5AYUH

Crystal structure of hyhel-10 fv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Crystal structure of HyHEL-10 Fv
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ayuH00
4FTVA 3REWB 3FQTA 1J10A 2V5RA 1CFVL 2MPAH 4M5YL 4U1NA 3QDMA 2VLJB 1MFAH 3OKEA 4I48B 1EEZA 1H3XA 3CH1B 4U1MA 1FNEB 2FX8H 4QRTA 1OL0A 5MHSD 4ZS7H 4GFTB 1CG9A 5EBWA 1B2WL 3MRRB 5HHMB 1I9RL 3FFDA 3QXVA 5FECB 1F97A 2J2ZA 2NY5C 2WZPD 3MBEA 5TFSH 2QADB 1FLRL 3VDCA 5SX5K 5HI4C 2JB6A 3QAZC 3T3PE 4XGZB 3AFLA 4RDQF 5IW3A 3UTPE 1LQSR 1U58A 1RZKH 1JTPA 1C5DB 3DUHA 3SBWA 2FSEB 1UXSB 2RIKA 4Y16A 3VFMA 3D39A 1IGMH 3JV4A 5D7KE 5C8JA 4C56D 4HDIA 1I1FB 2V7NA 4FQHA 1PKQE 1Z6JT 4RMRA 4PS4L 3HC3L 1CDGA 5GRVK 3GEWB 2XN9A 4L8DB 3HAEH 3U9PL 1FYTD 1NCNA 3OV6A 3LS4H 4Y2DC 3VD7A 2OP4L 4W4NA 1U8HB 1ULVA 2COQA 3U0WL 5TDNA 5SX5H 5IMLB 3QUMH 4NJAL 1KEGH 12E8H 1MCJA 5FGCE 4JO2L 2I07B 3D85D 4G9FB 1AGCA 3VMOA 1A64A 4AH2B 2FNBA 1I3RB 5CZXD 5CSBA 4JRXA 5ILTL 4GW5B 3VGEA 2ADGA 4HUNB 3HI6H 1QEWA 1FAIH 1HHGA 3KYOB 1E4KA 4V2BA 2IALA 4XPTL 1OM3H 4NKIL 4M6OH 3QIUD 2PW1B 4F9PC 3MV8A 1ZHLB 4KUZH 4JFEB 4N9GA 4ODTL 3V8OA 5EBGA 4Z7WA 3RUGB 2ITCA 3QIBC 2Z8SA 3GSUB 4GBXD 1K4CB 3ZHKA 1OTSD 4RGOL 5HYQA 1WWAX 1R0AL 5L8KB 1KT2A 1PG7X 5EO9B 5FO8B 3GMNA 3S34H 1NGXA 4WW1A 5LKNA 2HT2C 4QOKA 3PWLA 5JXAH 1TNMA 4GOSA 5FO7B 2Q7NA 3GI9L 4YWGH 5HBBA 5KW9H 3EJJX 5GGTA 1KYOK 4ODSH 1MHHB 3Q5YA 2PW2A 1OAQH 3K1DA 3RY6C 3X3FH 3JTTB 3QZWG 3BP6B 1FH5L 4P46B 5DUMH 2VB5A 5T1KD 2D7TH 3L9RB 3QEGH 4WFED 2QBWA 3KPRA 1CD1B 1IC7H 4RAVA 2HFEB 3JUYA 1ND0B 5CEYB 1KB9K 3BPNB 1QSVA 3NFNA 3BIAX 3QDJA 4CMMB 4QGTA 1J8KA 4XMKL 3D3VE 3O9WB 5KSUA 4BZYA 1BWMA 3DXAE 4PRNA 5D5MF 1MHEB 1H3VA 4OF5A 5GGRB 3LEYH 2Y25A 5GZOD 1D5ZA 1DBJH 1G7MB 5FCSH 1INDL 1QYGH 4D9QD 4Z7QE 4NJ9H 4R90L 3EDJA 4XAWL 4ZO8A 3SEPA 3LV3A 1CFQA 2DDQL 2Q8BL 5EOCL 2DTSA 1YY9C 3SKJH 1OP5K 3ULSB 3O2VH 3EAKA 1JHLH 4EJ1C 3GSWA 4ZYKB 5CJ5A 1DBAH 1Y0LB 3HE7B 3I2CH 4UDUB 2X4RA 2CDEA 2PXYA 4ZG1A 1RJLA 4S2SA 4JANB 2FX7L 2BP3A 2LVEA 4X4YA 1JPFA 5ISZA 2F74B 3GUTB 4H20L 3PXJA 1XR9B 5E94A 1IILE 3VXME 4HH9A 4J12A 3WIFB 3DETC 2R29L 5F96H 3KYMA 5TPWH 4U1LA 3UTSD 1IGTB 3L3KB 1JHTB 4UILH 2B2XL 2BOCA 2H6PA 5HI5C 5JIIA 2BNRE 2FCBA 1IC4H 1RHFA 4J4PA 1GZPA 4S1RH 3QI9C 1VPOL 2IANA 4F2MB 3QRFM 1ZS8B 4P2OC 3PIQB 2BCKA 2CR6A 2KPNA 5T1MA 5B38B 4X4XA 2B5IB 4L8BA 2V17L 5I1EL 3MV9B 1I9EA 4Y4HA 1GZQA 1FVDB 4QHNA 5F1IB 3RBSA 1XF5B 3BPOB 3RDTA 1LILA 2E8ZA 4MQXC 1YNLL 2JB5H 3U9UA 2FO1A 4A6YH 4JHWL 3BO8B 5FXCH 2Y36L 5CJQL 4X4ME 1JFQL 1UZ8B 4KAQH 4HXAL 1XFPA 4U1HA 3L3HB 4OZGF 3LEVH 3WXWH 3N50A 1KULA 2ITDB 2BSSA 5DHVA 3S36L 5J11B 5CJBA 5J1AB 3X17A 3OJDA 3OXRA 5FA4B 1S9WA 5DGRA 1RJYB 3VXSA 2DJ4A 1TJHL 1KCUL 2CD0A 4M9PA 5I15H 3U30C 4EZMA 1B0GB 1MWAL 3NCBB 4YHYC 3FFCB 3WLWC 1CDUA 2BHZA 5FKPB 5C0FA 4DQOL 4ZFGH 3V6ZB 4CL7A 2AK4D 1GXEA 1VKXA 2IGFL 4JFZH 2MKWA 4XMLL 5BRZB 1TQBB 2XZQH 3BE1H 5A2IH 5L7XL 4GXUN 1C7SA 1L0YA 3TN0A 3EYQD 1FNSL 1Q1JL 5E2WL 1R3IL 3NOIA 1OP3K 5E5RB 5J12B 1J1PL 1XR8B 1Q0YH 1JGEA 3OKKA 1M7IA 1U8PB 3EOTL 1A7OH 4QXUH 3EYOB 3I6LD 3IDMA 5HYEA 3KG5A 5ID0A 3JV5A 3TBWA 3B9AA 3MRPA 4K71C 2FH8A 4GUPB 2C1OB 5D8JH 5FEBA 4KROB 2VDML 2JJVA 1BHGA 4FS0A 4LRNH 1NANI 4RGNC 5GQBA 2LABA 3GSOB 4BK4A 3BIKB 4JM2A 2CR3A 1HYSC 2C3XA 5EBLB 4LHQB 2YN5A 1RULH 1RUMH 2YUVA 3ARDD 5GIRB 3CVIL 4KKBC 3CFJB 4NKDB 1OP3H 4DKDC 2X7LA 3KLHC 2DQDL 3W5NA 1R3LA 5BV7L 3KR3L 4YBLB 4DVBB 1ITCA 4HLJA 4EVNB 4DVRH 4G9DA 2RCSL 4TSAH 2CKBA 4ODUB 1FBIL 1A7RL 1H5BA 3O2WH 3MRGA 2OXHA 4OZ4B 3VXRD 5LXGH 2GSGB 1IFHL 3NTCH 3WN5A 3QWOA 5DHYA 2FR4A 3F7QA 1BOGA 4M8QA 4KTDL 2NPLX 2X70A 4MA3A 4QRRD 1W8NA 1WIPA 2CIIB 3IB4A 1H15B 1G6RA 2MTPA 3WLBB 5C07E 5KOVC 2WINA 3IETB 3EO0A 3CFBA 4G5ZL 2G2RB 1MQKL 1SJEB 1V3JA 3FT3B 2E6JA 3KLAA 4M6NH 1MSPA 3HI5L 1MRCL 3MLRH 1EAPB 2AJYL 2F5AH 2A6DB 2QQNL 1P7QB 3UXFA 1IC1A 2XKNA 3TJHC 3O2DL 1Q9LB 3QXWA 4RNRA 1MCOH 4X6CF 1XF4A 3NPSC 4HPYL 3MGAA 3BHBB 5L88H 3K80A 4XNMB 2GQHA 5F89B 2VDKL 3OSKA 3PL6D 4F7TB 5I30H 2W60B 1CD0A 1TFHA 1T2QL 1X5JA 1C5CL 2PO6B 3IDUA 4M5ZL 2FHCA 2MNUA 1N4XL 3IU3A 4GAGH 3PGFH 4NKOA 3D2UB 3RWIB 3LB6C 2YEZA 5DK0A 4HIJB 4JQXA 1JZ8A 4M7KL 3BDXA 4K07A 4RIRA 4HWUA 1FLTX 3BW9A 4ZSOE 1PLGL 5DJ6A 4OV6F 4X6EB 1TZHA 4O2FB 1DLHA 1ZHKA 2WWMC 5LBSH 4BUGA 2DL9A 2PYEA 4Z7VF 1ZA3B 1NSNH 4EUPG 4MAYD 3DMMD 1E4JA 4GRLA 4WFFD 4HG4J 3SDDD 5IG7A 3Q5OA 1NFDA 3I3EA 5IF0A 2DMCA 5EORH 3WSQL 5A2FA 5I8KL 2EDEA 3KPQA 2HRPH 3PV7A 5FV2A 1KGCD 2QLVB 3G6JF 4I0PC 3NIFE 4X80L 4PJFA 4XBGA 5K9QG 3INUH 3MA9H 2DWDB 2HJLA 4S1DD 3R0NA 1RFDL 2C1PB 1YJDC 4M61A 4S0SD 5DFVD 2DLGA 3MNVA 4I3RL 3HAEB 5GRJL 5C08D 4LAQH 1UT9A 5EIIB 3STLB 1RZJC 3QUMB 1G7IB 1AXTL 2O5YL 3QQNA 5I8OL 1ZGLA 4PTTA 3BP7A 2VR5A 5C09D 1TPXB 5IUSA 5HHVH 3NIGE 2CXKA 1LP9B 4NCDA 4JRYB 4U6VH 4P3WA 4NM4H 5F88A 2OL3A 1AGEA 4HWBH 3RWCB 3TIEB 1UJTA 4XXCA 3U7YL 3WIHL 1HK6A 4X6FA 2HVKB 3VFPB 3BUTA 2D7OA 4PJ7E 2SEBB 1CWVA 5BVJA 5IKCB 5DUPL 2ADIB 1JWUA 1J12A 1WIOA 5SV4A 3MC0A 5BQ7A 3DX7B 1EVUA 3RGVC 4DKEL 1AXSA 4WI9A 3DOSA 4JPWH 1WAAF 4JFDA 3QEQD 