5C0NC

Development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
216
Chain Sequence
b'QSVEESGGRLVTPGTPLTLTCTVSGFSLSTYYMSWVRQAPGKGLEWIGIIYPSGSTYCASWAKGRFTISKASTTVDLKITSPTTEDTATYFCARPDNDGTSGYLSGFGLWGQGTLVTVSSAKTTPPSVYPLAPGAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, adipocyte
publication title Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid transport
total genus 40
structure length 216
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nC01
2C1OB 2EKSA 4WHTB 4DUWA 5J6HB 1YEKL 5D93C 1CE1H 1J05B 3EGSB 4NQDB 4XPTH 3BGMB 4JHWH 5HYSA 3FT3A 1ORSA 3ARDC 3ARXA 3F5WB 1RQ5A 1FIGH 3PV6A 5GJSH 1BFSA 3ULVF 4M7ZC 1XGRB 2BHUA 3IGAB 4HK0A 4Y4HB 5C86A 4RZCA 3EJYD 1ZLWK 3QEQA 3MGTB 4GFTB 5GGQH 3BJ91 3BWAA 4EOWL 2X9YA 4P3CL 1NCCH 4LARH 1ZHKA 4P49A 1C7SA 4OF6A 1BFOB 4YPJA 1O7VA 5KVGH 5E6YA 3BN9D 1BZ7A 4RMVA 2EDNA 4Q6IC 4P2OA 4UV7H 2VZVA 4LSUL 4M4PA 5JPNA 2IPTL 4PGCB 5IWLA 1I4FB 1LP9E 1MNUL 5EBMA 2NY2B 4FMKA 3AXLA 3CX2A 4XVJL 4MDJA 1AGFB 2HJLB 4PJCE 3P0VL 1J8KA 3ARGA 2EC9T 4A6YB 4MXWH 5B39A 2AJVH 1JTPA 4ONHB 4HDIB 5F1SA 3L1OH 5HDOA 4HG4J 4G8GD 4XPGH 1WFUA 5HJ3B 4JFDD 4CVUA 1KF9B 4YLQT 3IJSA 4GMSH 1KEGH 3ES6A 4HGWB 1U92A 3TVMB 3HI5L 1IC5L 3C5JB 4WY7L 1AGBA 1QNZH 1EEZB 3MOQA 5EO0A 2E6JA 2YK1H 4BFBD 1MCNA 3B6SA 3D87B 3CDGB 1ZT7B 4NCC1 4OZGF 5HBBA 2R29L 5C0RL 3H9YA 5IQ9B 4Z0XB 3ZDXF 2KZWA 4ORZC 2W0FB 1HQRB 1A6UH 3EO9H 2E3VA 2MCG1 3SE8L 3VWJB 3ALWA 2X1XR 3N1FC 3UPRA 4R4ND 4R9HA 1I1AA 1DLFL 3VW3L 4UV4L 1NCAH 3L5IA 4UQ2B 4ZUUA 2OYPA 4JQIH 1R5VA 3DYPA 1D5IH 3HUJA 3C9NB 3D3VA 3WUZA 4GSDH 4X4ME 2J6EL 2Q8AH 5T3ZH 5J56B 4YDVB 4X6DA 2YMXH 5CLWA 3PXHA 5FO8B 4J3WA 4ISVA 4HZLA 2R2EB 5FM5O 2XQBH 4AIXA 4JDTH 2DWDA 4Z95L 5E9DA 4MQ7A 1KGCE 4L3CA 4YBQC 1PY9A 1VADA 1T20B 2OR9L 1KTKE 5I1IL 4YHPB 4OLYL 2NXYC 3TC9A 5HHOA 3RIAK 4KK5D 2JCCB 5I74C 3BKCL 2HJFB 4F2MA 3M8OH 4LCWB 1NAKL 4NM4H 4P46D 1Q9KB 4Z77B 1KG0B 1FGVH 3UO1H 1OAUL 5I1KH 5J13B 3RJDA 3MA7A 1K4CA 3ZYOA 3U0TB 1UB5A 4LCCA 2Z92A 5CP3H 2E9BA 3O9WD 4V1DD 3CPLB 3VFVB 2QTEA 5TFSL 4P4KA 1Q94A 3A67L 1QRND 3SGDI 5K59E 4UDUB 2GJJA 3K1DA 3MR9A 1PKOA 2OK0H 2GSIA 1QO3B 4TVSa 1URLA 2OZ4A 3T77A 1YY9C 4JO2H 4ODXA 1A1OB 3UTSD 1WITA 2CLZA 4WFHD 3QUMH 5GRWA 5J6GB 1HN1A 4Y4HC 3IKKA 2W9EL 3ARFA 3E6FB 2JKXA 5FCUH 1MJ8L 4J12A 2KBGA 4JHAH 4EDXA 2BNQA 3DGCR 4KROD 4Q0XL 3UJTH 4K7PY 5DQDH 5T3XL 2IANB 2GQHA 2Q20A 4P23B 2M26A 3TEUA 3ZSTA 3GMLB 3KLAB 4JM2C 4PJIE 2NY0B 3A6BL 4PJ8B 4TRPL 5JIPA 3IB4A 5DFVC 2J3SA 3GIZH 4LHUG 1YYLH 2EDYA 4LQFH 2CK2A 4HJGB 5HSFA 1NBVH 4R8WH 1U8IA 2B1AH 3PNWA 3ZT5A 3EYVB 1L6ZA 5CAYB 3U6RA 2AV7A 1DBAH 2J4WH 3BX7C 5F9OH 3S96A 3VCLA 3EZJB 4LSPL 4XAKE 3HZYB 1CFNB 5IB1A 5IEKB 3TVMC 1JHLL 3U4BL 3CDFA 1CFVH 1GOHA 1F4HA 2FD6H 3JTSB 4HWBL 4MMZC 3NTCL 4UQ3B 1SBSH 3IDIA 3BMWA 4P57A 4PYHA 1D9KD 4ZFGH 3U9UB 1NUGA 2H26A 3VI4E 3G6AB 2HN7B 4ELKA 2C1PA 3ZKSD 1PJ9A 4MJ6B 4XVTH 3OKNB 4NQEB 5DO2C 1IMHC 1JYWA 4M61B 4Z18A 3S5LG 1CXFA 5F9JB 4W6YB 5I8CA 3WNKA 5D8JH 3VWJC 2FX9H 1YECH 4YBHA 4LVNC 3W9EA 1XF3A 5M7QA 5HGBA 5C0CA 1IAIH 5E2WH 2VLLA 1BQSA 1DDHA 4X6FA 3JTTA 4NQVA 5I73B 3BI9X 4TTGA 2UZXB 2Y06H 4P5KB 3DARA 5EFIA 5E24E 1EUUA 5ALCL 5LWYL 3FQNA 3MREA 3ROOB 5FYJH 3TA3B 4RGNB 3CCHA 3BVNB 5GZND 1G7HB 2NY4D 5SWSA 2I9TA 1SYVB 5HYJB 4LNRB 5DJCA 4GRMA 1KN2L 5I1DA 3VWKB 4LLMB 4MJID 4OV6F 4ZFFB 5DMGD 3FQTB 3VXQA 2DQUL 4HHAA 3UBXA 3QFDA 1A6WL 1M7DB 4GKZA 5GZOD 4I3SL 3PWPA 4AM0B 1BIHA 3LN4A 2PXYC 3SCMC 4Y1AD 1INDH 2C4XA 3RU8H 1EAPB 4L4TE 1YUHB 3FO0L 1KNOA 4XHJD 1IAIM 2HMIC 3C8DA 1I8LC 1QSFA 1Z6JT 4L4VA 1HIMH 5J13C 5DJXA 1KPUA 2JJTC 3CAFA 1S5IH 4AIZA 5D1ZB 2MKLC 3V5DB 4KDVA 1FBIL 3RL2A 5JHDA 4LEOA 2NR6C 4D0DB 1LNUB 4LLDB 3NCYP 1FL3B 1U41A 2CK0L 2CO6B 1V7NH 1QEWA 4GG8A 5DJ6A 4FFYL 1JGDB 3RWFB 5IV2B 3BUYB 1RK1A 5CJXA 1B4JH 4LSRH 1N8ZA 2GAZA 4N5EC 1L7TH 4P23C 5J1SC 4DQOH 3HFMH 4AEEA 2UWEE 1EVTC 4PJ8C 1A2YA 1QBMH 1I8IA 2VUYA 4P9HC 5T5NG 2LE9A 4U1HB 3WYRA 3WO3B 3HLAA 1YA5A 1CE6A 3FQWB 1BQHB 2HTKD 2O5YL 2DYPB 3FRPA 4F80A 2Y5TA 1X5JA 2R1XA 4LRNL 2OX5A 1CQKA 5C6TH 2LU3A 4OLEA 1BQLL 3VH8G 3MUHL 4HT1L 1U8OB 4I48A 3F7VA 2DQHL 1OAZH 1CFTA 1S5HA 5GGRA 1UJTA 3RDTB 2OR8A 2NY6D 4JM4L 1XZ0A 1ZLUH 3M1BB 2PCPB 2ZCLH 4WEBL 3EYSH 2R0WH 5D7LD 2A6JB 1EJOL 4J1UB 3RY4A 2EIBA 3DMMB 3VFTA 5DF0A 5GJTL 5EZIL 5C3LD 1RHHB 2F8OA 3ZKXC 2DDQL 1TVHA 4X5WB 3LKRA 4WU7B 5DA0B 2X4QB 5EBLA 3C08H 4JFDA 4G6MH 4NNYB 3HUJE 4ZO7A 5D7SH 4PP2A 1KJ2L 4KPHH 4DKFH 4E5XA 1DQDH 3IYLW 2LV4A 3AS2A 3QIWD 1LEIA 5HVHB 4BH8B 3BH8A 2O61B 3O2DH 5CSZB 2MCPH 1DQML 4PTTA 1T7VA 4QRPB 4LHJB 1IGTB 4HLJA 4JJ5A 3E6HB 1F8TL 3O3BA 4J8RB 4NYLA 1F58L 2SEBA 3BP6B 3RPIA 1KJ3L 3EBAA 1NMAL 3TA3C 2QHRL 4RGNC 1JHKH 4CMMA 4O2FB 5IVXA 5HHOE 4DGIL 1RZKH 1T5XB 3VFMB 5I15H 3DX9A 3ZZ1A 3VWKC 3MCKB 3WD5H 4XPTL 2YPLE 2PETA 3KXFA 3SHSA 3T0BA 5CLTA 5FGBC 5FYJU 3V4VH 1FNSL 1E6JH 3T65A 3WHXB 4YDJA 1NFDE 5GJSL 3U0PA 4J23A 4OZIA 1YEFL 4JFOA 1FFPA 3ARDD 1S8DB 2YA1A 5GGTH 4YDLB 1FVDA 2ZSWA 3WNLA 2YUZA 5C7XH 1G7IB 1A7RH 5KBNC 1LO3L 1SJEA 3WN5B 2ZG3A 2ATKA 1NCCL 3LVEA 4LARL 3ZHKA 5KVGL 1UZ8A 4OZGB 3PP3H 