5AYUH

Crystal structure of hyhel-10 fv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HyHEL-10 Fv
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ayuH00
2GAZA 1P4IH 5EFIA 1YYLH 2FATL 2UUDH 2VLKA 4PY8I 1UXSB 4YBLC 4MCZA 1JPTH 2VR5A 4ZFZB 3CAFA 3DYOA 4HIIB 2D0GA 1F4WL 1MFEL 3MODL 1GC1L 12E8L 4ZFGH 4GXUM 2YD9A 3W5NA 3U4EA 4NSKB 4ZUUA 3QUYA 4JLRA 4KI5E 3P4OB 5DFTA 1AD9B 4YFLF 2DKUA 3HUJB 5EOTA 2HTLD 5C07E 4O2FB 1FFPA 2R0WL 5D7IA 2K9UA 2BVYA 4QRQB 3DUUB 4H26B 3O2DL 1S9YB 5DRZA 3IDXH 4PGCB 2R9HD 2RCSH 3F58H 5JTWA 3BKML 1U3JA 1MEXL 3QIBB 1J8KA 2C1PB 1OTSD 5IFHH 1P5VA 4NBYB 3GRWL 5FV2A 1UB5A 2YUVA 3U0PB 5E2WL 1I8IA 4JM2F 3MMEB 1MAMH 5CP3H 4O58L 1FZKA 1XGTA 4WJ5A 2DF3A 2UZYB 5GGTH 1QBAA 2J8UF 5IW6B 3NGBB 5IMKA 4KRPC 1ZVSB 4D9LH 5FCUH 2WIIA 2XKNB 3QDME 4RBPK 5I9QC 4C4KT 4NRYA 4I3RL 1R3HA 1F8TH 5DRNB 1XZ0B 5IFAH 3ARWA 5IVXE 5DS8A 4M03A 2KQMA 1MFBL 1LQSR 4FQ1L 4N0YH 4NM4L 1XEDA 2DBLH 5I19H 2O61A 2DTSA 4KC3B 4X6DA 2QQLL 3LEYL 3NCBB 1KCUH 3KPLB 2V9QA 4KAQH 4E0RA 4I9WD 1T1ZB 2V2XA 2DJ4A 1WCQA 3MYZA 1IBGH 4WFEE 4XMLL 1CBVH 4KDWA 1N8ZA 2ZUUA 5F6IC 3MJ7A 4HBCL 4R3SA 5H35B 5FHBL 2COQA 3NCJL 2OBGA 4LP5A 3GMPB 5EU4B 3UJJH 1QSEE 3HC4L 1WC7A 4LLUB 4M5YL 3FO9B 1JRHL 1UEMA 4JFDD 1KNOA 1ERNA 3CFKB 5E2UL 2D31B 4U1LB 3NIGE 5DGQA 4PRHA 1TFHA 5EORH 1DQML 2VZUA 4NUJA 4YR6A 3CZFA 4OGZA 1WAAA 1OLLA 5IW3A 1JBJA 2IBGA 5CZXD 5DZLA 3F12A 1L9NA 1AKJA 1CGTA 5I1JL 1JPFA 1UADC 1CYGA 3WHXA 2F5AL 4ZTOH 3DV4B 4QRUB 2YUZA 4NWTH 4R26H 4ERSL 5KAQF 3U9PL 3JXAA 3RZCD 1OB1B 1AO7D 3MV7B 3VXOB 3GRWH 4PB9H 3O3AA 2H2SD 4HKZB 4LOUC 4OJFL 2HFGL 2UWEE 4GRWB 4NCDA 1QSEB 2YD8A 1A5FH 5DD0H 2XI9A 1QLRA 4I18A 3JTSA 3O4LD 4EDXB 3TCXA 2H41A 4ONOA 2X41A 2H6PA 5HVWA 1D5MA 4JQVA 3AS1A 2OJEA 3OX8B 4PG2A 1IMHC 4R7DB 1T5WB 1HQ4A 4FFZL 3NFNA 1QSFE 5L8LB 1FH5H 2XN9D 1LO3L 1QA9B 2UWEF 1LNUA 2OZ4L 4R8WL 4FQJH 4EI6A 1TCMA 4HC1L 1IM3B 1P84J 1FZJA 4LSSH 5GHWL 4I3GA 3PUCA 3OB8A 4QOKD 3IXAB 4QXGH 4M7JL 3GHBH 2OMBA 3OZ9H 5C9JB 4P49A 3NCFB 1CDYA 4F15B 1JMXA 3S36X 3KPTA 2F74A 4Y5YA 4PJHB 1BLNA 5FO8B 1G6RA 3MLVL 1R3IL 