4P57B 4PRPB 5D2NC 1T0NB 1UM6L 5CSZB 1ZANH 3EFFB 5D93B 1ZVSA 2IAMC 3PWPD 1RJZA 4GMSL 2G9HA 4ISVB 1NANH 2AXGB 1BQUA 4Q58C 4YXHH 4QRSA 4YXKH 4QYOB 2W1NA 1BFVH 3BD4A 4YHMH 1CGVA 1S7SB 4MA8L 2HH0H 4YX2L 2LVCA 5K9OB 1FL5A 3M17A 1GC1C 4GRWH 2XWBB 5CJOL 5D6CA 25C8L 5I9QC 4EQ3A 3CNKA 5SV3A 2XA8H 3TNNB 2P44B 5F1KC 1YQ2A 4ZAKC 2GJZB 4TVPE 2VNCA 1P69B 3GRWH 2YWZA 3LD8C 1J0JA 1J0IA 2PYFB 1U8LA 1KTKE 2WUCH 4IS6B 1XIWB 1MI5B 3NFSH 5ESVB 4JKPL 1PY9A 3O6FB 4XC3H 1EK3A 2OI9B 5CUSH 3ZDYE 4Q97A 3REWA 5FOBB 3NH7H 2F54E 3WUWG 1CGYA 4RGNE 3KDMA 7FABL 2VLJA 1UACL 4I48A 1D5MB 4KJYB 1Z9SA 4K7PL 1ZT4B 5TH2B 3CH1A 3VI4E 3ULVF 1EHLH 2OK0L 4RX4A 1CFNB 4U1SB 1QFPA 2IPUG 4QTIH 1J8HD 5A3ID 3D9AH 4RAUB 3MRRA 3T04D 3UZEA 4HMEA 2VZ1A 1RUQH 4MD0B 3BP4B 1CYGA 4G8FB 5FECA 3V5KB 5JHDB 1JZ4A 1D3CA 5BO1H 2EYTA 4ZTPL 4NQEE 4OT1H 4UV4L 4XNQB 4XGZA 1IBGH 1C5DA 1KFAL 4UIMB 5DJ0B 2FSEA 1NUFA 3C5ZB 5F3HB 1K3IA 4QF1B 3ROOB 3CLEH 5D1XC 2X4QA 4JO1H 1INEL 2I60L 1I1FA 4NN7C 2XIDA 4FHBD 2WWKO 1MFNA 1ROWA 2P8PB 4LNVA 2CK0H 4ALAH 1J1OL 4TTDC 4NNYB 2YK1H 1BAFL 5HGAB 4L8DA 2HJFB 3PGCB 4MWFB 3LVEA 1U41A 4OV5B 4FQJL 3TNMB 1U8HA 2FEDD 4JFFB 1MUJB 1AHWB 1GPOH 2I07A 5EZJA 4G9FA 5E00B 1I3RA 2E3VA 4ZUUB 1VFBB 2F53B 4GW5A 4A6YB 3DJ9A 4ZFOL 3CX5K 2QQQA 1XGYL 3QPXH 4W4OC 1OSZB 1NKRA 3BDBA 1ZKAA 4CVWA 4OQTH 1DEEB 2O5ZH 4F9LA 1U8IB 6CGTA 2ARWA 1ZHLA 4JFEA 2H32H 3J7HA 2AJZB 1NJ9B 5K59F 2W65B 1K4CA 4NO0B 3C60B 5GJTL 4M1CC 4JN1H 4LEXL 3BJ91 5EO9A 1D9KA 4GRMB 1NCUA 5FO8A 1MCKA 3MRKB 5HHQB 1IE5A 3UPRB 1AIFA 2ATKB 4Z18A 4JDZB 4YGVB 1OPGL 3CZJA 5FO7A 1WV7T 1MHHA 1UCTA 4HFWB 3MBEC 5JQ6H 2X1WL 1UA6H 8CGTA 2IBBA 1JGLL 2OTWA 4P46A 2Q8AH 2J8UF 2VO5A 3L9RA 4N0RA 2C3GA 3L3IB 4Y16C 1CD1A 3B83A 1ND0A 5I1AB 2Z91B 3MRBB 2OR9L 3AS1A 3ULUH 2JELL 4M3JA 4PY8I 3WV0A 3O9WA 3V4VH 1KJMB 2A9NH 3O4LB 3PQYE 1KB5H 3UAJC 3U4EB 1RU9H 3QUXC 5C3LD 1CK0L 3CGTA 3ARUA 4OB5H 3BQUD 3VGDA 4XZUB 1MHEA 5F7DB 5D96C 4P2YA 5GGRA 5DEFB 4NHUB 3MLUH 1CLCA 2F58H 3VXUE 3T2OA 4BKLB 1PDKA 1YMME 4MNQB 1BF8A 1G7MA 1G9NL 2J7LA 2YBRB 3DHMA 2KDGA 4Z78B 4XAKE 1FCCA 1LEGB 3SO3C 4I3SH 2VMFA 4X7DC 1AO7D 1MLBB 1E4KC 1T6VN 1GOFA 5DURD 2I9TB 1KXTB 3ZKMD 2YD2A 4ZYKA 5INCB 2VKXA 3HE7A 2YXFA 4IRJD 3QJFB 3U6RB 3CC5B 2E9BA 2YPLD 1FL6B 2R56L 4UINL 2F74A 4X99B 3GUTA 2RFXB 1I3GH 4KQ4L 1K5NB 3W0WA 3TIDA 4MJ6B 4R0LA 4LEOB 3W2DH 3WJLC 5TF0A 1IGTA 3I3BA 3L3KA 5A43C 1M4KA 1JHTA 3RIFK 1WC7A 1YPZE 3O3DB 3HB3D 5T3XH 1NFIB 4F2MA 3CU7A 4ZTOH 5IQ7L 3NCFB 5F8RC 1RZGB 1ZS8A 3PIQA 3BEVA 1FV1A 1HNGA 3RKDD 1U3HA 4KI1A 5B38A 4LFHD 2I26N 5IBLD 5D2NE 1EGJA 5F1IA 2AV1B 5GISL 4JFHD 3P9MB 4F3FB 3GSNL 4PJ5B 3B2VL 3IFLH 4HWEL 3IS1X 3ZE0F 3BO8A 5B8CA 5FB8B 5KAQF 1JGUH 3ARPA 3LKRA 1DANU 2EXWC 1UZ8A 3FN0H 5KN5B 3WNNA 4E41B 3L3HA 2WAHA 1U2HA 4N5ED 2ITDA 4ENED 1X6NA 4IRZH 4EBQH 1LNUB 2ICEB 3VMNA 3QUZC 2AEPL 2EE2A 5J1AA 3RVUC 5SWSB 5FA4A 3TA3D 1ITBB 1RJYA 4PV8A 4P9ML 1T7VA 1QA9B 4UT9L 3RFZC 3LHPL 2CUIA 1B0GA 5E8NB 1CICC 1MCCA 4IIQB 5I16B 4QRQB 3FFCA 3IFNH 1VADB 4WY7H 2EDFA 1F58H 3EO1B 4F58H 3V6ZA 1DBKH 1FE8L 2WBJB 3VWJA 1FFNB 1A6PA 5BRZA 4KRMB 4MMZC 4M48H 1UM4H 2QQKL 5FHBH 4NP4H 3VFRA 3S4SG 3GK8H 2VLKE 4PBVC 3S35H 2V2WB 1F3DJ 5I1JL 2GYSA 4KVCH 3VWKB 6FABH 2ORBH 5E5UB 4GG6E 4UBDD 4F57H 2NY4B 4WEBH 2WNGA 3PABB 3OB0K 4WCYH 3RA7L 1VGEL 5FYJD 1XR8A 2Y1VA 1U8PA 3EYOA 1NGPL 3MZGB 5JNYB 1JWMB 3TH2T 4GUPA 4QWWD 1AC6A 2C1OA 1AE6L 3SDXE 5HYJD 4G6KH 2DKUA 5I8EB 5A2LH 2DQIH 3GSOA 3WFCL 2B4CH 3BIKA 2N56A 5EBLA 4AJ0A 4RWHA 5FM4A 5H2BB 3CDFA 1A7QL 4KHXL 5GIRA 4PJIF 3CFJA 4GKSA 4LCIH 2BVYA 3OB0H 4NKDA 1QOKA 5IB5B 1UEYA 2M8XA 5CGMA 2VXSH 3H0TB 2V2TB 2CDGB 2EDKA 4EVNA 1Y6MR 2FHBA 2L4OA 4LCYB 5GS0H 4ODUA 4ZXBC 2P5WB 2D7PA 4OZ4A 5FDYA 1FVEA 3VFTB 3QXAA 3GSQB 1AP2B 4ONHB 1N6QH 2GSGA 4NRYB 4ZMAT 2FGZA 4OCXH 4U2YA 4XXDB 3G6DH 5DHXB 3MACL 1JV5B 2NY3B 2ZCKH 3CSBA 1UWEH 3HNTH 5JOFB 1A3LL 1E6OH 3MV9D 3P9LB 4MNGB 3LQAL 5F9WC 2CIIA 4I18B 1H15A 4FTVE 1RZ7L 1RK0A 5C0BE 3WLBA 5DD6A 3TN0C 3IETA 4Q0XL 3M8OL 1LK3H 1UVQB 2G2RA 1SJEA 1P9MA 1CFSB 3PWUB 4X6DA 1K6QL 3FT3A 4OCNC 4LOUC 1R5WA 4GAFB 3FKUS 4PJ9C 1EAPA 4IOSD 2A6DA 3LOWA 1P7QA 1RUPL 2PTVA 5ADOH 1QQDB 4GRWB 1OAXL 1I8LC 1OAYH 1Q9LA 2FJFB 4YUEH 1F02I 3WDIA 1QNZH 1C8PA 1JI1A 3F7RA 4XNMA 1T7YA 1JPGA 1F4XL 3H7BB 4QHKJ 4OBRA 5HHXH 4F7TA 1RUAH 3DUUB 3V4UL 1MH5A 5C0IB 5HHNB 4HS8L 4X9IA 3Q6GL 4S1QH 5I1CL 1O0VA 5E5MB 1LO0H 1EIBA 5I1DA 3HUJF 1IGYB 1MHCB 3SPVB 3AS2A 1Q0XL 4NZRL 1ZT1B 1YNKL 3V4PL 3VGGA 4YC2C 4EI5D 1KPVB 3WL9B 3O8XB 4PG2A 4X6EA 4O2FA 5HD8C 2GW5A 4MJID 3TYGH 2HYMA 5JDSA 1JPTH 1ZA3A 4LLVB 3C6SB 4P23B 3WN5C 3HMWL 1KLGB 3LIZH 5K9JH 5ADPH 2G60L 3PP3K 4U7MA 4K3DH 3PDOA 4HWNA 4JHAH 3MJGX 1NCBL 4N1CA 4F8QA 4H1LG 1BLNB 3FT2A 3UBXA 3SJVE 4XH2B 3QIUA 5EZLB 2AS5M 4L8CB 4OSUL 1H3TA 2X4UB 4FG6C 2WQ8A 1F2QA 2Y5TB 2DQCL 5GGVL 1CLYL 4URTB 3MUZ1 3IGAB 2DWDA 4FZ8L 4O4YH 4CNIB 5GRUL 4Q9CA 1QSEB 3MLWL 4KJWC 5KOMC 2C1PA 3X14B 1WZ1H 1S7VB 2X6MA 3PP3H 4LSTH 3HAEA 5TE6L 2R4SH 3MV01 1KNOB 2B1HH 4LASH 2JIXB 2FHFA 3OF6D 5EIIA 4O02H 3K8KA 3STLA 3QUMA 1ZLUK 1KG0A 