5AYUH

Crystal structure of hyhel-10 fv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Crystal structure of HyHEL-10 Fv
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ayuH00
3CXHJ 3X12A 2VTFA 5C0BA 3MREA 1WBZB 1FNLA 4QYOA 3BD4A 4RFNB 1K5NA 4LSQL 4X4MA 1KJ3H 4G43B 4PJDE 2B7DT 2F54B 1C16A 5F7LB 2HMID 5EUOA 5T5NF 2OI9C 1CQKA 3QNYA 3QUZA 3RI5F 4Y2DC 5A3ID 1MJ8L 3OBAA 1F58L 3FQWB 3W0WB 2FBOJ 2ADIB 4XP1H 2YPVL 4NIKB 1JP5A 1ADQL 4B0MM 2QSCH 5L2KD 4M3JA 3TV3H 1BQHG 4F7CA 1U8LA 1HQRA 2NW2B 2D03H 3VXTB 4KV5F 1I4FA 4Y2DD 1U8OA 3J7HA 4HF5L 4OCYL 1E27B 1CG9A 3CC5B 1SJHB 2R23A 4L8SC 4WFGE 4G42A 4KKAC 4ODWB 1LK3L 4EEEA 4JKMA 4CU7A 5E6IB 4LLYA 1N26A 1CCZA 3RX7A 3MV7E 2WBWB 3MLXH 4H88L 2AV1B 4KKAD 4RGMB 1OTSC 4Y2OA 5E7FA 3E8UL 3O41B 1PG7W 2R0ZL 3Q5YA 1U0QA 3ES6A 3RL2A 4GOSA 5HVWA 5EUKA 2OTUA 1AC0A 1WFTA 1HKFA 4RFEB 3QI9A 5JNYB 4M9PA 2QJDA 1M6OB 4PJIA 3C8KA 2VZ3A 4RISH 1OTSD 2IH1B 1CTNA 1S7TA 4F37F 4CVUA 4QRTB 3DI3B 1HOCB 3VFRB 1HHGA 2CKNA 2Y5EA 1N7MH 4HS8L 2X4NA 1DEEB 3OJVC 3OGCB 1F00I 4PJ9D 1DQTA 1KTLA 4PV8A 1FNSH 2UUDH 1HK6A 5GRJL 5SWZD 4OZHE 4BUGA 2P8MB 2RIKA 3QXDA 3GIVB 3JVGA 5A2LH 5HY9B 2FX9L 1KJVA 4IS6B 3Q1SL 5C09D 2ORBL 5CZXC 1QUNA 3V0VA 3ARTA 4XCNB 1FO0B 4NO3A 3F8UB 1JWUA 3DO3A 3ARUA 3IFLL 3G08A 2X9XA 3FB7A 4KKCC 3FQTA 3OXRA 3OR7A 4QHNA 5CZXD 4D9RE 1IAIH 4HFUH 3SE9H 1OY3B 4WFFD 2LQRA 3U0TB 1MFCH 4X6DE 3RWJB 2VLJE 2OBGA 5HJ3A 5IR1A 3FT2A 4WFHE 3RPIB 1GSMA 3H3BC 4KKCD 3IDYC 5CSZA 4LIQL 1A4KB 2DI9A 2NXYC 3S88L 3BEWA 1D5XA 4I77H 4LHUA 1I9RH 2APBA 3VD3A 5JOFA 4HUVA 5BS0B 3BPCA 2GY5A 3ARGA 4JFYB 1WEJH 4N8VA 3WCYA 1B9ZA 3R0NA 1PX3A 4L9LC 1MCPH 3AUVA 2EH7L 4W4OA 3L7FA 4XP6L 2NXYD 2C3XA 4HJGA 4JR9H 4JM4L 1RJYA 1BPVA 4RMVA 2E5EA 2A6DA 4HWBL 3FO0L 5HYJE 3RGVD 5DK0A 3RTQC 3WIFB 2NR6C 1JPTH 2YK1H 5E00A 3IKKA 1RIHH 3DRQB 3L3GA 2CDEA 2HA1A 4QCIA 4WW2B 5EBGA 1JE6A 5J13B 1NGQH 1DLHB 3MMEA 1F3JA 1KJ2A 2XN9B 3OR6B 2B1HL 2JIXB 4KJWC 3RTQD 3SPVB 2NR6D 1RUQH 1BJMA 2VDLH 4K3DH 1M05B 5D9SA 3DI2B 3OZ9H 2IBGA 4MNGA 4L29A 3ARRA 1N2RA 3T1FA 4GKSB 4WJ5B 1O7VA 1P7QB 4LSDA 4NQEA 4APQC 1IGIH 4DZBB 4HS3B 3SCMB 3SDDB 2L0DA 1MCEA 4KJWD 5HXMA 4M7JH 1WWWX 1PY9A 1SJXA 1Q9OA 3QG7L 2APXA 4FQCH 1T4KB 1K3ZA 2CLVA 3AM8C 1FGVL 3BH8A 1A0QH 2ZUSA 4LEXL 5D4QA 2GJ6A 3DVNB 4OTXH 3CSGA 5ANMB 2R1XB 2WLZA 1UZ8B 2AXFA 2IAMB 5E2WL 1OM3H 3VXRD 2Q3AA 1IJ9A 1ND0A 4P4KD 5FYKD 3FONB 2QV2A 5DVLA 4J4PA 5GGQH 3VW3H 1ZLUH 3I3EA 3BI9X 2W9EH 5HGHA 2VLME 3VRIA 3UBXI 3IDXL 3T4AA 4HXAH 1NBZB 5D96B 1PW3A 2F19L 4PRHD 2WMPA 4NKDA 3ESVF 1XH3A 3KS0J 3QH3A 4GRWB 5CGYC 3VFOB 1N5YL 1RK1A 5HHME 4L8CA 3K8MA 4JE4B 4NZTL 1IZKA 1MCJA 2WANA 3V6FA 2V7NB 5C0DB 1PZUB 1SY6H 4NUJB 1Q8MA 3NN8A 3MUGA 1JPFA 1F2QA 5CGYD 5GS1A 3DX6B 4Q74A 1NMCC 2E8ZA 1T5XA 1TZIB 5GGVL 3HPLB 4BH8B 4PG2A 2HJLB 5E2TL 2IPTH 5C0RL 1I9JL 1ONQB 3SE8L 4BH7B 4AIOA 2GSGA 4D0DB 5KS9A 4Q9RH 1JF5A 3OB0H 4DVRH 1CL7L 5DD3H 2FX8L 2GTWA 2IQAB 5DUBA 4M4RA 4I5BB 3KPSA 1MI5E 5ITFB 3MJ9L 4EN3A 1HEZB 1HNGA 2PW2A 1EGJL 3OAYH 3TO2B 43CAB 4KDVA 3PL6A 1OWRM 3SGJC 4NQCE 4AENB 4LNVA 5IQ7H 2WNGA 4PUBL 2RR3A 5DJ2B 4PJHE 4G7YL 3DO7A 4P9ML 3E0GA 4PJGB 4XRCA 3SO5A 2DTML 4KZEL 4RZCB 5CFHA 5DTFB 3K4AA 4LKCB 1U93B 1G6VK 5EWIL 5DGRA 2IBZY 4LSRL 3UC0L 4XZUB 3ZTJG 2ADJA 1NFKA 4OLZH 1U8MB 1QA9B 3GHBL 1EEYB 1QBAA 3TH3T 1IGTA 2WP3O 4KKLC 3SE3A 3FFCB 3CLFL 1JF1A 5E8NA 1QBLH 5E95B 4A2LA 3QUYA 1RZFL 2ESVD 1UKQA 4RCAA 4TSBL 1KB9J 3CFJB 1KCLA 3JSSA 2EKSA 3V6ZB 3GFUA 5LGJA 4KKLD 5IKCB 4P57A 1HH9A 4I3GA 1CXFA 4Y4FB 4PJBE 8FABB 1KXVC 4HIJA 4Y0GA 3H7BB 5FOBA 2R0LL 4WI2A 2F8XC 1AQDB 1SJEB 1XGRB 1AE6L 3X13B 1L7IH 5IFJA 4P5MA 2DQTH 4CN1A 1ZT1A 2I5YH 4J8RA 1J88A 1LO2H 3D85B 1UH4A 3P4MB 4QOKB 4CGTA 4F58L 5CBEB 1K9TA 4TQEH 1Z2KA 2AAVA 2MQ3A 5B38B 2HP4A 3B2UC 2OJEB 5E5RB 3QQNA 3QNZB 1Z9MA 3O11B 5EH1A 1J5OH 1DBBL 1FL6B 4OD2B 5ACMA 3TZVC 1ED3A 4LSSL 3PHQA 4OFKA 3UTSE 4JJHA 5L2KA 4EDXB 5GRYA 1WC7B 5JA8B 3B2UD 3QZWG 4YGVB 2A6IA 5IW1B 1UJ3A 4PJHF 4Y2DA 3MCLL 3K4ZA 4PJAB 3EO0B 1TTGA 3ARBD 4ONHB 3CVHB 1L4IA 1KACB 4PJCB 3OKDB 4KWUA 4ODTH 2X70B 4W4NA 2MJWA 5D5MB 2H6PB 3JV6B 2FGWL 3BT2H 1R3KA 5TQ2H 2HT3C 3MV8B 1NFDB 5E4EC 5DT1L 2E7LA 1F42A 4NWUL 2PKDA 1QSEB 2NQCA 1A02N 2AK1H 3ZKMC 2OTWA 3JV5A 4L8SA 2FH6A 2V2WA 3NCJL 4C57C 1F6LL 4W81A 3RVXC 1WZMA 2BNRD 3KS0H 5EU7E 3KDMA 4OZFA 5C0FB 5EU3A 3LKSB 1J1PL 4PJGE 2LFGA 5LG1A 3ZKMD 2R69L 1QFWI 3PV7A 3I85A 5H94A 4QWWD 4H1LA 4CMHB 2V2XA 3IJHA 3RVXD 5C0NC 4PJBF 4MAYD 2Q86A 3L95B 1XGUA 1QHPA 3QUMA 3CAFA 3KPLA 3PWJB 4GKZB 2CK0H 5CEZD 3HE6B 3FFCE 4HUKB 4ZPTA 4YC2B 2AI0L 3S35X 3U1SH 4PJ9A 5I8OH 3BVNA 4NRZB 5SWZA 4X9GA 2R2HA 2G75B 5JMRA 3U7YL 3U6RB 4JZNB 4IMLA 5C09A 3V52H 1MELA 5I1DA 2MQCA 4KTEH 4XC1H 1RJZA 1XGTB 1NSNL 3A67L 4OAWA 5GISH 1BD2D 3MCG1 3WLBB 2CMRH 3CU1A 2FHCA 5GSRA 2ITDB 1YNLH 2GUOB 1MY7A 4PD4K 5EZIL 4F7TB 3P0YH 1WWBX 3N85L 5BVPH 1HH6A 3IGAB 3V5KA 4ODSH 2VQ1A 3IU3A 4Q58C 1EV2E 3MJGX 3GZKA 2Y07H 3BKMH 4QOKE 3K4DA 5LGHH 5I74B 3RWIB 1IQDB 4WGVB 3T77B 1OVZA 2X40A 1V7NH 5FKAB 4PP2A 4JN2A 2A2QT 3MRMB 5J6HB 1D6VH 4FQJH 