2IGFH 1XFPA 5GRJL 3UPCA 1JHLH 3VXPB 5BMFL 4K9EL 4Y19D 2C3XA 4XC1L 1AGEA 4U6XA 1REIA 5I1GH 3ZE1F 2VXSH 3L7FB 3VMOA 3O4OC 1A3LL 1JPSL 1J8HB 2QLVB 3QBTB 1VFBA 3RNKA 2VDRH 5T3ZH 3T1FB 1S7SB 4IBLT 4NM8H 4X83A 3U82B 1WFUA 4XC1H 5F1IB 4X6CA 4AMKH 4KVCL 5L9DH 2YD2A 2V5RA 4OGYL 3WFCH 3LD8C 2EDLA 2GK0B 5DRWB 3CDYA 1MJUH 4HW6A 4PGDB 4NM8L 4F7TA 2YPVL 1SJHB 1JWMB 2XKSA 1UKQA 4PJ7A 4YE4H 4GKOA 4WUUD 3QDMA 3GUTB 1XIWB 4ZS7H 5BXFA 5DZNA 3MRNB 3VDCA 5D2LB 1NAKL 3O3EB 3FO1A 3N1FC 5E6IC 2WBJC 1IGJB 3HE7A 4LQ1A 4XZUA 2ZSWB 1F11B 4ZFOL 1IKFH 4PRPD 4ZXBD 4FQXB 5GISL 1NMAH 3GIVB 1WLHA 2VLRD 3T09A 4X9FA 4OCMC 1PKQA 4POYA 1G0YR 4HS8L 4OTXH 5BS0B 4JAMB 3SGKC 3TJEH 4RA0C 4C83A 3TYGH 3SJVE 3DSNA 1KG0A 1YJDC 4M7JH 4Y16C 3ZHKA 1RZ8B 3D2UA 3VFTA 1XCQA 3HR5B 3W9EB 1X5ZA 5HPOA 4KJPC 4UV7H 1TJHH 4AEHH 4C55A 5IMKB 2X5PA 2Q6WA 5K9QI 5DEFA 3KPRE 2R2BA 1DSFH 4JGMA 2NPLX 4N8VA 3DURB 3ULUH 2P8LB 1NFKA 1XF1A 5CSGA 3AS3A 1HWGB 4OZGF 4QOKA 4LSUL 2ZSVB 2I07B 2Y6SD 3HZYA 1S3KL 3GSQA 1U58A 1SBSH 5C6WH 2ICWB 4N8CL 3ZT6A 5DJYB 3X14A 1MQ8A 2CXGA 2G5BB 3MCKB 1DFBL 2EC9U 1MCPL 2GJ6D 3H9SB 3T65A 1T1YB 5EUOE 4I18C 5GRVL 5ALCH 4U6VH 2VDOL 4JPWH 1ZT4B 3T0XA 5AWNL 1JHTB 4NNPL 4HH9B 1Q0YL 3VRJB 1TVHA 1WWCA 2ZWLT 4EOWL 3NCMA 4YH6A 4U1LA 1EDQA 2NYYC 3DVGB 1KPVB 4P5MB 3O4LA 5EIQA 5HGDB 1ES0B 2J8HA 4Q9RL 4GBXD 4UV4H 4QTHA 1AGDB 1JPFB 1W72A 5CILL 5DHYA 2FJHB 1NCAH 4ONGH 2YA1A 5I75C 5LCVH 1JF1A 1UWXK 4YHIA 4JFPB 5HHOE 3B8YA 5C0CB 1IQDA 4HUVB 4DJMA 2HWZL 3IFPA 1RIUH 4BZ1H 2ZCKL 4KI5D 4JY5L 4C58B 3BGFC 4L3ED 4OCLC 2FWOB 4GRWH 5ICZB 2B0SL 1KYOK 1RQ5A 4U1SB 2HLFC 1QRNA 5FKPB 2ADGB 5K9JH 5EOCH 3BUTA 3ZSTA 3SGJC 2VAAB 2OR8A 3FQRA 4C56B 3ULVD 5C0FB 3L7EB 3HZKB 2MNUA 2NXZD 4PV9B 5K9JL 1TJIH 1MRCL 1Q9WB 4WW1B 4TPRH 4P2OB 3SPVA 4DK6A 3C08H 4MNQB 4DEPB 5EU5B 4AH2B 1IGFL 1XR8B 1G1CA 3SE3A 4J3UA 5E9DB 5GRZA 2CDFB 5TF0A 1E6JH 1OGAB 7FABH 1RZGB 3T2NH 3GMQB 5GS2H 4DUXA 3NH7L 4DFHA 4PIRF 4FFYL 2VDOH 4JPWL 4JGJA 3DARA 5HGGS 2YPLE 1E28A 1ZLSH 4YPGA 1FL3B 2VZ1A 2KQNA 5DWUH 3RGVC 5JNYB 3O9WA 4PGEA 3OAYH 1VGEL 1YEIL 3QXAA 4NQXA 2G2RA 