2NLJB 2W0KA 5B39G 3H9SD 4YFLI 4PGBB 1JGVL 5IBTL 3MJ9L 1LP9A 1DVFC 3O4OC 4M9OA 4OD3H 3V52L 4KJPD 3QDJE 4JVWA 5HHPB 4POZD 2XZZA 3DROB 3MRLB 3S37L 3TIEA 1IAIM 5DS8B 3HR5B 4HS6A 2H32B 5HDLA 3VFPA 3P9WB 3N9GL 4R4BB 5D1QD 2SEBA 3ARFD 1TJIL 3RTQD 4G3YH 1ZLUH 2UZYB 5IKCA 2ADIA 1T22B 4XP9L 1UH2A 4R97B 3DTXB 2R69H 2KUTA 3DX7A 1UCBH 3QCVH 3O45B 1NLBL 3W5MA 1NLDH 2AW2A 5D72H 2NXYB 5I6XC 4P57A 4I0KA 4PRPA 2P47B 1ONQB 3ZL4L 4M00A 5IB3B 3EFFA 4RQQB 4FA8A 3S97C 4G6FB 4PJDA 5DR5L 4ISVA 2VDPL 2AXGA 3LKSB 3VGHA 2NY5H 2ADFL 4MX7B 4QYOA 5IMMB 4X9FA 3SGDI 4DUVA 1S7SA 3U79A 4R96B 3T77B 5K9OA 3O6MH 3P3YA 2XWBA 2WIIA 5E9DB 5ISZE 3TNNA 3TVMB 4NBZB 4BK5A 2GJZA 2BVEA 4N1HB 3VXPA 3U7WL 5CFHA 1KB5B 2J88H 1B6UA 1UZ6E 5DEGB 4WI4A 2V9QA 3F5WB 3HG1E 5D6DA 1QSFE 1UJ3B 1V3LA 1VB9A 1BQHG 3TZVD 2A73B 1XIWA 4IS6A 5EU6B 1KENH 1MI5A 4PJEF 5ESVA 4U0QB 3RWGB 3O6FA 4HJJL 2LAGB 5FOBA 5EU3B 2NNAB 4JCLA 4OFIA 4P4KB 4EXPX 5JHLL 3ARBB 4M6ML 3L6FB 3RX8A 2GTZB 4HC1L 1D5MA 3IJSB 4KJYA 4JM4H 1ZT4A 5IVZB 5TH2A 5LWYH 2WBKA 4NFBA 4R9HA 2VH5H 3IJYA 3CSPA 4U1SA 4HCRL 4RAUA 4PJAF 4XVUD 1UGNA 3DVIA 4MD0A 3GMLA 2EXYC 3D5OF 4UI2A 4W70A 4LPTA 3KLDA 4G8FA 4LRIC 1EA9C 4NO3B 3V5KA 5JHDA 4WHYG 4FQCL 2VJXA 1C16B 5LGHH 2CRMA 1BP3B 1JZ3A 4XNQA 3M07A 5GRXG 5DJ0A 4ETYA 1GIGL 4N0UB 5C71A 3C5ZA 2Z8RA 5F3HA 4QF1A 5C0CD 3ROOA 2B0SH 4J3TA 2UWEB 5TE4L 4PGZA 3W11D 4IOFC 1MY7A 4I1NB 2P8PA 3C2AH 4Z8FH 3C87A 3O3BB 2E7HA 5K33A 4NNYA 2J1KA 4JRYD 3HCVB 5T33L 2HJFA 3PGCA 4XP1L 1FFOB 4WHCA 2NY1D 4OV5A 3EYSL 2AJSH 2AK4A 3FO1B 4PRIE 3SQOL 4JFFA 1MUJA 1AHWA 4PGEB 3NGBB 1CVSC 1TTGA 1NMAH 5E00A 3OXSB 1AR1D 1NDGB 3IF1B 1VFBA 2F53A 5KJRL 4WNQB 4WVRA 4XPGH 1ZTXH 2R1XB 5IJKA 1PBYA 1OSZA 5CHNB 4I3GA 4OLZH 2DQHL 3TT1L 4XWGH 3LSOA 5KSBB 3BPLB 5KSBF 3G5ZB 4AEIL 1DEEA 2X89D 4LVHC 1U8IA 4XCFH 4OBSA 2CK2A 1SY6L 3MRDA 1QLRB 2XQYG 5C0ND 2AJZA 3CLFL 1NJ9A 4HLZG 4M7ZB 2W65A 3LKPB 5JW4Q 1YYLL 3LN9A 3OL2A 2BNUB 3RRQA 5FA3B 2H9GB 3C60A 4NO0A 5IIEA 3RP1A 2HLAA 1PJ9A 3WNPA 1DFBL 4GRMA 4NQTA 3MRKA 5F7EH 2XNAB 2W92A 4YHPB 4C58B 2ATKA 2W0FB 4JDZA 4WO4D 1F4YH 4LHUB 4YGVA 5E6ID 5EWIL 4TTGA 3RPKA 4M03A 2EDDA 1DQDH 3CFKB 3NIDE 3T3PF 4I2XE 5FYJL 3KPTA 1A6TB 1PAMA 4HFWA 3SE4A 3DO7B 5J6HB 4AM0B 1CBVL 1OW0C 5IJVB 3L3IA 1PKQB 4HQQL 1NMCB 4YPGA 2Z91A 1YC8A 2FIRT 3MRBA 4Q9RL 1P7KA 5BVPH 2EKSA 4DAGL 1D5IL 5C0RH 2ZP0T 1KJMA 3B8SA 1ORSB 4OLWL 2YUZA 4WFHE 3U4EA 1DLFL 3I6KB 5FGCB 1NC4D 4YDJB 5F7DA 1HSAB 2FATL 5DEFA 4NHUA 3ULVD 1KYOJ 1T83A 4BKLA 5D2LE 1BVLB 1EFXD 4MNQA 4P5TC 4TQEL 1A4KA 1NGQH 1D6VH 3CSGA 2AK1H 3P77A 5A2KH 2VDLL 2YBRA 3WMSA 4Z78A 1CFTB 5E24E 2MQ0A 5FKAB 2O93L 1KB9J 2ATPA 1MNUL 1X7QA 1IARB 2HTKD 3BT2L 2IFFH 5F97E 2I9TA 2GKIA 4WW2F 1IC5H 4F9LC 2H2PD 4RMVA 5F7UA 1MCWW 3QJFA 3SHSA 1N7ML 5LQBL 3WD5H 4PJ8C 2P43B 4P3CL 4TRPL 3SE9H 2GJ6D 3SO5A 1FL6A 3AY4A 1A9EA 4X99A 2RFXA 4YHKH 5E2TL 3SGDH 4PLKD 1K5NA 1D9KC 1MFEL 1KN4L 3AM8A 4MJ6A 5I17B 1WWBX 1HH9B 2HKFL 4LEOA 1IGCH 3RY4A 4OM1H 2C7UB 2YPVL 2XTJC 5DJ8B 3WS3B 3KPSD 3WNLA 3O3DA 1DUZB 2VN4A 4PV9B 4AMKH 2HLFC 4JZNB 3P0YL 3T2PA 1SEQH 4XNZB 1NFIA 1IRAY 3VG0L 4JB9L 1S7QB 2IQAB 3HI1B 4JQIL 5IM7B 1RZGA 4U7SA 5E8DL 1I9IL 4LCWA 4PRHD 1CU4H 2XA3A 4TVPH 3VMPA 3D3VB 5IEKB 2FX9H 2VC2H 5KZCB 3DXAB 5HHOE 3VXTB 2PYEE 4W6XB 2AV1A 3UJJH 5HYFA 5FYKU 1B88A 3P9MA 1T4KB 4F3FA 4PJ5A 4WFGD 3O6LH 1S8DA 3A6BH 4QO1A 3VDAA 5DD3L 3SDDA 5M94B 3P11H 3DRQB 5FB8A 3CUPB 1U6AL 5KN5A 4AG4H 2Y9RT 4YQXL 4ODVL 3B9KC 4NQCD 4F7CB 4L4TD 3T1WA 1TCRA 4E41A 5FK9B 1BQLL 3MCLL 1A2YB 4P2QD 1NBVL 1J05B 3QNZA 5T3ZE 1LNUA 2ICEA 4OGAC 5CZVH 1QA9A 5ITFB 2N7AA 3QWRD 3N06B 4RGMC 4EN3B 1VFMA 5E8NA 4CU7A 5HVHC 4IIQA 5I16A 4QRQA 4OM0L 3DX9B 1VADA 3PV6B 2CLRB 3QNYB 1E6JL 3EO1A 4FN0A 3TC9A 4RMWA 4OCLC 2WBJA 3F62A 1FFNA 1A1NB 1VEMA 5FYLE 1TXKA 4XVTL 3VXMB 1JNNH 4Y4KC 2Q3ZA 5BMFL 2Q76B 4EDWL 1WICA 3O4LD 1HKLH 4PUBH 2J6EL 4YBQD 1EEYB 5D1ZB 2V2WA 2AJXL 3VE0B 3H9YA 2APXA 1FVCB 3VWKA 2BNRB 4R0LC 4CJ0A 2AABH 5D4QA 4CVZB 4L4VD 4JDVA 3PWVB 3PABA 4LVOB 4GS7C 1ERNA 3KPOB 2NY6B 4FFYH 2N7BA 1ZLVK 1JL8A 3N1GC 1HZHL 2R1WB 4PJBF 2AQ3A 4X5XB 4FNLL 1JWMA 4ODXB 4UTAL 1T1XA 1GGIH 2BHYA 2DQEL 5GGSB 5IWLA 4M3KB 4QRPD 5I8EA 1U3HC 4TN9A 2G5RA 5CD3B 2ZCLH 3HLAB 5CGTA 4RMQA 1RZ8A 2AAVA 1L0XA 3UTTE 5L6YH 5I1LB 4JFQB 3BD3A 1QPXA 4V1DD 5B8CC 5IB5A 4R2GB 5DTFB 1J0YA 1RIVL 1ZLVH 1T7WA 2KZ1B 3H0TA 3Q2CA 2V2TA 2CDGA 1WF5A 1U93B 1U3JA 1CN4A 4LCYA 4Q7DA 2HTLD 2A6JB 1GHFL 2Z4QB 2P5WA 1NKOA 3G04B 2MQ3A 3VFTA 3GSQA 3HZKB 3NACH 1V7ML 1XF2B 1AP2A 2C4XA 4ONHA 3MXWH 4CMHC 4LNRA 3E0GA 4PJGE 5IFJB 1KBGH 1A6WH 5AG8A 4XXDA 1EZVY 3ZDXF 1FNGA 1JV5A 1KIPB 3OJVC 1B4JH 5JOFA 3QFJA 5EU5B 3TO2B 3ZTJH 4CVXB 3GHEH 3P9LA 4MNGA 3VWJC 3SDYH 3O0RL 3RVXD 4I18A 4XVSL 1ZLWK 4PGCB 4NZJA 4OGXL 4FXKB 3WFBH 3ILPB 4ELMF 4P5KB 4KWUA 1PGRB 3EYFA 1CFSA 1JHKL 3PWUA 1G9EA 1E0OB 1ZGLM 3MRFB 1T89A 3N85H 1IKNA 1YUHB 3BH9B 3IRPX 4WWKD 1IEBB 2NR6D 4L1HA 4NZTH 4Q9QH 1TDQA 4AL8H 2Z31D 1FDLH 3QAZB 4JVPA 4GO6B 1KJ3L 5BV7C 4OJFH 1QQDA 2HG5B 2M26A 2EH7H 1MFCH 1FAKT 5AWNH 2FJFA 5SWSD 1J0HA 3H9HA 1T03H 