5C0NC

Development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
216
Chain Sequence
QSVEESGGRLVTPGTPLTLTCTVSGFSLSTYYMSWVRQAPGKGLEWIGIIYPSGSTYCASWAKGRFTISKASTTVDLKITSPTTEDTATYFCARPDNDGTSGYLSGFGLWGQGTLVTVSSAKTTPPSVYPLAPGAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Fatty acid-binding protein, adipocyte
publication title Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 216
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nC01
1CZ8L 1VA9A 1AXIB 1FL3A 2F19L 4WUKH 5DXWA 4HG4J 3AAZB 1GGBH 3HI5L 1YJDC 4MXQC 4QCIB 1YNLH 3SGEI 2VISB 2LTQB 2NW3A 1T7VA 3IDNB 1F90L 4OZHB 2J8UF 2XWJB 2MQ0A 4OTXL 4PJHE 5H37H 4BSVA 1AGDA 1M7DB 4RISL 4ZNCD 4M61A 1YYLL 3TYFB 3MNVB 3ZO0A 4QRTB 3QDGB 4R7NA 5DO2C 3X14A 1QLFA 3Q5TA 1UGNA 4CMHC 2KZ1B 2AVGA 4N5EC 3FB5A 4E41B 5J1TC 2FEEI 1CWVA 5CZKA 4L9LC 4QOKA 5L9DH 2GK2A 4BSWA 4RGMB 5DMYA 3E6FB 2OJZL 4ODTH 1NBVH 1F11B 3ZYOA 4KV5F 4XGZB 1JRHI 4HXBL 1T66C 1ZANL 1HSBB 5ELIA 1OGTA 5GJTH 1CD1A 3VWKC 3QNZB 1RUQL 1EZVX 1MFBH 4PTUB 1VENA 4AZ8A 4JQIL 4WW1A 1KEGL 1FNGA 2VDQH 4ZTOH 2VDML 3G6AB 4W4OC 1H8NA 2MNUA 4Y4KB 4KZDL 3P73B 4EDXB 1TQBC 3TN0B 3EJJX 1P7KB 5J56B 4IHOB 3EOBB 1FGNL 3MXWH 2EYRB 2W0FA 1HILA 1WSST 1YEIL 3RNQA 1RZ7H 1UWEL 1MJUL 2PW1A 4OF7A 3OBAA 5J12C 3M07A 1NAKH 5IWLA 2Y36L 4MCZB 3QDGD 4GXVL 1FNEB 4U0RC 2EO1A 2I5YL 3EGSA 1YPZA 4UT6L 3RWHA 4I3SL 2W9EH 1PZ5A 4UDUB 4E41D 5C9JB 3MRBB 1AY1H 3CDGA 4KROC 3AS3A 5HYSA 5INDB 5I1GH 5JXEA 1ND0B 1BFOB 3LB6D 4XNXL 3RWJB 2XY2A 3ALWA 5DZNA 4NQXA 3CUPB 2VABA 4PB9H 5GRXG 3BZ4B 4U7MA 4JRXE 2NY5C 1CBVL 1PDKA 5E9DA 5D2NB 1KJ2A 3OKDB 1NSNL 5EOQL 2BDNL 4M6NH 1FLRL 2IAMB 3HE6A 3TO2A 2AJYH 4JO4L 4F7EA 5T5NF 4WW2A 4P57A 3LZFH 3PV6B 4U1KA 2JELL 3KPSB 4Y4KD 5JA9A 3JBG7 1DR9A 1TVHB 3DURB 4NNPL 4WI2A 3ISWA 5KVFH 2IEPA 4DEPB 2MPAL 3O2DL 4JFFA 3BPCA 1IQDA 1X9QA 2FR4B 2B7DT 2H1PH 4QRRE 3QBTB 5TDNB 1TQCB 5KBNC 2C1PB 4N90E 4PG9A 1X5GA 4K7FA 3QP3A 2BVQA 4CDHA 1JI2A 3O11B 1JGDB 1PQZA 1U3JA 4P3DA 4DUVA 4F15B 1A14L 1BOGB 1OAXH 1MJ8H 4Y2DC 4KPHH 1KXVC 4DK6A 5HHNA 4WUKL 4IS6B 2VR4A 3QI9A 1GGBL 5IJVB 2NY0C 4G8GA 1YNLL 1U2CA 5IQ9B 1KLUB 1WZLA 3PQYB 5DHYA 3PWJB 4BFIB 1T03H 1MLBA 4KMTH 2NY4B 2VJXA 4HC1A 1RZKC 1U91A 4TVPH 4ONOA 2C3HA 3T0VA 3B9EA 4XC3H 1WK0A 4PJIF 2IAMD 3T8XA 3WS6C 3OKEB 4RZCB 1XF2B 2PO6B 4PRIB 5C2UB 1U93B 1DBJH 1ZA6B 1CTOA 1A1MA 3KPSD 3HG1E 3RWDB 1G7JA 1S7VA 3GSXA 5GGUA 4LSPH 5L9DL 1G6RH 3V6ZA 3FCTA 2GJ6B 2X4OB 4ODTL 2AERT 1NBVL 3U7AA 4B50A 1IM3A 5HHQB 1ZHLB 4OZFA 1TVBB 1YY9C 3G08A 5GJTL 1ZLSH 5IMLB 1MFBL 2FJHB 5IHBA 2JCCF 3MRKB 1ACZA 3ZKXC 2YS4A 5CS7A 2WIIB 3UXFA 3UAJC 2VDQL 1BQHB 4ZTOL 4TNVK 2EE2A 5FOJA 4MQXC 4RIRA 2X89A 2HP4A 4AY0A 3EAKA 1ZT4A 4OFYD 5JW4N 3QIBA 3PQYD 4A6YB 5JW4R 2NY4D 3JTSB 3MXWL 4HIJA 1RJLB 1NGWB 3G04B 2X4SA 5CBEB 1RZ7L 4N1EA 4LKCA 1XGPA 2Y07H 4JANB 1NAKL 2C3VB 3L3GB 4L8CA 1EBAA 2IANE 4LRIC 4TNWK 4PRID 2JJTC 2Z93A 1V7NL 3CAFA 4P2RE 2W9EL 4R9HA 3E2HC 1T1ZA 1AY1L 1QR4A 1T3FA 5I1GL 1FO0L 4M5YH 5C0BA 3JWDH 1ZA3A 5DVLA 4FQLH 1R3JB 3KLDA 3DV6B 4QXGH 3C6LC 4PB9L 2JKXA 2HN7A 4KMQA 4WHTB 2E6JA 1B3JA 4NQSB 5A16B 3C09B 2OK0H 4M6NL 2HRLA 1PGRB 2AJYL 1C08B 4WFEE 2BX5A 3LZFL 4L3EB 2X09A 1KIPA 3ALXA 4ZXBA 5KVFL 4MDIB 5CILH 4AIZB 3BEVB 1AXSA 3SKUD 2H1PL 3QJFA 5L7XH 2M1KA 1M05B 5CJBA 4PJDB 3ZE0F 4UNTA 4PRHB 3TEUA 3KPLA 5FKPA 3ET9F 3VGBA 4U6XB 1QR1B 1OAXL 2A9MH 2Y9RT 1MJ8L 4KPHL 5DMKA 4GBXC 4M6MH 3NZHH 4EI5C 2M8XA 4UQ3B 4K9EH 3T77A 3TT1H 4XWGH 5CEZE 4K71C 5JW5B 5L2KE 4NKMB 2FJFA 3R0NA 5FHAH 5IB3A 1BPVA 2BNQA 2L7UA 1T03L 4KMTL 3EYOA 1CDJA 5F9WC 2Z92A 1JPSH 1NGYA 1R24B 1DLFH 4TVPL 5LGJB 2EE6A 4WFFE 1VEMA 1ETZA 4XC3L 5J1AB 4PJAB 2YPLB 4HFWA 3RKDC 1BBJA 1GZQB 4LLDA 2XKNB 1XF5B 2BHUA 4L3ED 3T04D 1DBJL 4JN2B 1E28B 3RDTB 3TM6A 3QG7H 3G5XB 3P9LA 3U2SB 3ARFA 2DWDA 4ODXA 1DSFH 3LQZA 3EOYG 1G6RL 2AS5M 3BUTA 4OZGE 5KZCD 2DJSA 2YHGA 4YHLH 3TO4A 3VWJB 1AJ7H 1DE4A 3FO2B 1QPPA 4P2QB 4PRHD 4HH9B 4X7SH 4W6WB 3ILPB 3TPUA 1Z9LA 1D9KB 1WAAA 1ZLSL 5EBLA 1T04B 2A0LC 3FZUC 3PHSA 5D1QB 5BV7L 5LCVL 5E95B 4ENED 2GT9A 5C07A 1JZ6A 3BMWA 3ARXA 2IH3A 3VA6A 4JY4A 1K4CB 2AJVH 4H25A 4KK8D 4BQBA 25C8H 3SY0A 5EZLB 4OB5H 5CSZA 4F80A 1EX0A 5A2LH 3IJSB 4P2OB 4NQVB 2ZUUA 2Y07L 4MJIB 3CFBA 4RX4A 1NJ9A 2YPLD 3FQRA 5DJDB 2UV3A 4U1LA 3Q6FA 3LKSA 4X7EC 4WUUB 2MSPA 3HLAB 4Y5YB 3QO1A 3BP4B 3RDTD 1R3LA 1U8JA 2FATH 4YNYB 5IG7B 4LNRB 2NR6C 2O26U 1D5MB 1T7ZA 3K80A 4M5YL 3KYNA 1CXHA 3VW3H 3GSNA 1EDQA 4FQLL 3BWAA 4QXGL 5F96H 2E27H 2OZ4H 2NY1D 5JHDA 4XXCC 4BJLA 5MERA 4HJ0C 3VWJD 3DX7B 3L3HA 1DLHA 1N2RA 4P2QD 3HNVH 1ZS8A 2OK0L 1D9KD 3ZMRA 4KRPC 1NMCB 2R1XA 4UZGA 4YX2H 1ZLWK 4ZUTA 2Z31A 1TTUA 2H32B 4P46C 3JXAA 1FFQA 5HHPB 1YMHA 5CILL 3S36X 3TBTB 1UCTA 1U41A 3HUJB 5I1LB 1GVIA 3TCXA 2AK4A 2KQNA 3SKNB 1ODAA 3GBNH 1X3DA 5AWNH 3MCKA 3OXSB 1VDGA 5L7XL 5CP7A 1IAOB 1ACYH 5CWSB 3X17A 2VTFA 3MGOA 4P2OD 1JPGB 2AQ1A 2MQCA 4MJID 1AP2B 2XA8H 2A38A 1WT5A 5GQBA 2A9ML 4WUUD 4KKBC 3NZHL 3VFRB 5DR5H 2CXGA 3TT1L 4K9EL 2YEZB 3C2SA 3QXVA 4XWGL 4LCCB 5KTEH 2QSCH 3MRNA 1YMMB 4U1NB 2EDBA 5FHAL 1UZ6E 3LCYA 5D1XA 1NGQH 5IROA 3SCMC 