2DKSA 5I1AB 4H25B 4PJ7A 4LLDA 5IQ9B 4HULB 2VYRE 3QO1A 4DKFL 4KXZH 4OF3A 4PJ5E 4YEEA 4LVHC 3GHEL 2DQGH 2DDQH 2F15A 1NGZA 2J3SA 3BE1H 5INCB 1IQWH 4PJAE 3VJ6B 4X4YA 4PJCE 3RGVA 4L9LA 3H9HB 4NOBA 5C8JB 3EOYG 4QHUA 1HXMB 1N8ZA 1NFDE 3EFFB 4XP9H 4N0FB 3WJLC 5DRZA 4N9OB 2DM3A 3BDYH 3BP7A 4WI9A 4K8RD 5LGKA 2HFGH 1NJ9B 2NPLX 3WFDL 4HHAB 3KYOA 5GRUL 1KG0A 2ZCLH 4HCRL 3LPFA 1FG2B 5D8JL 3IVKB 1H3PL 3BKCL 1FL3B 1A7BA 3ULVE 1MCLA 1YEGH 4P3DA 4HKZA 4JKPH 2BVPB 4XB8A 1WIOA 1JRHL 3GBML 2ZWLT 4MJ5B 2XXCB 3BMWA 4WW1A 3TA3B 4YBQC 1AH1A 3OGOE 2FD6L 1Q9KA 4KPHH 5HHPA 4X4XA 1AGBB 3F7VB 3F5WB 3GI8L 3BN9C 3HZMB 1WBYA 2I60H 1LNUB 1KBGL 2ADFH 4PRDA 3TLRA 4OZIE 1MQ8A 4Z5RB 4X6EA 4YBQD 4P5TB 4U7KA 3VXRA 3DX9B 4AMKL 3EYOA 4P4KA 2E9JA 1NUNB 2CGRL 4K3EH 5INDB 1SVZA 2HG5A 3ULSB 4XC3L 3LQZB 3BN9D 1MVUB 4OGAC 3AM8A 1MFBL 3NA4A 4F3FB 2ZSVB 4EBQL 5GJTH 4PRHA 3VCLB 1TZHB 3BO8A 1T21B 3DVGB 4OGAD 1FV1A 1YJDC 2YD6A 2V5YA 3BUYB 3PV6B 4A2MA 3WNKA 5GRZA 3TIEB 3I75A 3L3HB 4RRPA 1JNNL 3QPXH 4X9FA 1RI8A 3MYJA 2WM0A 2EIZB 1QQDB 4JFDD 4UNTA 4JO1H 2C26A 3VGBA 1J0JA 4CN4A 4Q6IB 4NJAL 3E6HB 1P7HL 5I71C 3HC3L 5FYJE 5D1QC 3SGDI 1O0VA 1GZPB 3V6OE 3NZ8A 1NFDF 4UMGA 2D9CA 4LPCA 4YO0A 5SWSE 4PTUB 2QKIB 3E6FB 3ZKNC 4M6OL 1NGXB 5IVXE 5D6DC 4XCYB 5D1QD 1F90L 3ZT7A 3VGEA 3ULVF 1QRND 4HBCL 4OCNC 2NTFA 3KYNA 3HUJA 3EDKA 4X6BA 1DDHB 2BVOB 1YECL 3DGCR 2FX7H 4UILH 3H9SB 2H26A 4K2UL 1FZMA 5IBUG 1OAYL 1G0XA 1NBYB 3MLSL 4LU5L 1KCVL 5C0AD 1AXSA 4WY7H 5IESL 1CXKA 1TVHB 1JWSB 5DHVH 3SKMB 5I1KH 1ZXQA 4GJTB 1DQML 3UTPE 1Q9WA 4YFLF 3DSFH 4OZIF 2R2EB 4HGWB 3UBXA 1DANU 4X5WB 4GRLB 4U6YA 5DRWA 3O2DA 3FZUD 4U1MA 3VXQA 1YN7B 5DQDH 1CXLA 1IL1A 4Y8AA 4U1JA 4PRNB 5CBAA 5HDQL 2ESVA 4JHWL 5EULV 5J12B 3I84A 2F58L 3DVIA 5E2VL 5DD1L 5DJCA 1OW0C 4DVBA 4Z7OE 1VKXA 1HHJB 3IJYA 1HWGB 2WBJC 3ORJA 4ZUUB 1N64L 2XY1A 1TCRB 5JIKA 4UV7L 4OM1L 3L1OL 4KI1A 1K4CB 4L5FH 4YUEL 3V7MA 2BVUA 2DWDA 3U30B 5HYSG 2WBJD 1CDGA 1NLDH 3FO2A 3HC0B 4EI5C 5MENE 4UIKH 2J8UE 4L4VB 1EERB 3IXAA 2FEDC 4U7MA 1Y18B 2IPKA 3FQRA 2AABH 3RKPA 3O8XB 5IVXF 5IF0A 3PWLA 2ZZUT 3ZL4H 1FVEB 4GXUN 2PETA 2EDEA 1T1YB 1KELH 4XNMA 2W0FB 5ESVA 1ZA6B 3QJHA 1FVDA 1A7QL 5F71A 1JHLL 4FQLL 4LASH 3ARBA 5H37H 5FUCE 3GIZH 3N0PB 4FRWA 4M93B 4YDKL 5AZ2H 3JWOC 5HBBA 3LV3A 1CIDA 1Y6NR 3Q3GA 1PY4A 4UUJA 1KN2H 2D7TH 3OKEA 2OCFD 2CPCA 2IGFL 2E9IA 5CP3H 3TN0C 4V2BA 2ZUWA 4PG9A 2DIAA 4XNYH 1H9VA 2BNRA 2FIKA 1FL5B 3NCYS 3H3PL 4OUOA 1QNZH 3WIIL 1DQLL 5FUZH 4O58H 3QXWA 5F8QC 5HI3D 4TN9A 3VDCA 4Z7OF 4O00A 1NCUA 4RWHA 1NBVL 4G6AC 5C92A 2VDNH 5CP7B 1MCBA 3KLHC 1R3HA 1RZKH 4TULL 1I7TB 4IOIA 1MIML 4JFXB 3L3IA 2F5AL 4QKXB 4MAYA 1X44A 3GRWA 2EICA 3PABA 1KYOJ 4QY8B 4Y4HB 2LVEA 4OZGF 3PWVA 2MOVA 5GS2H 1KFAH 2YC1A 3BDBA 5T3ZH 1JZ5A 1ZT4A 3OKNA 1G7MA 2FL5B 4CKVX 2RHEA 3KYMB 5DJYB 1G6RH 1T0NB 2J8UF 4JDTL 1A6AA 3KLSA 3P73B 4KH2A 3UP1A 1KIQB 1YZZA 4R3SB 1ZHKB 4MA7L 3VI4F 4AJ0A 5HPMB 1INDH 2HFEB 1XIWC 4YHKH 4BQCA 3DV6B 1R3JA 1YEJL 3QXAA 4MCZB 1BD2A 3ZDYF 4R97B 3LRGA 1OPGH 1TZGH 3P4LA 5D6CB 5BVJA 2DLEA 5FO8A 3F65A 5IIEA 3T04D 1CDBA 1EH9A 1XIWD 3C6LB 1IGYB 4M00A 4JPWL 4PY7A 5GXBB 5EFIB 3BZEB 4YXLH 2NY3B 1A14L 4KTYA 1NCAH 1PQZA 4WI4A 2CXGA 4K7FB 3ARPA 1FN4B 5IMMA 2XWJB 1MFEL 3G5VA 5GGUB 4O02L 4PB9L 2YRLA 1RZJH 1S7WB 3FTGA 3RI5K 4UDUA 4I9WE 3HCVB 4MNQB 4V1DE 4DUXA 1N4XL 1BECA 5D2NB 4ESKA 4OD1L 5D7JB 4I2XE 2MHAB 4JKWA 1RMFL 1EO8L 2P5ED 4LARH 4M4PA 1REIA 1G7LB 1K2DB 4NP4H 3ZE2F 5KSAD 2RJMA 3EJZD 1OOAA 1AR2A 1BVKB 4K94C 1HWHB 5KVGL 4JO3H 1P7KB 1HN1A 2FECL 1N59B 3WN5B 5DMJB 5JW4M 2VL5A 1B0RB 3D9AH 4MQ7A 5I19L 1IM9D 1FRGL 4GG6E 4JCMA 1J7VR 4PJ8C 3RVWC 4NRXB 3AS1A 4ZPVA 2NMSA 4JEGB 2HKFH 2A73B 4ZSOA 1IMHC 1AGDB 5JQHC 1CWVA 5MERA 3WJLA 4Z7UA 2BMKA 3E3QC 3SQOH 2YSSA 3OQ3B 4PJ8D 5CWSA 4WUKH 5DSCA 3FOLB 3RVWD 4BFIB 1M4KA 3KPQA 3LAFA 3L5IA 3OAUL 3DUHA 2ADGB 1FFOB 2UWEE 2IJ0C 4NKIL 3NGBC 4L4TB 2ATPA 4F37K 4F57L 3TYGL 4KGLA 5IVNA 4NCDA 4ZUWB 1XCTA 2UZXB 3T0VA 5HHNA 2O5ZL 2J4WH 1W0VB 4OSUH 5KVFH 7CGTA 4PGBB 4YDLB 5LXGH 4OCMC 2BOBB 4HSQA 4OCWL 3LKRB 4NC2B 2P44B 3R06B 4X0KB 2GITB 1X5AA 5HHOD 1S7UA 4ZXBB 2Y7QB 4JN1H 2AJSH 1RURL 1A4JB 5DC9B 3NTCL 1U3HC 4JAMA 5JORA 1GIGH 1T89C 4HMDA 4TYUA 4IIQC 3SDXA 5IOPB 3MGOA 5TDPB 4XXDB 1GC1C 1MWAL 1XCQB 5DI8B 1OP5H 1RZ8A 4WI8A 5GHWH 1P6AB 3CLEL 1D5BA 5DMIH 4OCRH 1FNGA 1QR4A 2XNAA 5SX5K 2A9NH 4Y8DC 4JFDA 3NCFB 1U3HD 4KKNA 4D9LH 4ZTOL 3QDAA 3VWJD 5KZCB 2Q8BL 1NUGA 4R8WL 3IF1B 1TLKA 4KK9C 4RGMC 1OGAB 4FQHB 3TWCH 4ELKA 3SJVB 2B1AH 5A2KH 3EOTL 5ALBL 3DGGA 4GG6F 5DC4B 4M61B 1FBIH 1MFAL 2SEBA 5EBLB 4I3SH 5FA4B 2Q3ZA 1EK3A 3KWWA 1URLA 2ZPKH 3O45B 4BQ9A 3PP4H 4X80H 5CILL 1MREL 5D1QA 2ZUQC 3QDMD 4RFOL 5IB1A 4KK9D 2YRZA 4AT6A 2HFFB 1CF8L 1QRNA 5IVOA 1GJIA 3ILPA 4ZFOA 1WV7T 3QB7C 1YPZA 4X5XA 4JZJC 1T03H 1H5BB 1AXTL 2LTQC 4K55A 4MAUL 4PR5A 4D0CA 5LCVH 3MCKB 1KGCE 5C0AA 4RGOH 2F8OA 2OZ4L 4HX1B 5FDWB 2UWEF 2GK0A 4LCYA 3UTOA 3MUHL 1IM3A 2NTSP 4XVJH 1FGNL 3SO3C 4I3RL 4QRRE 5F3HA 1DEDA 3ELAT 5ICXB 5BZDA 2R56H 4FFZH 3VXUE 5JDJA 4OGXH 4AYFA 4OM0L 5EZJB 1P1ZA 3GBLA 