDNA 3ARRA 4UT6H 4TYUA 1KELH 4DJMA 5L2KE 3U6RA 1DP0A 2OSLB 4WTWA 3QXWA 4L9LA 5T3ZL 5C7XL 2F74B 2VZ3A 3ARZA 5I1EL 4RMTA 1HZHL 1E28B 3PGCB 4HT1L 1UKTA 1KIUA 4U33A 1Q9WB 4YBQD 4HJJL 2A9NL 3SPVA 4J3TA 2XI9A 3VXOB 1CDCA 3EYQC 1DBJL 4CU6A 5INCA 5EUOA 4X99B 5C09B 3VFMB 4OAWA 5E08L 5J9PA 4OCMC 5C2UB 1NEZB 2GJJA 4XPHL 3DGGB 2FD6H 3MJ8B 4P5MA 5I8CA 2VITB 4LCYB 3EJZC 4QRPB 3RY6A 3UPRA 2DL2A 2AAVA 4IRJB 1N0XL 2NXZC 3OKNA 4JFQA 4JZOB 1SM3L 5FOJA 3L7FB 5A2LH 3VXQA 4ZTOL 3HI6L 5DQDH 3MUGA 3D18A 2HN7B 1I3RB 5HD8D 1P2CB 1UM5L 4M61B 2XWJB 3DX8A 3AREA 3P11L 2Y6SC 3SGKA 5FM4A 5H37H 2VE6A 2VISA 3MQIA 1KXTB 2WBJB 4PG2A 3V4PH 1A0QH 4ZS6C 1NFIB 3GKZA 1MLCB 1NFDA 1ZVSB 2P42B 2Q7YA 4WFHD 4WHDA 1TZHB 4JVWA 2W1NA 4U1JB 4BFBD 4G6KH 1S7UB 1X5ZA 2D7OA 3RZCA 2R1YA 3P9MA 3ZLQC 3VFTB 3FOMB 1FZOB 4PJEA 5CMAA 4M03A 3TBTA 3SKJL 5J06A 3MGTA 2D4FA 4GFTB 4YQXL 5ICZB 3KYKL 3STBA 1D5XB 3A67L 1JHLL 2XXMB 1M6OB 3ZDZF 4ODHL 3SEPA 4X9FA 4UDUA 1VGKA 5JO5A 1AY1H 2Z8RA 2L4OA 2E7MA 5DHXB 4DN3L 3FO2B 1DN2A 3T0EE 4EEEA 5KW9H 3SKOB 4MNGE 4V1DA 4XHQA 3KNBA 4H25A 4FQLL 4PY7A 3FQTA 3VG0H 4AT6A 2RAMA 4K07A 1WZLA 4PLKD 1MAMH 2DDQL 5HI3D 1IGIL 4XH2B 3BMVA 2CSPA 4P2OC 1MVFA 4ODWA 2O26U 1RJCA 2J4WL 5LGHH 5JDSB 3KXFD 4MJ5A 3PHOB 4V1DE 1AI1H 4P3WA 4OLXH 1NMBL 3CMOH 2UWEF 3GBML 3MLTA 1L7TH 4YIQA 1JTTA 4NQCA 4TSCL 1KEGH 1CQYA 2HKFH 3MMEA 5C0JA 5T3XL 3MRMB 3MLSH 4LDEB 3VXTB 1ORSA 3QXAB 3QUZA 1BBJB 1MCPH 3LQZA 1UJ3C 3GNML 1VFMA 3KWWB 3FO9A 4XP4H 1KPUB 2EDJA 2GSGA 2IJ0C 2P44B 4N0FA 4Y8AA 4MJ6B 1A7OH 4OCXH 3UZQA 3GMOB 3IRZA 3PJSA 3TA3B 3S4SA 2H8PA 1MCOL 5IROA 4NJ9L 1IQWL 3UTQB 5ETUA 2OMBA 5J0BA 4D8PA 2FIKB 1QBLL 4YXHL 4LU5H 1VKXA 1JGUH 1HI6A 1UWXK 3QO1B 2E6QA 3QIBD 4NKMB 5ISZA 3WL9B 1LEIA 1EUTA 3VU2A 2WIIA 4PRID 1SY6A 4OV5B 1UH2A 3QUKA 1U3HA 1WWWX 1RZ7H 2HRPH 1M05A 1UVQB 1C5BH 1MFDL 1YA5A 3G6AA 4OFKA 5TDOA 1HQ4A 3GMNB 4G6JH 4D3CL 3CLEL 1G0DA 2CDFA 2ZNXA 3DMMD 4J7RA 1UZ6F 3HZMB 3NFSL 2AV1A 4IOIA 2YBRA 4U1MB 4WWKA 4F8QA 3DIFB 1HXMA 2K1MA 5GIRB 1P84J 2B5IB 2CQVA 2QSCL 1OTTC 1QSFB 1CE1L 4JFFB 5D7JA 3LN4A 4YAQA 4PR5B 5J1SC 4H1LH 2GUOB 1MFBL 5HDBE 2VLKE 4MA7L 4HUUA 2ZUXA 3BH8B 2OQJA 1IE5A 4GQPH 2VDKH 4Z77A 1X5FA 2VIRA 4RFNC 1I1AC 2VLLB 2LTQB 1ZA6B 3T77A 4QXTB 1MCBA 2DQCL 