2BK8A 3LQAH 3SO3B 2XN9A 2BHZA 2D7PA 5FUOH 2OTPA 1JPSL 4Q9CA 2V9TA 1DLFL 1JN6B 1FP5A 3KLHC 1AQDB 1JHLH 2IALB 3N1GC 3DVGB 2Q1EA 5EIVA 4CUCA 2E9WA 4YDJB 4R4FH 2CK2A 3MOBH 3QDME 3SJVB 4MJ4A 1FZKA 4JGUA 3O45B 3QG7L 4ALAH 4MA8H 1DSFL 2PTVA 3WE6B 2BVYA 4BELD 1XF3A 4QLRA 4V1DA 1FZMA 2CO6B 3D87B 4GKSA 4NKOB 4YHLL 5F88A 4RGNB 2P5EB 1AJ7L 3HZMB 3MA7A 4KKLC 5DQ9A 3MNZB 3G6DH 4QTIH 5DHVH 5HGBB 3D85A 4YIQA 3SBWA 3U4BH 4HUVA 1ORQB 4P0DA 1OTTC 2JLLA 4DOHB 1YMMD 5D9SA 4XRCB 2AJVL 2IC2A 1E27A 1EVTC 1BFTA 25C8L 3BD5A 4OB5L 5I2IA 3GBMH 4PG2A 4G9FE 2JK5A 5C08B 1D5XB 4JVUA 3BKJH 4FG6D 5BJTA 4MHHG 2V5RA 1OP5H 5DHXB 2P8LA 4NQED 4YDVB 1MCCA 1P1ZB 4HKXA 4ONGH 4MD4A 2N4IA 2FATL 3DVFA 3HAEH 2ICCA 2J6EA 4R90H 3EYFB 1ZHKA 3BGFC 3VW3L 1TMCB 1QBAA 5F96L 3RHWK 2E27L 3QIWB 2OZ4L 3KNBA 5E08L 2GTWB 3OGCA 3GSOB 4RGND 5GSRA 2P5ED 4HK0B 3TBWA 3FQXA 4QHKI 5LQBH 2Y4SA 3HNVL 4WFHE 2EYTB 4LDLB 1OTSC 2ZOKB 1R5VB 5SWQA 4PJFB 4PJAF 5FECB 4RNRA 1BZQK 4YX2L 5AUMB 3C08H 4LKXA 4PP1D 2H8PA 3GB7B 2BNRA 32C2A 3D2UA 2WWMC 4S10A 3P0YH 1Q94B 1DDHA 2F58H 3GBNL 1T0PB 5AWNL 3PNWA 5KOMC 1KLFA 1ACYL 3MRMB 4PRPB 3T0DA 5C08D 2VZVA 1RURH 3MJ9H 2MOVA 1MCEA 1BQLH 1A7QH 3F7YA 3BGAA 3WJLC 2XA8L 1MIMH 4YO0B 2HJLB 5KANG 3KHOA 5JORB 1ZGLA 5C0AB 1I1FA 5FK9A 5MEPB 5DR5L 4GRWE 4KK9C 5KTEL 2QSCL 4AG4H 1VHPA 1NGQL 1T83A 3LQAL 3QIWD 4MZ2A 1UJ3B 2I26N 5FUOL 1FDLH 3UYPA 5CLTA 1B9ZA 1T80A 5DVKA 5FGCE 4JPKH 5HGHA 3PJSB 5DQJB 5HI5D 2FJGA 1JHLL 3ELAT 2PCPB 3S36H 1A6AB 3TT3H 3WLWC 4BKLB 4QNPF 5DK0B 4U1JB 4R4FL 2PXYC 2WP3T 3MOBL 3MUGB 4G6MH 3I6LD 1CXLA 3O8XB 5IVZB 2XWTA 1HWHB 1QRND 4HWBH 4M62H 4ALAL 4MA8L 4LPTA 2AGJH 4GRMA 4LCWB 3O2VH 3DLQR 5JDJA 3MV01 2ZP0T 4PYHA 3QUYC 3H9SE 4JB9H 5DJYA 1F42A 4KHXH 4PRPD 3STLB 5BXFB 5CFHA 4LL9A 1RZJH 1A9BA 5JQ6H 2QKIB 3CSYA 4LPXA 1VGKB 1NGPH 3G6DL 4QTIL 4X6CA 3P77B 4XBPA 2BC4A 4GW1B 5C0AD 3U4BL 3QA3B 2OCFD 2KL6A 4JRYB 2I9LA 1DQDH 3MRJB 4FQCH 1I7ZA 2FSEB 2ITDB 3KJ4C 5T1DH 4FQXA 3S3JA 1MCIA 3MBEC 3GBML 1MCSA 1K85A 4Y88A 3BN9C 1QFUH 4HPOH 3BKJL 4Z7VB 4JZJA 1FYHB 5EU5B 5FFLA 3O8XD 4ONGL 4JFHE 2DI8A 3MV9B 1ZLVK 4FXGA 3RZCB 3SEPA 1WFTA 2FB4H 3S96B 3NIDF 1LD9B 4LCWD 4R90L 4CVXA 4PTTB 2HKFH 1D6VH 3SKJH 2AV7A 3WYRA 3P11H 3PHQB 5EU3A 4XPGH 5C86A 5IOPA 3HZKA 4AIOA 1I8IB 5LQBL 3IGAA 1S8DA 3LSOB 1LO4H 5JLZB 5JDSA 4Q2ZA 5ACZB 1G6RB 3DVNA 3GMNB 4EUPA 3SPVA 4Y7MA 1VSCA 3NACH 5DRWA 2YXFA 1MWAB 1JGEB 4GG8A 1CN4A 4JRYD 4MB3A 1WJ3A 2PN5A 3V7AG 3NCBB 2ZCLH 3P0YL 4LLQB 5FEBA 5SV4A 1ZE3C 2P5WE 4OCYH 4JJHA 1HNFA 4LGSB 2F58L 4U2ZA 4WHYG 5DMGC 4MS8C 2DQHL 3DHJA 5TF1H 3L3DB 3PWVB 5I30H 1RURL 3WS3A 3MJ9L 1BQLL 1A7QL 5D5MF 5F1NB 3O3BA 3VFOA 1UM4H 4A2LA 1DFBH 1OVZA 1MIML 1RZGB 1JUFB 1CR9H 4IRJD 1H0DB 1MCJA 4XT1C 2BVOB 1SHMA 2X4UB 2HLAB 2BMKA 4NGHH 4TVPD 3T0EC 3VXMD 4CJ1A 4KRLB 3A0OA 5I16B 1J11A 4N8VB 4AG4L 3ROOB 5D7IB 4OGYH 4ZS6C 5KG9B 4I18A 2PW2B 3BVNA 4PRDA 1FDLL 1QEWB 1J0HA 1HHIB 2P42B 4JPKL 1K9TA 3D39A 1LE9B 3S36L 3TT3L 3OHXB 2F54A 3P4OB 3U9UA 3DRQA 4EBQL 5ICYB 4G6ML 5E2JA 4F9PC 3UYOD 5BS0B 2X4TA 4HWBL 4M62L 5FOBA 4F37K 1BLNB 3ARBC 2AGJL 4M3KB 3O2VL 1K3IA 1PYWA 1TZGH 3LEVH 1WTGT 4WI3A 1MLCA 4JB9L 3EZJB 4KHXL 3K8LA 5J9PB 1HI6B 1RZJL 3WDHA 3BKYH 5JQ6L 2A6IA 1Z5LB 1BM3H 1XCTB 1NGPL 1KF9B 1IGTA 2C3XA 3PP3H 3RX7A 1WBYA 5MEOB 5HYJA 1HHKA 4M9OA 5C09B 4H20H 1VFAB 1LQSR 1A4KA 3ARDC 3LQMA 1JYXA 2OM5A 1A7BA 1DQDL 3BH8A 3H0TB 3OJMB 4FQCL 5HYFA 5T1DL 1RAMA 3ZKMD 3WNLA 3FAWA 5FGRA 1OGAE 5FHBH 2VXTH 1AO7E 3T0XA 1K2DB 5HGAA 4D9QE 2VLKB 4AH2B 5KSAC 3T4AA 3DI2B 3VXRB 4IRSA 2WW8A 1QFUL 2YPKA 2ADGA 2EXWD 1J10A 4HPOL 3BP5A 5TFSH 1K4DA 2BVPA 3IVKA 3RQ3A 4K07A 1J18A 3GJFK 2YUXA 3W39A 3SDXF 5JW3H 5GISH 3TZVB 2FB4L 5CJXA 3C8KA 4X6EB 4XP6H 3CFJB 1UM6H 1UZ8A 3FB8B 2E7LA 2RJMA 2HKFL 1D6VL 5E56A 3OB0K 3P11L 4UNVA 3EOTH 3SDAA 3U82B 1J05B 3G5YB 4XPGL 2YPVH 3RI5F 2AXGB 3MLRH 2GCYA 4P4RA 2X70B 4X6BB 1LO4L 3SQBA 4JHZA 2VLRE 1RUMH 2ESVE 3NACL 1XGTA 3WNMA 4YZFE 4WRLA 5D7KD 3VXSE 1B0GA 3O4LD 3V6OA 1I3UA 3DXAB 4Y4KC 4HWNA 3CXHJ 2ZCLL 4OCYL 2XTJD 4Q74A 3LN9A 4K8RH 1REIA 3TJHC 3MZGB 3CVHH 5I73B 2D2OA 5TF1L 1WIPA 5I30L 3QSKB 3IXTA 1CGVA 1UM4L 1DFBL 3BMVA 4M7JH 3ZHLA 3PDGA 5FCUH 2HFFB 3FKUS 4LBEB 1CFTB 5CSGA 3TZVD 3PWUA 4XVTH 3O4OB 3RJDA 4IDLA 2BOBA 3S3SA 3HS0B 3A67H 1JTOA 4OGYL 5CSBA 5D6DA 3VFSB 3MJ7A 3BEWB 4IM8A 4NPYB 4X98A 4E0RB 4PJ9A 4CAGA 3K2UH 5D6CA 4FFWD 2PYEA 3QG6B 3CX2A 1QSEA 3WXVH 3KAAA 2XZCH 3RPIA 1KJ2H 3SDCA 4OLZH 2ED8A 4WENB 2YSSB 2D03H 1H3PH 1FZOB 4POZD 3DXAD 4XP9H 5KSBB 3IRPX 2Q3AA 2ZNWA 2EDEA 5F44A 3LEVL 5IB5A 1YQVH 3BJ91 4X5WB 3VFWA 2ZUXA 1JYWA 2I25N 3DPBA 3BKYL 3VCLB 5BZWB 1FIGH 4XMPH 1T2JA 2AQ3A 1BM3L 3MOQA 1V05A 1KT2B 1U8KA 1BZ7B 4D0BB 4H20L 3WNPA 3TH2T 2XXMB 5EN2B 4C57C 1Q72H 4WY7H 3U36A 4JLRA 1QTYT 4QOKE 2CUIA 2AXFB 4U31A 5F7FA 4MNGB 1KC5L 1D5ZA 3MGAA 4L8SA 4OLUH 5LGHH 5FHBL 2ZCKL 2VXTL 4R4BB 2EDXA 2CPCA 2MMXA 1JWUA 3GSUA 3NZ8B 4R4NC 4LCUB 3FHQA 1J8HE 4N0UE 1EVUA 3STZB 5TFSL 1Q0YH 3PGCB 4KK6C 3BIKA 3WL9A 1IGIH 2Y6SC 5JW3L 3JV6B 5CMAB 5GISL 3DO7B 2DMBA 4OFVA 2CIIB 1JWSA 1SEBB 3SDDB 1ZGLM 2R56H 4XP6L 3LN5A 