4HZLA 4XPTH 3S3JA 4GMSL 2OLDA 5DYOB 2ARJQ 3SDCB 3MRNB 1F8TL 3GJEB 4J3TA 3ECBB 3HFML 3QEHB 3RX8A 3HLAB 1M71B 1KTRL 4L4TE 4YQXH 3QCVL 3QG6B 4DEPB 1UVQA 1J0HA 2LU7A 5BJTA 1OW0A 4GRMA 5DJDA 3ARSA 4LVNB 3MBXH 1QFUH 5A2IH 1JNLH 3TJHC 5ABDE 4L8BB 4U33A 5GSVA 2WBJA 4DN4L 4O2FB 5HGDB 1S9YA 4NWTL 4KC3B 1HHHA 2H1PL 2NXZB 3O9WB 4IRSB 5TDOB 1IC4L 5DJ8B 4KFZC 1HSBB 4X7TA 5E8DH 1AI1L 5DJAB 2P5WB 3QEQB 3VRLE 2EYSB 4OLUL 2FHFA 2QR0B 3WNMA 3ULVL 2P7TB 4KTDH 1FE8H 2EDWA 4WW2C 3VXOB 5CLWA 4G6KL 5J13C 3T8XA 3DROA 4HK0B 4S1QH 4AL8L 1G0DA 2VZVA 3LKOA 2F53E 3MV01 1LP9B 1YC8A 2YZ8A 4OCSL 4M7LH 4RDQG 5JOEA 3KPMA 5I1IH 5BZWA 2IADB 2VE6B 3UTQB 2XWBB 1GZQB 1I8IA 5HVHB 5K9KB 1X7QB 1PD6A 2H9GB 4N8PA 5F7EL 3V4UH 4XPAL 1UM4H 4CU6A 1A3LL 1S8DB 5D7LD 4AEIH 2O5XH 4PJEB 3VFGH 4LSPH 2NY5C 2Y25A 2LU3A 3SDDC 3GJFA 4R7NA 2I9TB 5IK3B 4LMQE 1VGKB 4V2CB 4JFED 4XI5D 2Y06L 4E0RB 3TBWB 5I76B 5IW3A 3HE7B 4EIZC 5IHZA 1LK2A 4OLXH 3QP3A 4TOYL 3PGFL 4CVXB 5I0ZA 4OJFH 4ZYKB 4KRNA 4JRYD 3FRPA 4P23C 4Z0XB 3T0ED 3WD5H 2YPKA 2WINA 5TF0A 4PBVC 1C5BL 3QQ4B 1WZ1L 5AAWA 1Y0LA 3PP3K 1NQBA 2HLAA 1G7IA 4FZ8H 1F6AB 1G7PB 4KU1A 1J8HE 1KNOA 1NC4B 4P23D 2VN4A 3CDYA 2HVJA 3CFCH 4MQXC 3ZE1E 5H37G 4CADA 3I9GL 5L0QB 5I1EL 3EDEA 5M94B 5ITBH 5FYJL 1X5KA 5L7XH 4UT7L 1CE6A 4WV1C 5GQBA 2NY2B 3OAZH 5EA0L 2W65B 4KJYA 4RA3A 5CHNB 3VXSE 1MRFL 5DHVB 3SKJL 4ORGA 5TFSL 4JO2L 5AZEL 4X5LA 1IFHL 4Z9KB 3VRLF 4YJZL 3MODL 5HYEA 4UTBL 2XRAL 1S5IH 1ZHBB 2C1PB 1I1FB 1BZ9A 2DICA 4X6FA 1FVCA 3C5SA 3DX8A 1I75A 1HHIB 1AKJD 4KY1H 3IDIA 3ZTNH 4HIIA 1T5WA 1MHEA 25C8H 1JVKA 5GGTA 1XIWA 4E5XB 1YMHA 5B21A 3U82B 1L9NA 1I8MA 3BZFA 1KTDA 6FABH 1S9XB 3PWPD 4M1CC 1LEGA 2FJHA 5DMKA 3PGCB 3P4OA 4ONOA 2VC2L 2P5WE 3QEQE 1I7UB 1A6UL 3X3GL 2D03L 1ZLSH 2DMKA 1FLRH 5DURD 3ROOA 3TBSA 3QPQC 5FA3B 4Y5XB 1CFNB 4P2OB 3HZYA 2YBRB 4TTDC 2R0WH 3THMH 4BZ1H 4HXBH 5DMGC 4PPTA 4M1CD 3CSBA 5GJSH 2IANE 3UTTB 2P5EA 5I1GH 2EE6A 1T1XB 1LD9B 4TNVF 4U6XB 1HSAA 5GIRA 1S7XB 5F7WC 3I6LE 5KSAA 4K07A 2CDGA 3U2SA 4I18B 3MLXL 5AUMA 3QPQD 5C07D 3GGWA 4GS7B 4PJEE 5IM7B 5IMKB 3OG4B 2KQMA 1IM9A 3WUWA 4EI6B 5DHYA 4ZMAT 1NKOA 3PWUA 4MJIB 4C56B 3K46A 3BP6A 1OCWH 2HN7B 1LEIA 3LRSA 2Z31C 3C8DA 3WO3B 3ARQA 3V2AR 4RNRB 1JGVH 2PN5A 4RISL 4HIEA 4ISVA 3FKUS 4JO4L 2XA8L 2VXTH 3DUSB 4OLVH 4QXWA 4QGTA 5D7IB 1YY9C 3QFDA 4PJ8A 1JZ3A 1ZE3C 1BFTA 1KIPA 1N7ML 1NUDA 4H1LH 4OKVA 1CD1A 2VXQL 4DAGH 5E9DB 2Z31D 2H32A 4MHHG 1QLFB 1FNSL 1RK0A 3QUMH 4LCCB 2PXYD 3QHFL 1BBJA 5FYLE 3NFSH 1A6VH 1KENH 1YY9D 1OD9A 2AJUH 1UWXH 3QO0B 4MA1B 1P84J 1I3UA 2EE2A 5FOJA 4NN5C 4U1KA 3QIWD 1AQKH 4Z78A 1QLEL 5IB2A 4JFFD 2Z91A 3N06B 4JCLA 3MPCA 1YEIH 3EYUH 4UAOB 3BQUB 3D6GA 4WDIB 1V8HA 5FCUH 4UZGA 5JHDB 3LN5A 2V9RA 4YR6B 4NNXA 5HHOA 1IAIL 1PG7X 2BSTB 1CGSH 3O6LH 4JFOA 1CE1L 1TFHA 1ORQA 1RZ7H 3PGDA 5CJOH 1F4WL 3PXJA 2EIDA 3BAEH 5ECJE 3FN3A 1KT2A 5KSVB 3BKJL 2IQ9L 4J1UB 1NDGB 5CSBA 1D3CA 3P9WB 1G6RB 3LCYA 3QWRD 5TH2B 3ZKXB 1U3HA 1WEJL 3C2SA 3FO1A 5E5MB 2BK8A 3VWJA 3NFPB 4QNPF 1ZS8A 5K9OA 1MCPL 3SOBH 4Z77A 4X6CA 3PQYD 4OD3H 4G8FA 3DYOA 2AVGA 1A21A 4X8JA 4JM2B 1TQCB 4YHIB 4G9FE 4XWOC 4OFVA 4LLWB 3D18A 3CZJA 1JPTL 4W6WB 2YK1L 5EC2A 3QDMA 2Q7YA 3L5JA 3X12B 2G9HA 5C0BB 3MREB 3UTTE 4YAQA 4NRYB 4HJ0D 1F3RB 3D3VD 4QYOB 2LU4A 4JY5H 5HPOA 4EXPX 3VFPA 4WTXA 3HE6C 1EAJA 1C16B 2HAZA 5EUOB 3QNYB 4YC2C 4DFIA 3EYSL 4P3CL 3QUZB 1RUQL 2VDLL 2I25N 2JKXA 4K3DL 2BVYA 3MOQA 3OZ9L 5EDXA 1U95A 5FB8A 4JZJA 4NBYB 1IGIL 4MJIE 1MVFA 1JYVA 4DJMA 1UADC 4F7CB 1U8LB 1HQRB 3GMQA 1I4FB 3GKWL 1IZJA 1U8OB 4M7JL 4U2YA 3RDTB 3MC0A 1CG9B 2GKIA 1CQYA 1RY7B 3BDXA 2R23B 2WK2A 3RWFA 4G42B 4KRMB 3MLZH 5DLML 3ARFC 4OTXL 3QCUL 4LLYB 2Z8VC 4ODVH 5GRWA 5IEKA 1RU9H 2N7AA 4WO4C 3HG1E 1ODAA 1PKQE 5GGQL 4KI5F 3ARFD 4CAGA 3VFNB 4L1DA 5CINH 2W9EL 5E1HB 2FATH 5FYKH 1M7DA 4FN0A 3ES6B 4XBEH 3ZHDA 3RL2B 4HXAL 3S35H 5EUKB 3QULA 2YN3A 4WO4D 3QI9B 3TBYA 4RDQF 4PJIB 3C8KB 2JJSA 3OKKA 5JHDE 4QTIH 2A83A 1S7TB 5AYUH 2EXWD 2VSDA 5FGCB 3WXWL 3PIQA 4I4WA 2ZP0T 2A74A 1HHGB 1EUTA 3NCMA 4Z8FL 1WCBA 5CJ5A 3DVFA 2X4NB 3AB0C 3LEVH 4OF8A 4DGYH 4LLQA 3BPOB 1KTLB 4PV8B 1D6EA 1S3KH 2BY0A 5F1KC 1ZT7A 1BLNA 5GGSA 2O93L 3W9EA 3QXDB 4PP1C 4PRPD 4EQ2A 4PGCA 1KJVB 1UEYA 2IPTL 3V0VB 5I8KH 2E27H 3LVEA 2VISA 4F7MA 1EO7A 1JWUB 5E6ZA 5DJZA 4PP1D 3AS2A 3B83A 3FB7B 3O6FC 2C4XA 1EAPA 3OXRB 2YD5A 3OR7B 3MLWH 4QHNB 1CGWA 2ITCA 1BAFL 3TA3C 3DARA 4GSDH 4JFEA 5HJ3B 5IR1B 3KHQA 4GAYA 4MJ2A 4NZJA 3H7LA 1IGCH 1CICC 3O6FD 4RMRA 3TIDA 1A7NH 4MMZC 3CK0L 4X4ME 3BEWB 5KVDL 1D5XB 4LHUB 3WXVH 3ZT6A 5LQBL 5JOFB 4HUVB 4P5TC 4JRYA 3BPCB 3QUXD 3T0EA 3ARGB 1R5WA 1Z0NA 4N8VB 1A2YA 4U4BA 4UDTA 4WVRA 1CICD 3L7FB 1NANH 1QBLL 1U3JA 5BOPA 4HJGB 2QHRH 1RJYB 4I8DA 5DXWA 5ID1A 4NKOA 3P30H 4P23A 2A6DB 1MIEH 3O2DH 4PJXB 3BD3A 1YUHA 5DK0B 4Y16C 5T1DL 4YZFE 2APWA 5E00B 1WTLA 5DDHA 3IDGA 5F9AC 3FQUA 4NCC2 5L8JB 2I24N 3L3GB 2CDEB 4MGXA 4QCIB 2Q7NA 5IFHH 5E8EA 3MMEB 3UPRA 1F3JB 4R0LC 1FYHB 3EZ8A 2AP2A 4Y16D 5HHQA 3IAPA 4Q6IC 3UEZA 5D9SB 1L7IL 2Z0BA 1QYGH 3SDYL 1I8KA 5D71H 4WV1A 4MNGB 1F5WA 4L29B 4MDIA 