3QHTC 3UYOD 4MAYB 1CTOA 4FTVD 4G43A 4U4BA 4F3FB 5D1ZC 3WUWA 1YQVH 4LHUB 3T1FB 1D5ZB 1M6OA 1A64A 3G6JA 4GRWH 5JR1L 4XZUA 4JLRA 2AEWA 2P8MB 4RNRB 3V6FA 4MNHB 3V6OC 1N2RA 2IFGA 5FUOH 4HH9A 2AQ3A 2AJVL 4LCIH 4P46A 5I76B 4XPGL 5SWZA 1U3JA 1MRCL 1Q9OB 2NY1D 2A6IB 4GMSL 1TNNA 4WI9A 3GSUA 1MJJB 1SJHA 1T1YB 1JZ8A 1AE6H 5A2FA 2WSKA 5JDSB 3O9WA 5JIIA 2VDNL 4UDTA 2WW8A 3IETA 2BOBA 5DEFB 3KGRA 2HTLC 1UWXK 2IMNA 3H7BA 5D1XC 3K2UH 1KT2B 5KSBF 4P59H 1K3IA 2YK1L 5C0GB 3QHFH 2AXHA 1PKQB 3S5LB 3MLYH 3C5SA 1HEZB 1RU9L 3RAJH 5I1JH 1J0YA 3QI9B 4NQSA 3L5XH 3SN6N 4AK1A 2NW2A 4NN7B 1U42A 2RCSH 2AV1B 2E6QA 3SJVD 2C4FU 1XGTA 3PHQA 4Z8FL 5E8DH 4O4YH 4ZUSB 4DGYL 1NCAL 4K3GA 1CTNA 1NH6A 2FGWH 3ORJA 1YMHA 3IRPX 5LAXB 2DBLH 4Y19E 4GSDL 5IIEB 3PWVA 2Q8AL 1MH5B 5T3ZL 1KXTB 3MUGA 3DMMC 2PN5A 3BISA 2A77L 2XQBL 5B3JF 4L9LA 1MREH 5FB8B 2EYRA 5C0CE 4OM1H 1L9MA 1ED3A 3MRFB 3MRQA 3FQXB 4N90E 4I77L 3QXTA 3WLWC 1J5OH 4HIEA 4CN6A 1TPXB 2R0ZH 1MPAH 4XWGH 5DRXA 5HVHC 4YBQD 2VH5H 1I7RB 4M1GH 3D9AH 2CXKA 4ZOEA 1DJSA 2D7QA 5JW3H 1E0OB 4QXTB 3KPNB 2I24N 4U0QB 3M8OL 4I2XA 2NXYD 2WP3T 4NM4L 4WRLA 1VFOA 3QUZA 1D9KA 1FGVL 5BQ7B 3UO1L 5I1KL 3QPQC 5FV1L 4JFQA 5DQ9A 3X13A 3BMVA 5J4MA 1FV1A 2M8XA 3PWPE 2BCKB 2FJFA 2HT2D 1TQCB 1KLUB 1IAII 4MCYB 1MY7A 3ILQD 5LBSL 2OK0L 4U1GB 2OJEA 1QSFE 4JO2L 3EDEA 4GXUM 4L4VE 4N9OB 2DM4A 4JAMA 1TXKA 5FCUL 4YDLC 3O3DB 4Y4HD 3WN5C 1U8LB 3UJTL 4X7SH 5DQDL 5KAQG 3ULUC 3DOSA 3ARRA 5DC9B 4MAYC 1U2CA 4MJIA 2EDKA 2V5YA 3L3OB 1TJGH 5CJQH 3GIZL 5C0JA 3DIFA 1N64H 4JM2D 4LAQH 1YYLL 3OXRA 5BO1H 4WI8A 2FB4L 4HUKB 5DRWB 4X8JA 4LQFL 3VH8B 4PGJA 4F7CA 3GI9H 4HKBB 1I3GH 3Q6GH 4LIQL 2ICWJ 1NBVL 3GMNA 2A9MH 1DCLA 1FFOA 2B1AL 4P5TB 4FQLH 5C07D 4TOYH 1DBAL 3QUXD 2J4WL 3NACH 4N0FA 4XPAH 5F9OL 1TTUA 1CD9B 4JFPA 4X0KA 3T8XA 1CFVL 4XP6H 2XWTA 2FD6L 1OD7A 3V6ZA 1HH6B 3CFJB 3AY4C 1G0DA 4Y2DB 1F5WA 1MWAH 1G7JA 2MMXA 3VFRA 1SBSL 2BY0A 1FVCB 2HWZH 3VMPA 1PY4A 1GL4B 5EBWA 2P8LA 4XVTL 3LAFA 4QHNB 5CIPB 2P44B 4W6XB 4JG1H 1U8NB 2GI7A 5LCVL 3BWUC 1XEDA 4NN7C 3EYUH 4J3SA 5D8JL 5DO2D 1PG7W 2FX9L 1YECL 3NFSH 1S9XA 3VFSA 1IC4L 3MRNB 3MA9L 4CVXB 1UA6H 3BESR 3MXVH 4PUBH 4JO1H 1IAIL 5E2WL 4ORGA 5D70H 3VWJD 5I16B 3HRPA 2IG2H 1CLYH 4BSVA 1SMOA 2Y06L 4G8GE 1BVKA 4JFDE 4MNGA 4OCSL 4PRHD 3V6BR 4U7MA 4CJ1A 4IDJH 4Z7VE 1HHKA 2OLDA 3WFBL 3VRJA 4O58H 3JV5A 3HAEA 1VEPA 2I25N 2QSQA 3PG2A 1QYGH 4QHKJ 4RWYH 1H3UA 4OLVH 5D7KD 5IMOB 5IM7A 1TPXC 1KULA 4G8EA 1AXTH 4DVBA 1KCLA 4JFYA 2ZUQC 3GMRB 2GYSA 5INCB 1NDMA 2IAMD 1JBJA 5MEQA 2DQTH 3CU7A 3GBMH 1U36A 5D6CA 2PXYD 3SCMD 3U7YL 5KN5A 3R06A 3LPFA 1ZHLA 2Q1EA 4X6EA 4MD4B 1HIML 3U36A 2HMID 1S5IL 2CDEB 3ME0A 3BGFB 1F4YH 5D1QB 3P4LA 5A16A 3EFFA 2FYYA 2BRQA 2WIIB 5FHAH 5DK0A 1OAYL 4Z78B 5BVPH 2G75B 2XV6B 5TE6L 2HH0H 4U1GC 3VXSB 1NGYA 3OR6A 2HKFH 2AVGA 1K8IB 1RJZB 4N0RA 5E1HB 1VGKA 3O3EA 1IQDB 4MB3A 4NKIH 3RL1A 2R2BB 3WXWH 4G42B 3RY6C 3HPLA 2YD7A 4LSRL 5FEBA 3PP4L 1JYVA 1ZKAA 3VGEA 1MI5A 2W91A 3MYZA 3HFML 4RFOH 3L6FB 5F96H 3EO0B 4N5ED 4PRNB 2Y72A 1EHLH 4I0PB 4MYWB 1KB5H 2XY1A 4PJ8D 1I7UB 1FAKT 3HPJA 3L5JA 4NC1E 3LIZH 2PF6A 1XR9A 3ARDA 4PJBA 5IVNA 3F6IA 1QLRB 4V1DE 1Q1JL 5C6TL 3MRBA 2Z91B 4P5TC 5D7IA 1QRNE 1OAZL 4PJ9B 3WFEH 3Q3GA 2Z4QA 1A5FH 3R1GH 4FTVA 1BM3H 4N8VA 2ZCLL 3MRHB 3FQRA 3UTSE 2R0WL 4WFHE 1B2WH 4UMGA 1R3JA 1GZQA 3P73B 1FAIH 4PD4J 4Q6IA 4Y2DC 5JORA 3ARSA 2HVJB 3QDJB 4D8PB 3KPQA 1S7QB 3WDJA 4KKLD 4WTZA 3PJSB 1JPFB 4V2CB 4F7PA 3CXHK 3MUJA 1FN4B 2GSGA 3TN0C 5JW4Q 5FA4B 4I4WB 4G6ML 4TULH 2P43B 4JFFD 1MLCA 1LEGA 4MAUH 1T3FA 4PS4H 1LK2B 2X4OB 1DQDL 3KNBA 3MRJB 5E94B 1XGYH 4EI5D 4Q9QH 4BSWB 4MJ5B 2DLGA 3O2DL 3CJJA 2MCPL 3GZKA 4BZYA 5ANMA 5GGSY 2C26A 3AFLA 3RBSA 2P7TB 1N5AB 1WICA 2P46B 3UYRH 4ZTPH 5ICXB 2JF1A 3BEVB 2QKIB 1JHKL 4H8WL 3KHOA 1RZKL 1WT5C 5I15L 4NT6B 1S9YB 3QPXH 3WD5L 1A6VH 1KB9K 3X11B 4NO2A 3VG9B 3SDAD 5KZCB 3V4VL 3GIVA 5E8EA 1NCBH 4AQ1B 1E6JL 4I8DA 5IHZA 4NKDA 3T0DA 4ODWB 4DCQB 1W0WB 2WINB 5GGTL 4FQCH 2QQQA 5KSBB 1A7RL 4KDTC 2O5XL 1NEZB 2AK4B 3Q1SH 1QR4A 3VFPA 3T0EC 4RAVA 1C7TA 1N0XH 2C7UB 3LRGA 3PQYD 5DQJA 4XRCB 2XWJA 5E6IC 5BJTA 1NDGA 3MJ8A 5D1QC 5F1IA 2CH8A 2VLRD 1GC1H 3TV3L 4UIMA 3KJ4C 4P9ML 3NIFF 3IU3B 1QFPA 5FUOL 5F3BA 3QG6B 3RBGA 3J8F7 5GS0H 4LCIL 3RIFK 2V2TB 4MJIE 1MIMH 4XCCH 4HIIB 1AE6L 1UC6A 2X4PB 4NUJB 2YPVL 4DGVH 1UQSA 3DXAB 3W2DH 1EEYA 3ZYIA 3OJVC 5MERA 1NL0H 2EE2A 4GAFB 2D7OA 4Y1AE 1A6AB 3OJDA 4JZJB 1OVZA 4WNQB 1FC1A 2WQ8A 4P59L 4GMTH 4I0PC 2C1OA 3MV11 2HTLD 4WHTA 5D1XD 5FO9B 1KIQA 1VEMA 4TSCH 5J6HA 3FZUC 2BOCB 3EGSA 3MLYL 2AJUL 4NQDA 1ITCA 3BGMA 3G5VB 4PJ7E 3RAJL 2BY3A 5SX5K 3F5WA 3L5XL 4PJGB 1FNGB 4YIQA 3IGAA 3TO4B 4Y4HA 4PJ9C 4O4YL 3S37X 3LEYH 4U2ZA 2CKBB 3MGTA 4D0BB 3RVTC 2FGWL 1U3HD 5KOVC 2DBLL 1BFOA 3I9GH 4XPHH 5DRNB 4M9OA 5ERWB 1CDIA 5IB3A 4G9DA 5C8JB 4XX1G 4JM2A 2BVPB 1F00I 3QQ9C 2FHBA 1I4FA 5F70A 3FO2B 4PJ5D 4KKBD 3O2WL 1MREL 2DQJL 3H9ZA 3Q6FB 4Y5VB 4P2RD 1WF5A 1AGFA 2HJLA 5EOQL 4YNYA 5L2JA 4A6YA 4KK6C 4Q97A 1A7QL 5CEXB 4ONHA 3ARBB 1KPVB 4HDIA 4ZD3H 1J5OL 3V4UH 2R0ZL 1MPAL 3WS3B 4XWGL 5HJ3A 2PTTB 4MNGE 1AD0A 1TTFA 2VH5L 