3R1GL 3BZ4A 1DBKL 2W0KA 3BKCH 4WU7A 3DMMB 2X4SA 4MYWB 4KV5E 4HS6B 2CKBA 4FZ8L 4Z7WB 4X8JB 3KPSE 4XCFH 4JKWA 4QNPF 4X6FB 5CJOL 3S5LB 1FYHB 3LKRA 1V3KA 2X05A 5IKCA 2NR6C 4RFNC 3WLBB 1AGCA 2VC2L 3S96A 4G6FB 2VLRB 3HNTL 1U8QB 2ORBH 3BP4B 4X4ME 5HHPB 5J1AA 4YJZL 4NQVB 2CGRH 4I0PC 1IC4L 3GUTA 1SJHA 4XRCB 4OZFA 2DQTL 1LK3L 1NC2A 4KY1L 5B39B 2I9TA 2E8ZA 4OSUH 2CH8A 3QHZH 2LABA 4QTIL 3DX6A 4MAYC 4PJAA 3NZHH 1V3JA 3BQUA 2PYED 1LEGA 4KUCF 4MJ5B 1DJSA 3V6FA 5L2JB 2KL6A 2VLKD 2J3SA 4N90D 5JORA 25C8H 2DTMH 2W60B 1KTRL 5DVLA 3V6OC 4X4XB 1BZ9A 3B3IA 3QIBD 3FT2B 1NMCC 2OK0H 1FL5A 4PBVC 2XWTB 4PG2C 3FFCA 1E6JL 4LF3B 2W0FB 5FO9B 3T0BA 2F5AH 1KTDB 1P7KB 3G6JA 3MZGB 3W39B 4I4WA 2R4RL 3CFEA 3F7PC 2P24B 1QFWH 2AJ3B 4M7ZB 2BOCB 1RJLB 1NAMA 3MA9H 5D8JL 2X4UA 2AJSH 4C59B 3ZL4L 2KUTA 4U6YB 5CGMA 3S4SA 4KZDL 2F53A 4U49A 5C0EB 3QUXC 4FQ2L 4NT6A 3L3IB 5F3HA 4R2GB 5E2TL 5EC1A 1D3CA 3O3DA 2A6DA 3DO3A 1LD9B 1KXQE 1NGWA 4JRYA 4V1DB 4K55A 4QY8A 4IRSB 4WO4A 3FAXA 2MMXA 5F8RC 3QXDB 4P5TD 4UIKL 1AY1L 1U8PA 2ICWA 2IAMB 3IKCB 1XIWC 3KXFB 1N5YH 4PJ5D 1ZT4A 2HFFB 5C0RL 4F3FB 2WUCH 3STZA 3KLDA 2LTQC 4ZUTA 4LSSL 5GHWH 3OKMB 5J9PB 4R90H 2HVJA 5BRZA 3FHAA 2DS4A 4JFOA 1MNUH 3CK0L 1BJMA 2FO4B 3WJLC 1K85A 3PWNA 1OF2B 1ND0A 1YPZB 3UTOA 5C71A 1IEHA 1FG9C 4NBZB 4X98B 3GM8A 4MX7B 3WN5B 4BM7A 3PDGA 5FA4A 3NIDE 4QRPE 4P9ML 4WHYG 1U8MB 1R5WA 4ODWA 3QWQB 5EZJA 4NUGH 2IMMA 1J87A 2CLZB 5D7KE 4HFUL 5MI0C 4KQ3H 4MSWA 3PJSA 1C16A 4NQED 1A0QL 5CMAB 5BOZG 2EKSB 2FYYB 3F7VA 4DGYL 2Y5TA 4CKVX 3MRJA 4QRRD 4O2EB 4U33A 4QXGL 3QCVL 4RGNE 2L0DA 4LHUD 1TPXC 4R0LB 1AI1L 4NHCL 4NZUL 1UM4L 2AK1H 5T33H 2E5EA 3NIDF 3NPSB 3ZKMC 2X6MA 1JZ7A 1JNLH 3FT3B 3N50A 3HZKA 4PB0H 3QIWC 3HN3A 1KC5H 4JY6A 2OTPA 3D3VB 3G5VB 3ECBB 3QEUB 3VGAC 5ESAA 3QCTH 2NY3C 4LHQB 3G9AB 2JCCF 1BOGA 3R8QA 4Y8AA 4QHMB 2UV3A 5L2KA 2BVPB 1GAFL 2VL4A 4EVNB 4JO1L 3VGAB 1M6OB 4ELMB 5C0RH 1BFVL 5I1KH 3MO1B 3VA2C 3UXFA 4YPGB 4JJ5A 4MD0B 3O81A 4ZFFB 1YMME 3LS4L 3IVKB 1Q0XL 5ICXB 4P2QB 3QWRD 3W2DL 2HT3C 5I74C 4BK5A 4D9LL 5IWLC 4PRPB 4ZXBB 5I1LA 3EDFA 5FOJA 5FYLD 4TOYL 