1LO2L 4RMTA 1N2RB 3T1FB 5E8OA 4NQEB 3WS6A 5C2BH 4NZUH 3L5WA 4ELMA 4EUPA 2R9HC 3MTRA 2YD7A 4YIQA 5GRVK 1AKJA 2D0FA 2FYYA 4OKDA 5ADPH 5AYQA 2OR8A 4WU7A 3CMOL 3O2VH 2FBJH 1Z5LA 1Q9OB 4LPUA 4ZDHA 1DUYA 2E6PA 2P1YA 3GMPA 1J5OL 3GKZA 4ALAH 2CLVB 3MR9A 1NCDH 2Z9TA 5I1JL 2GJ6B 2RAMA 3PWPA 1U8KA 2AXFB 1V7MH 1QFHA 1JUFA 1ND0B 3KJ4C 4M5ZH 2OL3L 3BEVA 2HT2D 3MRCA 3QEUA 3RBGA 3H9YA 3O6KL 4H20H 4IOSD 4U1LA 4P2RB 2IALA 5HGHB 3U4AA 4LSVH 1BHGA 1EIBA 5TQ2L 1V3MA 3VRIB 3T4AB 4GRLC 3VD5A 1A6ZA 3U83A 5CJQL 4L8DB 4NKDB 1XH3B 4KQ4H 3QH3B 1JGDA 2EECA 2K7PA 4MWFA 5C07A 4L8CB 2NY7H 1E6JH 2JE8A 5CZVL 4M5YL 1VFAA 1AD9A 3V6FB 2B2XH 2JCCB 4QHMA 4U6VH 1AJ7H 3NN8B 1R6VA 1S78D 5C08E 3VG9B 1T04A 4M62L 1PVHA 1ZKAA 4X7FC 5F6IC 4JLRA 5GS1B 4G8GE 2HH0H 5EBWA 4N90E 4IRZH 1T5XB 4HKBA 2L7JA 3VWKD 1U9KA 2Q8AH 5D1XC 2GSGB 5KS9B 2WQRA 5IB4A 1FORH 1Q72H 2GTWB 4M8QA 2Z31A 3KPSB 3JTTA 4EN3B 5I8OL 2VLKA 3VI3E 2PXYA 1B0GA 3IB4A 3PL6B 5CEZH 4QF1B 5F9JA 3RHWF 5D1XD 4PJXE 4FNLH 1OT1A 1U58B 4PY8I 4M43H 3V52L 1NAMA 1X4ZA 1SBBA 1EFXD 3GUTA 4KTEL 3DO7B 3QIWA 4OLYH 5AG8A 2CDFA 4JFFA 4YLQT 1F3DJ 2IG2H 5GISL 1EMTL 1BMGA 1FFRA 3L3JA 5ADOL 4Z6AT 1DE4A 2EC9U 1QZ1A 4TTGA 3DHJA 2ADJB 3P0YL 4GW5A 1IGTB 5BVPL 1LILA 3IJSA 1OB1A 2DLGA 4MNGE 1JF1B 5E8NB 2BY3A 3JXAA 4UQ3A 4XCFH 1E6OH 3QUYB 3BKML 3L5HA 4XVSL 4DTGH 1HQ4A 2C9AA 5LGHL 4LDEB 4UBDC 3CPLA 4OF5A 1HZHH 1V7NL 1Z9OA 2FB4H 2HKHH 3QWRA 2EKSB 1OGTA 1D6VL 2IH3A 4S1SH 1RIUH 4P57B 1HH9B 1ADQA 4OIAA 5EN2A 5T33H 1PZ5B 3RVVC 5E70A 3PQYA 1GGYA 2DIBA 5FOBB 1A47A 2DQGL 2DDQL 1NFIA 1QFWH 4YHPA 4QLRA 5IFJB 2F9BT 4P5MB 1ZT1B 2BVQA 2EDTA 4J8RB 2NY1D 5ID0A 2D31A 4P2RE 3JV0A 1R3LB 4XNQA 3CX5J 1PX4A 4XVUD 3KPNA 1ZLVH 4XP9L 5BMFH 3X3FH 3BDYL 3D3VA 5BQ7A 1N5AA 4IDLA 2HFGL 4G8IA 3V4PL 4PGEA 5L88L 3GSXA 1EO5A 2C3GA 4U31A 2V6HA 1N6QL 3EYQC 3HS0A 4ZS6C 2EEAA 3MRDB 4JPKH 4K8RH 1VESA 1QP1A 1YEGL 5FKPA 1ED3B 1X5YA 2JCCE 4JKPL 4O2CA 3PHQB 3VI3F 1WK0A 5J1TC 5L2KB 5EZLA 3VE0A 4ENEC 3FB8A 3RIAK 2OX5A 2A6IB 1UJ3B 4I0PD 4Y2DB 3EYQD 1EJ6A 1TVBA 4HGMA 4RAUA 4NKQB 4LRIA 1W72A 4R97C 2I60L 2R2CA 1R3KB 4KJPD 3MGAA 5BXFA 3LEYH 4ENED 2ADFL 3NAAH 2EIEA 3I6KA 2BXYA 3ROLA 4MA8H 2A77H 1QOKA 3KPSE 3RWEA 3I50H 1HE7A 4O5LH 3E2HC 2Y36H 2OTWB 4KK5C 4K3EL 2VUYA 4L8SB 2V2WB 1A8JH 1Q94A 2NY3C 2NY4C 1T2XA 4G7VL 1OP3H 3GSUA 3ARFA 1OAXH 3KDMB 4OZFB 2X6MA 1JN6B 5EU3B 1G9MC 2ID5A 4MXQC 5GJTL 2EO1A 2DIJA 4PGZA 4WO4A 4KK5D 5H94B 2Q6WA 4K23H 4H1LB 5D2NC 2NY4D 2V2XB 3S4SA 3IJHB 2EEBA 2C3WA 5DZLA 3DMMC 1XGUB 3QPXL 3QUMB 3KPLB 5J11B 1YN6A 5ALCH 4MXQD 5ESQA 2CJUH 3U4EA 4ZPTB 4D0BA 2DS4A 4XCCH 4JKKA 3BVNB 2VXSH 1KULA 5H8DA 5SWZB 3CH1A 1RUAH 2R2HB 3DMMD 1WFOA 1YEEL 2RCSH 4IMLB 5C09B 5BOZG 5I1DB 2W0KA 1OL0A 2I9LA 1YJDH 3MLTA 5AWNH 1CVSC 1RJZB 3S36X 3NACH 4OAWB 5GSRB 4P0DA 4KVCH 4HWBA 4URTB 5FYLL 1DBJL 2QSQA 3PHSA 3UJJL 3U7AA 3FMGH 1HH6B 3V5KB 2VQ1B 3IU3B 4H8WC 4YDJA 4OV6F 2K9UA 1WTGT 1CN4A 3O6FA 4NFCA 2C3HA 1T83A 4E41D 2VJXA 4P9HL 3RWCA 1E4KC 4FTVE 5I16A 4PP2B 1UKTA 3DSFL 3NCYP 1RFDH 3QUXA 1B3JA 4RRPG 5DK3A 4MCYA 4PJ7B 4YBLC 1I7ZA 1RUPL 4LLDB 4YDLC 1CLZH 2EDJA 2NLJB 1CICA 3C08H 3QO1B 5KJRH 5DQDL 5L2KE 2NXYB 1WBXA 4HV8A 1GRWA 4FQ2H 4HC1L 3QNXA 3QXTA 3VFWA 1JZ6A 1ZV5A 1NGZB 4MJ4A 1LDPH 2XZQH 3D87B 3JZ7A 3S9DB 4X4YB 2KUTA 2X7LA 1TJGL 3RGVB 3EOBA 3ZYJA 3CVIH 4L9LB 4NNPH 1HILA 4QHUB 2O5YL 1N8ZB 1PFCA 3BP7B 1RULH 2C1OA 3GDBA 1YDPA 1DZBA 3KYOB 4L5FL 1KG0B 2H8PA 4Y16A 3RTQB 3SGDH 1JYNA 5BV7C 4NUGL 4P3DB 4HKZB 3OJMB 3EBAA 4UIKL 3T3PF 1UH3A 5I1LB 3MV7D 4R0LA 2Q87A 4WW1B 4Z76A 4YH6A 1C1EH 3ZLQC 4FFYL 2X44D 1CFVH 3ZYIA 2OR7A 5KSBE 4RAVA 4BFBD 1KB5A 1Q9KB 5HHPB 3ZL4L 4X4XB 3ALPA 1WBYB 3PNWA 3K80A 4PRDB 5IT2H 3V0WH 1DL7L 4X6EB 5JUEL 2PR4H 3VXRB 3FFDA 3S6CA 4POYA 4J6RH 3K2UL 3EYOB 4M48H 4P4KB 1JHKL 4PS4L 5EIIA 2HG5B 4LASL 5ICZA 4NBXB 4RQQA 3I2CL 3GIZL 4UT9H 5C09E 4D8PA 1JWMA 5F3BA 2ZOLA 2AK4E 4QEGA 5F44A 4HWEL 1S7QA 1UQSB 3MJ9A 4P99A 5KVMC 4OI7A 1P4BH 2D7TL 4FQ1L 4PRHB 4XNZC 1EGJA 2X5PA 1UXSA 5F89A 3BO8B 3T3ME 3JWDC 4LFHD 1FV1B 3GJFH 3VFUA 4KK6C 3SKNA 1X4XA 3I75B 4K7PY 3SDCC 5ACLA 4XNYL 4JFZH 2NY0D 3MYJB 1DQJA 1HNFA 1CLYH 4O58L 1S9WA 4RGNC 2E9WA 1FAIL 3JWOH 2XPGA 4D9RD 3VXME 3VWKA 5T1LD 3NZ8B 3M17A 2NX5D 4YO0B 3EYFA 2VLJD 3BISA 3NABL 4WFHD 3LQAH 3HRPA 4M03A 3SDAD 3GI9H 4LVNC 4CN6A 4EDWH 4HDIA 1NMCB 1Q0XL 4RAHA 1KFAL 4EIGB 3RY6C 3ZHLA 4XH2A 2NTFB 3KYNB 5IMLA 3HUJB 4ZO9A 4X6BB 4H26A 2P8LA 3Q6GH 5D1XA 1MCSA 2X4PA 2DRUA 5I1CL 3UO1L 2H26B 1F2XK 3S37L 1FZMB 1A5FH 3BIKA 4Q2ZA 2V2TA 1EFXA 1FDLH 5KSBF 4N5UA 1AXSB 3G6JE 4WI5A 1INDL 4X7DC 1EHAA 2CO7B 1MHHB 1I85C 3F7QA 3KJ6H 2WWMD 2XZCL 5HYJD 1A9EA 1DBAH 1OPGL 1TZGL 4WEBH 5K59E 1T2QH 3CH8A 3UBXB 2EYRA 1P5UA 4U6YB 1YEDA 1QBBA 3VH8A 4HIXL 5DRWB 5FGSA 3W9DA 5E6ID 2BVEA 3LS4H 4U1MB 3VXQB 3OHXA 3FQNA 3QEGH 4J7RA 1IL1B 4U1JB 1SBSH 5CBAB 3FN0L 1NCAL 2XQBL 2E3VA 1NL0H 2ESVB 4OT1L 3JV4A 5DJCB 5GGTH 5JQ6H 2K1MA 4DVBB 3CFDA 2DQDH 1YY8A 4B7LA 1VKXB 3AS0A 3MFGB 4NDMA 3S5LG 4L3EA 4UIMA 3IJYB 3T3MF 4UB0H 3TVMC 4JQXC 4D3CH 1SYVB 4LSTL 4RSVA 4PRAA 3DHMA 1KN4L 