4JG1H 1NDMB 1ZLWH 3HRZB 3SCMD 3H7BA 5D70H 1EHXA 4DCQA 3DUUA 5DRWA 4ZPVB 3TLRA 1YJDH 3S98A 5C0IA 5LAXB 1G9ML 1YECH 2O5XL 2DLEA 3K8MA 1YYMH 1ACZA 4Y2DB 1IAII 1U0QA 1IGYA 3X13B 1X4ZA 1RZJH 3SPVA 3AMLA 4HFUH 1ZWIB 1O7VA 3BGFC 1FHGA 1LVEA 1KPVA 3WL9A 4QHLB 5CJXA 4KK6D 3JWOL 1JI2A 3HN3A 1NAMH 3AMKA 2DQTH 4M7JL 3KWWB 2FD6L 1I9JL 1KJ2H 4P23A 1U8JB 2D9QB 3NCJL 12E8L 3PWNB 3ZDZF 2PF6A 1S5HB 4JFOB 3QIBB 3RI5F 5C07B 3O6KL 4XH2A 4KI5F 5BZDB 1LO3H 5EZLA 4L8CA 1FAIL 2HT4C 3LKOB 2VAAB 2X4UA 1KTDB 3BWAB 3GNMH 3O3AB 2V5YA 4JN2B 4C4KO 5KVFH 4NGHL 1W72H 4Z7UE 3IGAA 1TETH 3BSZH 2R39A 4L3EA 4OLYL 3WFZA 1JZ2A 4PREA 3IT8D 1QSEA 3R1GH 4NWTH 1TZIB 4ZS6D 1EJOH 3DECA 3ZTNH 2XTJE 4CKVX 2HMID 4PJHE 4LKCB 3UJIH 1RJCA 5CEXB 1GC1H 3T08A 4Y1AE 3JV6B 3QCUL 4FQPA 4J1UB 4LSQH 3MLXL 4PGBA 4LPXA 2R4RH 4XBEL 4YWGL 5E1AB 5KW9L 5E8PB 2DRUA 1M7XA 2FEEI 4L9LC 3KXFE 5GHWL 3C09C 4PLJD 4HGMA 3B3IB 4U1JB 3UO1H 4XCCL 3BYTA 5DUML 3UYRH 5HSFA 4HSQA 4JPVH 3DROA 3MRLA 1QRKA 3QEGL 1BVKB 1SM3L 4OQTA 1NGWB 5DS8A 2ESVA 3HR5A 3ALXA 1IC7L 2H32A 4NKMA 4ZSOB 3TM6A 4IRSD 1ZK9A 1WITA 5EOQH 3ZKXC 3MRHB 3CAFA 4X7SL 2BVOB 1T22A 3DTXA 3IAPA 3UX9B 1T6WA 4N8CH 3LH2L 4PG2C 3O45A 2ZPKL 4GQ9H 2EDWA 1XF1A 4OZIF 4XCYB 3QH3B 4FQIH 5CZXC 1FGVL 2YUXA 1ONQA 3LEYL 2A2QT 1N3NB 5IB3A 4RQQA 3DV6B 1G7QB 4XHJD 3LKSA 4JR9H 4QNPE 5IMMA 3X3GH 5KVGH 1Q9KB 4GQPH 3W82A 5INDB 3QIUC 2ENYA 4R96A 3HE6D 4AIOA 5JW4R 1CXLA 4M7LH 5DLMH 3SKJL 3T77A 5ALBH 4HULB 3L5WB 4YDKL 3O2VL 4PP2B 4OZFH 3TO4D 5D7JD 3BVNB 1GSMA 3CFEB 1UB5A 4GBXC 4YFLF 3DIFB 3W0WE 1OTSC 2YPLA 5BS0D 2BK8A 1KB5A 2UYLB 3BKJL 4PRAA 3PNWB 5DEGA 4NQVB 3QI9B 4M1GH 5KS9F 5CKGA 3F5WA 4D8PB 1NCWL 1A6ZB 1KXQE 1UJ3A 2FECI 4P2OB 3MV7D 1ZLSH 1DDHB 1KIQB 1OD9A 2A73A 4LPWA 4P2RE 5EU6A 3HZYB 1EHAA 3RWGA 4IDJH 5TPWL 1NC2B 5EU3A 2NNAA 3GKWL 3H6JA 3L6FA 3TCLB 2GTZA 2XZAL 5L8LB 3B5HA 3IJSA 1QFOA 3UJTH 1CXEA 1WEJH 2VQ1B 5IVZA 3RWJB 5KG9B 3VH8B 1BEYL 4PJ7B 3PHSA 2XV6B 4HV8B 4LPCA 3T3MF 2H41A 4RFNC 4OZHF 3CK0L 3LCYA 4DN4H 3VJ6B 4NO3A 5EG6C 4FQ1L 4P4RB 4UT6H 1C16A 5I18H 2JB5L 2ED7A 1MIEL 5GZOC 5B3NA 4A6YL 5JW4M 3U30B 2P7TB 4XPFH 3MRIB 4YHYB 4LK4A 2J8HA 2EE3A 3GJEB 3BMWA 4KAQL 1B0WA 4LL9A 2M2DA 1L6ZA 3TA3A 2UWEA 1F5WA 2J12B 3LEVL 4M1DL 3SDAA 1DSFH 3EOBB 3K0WA 3VCLA 1KELH 3O3BA 4MZ2A 1SBSH 4MMXC 1IT9L 1HDMB 4KRPC 3HCVA 1URLA 3E3QC 3NAAH 5I15L 1MJJB 4YZFE 4LSUH 4KKAD 1MRDH 4DKFL 4UT7H 2BFVL 4PGEA 4PBWD 5FGRA 1I8IB 3OXSA 2YD4A 2C4FU 1AKJB 1LDSA 1NDGA 3IF1A 5D5MA 3EKCA 4JFZL 5CBAB 4TUKL 4WNQA 4ZUTB 5H37G 3BH8B 4G8GE 4LFHG 3THML 2XZQL 4K71B 4KZEH 5L8JB 2F54B 4K7PY 1IGJB 3ZKQD 4RGNB 4C4KT 1J0KA 1L9MA 2I9LB 3BUYB 1SHMA 3LKPA 3O3UN 4CUCA 3MUHL 5HY9B 1Q0YL 2BNUA 3FRPA 4A2LA 1T7XA 2H9GA 5FA3A 1TJGL 1KIRA 4QXUL 1FRGL 1FZOA 1ZAGA 3FRUA 5EU7C 3H3BC 4YHNA 1OARH 3T0ED 4ZQKB 4X8XA 4XP4H 1S7XB 1Z0NA 4YHPA 5EZOH 2W0FA 3GHBH 3MGOB 4LHUA 4YNYB 3CX5J 4HHAA 2PUQT 2X1XR 1H0DB 4NQEB 3CFKA 2X1QA 5ACZB 4R7DB 5EZIL 2DYPB 4LSVH 1A6TA 3QG7H 4I9WD 2ZUWA 3C5JB 1NEZB 1RULL 2E6PA 4RISL 4ZFZA 1FCGA 3DO7A 4OCRH 3SY0B 1FIGH 3JTSA 5J6HA 4AM0A 3T09A 3D0VB 1HHKB 2DJSA 3MLTB 2MWCA 4JPIB 3BZEB 2RR3A 3I3DA 4DVRL 3WFEL 2FYYA 5GGTH 3ZT6A 2AJUH 4JQVC 4ODBD 4P4KD 3VW3H 5MENB 3ARBD 1IKFH 3I6KA 4IMLB 4YDJA 5LXGL 3B9DA 5GSVB 2I24N 1N2RB 2VWEC 3STZB 5IQ9B 1FG2B 4PJCF 4RMTA 2VE6B 1VACB 2DN7A 4JLRB 3RZCD 3OJMB 4FMKA 2CO6B 5GS2H 1OGTB 4X6DE 1CFTA 3LAFA 2LTQC 4K23L 3VXQB 3BAEL 3EYQC 4WUKL 5I1IH 3U2SB 4P59L 3D69B 5EFIA 3UC0L 5MHSE 3NPSB 3F12B 3JWNC 2P1YA 5JW3H 1QR1B 3L3DA 1RY7B 4M4PA 3ETBF 3MLRL 3QP3A 4BYHA 5DDHB 5T3XD 2RHEA 1PD6A 3FO0H 3QPQD 3MRCB 3N1QC 1V5JA 3GO1H 1HH9A 2EYSB 1MCOL 4FXGB 5HPMB 2C7UA 3QA3A 3ARDC 3CDCA 4C56E 5DJ8A 3WS3A 5CP3H 1NUDA 2AQ1A 1DUZA 2BRQA 1W0WB 4PRBB 5D9SB 5I30L 3KYNB 5DC0A 3MOBH 4PV9A 1QFWM 2BXZA 2MHAB 1BBDH 4Y4FD 4JZNA 2CGRH 1FYTE 5B38G 2IQAA 3HI1A 4HBQA 1VDGA 5IM7A 1G9NC 1LWRA 4IEFB 2VQUA 3D3VA 2GFBA 1AFVL 3EW3B 5C2UB 5IEKA 3PQYB 3VXTA 5TQ2H 4XX1E 3GBML 15C8L 1JF1B 1T4KA 4QLRA 2H1PL 1Q9OA 3VXUB 1EO5A 1ED3A 1YMMB 1IAOB 2WUBL 3C6LD 5IFHH 3MYZA 4DN3L 4MD4B 3BISA 2C4FT 3CUPA 5CAYB 1YEHH 4I0PB 43CAA 5E4IA 1T83C 2HKHL 4F7CA 4OTXH 4N0FA 5FK9A 5ICZB 1A2YA 2CKNA 1J05A 4QTHB 1JNJA 2BVTA 1G7PA 4LDLB 3MGTB 4OI9A 1A6AB 4KV5F 5ITFA 1YMHB 3QUYD 2NY0C 1XGUA 4KVNH 3DX9A 3QNYA 3MA9L 3FQNB 4JKWA 1W0VB 1WUNT 2HFTA 2QSCL 4K94C 4R26H 3I75B 3GGWB 5E99H 5DHVH 4WEMB 1A1NA 4I0CC 5T1LB 3VXMA 4DEPC 1BD2A 1NAMB 2Q76A 3K46A 3AY4C 5I19L 4WFEE 1EEYA 2V6HA 5D1ZA 1KJ2B 3VE0A 3PL6C 4ZO9A 1FVCA 1YPZB 2BNRA 3MNWB 1YPZF 4CVZA 4HGWB 2EDRA 3PWVA 3I50L 3AB0C 3CMOH 1XGQB 3GFUA 1R5VA 2GSIA 5BCAA 4OI8A 3KPOA 4UZGA 1YEGH 3TJEL 2W9DL 5DT1L 5T1DH 4ONGH 2VR9A 3ZE2E 4HWBL 2WV3A 4X5XA 1W72B 4ODXA 1A1OB 3MCKB 5D2NB 1OWRM 1A6VH 1RSFA 2IAMB 5F8QC 4D9QE 1IM3A 3HLAA 3F6LA 2KH2B 3ORJA 4X4MA 2HJKB 4PJDE 5I1LA 4JFQA 4MAYC 4LPYA 4YEFA 3SDDC 3BP5B 5I9QB 4TPRH 5DTFA 2ICCA 4KK9D 1ZOXA 4QY8B 2BSRB 1I8MB 2VXVH 1P5UA 3E3QE 3KGRA 4ZAKB 1ZANL 4YXLL 1U93A 4FABH 4YXHL 1EBAA 5FM5O 2A6JA 3LD8B 2P5ED 2Z4QA 4OCYH 1FO0H 3G04A 5TE7H 5IGXH 