5CD3A 3Q6GL 1OVZA 4CNIA 1F2QA 4QYOA 4CU6A 3D2UD 3B4NA 2ZP0T 5IFAL 4G9DA 1MHHA 3EO0B 1BGXL 4YEEA 2FB4H 4QHUA 4WTWA 4YR6B 3FB5B 1CG9B 4H0GA 3ZSSA 1KCUL 4PJFA 5C7XL 5IHUL 2XZQL 3O8XD 3TBTB 1J05A 3AC0A 4OF6A 2VLRA 3S8WA 1G7QB 5IMMA 3KS0J 1I7RA 1IBGL 4XMLH 1CBVL 3QIUC 2HMID 1OM3H 1I1AD 4HAFA 5DUPL 5B8CC 2O5XH 3F7YB 2C7UA 4ODTH 3ARED 1S5HB 4NJAL 4R96A 4IIQB 4S11A 1W8NA 2XZQH 3BD5A 3K4DA 1WISA 4X5LA 1C08A 3ZE2E 2YMXH 1WTGT 4MD5A 1R0AH 3FB7B 1X5JA 5DJDB 3O6KH 4ZQKB 3BQUB 5AWNH 5AG8A 1QQDB 3ZYJA 4OF8A 5DEZA 3KYAA 3H6JA 5IB1A 4WUUA 3TA3B 3P77B 4PB0L 4AYFA 1T4KA 4DGIH 3FZUC 3FRUA 5F7WC 3RL2A 4ZOEA 3L3HA 1W72L 3OKNA 2D7PA 2I9LA 2NMSA 5DHVB 2AV1B 5LKNA 1HCFX 2H32B 3MLWL 5DJ0A 2VQTA 3TN0D 4M7KH 1NL0L 5GIRA 2Y9RT 3VFRA 1FH5L 1T5WA 5DD1H 3PXJA 5E4EB 4MJID 5GS0H 1KIQA 1Z5LB 3BH9A 4P2RD 2VITB 3VMNA 2UYLA 3ULVE 3O3UN 3ZMRA 5JHDE 5T3ZL 1K2DB 5E5UB 1Q1JL 2EH7L 3D25B 2J6EL 4PJAF 2YZ8A 4PRID 3DXAD 3EFDH 4JFHD 2VB5A 3KJ6L 1HHKA 4PP2B 4PJXB 2WK2A 3SHSA 2V6HA 2HH0H 3LKNB 5GS3A 3W9DA 4UZGA 3MNWB 2PR4L 1ZVHA 3B5TA 4QHNB 1CLZH 1RVFH 3HI1B 1FJ1A 4KJQC 3DXAB 4MB3A 3PWPA 1H5BC 4PV8B 2R0KH 3DIFA 1IAOB 4I1NB 5TQ0H 2P5WD 3F5WA 2C4XA 2LE9A 3MV9A 4QXUL 5T3XD 2FECI 4DN4L 3O8XC 2OQJB 4G8GE 2A83B 4X6EB 4LAQH 1JI2A 4K3DL 2CKNA 3C08L 4HPYL 1BQLL 1DANT 1UA6L 1UWGH 2Y25A 4ODHL 4XHJD 3HCVA 1QBLH 5TQ0L 4YGVB 3LEVH 1ZLUK 1AO7B 2LVCA 4XPHL 4XNUH 2BERA 4ZFOB 1RJYA 4OCYL 2Z35B 2AKRA 4Z76A 3DX7A 4HFWA 1IEAA 4YPJA 3TNMB 3Q48A 3WYRA 1RULH 4HWZB 3PWLA 4YHKL 3TJEL 2V2WA 3NBNA 4HGWB 1YPZA 3MSPA 4N68A 5T1MB 5SX4I 3MRRB 3DJ9A 5HHQA 3OJMB 2VZSA 4GQPH 1DVFA 4HWBH 1XF5B 3RIFK 4C56E 5D1QD 3GMNB 1OPGL 1Q8MA 4HJGB 5A3ID 3FO1B 3PDDA 2R2EA 1U8IB 3SCMC 3ZLQC 5L0QC 1DN2A 4PY8J 2NZIA 3D85D 1KT2B 1H5BA 2W92A 4GAFB 5FUZH 5J12B 5DD1L 3WO3B 1WEJL 4Q74A 1HIML 3LSOA 4KKCC 4MSWB 4NN7C 3W82A 3W0WB 2B0SH 4DUVA 1G6RH 2UZXB 3CMOL 4X7DC 5EOCL 5D1ZA 3O45A 4AY0A 2ARWA 3DMMC 2R2HB 5DMGC 4C83B 1FG2A 1A9EA 3JWOH 4QRRE 4H25A 1PZ5A 2EO1A 4UNUA 3LN4B 2IMNA 3THMH 2IQAA 4NKQB 1BD2A 4KQ4L 1VEOA 5BV7H 2RB8A 3MBEC 4OCWL 2NTSP 4F57H 1BEYH 3U6RB 