4IBLT 3VFVA 2XZAL 1F45A 1UM6H 4M1GH 4JG0H 1KEMH 4LARL 3LEXA 4GLRH 1OD7A 2DWDB 5JIIA 5FK9A 4NP4L 1YQ2A 5IVZA 3QA3A 3FO2B 1NEZG 1W2KT 1MF2L 3DETC 4JO3L 3TVMD 4AM0A 5KVEH 3HR6A 1GGBH 3D9AL 4MZ3A 4NO0B 5AAMA 32C2A 3R4DA 4Z7VF 3IXAB 3PDGA 2DTSA 5D2LE 3WNPA 2IPKB 3FQRB 4KZDH 5IF0B 3PWLB 4X9BA 2VLMD 3G5YB 2ATKA 4GW4A 3P4NB 3SN6N 2NY2C 4Q9BA 2JELH 5CJXC 4ZAKA 4NJ9H 2M8XA 4XNMB 3I6GA 3IKCA 3SQOL 2J88H 5ESVB 4NQDD 4K94H 2A6KA 3F7YB 3QJHB 1FJ1A 5HHMD 1FVDB 4JDZA 2YD3A 4GKOA 2JJTC 1G7QA 4I0PA 2X9WA 3G6JF 3ARBB 1KCUL 3WNOA 1BQSA 4R6UA 5FO9B 3FT4A 3BMVA 1DQDH 3LV3B 4S2SA 3Q3GB 5DGQA 5K59F 2H32H 4UUJB 3OKEB 4MXWL 4EVNA 1XGPA 4HWZA 1ZHNA 3K81A 3ULUE 1NCTA 4NQXA 5KVFL 3HUJE 4PG9B 4ORZC 1CK0L 3QHTC 1EHLH 1JPGA 5B39G 2BNRB 2CR3A 2FIKB 5E4EB 2AKRA 1WGOA 2QBWA 1MI5D 2D4DA 5IV2A 2AJSL 1FPTL 1GVIA 4NQCD 2OR9L 1GIGL 1PKOA 3RBSA 2D0HA 4P2OC 4W6YB 4IOIB 4Y7MA 3L3IB 5BRZE 1UCTA 3NZHL 4P2QD 4R9HA 4MAYB 3S5LB 3IRZA 2J12B 5DMIL 3PABB 3B8SA 4OCRL 1SMOA 2A9NL 2MFNA 4LCUA 1QFWM 3WHE0 4UTAH 4D9LL 2YC1B 3WDJA 4I18C 1ZT4B 3NIDE 3OKNB 3OXSA 5IHBA 1G1CA 4LVOB 1G7MB 1DFBL 3DMMA 4MMXC 3TWCL 1YEKH 3PWNB 1YMMA 2ZG1A 4X98A 1A6AB 2VLRD 4YHMH 4I3SL 4P46C 1OAZH 5D2LF 1GC1H 2DQCH 1AR1C 3GSNL 4HUMB 2FDBP 3PP4L 4X80L 5E99H 5I8EA 1TVDA 4PRIE 1R3JB 3KLDA 3QXAB 1BD2B 3KPOA 1KJMB 2A1WL 3T09A 5BVJB 2OMNA 5FO8B 4P46D 1T03L 4OGYH 1KPRA 1AR1D 3QFJE 3QRGH 2RB8A 3WHE1 2F74A 5LCVL 5B8CC 4RGOL 4BK4A 5HI5C 2XTJE 4WENB 4JPIA 1PQZB 4MXVF 4E41A 3AREC 4MA1C 5IMMB 2R2BA 3G5VB 2R56L 4FFZL 3GBNH 4OGXL 3LKNA 4LAQH 3FTGB 3ULUF 4UDUB 1N6UA 5DZNA 4UAOC 5HI5D 3IT8D 4JGUA 1DQQA 3MXWH 3H3KA 4CRPA 3KNBA 1N6VA 1E4KA 3ARED 2H2SC 3AGVA 5DJXA 1P9MC 4C54A 5I15H 1AC6A 3T08A 4P2CG 3HB3C 4HAFA 3I02A 3UTSD 5F97E 4J3XA 5E08H 1FIGH 4JRXB 1XF2A 1JGLL 2VL5B 5GRXG 4C58B 4POUB 4HG4J 4YQXL 4LVHB 4HH9B 1JPSH 2H2SD 1D5ZA 5I66A 5E56A 3QWOA 2KZWA 5C0IA 2FJGA 3GK8L 3R1GH 3HB3D 4ZPVB 2MCPL 1Q0YH 3ARWA 5MERB 3NIDF 3O4LE 4Z7UB 2BMKB 1QEWA 4BSWA 2YSSB 3H8NA 5F1IA 1AFVH 1QACA 3MV7A 4JM2C 4LF3A 5CWSB 2X4OA 5DSCB 3QIUC 3LZFH 3KPQB 4PFEA 5E8DL 5EU6E 1TJHH 4FQPA 4Y5VC 4MB3A 4P59L 2BCKA 5F96H 3TO4D 4HPYL 4X7SH 4MVBD 3TT1H 2ATPB 2AJXH 1HI6A 2WIIA 4B50A 4S1QL 4Z95H 4U1HA 5CEZE 3QIUD 1XCTB 3GMOA 4HLZH 1UA6H 1SJVA 5I1IL 5D1ZC 5HHNB 3KVQA 4H0IA 3O3EA 1PYWA 2GJZA 2A0LC 2LE9A 1WCQA 3VG0H 1RZJC 3V4UL 3M8OH 1UM4L 3MRGA 4HUWA 4AEIL 2VMFA 1EUUA 2O5XL 4QXGL 3VFGL 5ISZD 1S7UB 3MLPA 5D1ZD 3PUCA 4JANA 4OZHA 1CD0A 3U46A 4JAMB 5JORB 2EXYC 1BD2E 3LKPA 3SDXB 3RWHA 3MGOB 2AJVL 3EDJA 3DXAD 1QFOA 1RZ8B 4TUKH 4XX1G 1ITBB 1D5BB 5HGAA 2AEIT 4YHZH 1FNGB 2XNAB 3RZWA 4E9LA 4JFDB 4UQ2A 3BGFB 2EXYD 4MQTB 4P5KB 5TF1H 5TPWH 2AV7A 2NY5H 4TVSa 3F12A 5JDSA 3VRJA 5T1LA 5DC0A 1R5IB 3GSVB 1RPQA 3BYYA 2NX5A 4NQTA 4FZ8L 3DGGB 4LCWE 4J12A 4OI9A 2VLJA 2SEBB 3GMMA 1I1AC 3BZDA 5E5UB 2VL4A 4QOKD 3KWWB 3SDAA 3WL9A 3DV4A 3EYVA 4YFLI 3QJFB 1YNTA 5D1QB 5IB1B 4GMTH 2D0GA 4AT6B 2D7QA 2JJUA 2J7LA 3ILPB 4ZFOB 4HQQL 1B4RA 1YPZB 4KVNL 4X5XB 1U8JA 4HPOH 1I1AD 1BGXH 5K9QI 4OQTH 4PR5B 2R29H 4PJ5D 3GNMH 3RIFK 1BZ7A 4JRXE 4HK3J 3WDHA 5C0AB 5IG7A 1DTUA 3RY6A 3TJEL 3VXTA 2GK0B 4LCYB 1S5IL 3ZSSA 1IM3B 2BJMH 5IEHA 3JVGC 4DZ8A 2DKMA 3CC5A 5HYJA 2BY1A 1OSPH 4GRWH 5F3HB 5EOTA 1NCWH 5BZDB 3ULVC 1ZOXA 4XHJC 1MPAH 1ZAGA 3EO1A 5E6IA 25C8L 1P1ZB 4BK5A 4Z7UE 1FH5H 4HZLB 4OIIH 1YEHL 2VDMH 2VXUH 1DUZA 4BQBA 1P69B 5IBTH 3WV0A 1HDMA 1KIUA 3HRZA 5FM5M 4NGHL 4XHJD 3ULVD 5FXCH 2GQHA 4XB7A 2J5LB 2WUBH 4JQIH 1ZLSL 1FLRL 5HGBA 4Q6YA 4YPGA 4PD4J 1TJIL 1BEYL 5CD5C 2YD1A 2AXGA 4S1RH 4BZ1L 5DR5H 1M6OA 1UVQB 4HXBL 4M6MH 5BJTB 4M9OA 4GRMB 1QVOA 5FV1L 1KC5H 5DJDB 3RU8H 4UI2A 1CTOA 4OLWH 5GSVB 2WBJB 1GGIL 5T5FH 3EJYC 5FHAL 3TVMA 4UU9A 4JQXA 5CD5D 1AGEA 1S9YB 3MLUH 1WT5A 2OP4L 1HHHB 1BFVH 1MHCA 3B4NA 3LH2H 3V0AC 1R24A 4X7TB 3DURA 1MJ7L 1UWEH 3LHPH 1G1YA 1HCVA 1MQKH 1MFDL 4MSWA 1JGVL 1L7TH 3T8XB 1TETL 3DROB 3LKOB 1NCCH 2B0SH 3IFOA 2VXTL 4JFDE 4OGZA 4OLVL 2MSPA 4GXVH 3KPMB 5BZWB 1I8IB 4RA0C 1MAJA 1S7VA 4NT6A 4B53A 3FB6B 5CJXA 3QUML 3WBDA 3NMEA 4WU5A 1NCNA 4CJ0A 3U0PA 1CD8A 3GJFB 1A6VL 4IHOB 1BQHA 4R7NB 5EU4A 5DVKA 1A4KA 2IC2A 1DCLA 4FZEH 3VDAA 5SWSD 3T0DA 4ZFFA 4Z7WE 4M1DH 3IRPX 4UNUA 5IB3A 3MRJA 4RWYH 1YPZE 5IHZB 1E4XI 2CKBA 1LK2B 2DQJL 4JHBA 3GMLA 5EZOH 3MRFB 5FCUL 3RHWK 1OT2A 4ODBD 4R26H 1IGMH 3BRDA 1MI5A 2YPKB 4LQ1A 2WINB 1CGSL 3O6LL 1F6FB 1KLUA 4ZUTA 4J4PC 4NQCA 1KCRH 1VADA 1CLOL 1Y0LB 3TH2T 4N0UB 2HLAB 3QUKA 1A3RL 3CNKA 4PJHA 1KSRA 4NKMA 5FDYA 5FF6A 4P2QA 5KBNC 5KANI 4MZ2A 3B5TA 2HVJB 4DFHA 4C83A 4CADB 4LSQH 1DLHA 2VDKH 3UTPD 3ARXA 1CE6B 2V5TA 4TVPD 3MRHA 4KJYB 4XMKH 3ZKQD 1ERNA 2VLRA 2R1WA 2CRYA 2VR5A 3V4VL 4ORGB 1T2JA 3MV9E 1IGFH 2VLLA 5GS1C 3UYOD 1HIMH 3MYZA 3O4OB 4DOHB 4X6FB 1BZ9B 4HF5H 3VMOA 1FVCB 3C5SB 2HLFD 4PG2C 4LPWA 5JIPA 3DX8B 3S34H 1T4KA 2ED7A 1IAMA 4P46A 1LK3H 4XX1E 4HIIB 4XCEA 1WSST 2HJFA 4PJBA 1MHEB 3SEPA 3RRQA 1XIWB 1YMHB 4YHNA 1UWGL 4K7PX 1LO4L 1I8MB 3BZFB 4JKLA 3CFIC 4H88H 3C2AH 3PL6C 1KTDB 1T0PB 4R7DB 1TTUA 2GTZA 5FYKU 1LEGB 2FJHB 5DMKB 3WDIA 3IDJA 5MEND 1OHQA 