2VDOL 2ID5A 2BJMH 3C8KB 2JCCE 4S1DC 2VRAA 1KV3A 3U7AA 1RZFH 4H25B 3EJZD 2XA8L 1HWGB 5JW4N 5DFVC 3L1OL 3UTSE 5F6IC 1KEMH 3TH3T 4L3AA 5KZCD 3BZDA 3DXAD 3T0BA 5MERB 3TO2A 1QG3A 4CVXA 2CKBH 4EIGB 2XACC 3GRWL 2VLKB 1VHPA 1T1YA 4Z7VA 4PGCA 1S9VA 4PY8J 4GG6B 4OCWL 1A8JH 4FXKA 4O9HH 1WZLA 4TOYL 3ILPA 4P5KA 5EU7E 4PRDB 1Q72H 3VRLE 3BH9A 1NUGA 4MA7H 4APQD 4OFYA 1CDIA 1CF8L 1T7ZA 3SDXB 3K2UL 3SDXF 5D7SH 3U0PB 4NCC2 2HG5A 4GSDL 1MCPL 3D18B 4G6AD 5C0AA 2I27N 4QXWA 2QSTA 4EN3D 1NDMA 5D1XB 2ZUXA 1RUQL 3HRZA 4OKVB 2R9HD 4NN7B 3GSRA 1IAMA 2ZKHL 4ZD3H 1H3PH 1SEBB 2OMNA 3E2HC 4X7TA 5BO1L 4XNUL 5LAXA 2FB4H 4FP8L 5IMKB 2IH3A 1MJ8H 4NNXB 1C5BL 1HKFA 4OFKA 3X13A 4U0RC 1NGZB 4TSCL 1MPAH 4HZAA 3LQAC 5I74C 4JO1L 2YD5A 5EUOE 2AK4E 5DMKB 1DQML 1R3HB 1QBLH 2VWEE 5D7IE 1F8TH 1CGWA 3FB8B 4QHLA 1W0YT 4WDIB 4K3EL 4ALAL 2IF7A 4YHZL 4K3JL 4X5LA 2YK1L 1TVHB 3CVHL 4K7FB 1QBML 5IVXF 2CPCA 3KWWA 2X4PB 3H42H 1U8JA 4JDTL 2A38A 4U1KB 1ZVHA 2AJVL 4FTVB 4JFOA 3M1BB 4N1EA 5C0BB 5C07A 2QV2A 1OD7A 5BZDA 3I6LE 3PJSB 1WAAA 3LKOA 3QPXL 2VAAA 3O3AA 1Q38A 1CDYA 2YA1A 4AYFA 4NUGH 1JYVA 3SDCD 2VDNL 5GZND 1H8NA 3ARGD 3HAEG 1IKNC 2HT3D 3MBEB 1TZIA 3MUJA 5FCUL 3RY6A 5C70A 4JGUA 4QGYA 3VGBA 1G7HB 4MNHA 2VXQH 5A3IC 3I9GL 4LKCA 3FQUB 4JN1L 3HTLX 5CEXA 5AYUL 2WSKA 1B9ZA 4Y16B 3EZJB 2LU4A 3JV6A 1FNHA 4DGIH 3JV4B 2BNQD 1DN2A 1A7NH 5HDBF 3NCCB 5E1AA 1AGDB 1RHHA 4FQHB 3VI3E 5E8PA 3HS0B 1HXYB 3WIIL 4U1JA 3B3IA 5JQ6L 3EDKA 3QUXB 3VXRE 4FZEH 5D96B 2Q8AL 2DIJA 2C26A 5DZOA 1BVKA 3SE3A 1NGWA 1JNLH 2GK2A 2R0WH 1QLEH 3OX8B 4ZSOA 1DL7H 3GJFK 3MRHA 4QRRE 3D0LB 4Z95L 2BVOA 3SO3B 1QEWB 5CJXC 3RIAF 2FEDC 1KCKA 1RU9L 2OL3H 4XPAH 5E56A 2IALB 4XCYA 3QH3A 5KVDL 2A77H 5HTSA 3PWJB 2F58L 1KCSH 1N3NA 2CLVB 3SJVB 2EDLA 1HIML 5E2UL 4N9GB 2CH8A 3DV6A 5GGVY 5H8DA 1G7QA 4Z7WF 3QIWD 1I7ZB 2LAAA 1CGSH 1JYNA 4QT5B 2W38A 3CXDH 2YC1B 5INDA 3GJFH 1MEXH 4HD9A 2IBZY 2YD6A 3L5WA 1GAFL 4Y2DD 4PP2A 3BVNA 4PJXE 3CFEA 3MRMB 1E28B 3OHXB 4N0YL 1FNAA 3DIFA 2E7LA 1FIEA 1Y6NR 4FQ2L 1U2CA 4AEFA 1CS6A 2PW2B 2UYLA 3PNWA 1OT1A 4NQVA 3QI9A 3BKCH 3H7LA 4O58L 2FLBT 2PR4H 3LZFH 1QFHA 4P2OA 5I75C 3HZYA 3W2DL 3NFNB 3PXHA 3QDJB 2PCPA 1FJ1B 4M5YH 5DF0A 1XF3B 1NC2A 4LCWE 1AXIB 3F7PC 3V8CA 3W9EB 1HQRB 5D71H 4TUJB 5T3XL 3S88L 3QIBD 2VQ1A 4KI5D 2H45A 3RWJA 5KG9A 1B2WH 4PJ5E 2MOVA 4PJ7A 1I9RH 4HV8A 4WFFE 1D5ZB 4LGSB 1HHJB 1Z3GL 1XGPB 5A16B 3VJ6A 1FLRH 4L29B 4RSVA 3K4AA 4Z77A 3ARXA 2R0ZH 3QUZB 4P4RA 3BQUC 1QRND 5AG9A 3OG6B 3T65B 5DMIL 2IJ0C 4MJ4A 2FWOB 2P7TA 3MRIA 3KPNB 1KGCE 1CICB 4RRPG 4FFVD 1UADC 3GJEA 1CDBA 5SWQB 2B20A 4NQSB 4H0HB 4PS4H 1S9XB 3HC3H 2CUMA 2DD8L 4IRZL 1RJLB 4NM8H 2BMKB 1LEIB 5ISZB 5C0EB 5J57B 2OP4H 1AY1L 4HX1A 3SQBA 1HDMA 4UQ2B 1CLOH 2EZ0D 4IRJC 2R0KL 4P9HL 1NBYB 5C09E 5ILTH 4ZPTB 1DQTA 1I8IA 3O81A 1F58L 4U6YB 1AKJA 1DBKL 3HG1B 1QSFB 2AXFB 4ZUTA 3BH8A 4XPTH 4NKIH 1R3JB 4L4VA 4M48L 3S35L 2BSTA 3OR7B 1MJUL 2BCKB 2ENSA 2F54A 1IGJA 3UDWC 3HB3C 4L8BB 4F57L 5IESH 4ONFL 4QRUB 1XGRA 2I9LA 2Y06L 3BUYA 2XOTA 2CRYA 3G08B 4Z0XB 5HY9A 1WSST 1MAML 1MFDL 1H3WM 3RKDC 2HWZH 3U4AA 3QEQE 5IBLC 2Q6WB 3H2WA 1S7XA 3GI9H 4MCYB 3MGOA 3VD9A 4U1HB 4YNYA 1KN2H 1H0DA 4NQEA 3PWPE 2Z35B 2DQIL 2B4CL 4R7DA 1GGBL 1FORL 2DYPA 4LDEB 1FH5H 4ZXBB 1QFWI 3OJDB 3VA6A 3C5JA 1MHPL 1NEZA 2IFGA 2Q1EA 4LCIL 3SY0A 1U8NB 3AUVA 1HSBB 3EJYD 4MLSA 1J11A 4N5EC 5DFTA 3AREA 4ENEC 3D0VA 3QHZL 1I3UA 1MCBA 2X4SB 3MLTA 4JPIA 2NXZD 1YA5A 4XMKH 3TA3C 1OGAD 3SDAC 1KPRB 2K7QA 1VKXB 2FJHB 5F9WB 1MVFA 4HK3N 2EICA 5I0ZA 2GCYB 5MEOB 4PRIB 5EUKA 4MQXD 5CINH 4UU9A 2WLYA 3QFJE 5MENA 1DUYB 1I85C 5E7BA 3IRZA 4WIQA 3TN0B 4IMLA 2AGJH 1N6QL 1YEFL 2VISB 5DJDB 2ZNXA 2C5DC 5GSVA 1INDH 4Z5RB 2BY3A 4YHLL 2FDBP 5IQ9A 3G6DL 1W2KT 4PJ9B 5HDOA 4JLRA 4XAWH 1UWEL 3HNTL 2DDQH 1OGTA 4FMFA 4HH8A 4KK8D 3L5IA 3BN9D 1M7IB 4IHOB 3VXQA 4GLRI 3W81A 5E03A 2EDOA 3U2SA 4UBDC 5JXED 2P8LA 3D69A 4GAJL 3AC0A 4JZJA 4W68A 1J8HE 5MP6L 1LK3L 3LQZB 1HN1A 4D0BB 3MOQA 1M05B 4OIIH 3BZ4A 1QR1A 4BZ2L 4JM2F 5GGRY 2F19H 4HUVA 3IXAA 2VLRD 1FO0B 1YEKL 3K4ZA 4WEUD 1YEDB 4QWWC 5DDHA 2X7LB 1G0DA 3MRCA 2CQVA 1OAYL 2R29H 1R3LB 4PTUB 3HZMA 4I2XB 5IB1A 3ES6B 2EYSA 4TVPD 4M6AA 2B2XH 4FXGA 4YC2B 5HPMA 5J6GB 1JZ7A 4O00A 3F6IA 2W91A 4WTWA 1VPOH 1W0WA 5D9SA 4BH7B 3KYNA 4RMUA 1WFTA 2D0GA 5FFLA 2MHAA 4MXQD 5JR1H 2YKLL 4H0IA 1LO0L 1GGUA 3WN5B 5I1EH 1CDCA 1ZA6A 3ARRA 3PQYA 1SMOA 1YNLH 1JF1A 4JHWH 4Y19D 3VDBA 2F15A 3V9FA 2KKQA 4MXVF 4KU1A 3MX0A 1JFQH 3P30L 3N1FC 4P3DB 2BY1A 5D2LB 1YMMA 4HXAH 2WINB 1JPTL 4I0PA 2GY5A 3S96B 3S36H 1LO2H 4HMCA 5ICZA 1LO4L 3DX8B 4DGYL 1EGJH 2Z9TA 3UBXI 1PVHA 4L3EE 1HHIB 3MGTA 3RKPA 1MWAH 3L3JB 1A6AA 2BY0A 1YMHA 3RQ3A 1ACYL 2BVQB 4RNRB 5JORB 4C57C 1U92A 1AD0B 2KBGA 2IGFH 2YRPA 3FQNA 1W0VA 4MDIB 4NQDD 4XMLH 2JK5B 3ALPA 1DVFB 4LLWB 3O4OB 1EXUB 3GGWA 4F15C 5L7XH 3TYFB 5T1LA 1WGOA 4GJTB 1JGDA 1NAMA 4PR5B 5J1TC 1WFUA 1EHNA 1BF2A 2B1HL 3IU3B 4LASL 1Q1JH 4PP1D 1KJ2A 4BQBA 2XKUA 5D7LD 4O02L 4D3CL 4Y5VC 3MNWA 4HGWA 1A3QA 3LN4A 4LKXB 3TT3H 2X41A 1EMTH 3EOTH 2DS4A 2ESVE 1CI5A 5TGBB 3GI8H 2BRRL 3RGVA 2QHRL 