3EO0B 5L0QB 3LPFA 2BY0A 1VPOH 3GMRB 4TUKH 3EOTL 3MRHB 5FA4B 5KS9A 2YPVL 2Z4QB 5F9OH 5IB1A 3AMKA 2Z35A 1WICA 4G9DB 3WUZA 1I7TB 2A74B 4HS3A 1I1AC 1KGCE 2EDLA 3MACH 4UUJA 1RUML 4LK4A 4WGVB 4OZFH 3TV3H 4M93C 1FFOA 4IOFD 4WWKB 4LSVH 2F53B 5DI8B 2P7TB 5I75C 4N1CA 2CLZB 2R2BB 4Z77A 5F9JB 5IFJA 4ZFGH 5CD3B 5DHVB 5JUEH 4GAJH 4K8RL 4NJAL 3CVHL 3DX8A 5FYKH 2WWKO 2JTDA 2VSCA 2P8MA 2VLLA 4AMKH 4Y4FB 2FGZA 4M7JL 2R9HC 1KJVB 3K7UA 5FCUL 4PY7B 3S5LG 3L95B 4XVTL 1RK0B 2HFTA 5DS8A 3T1FB 4NZUH 2KKQA 3SDDD 2FLRT 4F7MB 3A67L 3BYTA 1BX2B 4NM4H 4P2YA 4D9RD 3WIIH 1NC4D 5DK3A 1A1OB 3S37X 1XCQA 35C8H 5FXCH 2QR0B 2E9IA 1QRKA 3K2UL 4YK4B 4KQ4H 3HAEB 4CADA 2HVJA 5I15H 2NXZC 2E7CA 3WXVL 1QLRB 2XZCL 1KJ2L 5T1LB 4Z7UF 3VG0H 4OLZL 4J1UB 4WWKD 1KTDB 2WZPD 2F53D 3QUZA 2WBJB 2D03L 3LKPA 1H3PL 4XP9L 5DJXB 3IJYA 1NCCH 1ZVSB 4AEFA 2FH6A 3CXDH 3QFDA 1I1YB 2RFXB 1ED3A 1YQVL 3QJHB 4ZDHA 3WIFA 4DZBA 3KWWA 1FIGL 4XMPL 5DJAB 1MIEH 5I66B 1PKQE 5TF0A 1MF2H 1PY9A 4WI5A 1LP9A 4FQQA 1PG7L 4C56A 3RWIA 4M5ZH 3ARGC 1U42A 1Q72L 1D3CA 1YEDB 4WY7L 5B3NA 4CBPA 4HIHA 5E00B 5F7DA 4ZFFA 1QD0A 1KULA 2VNCA 1BIHA 5F7MC 3QUKB 2B8OT 4APQB 4OLUL 5LGHL 4YBQD 2EDRA 5IM7B 3VGFA 4UIMA 2BZDA 4RBPH 4DZ8B 3FQNA 5FYJD 1HKLH 1Q0YL 4Z7OF 1OF2B 4PRAB 4PJIE 4GG6B 5T1LD 3REWB 1M71A 4KUCF 4XH2B 3ULUH 4XPAH 3OPZH 1WLHA 4HAGA 2WBJD 1N8ZA 1JWMB 2R56L 4RMQA 5C1MB 1VPOL 4X7DC 2X4NA 5EO1B 4MXWH 1QO3B 4TUKL 5F7HA 1HH6A 1IKNC 3HCVB 2NY1C 1U92B 2V7HA 4QTHA 3FRUA 1AHWC 1HHGA 4K3DH 3T3PF 3VXNB 5FDWA 2LU3A 1SJHA 1D9KC 4GKZB 3MACL 2G5BB 2AJXH 4PB0H 1JV5B 4X5XB 2EDJA 5DEFA 3TV3L 1J9CT 2CKNA 4NUJB 4LSVL 1DANU 5IVXF 3HRZB 4W4NA 2E9BA 2F5AH 2OSLA 2HA1A 4OKVA 2Z0BA 3X13A 4FOMA 4ZFGL 5JUEL 4APQD 1PX4A 2X2YA 5FYKL 3PWNB 4RFNB 5DZLA 4AMKL 4EXKA 4GXUM 4XNQA 4MSWA 1NGXA 3GJEA 5D2LA 4ZFOL 1VFBB 2X7LA 4Z7QF 3NN8A 3QEGH 1IGFH 5C0RH 3HB3C 1EERB 4P23C 1JF1A 2QSVA 4X99A 3B6SA 4ZFZB 2GW5A 3O6FA 2QTEA 3ZDZF 1JHTA 3T65A 2WINA 1HEZA 4D94A 4OGZA 4QWWD 4ZUVA 1X5YA 4NM4L 1OB1B 2IADB 4UU9B 1B88A 3UEZA 1OT2A 1I3RB 5F7NC 35C8L 5DT1H 4QHNB 5C3TA 1G7PA 4KQ4L 2D7NA 1U8HA 4YFEA 1RI8A 5I15L 1O7VA 1BD2A 1RZ8A 3H7BB 4P5MB 4AT6A 3P9MA 4TTDC 3VG0L 4KDVA 3ES6A 1PEZA 3IS0X 3WEXB 2GHWB 1FN4B 1A3LH 1NCCL 1U8PA 4JEGB 4WO4A 3CXDL 4IOIA 5CEZH 2C4FT 2K9UA 4G42A 3RGVC 5DD6A 4TSAH 3C6SB 1WWAX 3MRLA 3DV4A 1MIEL 5SWSA 3ZE0E 3GRWH 3E3QC 3JWOH 1AI1H 3K4ZA 1DQQB 2VQUA 1JYNA 3S5LA 1E6JL 3EYSH 1KB5A 1W72A 3TNMB 4ZPTB 4M5ZL 3VU2A 4JDVB 1KPUA 3RRQA 3GI9H 2NTFA 4XMKH 3NPSB 2GJZB 4JN1H 5E5MB 4PJ7B 3B9KB 3BZFA 4X6DB 2WIMA 3QHZH 4XX1E 1P7QB 1HKLL 4XI5C 1WAAE 2ZJSH 4P48A 2ADFH 3ULUL 4XPAL 3OPZL 4DCQA 4FA8A 5DFTA 2ERJB 5C07E 4ZOEA 3UDWA 1IGJA 1NFDF 4HXAH 3ARWA 3U30B 5HGGS 1W0WB 3QH3A 4KJYA 4AM0A 1CF8H 1KNOA 3B9DA 4K3DL 2CDFB 5DUPH 4MAYB 2AJXL 2Q86A 5C0IA 1LILA 1F3JA 2EDTA 3NFNB 3FTGB 3HMXH 4I3GA 4OV5A 3FT4B 2F5AL 1BQHG 4PP1C 1XIWB 3EO1B 4LNVA 4XNUH 2R1WA 5B8CA 3AAZA 2BCKA 4CN6A 4QCIA 1P9MC 2HT3D 5GS1B 4X8XA 3ARTA 2VISA 4X7TB 2ATKB 3B9KD 5IIEB 1QHPA 5MENA 1Z3GH 4OZHA 2D9CA 4KQ3H 1P7QD 1V3KA 4NO2B 5ANMB 3WDIA 4JFEA 5KVGL 1M7DA 4YPJA 3TYFA 3MNVA 5C0RL 1IGFL 1G6VK 2BOCB 4QRTA 4PGJA 3QDGA 4Q0XH 2X40A 3NCMA 1DVFC 4JZOA 3LKNB 3KG5A 4E41A 2VXUH 3RVUD 4M1GH 2AK4E 3UJJL 2A73B 5DT1L 4J6RH 4ZSOE 3GSNL 3V4UH 1KEML 1KN4H 1I8MB 5CJ5A 3SO5A 1NCNA 4XGZA 5J4MA 1SMAA 5HI5C 1T0NB 4MAYD 3UZQA 4U6YB 1HSBA 5E8OB 3QNZA 4DQOH 4PJXB 4PTUA 3WFHB 3WLBB 1XIWD 3CGTA 3K2MC 2P45B 4J12A 5ICZB 3G6AA 1A3LL 4Y4KA 3P73A 5C0ND 5CEZL 4EDXA 4PRNB 3TN0A 1P7KA 1NEZB 4IHOA 3EOBA 2OMNA 1EO7A 4LOUD 4OCXH 2AXJA 4TSAL 2XY1A 2EYRA 2VZUA 3GRWL 4DN4H 1AI1L 3LKQB 3Q1SH 5FM5M 4MGXA 3C5ZD 3CVHB 3EYSL 4MCZA 1FNEA 1TNMA 3FN9A 3HZVB 4JCMA 4JQVC 4UDUA 4DGIH 3MRBA 5CJOH 5C9JA 2RAMA 3GI9L 4U6HB 5DEGB 4XMKL 5EUOF 1ND0A 1BFOA 4JN1L 1O0VA 3RWJA 4Q6YA 4KKAC 2APWA 3CUPA 3FQWB 1G7MB 3BZ4A 4MMZC 5I8KH 3QHZL 5IVOA 5D2NA 3OKDA 2ZJSL 3KXFB 4ZPVB 2ADFL 2NY5H 2IAMA 3MLZH 4PJCF 5FB8B 1A4JB 4HDIB 3ZT7A 2V2TB 3PV6A 5K9OA 3G6JF 3KPSA 1HQ4B 4N0YH 1TVHA 4GAGH 4HXAL 4JQXC 3BKMH 4CGTA 3EOAB 4PGBB 3S4SB 1X5LA 4ZOCA 4E5XB 1YY8B 2FR4A 5TDNA 1CF8L 4G8IB 1UCBH 2C1PA 5A1AA 2BY1A 5DUPL 1EGJA 4XP4H 1UG9A 3O11A 4I0CC 4K8RD 3JVGC 1BOGA 4C54A 4R26H 3HMXL 5J06A 1LGVA 1P6AB 3DHMA 3UPRB 4XNUL 1UWXK 4PJHB 1FL5B 4IS6A 4UI2A 5FCSH 5IJVA 5DWUH 1JL8A 5IQ9A 1VERA 3SE4C 1KLUA 2AK1H 3PQYA 3PWJA 3QEUB 4Y4HD 1Z3GL 1A9EB 3FFCD 3QDJD 4KQ3L 2FH8A 3QYCA 3T08A 3KXFD 3G5ZB 4O2FB 3U9PH 1P4BH 1RZKH 3WO4C 4IRJC 1ITCA 1WFOA 1EIBA 4JKWA 2YD4A 4RZCA 4Q0XL 2PO6A 1XF2A 4PRIA 1U93A 2ADIB 5TQ0H 1ZA6A 2BNRE 3OG4B 3RWDA 4ODVH 4KJPD 4M1GL 1LDPH 1NCWH 2VMFA 2GJ6A 2X4OA 3OAUH 4J6RL 3VXQB 3V4UL 1KN4L 2PYFB 1CGXA 5HHQA 1ZHLA 3CH1B 3H9ZA 4DK3A 2VRAA 1UEYA 1ZLWH 4DQOL 1P2CB 5IMLA 2FJHA 2KBGA 3BIAX 2WIIA 1BQUA 3JSSA 4Z0BH 4B7IA 3S98A 1OWRM 1B6UA 1CGYA 4GRWH 5D71L 2W0PA 4A6YA 5I19H 4OCXL 1UH2A 4LPCA 3JTSA 1RJLA 1BWWA 1NGWA 2Z8WC 4NNXB 3G04A 3B5TA 3W81A 4RAVB 5CBEA 1T7YA 4DN4L 5LJYH 2ZPKH 3Q0HA 3GHBH 4MA1B 3Q1SL 4JANA 4FFVC 3L3GA 4MD0B 2H41A 1A6UH 1MVUB 4N8PA 4DGIL 5CJOL 5B3JE 4YDLC 3U48A 