1T2XA 1VB9A 3D9AL 1QHOA 4N1CA 3QRGH 3WLWD 5JOPD 1LQSR 4P2YA 2XIDA 4HGWA 4PGEB 3TVMA 3O2VH 3VXMD 4XCFH 3B9EA 3C5JA 4U1LB 4AT6B 5L8KB 4QRPD 2R4RH 1EEZA 1UKTA 5JNYB 1C5CH 3IJYB 4LOUC 4BZ2H 5GGSB 5CS7A 4FNLH 3CDGA 3CXDL 1VACA 2W60B 3P3YA 4X7EC 1J86A 5IQ9A 5D7LE 5F7YC 5D9SA 3FO9B 5HDLA 5L0QB 2W0FA 1HQRA 3VG9C 4ONGH 5IMKB 1ZTXL 3L3JB 3VWJA 4UAOB 1OGTB 4GQ9H 3C5ZC 1F90H 4B0MM 2OTPA 4UQ2A 4WV1B 1WBZB 1P84J 4LHQB 4OBSA 4WHYH 4PJEF 5D2LF 3I75A 5JA8B 4X7SL 1G7QA 3ZTJH 4YDVA 5FO8A 4H5SA 2HT4C 3TIDB 2R2EA 5F71A 4NOBA 3V4PL 4WUKH 3ULUD 3WFCH 3JUYA 2PR4H 4U1MB 2H8PA 1TJGL 1N64L 3CNKA 4LHUD 3M45A 1B0GB 3MBEB 1DQQB 1RIHL 1T20A 2ZP0T 1I3GL 3LS5H 3Q6GL 1BVZA 3UJJH 4J7RA 2A9ML 2PXYA 3SCMA 1D6EB 4ZDHB 4FQLL 2JCCA 2BNUA 2HJFA 4XPAL 4B7LA 3NACL 4LCWA 4XNQB 2A83B 4OD2B 2NLJA 4PY8I 4Z77A 1KG0A 2E8YA 3SE4C 4DN3H 2GK2A 1I8LA 1J11A 3STZA 3DI3B 2E9WA 4XP6L 1LP9F 4EZMA 5LXGH 2JJTA 3U0TA 5CZVH 4Z7WE 1MWAL 2ILLA 5AD0B 3D18B 3CPLA 3VFVA 4PJCF 2HWZL 5D7IE 5CZXC 2CRMA 4EBQH 4UDUA 2OL3L 4QT5B 4FTVE 3V2AR 4PJHA 1P7QD 5C0EB 1NUFA 5IQ7H 1MY5A 2NW3B 1A1OA 4QWWC 2XN9B 4HUUB 4DZ8B 5ADOH 4NRZB 3EYUL 4HUXA 5J6GA 3TO4C 4PUBL 3MXVL 1BVLB 3QWRA 4KUCD 3QZWG 5EUOB 4RDQF 2IG2L 1CLYL 1WAAA 1RMFH 2IANA 2I60H 4N68A 4P23A 3P30H 2HT3D 2EYSB 4R3SB 3GMLA 1E4JA 3KLAA 1ZOXA 3LQMA 1ZLVH 2FR4B 4PJ8A 5ELIA 4IDJL 2EEDA 4DEPB 3B5GA 2EC9U 5ANME 3MLWH 1QYGL 5E70A 4HJGA 5AWNL 4LCUB 1AQDB 1T0PB 2VZTA 3ARBC 3HG1D 1HSBB 4ONFH 4MX7B 3MJ7B 1R5WB 1I1FA 2Q7NA 5FXCH 3HZYA 4L1HA 1UM6H 3DSFH 1CDBA 2DQTL 1IAOB 3QUMB 3SDYH 3GBML 2A1WH 2P49B 3JTSA 1FQ9C 4CNIB 1BHGA 3DYOA 1A7NH 4JCLA 3SJVE 4HC1A 1HHGA 5C0IB 3LV3B 3SDDB 1UVQB 2X1OA 1V3JA 2ZJSL 3U9UA 3KS0H 4PGBB 3LEXB 1TFHA 2DJSA 1C08B 1WFNA 3B5HA 3G6AA 1F4YL 1VA9A 4JFFA 3RZCC 4MJ6A 2H2PC 4MB4A 4NQEA 1EERB 3EAKA 2FZ3B 4M61A 5BVPL 4ZO9A 3TZVD 5L0QC 1V8HA 2HH0L 5F9JA 3IFLH 1EDQA 2YUWA 1K4DB 3VRIB 3IDGB 2HKFL 2YA2A 3DUSB 4BJLA 2XKUA 4ERSL 1I8MB 4FZ8H 3JWNC 4UT6H 4L8SC 4WV1C 2Y6SC 3WXWL 4HWZB 4JPKH 4DOHE 2IBGA 4P5KA 3AB0B 4HX1B 2EZ0D 1RZGB 2CMRH 3HE6B 2NY3D 4Z7OE 2R69L 5MEPB 3U0WH 4PGZA 4MNQB 2YOCA 3ROOA 5K59F 3TA3A 3EFDH 5F96L 3DX8A 3LRHA 1SYVA 5HYJA 1A02N 4LNRA 1ZLSH 4APQD 1A9BA 4HIHB 3TNNB 4M62H 3VWKA 1FZOB 2JE8A 3I3EA 4ZFFA 2NY7L 4FQJH 5K9KB 3JZ7A 5FGBA 4WTXA 1ZT1B 2IGFL 1EX0A 4Y88A 4AM0A 2COQA 3EIFA 3O6LH 4K23H 5CJ5A 4R0LC 5DDHB 3WFEL 1EAPA 4HD9A 1YUHA 3PQYA 1A5FL 2DQFB 4PJIF 1NC4B 5F89B 4HCRA 1BM3L 5DA4A 3STLB 1NCWL 3ZDZE 1FC2D 3I3BA 4UTBH 2BRRH 1B2WL 5I9QB 1TVDA 4LSTH 5DRZB 1CU4H 2AGJL 1CGSH 1FAIL 2VLRA 5F1NB 5ICZB 5D1ZA 3F8UB 1J18A 1D6VH 4KUZH 5SV4A 3O4LD 1BJMA 2IALA 3V5DA 1IQWH 3QUYB 5EOTB 3OKLB 5DHXB 1IM3B 2GT9B 4Y4KC 3KDMB 4I5BB 1ETZB 1UFUA 1G0XA 5B8CC 4D0DA 1LNUA 4LLDA 4AG4H 3V6OA 5HDBE 3QDGB 4OCMC 5F8RC 1FL3A 3NH7H 3TN0D 4MAUL 5DJ0B 4PS4L 3ROLB 4RA3A 1JGDA 4KWUA 1XGYL 3RWFA 4Q9QL 2VITB 5IV2A 2EICA 1MAML 1P2CB 1A7PH 4EJ1C 4K71B 4OZ4B 1QZ1A 2VERN 4LL9A 2ESVB 1CL7H 2MTPA 5HI4C 3VI4F 1DEEA 5C07E 1EIBA 2AJSH 3UYRL 2GY7B 5ICYB 3HMXA 1VHPA 1UH4A 1X5GA 4TN9A 4U1HA 3AM8C 4DEPC 4E0RB 2AKRA 3ILPB 1BQHA 2DYPA 1FE8H 1A6VL 5KSAD 2I26N 2YC1B 4JY5H 3BQUD 4P4RA 3RIFF 4YEFA 3RVVD 2HAZA 2JIXB 4MWFA 4PJXE 1MLBA 1QSED 4HAFA 4GXVH 3M1BA 4N0UE 4FQCL 1NGZB 2PCPA 3HZKB 2HJKB 3Q1SL 1DSFL 2A6JA 3FT2B 2CR3A 2EH8H 4PIRF 4J1UA 4P2RA 3DMMA 2VR4A 3T0ED 5D2NB 2OXGA 4G6JH 4X7DC 1RHHA 5I1LB 4X5WA 1GC1L 2QADB 3DURB 5E6ID 3QIBB 4PRHE 4NNYA 5D1QD 3X12B 2IQ9L 3ARQA 1MCFA 4NGHL 1ZLVK 5GS0L 3LQAH 4BH8A 3BRGC 4YWGH 1LDPH 2O61A 3VXMA 5CSZA 5DC0A 1QBLH 4U1JA 4QRPA 5MENB 5JIKA 1IGTA 2J88H 3F7QA 3E6HA 5D7KE 5BRZD 2A74B 4U0RC 4DGVL 4J8RA 1DN0A 1UJ3C 5F7EL 1RK0A 2VXQL 3OF6A 3MV9D 1O7SA 2W9DL 4HEME 3FONB 3E2HB 5CBAB 1GGUA 1H3WM 4GMTL 2WBJD 1RUQH 4O2FA 5E5UB 4UOJA 3KLHC 2QSTA 2JCCE 1T5XA 4NZUH 4X5XB 2YR3A 3MCKA 2Q86B 1GIGH 2WWMC 3LKSB 4KI5D 3U79A 1Y6KR 3BRDA 4AEIH 1JWSB 3MJ9H 3WHXA 4F15B 5FF6A 1GYAA 1U9KA 1R3HB 4P2QB 1S8DA 2OS7A 2VQTA 4OFYA 1XH3B 1G7IA 2UWEF 3MRGB 1NC2D 2BSTB 3WN5A 4MD5B 3WSQH 4JFXB 1OSPH 4MMXC 1EFQA 5I9QC 3I9GL 4OZGA 1PG7X 1UEMA 1OP5H 4MAYA 1TZIB 3RVTD 1LDSA 4F3FA 4PJHE 4LHUA 5E7FA 2V5RA 1GHFL 2P8MA 3N1MC 4RSVA 1CD0A 3IKCB 4MXQD 1FSKB 3INUL 4PRBB 4MNHA 3AS3A 4HW6A 4NFDA 4M6OH 5KANI 5FA3B 4ZD3L 5IMLB 3V4UL 5I76A 2X4TB 4PJEB 5D2LB 1MCWW 4KK6D 1Q9OA 5I1AA 3QRGL 4NKQB 1MJJA 4K71C 4WI5A 1EAJA 1RZFH 3FN3A 1BGXH 3EOTH 4YFLF 5ALBH 1OY3B 3FFDB 4HZAA 4XCFL 5DEFA 3MO1B 1RUPH 2IPUG 5IEHB 1KT2A 1C5CL 4Y16D 4PYGA 4V2BA 1XGUB 2EDXA 5C0GA 1S7SB 1DBML 3HUJF 4LVHB 5MI0C 5T1LB 3S5LA 5HXMA 3TBSB 1F13A 3E8UH 5DVNA 5HYIA 2VRAA 5F9WB 4GRWB 1VPOH 2X05A 1C12B 1CDYA 2AV1A 4GQ9L 1QACA 3KG5A 5DD5H 5K33A 3LB6C 3D39B 1T66D 1A7OH 1NAMH 2MJWA 2P48B 1BFTA 1LP9B 2AK1H 1OTTD 3QQ3B 4YAQB 5LAXA 4JFFE 3T04D 1D7FA 3C5ZD 3S88H 2VWEC 1CG9B 5IIEA 4PJCB 4X7TA 3I02B 1MH5A 1BX2B 4S1RL 5EUKB 2FL5A 1ZVHA 5CWSB 4WUKL 1DUZB 4H1LH 4OKVB 3WDIA 4NN6B 3WFCL 2PR4L 2J1KA 2HT4D 2MNUA 3H3PH 2QADC 5LVEA 4YDIH 4H26B 1NFDF 3MRFA 3QIBC 4LKXB 3LS5L 3GHEL 3GGWB 1EH9A 3VFOB 3TT3H 4TSAL 1I7RA 3OG6B 1I9RL 4ZFZB 4QXTA 3B3IB 3KPNA 