4HS3B 3S5LB 2VDMH 5HHOB 5E70A 3FAWA 3EIFA 5I6XB 1A1OA 2PYEB 2XQBH 5D2NA 4EI5C 4MQ7B 1WTLA 1JVKA 1NFDF 2IAMA 1ES0B 3BEWB 3TPUB 5KSVB 1KSRA 3SKMB 3CVIH 4Z0BH 3SGKC 4FXLA 3ILQD 2DQDH 2R69L 4PB9H 5BV7H 2Q3AA 4LCCC 5I1HH 1AO7E 3KPQB 3KR3H 3S7GA 4F7EB 1CTNA 4MJ5B 5D72L 4QY8A 2BSRA 2RCSH 3EZ8A 4PJFF 3VRIA 1FBIH 1A7RH 5IROC 3K3QA 5KTEH 3HE6A 4YIQA 3DVGA 3MNVB 4MJ2A 2IPKB 3D25A 5CCKL 2YPLE 1IFHH 1QFWH 4RFOL 5DJXB 1NEUA 2VOTA 3O6ML 4QCIA 3C8KA 4R4FH 5DSCA 3JWDC 4H25A 3BP7B 1QZ1A 1WJ3A 2BZDA 5MERA 4B0MM 4KKNA 4BM7A 5C6TL 1GL4B 2VLKA 4LSSH 3S3JA 2OL3B 4GG6A 4OUOA 1BGXH 1MQKH 3DGGB 2D0FA 3VXUD 4X6FB 1MCEA 3HI5H 4NRZB 1MRCH 3F7VB 4KJPC 1L4IA 4PRDA 4KQ3L 4POZC 3EFDH 2QQNH 4JFHE 1G1CA 5J3HD 4MVBD 3O2DH 3GJFB 3T0DA 3U0PA 5KSAD 4GLRH 4JM4L 4JKMA 2VH5L 5D1QC 3ARFC 3D18A 3BDYH 3RTQC 3RL1B 5D1XA 1RQ5A 1ZVSB 3UTTB 3WNOA 4ODWB 4OKVA 3CDYA 4B53A 1I1AD 2G9HB 1CGUA 3DUSB 2DAVA 4QRSB 1T2QH 4DW2L 1SEBA 1C5CH 5EBMB 1OHQA 4M5ZH 4I5BB 3UPAA 1N4XH 5IMKA 4NO2B 3M17B 1A47A 4DZBB 4NNXA 4IJ3C 4WTXA 1JTTA 3ZT5A 3WUZA 2EKJA 3OZ9H 1KACB 4M7KH 4H0GA 1NGZA 1N5AB 5CEZD 2E27H 4LU5H 2YA2A 5I1GL 4O5LH 4OFDA 1XCQB 1PLGH 1R3HA 5DMKA 4MA1C 5DVNA 3FB8A 4LAJH 4WDIA 1H8SA 4U1GC 4BSWB 4PJGB 3VG9C 2EC8A 4W4OA 4G6JH 1TVHA 4XTRC 4K7FA 5D5ME 2HN7A 2AJSL 2X4PA 3OWEA 4LVHB 1OAUL 2NX5D 3WSQH 4U1KA 1NMAL 2YN3A 3W9DB 3M1BA 4Q6IC 4YDLC 5C0BA 5FYJE 3KDMB 1P4IL 4XPGL 1ZTXL 3PJSA 3TZVC 2FH6A 3X12B 4X80H 5F7LB 2VXUH 4XWGL 3C8DA 2JJSC 1KUMA 3FB5A 5JIHA 1OVZA 5HYJE 1P5VA 5MEQA 1A02N 1RFDH 2OZ4A 3SKUD 4I3RH 5C2BL 1G9MC 2UVFA 2Z93A 1LGVA 5GRJH 2EYTB 3WS6C 5GGUB 1G7HA 4XP5L 4XVUC 4NC1C 3FQUA 1G0YR 2O5YH 3V2AR 3ZKSD 5I8OH 1A9BB 5F7EL 1NCDL 2R2HB 1FZMA 3ARQA 2QEJA 4J3VA 4FQXD 2X4QB 4D9RD 1W8OA 1ZT7B 1DQDL 3DGCR 3D48R 1AGDA 3JWOC 5EIVA 3HS0A 1HXYA 3B6SB 4J2XA 3QUXA 3U7YH 4WHTA 2IMNA 3WIHH 2EDNA 3QZWA 2K7PA 2MSPA 4PJEA 3W11C 5C3TA 4P5TB 3OX8A 5EZJB 2H2SD 1ZE3C 4HKJB 1YDPB 1OWWA 2MKLC 3D0LA 1AGBB 1WBXB 2QQLH 4DKEH 4HKXB 1DJSA 3FMGH 2NY1C 5C0RL 2E7CA 2BY2A 3K74B 2GHWB 2IQ9L 1AR1C 3PWJA 4GMSH 3VD3A 5F9JB 2CLVA 3SJVA 1TIUA 4Y0GA 1JPST 3LRHA 2MCG1 3E1F1 4OZGE 3RWDA 3RUGF 1I7ZA 4PJ8B 4QT5A 1S5IL 3Q3GB 3OKYA 2YC1A 5CJOH 4CAGA 2IBGA 4Z7UB 4GW4B 4OLUH 5L2JB 1D9KB 1JRHL 3NCYP 1P6AB 2IFFL 1ZGLP 1AIFB 3WJLA 2AI0L 3MRMA 1E28A 3OHXA 4ACPA 4YH6A 2XTJB 5SWZD 4PJHB 3QDGA 1F00I 2UY6A 3WD5L 4Y1AB 1HNFA 3F58H 1IJ9A 2OTWB 4E0RA 4WO4C 2VITB 5E6IC 3EDFA 1ADQL 4JKPH 3TBSB 1JPSL 4XC1L 3KXFB 1IGCL 4PGDB 3V5HB 4BJLA 3E8UH 1FJ1A 1XF3A 1N64L 3MBXL 1UACH 5ETUB 3WJJC 3W9EA 1HQRA 3GIVA 4FTVD 4K7PH 2OK0H 4TUJA 5JTWA 1XCTB 3WHE0 1MRFH 5DVKA 5DD1H 3QDMD 4MJIE 4K9EC 4M1CD 1RURL 3SE3C 3B9KB 4KC3B 4TVPL 1CU4L 1HHJA 1XGPA 5JOPE 5A16A 2VKWA 4L29A 3UJJL 3QUZA 4I77H 4Y7MA 3HRPA 1DCLA 1KFAH 3ULVC 2B7DT 3T65A 3LQMA 4RGMB 2FWOA 3KPNA 5JW5B 1CICA 1INEH 5HVHB 3MLVL 4AG4L 5SWQA 2I60H 2YR3A 4Y16D 3D39D 2ZSWB 4NQSA 3TBVB 5CP3A 1S9XA 1J1OH 2HTKC 2NCMA 2BMKA 4Y4KB 1FNFA 5CZVL 1LEIA 5C0EA 3UAJD 2CUHA 1U3ZA 3KPPB 3OG4B 2AV7B 4UQ2A 2XN9D 3SE8L 3W0WB 3TIDB 1PZ5A 1BD2E 4R0LB 3H9SE 4DFIA 5IR1A 1NBYA 1MJ7L 5EC2B 4ZPTA 1OP5H 4U6YA 4GS7B 2E7LC 1WC7B 1XGYH 3HG1A 1QSFA 2AXFA 4PLKC 3S36X 4KRLB 4JRXD 2W0PA 1JNNL 4KTEL 4P2RB 1R3JA 3B5GA 3CX2A 2AEQH 3OR7A 3BEVB 1FV1B 1U3HB 3CDGB 4LSDA 3NA9L 4Q74A 3GDBA 3CU1A 3FRPG 3MV8D 1EUUA 2A6IB 3R4DA 1N5YL 4QRUA 4I13B 3G08A 1A14H 4Z0XA 3C08L 1MWAB 3FHQA 5B8CB 5IW1B 3IAQA 1R3KA 4LHUG 1BFOA 3LKRB 1EZVX 2Q6WA 1OPGH 2E8YA 4MCYA 1UM5H 5HGHA 4QOKD 4X6CE 4MGXA 2Z35A 4MAUL 4JJ5B 4ZXBA 4HJGB 4FFZL 3JVGC 4NKQB 4GMTL 4PV8B 4RA3A 3RHWF 3KYKL 2AP2A 2D7NA 1U8NA 3EO9L 4CMHB 1HSBA 3DARA 1TNNA 5BW7C 1DTUA 2OR9H 4BSVA 1PSKH 2X4SA 2JELH 3KYAA 3KPRD 3ZE1F 1KPRA 3RWHB 3QDJD 3VWJB 2FJHA 1UQSB 5GS2D 2GCYA 5MEOA 4PRIA 5DMGD 1DUYA 3VFRB 1T66D 3GMQB 4AEEA 3MXWL 2VISA 5DJDA 4Z5RA 1G9NH 2GY7B 4Z7VE 1RMFL 2JJTC 4CN4A 4WUUA 1CT8B 4PJ9A 4G8GB 2D03L 1P53A 1P1ZB 3WO4C 4YBQC 4IHOA 5BV7B 1AGFB 5EB9A 5AEAA 1I8LA 1IAKB 4MQSB 2KQMA 3ARYA 4NC1E 3TEUA 3LQZA 3WE6B 5DYOB 4D0BA 3TESA 1M05A 3G6JE 3V6BR 1KPUA 5C0AE 3P4OA 4UINH 4NZTL 2B8OT 3G6AB 4Y8AA 1FO0A 4AL8L 1FDLL 1HI6A 1YEDA 2PXYD 4KQ4H 5HGGS 2Z0BA 4GKSB 1JJUA 3MLSL 5FYKE 2X40A 4JFXB 4LSRL 5ISZD 5AWNL 3BESR 4PTUA 5C9JB 4I2XA 3NCYS 3ES6A 1YN6B 3BGFB 2AKRB 5C0CE 5J6GA 2OJEA 3QO0B 4JREC 4K94H 4YJZL 5IBUB 4YHOL 4F7PB 3KJ4C 4BH7A 4MS8C 1FVEB 3QXAB 5DC9B 4J4PD 2Q86B 3RPIB 3RZWA 2IAND 3P0VH 1N0XH 2PN5A 3AREC 4LQFH 4M62H 1RZJL 2HTLC 4P99A 3GSNH 4KMTL 3MOAL 2ZG1A 4EI6B 2X4OB 1FN4B 4Y4HD 5IW6A 5DFWH 3RDTD 4Y88A 1CE1L 1V05A 4P3DA 5D2LA 1RK0B 1UC6A 2W07A 5F1NB 5DD6B 1Z9MA 2DQTL 2Y7QB 1K4DB 4CJ1A 5C0GB 1WAAE 4X6DB 1Y18B 5CEZL 2K9UA 3S96A 3RVXC 2AEPH 1R5WB 3DX8A 1G6VK 4NWUL 4Y5XC 1FL3B 4P9MH 4K2UH 4H1LB 1HHIA 5I1KL 4N90E 4X7FC 3L3JA 1S7RA 3MLYH 3VXSD 1CVRA 3GNML 5HGDB 2BVQA 4G7YL 4JZJC 1JN6B 1W72L 2EO1A 4JZOB 4NQXB 4WWKC 5JORA 1AD0A 1EERB 5HYIA 2R8SH 2EDQA 2Z31C 4DFHA 3BSZL 1TETL 1JPGB 4MDIA 2Y07L 3OKMB 2JK5A 1DVFA 4LLWA 1EXUA 1U8OA 4L9LB 5C0DB 1MH5B 2I25N 3C09B 3TYFA 2QQKH 5E2VH 1YN7B 3AAZA 