4N0FB 4ZFOB 4XVJH 3QQ3B 3ZKMC 4YWGH 4XAKE 5E4EC 1R3JA 3DV6A 2AJSH 3MMEB 3WJJC 4B41A 3NGBC 5I8KL 2XRAH 4WHTA 2QJDA 2EXWC 4NQSA 3IU4H 5A16A 2VDPH 4L5FH 1E4KA 4X6CE 5C0DB 3VD9A 2NY5L 4JKKA 1L0YA 3MLZL 2E7BA 4ELMB 2D7QA 3CIQA 1CDUA 1C08A 4U05A 4L3EA 2H9GA 2ZUWA 2EEDA 3EHBD 2Y5TB 4MXVF 4N0YL 5I9QC 5I6XC 4ELKB 3BKML 3BEVA 3P4LA 3NTCH 4GRLC 4GAYB 3VFVB 2B5IB 4PJBF 1MCRA 2V2WB 3WN5B 4Y0GA 3OWEA 1FYTE 1M05A 2NTSP 1NQBA 1UCBL 1K5NB 4PJDA 3SHSA 5TDPA 4PRHA 4BYHA 1UACH 4U6XA 4UOJA 1QR1A 1MNUH 1OAUH 1NFKA 4M6OH 4R26L 4PJXF 1YZZA 4J4PD 2K3TA 2D0HA 3QXUA 3O3AB 3OR7B 4FQJH 4UQ3A 4JRXD 4OGAD 3B3IB 5JW5A 5EC1A 4NKMA 4NWUH 3IU3B 2XTJC 2AK1L 3UPAA 2L4OA 3QQNA 4U7SA 5IMOB 1U8LB 1IEHA 2P44B 2KDGA 3ZDXF 1R24A 2P49B 3L7EB 4NCC1 3L3KB 5LGJA 5GS0D 4ETQB 3U9PL 3E3QE 5J1AA 2YPLA 3PIQB 1GZQA 3HNSH 2XKNA 1XF5A 3PL6C 1SQ2N 1AGFB 3AS0A 5JOFB 5TQ0L 4QRRD 5B38G 3C5SA 4JN2A 1E28A 4X80H 4ODVL 4N90D 1DBKH 3RDTA 1AC6A 5C0EB 3MQIA 3G5XA 3U2SA 1LDPL 5T33H 3RZWA 1RVFH 3OAUL 3F62A 2A9NH 2OTWB 4UOW0 5I1CH 3VWJA 3FO2A 2VYRE 5ETUB 4P2QA 4HH9A 3ILPA 1A6VH 1S78D 2COQA 1T04A 3QZWG 1KTLB 5D1QA 3OX8B 4ZYKB 3S35X 2HVKB 5L88H 1YEJL 1YYMH 1LK3L 4X9BA 4JKPH 1WGOA 4UV4H 1K4CA 2UWEF 4FXKB 5C0FB 5I19L 1RSFA 2IANB 5EZLA 5ADPH 4U7KA 3OL2A 3IJSA 4HZLB 4P2OA 4MNQE 4P2RB 2ZPKL 3WHXA 5D5ME 3HG1D 1U3HC 4MJIA 2F54E 5DJDA 1ZTXH 3O9WB 5J7CC 2FBJH 5IVNA 4WUUA 2GITB 3HLAA 4NHUB 1A6UL 3ARRA 4Y5YA 4YUEH 1F6AA 3BP4A 1AGEB 5C6WH 3ZTNH 3BJLA 4YNYA 1AD0B 5IG7A 3GKWH 4Q6IB 2WLYA 4CU6A 1D5MA 3DX9B 4XVJL 3EYQD 4JPWH 4YWGL 4MX7B 3BRGC 1GYAA 1E4XH 2AJSL 4U3CA 2XZQH 2XRAL 1F2XK 2GK0B 3DETC 3DX7A 2BJMH 3IU4L 3MROB 1HSAB 3VXUA 5KJRH 4L5FL 5CEXB 2HG5B 1IC1A 4L1HA 3HR6A 3MTRA 3QNXB 2DD8H 1FH5H 2H32A 3BT2H 4R8WH 1ADQH 3F5WB 5HHPA 1YDPB 1CD8A 2Y25A 3TBTA 1FPTH 4TSCH 1A7OH 3MX0A 3AREC 4MLIA 1XMWA 4GXUN 1P6FA 3HUJA 3NTCL 4BM7A 5I1LA 4N0CD 3SKNA 2DYPB 2IAND 3TA3B 1OLZA 3OXSA 5C0CB 3GMQB 1IAOA 3AVEA 5CWSA 4WHYH 4JO2H 1G0YR 1JPGA 4P2RD 1FC2D 1HYSD 1AP2A 1UACL 2X41A 1QNZH 3C60D 4G6FB 4XCFH 3O9WD 2B4CC 1MNUL 1OAUL 3DROB 3MV8E 4CVUA 4M6OL 4IOFC 5FF6B 2EIDA 3VFRA 4FQJL 1U95A 4LCCA 5J13B 1YMMA 1C5DB 5CD5C 4NWUL 2D9QB 4U1NA 5D7LE 2ICEB 4I0PB 4WFED 3BDYH 2R8SH 4ONFH 2UYLB 5HVHB 2FBOJ 3JV5A 4WU7A 1AQDA 2ZSWB 3VG9C 2IALA 3DVGA 1ZLVH 4R6UA 4YDJA 3HNSL 3SDXE 3HPLB 4XVUD 2AV1B 3SJVA 4QXTA 3SE3C 4WI6A 4ORGB 3V6OE 4X80L 1DBKL 1G9EA 4OFPA 2R2CA 4N9OB 4BH8A 4Y5VB 2EC8A 5T33L 2QQLH 1RVFL 4R7DB 2DYPD 2A9NL 3TA3D 3WE6A 3QHTC 1PKOA 2I07B 3LV3B 5BQ7B 5C7XH 2VH5H 4P4KB 4ZUUB 2P5EA 5CEZD 3HZMA 4G6KH 4M3JA 5L2KD 1A6VL 4WWID 3O2DA 3MNZA 3BESR 5HGBA 2YUZA 2CD0A 5SX4H 1JGLH 4GH7B 4IIQC 5D7JB 1ORQA 5L88L 1YYML 4UV4L 4WFFD 4XRCA 5KANI 1H3WM 2FDBP 3I02B 4I0PD 3IT8D 2VQ1A 3BHBB 4NKDB 5ADPL 2X4QA 1W0VB 1KLGB 3V95A 1EV2E 4PJEF 3W5MA 2XPGB 5C08A 4H5SB 1D5XA 2BSTA 3RTQB 1JGUH 1S7WB 3LKRB 4XNMB 1ZTXL 2FBJL 5E24E 3BZEB 4YDVA 3D3VE 1P1ZA 4YUEL 3IDGB 3W11D 1LE5B 5D96C 3E6HB 4EI6B 1U8MB 3ZTNL 4N8VG 3RVWD 3GKWL 2NY6B 4YC2C 1C1EH 2HJKB 1NCUA 3EYFA 1MELA 3RVXD 3I3BA 4JPWL 5DJ2B 1E4XL 1GGCH 4PREB 3QIWA 1UFUA 2XZQL 2GTWA 3GSOA 4P4KD 4HK0A 2BJML 3S35H 2AI0H 4UMGA 5FO9B 5KJRL 2EYTA 4CMHB 4BQCA 2ZOKA 1R5VA 2CK0H 4PJFA 5FECA 4L9LB 3CC5B 4RMVA 2EH8H 5AUMA 2YD6A 2R1YB 5E03A 4MD5B 2QLVB 2DD8L 1PAMA 3UO1L 1FH5L 4R8WL 3GB7A 1QFPA 1P4IH 1FPTL 2EICA 2B39A 1A7OL 1Q94A 4YAQB 3TWCH 2ILLA 1V5JA 3VWKB 5IW1B 4PRPA 4JO2L 1N5AB 4LGRB 1XGUB 3RTQD 1MCWM 1QNZL 2APVA 1N59B 4XCFL 4YO0A 1M4KA 2HJLA 5JORA 1BJ1H 1TQBB 5C0AA 4HIEB 2LU7A 3SQOH 2NY6D 4PJ5E 4PUBH 1A6ZB 1Y6KR 2MKWA 3OV6A 2IPKB 5CEYB 1BIIB 1UJ3A 5J12B 1P4LB 4HWZA 1DBMH 3BDYL 2R8SL 3QDMB 4ONFL 4U0RB 1IAKB 3P9WB 3PJSA 4NBYB 3MGTB 4OD3H 5DQJA 1E4XI 2FL5B 3GJFH 2EDQA 1A6AA 4PS4H 3MV7E 4LIQE 4BKLA 5LBSH 5DK0A 4U1JA 3MUGA 2ICES 3O8XA 4X6FB 1CGSH 5IVZA 4O2EB 4KTYA 3T0WA 3GHEH 3OB0H 2DIBA 4LCWA 3NIGE 4UT7H 1G7IB 4MQTB 4QY8B 3VWKD 5C7XL 3IXAB 2VH5L 3STLA 5BXFA 4H0GA 3U0TB 4G6KL 3T2QA 2HH0H 2JJSA 5AZEH 4LLUB 4M1DH 3P77A 1JGLL 4GW1A 4LEOB 1M7XA 1A64A 1BREA 3QA3A 1TPXB 4JRYA 5SV3A 1J0IA 4Y16D 2A6JB 3AM8A 3MRJA 1PLGH 4Y89A 2VXVH 3RY6A 4OUUB 2FSEA 2ITDA 1H5BC 4B53A 5BVJB 1LO5B 4LVNC 3QDMD 3TC9A 1JGUL 4Y2DB 5C0JB 3WXWH 2J8OA 1DTUA 4Z7VA 3QUMH 2VL4A 1HXMB 2NY0B 1BEYH 3VXOB 1M7IB 1CGWA 4ZMAT 1VCAA 5DFVC 4EIZC 3MV9A 3LDBB 3RZCA 3S96A 1C1EL 2O61B 5IW6B 4PTTA 4HJGB 4NFCA 1GGCL 4JRWA 3PHQA 5T3XE 2Y72A 1I8IA 1AR1C 3KYAA 3S35L 2AI0L 1OAKH 3LSOA 4XAWH 2YMXL 5ACZA 1G6RA 3GMNA 3PDDA 1BFSA 4Z7UE 4U1MB 2EH8L 3RA7H 4C56E 1JGEA 1XH3B 1FBIH 5E70A 4G9FD 2YXMA 4N9GB 4OZGF 1VESA 2XQYK 3DX6B 5SX4I 1P4IL 1YQ2A 1CXIA 3TWCL 4WI7A 3HI6H 4G7VH 1ZWIB 3D18B 4GS7C 5HPOA 1Q0XH 1GOFA 3LRHA 4ERSH 3L3DA 1NMAH 2D0GA 3PWVA 1ZHBB 3VGEA 3ZKXB 4Y2DD 4GRWB 2UUDK 1CD0A 5F1NA 4LU5H 3HE7C 1RZGA 1H0DA 3IFOB 2BVOA 5F7LB 4NNYB 4LPWA 2X4UA 3BAEH 2HLAA 4F58H 1KB5H 5I16A 1MH5B 3SQOL 4N8VA 3JV0A 4PUBL 4WFHD 3ROOA 5D7IA 2JIXB 1TXKA 5KG9A 4XCNB 2PW2A 3E8UH 3JV4B 5IB2B 1JZ2A 5HPMB 5H8DA 5EU7C 3RKPA 1QEWA 1DBML 3P40A 4Y5XC 1HHIA 2VITB 4ZOAA 1CE1H 2FX7H 4OD3L 3QNYB 5D4QA 1LE9A 