4HXBL 1HKLH 4YHLL 2ZNXA 5CJ8A 3O6FB 5BQ7A 4DN3L 2DLEA 5F7FA 5HHQB 1F3JB 2XG4A 4ZO8A 2APTA 2B2XH 3BKJH 3ZDYE 3E2HC 2Y23A 4OLUH 1XCTB 3QXUA 2BCKA 4EBQL 2BMKB 3KHQA 1KLUA 4ZYKB 4MCYA 4C58B 3U4EB 3P77B 3PQYE 4D0CA 3B9DA 1U95B 5CZXD 4G3YH 4XCNB 1TVBA 1J87A 3OGCB 4F15C 4IIQC 2YSSB 2VLRE 1VFAB 4F8TA 3HE7C 1HHHB 3VFGL 4QWWD 3RY6A 2EIDA 3TO4D 1FP5A 1U8LA 1RMFL 4BZ1H 2I60L 1SVCP 4WGVB 3P30L 4ONOA 1UWGH 1F3DH 3V6OE 3GKZA 2JK5B 2IH1B 1N6VA 1CICC 1X6LA 3BP5B 5I8EB 3L3OA 3TCLB 1Z9OA 2GFBB 3PWJB 4AYFA 5CKAA 1FSKC 5DRWA 3VH8A 3NCMA 3MLWL 4HWEH 4HKBA 4W6WB 2W07A 3MZGB 1RZKC 4PGDB 4TUKH 1TJIH 4RGOH 1AY1L 4P5TA 3QEGH 4P2CG 2CIIB 3MODH 1LO0H 3MRKB 2Q76B 3PHOB 2BC4B 5IVZB 1G0YR 3ARBD 1PFCA 1UM6L 1DBKL 3DSFL 1KN4H 5GS2H 3SDYL 1PSKH 2D4FA 1UB6B 3RVXD 2ENSA 3O4LA 1HH6A 4NCDA 1J10A 4RBPH 4Y2DA 4M8VA 3L3GB 2CO7B 1X5KA 4JN2A 3CFKB 1FVCA 3K4AA 3TN0A 4ODVH 1JIBA 1ZHBB 3KWWB 4QHNA 5CIPA 5F9WC 1R24B 4UU9A 1XFPA 1T4KB 5DJAA 5EZLB 1U8NA 5H8DA 3OKOB 1PAMA 4R7NB 4HUMB 3RZCD 3IFLL 5E6ZA 2H2PD 3CU1A 1IKNC 4PJ5E 1XCQB 2DF3A 1NMBL 1CL7I 1XF1A 4PJIB 3QCUH 2ZSVA 3MRNA 4CVXA 4P2RE 4U05A 5I16A 1W72L 3SKNA 2Y07H 4UT6L 1XIWB 1YEGH 5I17B 2L7JA 5GRJH 3WO4C 5DI8B 4NZTL 4YEEA 3GMMB 2CMRL 3JV4B 3X3FH 5HVWA 3U0WL 5DLMH 5JOPE 4Y5YB 1KFAH 3MOAH 3EFDL 5F21B 3FKUS 4NN6C 3N9GH 5IBUG 1YEEH 1FO0L 2B0SH 2VOTA 3VXME 1ZLSL 1MWAB 1WT5A 1JCKA 4M62L 5JHLL 4QRPE 3S36L 1ZGLM 5DMJB 3FQUB 4FQJL 2HRPH 2XG5A 2HP4A 5IW6B 3THMH 2FO4B 5IMOA 3W39B 4G5ZH 2XOTA 4OGYH 3UZQA 2AJ3B 5EU3B 5INCA 1DLHB 3PGDB 2GTWB 2FWOB 1Z9MA 3S35H 1F11A 4JY4B 4KDTA 3O6FC 5JLZB 1HCVA 3N85H 4G6FB 2ZKHH 3AMLA 4GS7B 3AAZA 1YEHH 1RUMH 3T0EA 4MD4A 4ZOCA 4LSTL 1AGDB 3OAZH 1AHWB 1P4IH 1CU4L 4NRYB 2CDEA 5E6IA 5C3TA 4KUZL 5D1QA 1IQWL 4R96B 4NNXB 5F6IB 2WIIA 1AD9B 4OV5B 1IRAY 2G75A 5CEZD 1AFVH 4AG4L 4NZRH 3N1PC 4Y4KD 3ULUE 3QNYA 1S7WB 1K8IA 2CUIA 3QUKB 5EH1A 4L8BB 2OP4H 4PLNC 1MJ7H 1IQDA 5IBLC 3MRPB 2R2BA 2XN9D 3ZDXE 4G42A 5F97E 4EQ3A 2I9LA 4QXUH 1JHTB 2APXA 3R0NA 4IMLA 5GS3A 2VKWA 3IXTB 1L7IH 1SVZA 1CL7L 1H5BB 5JZ7C 4KY1L 3NZ8B 2ZUSA 2OTWB 1LHZA 3L6FA 3O81A 1XGPB 4LMQI 3EO0A 1BJ8A 4PRNA 4HWBA 4IOIB 4I0PA 5HI4D 3TP4A 3L7FA 3SGKC 3ZHLA 4YZFE 3P4OB 3QDMD 1YDPB 3VD5A 5J12B 1I7UA 3EJZC 2EKSB 1KCRH 2QQKH 1FE8L 3ZT6A 4KMTH 1CN4A 2IF7A 3RVUC 4X83A 1WIOA 1PX4A 5HYSB 4HLZH 4BFEA 2Z91A 1MCDA 1ORSB 5C2BH 3LKPB 4PJ9A 5I1EL 4JREC 3H8NA 3UPAA 4NWUL 4LF3B 3MRHA 4NUGH 4Z7VF 2FIKA 1NJ9B 3HTLX 1EEQA 2C5DC 3P73A 5DHVH 2HVJA 3QDJA 4L5FH 2QQLL 1ZHKB 4D8PA 3MV01 4HBQA 1S7QA 4POYA 4WUUD 4WO4B 1EGJA 2PYED 3PJSA 4WHYG 1A4KB 1JPFA 4P2OB 1PYWA 1F4XH 3NA9H 5JPNB 5FA4A 2N1KA 1MFDH 4XXCC 4I4WA 3DVGB 4ZS7H 1KB5B 5IJVA 1LK2A 5E94A 4G6KH 2XY2A 2UWEB 4BSWA 4LLVB 2LABA 4MJ5A 4YWGL 3O0RL 1TZGH 1XIWC 1EPFA 4O9HH 4OF5A 4IM8A 2P7TA 2J88L 1HNFA 4NQXA 1KC5L 1N5AA 3VG0L 3HG1E 1U92B 2UY7A 4IBLT 3FTGB 4JN1H 4OLWH 5ICXA 4Y5YC 3BEVA 2EDEA 1Q0XH 1WUNT 2QKIA 5JTWA 2LFGA 4HKJB 4YFDB 1RUQL 2A73B 2BVEA 2FEEL 4ODUB 5HHVH 4OF3A 1S9YA 1NFIB 1GIGL 4E41D 3X11A 5BOZG 3VDBA 3K74B 2DMKA 3KLHD 4RBPK 1N26A 1IE5A 1IGFH 1GXEA 4AEIL 3C5ZA 3D48R 1TETH 2AJXH 4ODWA 3AUVA 5D72H 4DCQA 2WINA 3AGVA 2BZDA 3UPRB 4FRWA 3ESUF 1I1AB 1GOGA 4S0SD 5C9JB 3WSQL 4ZUUB 3VD3A 1R5VB 1OSPL 4GH7B 3HUJB 2C7UA 1J1XH 3UTTD 25C8L 3MGAA 5I30L 2V2WB 5F6IC 3SDXE 4KZDH 2A6KB 3S36X 3D85B 3IU3A 1FL5B 1NGQH 1QFOA 2DWDB 2ZCKH 2X42A 4ELMB 3LZFL 3QG6A 3NCJH 1JWMA 2D7PA 15C8L 3ARED 3BSZH 4W4OC 4Q58C 4OT1H 3H9SD 1E6OH 3O6MH 2V2TA 5IFJB 5E56A 4UIKH 2XZCH 5E99H 5HHOB 4HIIA 3DRTA 4NUJA 1RZFL 1D5BB 1CFQA 3ZE1E 3EOTL 3SE4A 3DXAA 4I3RH 1CS6A 3V9FA 5F8QC 2HFFB 2YPLB 1KELL 1RUPL 1ZT4A 4HIXH 1FORH 1OPGH 2VC2L 4JZJA 4N9GB 4WNQA 4X6CE 3QQ4B 3WMSA 1NFDB 2YZ8A 4LSSH 2VMFA 4ZNEE 1K4CB 5FO9A 2Z92B 3QNZB 1XMWA 2BOCA 3T2QA 2FJHA 5HI3D 3G5VA 4H0IA 3E8UL 5C0DB 1GGCL 2C3GA 4NDMB 4RISH 1BQUA 3OAZK 1FCGA 4PJGA 3MR9B 1AI1L 3O4LE 3MRRB 2VUOA 4XP4H 4U33A 3TO4A 5L2KD 1UEYA 1KJ2A 1X5HA 4M6NH 4K2UH 1A7OL 1NAML 5BCAA 5DYOB 4D0BA 5MEOB 2JIXD 3S88L 3GMPB 5DRNA 1CWVA 2X4RB 4NP4L 5IBUB 4JPVH 4KJQC 2YD5A 3NABH 2OMBA 3FO2A 1I85C 1OP3H 4MCZB 4YJZL 4YDKH 3OWEA 3GHBH 3H3PL 2JJSC 1CDHA 4YDIL 5ACZA 1F3RB 4R2GB 5CP7A 3MRIA 4HGMA 3T3PE 5CEXA 5HYFA 3ARBA 1KPVA 2QADD 3H6JA 3WS3A 2PTTA 1LO5B 3TT3L 4HFUH 3V52H 2X4UB 4QLRA 2B4CH 1HKLL 1JF1A 2AV7B 3S96B 2WBWB 4AT6A 5IB1B 5MEND 4HMEA 5GRVK 5JNYA 3IJYA 1QSEE 2B2XL 3BKJL 5GGSA 4OLUL 1Z9LA 1QA9A 1OT1A 2XZQL 3B43A 3RZCA 2W60A 4NJAH 1T6WA 3FO9A 1R3KB 2KL6A 3N1QC 2C1PB 1FFNB 4Y19B 1U8MA 2BFVH 4G3YL 3IDJB 1OGTA 3T0EE 4NIKB 3G08B 4FQXD 1E4WH 4LAJH 3BEWB 4FHBD 2MQ3A 3ZO0A 4L8SA 3BDYH 4WV1A 3TYGH 1XF3B 2ICES 1NLDL 4KU1A 5SV3A 4EQ2A 2VLKD 5TQ2H 1CDJA 4M43L 2PTUA 3HE7D 4BZ1L 3JTTB 1JI1A 4LSDA 1UWGL 5GISH 5EU6D 1JF6A 5L6YH 4IHOB 1Y6MR 3FQNB 4PJ7F 4U1MA 2FSEA 2G2RB 5BRZE 4KZEH 1V3KA 2EE6A 1CICD 1B0GA 1QQDB 1DQQA 3D0VA 3MV9E 3IS1X 4XI5C 4HWEL 2E9JA 5DJZA 4GRMB 5I1DB 1JGUH 4R4FL 1TJIL 4S1QH 4RGOL 4ZDHA 4M93B 4JQVC 5L7XL 3QFDB 3MODL 4R0LA 1LO0L 2R39A 4ETQB 3PWPB 4XNQA 3LN4B 4URTB 2A83A 4OD2A 4KI5E 1KN4L 2B39A 1PSKL 3BIBX 4FFWC 1MRDL 1FZMB 