1EJOL 2IEPA 5I1JH 4PR5A 2OYPA 1DQQB 2BNQA 5I1DB 2RQ8A 4C56B 3SCMC 4BQCA 1GC1L 3TN0D 5TQ0L 1IEAB 1PQZA 4TNWK 2OJZH 2VDQH 3FN9A 2DQFB 4LSQL 4LKXA 3VA2C 3ZKXB 4E5XA 2LQRA 5DQDH 4PBXA 4YPJA 4ZUSB 1FYTB 1TVBB 3BIBX 4ELKB 5TGBA 4D9LL 2PTTB 1CD8A 4HS3A 1AE6H 3D85B 3S5LA 5HHOA 5JDSB 1PZUB 4JPVL 4NNPL 3ULVE 1B90A 4MQ7A 1FYHB 3PDOB 1ES0A 3BEWA 3TPUA 5KSVA 4KK6C 1LE5B 1A7QH 2AXHA 5CMAB 1T0MB 3QHFL 3FT2B 4KHXH 4KTYA 4LPVA 3SKMA 4JM2D 3UBXB 1WIUA 3U83A 3QIUB 1HEZA 1CGTA 1MF2L 4N8CL 4Z76B 2Y6SD 4F7EA 4MJ5A 2F5BH 2ICWA 2X05A 1CQKA 4FQIL 2APTA 5AZEL 1R24B 4GBXB 4KY1L 4F37K 3RAJH 5C9KA 2DTMH 2NY7L 2IPKA 3X3GL 2HP4A 2GJ6E 3P4NB 4LLUA 4KDVA 1X5GA 5F7MC 5DJXA 5F9DC 3MA7B 4XNYL 3MACH 1KG0B 1IGIL 3UTOA 2X4NA 1KCVL 3WFDL 4ZS6C 9CGTA 3LQAH 2HMIC 3KPSE 5T1KB 1RUKL 1LP9F 2WM0A 1RZ7H 5E8EB 3OPZL 4XVJL 3RNKB 3ME0A 3FAXA 4Q0XH 3DGGA 1WZMA 5DJYB 1WT5A 1K6QH 4PRHE 1ZLSL 4RFNB 3HMXA 3OGCB 4HS6B 4NRZA 3F7VA 1YEJL 4PLJC 4LRIA 2JJWA 1RD6A 3WXVL 2VZTA 4KJWD 3D6GA 4WFGE 1WBZA 1OAXH 5K59E 3GJFA 3KS0H 2CMRH 1LE9A 1BPVA 1ZHNB 1WEJL 3UJTL 1FC2D 3TBTA 4IRSC 4PFEA 4XNXL 43C9B 4MB5A 4CRPA 4DGVL 1F4XH 5BOPA 4NQCE 4L4TE 3RL1A 1LDPL 4FOMA 3V4UH 3UTTA 4ODWA 4PJDB 4PJDF 2FGWH 3DUSA 1C12A 1OCWH 4P2QE 5CGYD 3V7AE 4HS8H 1IGFH 3Q6GH 5I1CH 2PKDA 3VFGL 5EBMA 4WGWB 1HWHB 1SJVA 1F3JB 4I5BA 1M7DA 4KRPB 1OAKL 1X5KA 5JIPA 4NO2A 3ZSTA 4DZBA 4K7PX 1TZGL 4NZRH 2WIIB 4XPFL 1YNKH 2J8UE 1X44A 3HFML 4XHJC 5ESAB 2DQUH 4WRLA 1N5AA 1Z2KA 5B3JF 3VXPB 2FBJH 1XCQA 5DJCA 4EEEA 1DSFL 3FONA 3HE6C 2VL5B 1KELL 2JCCB 2J4WL 4BSWA 4PJGA 1SBSL 5IFAL 3MRJB 3RVTD 5D7JC 3TO4C 3HMWH 4Q2ZB 3UTSB 2G60H 4LSUL 4HUUA 1IAIL 1V7NL 3LRGA 2PYED 4L4VE 4GRLD 5HDQL 4FQQB 5LGKA 1VFUA 1OAZL 3W9DA 1YEEL 4OSUH 1UH3A 5L9DH 4NYLB 2DQCH 5GGVH 5DD5L 1CLYH 35C8L 5I2IB 3X12A 3IJYB 4FZ8H 1DBBH 4QRPE 3MREB 2ERJC 4POYA 5EC1A 2NY2D 3GMLB 4KJQD 5IOPB 2DWEB 2G75B 5DQ9B 3AS0A 4HF5H 5GGUA 4V1DE 1FPTL 3GKZA 2W9LA 5I8CB 1OW0A 3LS5L 1OARL 1A9BA 1JGVH 2R2HA 3MRQB 3FT4B 5IBTH 1XZ0B 3MJ9H 3GHBL 3QFDB 1XMWA 4ZFOB 1ZT7A 5CLTA 5DMYA 4UAOC 4YDIH 2WK2A 3B6SA 4LSVL 1WFOA 3S37H 2QKIB 5HPOA 3HNSH 5FGBC 4KK5D 1FIGL 5EUOB 2AK4B 3IJHA 5D7IB 3N9GH 5MENE 4P5TA 1HHHB 3MODH 4KPHH 4HKJA 1YDPA 2YPKB 4X98B 5L2KD 5ICYA 4XP9H 2ZCHL 1AGBA 1M71B 1X5YA 3QR2A 1WBXA 4HKXA 2LTQB 5GGTL 3S9DB 3DNKA 2IMMA 4KKAC 2FEEL 3VW3L 3ZL4H 1M6OB 5FAAA 1IKFL 2IWGA 4LLQB 4M4RA 5EA0L 3ZE0E 3LSOB 1BBJA 4JE4B 5DR5H 4JFDD 3VXNB 5F9JA 3MRDB 4UTBL 5L0QC 2KZWA 4PJ8A 2F8VA 2DM4A 5IIEB 3Q3GA 4L8SA 4Z7UA 4GW4A 2HLAB 5L2JA 3OMZA 1HILB 1IM9A 2B39A 1A22B 3UTQA 3U7WH 2DM7A 5K9KB 1ZV5A 4LARH 3ARDB 4PJHA 4HW6A 3QISA 1SVCP 4L1DA 3T0EC 4Y1AA 4OLXL 5CWSB 4ZOAA 5HJ3B 2VITA 3WCYA 5ICXB 5HVGB 5HYSB 3V6FB 3GSXB 3MNZB 3TBSA 4HJJH 4MCZB 4LP4A 5DUBB 3KXFA 4YPGB 4PGDA 3V5HA 1P7KB 2NMSA 4M6MH 3VXRB 2EKSB 4U3XA 4HC1H 5ETUA 4Q9BA 3IU4L 2Y72A 3MRNB 3NPZB 3VH8G 2ZUYA 1DQLL 3RJQB 1XCTA 3P40A 1O5DT 1A0QH 2VLJD 4HCRH 4G42A 1EO8H 4QRRB 3B9KA 4RX4D 1FFRA 4WENB 5DWUL 4FQCH 5TQ2L 2NYYD 1A4KB 5HHMD 3P77B 5E0QA 1Q94B 3WEXA 2ATPB 2QADD 1X7QB 2NY0B 1XAUA 4PJIE 1EPFA 5DK2A 1BWWA 3ALWA 5E6YA 5IFHL 5JW5A 4UIKL 3JXAA 2VERN 3RZCC 5TE4H 4HXBL 2ZSWA 3MYJB 4Y5YA 3TBVA 3PE9A 2DQGH 3RU8H 4QKXB 4Z7OF 4N8VB 3HKFA 1LK2B 3MLZL 4Y8DC 4DEPB 3LEXA 4Y4KA 4XP1H 4PJXB 3EYSH 4HZLB 1A9EB 4OF0A 3CPLB 3KPPA 3SQOH 2AV7A 5KVEL 4HUXB 3PL6B 1EX0A 2AEIT 3NFPA 4R8WH 2P4AB 3GSNB 2Z8VC 1DR9A 3AB0B 5EC2A 1SBBA 5KJRH 5KVMC 4G9FD 4R26L 3QPQC 1HH6B 5E99L 2BC4B 3TT1H 2DQHH 5SX4H 4N8PA 1D7FA 4MB3A 4P2RA 3A6OA 4AEIH 4AIZB 3NVQA 4LCWB 3CDGA 5F9OH 1YYLH 4IMKC 2A6IA 2BXYA 3EYUL 4JRWA 4Y4FC 4JFED 1FC1A 1S8DB 1GGCH 1MWAA 4MAYB 3RGHA 1DFBH 2D0HA 3CFCH 3SDDB 2QL1A 2ZJSL 1MIMH 4ONGL 5IW1A 5EWIH 4PD4K 1D9KD 4OF6A 1TCRB 1A6VL 5FYJH 5MEPA 1NPUA 1NEZG 3A6CH 4JJ5A 4S11A 3DRTB 3QNZB 1ODAA 1QACA 3C6LC 1UB6B 4HJGA 5JPNA 1CBVH 4P9HC 4HQQH 1MCHA 4P46D 1QHPA 4Q9RH 4UNVA 3HUJE 2VXVL 5IEHB 5F6IB 4DAGH 1D5IH 2EH8L 5BS0E 2ZSVA 4OLWH 3RWHA 1DLFH 3QUYC 1UQSA 2EIEA 4ESKA 1FGNH 4K8RC 2FATH 1KOAA 3O9WD 4LLMA 4OCYL 4EKXA 1JZ5A 5IGXL 1P6FA 3GMQA 5C09B 1B4RA 2GJJA 3MV7E 1WCQA 5AAMA 4TQEH 1GGYA 4LIQE 1RZFL 3RVWC 2X9YA 4XMPL 4JDVB 2VDLH 5ECJE 1CT8A 3EDEA 4G8GA 1X3DA 1P1ZA 2OXGA 2CKBL 1HINL 1MNUH 5E6ZA 4H26B 5EOCJ 1AGFA 4OGAD 5DA4A 2XZCL 4JG0H 2RGSA 4MQTB 3R06B 1IAKA 3L3GB 1T1XB 3V0AC 2Y5EA 3WE6A 3DLQR 5DYOA 3V6OC 1N7MH 5LQBH 1Q72L 3HE7D 3T4YB 2UUDK 2XWTB 4L9DA 3E2HB 4TRPH 1QSZA 1RZ8B 5C6PB 3CIQA 1A7PL 3G6AA 3WKMH 3TFKD 3QEQB 4WU5B 4OFVA 2UY7A 1C1EH 5E2TH 1MFEH 5GJSH 3JV0A 5J7CC 4JFXA 2HKFH 1G6RL 2DM3A 2EDXA 3PWPB 1I1AA 3ZTJG 5C9JA 4WW2C 4U0RB 2YPVH 1YN6A 2AKRA 3W0WD 1NMBH 3QO0A 4NHCL 5I74B 2JF1A 2D4FA 3OR6B 4F7PA 5AUMB 4WJ5B 1H3PL 3VG0H 4KK9C 1CIUA 2X5PA 1CLZL 4JQIH 5E8DH 1I9IH 2Q86A 4YK4C 2UUDH 3QO1B 1JP5A 3RPIA 3T4AB 4LNRB 2EIDA 1QFUL 3DSFL 1HXMA 2ZOKB 4OGZA 1BQSA 1FNGB 3TWCL 1KC5H 1U3HD 3QFJB 5T5FL 5DD3H 2DQJH 2QJDA 4EI6A 2X4OA 3O2DA 1FN4A 2APWA 2FO4A 5I71C 3EJZC 5ACMA 4YQXH 5F1NA 1RZIB 4WU7B 2Y7QA 4BZ1L 1K4DA 3EYFB 3MCLH 5C0GA 1G84A 1YNTA 4OGYH 3H42L 1IL1B 