4LRIA 3WL9A 1MUJB 3D3VA 3DGGA 1C5DA 4MA7H 3LIZH 2J5LB 3C9NB 3L9RA 4LEXH 3KYKH 1IT9H 5HYFA 2V7HA 1IGMH 5DQJA 2MWCA 4JHAL 4KVNL 5TE7L 2FL5A 2VQ1A 3QO1A 3NIFF 2AEWA 1YZZA 4IJ3B 1J86A 1RUKH 2Q8BH 1KB5L 5KAQG 4XWGH 2NQCA 4S2SB 2R1WB 1DFBH 4XPBL 2VC2H 2VE6B 5CSBA 4YZFE 4JN1L 2GTZB 5FM5O 5ILTH 3EO1A 4LCYA 1UM5L 4YAQA 1I9JL 3O41B 4OF5A 3QIUB 3VFVB 2NY7H 5LGHH 1EO8L 4LLAA 3S35L 1N59A 4OM0H 3CLFL 3FFDA 4NRZB 2EYSA 2VZOA 1OQXA 1A6ZA 2WP3T 1HOCA 3MODH 5AZ2L 3PHQB 1YEFH 4HDIA 4ZUWA 1CG9A 4Q9RH 3EJYD 2NY7L 4K2UL 1IGCH 4PJFB 4AJ0A 5L88L 4ELKA 2YD1A 3GMLB 2C1PA 3BN9D 3QJFB 5C09E 2R1YA 4PRNA 3LKSB 3IXTA 3PGCA 2B8OT 5J11C 3B6SA 1TXKA 4L3CA 4R0LC 5GS1C 1S5HA 1SJVA 1WTLA 3KNBB 4W6WB 3RRQA 4WHTA 2K1MA 1FL6A 2H2PC 3VCLA 3TNNA 1Y6MR 1J1XL 4ISVA 4L5FH 5IB1B 4R90L 3MBXL 3H3PL 2EIDA 4BH7B 5DS8B 3STLA 4PJ8C 2NY3B 5H94A 5F21B 1B0GA 2VLJB 3FCTB 3RY4A 3HR6A 2H26A 5HI4C 2XV6B 4IDJH 1QEWA 5DUMH 1MJ7H 5E8PA 5ISZE 3HC3L 5CJ5A 1Z9OA 4ZNEE 1FNSH 1HK6A 1DQDL 2H32A 2PW2A 2MFNA 4DCQA 4OFDA 4J3XA 2DBLL 1CVSC 3NFPA 1S9VB 1DEDA 3ELAT 2QSCH 3DETD 4M1DH 2UYLB 4YBHA 1MHCA 5KSUB 5DJAB 1OSPL 1UENA 1U8OB 1NGPH 15C8L 5C0ND 2Y72A 1VFAA 1AHWC 4ZOAA 3HPJA 4NHUB 1J8HE 1FORL 4RNRA 1TVBA 4XX1G 4QRSA 1P1ZA 1JUFB 4AM0A 1VFOA 5FYLH 3BP5B 2ERJB 2Y4SA 5E1AB 3QEGL 4DGVL 2B2XH 1G7MB 2CRIA 3TM6A 3TA3C 1A6UH 1OCWH 3DBXB 2Y36L 4XVTH 2ZCLH 1KJVA 3CUPB 1ZGLA 3OPZH 4Z95L 3FQTA 3QUKB 3O11B 2X70B 1S9XA 2LAAA 4NO0A 2Z35A 4OD2B 2DKSA 2IH3B 3D0VA 1RZKH 5FKAA 3S96B 3EYUH 5TDPB 3EZ8A 2DIBA 4ONHB 4MQXD 1F8TL 4JFZL 1CFSA 2DI7A 3VFWA 1LDPH 4XNXL 5JPMB 4HGWA 5T1MA 5DMIH 4M02A 4HJGA 4OCXL 4UU9A 3VWKA 2BNUA 2KPNA 1P4IL 3R0MA 4NSKA 2R39A 1TCRB 1YQVH 1I8LA 5FHAL 5E08H 2VL5A 4I3SL 1U8LA 4FXKB 3UBXB 1UEYA 4E41E 1DL7H 4LLQA 3UTPE 2E27L 4ZXBC 2BC4A 3NACL 4TTDC 5I8EA 4B53A 3IDJA 3GKWH 1F6LL 4XCNA 5EBGA 1HHJA 4WENB 2YSSB 3HNTH 3BW9B 2MHAA 1Q94B 1DL7L 2X4QB 2WINA 4A6YA 4PUBL 5F96L 3FRPG 5BQ7A 1RFDH 5F8QC 2VKWA 4U6XB 5I1CL 5F7UA 3GI8L 3ZKMD 4OSUL 4RGMB 3FB6A 3FONB 1C5DB 2YPKB 3LRSA 4J3OC 2BVTA 5IB5B 2Z91B 1YYMH 1CT8B 5EZOH 5GGTA 5BVJB 