3BRFA 1CD8A 2XZAH 5HGGS 5C08D 3MACH 3TIEB 4F58H 1QSFB 5AD0A 4L4VB 1KPUB 1DR9A 1VDGA 4JDZB 1Q9LB 1RIVL 2NZIA 4Y4KA 2P5WD 4ODVL 4QT5A 4S1SH 4QGYA 5B8CA 3VXUD 1ZHNA 4XNUH 5C0EA 1NCDH 1GC1C 3B2VH 2XN9A 4HUUA 4LEOB 4DZ8A 4NRZA 5ITBH 3H42L 4I9WD 2V5MA 3V0WH 1KCVL 4GLRH 1K2DB 2H45A 4OLZH 1BVLA 2O93L 3CFCL 2Y07L 5EUOA 5GS0C 5CGYC 4JR9H 5D5MA 2ERJB 1RJYB 1YEGL 1R5IA 3D39D 3VRLE 4KAQH 3BPLB 5F7LB 3QDMA 3X3FL 2FR4A 1PDKA 5GRYA 1MCSA 1KFAL 3MOAL 1HYSC 3FB7B 3AM8A 1YEEL 3KR3H 1I8IB 5CP3A 1AO7D 2VN4A 4C56D 1HINL 5DJ2B 4R2GC 2VDMH 4LCUA 4WI3A 1AQDA 1UACH 3THML 4G5ZL 2UYLA 1S7VA 4MX7A 5DK2B 5ID1B 1E27B 1I3RA 4Y0GA 3F7VB 3FT4B 3QUMA 1IAOA 1BF2A 2GEEA 2W0PA 3MOBH 1S5HB 3S35L 3RI5K 1MUJB 2WUCL 4CNIA 3N85L 2ZKHL 1XZ0B 1YEHL 1RUML 2Y9RT 1EZVX 4OF0A 1X9QA 5C0IA 5JW5B 3LV3A 4U1NB 1UVQA 1MIEH 1KYOK 1NGPL 1C08A 1MHCB 1ERNA 5A40E 4ZXBD 4ZPTB 1WWAX 1WSST 4NPYB 1AFVL 2K7QA 3UROR 4NZRL 1A3RL 4G8GB 4JANA 5E2JA 3VRIA 3IDGA 4LPYA 3PWNB 5ESVB 4BM7A 3DUSA 4PP2B 1OP3K 4Z7VB 1I8MA 4E5XB 2OP4L 1HQ4B 1MJ7L 2UV3A 4PLJC 1LE5B 1LEIB 3BH8B 1HDMB 1VKXB 1DBBH 4Z7WF 1WLHA 4HWZA 4RA0C 2LAAA 3DLQR 1UJ3A 1K5NA 1L7IL 3VGGA 5IBLD 1RZGA 2VAJA 5D7IF 5KOMC 5MEPA 2DIAA 3SQOH 3KPSB 4U3CA 2SEBB 5KSUB 1ZANL 3SOBL 1LO4H 4E41A 3RPIB 2D0HA 5IT2H 1RURH 4HIHA 1N4XL 4PJDE 3NBNA 3T2NH 1FZOA 3TH2T 4MHHG 1VENA 4LLQB 4TPRH 1KCRL 2QQKL 5JXAL 1J0JA 1FJ1B 3DX9B 3KYMB 1ZT1A 3QIUD 1F6FB 3LKQB 3EJZD 3GSNH 4OD1H 4M93C 3RWIB 5C2BL 3RVUD 5ECJE 5DDHA 5JOEA 3T65B 5F89A 4PRIB 1NC4A 1T03H 3STLA 2DI9A 2CR6A 4NUGL 2VKXA 4OZFH 1IBGH 1YN7A 2JB6A 2EDLA 2OXHA 5DRZA 3D5OF 2EH7H 5ICZA 4L5FL 5DUPH 3MGOB 4PJGE 2DL9A 2IADA 5EOTA 3OKLA 4G43B 1IM3A 2GT9A 1F4XL 3FFCD 3OR7B 4JGJA 3WUWB 3KDMA 1SBBA 43CAB 1M6OB 1ETZA 3D2UB 3MRMA 4J4PD 3H9SA 1MFDL 2H9GB 3QDGA 4QF1B 2AXGB 3MFFB 5EU7C 5DFWH 4ZS7L 1QFWH 5DJ0A 3S7GA 3V6FB 4H1LG 3ROLA 1A7BA 5B38G 1N2RB 3TFKC 1HZHH 5EBGA 4RQQA 5TF1H 4P46B 4OFPA 5K9QG 3QH3A 4ODSL 1QTYT 2Q3AA 2ERJC 4O9HL 3EDDA 4YXKL 5LGJB 2ESVA 4GBXB 2YBRB 3BPLC 2F53D 2OBGA 3O9WB 5ICYA 2C3VB 1IGCH 4FZEH 4OLWL 4V1DB 5HI5D 1RUKH 4OGXL 4XMPL 4QRUA 4LLAA 3H7BB 3ESVF 4UB0H 1QRNB 1FNEB 1YEIH 3LSOB 4E0RA 3DV6A 5HHVL 4OD3H 3ILPA 4RMTA 4GOSA 3C09C 1YEKH 5L2KA 1S7TB 2YC1A 3UTSB 3JV0A 5TH2A 4LEXH 2JIXA 3EJYC 3MV7B 1TETL 4X7CC 2LVCA 5D72L 4KROB 3EO1B 3T3ME 4Z7OF 3CZFB 1NGZA 3WHE0 3HZKA 2HJKA 2K9UA 2GJ6D 3CH1B 1VSCA 1YMHB 3K8LA 2AEPL 1J1XL 1UWEH 4ENED 2ADJB 2WZPD 3UPCA 3FO1A 4G7VH 3PWVB 5FDYA 2CDGB 4Q2ZB 4GKOA 2E7MA 4LSUH 3U1SL 1PQZB 4PV8B 5I1LA 1CGYA 4X4XB 1IEBB 3DURA 4GKSB 3QIBA 4KZDL 3IDMA 3LD8B 3X12A 3FMGH 2ED9A 2ZOKB 1NGQL 2H6PB 3NCJL 3P0VH 3BSZL 1GZPB 3D1MC 3KYAA 4OT1L 5E00B 3O6ML 3TBTB 1GOFA 4LPVA 1KXQE 3ZDZF 4JB9H 2E27H 5MENA 4WVRA 4UIKL 1G1CA 1EV2E 4LASH 3CXHJ 1GGTA 4LDLB 3EYOB 5A2LH 4KKNA 2JJVA 4UNVA 4HPOL 3HI5H 2X89D 5CJBA 1CXEA 1D9KB 3FONA 1OPGL 4HIXL 4R26L 3IXAB 3LHPH 5CBAA 5LGKA 5E5MB 2DI8A 4NM8H 3MRLB 4LSSL 3WE6B 2UZIH 4CBPA 4NSKB 4X5XA 2H32H 1FV1B 1OOAA 1P7KB 2Q86A 1HOCB 4XNZB 5AG8A 3LKSA 4JM2F 5BV7L 2NTSP 1JWSA 4IIQA 3SE8H 5DD0L 1R3HA 4P2QA 3HE7A 3IFNH 2HFEB 4M6NL 4K2UL 3QT2A 5CEZE 1XH3A 3MRGA 4JAMB 3O2DA 2BSTA 4MD5A 3DO7B 4JFXA 1I3VA 2D03L 1KB9J 3TF7C 1TZIA 3QEHB 5H35A 3JSSA 2J6EH 4U49A 2PW2B 4JPVL 2NY4B 4OTXL 4ZS6C 3NGBB 2XN9E 3NABL 4OIBA 3HI1B 4XHQA 1AH1A 4MJIB 4YDKL 5D6DC 3IKCA 4OB5H 5EUOE 4PRBA 1N59B 5D5ME 4Z95H 4PJXF 5J11B 4DN4H 4F33B 5FA3A 5C6PB 5IMLA 2X4TA 4PJEA 4Y1AB 2YHGA 4PBWD 3QDME 3GMNB 1YJDL 5DD3H 5DTFB 3VGDA 2EXYC 1Z5LB 3FFDA 4GBXC 5H2BA 3MO1A 2VXVH 5F3HB 4PJ7B 5GGTA 1JPST 5TE7H 5IEHA 5J1TC 2EIEA 1DL7H 2P5WA 1OAUH 2YUVA 3MLXH 1XGUA 1S7SA 3MCLH 4GAYB 4AH2B 2X41A 3HB3D 1G7JB 5EO9B 3TBSA 1A1NB 1JN6A 4GLRI 4NJAL 5TFSH 1KIRB 4HUNB 3I85A 3BDXA 2A0LD 4L29A 2P8LB 1C12A 4WUUE 2BFVL 2PYEE 1IKNA 1OHQA 1E4WL 2XPGB 3D39A 5ISZD 1SJXA 1W0YT 43C9B 2V5SA 3VD9A 3VXRB 4AJ0A 2CPCA 3QQ3A 3TYGL 4YAQA 4G9FB 3RX5A 2OM5A 1MJ8H 3M07A 2VSCA 5TQ2L 2FECI 2GKIA 3I02A 4NBZB 1BX2A 4Q0XH 2GJZA 4KJYB 5EUKA 1TJHL 1BVKB 1DUZA 4OKVA 4MNGB 5L9DH 3A6BH 4PY8J 4TRPH 1RSFA 4LIQE 3JWOH 1F6AB 4KZEL 3GK8H 2UY6A 1Q72H 4H26A 3CMGA 2DS4A 1QOKA 2ZUYA 3HAEB 3LD8C 4LKXA 4HSQA 1FGNH 1QBBA 5DJ8B 3WEXB 3PF2A 4XI5D 4B7IA 3RZWA 3OG4B 2NY6B 3B3IA 4E41E 2QBWA 4JFYB 3DNKA 3O6FA 4PJHF 5GPRA 5D7LB 4LRIC 5MEQB 4TVPH 2XZAL 1F3JA 5HHQA 1JHLH 5D6CB 1JYNA 4F58L 2IPKA 5B3NA 1ZHLB 4FFWD 1T04B 3NTCH 3ZSSA 5DVLA 3RUGE 3U36B 2IBZX 1S3KH 4UNUA 4KRLB 5C0NC 4ZYKA 1I7ZA 4XNZC 3LN5B 3U4EA 4H1LB 3L5WB 3P77A 5J7CC 3UTTE 2FYYB 2OMNA 1U95A 3MX0A 3OKKB 4XX1E 4X4MA 5JW4M 4XCNA 4XNUL 3QIWB 1OD9A 1NCDL 3EYFA 3OGCA 3U48A 5C92A 2YSSA 2V9TA 3BAEL 3V0WL 3GUTB 4LNVA 4XP1L 2F5BL 1HHHA 2D0FA 4OLZL 2EDTA 4ZTOL 4WFFD 3LQAC 5I1GH 3RI5F 1NUNB 2CSPA 4KHTH 3H9SE 2AAVA 5GS0D 4PV9B 5CGYD 2JK5A 2IH1A 1N7ML 4NWTH 1OGAD 2NY4C 2PYFA 1P7HL 5LWYH 5I8EA 4DZBA 4UNTA 3VA6A 2VTFA 3KPRD 3SGKA 3TCLA 2GFBA 4LU5L 3PWJA 5EWIH 2O26U 4FFZH 3TT1L 5DMGC 1XF2B 1TMCB 3W0WB 1PX3A 1G9MH 2FLBT 5J11C 2VDML 4PGDA 3BDBA 4NO5B 1CDCA 3ARDB 4Z7WB 2CIIA 3MRKA 2Q76A 3PHOA 2BC4A 4XHJC 5IVZA 4M7ZB 5D7IB 1QVOB 