3ARGB 4PBWD 2P43B 3FQWA 4GAYB 4P2QE 3GJFB 4HFUL 3RKPA 4BK4A 3RJDA 1T89C 2C1PB 5JIKA 2F58L 2AXGA 3M17B 2ZOLA 1D5IL 4QY8B 2HFGH 1YPZA 1T5WB 1RU9L 1RZKH 3ARED 3O4LB 4HUXB 3TO4C 1X6NA 3B5GA 4PLJD 2JB5H 2XKNB 4G80A 3I3DA 3VA6A 3BJ91 5D2NC 4OLYL 3T65A 1GHFL 5ESQA 3DYOA 1T21B 3IDXH 5DVKA 2EIDA 2ZG1A 3HZYA 3KS0J 3TVMA 5DJ2B 5E94B 2HTKD 1KJ2H 1Q94A 4QYOA 4HULB 3RZCD 2VXUH 4F7TB 3NIFE 1OAYH 1RSFA 4NN7C 5DJYB 2C3HA 1CICB 3FQUB 3H3KA 1KCUH 2BSED 5EBMB 2A6IB 1TFHA 3KPMA 5IWLC 2X9YA 3G9AB 1CLZH 2O5ZL 5EN2B 3D48R 3UC0L 5FA4B 2LVEA 3OKDB 3CZJA 3SJVE 4HAFA 1YDPA 1E6JL 4V1DD 1JUFB 2EDNA 1XFPA 5ECJE 5IV2A 1CQKA 2J88L 1KIQB 1IEBB 3G5YB 4M62L 3IJYB 4WI8A 9CGTA 1F2XK 2DQFB 3UYOD 5IQ7L 1GSMA 5I0DA 3BD4A 2A6JB 3SDCA 4YHIA 5SV3A 5I17B 2YN5A 4JY6B 3SE3C 3A6BL 2UYLB 4TVPD 4XC3L 1N2RA 4WHTB 2D2OA 2NY6D 2DQJH 5FYKL 3CZFB 4QXGL 4NQCD 2CPCA 3P4MB 3DXAA 4N0UE 5LGJB 4AEHL 4ONFH 3BI9X 1Z9MA 3DUSA 1LO4H 1LDPL 4IOFC 3QUZD 3WS6C 2JCCE 3QQ9D 2DWEB 4X9HA 3VE0B 4U6XA 1W72A 3RJQB 4UZGA 4L8DA 5A1AA 1BZ7A 1YY8B 1A5FH 1E4XI 5E8OB 1FC1A 4MLIA 5EBWB 3O6FC 4OQ1A 2IQ9L 4X4MA 4HUNB 5BVPH 2R1WA 1G7PA 2G5BA 4E41E 2VWEC 4G3YH 3MFFB 4AQ1B 2YD5A 4XMPH 3IAQA 1X5JA 4LMQE 1NCWL 5D8JH 4WFFE 2EYSA 2WSKA 2KQMA 1R24A 1RUML 2G2RA 1J10A 5AZEL 4RWYH 1I3UA 1F3DJ 4JFZL 1UH3A 1H3TA 4HMDA 3OKOB 5ISZD 4BQCA 2OL3B 3GDBA 4QHUB 4RA3A 2XXCB 3EO1B 2B2XL 3QFJA 4U6YB 5GGSB 3JZ7A 5DI8A 1U3HD 2JELL 4M1GL 2P45B 4DKEH 5ACMA 4PJIB 4G7YH 4NO0A 2WWMC 1JZ5A 3QG7H 5T1DL 2ADFL 1QSEA 5F1KC 3NAAH 3S36H 3ARUA 2QQKL 3GSUB 3P2TA 1G7QA 4KK6C 4JEGB 2DQUH 3BP5A 3HE7A 4XI5C 3UJJL 5EUKB 2D7PA 3EJYC 4B50A 2MFNA 3F7YA 4WWKD 1A7QL 4O00A 5FOBB 3RPIB 3V6FB 1RZ8B 5HY9B 2IQAA 1MFCL 3FJTA 4PGDB 4BZ2H 5TQ0H 1WAAA 2ICEA 4XMKL 3MFGB 4HFWB 5LWYH 3MV8B 1U42A 4JQVA 5D7JD 2A77H 4O9HL 1FRGH 5KSVB 3DX7B 4U2YA 3FRPG 3MX0A 1H15B 1AQDB 2V9RA 4PRPA 2C9AA 1CVSC 2G9HA 3IF1B 2VDPL 4PJ8B 4ZOEA 2YR3A 1VDGA 1FL5B 3K8LA 1U8NA 5CJQH 2E27H 1K8IB 3QHZL 4L29A 1MSPA 2B1HH 4NM8H 1FFQA 4XRCA 4PJDA 2EKSB 4M5YL 2M2DA 3OAUH 1YNLH 3GMRA 1UKQA 3BN9C 4PRPE 1RIVL 5EZOH 4DGIL 1DE4B 5F9DC 2AK4B 3HKFA 3TN0C 4Z7OF 3K8MA 2IH3A 2V17H 1N6QL 5FAAA 1R3HA 5GSRA 2VDQH 4POYA 2J7LA 1Z6JT 3SDDB 2I9TA 4KAQH 2NNAB 4RQQA 3TC9A 4OCNC 2MCPH 3GKWH 4PS4H 3QUY