5JPMB 1Y18A 1NBVH 3OBAA 1BJ1H 4RWYH 4ZUWB 3I84A 3DO3A 1T5XB 4MB4A 1FL3A 3QCTL 2PTUA 5J9PB 4H1LA 4OCSL 2FLRT 1J8HB 2ZUTA 5C0JB 4GRWF 3EBAA 3T0EE 4G8EB 5HGDA 3H9HB 1JN6A 1E6JH 4JZOA 4NQXA 5EIQA 4APQC 2XKSA 1OLZA 2AJ3B 2MCPL 3OKMA 4DCQB 3FFCD 5DRWB 4JPKL 1E4WH 4L9LA 4UB0H 5C0DA 4EDWH 4YR6B 3HPJB 4I9WE 1YN7A 2J6EH 3RX7A 1MFBL 5HI3D 3VWJD 4G6AC 4HMDA 1DQQA 2VXQL 2O61B 4FQXA 5BRZD 2LV4A 4HUKB 4C56A 3VRJB 2R9HC 3P2TA 4HIIB 3JWDH 1IEAA 5JA9A 2DQFA 1A7NL 2GIYA 3LMJH 1IQDB 4PJEE 1CGXA 4ZUSA 1FYTA 1TVBA 1HZHH 5JOEA 4ELKA 2IBZX 4FNLH 4KGLA 2JE8A 4UTAH 2PTTA 5J0BA 3VXOB 3U1SH 3D85A 4FZEL 5IHUL 1F90L 1JNLL 5BOZG 1UG9A 1QLEL 3WNKA 4KROD 4PJAE 4BFEA 1LE5A 1T2JA 5CMAA 3ECBB 3FQWA 1T0MA 4L3CB 3ESUF 4OF7A 4Z76A 1M1SA 3GBNL 2YXMA 4XPAL 2OL3L 3PP4H 3S37X 3OQ3B 3G5VB 2W9EL 3QRGL 4YFDB 5B4MD 1T5WB 1R24A 4KDWA 4GBXA 4L3EB 3QQ3B 2YRLA 4PREB 5DRZB 1GHFH 4YLQT 1NL0L 5ENWB 5J13C 1V7MH 5GGSY 1CGSL 3WIHA 3P4NA 3CXDL 3S6CA 3BPCB 3QDGE 1MEXL 2A9MH 1G0XA 3AXLA 4BUHA 4AQ1B 3SDCC 3MA7A 1DZBA 5GZNC 5I75B 2XG5A 3ARGC 1BOYA 5FYJU 1BIHA 2VSDA 2HT3C 5LCVH 3GB7B 3O0RH 4E9LA 5T1KA 3HC0B 5ALCH 3K4DA 4XVSH 5E8EA 4OGXH 1TLKA 3RNKA 3AVEA 2AQ2A 1OSPH 5DJYA 5ID1B 2D7MA 4PY7B 5JQHC 3FOLA 2ESVB 3OGCA 4KZDL 4NN5C 1BQHA 4NKMB 5H35B 1KJ3H 3BQUB 4BFIB 5DD0L 5BZWA 5D71L 4K55A 4OZFG 4JO4L 1F4WL 4AEHL 1ZHNA 1P7QD 2A83B 3FOMA 4ERSL 1D5XB 2MJWA 4B41A 4B7LA 43C9A 1CL7L 4X5WB 5FHAH 2VUYA 4G6ML 2ZG2A 4NUJB 4FFWD 1AO7B 1G9MH 3GMMB 2R0ZL 2O5XH 1X5ZA 5DURB 4KHTL 1F3JA 3T0VA 2DBJA 1NUNB 1JWSB 1I1RA 4IRJB 2NZ9D 4JFPB 5M7QA 2PO6D 4S10A 2ARJQ 1NCTA 5ESAA 3QIWC 4J7RA 5ESQB 4LLYB 3D2UD 3QQ9D 1UB5B 3ULUF 2YPLB 3CD4A 1CE6B 3JWOH 3WBDA 4PRAB 5FYKH 4NM8L 2VL5A 3MQIA 3TV3L 2JCCA 4M7JH 4WI5A 3MRJA 2FD6H 5FUCC 1I9JH 1T1ZB 3OKDB 4Q2ZA 3EHBD 3UTSA 1BZ7B 3NCJH 4X6BB 1CLOL 4UV7H 2P8MB 4JFYB 3KHOA 3MFFB 5FM5M 4FQQA 5HXMA 3O6KH 3L7EB 3V6OE 1ZEAL 3GIZH 3P4LA 2WQRA 1CD9B 4NYLA 4NGHH 5I2IA 3QEUB 1WT5C 4OLYH 2BDNL 3MREA 5IESL 4P0DA 5IOPA 2DWEA 4G7VH 2G75A 2ZUSA 5DQ9A 4KI5C 1NGYB 1CCZA 1KIUA 3F65A 3D1MC 3QCUH 5I8CA 3SOBL 2HWZL 4LSPH 3MLXH 3C5SB 1U8KA 3MRQA 3FT4A 3SGJA 4XBEH 1XZ0A 3QFDA 3TA3B 1KN2L 2UWEF 5GHWH 3SKNB 3SDAB 2F9BT 4Z9KB 4ZFOA 1KCRL 1HQ4B 5DI8B 3RVVD 3I02A 4XCCH 3VCLB 4JQVA 1LHZA 2P5EE 3KJ6H 3U4BH 2QKIA 4FFVC 1SM3H 4J23A 5EUOA 5F7YC 4AIXA 5D7IA 4P48A 3DVNB 1NBZB 1HHHA 4M93C 4CVUA 1BZQK 4X7SH 2YPKA 3MTRA 4X98A 4KKLD 4JAMB 3RBGA 3V0VA 1M71A 3LH2H 2YD9A 1S9YB 1PG7L 5D5MB 2ZPKH 4HKZB 4WUUE 2EZ0C 5CINL 3RIFF 1FGVH 1CQYA 5FF6B 1M6OA 2C3VA 4NZDA 3U46B 4K9EH 4LLQA 5EO0B 2P48B 2AGJL 2E9JA 2IPTL 3VXNA 1IZJA 1NBQA 4PRPD 2APBA 4GW1B 1RK1B 2VUOA 4HK3J 2GK0A 2ICES 3MROB 3IFOA 1KIRB 3ULVH 4YDKH 5HYJB 1FZOB 3ZYIA 1HILA 3FRUB 4ZODA 2OR8A 4YHNB 4KRPD 3ZKNC 1HOCB 1NAKH 4HHAB 5K9KA 3ARDA 4OIIL 3T2NL 3BKJH 4L5FH 4J8RB 2F19L 4IOIB 1NCWH 4ZFZB 4H8WL 5CWSA 3JTSB 2DOCA 5HJ3A 5BXFB 5ICXA 5AD0B 5HYSA 1U95A 3GSXA 4KMQA 3MNZA 3V6FA 4MCZA 5DUBA 3ARWA 2YMXL 1KLUA 5K93A 1WWCA 3GKWH 1XIWD 1MI5D 3VXRA 2FYYB 2XZAH 3BKML 3O6FD 3AU1A 4NDMB 3MRNA 3EJYC 1H3UA 3P0GB 1BEYH 3NCMA 3HPLA 1JUFA 5JR1L 2NXZC 3SGEI 2IH1B 1UWGL 4PJBE 3CK0H 1B6DA 4QRRA 2HRLA 3CFDB 1PEWA 1MAKA 2PNDA 4FQ1H 4QHMA 1MIEH 3WDHA 1WVZA 3A67H 1Q94A 5J06A 5JHDD 5ITBH 4X7CC 2MMXA 5EFIB 1U8QB 4OZGB 1TQCC 3R0MA 4M1DH 4KK8C 3MYJA 1MREH 2VXTL 3BN9C 1RIHH 3C5ZD 5F7KC 1LO2L 3L3DB 4YEEA 1VGKB 4CBPA 4GXVH 4JO3H 4F15B 1EGJL 1YQVH 1IT9H 4N8VA 1Z5LB 3B8YA 1LK2A 5JXEC 4AK1A 3GMRB 4PJXA 4HZLA 4L8SC 1UYWL 3CPLA 2B1AL 4HUXA 4DKFH 4OLVL 1EFQA 2BFVH 3PL6A 4Y5VB 4C59B 1FFPB 2H26B 1JF5A 2BNQE 4HJ0D 5E1HB 3GSNA 4JFFD 4HEPG 3QA3B 1ZMYA 1ZHBB 4TUKH 3ZDXE 1A4JB 3THMH 1HH6A 2J5LC 3T2QA 3MSPA 4M43H 2BC4A 1LMKA 4LCUA 2DLFH 2F53D 3ROLB 4Y2OA 3I6GB 2A74A 4XPHL 4AIZA 5GSRB 3VU2A 2XRAH 4EI5B 4PYGA 5LGJB 2GFBB 1L7TH 1P84K 4ELME 2Y23A 4ODHH 3TT3L 4DK6A 4MXQC 3OKNB 1EMTL 1S78D 1TJGH 4MJIB 1FRGH 1Q9OB 3GZKA 4MAYA 2OLDA 3DMMA 5IVOA 1OB1A 3B2UD 3GI8L 4LCCB 5C7XH 1ED3B 1DN0B 1PYWB 4NO0D 3C60D 4R7NB 3IDXH 2XQBL 4Z7QF 4XPBL 1WCBB 43CAB 3NCEB 4N0FB 5EZIH 4MZ3A 1AQKL 2YOCA 3DRTA 4RISH 1YEIL 5DJZB 4Z0BL 1G7PB 1UB6A 4EOWL 3E6FB 1MOEA 1N8ZB 2D31B 4PB9L 4BA8A 5I1HL 4UDTB 2P24A 3L5JA 3L5XL 1XGUB 4U7KA 4LVNC 3NABL 5FUCE 3WFEH 5IEHA 4WTZA 2EECA 3DHJA 4Y5YC 3KNBB 1A3RL 3MXVL 5C08A 2VIRB 5KTEL 4CU6A 1BD2B 3H9SB 3RJDA 1QFWL 3TH4T 1OT2A 3O41B 5C09A 2CIKB 1BM3L 2VLMD 4R4FL 3C8HA 4NN6C 2I5YL 1L0QA 3B9VA 2DKMA 1LEKB 1K3ZA 1CTOA 5IT2H 3ZDZE 4K23H 4MNQD 3D87B 1R5VB 5CBEB 3BAEH 2GSIB 1GGTA 4WUKH 1N59B 1NCAL 2K3TA 1S3KL 4LSSL 4H26A 4PP1C 4P59H 2UV3A 5CIPH 3IDGB 1K2DB 3RY5A 3UC0H 4HUWB 4HBCL 1AI1L 4KI5E 1BGXL 1MCLA 3R06A 3LRSB 3L3GA 5D1QB 3ARFB 3FN3A 3RTQB 2NY0D 4ZO7A 1HCFX 3FCTB 1U36A 4F33B 2KL6A 1IM3B 3GSVB 3T4YA 2XWTA 3EFDL 1T21A 3RNQB 3QEQA 4WU5A 1QRNE 2VDRL 4WV1C 4X6CB 4IJ3B 3PWPA 3G5YB 3T0WA 3T1FB 4X9HA 5GGQL 3ARSA 5JZ7D 3BDYL 5E95B 3ILQC 1PY4A 3EOAA 3OAZK 3OR6A 1JZ6A 4MA1B 3QHTC 5AUMA 4WJ5A 4U1GB 3BMVA 3P73B 3VG9B 3EYVB 3OKLB 3EUUA 3T4AA 3QO1A 2DLTA 4S1SL 1AFVH 2V5TA 3NZHL 4P49A 2IG2L 3HA0A