3MOBL 3H0TA 5CJOH 4EN3B 1UB6A 2W1NA 3RA7H 4B41A 4FTVB 5L2KE 5CSGA 3L3GA 3FQRB 3CFKA 2R8SH 1QFWI 1GZQB 4LBEA 1MIEL 1WCQA 4F57L 1K8DB 2YA0A 5ABDE 1ZHBA 4OFIA 3KWWA 1R24A 1T4KA 4XXCA 5EZLA 2Z8SA 3GM0A 1BAFL 3OKOA 2GSGB 2BVUA 2HA1A 5AUMA 2Z93B 3RKDC 3PDGA 4PJIA 4PRAA 3QBTB 2NY1B 4Q6YA 5EC2B 1T3FB 2V7NB 2F53A 4FFYH 4H20H 1MELA 3NFPB 1XIWA 5IP4A 5I17A 3ZDYF 1DBBL 1MHPH 4UI2A 5ANMB 1KTLA 1U8QA 3B9KB 4H88L 4Q74A 1MQKH 3X17A 4PLJD 5DI8A 2CGRL 4YQXL 3GMMA 3JV4A 4Z7QE 3GO1H 1CCZA 5EN2B 1HILB 4Y5YA 3SQOL 5IF0A 3RWEB 1WV7T 1LO4L 2J5LC 2XQYG 1QG3A 4WHDA 3QB7C 5IT2L 1RURL 1MWAA 5MENE 4ZQKA 4X9GA 4PFEA 3BOVA 1A1MB 3FQUA 3BD3A 5FKAB 4TPRL 4C83A 5IW6A 2FO4A 3W39A 2O5YH 1ZGLB 5I19H 3SJVB 2AJ3A 4LRNH 4NO2B 5SWQB 5EU3A 3GSNL 3CFEB 4OD1L 1DLHA 1BQLH 4XP5L 2NY6C 2GTWA 2X1WL 3SDCC 5IHZB 2FWOA 5F7DA 1T03L 4JY4A 5JLZA 3S98A 4JM4H 4YGVB 3ZLQC 4GJTB 1IBGL 4WEBH 1AGDA 1IEHA 4NBYB 2OSLB 1EO8H 2BK8A 2D4DA 3VFPB 4F9PC 4RAVB 5DUPL 4MXVE 4K3DH 1IKFL 5TF0A 5DD1L 5IG7B 2V5TA 2VLKE 2XFXB 4R96A 4NNXA 1AD9A 5BJTB 3ISWA 5GJTH 2FO1A 3WFDL 3MV8B 4DOHB 5EU6E 3QIWC 4UIMB 4W4OA 1QFWL 4U1SA 1GJIA 3OMZA 5IFHH 2AI0H 3QUKA 1HZHL 4L8BA 5F3BB 5J9PB 5TF1L 3MRPA 3T08A 4PRPD 2NTFB 5ID0B 1CI5A 5I74B 1JHTA 4P3DB 2Y4SA 3IXTA 4LDEB 2F15A 1H5BA 3NZ8A 2OTWA 1XGPA 4IEFB 1RUKL 4IOIA 1I1YB 3OJDB 3EW3B 5C09D 1BD2D 1NMAH 4UB0L 4E42B 1MAJA 3P4OA 3HKFA 1YDPA 4L9DA 5C08E 4OD3L 4DGIH 3LS4H 1KIQB 4BFGA 4LEXL 3UAJC 2DQCH 3LKPA 2P5WE 1FNSH 1RV6X 4XPBH 3DPBA 1YEFH 4X9FA 4YIQB 3CX5K 3VXUE 2F54D 4LF3A 4EN3C 1NJ9A 3WIFA 4I9WE 1A3LL 4GRWE 1LO3H 2YS4A 4HPYH 1UWEL 4WO4A 1O5DT 1U91A 2BXZA 3DETC 3OX8B 1I85A 4G7VL 4ALAH 5IB3B 4G9DB 1A4KA 4JM2B 4UUJB 4JO4H 3DUHA 1C5BL 1P9MC 5GGVH 3D39E 5JR1H 4NZDA 2DM3A 2JJSA 4P3WA 3TCXA 3DVGA 5IHBA 3V7AG 3FMGL 1TZHB 5DEZA 3SEPA 1KB5A 3MLUH 4YNYB 5L2JB 2PUQT 5B21A 5C07B 1OB1A 2UWEA 3LDBB 1U58B 4BELD 1R3LB 4LLVA 2NY1C 1MRFH 2J8UB 3QUXB 5C71A 1AO7E 4JB9L 4C56E 2DKUA 2E27L 3AROA 1B4RA 5I71C 2WNGA 1MRCH 4NQUA 1AD0B 4LASL 4FQPA 1YMMD 5IB2B 3B9KC 2VR9A 4L8CB 1F45A 3O11B 3FTGA 1ES0B 2VDNH 4EIGB 1WZLA 3LHPL 5T1MA 4HKJA 3MLVL 5IK3A 4NM8L 2A73A 4PJXB 3AC0A 4DKEH 2UZIL 4ODUA 5JIHA 2GK0A 3KPSD 3ULUF 1NFIA 3QXAB 4N0UB 5BS0B 1VACB 1WIUA 2ITDB 1RU9H 1JPGB 2YD9A 5D9SB 1FCCA 2MWCA 1MCJA 1MCPL 1X5FA 4WW2C 1RZ8A 3IFNL 4LVNB 4Z8FH 3S97C 2B5IC 4DGYH 4CRPA 5C9JA 4LSQL 4PRHB 1DVFB 3L3HB 4PRID 4YZFF 4QRRB 1A22B 3I75B 5CEZH 1G7QB 3ZKQD 4H5SB 1H8NA 2V2WA 2A77H 4K94H 4LVOB 1N0LA 3GB7A 2AJYL 2X40A 2A6KA 4ZS6D 3D85A 4OB5L 3VD7A 1FL5A 2H8PB 4ELMA 1QSZA 3QYCA 4DN4L 2HYMA 3D2UD 3PABA 1YEDB 2WAHA 4UOW1 4I77H 2XZZA 2IAMB 5IFJA 2DQEL 4JQVA 3UBXG 3MMEB 4HFWB 2PXYB 5DD3L 3SCMB 1CDGA 1D5BA 4XBEL 2BNUB 4KUCF 5K9OA 2HFFA 2VXVL 2YPLA 3G5YB 2NLJB 1NMCB 5TE7L 3ARPA 4N9GA 5FCSH 3STZB 2EXYD 1DL7L 2BHYA 2VDRL 3QQ4A 1F97A 1NFDA 3MLXL 4GBXD 5HVGB 4ODTL 5DVOA 4ESKA 2HT2C 3MCLL 3F6LA 2X9WA 3QNZA 3ILQC 4D3CH 1RHFA 4F8QA 5C0DA 4KHXL 3B8SA 4NDMA 3DECA 4RCAA 4I18B 1OCWH 2P24B 5LBSH 3MRRA 3FFCE 4PJHB 5AZEH 4HULB 4O02H 4FQIH 5DYOA 1ADQH 1EBAA 4HUXB 4F7EB 3QHZL 4ZMAT 5MEOA 3LPGA 3MV7D 4KJPD 5F6HI 3GMPA 5HHNB 3IFPB 2X4RA 3BO8A 1J0KA 4Q9RL 1LEKB 2QSCL 4KVNL 2F9BT 5DZOA 3CFDB 1ZSDB 1AKJD 2DLHA 5L88L 4MCZA 3KS0J 5L9DL 5F7MC 3JWOL 4IRJD 1FNAA 1K85A 3GK8L 2VZOA 2F53E 2AABL 1Q72L 4M5YL 2FB4H 1IEAB 1FGNL 2CUMA 3FRPG 1WCBB 3LDBC 4LIQH 4JQXC 3QUXC 4RGMB 1LO5A 1T89C 4EVNB 2XI9A 2K7PA 2E7CA 2X4UA 1GPOL 1V3LA 3OJ2C 3CSYB 2ID5A 1I1FB 2V9RA 1YNTA 1M71A 1KEML 3DX7B 1WTGT 5EOCJ 4DJMA 32C2B 1KSRA 1LO2H 4TVPL 1RZIB 4QXGL 3L3KA 3SDXF 3WIIL 1FVEB 1HHGB 2F19L 4RX4D 4P99A 1S3KL 2GJ6E 3VDAA 3U46B 4OZFG 5KTEL 1OL0A 3CZJA 5T5NF 4RFEB 1R3KA 5FUZH 5FOBA 4JFFB 2VLJD 3OTTA 1FFNA 3P0YH 3C6LC 4KKCC 3ZKXB 4Y2OA 4Y19A 2OI9B 5HY9B 1IC1A 3UTOA 3IDJA 5C0ND 4HS8H 5HD8D 4EI5B 3G08A 5C9KA 5LCVH 3BEWA 5F7HA 3BD5A 4UT7H 3ZE1F 5MP6H 1DFBH 4WWKD 2YRLA 4M02A 2RIKA 1M7XA 4AY0A 1IC4H 3MA9H 5MHSD 4XH2B 2D0GA 1T2QL 2F58L 4IOSD 5I1GL 1EBPA 4K3JH 5TDOB 4X6CF 4G8FB 4KHTL 5T1KD 4ZAKD 1DVFC 2UUDH 4YR6A 4NWTL 3TM6A 4LLUA 2YD1A 4IHOA 4N0CD 4OCSH 2J2ZA 1W0VB 2DD8H 1W8NA 2G2RA 4LVOC 3RTQC 5EWIL 3WFBH 3DX8B 4FFZL 3T0AA 1A21A 1QQDA 2ADIB 4I3GA 1SQ2N 1A9BB 3SDAB 1G9ML 5A2JH 4AEFA 3QFJD 1N6QL 1NEUA 1EK3A 4GW4B 3BW9B 4XAWH 2IAMC 2NX5B 4OIAA 3N50A 3MLPA 3C60B 4ETQA 3W5MA 3UC0H 2CLVB 4KTYA 1G7LA 5CJOL 1FZMA 3RA7L 5JO5A 3PQYB 3TIEA 3U7YH 1NMCC 2R56H 5D96B 3SBWC 2R8SL 3QXWA 4JDZA 3SKJH 1Q9LA 2VLRB 3PGFH 3QDHA 5JW4R 3T3PF 1WZKA 2IALB 2OCFD 2FDBP 4XC3H 3T0XA 4I18C 1CFSB 1OAYH 5H94A 4MQXD 4PRPA 2I07B 5TE6H 1UM4L 4MA1C 1REIA 3WV0A 1K2DA 3RKDD 1JGLL 4AIOA 3ALPA 5DZLA 4H20L 1WEJH 1RJYA 3S37H 1MHPL 4DW2H 1A6TA 1MQKL 1DQLH 3VXRD 4G9FD 1AR2A 3PP4H 2ICWI 4BFIB 1DQJB 4JY6A 3GO1L 4BQ6A 1T1XB 3VGBA 4WW1A 5AYQA 5D1XB 1DEEB 2XXCB 4QHMB 3DVIA 3FB7A 4CDGC 1PLGL 12E8H 3AS0A 5DJ2A 3STBA 1B6DA 4NRXB 2AKRB 4K8RH 1T0NA 1IGIL 5I19L 4WJ5B 3ELAT 2F54A 4RGMC 5BV7C 1Q1JH 1HH9B 5DK2A 5ID1A 1E27A 4P4RB 1Y0LB 4QRTB 3FT4A 1U3HB 2BNRD 4MWFB 1X5IA 4PJAA 1MLBB 4LCYB 4GW5B 2FIRT 1MUJA 3QA3B 1NBQA 4HQQH 3SDCD 4JRXD 5JW5A 