5F9WC 1X6NA 3DLQR 4Q0XL 2F53B 3BPOB 1CR9H 4LPUA 4K7PH 1WZMA 5FGBA 5D1QA 1OWWA 4JCLA 5T3ZD 3H3KA 2V7NB 3K8KA 5HHNB 5C2BH 4OV5A 3NTCH 4LSPH 2XQBH 3QO1B 1KJ3H 1MELA 4UIKH 4TTGA 5HVHB 2AK4B 5C9KA 3HNSL 5BZWB 2HG5A 3CGTA 5T5NG 3S36L 1D9KC 5JZ7D 2EDRA 3P11H 2R1WA 4JM4L 2F54B 5EBWA 4ODTL 2AP2A 1G7JA 3GI9L 2EDTA 3OSKA 4NUGL 3SBWA 4EN3B 1R0AL 3WJJA 1EPFA 1R3HB 4Z77B 4HD9A 1PG7L 4FN0A 1WC7B 1KLFA 4GRLA 4LLUA 3KPPB 4UMGA 5H2BA 2XWJA 1YEHL 1G84A 1ND0B 4DGIL 1ZKAA 4X99A 1WBXA 3GMLA 4DTGH 2GK2A 1P7QA 2QSQA 3MUHL 4NPYA 1YY9D 5DVKA 1JRHH 1UFUA 4LRNH 3EO9L 1D7FA 1EV2E 1I7TA 3DUHA 1G9NL 3VXTA 1CFQA 2GY7B 3GEWB 5EZJB 4PJEE 2R1XA 2XY1A 4HUNB 3P30H 5DYOB 1UZ8B 1R3IH 1Z9LA 1LO5B 3FTGA 5JXEC 4F9PC 2BNRD 2EDOA 2VZTA 3LKOA 4P23B 5KSVB 4G43A 5D9SB 5IQ7L 2WWKO 1X4ZA 1LO3H 4OUUB 4D9QD 4NKMB 1J0IA 2L7UA 1H8OA 2CJUH 4O2EA 4EDXA 4F9LA 2VABB 3N85H 5A2IH 3CVHL 3SDAA 5JUEL 4RMUA 1ZLUH 1BZ7A 3BVNA 3ZKNC 5BRZE 1CR9L 4EUPA 4JQIL 2NY3D 2W0LA 2H8PB 3N9GH 1UQSB 3GSOA 3I02A 5HDQH 1NAML 1AH1A 3QIWA 5C2BL 1AQKH 1QSFD 3ARBA 5INCA 1FNFA 3RWGA 4BKLB 2GIYA 3SDAD 1V7NL 1MQKL 2MSPA 3T65B 4BUHA 2YPLA 1MCOH 3QXUA 3AXLB 4ODHH 4HBQA 4N0FA 1BFVH 4HUMB 4EVNA 3E0GA 4UIMA 3QB7C 4ODXA 3QCVH 5CEXA 1EIBA 3IXAA 3TT1H 4XVSL 2FIKA 3QXVA 5GS1B 3NFSH 3HPLA 5LVEA 1F90H 1YUHB 2F58H 2BVOB 2Y7QA 3ULSA 1AXIB 1A3RH 3I6GB 3DO7A 3GNML 1MFDL 4K9EC 4MNGE 2A77H 1WICA 5SWQB 2P46B 3OZ9L 4UTBH 3EZJB 5LQBH 3R06A 1CK0H 5E1AA 2GITB 2BSSA 1A3RL 1TDQA 5JW3H 2JB6B 3GSWA 3TT3H 1HEZB 2F8VA 3O11A 3GBMH 1UACL 2X40A 3RDTD 1MHHB 3NOIA 4Z78B 5I71C 4KKLC 5JHLH 3OL2A 1PEZA 1NBQA 5LQBL 3ARYA 3FQTB 3QUKA 4OZIF 1OARH 2GSGB 1RUQL 2VDML 4JZOB 2IFFL 2HKHL 5FK9B 4JFEE 3MLYL 2FHCA 5ALBL 3JV5A 3TPUB 3JWOL 3ME0A 2JB5H 4IJ3C 1OGAE 4WV1C 4TULH 5C09D 5GRUH 5LWYH 3UO1L 1WZKA 2FR4A 2EE9A 1EHXA 1R5VA 3O3EA 2BY1A 1RZFH 4MXWL 4AEFA 1BWMA 4XCCL 1XR8A 3L5WB 4XB8A 1I9EA 3EJYC 5J4MA 1F58H 2L4OA 2QR0A 4YDIL 5JQ6H 5E9DA 3NA4A 4OLEA 4X4MA 4XAKD 4V1DE 2VRAA 2GYSA 2VWEC 2IANA 5CP7A 3LQAL 1QBBA 2E9WA 4D94A 5F7DA 5A2LH 4L8DA 5KVDL 4U1KB 1RY7B 2NY1C 2DN7A 4PS4H 2DQFB 3H42L 