2R0ZH 2R15A 2WLYA 2X2YA 3ROOB 3WSQL 4BZ2H 5B8CA 5E6YA 4Z7WF 3TBSB 3MRQA 4MLIA 4L4JA 1OQOA 3HZYB 1EJOL 3MLZL 3WFEL 5IBLD 2XFXA 3VFOA 1GGCH 3AREA 2P5EB 3QYCA 3FO9A 4JPVL 1HSAB 1MLBA 5GIRB 1KCSH 1BOGA 3K7UA 2R39A 5KSAB 1W72H 4ODVL 2CDGB 1RU9L 3L6FA 3U2SB 5C0DA 3UTSA 1ZK9A 5AUMB 3P3YA 4WUUE 3GGWB 5JW4Q 1EEZB 5FEBA 1IM9B 3WUWB 5GRJH 1SYSA 5MHSE 1WITA 1A3QA 5DHYB 1P9MA 2H41A 4NQSA 1Z3GL 1J9CT 4XBEL 3BP6B 2FX9H 4QHKI 3S35L 2VUOA 4KK8C 2ORBH 1ONQA 2JTDA 1LEIB 1A6WH 3LRSB 5C0CB 5CMAA 4HIEB 4ISVB 3M07A 4QTIL 5EG6C 3IFLH 3QFDB 4PJ8B 4OKVB 1KIPB 4KK8D 3T65A 4KROC 1CD1B 2BFVL 3MA7A 4IDJH 4NYLA 4JB9L 1MWAA 2CR6A 4DGYL 2H32B 4N0UE 3ZYOA 4F9PA 1GH7A 3TO4A 2FNBA 5DQJA 1RK0B 3CX2A 1FG9C 1BBJB 1R3IH 3HTLX 2VERN 4LIQH 5DWUL 2WQ8A 5F7HA 4KROD 1J18A 4U1KB 3S8WA 3NFNA 4N5ED 4Y1AE 4Z78B 5IB2B 4LRNH 4XBGA 2Z91B 1ZVSA 3JTSA 1GOGA 3NGBB 4YE4L 5EIVA 3AXLA 5JO5A 3LN5B 4NCC1 2EH7H 4NNXB 1SEBA 5ISZA 5HHOB 1UJ3C 1G7JA 2R4SL 4JFOB 5D1ZA 4ZQKA 5LAXA 3ULUL 4GSDL 1QR1A 4HWBH 5SV4A 3FO0H 1KT2B 3DXAA 1A7NL 4HBQA 4YX2L 2E7LC 3RUGE 2MKWA 4NZRH 2DM2A 1IEBA 2VOTA 1INEH 1U3HB 4HUXA 4L3AA 2YUVA 3FO1B 3VWJB 2BC4A 4IIQB 5K9OB 3D0LA 3MZTA 4Z77B 1XGRA 4FG6C 3HZVA 4X6CB 5GS0C 2LV4A 4Z7NE 1F4YL 3G6AA 4G8FB 2QHRL 5JPNA 5GPRA 2CIIA 3P11H 4ZS7H 3P30L 3O2DL 4QOKA 5CBEA 4NN7C 3D18B 4EOWH 3INUH 1HYRC 5EC2B 3QIBC 3QDMB 3ZDXE 4FG6D 2Q7YB 5GS0D 1RIVL 3BPNC 3HI1A 3B2VH 4M7LT 1VGEH 5IFHL 1I1AA 5J11C 5SV3A 2DB8A 1J12A 4LEXH 1A7PL 1UXWA 3DIFA 4I9WD 4M6AA 4V1DD 4PJ5A 3STZA 4PJ9C 3QIBD 4WCYL 2ZUQB 5IMOB 1QYGL 3HNVL 3D39D 4TSAL 2F5BL 1U95B 5FB8B 3K1DA 1NDMA 3N1GC 5EOCJ 3Q6FA 4JZJB 4FXKA 4XMLH 3Q5OA 5K93A 5C2BL 4NZUL 3OKDA 4W6XB 2X70A 2LTQB 2DM7A 3MNZA 5DEGA 4U0QB 43C9A 2H6PA 3GMQB 1D9KC 3CXDH 5ADPL 5C0CE 1NFDA 3O2VL 4PY8J 2FBJL 1GAFH 2F19H 2DI7A 3RWFB 4ALAL 1KV3A 2BNQB 1ROWA 5C6TL 1N5YH 3SO3B 1NCDL 1MAMH 4U6HA 1O5DT 2AGJH 1KB5H 1D9KD 2D7NA 4PJDF 1V7ML 1S5HA 5IEKB 4XNUL 4G5ZH 4QHLA 4XPHH 2UV3A 3E3QE 1ZEAH 3V9FA 3LKSA 2GFBA 4H20L 1XMWA 2OYPA 4QRUA 1NGYA 1M7DB 3RUGF 4LSVL 1D5IH 5TGBA 5C0RH 1I9JH 2A6JA 3TBTA 3QULB 2O61A 3SE8H 5JR1H 4MB4A 4U6TA 5CD3A 1W0WA 4OZIA 3OKKB 2ZCKH 5CLTA 1DN2A 2A83B 2NY7L 1JCKA 3NCBB 4Z7NF 3MJ9H 1VHPA 1E6JL 2F54E 3PIQB 4I4WB 5HHOE 2GY7B 4G3YL 1WCBB 4U6VL 3S36H 2V17L 3H6JA 9CGTA 1VA9A 3NH7H 3BFOA 3ZO0A 3W0WE 3RGVC 4LLQB 3RJQB 3UZQA 2X4SA 2ZKHH 5I9QB 1D6EB 3ZE0E 4G7YH 3ZDXF 2HH0L 1BLNB 4HT1L 5GGSB 4IRZL 3W9EB 4G6JH 3UZVB 4BSVA 2DTMH 4PGCB 4KZEH 1DBMH 5EWIH 5ESAA 5ILTH 4LSRH 3UC0H 1FORL 1Q72L 2GUOA 2VISB 4KDTA 4F7MB 4JRWA 2Y72A 3GHBH 5DJZB 3CLFH 2YKLL 1EAPB 5D7LB 5CEZL 5H35A 15C8L 2ITCB 5EORL 2RFXA 5CEXA 3QZWA 4LQFL 4FNLL 3BD5A 3OV6A 3GSRB 4JFEB 3P2TA 1W8NA 3V6OA 4TSBH 3QDME 5SWSA 2BOCB 4GAYB 1QD0A 3IDUA 1YNKH 4OZHF 3TIDB 1XF4B 3DECA 3VFTA 3QDGB 4H25A 3LN9A 5IVXA 3G9VA 4JRYB 3T0EB 1MCDA 1R5WB 4P4KC 5C3LD 1Q1JL 4B7IA 1A2YB 2N1KA 5MI0B 3WEXA 4UDTB 4GFTB 3MNWA 2CSPA 2ZUVA 1CS6A 4DTGL 3HAEA 5C8JA 3VD4A 5ID1B 4NKOB 1TITA 4P23B 1FFNA 1HZHL 4J2XA 4HFWA 35C8H 2FB4L 1FNEA 4X6DF 1YUHB 3F7PC 2YPLD 4S1SL 5DDHB 5TQ0H 1NJ9A 1CGTA 1RIUL 3JUYA 3Q5TA 1FZKA 4QRRD 2BNQE 3FQUB 4RMWA 3MA9H 3VXUD 1NANI 5E8EB 5F9DC 3UPRB 4LSSH 3P0VL 3ZHKA 1QFWL 5HHQB 4LPXA 1V3JA 1I8KB 1FCGA 4WV1B 5L6YH 4MDIB 1QSZA 5E8OB 3KPRD 1ZSDA 5GZNC 4FQXC 1Z9LA 3L5WB 4ELMB 5CIPA 3VD9A 1AKJB 2FYYB 3W82A 4B41A 5EOCH 3MBED 4WU7B 3E1F1 1Z5LB 4WTZG 5B38G 2BY2A 4ZDHB 1DUYB 3GMPB 2KDGA 2M2DA 3MOAH 4ZFGH 1QO3A 4N0RA 5C7XL 4YFDB 3MR9B 5GZND 5BS0E 2EDNA 4FQXD 1H8SA 3NCJH 2VWEC 4OZGA 1UYWH 3PWPB 1MVUA 2EEDA 1JUFB 5MENA 4NSKA 2CIKA 3BEVB 3MRCB 1MY5A 2N7BA 3GO1L 3QEUB 4JVPA 2J8UA 3BXNA 2GW5A 5DURB 3S96A 1J1PH 2EDRA 4KMLB 4U1LB 2R69H 2IALB 4K9EC 2XT1B 1U3ZA 3LEYL 4N9GA 3NAAL 1S7SA 4LOUC 4CDHA 1B6UA 1A6ZB 4MA8L 2A77L 3I50L 4QXTA 1JGDB 1BVZA 1SEQH 2BHYA 2F53D 4MWFB 1GOHA 1P5VA 4NHCL 5DD0H 3K74B 3MFFA 5D7LE 2V5MA 4NC1C 2XN9E 1AD9B 2GEEA 3F7RA 4QHMB 5C1MB 4LOUD 2NYYC 1MCFA 3U36A 3U7YH 1T04B 2D4FA 1JJUA 3MUJA 4TRPH 4U49A 2QSTA 5EBWB 3QDGE 4DCQA 4K23L 1NSNH 4BA8A 1H3TA 1MAKA 3OKLA 1OQXA 2NYYD 3B9KC 4IRJD 4ZOCA 4R90L 2ZSWA 3R8BB 4NC0B 5IB4B 1I9IL 1DDHA 3FJTA 2CJUL 4M8QB 2Z31B 4XCCL 3JTTB 1FIEA 1AO7D 2VXSL 5ANME 3MRIA 1G9MH 2PXYB 1B0GB 3RJDA 5F9JB 3B9KD 2ARWA 1JYXA 2RCSL 5FGRA 1NAMB 1YJDL 5AWNL 3GUTB 2X41A 3P40A 3K8LA 3QIWB 2R2EA 3NACL 1J8HD 2CDFB 1MRCL 2HTKC 4JFFB 5HDLA 4MD4A 3L3JB 1OSZA 1DE4B 4LCIH 3RAJH 5H2BB 2X4TA 4DKFH 3DLQR 4GRWE 4S11A 1IKNA 4GW5B 1MUJB 4NN5B 2EDFA 2DQHH 5FV2A 1OB1B 2EYTA 3C60C 2HTKD 3VXSD 3ARBC 5J4MA 2X89D 4QT5A 4XHQA 1HQ4B 1HHJA 3P9LA 3CPLB 3S4SG 2R0KL 1SM3H 1RFDL 5HHVL 3TM6A 1OGTB 1TCRA 2IH3B 1IARB 3C60D 3WLWC 5EN2B 5GRUH 4WW2F 1QFPA 1EPFA 4AY0A 1CLZL 2Y9RT 5D8JH 4BUHA 5KJRL 3PQYB 3G6DH 1H3PH 3BKCH 4KJQC 5HYQA 2W9DH 2K3TA 1BQUA 1BBDL 4H8WH 4GAJH 1NFIB 1G9EA 4YHPB 1JRHH 3GBMH 3VXPA 2NCMA 3IFPA 1BVLA 1RZGA 1IEAA 3WLWD 2BVQB 5ID0B 4QWWC 2XTLA 4XNQB 5JLZA 1MNUH 4KJQD 3KPNB 5ERWA 4MAYC 2QQKH 3D3VB 4TNWK 1N5AB 5BQ7B 3GI8H 1RULL 4PGEB 4G8IB 5SX5H 4V1DA 1F4XL 3GSXB 4MA3A 2W0FA 1X5XA 4I2XA 