4Z7OE 3R0MA 2A6KB 4ZUSB 3E2HB 3OHXA 4PS4L 4F7CB 5L6YH 5LBSL 3P4OA 1Q1JH 1YA5A 4RFEB 1CLOH 5GIRB 1MFDH 2BVTA 1CGSL 3V8CA 5BS0A 4CJ0A 2DJ4A 3C6LB 3QUXC 1BLNA 5JOEA 3GHEL 4HGMA 2RBLA 4JFQB 4NC1E 3RVUC 4JHWH 4UT7L 1MY7A 1YY9D 1EUTA 1NAMH 1TTFA 5SWZE 1HI6A 3H2WA 1J0JA 3T3PE 3UAJD 3FOMB 3EO9H 5HDQH 2HH0L 5GS2H 1IARB 1Z5LA 5GZND 4LVHC 5T3ZE 4MQXD 5AZEL 4M1DL 3CFKB 1A5FH 2VE6B 1GAFH 5IK3B 4B7LA 1IM9D 1EPFA 3PDOB 3V52H 5IVXE 5MEOA 5C09A 1NH6A 1VFAA 3SKMB 3V4PH 4LSQH 1PLGL 2VXVL 4XC1L 2JIXD 3UC0H 2XG4A 2CRZA 2R0ZH 2DTSA 1HINH 5HBBA 4LOUC 1MSPA 1K2DA 2VLKA 4AH2A 3IDYC 4XB7A 3VXRA 1JHKH 2DOCA 1BD2E 3WXWL 4GBXB 4EI5B 2EIZB 4Z7WF 3BP7B 3QUML 3C5ZC 4K71B 2MJWA 4Z7QE 3OKOB 1BEYL 3UJIH 5T1MB 3IKCB 1UZ6F 1HYRC 3TZVA 3H9SD 3ESVF 2JB5H 3C6LD 4X6EA 3ZDZE 2PKDA 2V17H 5F9WB 4KGLA 5BW7A 5EU6E 4JAMB 3CFJA 3FB8A 1FAIH 1N3NB 1J05A 3G5YA 4OD2B 4L3CB 2AXGA 5DVNA 5I17B 2X70A 2XACC 1OAKL 4X6BA 4XAWL 2WWKT 1RZIB 4F8QA 2P5WB 5J57B 1TJGH 2OQJB 3RA7L 3DGGB 5DVOA 1VFOA 3ARQA 1FBIL 1DQJB 3DXAA 1F8TH 3HI6L 4G7VL 3TVMB 1Q0XL 4Q97A 4ERSL 1R5WB 3AY4C 1NMAL 3C9NB 2ICWI 4JFHD 5K33A 1RK1B 1JNNH 3OR6B 4OF6A 4HKZB 4GBXD 4LU5L 4EI5D 3AGVA 1I1RA 4JY5H 1B0WA 3P0GB 4S1QH 2HFFA 2ZSVA 4LBEA 1CFTA 4LHUB 3AB0C 3QHFL 3BAEL 4F58L 2FX9H 1KB5L 4WTZG 4LP4A 5EUKB 3BUYB 5IMKA 3DSNA 3HS0A 3RL2B 3SE8H 5GGTH 1KENH 3VI3F 3VFSA 3BEWA 3FOLB 3GBLA 4HX1B 4NPYA 4KHTH 4E0RA 4UDTA 1UH3A 3RKDD 1MUJA 4Y4HC 4YJZL 3IRZA 4KDTA 2EKSB 1CE1L 3QXAB 3QG6A 3OJDB 5CZXC 5L6YL 2P5WD 4K3JH 1Y0LB 1Q1JL 4HK3N 1CLOL 2OZ4A 4DKFH 1OOAA 3DYPA 5CKAA 1MFDL 4PJGB 2YSSA 4LLMB 4I4WB 1WEJH 2J88H 5KSBA 3QEQE 4JHWL 3W2DH 1NFDE 1KYOK 3TVMD 1NFIB 4OIIL 4I5BB 2EDKA 5HHXH 4LGPB 4OZIB 1XT5A 4X5WA 1NAML 4KRPB 5CGTA 5MENE 4OZHE 2A0LD 3FZUD 3OKYA 3EO9L 5BZWA 5HDQL 4JFEE 3ZSTA 4P46B 2VLJA 1SJVA 1QBBA 1UXWA 3IDMB 1KT2A 1A5FL 5HHME 1GAFL 4CVZB 4LHUD 1OHQA 4RA3A 4W70A 3V52L 1BZ7A 4QGTA 4D0BA 1OGAB 5EN2A 1AO7B 3OB8A 3V4PL 3GMOB 5FO8B 2YD5A 1E6OH 3VRIA 4EQ2A 4LSQL 4G43B 4EDWH 4Z95H 1ES0A 2BNUB 2AXFA 3UC0L 4MNGA 5F1KC 4HIXH 2R0ZL 1HINL 2FGWH 3U1SH 5DK2B 4R4BA 3EYVA 1WZ1H 4WNQB 5IEKB 5ILTH 1JHKL 3FAXA 3NZ8A 4LCUA 5GGVY 3W0WE 1X5XA 4PP2B 5F6IC 4XCCH 3STZA 3PGCA 3Q6GH 3UJIL 2K7PA 3ARZA 3JV6A 5CMAA 3DO7A 3UPCA 2CIIA 2JB5L 3SCMB 5ACLA 1SEBA 1T0MB 5J6HB 1HXYB 3BE1H 3SDDA 3P4NA 4OIBA 2IBZY 3EO0A 4HJ0D 5JW4M 1GSMA 2FO4B 3TCLB 3GMRA 2KZWA 2CLRB 2HFEB 3MRHA 5FA4A 4DGYH 2Z4QA 5A2KH 3VXSB 4G9DA 1I7TA 2A74A 3MA9H 1X44A 3PG2A 4OUOA 1GJIA 2Q76B 2ARWA 3SGKA 1KELH 4EVNB 5F1OB 4N8CH 1TJGL 3MYJB 3VXPB 1OGAD 4WWKA 5F21B 1AO7D 2F53A 3U4AA 2P7TA 4D9QD 3PE9A 1ONQB 2NXYC 2R2BA 4XWOC 5F9JA 4ODSL 3QO0B 5CD3A 4L4JA 5DHVA 2MCPH 1G7QA 4I3RH 3MO1B 1CVSC 3MUHL 1JNNL 4JM4L 3PP3K 4KKBD 4Y4FA 1TNNA 1KJVA 4JY5L 3VH8B 2X9WA 1JNJA 4S1QL 4PY7A 3L95A 4MNHB 4M43H 2Q6WB 3SCMD 2FX9L 4XZUB 3QCVL 3BKCH 3T1FA 1GL4B 3MLPA 1MOEA 4F7MA 3TH4T 4WU5B 3KLHD 3SE8L 5EUOE 5GGTL 1KENL 1BX2A 2VLRD 2EYSB 2ESVD 3O3EB 4KHTL 1MCDA 4KXZI 1A1OA 4HGKC 5KSVB 2QR0A 5DJZB 3VXSD 3HAEA 1AQKH 5ICXB 1JCKA 3N1QC 1I85A 1S7SB 4K3JL 1QLRA 5I8CB 1CICC 4PJCE 5T1LA 4DKFL 5KVDH 4KGJA 1YECL 3BGFB 4J1UA 5FGBC 1KTDA 2WBJA 5T5FH 1WEJL 5GGRY 2J88L 4BSVB 5DJXA 1JZ7A 4HS8H 3W2DL 1ZVSA 4LSSH 5DFWH 1X4XA 4KKLD 1I1YA 2RFXA 5HHXL 2EECA 4L29A 3MRQB 3QJHA 4R7NB 1EHAA 1QLFB 3D0LB 3RVTD 3RVVC 3OKKB 2L7JA 3FB5B 1SBBA 1OTTD 2ENYA 3GSWB 1CE6B 3I84A 5I66A 4QOKB 3GIZH 3R06B 2W1NA 3HPJB 1S78C 3ULVE 4PRIE 5IT2H 1F4WH 1YNKH 4YBLC 1UT9A 4OCLC 1E6OL 1YEDA 3MJ9A 4WTZA 2J8UB 4EDWL 5E00A 4Z95L 3FB6B 3G9AB 1J8HB 4N0UB 4RQQB 4HLZG 4HIXL 3QFJA 1R3IH 2GJ6E 4APQA 2DTMH 5IM7A 1WZ1L 2Q87A 2HJFB 4M7ZB 4QRQB 3NCCB 3FO1B 5ILTL 2YWYA 4DZ8A 2ARJB 4XCCL 1OF2A 1FLTX 4PRAA 4GG6A 1A22B 3Q6GL 3REWA 4XH2A 4LLWB 4O51B 5B4MC 4HZAA 2G60H 5GZOC 1CXKA 5I1AA 1K3ZA 1N7MH 3BE1L 3DGCR 4XNYL 1JWMA 2GIYA 2R2EB 3GJFB 5K9QG 2EIEA 3WFCH 3HMWH 1CDIA 2HWZH 4GW5B 4LCIH 1I9RH 2PW1B 5EO1A 1EEUA 4OLYH 3QCTH 1CLZL 2RB8A 4OBSA 4DGYL 3HCVA 2XXCB 1LO3H 4HWBA 1U92A 2PXYB 3D6GA 2N1KA 3RWHB 3QIUC 3MA9L 1NCDH 3CDGB 3MRPB 3VXNA 5AYUH 4QOKD 5IV2B 2G5BA 1KELL 2W65B 5GRYA 4N8CL 4NO5B 1T1YA 1EFXB 1MHCB 2YUWA 4NQXB 4NUJA 2PR4H 3BRFA 4UB0H 3HRZA 3QUYB 1S9KC 4QHKJ 1J8HD 4Z7NE 4MJ6B 2KQMA 2DBLH 4I3RL 3NH7H 3PWNA 1PD6A 1CDGA 5FUCE 3DO3A 4DUXA 1HYSC 2ICWB 3IB4A 1X5AA 5FYLE 3C60C 1VFBA 4QRPB 1G7LA 3DECA 3KJ4B 3QAZC 4M43L 5IJKA 3BQUA 3BKCL 2VN4A 3MBEB 4ZFZA 5M7QA 4RCAA 2GKIA 1BGXH 2YOCA 1KGCD 3QUMB 1IGMH 1OB1A 2IADA 4PGCB 3B5HA 4LMQI 1DBBH 2ADJA 1I3RA 5BCAA 4NC2B 3KYOB 5EB9A 4QHNA 3ZE2F 2PXYD 3OQ3B 1AQKL 4OLVH 4HBCH 3D69A 3FMGH 3EYUH 2Y23A 3H7BA 3TBSA 1XGYH 5KVDL 1EFXD 4JM2A 1S9YB 1GZPA 1MLBB 5T5FL 3QUYD 2AP2A 3WEXA 1FN4A 3KPRB 1WTLA 4HS8L 4LSSL 2OXGA 1PKQB 1AXTH 1IZJA 4QEGA 2VQTA 3S4SG 3MPCA 3QDAA 3HI1B 4PJBE 1HK6A 4YZFF 3DMMC 1ZAGA 4H8WH 1A1MB 3ZHDA 1KPRB 2PUQT 2W9LA 3GIZL 5CIPH 1E4WH 3GSXB 2QBWA 1DQQA 3RY4A 3IDJA 5IT2L 1F4WL 1NUGA 5IB4A 3TNMA 1UWXH 3MBED 4JDVA 4OM0H 3RX8A 5EULV 3ZTJG 3BN9D 3G08B 1R3IL 4UNUA 5BV7C 3RFZC 2GJZA 4Q9QH 2DTML 4PJIB 1HWGB 5E5MA 4PBXA 4CN4A 4NYLB 4PJ7A 3B9KA 4UINH 