4PJ9B 1A64A 4URTB 3PABA 3RA7H 2X09A 4WWKD 5HYSB 1M7XA 2DOCA 1NBZA 4LLVA 1PZUB 5JOPE 2RAMA 2G2RB 4TRPH 4BELD 5J6HA 4Y4FA 2AJVL 4HK0B 4LEXL 1U92A 5K33A 1OP3K 1OSZB 3RVVC 3OKOB 2G75B 3GGWB 1I3RB 4X6CF 3MBXH 4YWGH 4YXHL 3IFNL 1LEKA 1H3UA 4KK8D 4P23C 1D5XB 4UDTB 1SJEA 2OM5A 3HI5H 1PVHA 5IG7B 1FJ1B 3RZCC 1Q0YH 1ZSDA 3ARSA 4H5SA 4M93C 2OL3L 1TZIB 3WLBA 3G6DL 4NQDE 3MV8D 3MUJA 1MJ7L 1GCFA 4AENB 1ZT1A 2WLZA 1FVCB 4WI8A 1FGNL 2IJ0C 4UI2A 4HIJB 5TE4H 4OAWA 3V95A 1I1AC 1QFPA 2C5DC 4WY7L 1DZBA 2NX5B 5ID1A 4XPHH 3KXFD 3FRPA 4JHBA 3Q5OA 5ALBH 2VDPH 3QQ9D 3GRWA 4I0PA 4NKOB 4YO0A 2EC9T 2WBKA 1T21A 2W9LA 1JHTA 1XGQA 2OP4H 1DUYA 4V1DD 2HH0L 1LK3H 3ET9F 4LLYB 2Y06H 1MCPH 4KRLB 3IDGB 1I1FA 4WO4D 4MA1B 2DQJL 2VO5A 4HGKC 2XPGB 1F6FB 1J0YA 4XCYB 1U8NA 4NPYB 2OR9L 1ES0A 1BOYA 4XNQA 4QF1A 1MWAB 5D70L 1R3LB 1DP0A 4PP1C 4F58L 3QJHB 3GSQB 1K8IA 1ZLVH 2Y06L 5F97E 5C0IA 3KPOA 3JV6B 3U7WL 4M8VA 5MEPB 1PD6A 2VDKH 5IP4A 2VDLH 3I2CL 3MV01 4KJPD 1J1PH 1SM3L 4K07A 1IZJA 2AJ3A 3DYMA 2FD6H 5DYOA 4PRAA 1BFOA 1EBPA 4HZLA 4OT1H 1CQYA 4CBPA 3ARXA 4Q9CA 2VKXA 1RZKL 4P23A 4WI6A 3X17A 5KSVA 4K3JL 1IGYB 4XPGH 4P5KA 4OGXH 4WEMB 3L3IA 2R0ZL 1OGTA 3UZVB 5KVMC 3FFCD 3L3OB 4UDUB 3ROOA 3QUZA 5C0FA 2IH1A 2MQ3A 4GAYA 2B5IB 4ODVH 3KPQA 1CGXA 1IAKB 4F80A 4WO4C 5F7EL 4NKIH 5LGHL 1KSRA 1CFTA 2H8PA 6FABH 4ZSOE 3VFOB 3BIBX 1GHFH 2XA8L 5LAXB 3BRFA 4RQQB 2AJXH 3U0WL 4G6KL 5D5MB 4F9PA 5HHXH 4DKEL 4XBGB 2XKNA 4LFHG 4UIMB 4YHZH 3SO3C 1T22A 4CMMA 1S78C 3VD9A 4JEGB 4IS6A 1I1AB 1FIEA 2E6QA 2JJTC 4YUEH 3G04A 1NCTA 3ULSB 4E41B 2CRMA 2DWDB 3HMWH 3QNXA 2HLFD 4HC1A 4WW2C 3FQRB 4XNZB 5T3ZE 4YHZL 4NP4L 4EI5B 3QEGH 4DGVH 3OXSA 3W11D 2FZ3A 3V4PL 4EQ3A 3CXHK 3FFDB 4NRZA 1DBAH 3WHXB 5A3IC 4M4PA 3OAYK 1RUMH 4Y7MA 4K7FA 3LPFA 3MJ6A 4RGNB 4KDTA 4P2OA 3OPZL 4Z95H 5DZOA 2R23B 1FFNA 2YEZB 4WU7B 2J8UE 3SKUD 2DL9A 1SQ2N 1WT5A 4Q0XH 4I48A 1UKSA 4L4VD 1S8DA 5D7LA 3LH2H 5IVXB 2R4RH 4Y5XC 2P45B 3QUZD 4MDIB 5I19L 3JTSB 3IRZA 3B9KC 4P3CH 1ZOXA 1TLKA 4LP4A 3S37X 4OLYL 4JFXB 4G80A 3SGEH 2J8UA 1WK0A 1QR1B 5CINL 1T0PB 4EIGB 3O2VL 1PFCA 4HJJL 3BT2L 