3VGAC 1JI2A 3QIBA 3HS0B 2IAND 3OKMA 2ERJB 4M7ZC 5IHLB 4LVOC 3D39A 5FKPB 2YD2A 4O2CB 3I6LD 1ZWIB 5EZLB 1T7XA 3VE0B 3FB8B 2FCBA 2HT4C 1C1EL 1CFVL 2ZUXA 1TVBB 4RAUB 2OTPA 4GG6A 3B5GA 2ED8A 1W72B 3DUUA 3HZKA 5BXFB 5BV7H 5IT2L 2HT4D 2DQEL 1D9KA 3EFDL 3ROLB 4GRWF 4BQ6A 3RWEB 3LS5H 1WWAX 1NBQA 4KDWA 5F93C 3CGTA 4GAFB 3UTZA 4XAKE 3W81A 1Q94B 3MACH 4ODHH 1IT9H 3GSUB 3HC3H 3ARFB 2PYFA 3TNNA 3QHZH 4M3KB 2UWEA 5C6PB 1MFNA 5DO2C 4WO4B 5FYLD 4M6OH 2Q6WB 2F8VA 4P9HC 1T66D 3S4SB 5CUSL 3A6CH 1WJ3A 3DRTB 2BDNL 1F90H 4PLOB 2XKUA 3BP4A 4JFZL 1LE5A 5HI4C 1YN6B 2LAGB 3KYMA 4R96A 5ESQB 1T0NA 3MRBA 3U4EB 5DO2D 4D0BB 3ALXA 3LMJL 4QRSA 4KI5C 5HYSA 3P73A 3B6SA 4K2UH 1OAYH 1ZTXH 3MLSH 3CH1B 1KCVH 1ZHKA 4PRPB 4H5SA 4K8RC 5HI4D 2W38A 3JWDH 1C5DA 4WI3A 4D94A 3AB0B 3MLTB 2I9LB 3U79A 4PJGF 1BF2A 4KI5D 3GI9L 4WHYH 4D9QD 5D5ME 4OB5H 1LEKA 3MV8E 2VZSA 5FHBH 3SGEH 3EGSA 4S10A 1QSEE 3LQMA 4R2GD 2DL2A 2X1OA 1A5FL 2F58H 4AIXA 5E2VH 4JQVC 4K7FA 5F7DA 3N1PC 1FDLL 1MJJA 3B8YA 4YDJB 3B9AA 3D48R 3O6FB 4G9FD 4WFEE 4WEMB 5SWQA 5HSFA 3RWCB 1DBAL 2ICEB 5I16B 4WEBL 1UZ6E 2G2RB 3QUXB 4UV7H 4OM1H 3L1OH 1SHMA 4MCYB 4YUEH 1I7ZB 1FFPA 1ITCA 2HTLD 1CICB 3HMXA 3QEGL 1AGCB 3T2NH 5IJKA 1JGUH 1WBXB 4HV8B 2ED9A 5EOQH 5C3TA 1WIPA 4TUOB 3VFWB 1NL0L 1AY1L 2JB6A 3OJDA 4DK3A 5CZKA 1UKSA 4MYWB 3UYPA 2YPLA 1C12A 1HILB 2CQVA 4G8EA 4QRRA 4H0GA 4JFHE 4UB0L 3U9PH 1CFQA 4GH7B 3VXUA 2C1OB 2OL3A 1FNHA 1UM6L 2FJFA 1YDPB 3U0WL 4M1GL 5JIHA 1KEML 3BGFC 4P2YA 4JVUA 3RGHA 2H8PB 5JW4R 4Y16B 3QQ3A 4CVWA 4AG4H 3T2PA 1ZHLA 5F7YC 1A7QH 2Y6SC 3PP3H 5C0JA 5KVEL 3NBNA 3KPRA 4NO5A 4O9HH 3CD4A 4R0LB 3HG1D 4RBPK 2BNUA 5I73B 5F88A 4Z76B 1W8OA 4PJAF 1WFUA 3MBEA 4PJCF 4RAVB 3VMNA 1KB5B 4KZDL 5D5MF 2YA1A 3F58H 1JBJA 2Y6SD 2IGFH 1SQ2N 4B5EA 3PNWB 4FQXA 4R4NC 3CSYA 2J88L 3CCHA 1NMBH 4K94L 5DD5H 3FFDB 4X0KA 1LO3L 5HVFB 1CR9H 2DJ4A 5E2UL 3WIIH 3VDBA 1CZ8H 5EIIB 1J1OH 5ICZB 2OSLA 4PRPE 1NBVH 5EO0A 4Q7DA 3MOBH 3TC9A 4R4ND 4D8PB 1HKLH 1JWMB 3LKQA 5F3BB 1CDIA 2ZOLB 2DKUA 1DQDL 1B6DA 1UZ6F 1S7QB 3KJ4B 1F11A 2G60H 2MWCA 2E6JA 7FABH 1UXSB 1TPXB 5F89B 4J3UA 5DVNA 3FZUC 3RVTC 5ICYA 2F53A 5DRNA 3RKDC 5F1NA 3VFUB 3SKNB 4CBPA 1ZVHA 4KRPC 1EHLL 4EKXA 3MROA 1B4JH 4JDTH 1AIFA 1S9WB 1QBML 2J5LC 2CKBH 4G9DA 3RVTD 3WNNA 2UZIH 2XPGB 5FA4A 3RKDD 2XQYG 3VWKB 4KRPD 3M17B 3O2WL 4PJFB 3EYFB 3W5MA 4XWGL 1IAOA 4IRJA 3UZEA 1DN0B 2V5SA 2JJWA 3IS1X 3LPWA 2W0LA 2PYEB 5F6IB 1H3UA 2DAVA 4UTAL 5J57B 1AO7A 3ZT5A 3CDGA 5IMLB 3GB7A 3MCKA 1YEKL 2P8LB 3B9KA 5D1XB 2X4PB 1A14H 5I2IA 2V2TB 4Q2ZB 3IU4H 1OAZL 1EFXB 1GC1L 4ERSH 1J8HA 3LSOA 1J87A 1MFEH 2PUQT 2D3VA 5E99L 5GGSY 3HI5L 4PB9H 3HC4H 3REWA 3RDTD 3NIGE 1A9EB 2EIBA 2W60A 4OD1H 2EYRB 1RMFH 2X1PA 4XMPL 1YEDB 4NN6C 2XXMB 4OGYL 3W9DB 3QRGL 1MCWW 4JZOB 4N1HB 3VXSA 3OHXB 2BVTA 3FQNB 4C55A 2X89A 4JG1L 5FECA 4N0YL 5I6XC 3D2UD 3JV4B 3VFMA 5I19H 1AHWC 1MOEA 3CFDB 3G5ZA 1YY8B 3C5ZC 3C60A 4NDMB 5DQ9A 3BKYL 4UIMB 2HRPL 1BIIA 4HJJL 3GBNL 3KLAA 2VXVL 3EUUA 2H45A 1MCWM 4PRAB 4L8BA 3VFVB 4N0CC 1IC7L 5ETUA 2CD0A 2VDOH 1INQA 4CNIA 3LEXB 5HI3C 3R8QA 3C5ZD 2GJJA 5FK9B 5IVZB 5JW5A 3LQAC 3G5XA 3QA3B 4ACPA 5E08L 2NY1B 4Z0BL 1FIGL 5DJAA 4AM0B 4MLSA 4N0CD 3H9SE 3A6BL 4YNYA 32C2B 3L3DA 1FO0L 1LWRA 1JPSL 4DW2H 4F57H 5JXEC 3R1GL 4GLRI 4LGPB 5HYFA 2YHGA 1NEUA 2ATKB 2IANA 4HH8A 2IMMA 4Y5YA 1Q0YL 3LPGA 3MUZ1 1X6NA 1Q9LA 2V5RA 3I6GB 1KPUA 3IKCB 2E7MA 4ZD3L 2A6KB 4F7EA 1AFVL 4OCWH 4O51A 1FJ1B 2FIRT 4JDZB 5JXED 2QADC 3LZFL 4PJEA 1G7QB 3FT3A 4I0PB 1TJHL 2COQA 3BJ91 3O4OC 1DP0A 4HAGA 1MCCA 5F96L 3NTCH 4PJFE 4L9DA 5C08D 3DBXB 2FHBA 1YYML 2YD9A 3MNVA 3FT4B 3TT1L 3NIGF 1XT5A 3SKOA 2AJXL 1GPOL 3UPAA 3L3OA 1PG7L 4S2SB 5T1MA 1MWAH 2PYEE 2A9MH 4G8GD 2QADD 4NHUA 4CVXA 4HWZB 4EVNB 2BSRA 2GAZA 4JHAH 1U8HA 4ZYKA 1E4WL 3QQ4A 2Q8BH 1JPGB 3VG0L 4QRPD 1I3RA 2AKRB 1FC2D 3WJJC 3EOTH 4AH2A 1JFQL 1A22B 2V7HA 1F6AA 5IV2B 3E2HB 1MFAH 3FHQA 5TE6L 4HGKC 3QT2A 4L4VE 2NY4B 3KPPA 2AJZB 2CRZA 4RFOH 1BFSA 4TUKL 1XF3A 3DYPA 1CF8H 3NVQA 4E42B 1A7OL 4LCUB 5KSAC 2FO1A 4FMFA 4NNYA 3EJZC 1V05A 5MP6H 5TF1L 1YEFL 5DHXB 1JHTA 3OXSB 3EOAA 1FSKC 3DMMB 4KHTL 4X98B 3C9NA 1KF9B 3RQ3A 4MD0A 1IKFL 2VAAA 5TDNA 4K7PH 3WFCH 5I8EB 3JBG7 4HC1A 1JNHA 12E8L 2E7CA 2DLIA 4GMTL 3KPOB 3N50A 3V6BR 2ILLA 4E5XA 2YUZA 4U05A 1ZANH 4HPOL 3WO4C 1FZOA 4U1NB 4OQTL 5J6GA 1KPRB 4FFWC 3W2DL 1F8TH 4AEFA 1I7RA 3KXFD 1II4E 2R29L 2F74B 3PGCA 4QRQA 1VFBA 2VQUA 3HFMH 3C6SA 3WMSA 4JPIB 4G9FA 2C5DC 2BJML 5ACZA 2UVEA 4LFHG 4NM4H 3HNSH 4QO1A 5EO9A 1OSPL 5FA3A 1OWWA 4Y5XA 4FFWD 5LBSH 2R2BB 1NCWL 4LP4A 5KAQG 4JQVA 4N1EA 3F6IA 1NAKL 4KUCF 4F2MA 2VDML 1DQQB 2VXUL 3KNBB 5SX4I 1TTFA 5DJXB 4WHYG 4W70A 2H3NA 3MLVL 2BZDA 3W39A 1PLGL 3I02B 4YBLB 2E7HA 3ZMRA 4JQIL 1XF2B 4U1GC 3IAGC 4OLUH 2HN7A 3ZTJH 3ULVH 2DJSA 3Q2CA 5A43C 3BWUC 4GAGH 3O81A 4XAWH 5I66B 4G6KH 3QWOB 4M6ML 5C0IB 4AL8H 5E8PB 2AXHA 3VWJC 4OLWL 5T5FL 5GGRA 1QEWB 1WAAE 4YHOL 4BSWB 1IRAY 5BCAA 2W07A 3MJ6A 5F1IB 5F7EH 3LH2L 5T3XD 3MV7B 4LF3B 3ZSTA 3HG1A 4XVTH 2X4OB 4AEHH 4TPRL 1ES0A 1WLHA 3PF2A 5CP3A 1PKQA 3T2QA 1CBVL 5BV7B 3BZ4A 1M7XA 