4X6DA 3ZDXE 4LVOC 1A8JH 4HKJB 1IEAB 1P7QA 2VZ1A 4RIRB 4MCYB 3T0EB 3VD3A 3RWFB 2R23B 1ZT4B 2VZ3A 3IFLL 2G60L 1F02I 5IUSA 3FRPA 3W11C 1N7ML 2C9AA 2APXA 3VJ6B 4GO6B 2X4SB 1ZVHA 1GGTA 3WFCL 4LLAA 1PEWA 3FO0H 3HMWL 2HWZL 4LCIL 1I9RL 3R1GH 4PD4K 4OLYL 3QCTL 2NCMA 5EBMB 1QFHA 2JCCB 1LO3L 3LPGA 3K81A 4OQTA 4JG0H 5F3HB 3M1BB 2CDFA 1NCDL 4YBHA 5AYUL 4MAYA 5DQDH 3ARBB 4H1LG 5MEQB 3TNNB 1NAMB 1VFUA 2GJJA 3NFNA 1IZKA 2PR4L 5CAYB 3FTGA 4UB0L 4ZG1A 5DMGD 3FT4A 4MS8D 3WHE1 1XIWA 3EO1A 3OKMB 3G5VB 1S9WB 2DBLL 4P5TC 2DM3A 2D31B 2UWEE 5GS1A 4X7TA 2V9QA 2ATKA 3NH7L 2AEPL 5E6ZA 5IIEA 4WV1A 5AG8A 1GIGH 3MODL 3VXUE 4HJJH 4NO2A 5ANMA 3ARDB 4WEBH 2EC9T 1F2QA 2NLJB 4ZS6D 2BOCA 1T22B 2IH1B 5A40E 4QXWA 1OD9A 3PWPE 3R8BB 1QHOA 2GUOB 2NY6C 1BGXL 2NY2C 4UTBH 5JXAH 5KSAB 3I50H 1IGML 5D1ZA 1MQKH 5FKPB 1DBBL 2ZUYA 4L3AA 1SVZA 5I76A 4RBPK 1X7QA 4NOFA 4P59H 3SGJC 3CU7A 1G0XA 4OLVL 5DMKB 4HBCL 2DKSA 2DKMA 3FMGL 3EYUL 4UV7H 5AAMA 1T0NA 1L0XA 4U6YA 1EJ6A 3I2CH 3ARBD 1W8NA 2CXKA 1XGYL 5LG1A 1CXEA 1NC2B 3QDHA 4MVBD 1A6PA 3WLBA 1RFDH 3CX5J 5GS2D 3U0PB 5ICZA 5ITFA 1NBZB 2BHYA 12E8H 4HF5H 4FZEH 4PRNA 1AXTL 1NEZA 4DN3H 3CPLA 1YEHH 4CNIA 4R0LC 1JMXA 5EO0B 4H8WL 4WHCA 4GLRH 1YPZF 2GI7A 4BSJA 3EUUA 2NY3C 1D5BB 4ZXBD 1KIUA 1E4WL 3ARDD 3LKQA 3MBXH 4ONHB 1OP3K 3PGDB 1H3VA 3LQZB 3CZFB 3CVHA 2MTPA 4JZNB 4TYUA 3SJVE 3K1DA 4JO3H 4OM0L 4ZOBA 4QF1B 1X5HA 2FYYB 2FO1A 4Y16C 5KSAD 4EN3A 4KU1A 4U6HA 5DEGA 3TPUB 4GJTB 4Q9QL 2FRGP 1YNTB 2E7MA 2YK1H 4U49A 3FQWA 4UINL 1G7MA 3GMMB 4WW2F 4JKLA 4X4ZA 2X1PA 3U7YH 5I1EH 2IH3B 3KXFA 4ZPVA 5F7KC 4QRUB 2RIKA 1NC2D 4PGZA 5FB8A 2DMCA 1T1WA 4KI1A 4HDIA 2V5TA 2V2TA 1RZFH 3CDYA 3L6FB 4O2CB 3F12B 3FO0L 1OAZH 4FQHB 3R1GL 1NJ9B 2Z9TA 3EOAA 4PGBA 3S4SA 1YY8A 4JG0L 4PBWD 4G8IA 2W92A 5GGQH 5DQDL 4O58H 1HIMH 1QYGH 2XQBH 3TJHD 4O02H 1WFNA 1TPXC 3TO4D 3TLRA 1PW3A 3UPRA 3GSVB 4PJHA 2OJEA 4LPYA 4CW1B 2IBGA 3QEUA 4I2XE 3PHOA 1W8OA 4ZUTB 4PJEE 1A9EA 5C07D 1GIGL 2EZ0C 4HJJL 3KJ6H 5J11C 1WFUA 2YD9A 1Z6JT 2H26B 3KPMB 1N26A 1T89A 4PY8I 3G5ZA 4O2FA 4U1HB 5ESAB 3T4YB 4WEBL 4MMXC 1CD9B 2AKRB 5EDXA 2JE8A 5DGQA 4JFDE 5F7WC 3LDBC 1HH9B 2LE9A 4K94H 4KVNH 4ZSOB 5JZ7C 2ADIA 4PLJC 4UTBL 5JXAL 3I50L 1MQKL 2WM0A 2YKLH 5BRZE 2G75B 3K8KA 2E7HA 4P59L 2Z8RA 3KHQA 2EEBA 3VXQA 1KCKA 3WFBH 5AG9A 2PYFA 3ULSB 4UV7L 2B2XH 1NBQA 3I2CL 5CP3H 5D1XB 1P2CA 2NY7H 1RFDL 4MQ7B 2GSGB 1IC5H 3N50A 1MWAH 4PGDB 5KSUA 3RBSA 12E8L 1S7XB 5JHLH 4HF5L 2J8HA 4FZEL 1KYOJ 1EHNA 1J87A 1I1AB 4DN3L 4JFOB 1H8OA 2DM7A 4MJ5B 2CR6A 4M93B 3GZKA 4L9DA 4NNXA 4XNZC 4RAVA 5I74B 3MBXL 4FFZH 5GZNC 3MLTB 5CKGA 5I75B 3JZ7A 3ARYA 1XF4A 2AK4D 3X12B 3MJ6A 4F9LA 5K9JH 1XF3B 5DTFB 4JO3L 4MD0A 4J4PA 3NCFB 1MVUA 5IBUG 4DVRH 2Q7YB 4HHAB 4WEMB 4N0FA 1U2HA 4QHUB 4R4ND 4ZFOA 3QQ3A 4L4VA 1RUKH 1M6OB 4LF3B 2YK1L 4KK6D 3MRIB 4R2GC 2RGSA 1ZSDB 4JFZH 4UQ2B 1O5DT 4HUVB 2Y6SD 5FKAB 1T20B 3GI8H 5E8EB 3U7YL 5I1EL 4K3GA 2W91A 5C0DA 1S7RB 3SDYH 1RULH 5D1XD 4ELMA 2FIRT 4NRXB 4LCYA 2EC9U 1RZFL 1FSKC 5GRJH 5MP6H 3ZYJA 1QACA 1OAZL 4E9LA 4HW6A 1I1AD 2G9HB 4ELKA 2NXZB 3R8QA 1GRWA 4GAYA 1U8NB 3VFVA 3WN5A 2V2WA 4MD4B 3UTTE 5GRWA 3RUGA 1K5NA 1PJ9A 3L5IA 5GGQL 4O4YH 1FV1B 4M00A 2IQAB 4M7LT 4O58L 1AIFA 1HIML 4GLRI 4X9HA 3UTZB 2YRZA 1GGYA 5FO7B 5CHNB 3MV9E 3KNBB 2XQBL 5D70H 3P2TA 2I60H 4O02L 3RAJH 3O3AA 5KZCB 5C71A 2E5EA 3E0GA 3B3IA 3DUHA 3ZT6A 1CFSA 3BXNB 1N0XH 2R9HD 3KS0H 1SMOA 3MREB 4U3HA 1U8LA 4ZAKA 3L7EA 1AGBB 3KJ6L 3L3KA 5EC2B 5T3XH 2GSIB 1CFVH 3ARGB 4ETQA 3MC0A 2F15A 4KKCD 3ME0A 3PIQA 1DDHB 3BRDA 4R97C 2EXYC 4K94L 4KVNL 2C3WA 3VGDA 5JOFA 3LVEA 4RRPG 3NBNA 5C0EA 4Y8AA 3F7YB 1FG2A 5E6IC 2YKLL 1H15B 1WAAF 2FNBA 2NXZD 1ZGLB 2R0LH 1IMHC 2OTWA 1BF2A 3H9HB 5EIIA 2B2XL 3RIFK 2ITCB 5ETUA 1NBYB 2FD6H 1CDCA 3KDMB 4LSPL 4NUGH 2NY7L 4QHLB 3V9FA 1KTLA 1IC5L 1B6DA 1MWAL 2NY1B 3OX8A 3WUWB 4ZYKA 4OLXH 2VR5A 2HVKA 5JOPE 2NQCA 2D7MA 5JHLL 4NKQB 1AHWB 2VWEE 5DD5H 3TVMC 1I1CA 2IFGA 4FXKA 2IPUK 4M4PA 2VUOA 5EOTB 2VZTA 3AFLA 1EH9A 4OCRH 3I9GH 4HZLA 4URTB 2BNRD 4P2RA 4Y19E 3ARGD 4FFZL 5ENWB 1SYVB 1A47A 4MWFB 1DEDA 1WIUA 3O9WA 1RZJC 5K9JL 3AXLB 5BS0E 5GJSH 4U1SA 2GITA 4NHUA 3UZEA 4DVRL 2HTKD 2P43B 3B5GA 2EE9A 1GCFA 1AGEA 1X5ZA 1A9BB 5HXMA 4Z78B 4Q6IA 4HIIB 3DX9A 4G6AC 4NQDE 1RUKL 3I75A 4XBPB 4MX7A 3AU1A 2FEDC 1K6QH 3CDCA 4PJ8C 4OZ4B 3GI8L 5CJQH 1EA9C 1T2QH 4ZUWB 2GK0A 4P23B 3MROA 3V79C 1HSAA 3SDYL 5CEXA 2HG5A 4YQXH 1RULL 1XGRA 5DDHB 3O2WH 3JWDL 5C09E 1T21B 5D7KE 5GRJL 5MP6L 3QNXA 2X6MA 5HI4C 1FYTB 3F5WA 5DURB 1YDPA 3FN3A 1UYWH 2DYPA 3TA3A 2VLKE 5C0CA 1OD7A 3GMQA 3VXRE 4U6TA 3LMJH 1UB5B 2O5ZH 4LQFH 5ERWB 4O4YL 1OW0C 3KYKH 4YXKH 1FL6B 2DQFB 1DEEB 4XAKD 3RAJL 2I60L 5FF6A 3N1FC 4M48H 3K1KC 4LLYB 3HZKB 1X4ZA 2B4CH 3KLAA 3GRWA 2IPUG 4L4TE 2DQTH 1DQTA 3RGVB 1KXTB 5CIPB 1C5DA 3TYGH 1N0XL 1OSZA 3DVNB 5FM4A 4I8DA 2FZ3B 2Q8AH 1GC1C 4I0PA 5DA0B 3HB3D 2UYLA 4LLVB 4P23D 5T3XL 1CFVL 4M6ML 4OFKA 2ZSWA 4Z7WE 3BISA 3IETB 4IMLB 3Q5OA 1SEQH 3IJHA 2Z8SA 2AV1A 4ORGA 3DBXB 2VDOH 1FYTD 4WI9A 1WITA 5DURD 4Y5VA 4TNVF 4U1IB 4R7DA 3PABB 3T3MF 2R0LL 2I07A 1CK0H 3LV3A 4ODUB 4TTDD 5BQ7A 2R29H 