4U1NA 1EO8L 4XMKH 5ISZE 4KKLC 4PJ5B 4GW1A 4YXHH 1MHCA 4K3DL 1DBJH 4P2RB 4ZPTA 1KACB 3ZKMC 4M1DL 1P69B 2EC8A 4NPYA 3T4AB 4BUGA 1CXIA 2OI9C 1IGJB 1NCTA 4UINL 5KS9A 4G8GA 4EI5C 5DWUH 3PWNA 5ESVA 1KXVC 3DSNA 3ARUA 1LD9B 2AI0L 4KI5F 4H25B 1YMMA 4Z7VA 5IFHL 3SQBA 1HQ4A 1T83C 1PEWA 1LE5A 1HDMA 1VKXA 3VXMB 3R8QA 5C1MB 5A3IC 3P4MB 4LK4A 4U1JB 5E08L 3BPCB 4QHKI 1GH7A 1YPZE 2B4CC 3A6OA 1GRWA 3D69B 4P48A 4ELME 3KPSA 1EFXD 1DN0B 3CVIH 1CD1B 5KSUA 1RK0B 3ULSB 4UTAH 2LAGB 4M6MH 4P4KC 2Z35A 4H8WH 1A0QH 4LLQA 2APVA 4L3ED 3LS4L 3SDAC 3PE9A 1FJ1A 4BA8A 3KYMA 3QXDB 3BE1H 3LKQA 1DEDA 5K93A 3W0WD 3FOLB 1JMZA 2DQCL 3RWIA 3C60C 3VRLF 4XPBL 5FF6B 4OCRH 1BJ1H 1Y6NR 3HNSH 4PRIA 5TPWH 3UAJD 3OJMB 2N4IA 1CXKA 1YZZA 1YN6A 3FN0H 5ACLA 4OQ1A 4X8XA 2O5XH 4HPYL 4DWHA 5D96C 3MGOA 4EN3D 3C6SB 2BSRB 4NO0D 1YQ2A 4ALAL 4WFFE 2Y1VA 1G7PB 1V3MA 3OR7A 4JO4L 2FX8H 4DK6A 5GGVL 5D6DA 43CAA 3D2UA 3DETD 4MA7L 3UTQB 3KYNA 1F02I 2H9GA 4QF1A 2AXGA 3MFFA 3TV3H 1OGAE 3IU4H 4P9MH 3MLUL 1QPPA 3MROB 2UUDK 3JVGC 3KPRE 5DD6B 2V9QA 3X3GL 5F7UA 4LLWB 1MRFL 3MLTB 5DSCB 3BKYH 3PUCA 3ZTNL 1GVIA 3GJFH 4PBXA 2ATPB 3VXOB 1JZ6A 5I1AB 3HA0A 4RIRA 5LGJA 4GBXA 2YBRA 4AQOA 1T1ZB 5GRUH 2VZUA 1SM3L 3LPWA 3NCCB 2YPVH 2C3VA 4V1DA 5KAQF 3B9KD 4OZFB 1JL8A 3RX8A 1QRNA 1FNEA 3LSOA 2Z9TA 1T80A 5GS2D 4DKEL 1HI6B 2DJUA 3MXWH 4D2NA 1P7QB 1S7TA 4XVUC 2AJUH 3UTSA 5JUEL 3SKUD 1DANT 5GS1B 1QBAA 3MV7A 3VI3E 3RIAF 1CGVA 3S34H 1U3HC 3EO1A 3UCRA 3CZFA 1UADC 4YXLL 4OCWL 5EIVA 3SE9L 3CH1A 1JZ2A 1F42A 1B6UA 4KXZH 3WNMA 2X9XA 4HH8A 2ADJA 4PJDF 3DGGB 5CEZL 4X7TB 2R1YB 2CDGA 4KKBC 4Q2ZA 3QO1B 5EG6C 3RNKA 1PQZA 2GIYA 5IHUL 4PV8A 2X6MA 4X4XA 2FL5B 1IEBA 4K94L 1T21B 4GKSA 3EDKA 3O2WH 2DQJH 4Q7DA 2ZOKA 4OI9A 2H6PA 4YPGB 5EOQH 3HG1B 5KW9H 1JWUB 1GZPA 1OQOA 5E00A 1A7QH 4JRYB 2VXUH 2AEIT 3MV8D 3TBTA 3Q5YA 3VDCA 4XBPA 5D7JD 3C8KB 1TLKA 5F7NC 2ZUQB 2LU4A 3EYOA 1NCUA 4LRIA 2H3NB 4PJGF 2MPAH 3H2WA 3QXVA 2IBBA 1IAKA 4RX4A 1F3DJ 3IXAA 5E5MA 1KCUH 5JXEC 3MRLA 3WE6A 3G5ZB 3BZFB 4NSKA 1FYTD 4R97B 1P7KA 3TZVB 3CXDH 4BQCA 4D3CL 1HOCA 5CEYA 4KTEL 4M9PA 1ZLUK 1K9TA 3AU1A 1OCWL 4NC0B 1YC8A 4AENA 4D0CB 4POZC 1ZTXH 4JFED 3RGVD 3VXTB 4MVBD 1TVBB 2HFEA 1PBYA 5AZEL 4O02L 3ZYZA 5CJXC 4FQIL 1ADQL 1FG9C 2CQVA 1E28A 5HPMB 1P1ZB 2DJ4A 1FNFA 3DO7A 3SDXB 4NJ9H 4U2YA 3V0AC 3G5XA 2NY3B 3QEHA 5KVDL 1H8OA 2XT1B 2CRIA 4HF5H 5EU7E 2PW2A 3MFGB 5KG9B 1T2JA 4PRPE 3HI1A 4APQB 2M1KA 3V4PH 3QFJA 5AAMA 5LJYH 2ICEB 1N59A 3PV7A 4UILH 4KRNA 4NC2B 1JPSH 3KVQA 5JQHC 4F33A 3T2PA 1RIHH 2R1WB 4Y1AA 3T3MF 5C09E 1BD2E 5AEAA 2CDFB 4GG6E 2VXSH 4X6CB 4PPTA 3MJ9A 5DTFA 1TCRA 5EULV 1WC7B 1Z5LA 1UG9A 3UTZA 5C0BD 5F3HA 4PJ7A 3O45B 1LO2L 2Z31C 2Q8BL 1JUFB 1Q8MA 3O4LB 2VAAB 1I9JH 3WLBB 1G7MA 4GAYA 4AH2A 1BBDH 2F54E 5EO9A 5JA9A 4JN2B 1A1NA 2UVEA 2RR3A 4WTZG 3FB5A 1BWWA 1KIRA 5FUZL 3KPMB 4PJAE 3TN0B 3P0YL 2OL3H 4UU9B 4HS8L 5DJAB 3JXAA 5GS1C 2XPGA 5ILTL 3PP3K 3OGOE 4UT7L 5BS0D 3C6LD 4KKCD 4M5ZH 3WJJC 1H15B 1DFBL 4NHUA 1BOGB 3NCYS 5E4EB 43C9A 1HXYA 4F7MB 5MP6L 3ECBB 3VXRA 2EDQA 4G9FA 2ZSVB 3W11D 1SEBA 3PWUB 3T09A 5FGCE 2HT3C 3SKNB 4K3JL 4QRQA 5J89A 1HNGA 1ONQB 4KJYA 2DLIA 3IDYB 1J1PH 2E7LC 5KS9E 4JKPH 5GRXG 5IB5A 4OM0H 3DJ9A 1DVFD 2DD8L 1YMME 3GJFK 3ZE2E 1F6AA 4QRRD 2AQ1A 1CYGA 5CUSH 5HYEA 1Z3GH 5KSAB 5HYQB 3ET9F 3OQ3B 3BQUB 3I50H 2CUHA 1BMGA 3RTQD 2EDRA 5DJ8A 2O5ZH 3WEXA 2BNRA 2ORBH 5AWNH 1QSEB 4XAWL 3RPKA 3KPSE 2DM2A 1CLCA 3QO0A 3SDCA 1BECA 4YK4B 4HC1L 3UC0L 4A2LA 5D7LA 1NAMA 1RAMA 1MCKA 3K3QA 3QEQD 1DP0A 3WHE1 3MLRH 1F11B 4HXAL 2R56L 3KJ6L 4F9LC 4F9PA 3T0EB 3AAZB 1T04A 2CRZA 1JMXA 5HHMB 1OAKL 5EUOF 2L0DA 5D5MF 3TBWA 3F7YB 3SKJL 3PGFL 5E6IB 2ZJSH 1I3UA 1S9WB 3BT2L 3MBXH 4R97C 3TZVC 2OR7A 3K80A 3DBXB 1BREA 2PKDA 3LN5A 4H1LA 3L5WA 3SKMB 4CN4A 5B38A 4PRIE 3OKKA 3BPNB 3CVHH 3U82B 4XC3L 4NNPH 3QIWA 3KJ4B 2FX7H 3DVNB 1D5XA 4DKAA 3HMWH 3VXNB 3GUTA 5GGUA 3ARGD 5IROC 3B9AA 3QNYB 1NSNL 1NBYA 3QWOB 2HKHL 1X4YA 2IWGA 4ERSH 5BRZB 1EFXA 1WEJL 4LQ1A 4OLXL 3S37L 2EZ0C 2M2DA 4DW2L 2NY3C 3MV9B 1QFUH 4EXPX 1DQLL 2I9LB 4PV9A 4IMLB 4YHZH 2WBJB 4I13B 4U1IB 1RULL 2R69H 4APQC 3OHXB 1ITBB 12E8L 1XF2A 3W0WA 3L7FB 4WEUD 3MLSH 4U3XA 4JKMA 1OP9A 4LKCB 4N1HB 2APFA 2A9NL 4K8RL 4NO5A 2NY7H 1J8HD 3NA4A 4JKLA 2Q7YA 4HUWA 4Z7WA 2E5EA 1OT2A 4HCRL 4PREB 2IGFH 1WQVT 3MSPA 3NCBB 8FABB 1NC2B 1CT8B 3TNMB 1QVOA 3DHJA 4CMHB 1JGEA 1MVFA 4EN3A 2VR5A 4HQQL 4FXLA 1NCWH 2FIKB 1WJ3A 4XMKL 3D3VD 4JZNB 1FG2B 2AGJH 4YXHL 5TDPB 1K8DA 5E1AB 4CVZB 1P9MA 3MV7E 1YYMH 1DBJL 2GTZB 1M05B 1WBXB 1B0WA 1PYWB 3LKNB 1WZ1H 3TPKA 2Z93A 4XT1C 3ZKMD 3B83A 5E9DD 2FHFA 5I18H 5DWUL 5FUCE 5EC2A 2WM0A 5E4EC 1UYWH 5IJVB 1UT9A 2V7NA 3NFPA 2VZ1A 1MAMH 3UJIH 1IJ9A 1KCSH 2WWKO 4X6BB 3HMXL 3O6KL 5TQ0L 3B9KA 4KK8C 3OAUH 4HS6A 4RMRA 5DEGA 4Y16B 3RUGF 3IDYC 2LTQB 3HR6A 4NQXB 3P2TA 4KK9D 5EN2A 4CKVX 1HILA 5A3ID 3CVIL 3ZKNC 5GGVY 3RWEA 2EYTB 4UTAL 4M6ML 2H41A 3TBVB 5C0FB 2X7LB 4NBXB 3K7UA 1A0QL 1T1WB 5KSAC 1UH3A 4PB9H 4F37K 1A1MA 5E8NB 5FKAA 3BQUC 1ZA6B 4P4KD 1ZGLA 3RVVC 3SJVA 4K3HA 35C8H 3BE1L 4KXZI 5SWQA 4WW2A 3U9PL 3IAGC 3CFEA 5CCKH 5FYKH 4YK4C 4OCRL 