4TSCH 3N1FC 5C9KA 3OX8A 3PE9A 4BZYA 3LHPL 2BCKB 1QHOA 3HNTL 3PG2A 1OAQH 5J1AA 5IFAL 3UAJD 2DQUH 1L7TL 3RL1A 1HI6B 2WIIB 2W9LA 4U1HB 1NCCL 2B0SL 3QCTL 3GMOB 3PGFH 4GXVL 4XNXL 3SY0A 5E0QA 3L3KA 4MNQE 3O3EB 1G9NC 5D2NE 1PYWB 1DR9A 1ZGLA 2GJZB 4WWKC 2MPAH 1C5BH 1MEXH 3EO9H 1EXUA 1KEGL 3FOMA 2DWEA 2HWZL 3TNMA 3MRGB 4HUWB 1NCBL 2XIDA 3V5HA 1OARH 3QXVA 5KSVA 3FRUB 1A1MA 2HRLA 4JANB 3FQXB 3HR5A 3U46B 2YA2A 4DKEL 4WWKD 4M1DL 3LKPB 1KJ2H 2GSIA 3RWHB 3I9GH 3L7EA 1AGFA 3NA9H 4UT7H 2BRRL 5HGAB 2VDRL 1BQLH 1IGML 4UQ2B 4XNZB 1MRFH 1RHHA 5I8CA 3IDNA 2AV7B 1BM3H 3QAZC 4NQVB 1KCRL 3F12B 4JO2H 5AZEH 3VRJB 5T1LB 3MLRL 2NX5B 2BHUA 1B2WL 2XRAH 2CUMA 2Q76A 2CLRA 2VLJB 5C9JA 3GMMB 1C7TA 3QDHA 3OSKA 5CS7A 4NRYA 3SDAB 3WL9B 3DV4B 3EYVB 3VMPA 4RGNB 3HAEH 1YNTB 2VDKL 3SBWC 2BP3A 4QHKJ 5DRXA 4XT1C 5F9WC 2JJSC 4FTVD 3OKYA 1WAAF 4XMKL 1U8JB 5HHXH 3BGMA 4PREA 3CVHL 4KAQH 3DTXA 2EH8H 5F1SA 3KGRA 4ZTPH 1BZ7B 4IJ3C 4TVPH 1IGFL 3VFSA 2VC2H 3I3DA 5IG7B 5I9QC 1A6UH 3X3GH 1HIML 5I18H 2X1QA 3RDTA 5IEHB 4NO2A 4DZ8B 5HYJB 5EC1A 3S34L 5EOTB 5FUOH 5FO7B 5LVEA 1OAKH 1N0XL 5JHLH 1J0YA 3EO1B 5DUMH 3QISA 1VERA 1BX2A 2J6EL 2WP3T 4XP4H 5CIPH 1FFQA 1DUZB 5F9OH 2PCPB 3C2AL 3AU1A 5EBMB 1G7HA 1EHXA 3D2UA 1GCFA 1HDMB 3HRZB 3VFNA 4XI5C 4ZFZA 5FFLA 1MJUL 1OGAE 3WKMH 1E4XH 4FHBD 3SJVE 1GOFA 4BZ2L 5HGBB 4YPGB 4XPBL 4M6NH 4CW1A 3P77A 4K3GA 1OF2A 3TF7C 2FEEI 2AXGB 2MKLC 1AHWA 1GGCL 4JO4H 4KRLB 3QR2A 3T0EC 1QVOB 1F4HA 2XA8H 2EDHA 3GMNA 4LPVA 3STLA 1A9BA 3C5ZA 1KCSL 5DJ6A 5E94B 3UJIH 3RWDB 4YBHA 1W72L 3TH4T 1WFNA 5MI0C 4P3WA 1T1WA 4G80A 3CZFA 1GYAA 4OV5A 4FQQA 4JFQA 3TVMB 3X11A 4UU9B 4ZNEA 2VXQH 2KBGA 1AGEB 5KN5A 1DANT 1MHCB 2B4CC 5IROA 1R24B 2VKXA 3QHFH 3DURB 3L5XL 1QSFD 1DLFH 1UM5H 5D7KD 1A6WL 1WIUA 2AK4D 4ONGL 4MSWB 1QLEH 1S7RA 1QPPA 2DLTA 2YS4A 4DGVL 3AY4C 3IFOB 4NQDB 4GW1A 4ONFH 2ZNWA 1DSFH 2Z35A 5HHMB 5JXEA 2QSVA 2X4QA 4IDJL 2Y5TA 1S7VB 4NT6B 1CE1H 2NX5E 4J3WA 4EJ1C 1UGNA 1ACYL 5C08A 3WS6C 2NY6C 4WU5B 4YFEA 3M1BA 3ALWA 1F4WH 1R3IL 5FM5O 3U0PB 1BQHB 3BKJH 2IQ9H 4G8GA 5EU4B 4Q0XL 3WUZA 3VXMD 4RGNE 4ZFFB 2GT9A 2XG5A 2EE3A 5IB3B 4LRNL 3MRJB 4JFPA 2NY6D 2CKBB 3GMLB 1VEOA 5BO1H 4QRPA 2R4RH 1CXIA 3T2OA 3GSNA 1KJ3L 1MI5B 2DQIH 5GGVY 1KLUB 4ZUTB 1K8DA 3HPJA 4NQCB 1MCQA 1VADB 4M7KH 3O0RH 4PJXA 2WV3A 4S0TD 5ELIA 5E2JA 4XP1L 4X7EC 3QUKB 1EEQA 1JPST 4PJHB 1V3KA 4NKMB 5FF6B 4P2QB 2QSCL 6CGTA 3TV3L 3WJJA 1A6PA 4YWGH 4QXUH 4NZRL 4C83B 2PTTA 2UYLA 3MLYH 2QEJA 1INEL 5DFVC 2CXKA 4ODUA 3EYSH 4P3CH 1LP9E 2WWKT 3MRHB 4WHCA 1JZ8A 1XGYH 5C0GA 4U3HA 1BZQK 1Q38A 4AQ1B 1J05A 2R1WB 2VLRB 5CGTA 3P11L 1SMAA 3BHBA 4ZS7L 4ZO7A 2HJKA 3O3BA 4S1DC 2VLLB 5DFVD 4EOWL 3INUL 3GKWH 1U36A 5D7SH 4OZ4A 1NMAH 5KAQF 1TCMA 1H8NA 3PJSA 1I3GH 3B2VL 3EIFA 1P4LB 1VGEL 1A6TA 4P46B 3ARDC 5DLMH 3S3PA 4APQD 5HYIA 4P49A 1KOAA 4S1DD 3STBA 3TP4A 4XCEB 3QCUH 3ZE1F 5GS0H 2HJFB 4PJBB 4ZOAA 3KXFA 1FHGA 4YHNB 4JREC 4OZFH 1BWWA 1WQVT 3UXFA 5I30H 4DQOH 2PXYC 1YQVH 2AQ3A 4XBPA 2GTZB 4EZMA 4XMLL 3ARDD 4CMMB 2MTPA 1J8KA 3IDJB 4P2RA 3CXDL 3QIWC 5B8CB 5JZ7C 2VLKD 3QWQB 3MRQB 1GAFL 4L8DA 2FSEA 2FZ3A 3D0VA 4N1CA 4NQDE 5CJBA 2XFXB 4LNRA 2BSSA 3AREB 1MAML 3TPUA 3FO9B 3WHXA 2AGJL 1KB5L 1MLBB 3WXWH 1BOGB 3BH9B 2JCCA 4Z8FH 3L6FB 5JZ7D 1UT9A 3D5OF 3UTSB 3CJJA 4G5ZL 4XPHL 1ORSB 1E4JA 1ZEAL 1IBGH 4PIRF 5DS8A 1JK8A 2IFGA 1SYSB 2Z4QA 4NQSB 1WVZA 2LAAA 4HFUL 3SE9L 3ULUC 1D5IL 1XGQA 3EHBC 1MFCL 2XI9A 4I48A 3CFBA 2IPUG 5JR1L 5CMAB 2ZCKL 1LP9F 4CVZB 1AD0B 4I77L 1I9RL 3ULUD 4TUJA 3FCTB 3EHBD 3S36L 5MEQA 4QF1A 3T65B 4NYLB 3MA7B 3NH7L 1BAFH 1MWAB 4YPJA 1U58A 2ZKHL 3TO4B 5DQJB 4PJEF 4P2QE 5I75B 1VFUA 3WE6A 4JR9L 1XR9A 4G6JL 4HJ0C 1DBML 3QIUB 3CK0H 5JW3H 5KVDH 5LQBH 4WTWA 4Y5VB 5ILTL 2QQNH 1U3YA 3NFNB 5BRZD 4LLUA 4XBGB 2ERJC 1X5GA 3K1KC 4HG4K 2FR4A 1ZVSB 3JTSB 3FN9A 1RIHL 3ESUF 1FLTX 3AXLB 5JO5B 2VLRE 1NGQL 1K5NB 5I1HH 1SEBB 5ISZB 1G7JB 5D1ZB 4HUUA 4ZQKB 4WWID 5LAXB 1QR1B 3OMZA 4LRIC 1JL8A 4WWKA 1C8PA 5T1DH 5DUPH 4IEFB 2L4OA 8CGTA 1YNKL 1LDSA 3DXAB 4C56E 2OK0H 1PZ5A 4LPYA 4Y19D 5KG9A 1IEBB 1VCAA 3WS3A 4PRID 4LHUG 3QQ9C 1T0MA 3L9RA 5MEPA 4HUXB 2XTJC 1FC1A 2BC4B 3UJTH 5K9QG 4FQCL 4N8VG 3D0LB 4XGZA 2P47B 3HZVB 5D7IE 1A0QL 3SDYH 3G6AB 1XF5A 1YA5A 3QFJD 4MJ6A 5JPNB 2CIIB 2W92A 1R3LA 4IOFC 5E9DE 1OM3L 3QQ9D 4NO0D 5L9DH 2FO4A 3B5HA 35C8L 3HMXH 2XTJD 1VSCA 4G6FD 5TQ0L 3CMOH 3SQBA 4FTVA 3VW3L 2IWGA 3KYKH 3OTTA 3MA9L 3D25A 2EXWC 3WKNA 3HI1B 4IOFD 1MSPA 3MRDA 1I1AB 5I1JH 1VPOH 1UXWB 3DIFB 4FMKA 3RZCC 2OTUB 4ODXA 3VU2A 4PJ5B 3STZB 2BXZA 3SBWA 2ENSA 2UZYB 5E03A 2OL3H 3WYRA 3CDFA 4MS8C 5L6YL 1NDMB 1U8PA 2G5BA 3Q6FB 4FXKB 1BIHA 3O6KH 3BGAA 5FAAA 3MNZB 3TZVD 5DEGB 1DVFC 1SY6L 43C9B 3RZCD 4F15B 3BP5A 2VR9A 1F97A 1RV6X 1N0LA 5EOCL 3N1QC 2B5IB 4F33A 4OUUA 4N8CH 1K4DA 4MS8D 5CJQH 3OF6D 4A6YA 5T3ZE 3MRPA 3MOAL 2YXMA 4ZFGL 4U6HB 1DVFD 1A1OA 4Q9RL 1UYWL 5CZVH 1JI1A 1S5HB 4M5YH 3HAEG 4NO3B 2HT3D 4DVRL 3O4LD 5DD3L 4CL7A 4QHLB 1JN6A 4M62H 3G08B 4AIZA 3V5DA 2GFBB 4DGIH 4NM8H 3FQTB 3TCLA 1T83C 5EU6D 4QRUB 1NGYB 4I1NB 5KSBA 5IQ7L 4QGYA 3QUXC 5TGBB 5IW6A 2A6JB