2LV4A 4NQEB 1FNLA 1U8QA 2YD1A 4P4KA 4ZUUA 2VKWA 3WIHA 3GGWA 1Z0MA 2FD6L 4I18B 4GQPH 4IMKA 2WV3A 3HA0A 2A77H 1IT9H 4LHQB 4NUGL 3MUY1 1NEUA 5D7JA 3TPKA 1N4XH 3RGVD 5JNYB 4MNQB 5DD5L 5IF0B 5D5MB 2NX5E 4X7SL 4F33B 2DN7A 3I02A 4YXHH 2GTZB 5HYQB 3HMXA 3BHBA 4NKDA 4W81A 2YC1B 4I13B 1W0VA 2UUDH 1KLGA 4OCRL 3I9GL 2XPGA 3RVTC 3M17B 3B43A 3RTQA 3F7RA 3GSQB 1OARH 1S7WA 4XNMA 4JJ5B 5CZVH 3BYYA 1DQLH 1S7TB 2UZIH 3FL7A 1SJXA 5GJSL 1OQXA 2XNAB 3IDGA 4JFYB 1JI1A 1LE5A 3E6HA 4EI6A 1U8MA 4NQUA 1Q38A 4H26B 4GW4B 1YUHB 2HJKA 1P7HL 2EDFA 4XI5D 3VI3E 1QZ1A 5DJ2A 2BP3A 2G5RA 4PREA 4NIKB 3MCLH 3DRTB 5CJQL 5JO5B 5FO9A 5B38B 1DVFB 2VLJE 4YQXL 5BZDB 5D7SH 5FYJH 4L9LA 3CC5A 2ARJQ 2B0SH 3O2WL 2R1YA 3DUUA 3FT2B 4MD5A 1CGUA 1TETH 4MNQD 4YEEA 1UYWL 4G3YH 4YAQA 1WWCA 3U6RB 3W39B 4YPGB 3MV8B 3VWKA 5TDOB 5IW1A 3LMJL 1NCTA 2O5ZL 1N5AA 4LQFL 3QZWB 2VOTA 1XGUA 1QRNB 1UZ8B 4KMLB 3KYKL 4F7TA 4YXKL 1N59A 4W4OA 2ATPB 5I18H 1RHFA 4PGEB 2F9BT 4FTVE 2ZUSA 1U3YA 3SDAB 2APBA 5D7LB 4M48L 1F6FB 4HIEA 4XB8A 2B4CL 2EDNA 2DQTL 9CGTA 3ZKQD 4X4MA 3TYGL 1BJMA 1A6ZA 3LEXA 5A2IH 4NO0B 4HWEH 2Q8AL 5HD8C 3ORJA 3BO8B 2R15A 5CEYA 2JJVA 1S7QB 3SDXB 4M7ZC 4YHIB 4NZDA 3Q3GB 1K8DA 3QDMA 5TE6H 1IAKA 3MGTA 3FQUB 4OIAA 1DVFD 5EOCH 2FL5A 2W60B 4XCEB 5B3JF 3B2UC 4BH7B 5C6TH 4NN7C 1SEQL 3LH2H 5EBWB 1MHHB 4GSDH 4X6FA 2VDOL 3IXTB 4O2EA 4HWUA 1FJ1B 1MHEB 5AYQA 2C26A 4HUNB 5IWLC 4X6CF 1J86A 3MV8D 1G7IA 1CK0L 4QY8A 1A0QH 3IXAA 3MRCB 3PWUB 2R29L 3OAYK 4NP4H 5GGSY 5HJ3B 3CH8A 3NCJH 1P69B 3U0TA 5JXEC 1J0KA 3VRJB 2G2RB 4CU7A 3MJGX 1V3MA 4LLUA 2A77L 1IT9L 3SDAD 4LEOA 5D7LD 2WUBH 5TPWH 4Y8DC 1EXUA 1N4XL 5F89B 1ZKAA 1QSFE 2RR3A 1GGIH 2A6JA 3EDDA 4OUUA 4NO0D 3VDAA 3HE6C 4YXHL 3IAGC 5BVJA 4WW2C 1JPTH 3JWNC 3D3VB 5DSCB 3WSQH 4Y2DA 1KCLA 5C0JA 1OARL 4AEEA 1OQOA 1TJHH 5CZVL 1HXMA 1J0ZA 1X6NA 1DQLL 2UZIL 3VXOA 5F6HI 4LHUG 1M7IA 1S9VA 4KKAD 5DJ8A 1KIQB 1VEOA 4OAWB 5EZOH 4OF5A 3QWOB 5IW6A 2O61A 4XP1H 1U8KB 4HJGA 1MI5E 3UTSE 2Y06H 5ID1B 3H3BC 2FECL 4YHYC 3MCLL 3WO4B 4IRJB 3PXJA 3WS6A 3S97C 2J1KA 4JLRB 3U4EB 1EHLH 4MB5A 3QI9C 3VXMB 2Y5EA 2CDGB 5D7SL 4NRYB 1U58B 4L8SB 5FYJL 4U1MA 2CJUH 1OAYH 1NDMB 2C3GA 1XH3A 2CGRH 5C8JA 5GGRB 3A6OA 3DX6A 1TETL 2OI9C 5FM5O 3QFJE 1QFWI 4G3YL 3FFDA 4F7PB 2FIKB 1M1SA 1ZWIA 3D18A 5DJCA 3SDCD 4YDKH 1MCBA 3D3VD 5KN5B 1B0RB 4YH6A 2GAZB 5GRUH 1ZHBA 2HRPH 3C08L 4S2SB 2E8YA 3CCHB 1ZT7B 4LSTH 1MCFA 4GG6E 4PJ5B 5I18L 1U8OA 1GH7A 4LAQH 1EUUA 2YA2A 3IFOA 5C70A 4NNYA 5B39B 3IS1X 4U2YA 3FONB 1MAKA 1WZKA 1MH5A 4S0TD 5T1KB 5DJ0B 1LEIB 3HRPA 1CFNB 1RUPH 4HWEL 4XCNA 5F7EH 3JV4A 5IB2A 2OR8A 1AGCA 2DWEA 3MV7B 5HPMA 3EFDH 5HHOE 1Q9WB 3I3EA 2VITA 4HEME 5TE6L 4LRIA 3SGDH 2JJTA 3QNYA 1ZHNB 5EOCL 2FECI 3VE0A 4YHPB 2A6KA 4ZUSA 3CK0H 4YDLB 1MCQA 5C6TL 4RFEA 3LH2L 3T1WA 5GIRA 3OF6D 1D6EB 3SKOB 3B8SA 4GSDL 5ISZE 5E4EB 5EPMB 1G84A 4FNLH 4BZ2H 3C6LA 4NQCE 3NGBB 3MUJA 1L4IA 4JFQA 4G8EB 4Y1AE 2E6QA 5L8KB 4OI8A 1A0QL 2HLFC 4NP4L 4CKVX 4OV6F 3NCJL 4HUXB 3FOMA 5H94B 4OQTH 3PF2A 1TTGA 4PJ5D 2VLME 4GKNB 4D0DA 3CFKA 2VE6A 5MHSE 3GUTB 5I9QB 5IK3A 5I6XB 3PDOA 4W6XB 2HYMA 2WUBL 5TPWL 4MVBC 1IKFH 4GRLB 3HR5B 4LQ1A 3SKMA 5DRZB 1GGIL 5T1KD 1F13A 1L7IH 1FCGA 3IAQA 1OTUD 5ABDE 2GFBB 3MV7D 3DVIA 3UBXI 4FFVD 4WGWB 1JPTL 4HLZH 4WHDA 3QUZB 3LKPB 2YR3A 3VRLE 3WSQL 4ZXBC 4GBXA 4EI5A 3O4LB 1TJHL 1MREH 3VH8G 2EIZA 3BP7A 5MI0C 3NVQA 3OKOA 4YEFA 1CDHA 3IKCA 2XTJB 3V5DB 3BH9B 4QHMB 4BK4A 5EZOL 4JAMA 5I1DB 1ZVYA 4GAFB 2F74B 1QOKA 5ACMA 4XP1L 3VGAC 3ARSA 3VFUB 1I3VA 3H6JA 4Z7UB 1N3NA 3ZE2E 4YE4H 4L3CA 5EWIH 4MJ2A 3WHE0 5I17A 5CUSH 1EHLL 1JMZA 3PL6B 1C12B 2XFXB 1RZIA 5INCB 4JO1H 4IOSD 2OQJA 2CJUL 3DGGA 1OAYL 3A6CH 3SKJL 2A1WH 2CGRL 4GRLD 5DJ6B 1DQJA 4MA3B 5BOPA 1A3RH 1XGQB 2UY7A 2AW2A 1GXEA 4YDKL 1EZVY 2V7NA 4DAGH 5C0GB 3UTPE 1R5WA 4NBXB 4NSKB 3QUZD 3C9NA 5GRUL 2HRPL 1RK1A 4X4XA 4HKZA 2H6PB 4LSTL 4XTRC 4NM8H 3ARFC 2X4NB 4LAQL 1TDQA 2CLVB 4YHZH 4NHCH 4C4KO 5T3XD 2AEIT 3TO4C 1V7MH 3WV0A 3FRUB 5J3HD 1FVDB 1HHGB 3BUYA 1UQSB 1MCOH 2CIKA 1SJHB 1RUPL 4J2XA 3RL2A 5F7EL 4PLKC 1TZHB 3QXTA 3ZKNC 5E2UH 1U3HB 4KI5F 1CR9L 3EFDL 3CFCH 3FOLA 4HX1A 4FQPA 4MZ3A 1YC8A 4C56D 4FQ2H 1U6AH 5DYOA 2EKSA 4CMMB 3QXAA 1RHHB 1X4YA 3PL6D 1IL1B 4NGHL 4TPRH 1PFCA 1SYSB 3OJDA 2FHBA 3HI5H 3CK0L 1Y0LA 3LRGA 1HNGA 1BZ9B 1WIOA 2ZWLT 4PJGA 4FNLL 4LLMA 4XPHH 5SWZB 3KR3H 4I4WA 4BK5A 2VUYA 2AAVA 4XXCA 3RU8H 5E8NA 4BZYA 3K4DA 1HZHH 1NFIA 3C5JB 4I5BA 4N0RA 1DANT 4OZIA 4NN6C 1T5XB 4ISVB 3WBDA 1KFAH 4WVRA 5IVXB 1ADQA 3JUZA 4HQQH 4OQTL 1UVQB 1MJ7H 4P46A 3IDMA 5B22A 4TOYH 3GKZA 4CVZA 4HPYH 1TZGL 3AREB 2H45A 1IKFL 4PIRF 1AO7A 3WKNA 5FO8A 1L7IL 1EO8H 1PY4A 1BD2B 1Z9SA 4KKNA 4OI9A 3QRGH 4AT6B 1U3HD 3NIFE 4KUCD 1RUQH 1QVOB 3VFTB 5DK2A 3ZTJH 2CKBH 4WNQA 2Z31C 4KJQD 3ARUA 5IEKA 1C16B 5J6GB 4K3EH 4PP2A 5EU6B 1MREL 4WO4B 4D0CB 3TP4A 1L0QA 5H2BB 5IHZB 3SGDI 2DICA 1IQWH 2HT2D 5KS9F 5LVEA 3SCMA 5SWZD 1T0MA 5J6HA 1HXYA 3NCYS 2PNDA 3DETD 5FA3B 2FO4A 2MKLC 3TCLA 1PX3A 1WT5C 1I9EA 2CLRA 2HFEA 3VG9B 3S6CA 3LD8C 4YE4L 5EWIL 5T5NG 5CUSL 3VXSA 4Z76A 3MYZA 1WBXB 1UM6L 1BP3B 4JO1L 5D1XC 4I77H 5IROC 