2VLJE 3C5ZB 3HNSL 5TPWL 2NX5D 1TCMA 4C55A 3C60D 4YGVA 3ARFD 5DUMH 3FN0L 2KDGA 2OSLA 5J06A 2BNQD 1DSFH 1Q9WB 3LOWA 3LN9A 2YPKB 3NN8B 3ULVL 2NQCA 5MHSE 5IG7A 2XFXA 1KIPB 2FX8L 2GITB 3MV8A 5DMIL 3GDBA 3BPNC 5JQ6H 1MJUH 2BY1A 3JWOC 2MKWA 3IU4L 3UZVB 2IQ9H 1O0VA 1JE6A 3S3JA 3GRWH 4ZFOL 1CF8H 4NGHH 1JWMB 3WNOA 5J9PA 1JP5A 4NQTA 1KYOJ 3BKYL 2NTFA 2X2YA 3A6CH 3GBLA 5ID0A 4DTGL 3QFJE 4P3DA 4PJDB 2E8ZA 3DRTB 3DWTA 3HC3L 1FFQA 1CFQB 5GRUL 2VQ1B 2G5BA 5F7EH 5EORL 2WBJC 2VXQH 2C3WA 2W9DH 1I1YA 5EZJA 1ZT4B 5FHBL 4FXGB 4E42A 2IPUK 4QEGA 4LMQE 5HTSA 2A2QT 5GSRA 1EMTH 4JVWA 3MXWL 4KI5C 3L95A 1OW0C 2HLAA 2FJHB 3CSGA 5BZWB 1FFRA 3NPSB 3WNNA 5IW3A 2QQNL 4XVUD 4XCYB 1IT9H 2Y25A 2WIMA 2NYYC 3OL2A 3S34L 1KJ2B 4Z7QF 2KH2B 4CMHC 4WFGD 3OPZH 1G9NL 2DLFH 2DI7A 1MFCL 3OX8A 5IUSA 4UUJA 5DR5H 4MXQC 4O2EB 1NUDA 1GHFH 3VXRE 4G9FE 5SWSD 1TZHA 5HHPB 4DUXA 3INUH 3BH9B 5ACZB 1ZVSB 5KW9L 5C07A 5CP7B 3MRIB 1U58A 1R3LA 4NFBA 4JQXA 3QUXA 2J8UA 1G9MC 2FBJL 1T89A 2VXUL 3P40A 3QG7H 5FYLL 4HK3N 5IB2A 4EUPH 4MXVF 3KPOB 2MPAL 4KMQA 4L8CA 1JF1B 4Y16C 2LTQC 3O11A 1ES0A 3FB6B 5IKCB 5IR1A 3O3AA 1KCUL 2BNRE 4PJXA 5DHVA 3PIQA 3M17B 1WIPA 3QXAA 1QA9B 1DBMH 1TENA 2QR0B 4JRXE 2Y7QB 4N0UA 5JXED 3JWDH 5BS0A 4BUHA 3RZCB 3GSRB 3C6LA 2ITDA 1JPGA 4D9RD 2RGSA 1IAMA 3DROB 4AEHH 5JHDD 2CKBH 5T5FL 2F74B 1T66C 1VFBB 1U8MB 3FL7A 5EIQA 1OTTC 1MCQA 3EKCA 2A6DA 4M7LH 4PP1C 1X7QB 4POZD 3ALXA 3FB8A 4L8SB 2YWZA 4PRHA 4NJ9L 2VNCA 1DVFA 3L3HA 5F7WC 4K7PX 4QRRA 1FLRH 4HF5L 4S1RH 2RJMA 3CC5B 2P5EB 1VEOA 3RTQA 1UCTA 5HVFB 4J6RH 2FSEB 5E03A 4UILL 2VZSA 3QULB 1JPSL 1PGRB 3NIDE 4PTUB 5E2VL 1YEDA 2A38A 3D0VB 1ZAGA 5DJZB 3U83A 2IAMA 4HEPG 4G7YL 3GHEH 2VXSL 2JLLA 3MMEA 4OI8A 1WZMA 4HFWA 4L3EE 4LDOB 3MLZL 4GRWF 4TSAH 1DUYB 4R0LB 5F93C 1P5UA 1I9RH 4HXBH 3VFWB 4NKMB 1KBGH 4OGZA 4XTRD 4YHLH 3G5YA 3W0WE 5IFAL 2W0KA 4HWNA 5BMFH 1FNHA 3C8HA 4KRPC 3SBWA 2D31B 3V5HB 1I9JL 4QKXB 3ZMRA 1BBDL 2Z31D 2PO6B 3CH8A 2X4SB 4RRPA 2VIRB 1XF5A 4Y4KB 4I18A 3L7EB 1AC0A 2P24A 3MCG1 3NPSC 5LGHH 5B8CB 3MRDA 5JPMA 4XP9L 1ZHNB 4M5ZL 4F7EA 4FABH 5M95B 4R6UA 3P4NB 3VFGH 3MNWB 1N3NB 1R3IL 5HHNA 3IFPA 5D5MB 2W38A 1LEKA 1R5IB 3K4DA 1J1PL 4RMUA 3CFDA 1ZSDA 1OWWA 1Z9SA 4JKPL 3QDMB 4OM0L 3NOIA 3CSPA 4DFIA 1J8HA 5CUSL 3SO5A 3IVKA 1Z3GL 3O4OB 5CINL 3WFZA 5FECB 2EO1A 3SY0A 1IEAA 3I50L 1BQHG 3ZT7A 3GBNL 4RFNB 1WCBA 5AZ2H 2O5ZL 2ORBL 4YHNA 5E2TL 4EVNA 3KXFD 5KVEH 1BEYH 1AY1H 2UYLB 1IFHH 1S7VB 4EI6B 3DHMA 3CSYA 4JVPA 3VMNA 1WISA 4JRYD 3RVXC 1EHNA 3EDJA 4AMKH 1I3RB 3DX7A 3NAAL 1DBKH 4LGRB 4LLYB 32C2A 1RZIA 1JNLH 4Y8DC 3MLRL 4WUUB 1TDQA 2PYEB 4OJFH 4MB5A 1MFAL 1FVEA 4PRDB 4Q9BA 5J1AB 5DS8B 3U46A 3MBXL 1FH5L 4Z76B 4BK4A 4OFDA 2I5YL 4RFEA 4GRLC 4X4ZA 3CVHL 4CU7A 4NNPL 5HY9A 5FOJA 3OAYH 4EI5A 2AJZA 5CBEB 2FX7L 2EECA 4NCC2 3HMWL 4JPWH 1T83A 4JANB 1NMBH 1TTGA 5CHNB 4IJ3B 1SJVA 4XH2A 1W72H 5SWZD 5TDOA 2MQ0A 4G8FA 2BJMH 3HRZB 1CR9L 1W2KT 1QFUL 3MV8E 1HYRC 3PWLB 5IJKC 4U0RB 5FK9A 4K9EH 1UJ3B 3GSWA 1K5NB 4DAGH 1PG7L 2FH6A 4NZTH 5IW1B 4YHZL 1SEQH 1W0VA 4YUEL 5IBTL 4P5MA 5FM5M 4E41B 1HSAB 2ADIA 1FO0H 3RHWK 3SDAA 1MCEA 3MLSL 5JHLH 2VXTL 2IJ0C 3HHRB 3S36H 4XMLL 1KJVB 2XRAL 4GW4A 3BW9A 3VXPB 1FYTE 2NX5A 2DBJA 2FEDC 3C60A 4OF8A 1R0AH 4XBGB 4OZHA 3RUGB 4JJHA 5C0AD 1S7XA 2CLVA 3BP4B 4JHZA 5ADPL 1CK0H 5JMRA 4HJJL 1CQYA 3UTTB 4JFEE 4MA3A 5I8KH 2R2CA 1QKZH 1YN7B 2JB6B 4JRWA 2PO6C 4XNYL 4KJWC 1AXSA 2NY2C 1YYML 3BJLA 3WDHA 5EU4B 1P6AB 2IADB 4J3OC 2ENYA 4F37F 4XNXH 1WZ1L 1CFSA 3AREB 5GXBB 4PY7B 3FRUB 3MRMB 4IRZH 2XA8L 4K94C 4CL7A 2I07A 3H9SB 2G9HB 4S10A 3VJ6B 3JVGA 1WVZA 3GMOB 5I18L 2RQ8A 4ZSOA 1X5LA 2XTJD 1UYWL 1S9KC 4BQBA 2EDOA 3UJIL 4RQQB 1KCSL 3JV6B 4WFED 1QR1B 3PL6B 3QH3B 2VSDA 3OAUL 4BFIA 1DQJA 3QUZD 1T1XA 5D1XA 4KY1H 4QHMA 4KK8D 5H37H 2J8UE 5C0BE 1BIIB 4QRUB 2ADGB 2ZWLT 3ZKND 3O4OC 4PB9L 5MI0B 3V0VB 8CGTA 4NRXA 3DTXB 3DV6B 4K3EL 1OARL 4QY8A 4RFNC 1SY6H 4WJ5A 5L2KB 3B5TA 35C8L 4QTHA 1QPXA 1X5AA 1HH9A 5CCKL 5E8OB 5TH2B 3SPVA 3VE0B 5BZDA 1Y0LA 3I2CH 5ENWB 1ND0A 4QRTA 1U3HA 5FYKL 5I1EH 2B7DT 3GM8A 4KGJA 4LCYA 5A2IH 4GW5A 3QA3A 5L8LB 3B4NA 5DUML 1EGJL 4NWUH 4KVCH 4U6VH 2W9LA 5BS0E 4OQTH 2EIZB 4XB8A 4PJ5A 5KVFH 3SKOB 3W9DB 2QQLH 4TTDD 4OCYH 3KLDA 3FO1B 1XGQB 5FM4A 4OSUH 5HHMD 3T4AA 1IGJA 5KSVB 3H3KA 1MJUL 5JQ6L 1VFMA 1ODAA 1UWXH 4NQCD 3IDMB 1LD9A 4H25A 3GRWL 1CF8L 4QRRE 4FG6C 2R0KH 4GUPA 4IJ3C 3A6CL 4XWOC 2H2SC 3P4MA 3O0RH 3BPCA 1A9EB 2WLYA 5J0BA 1BBJB 3D69A 1KC5H 5GIRA 3VG0H 1CD1A 3T1WA 5AAWA 1YEJL 4XXDB 1L0XA 5JXEA 3ULSA 2XWBB 3LRSB 1B90A 2GUOB 4ZUVB 3QEQE 1EMTL 4L1DA 4Y8AA 4TVPD 2JJUA 4Y5XB 1A6ZB 4FQXB 3QXDA 4PBVC 3MYJA 3FOLA 1IT9L 4BH7B 1U6AH 4IIQB 3QZWB 4JCMA 1RZJH 4NHCL 2VLKB 2FGZA 3HE7B 3FHAA 1MF2L 3WXVH 4GXUN 2NYYD 2DQGL 3OPZL 4JG0L 3OAYK 4LPWA 4XVSH 2DLFL 3D0LB 5EU6B 2NY0C 2B20A 1UM5L 2HLFC 3C6SA 2BSRA 3RWDA 2WANA 5H35B 1G7PA 4XC1L 25C8H 2V2XB 4HMCA 5DR5L 1K3ZA 1CICB 5I30H 2W0LA 3UTQA 3ARWA 4TNVK 4FQ2H 3AREC 1NPUA 3MROA 4D94A 2H1PL 5C6WH 1RIUL 1CIUA 5DD6A 3LZFH 4LLWA 15C8H 3MLTA 5DSCA 2AS5M 2IC2A 5E8PA 2VABB 1KLGB 2ZUXA 3QG7L 3F62A 3MC0A 2ATPA 4YHOH 3VXOA