5K59F 4EVNA 1A7PH 3MYJA 3HHRB 3GMLB 4XNXH 3VXPA 3A6CL 2A1WL 3ARED 1YN6B 3NIGF 5E5UB 4W68A 2UVEA 1WISA 5J1SC 1NC4B 4H1LH 4U3XA 3MLRL 1A3RL 1BD2D 1DZBA 3PP4H 2OL3B 3QO0A 4QGYA 2ED7A 3BW9B 1C7SA 5F71A 3B8YA 3QISA 4I9WE 5GSVB 4DAGL 4KJWD 3MO1A 1EEYB 1YPZE 4LP5A 2WANA 4IIQB 5I74C 5FIEA 2X4RB 3UTOA 4NM8L 1GOHA 4K2UH 5EU6D 4HMEA 4WO4D 2DLIA 2CUMA 3ECBB 4NQTA 3VH8A 1JNHA 5CD5D 1I9JH 4MNHA 2C7UB 4CU8A 3CZJA 4NHCL 2Q6WA 3GSRB 3MUZ1 1V7ML 4XZUA 3T0AA 4ZO7A 5E9DE 1MCOL 4WU5A 3ZYIA 2GY7B 1JK8B 2D7TH 2Q86B 5E2UL 1S5HB 3PXHA 3CFCL 2EYSA 3MCG1 3O3EA 3SBWC 5KSVA 4FQ2L 1U6AL 5DMJB 5A3IC 5DJZA 3WD5H 5ICXA 4TPRL 5K9QI 5D96B 2R1WB 5B8CB 2BCKB 1CYGA 1S7SA 4KKCC 3QEQB 4OT1H 1NFDB 4YC2B 3VGGA 5I8CA 5GS0H 4JFFE 4LAJH 4PG2C 3P30H 1J8KA 4XPHL 1N6VA 5MENB 2ZG1A 3BN3B 3KR3L 1MCPH 1K8IB 3CDFA 8FABB 1BMGA 3RU8L 1HHJB 4JFEB 3MNWB 3V5HB 1HZHL 3MRQA 5HHMB 1LP9F 1KFAL 5LXGH 3S9DB 5AEAA 3D0LA 4JZOB 3MJ8B 3OKKA 4HQQL 1WCBB 5IKCB 1MJ7L 3GSWA 1CE6A 3R06A 4JREC 3HPJA 4G8GE 4TOYL 5E2VH 3X11B 4HPYL 2UY6A 4NFDA 2E9JA 2EKJA 1VACB 2K7QA 4G5ZH 4X4YB 5D8JH 1ULVA 3TBYA 2J8UA 3GK8H 1EO8L 3FB6A 3MLSH 3W0WB 1J8HA 4N0UA 4RQQA 3QRGL 4TN9A 3FB7B 2IMMA 3WJLA 1DJSA 3X3GH 2CKBL 4D2NA 1KG0B 2HJFA 1DUYB 4QRQA 2VIRB 3FO1A 3UBXB 4J3TA 4D8PB 4G6JH 2ARJA 4K3EL 1G1YA 1Q9OB 5D93C 1JP5A 3QEQD 4HS6B 1IQWL 4LLWA 4O51A 1F00I 5MEND 1UADC 1L6ZA 2HTKC 1MCHA 3RWEB 2R2EA 3GJFA 3D0VB 4JFED 4GW5A 2Y7QB 1U0QA 5CGYC 5HHMD 5TE4H 4PRBB 5EZJB 1IGIL 4F3FB 2AJUH 1H3XA 3QXDB 2NW2B 2PXYA 1J1OH 4GUPB 4OGXH 1V7NH 3MRPA 5IV2A 2NNAB 3NFPB 5FYKE 1FO0H 4I77L 1T83C 2W65A 4Z6AT 1A7PL 4NO5A 4LARH 4H0HB 1EFXA 1MHCA 2PETA 2Q3ZA 4QRSB 3BOVA 5TJWK 1JZ8A 3QUYA 5F9OL 3W9DA 3PP4L 3W0WD 1LK2B 4L4VE 4MJ6A 3GO1H 4Q58C 5D2LF 5BMFH 4AQ1B 1JE6A 5EFIB 2J3SA 4PBVC 5E2TH 5K9OB 3QCUH 1VKXB 2VAAB 1OP3H 3CMOH 4K2UL 5GPRA 1CLCA 2UZYB 2ICWA 3TN0D 4ELME 5EUOB 1I9JL 5C0BE 5M95B 5K93A 4GAJL 1H5BB 3CLFH 4QRPA 1NMBH 3MBEA 1INEH 4LVNB 4XPTH 4XX1G 2A83B 2D7TL 3QUMA 4AEIH 5IGXH 4PGCA 4PJCB 3KYOA 1G0DA 1I7UB 3TFKC 3BZDA 4KZEH 3RUGE 3WD5L 4GFTB 4NZUL 3G6JB 1XF1A 4OT1L 4FQXC 1RJYB 1E4JA 3V6BR 5GS0L 3TIDB 1S9YA 2Q20A 3WIIL 3P30L 4NN5B 1SJEB 1MCPL 2QQNH 1FZJB 3KPRA 2WAHA 4S1SH 3RBGA 4JZJC 1PKQA 3CSGA 5GHWH 5LXGL 3HI1A 4HEPG 2H2PD 3HZYB 3FQTB 1KPRA 3B9VA 3VDCA 5E2VL 2Z91B 3V0VA 2BNQE 4FMFA 4OKDA 3DTXB 3LIZH 5DLMH 4G5ZL 4GS7B 2OLDA 1PSKH 2NZ9C 4X9FA 1S9XB 2CDEB 5D8JL 3S7GA 2QV2A 4X0KB 3GK8L 3MLSL 1PBYA 3ULUE 3DOSA 3X3GL 4PJIA 4TUOB 1MF2L 3HE7B 3P4MB 1RU9H 1BVLB 3QWRD 4NYLA 1X5IA 4JY6B 4LVEA 2BSRB 4TSBH 4AL8H 5BV7H 5LCVH 3S37H 4G6JL 5DFVD 4HKJA 3QQ4B 1IEAA 4MCYA 3T0EA 3RWFA 4HCRH 1XR9B 2R23A 3CNKA 3KVQA 4L1DA 2O5XH 1WBZB 3VJ6A 1ZT1B 2CO7B 4Y5XB 1MRDH 1AR1D 1U8IB 5FV2A 2XYCA 4OCMC 5EBMA 5TE4L 3ULVD 2PO6D 1CCZA 43C9B 2JCCA 2AJUL 4JGJA 1J1OL 4OGXL 4M7LH 5F3HA 4F9PA 2DQEH 3M1BA 2X9XA 2J5LC 4I18C 3QUXB 3BPLB 3ARBA 3WIHH 3O41B 4LARL 5MEQA 3TNNA 2GJ6D 1IEBB 1NAMA 4MXWL 1TVDA 3G9VA 4HUWB 1EHXA 4OZHF 3OKMA 3QWQB 1BAFH 3QULB 5DRXB 4EXPX 3G5VA 1JF5A 1CG9B 1S9WA 3GO1L 1FFPB 5BMFL 2D31A 5FYKU 4LVHB 3HE7D 4PB0L 3O6KH 2OTUB 2HKHH 5E2TL 2H9GB 3QCUL 2KPNA 4WFGE 5C9KA 3CMOL 1X5FA 3CXHK 3ARDA 4L8DB 2C1OB 2XA3A 2NLJA 2HMIC 3B2VH 2IH1A 1T22A 3CLFL 2JJWA 2R0KH 1JF6A 2R2HB 5JHDE 1NMBL 3IDNA 1I75A 3PWLB 1INEL 1YJDH 4XPTL 5E4IA 2GUOA 5E94B 2XWJA 5TDPB 5KSAA 1V3JA 2NZIA 3IDYB 2P8PB 4AEIL 3N1MC 5IGXL 1TFHA 1Q9KB 3F6IA 5C0CE 4XP5H 3C5ZB 5HGDB 3QEGL 4KZEL 2O93L 5IEHB 5EO9B 3A6BH 5EC1B 4DW2H 3QUXD 5LAXB 4BQ9A 1NC2A 2DL9A 3J8F7 5HYIA 4S1RH 3M45A 5IBLC 3E6FA 4PJBB 5EU4B 2QQNL 4IRSC 4RAHA 4TRPH 3U0PA 4M1CC 1EAPB 1HN1A 1F11A 4S1SL 3NFSH 1NBZA 2V5MA 3QQ9D 1OPGH 4XCYB 5GHWL 5FYLD 4OSUH 1RPQA 5CJXC 4U4BA 2PTTB 2IPTH 3HTLX 1VB9A 5EO0A 4YHNB 2CSPA 3PUCA 3C5SB 1D5BA 4UBDD 1I8LC 4ONHA 2E7LC 2W0LA 3PGDA 4HKBB 3CZFA 3SDAC 4JZNA 2DS4A 2XN9E 5DLML 3LIZL 5AAWA 1PSKL 4QF1A 2VZOA 2FYYA 4XHJC 4YGAB 1DUZB 3LS4H 1T1XB 3JWOL 1MHPH 4J3OC 4ORZC 1Y18B 1YNTA 5DD1H 1RU9L 4AL8L 4TSBL 5TQ2H 3GMMA 3S37L 5L8LB 3V6OC 3AB0B 4LDOB 5FDYA 4HAFA 5JPMB 1VADB 1IAIH 1BJ1J 5GGTA 4HCRL 4QRUA 5INDA 4XVSH 5K9KB 3REVB 3EW3B 3WNNA 4V1DE 4B5EA 2O5XL 3BI9X 2HTLD 3L6FA 1AKJB 1ZXQA 1MRDL 5E1HB 4O2CA 1A02N 4Y4HB 3F12A 3WHXB 1ROWA 4NCC2 3FFCB 3QDJB 4FQHA 3D1MC 3T3ME 3OZ9H 1F6LL 1MFEH 1QUNA 4HUUB 4M7LL 1RMFH 1F6AB 2DQEL 3OKLB 3HC0B 3RL1B 1D5IH 2RQ8A 1R3KB 3U46B 3WIHL 5D6DC 3DURA 2UWEB 4PJ9C 4FQIH 5E08H 3CU1A 3WO3B 3BPNC 1PG7W 4LSUH 4UAOC 3WUWG 2HAZA 2XWBB 3GSVA 4ZO8A 1BAFL 1EBPA 1BWMA 1NLBH 3VXUB 5AD0B 1F3DH 4KI5C 4R96B 3TIEB 3SDCC 4CW1A 1JGDA 3O6KL 1SM3H 2HKHL 5LWYH 2RCSH 5D1QD 3ULVF 3EDKA 4IEFB 4MYWB 3ILQD 3PWPB 4Q9BA 1A1NB 3KPTA 2NPLX 2H26A 3KPMA 4U1HA 5ESAA 2XT1B 3T4YA 2SEBB 2AKRA 3B2VL 3CVIH 2CKBB 2R0KL 3BP6B 4OFYA 3L3IB 1HH9A 4BFIA 4ZSOA 1YEFH 2ICWJ 1AKJD 1YJDL 3NPZB 4EOWH 4BUGA 2N7BA 2G75A 5CZXD 5F6IB 4XP5L 3OKEA 1NPUA 3ULSA 1U95B 3A6BL 3VD4A 1R3HB 4DW2L 1T7WA 2VXUL 4L8SC 2JB6B 4S1RL 1CTNA 4MQ7A 2GSGA 4RAUB 4X5LA 4TRPL 4X4ME 4PGDA 4WU7B 3NFSL 3VXUD 1S7XA 3F7VB 1OPGL 2H3NB 1MCLA 1I1AA 4OSUL 4JFOA 1TVBA 4EKXA 2IWGA