3RI5F 4S1DC 3QPQC 4Y0GA 2Q3AA 2KBGA 3IS0X 3DV4A 2E6PA 2FECL 2QR0B 3KS0H 1IQWH 4DUWA 4MCYB 3V4UH 1T0MB 2VYRE 3WIHH 5CLTA 3FQNB 4FNLH 3S34L 2ATKB 3KJ4B 1R24A 4NOFA 5BO1H 4YDJA 1MIMH 4L9LB 2VDQH 4L8CB 2R0LL 4FFZH 3O6FD 1MVUA 3CFBA 3OAZH 5MEQA 2LU4A 5A40E 4GH7B 3KR3L 4HH8A 3EOBA 2HT2D 5CBEB 2DYPB 3SJVB 2BJMH 1N64H 1X5KA 3LMJL 4KY1H 4BQBA 2OX5A 2CO7B 4P9HL 4MQSB 4Q6IA 5IFJB 3QRGH 4Y4FB 1X9QA 5EORL 1CL7L 1PLGH 5JUEH 2B1AL 3O9WD 2HRPL 4POZC 3A6BL 4PJHE 4NZTL 1WWBX 1TZIA 1A6TB 1D5XA 4UDTA 5IBTH 5JQHC 4TSBH 5C9JA 2PUQT 2A2QT 4KGLA 4ERSH 3AU1A 1LP9F 1G7MA 3LH2L 4R4NC 4TN9A 4F7TB 3WNOA 1CGSH 4EZMA 4EXKA 4P3DB 1H15B 4L29B 4KK6C 1FZKB 1AR1D 3LDBB 1KBGH 2NLJA 1RIHH 5DEGA 3V6OE 5HGBB 1OSPH 2UY6A 3PXHA 3LV3A 4JM2B 4RZCB 2FX9H 2EXYC 5DUPH 1IGJA 3RNKB 1RMFH 3C8HA 1OY3B 3MA7B 3RVVD 3BDYL 3FRUB 4FZEH 4PJCF 4H1LB 5J8OA 4QXTA 3QDJA 4KZEL 3FQUA 3WO4C 1YMMB 2GCYA 2WUCL 5KZCD 4OFYD 1IAII 2NR6D 2DAVA 3PWPD 3PQYE 1YN7A 3JV6A 1AGFB 3LEXB 5HHMD 4HWEH 5CFHA 1NAKH 3VW3H 3S88L 1KXVC 4Z7VB 5I2IA 2Z4QA 3NVQA 3P0GB 1MCFA 2VXSL 4GRWE 3P30L 3RNQB 4EUPG 5E6IA 3QI9C 4HT1L 3BISA 4Z7QF 4JKLA 2PF6A 3GBML 4RAUA 3K0WA 3KXFA 4XP1L 4OZHF 3MJ7B 5JW4R 4K7PL 4KUCD 5DEFB 3PP4H 1U3HA 5J9PA 3RVTC 3P0VH 2EKSA 4UT6L 4XNYH 4PJXA 4PJGB 1SYSB 5D1XD 4DAGH 3DVNA 5HSFA 1F02I 3SDDD 3L3OA 1JN6A 3G6JF 3P2TA 4GBXA 4P59L 5TF1H 4UQ2A 3CXHJ 1A1OB 1BX2A 1GAFH 3QAZC 5ADOL 2EIZA 5DFWH 5FYJD 4NO3A 3S36H 5JA9A 1E6OH 2G60H 5ABDE 3A6BH 1O7SA 1CFTB 1BMGA 1RV6X 5KG9A 3LQZB 4J7RA 3X13A 5AD0A 4JVWA 3CX5J 4E5XB 5L9DL 1CIUA 3VI4E 5CEZH 3RFZC 1U95A 1JIBA 2ED8A 1R3KB 1TQCC 2FSEA 2AXJA 4HFUH 3KPRD 4G8EB 4K3DH 2F58L 4NQCE 1TVHB 3TNMA 3F62A 3AREA 4E41A 1UWGL 3KHQA 3WNMA 4ELMA 4X9HA 3DSFL 3TFKC 1RFDL 1I1AA 4RFOH 4YIQB 5FGCB 1X5IA 2APVA 4WTZG 5E9DD 5ADPL 2IPTH 1QRKA 2I60L 3N0PB 3HI6H 4G6AD 2OJEB 4G6JL 3MRHA 1BQUA 2AJZA 1L0QA 4M7KL 5C09A 1JYWA 1JK8A 1MOEA 5IMLB 1S8DB 4JZJB 3LB6D 4ZPTB 1IVLA 4MLIA 4MJ6B 4QHUB 2A6JA 5I1JH 3J7HA 3TV3H 1BFSA 1Q1JH 3VE0B 5IGXL 3RU8H 2CUHA 4KMQA 3QEHA 5D7SL 2EH8L 1YEDA 4XBEH 5JOEA 3MACL 3ZT5A 3HB3D 3EFFA 4LSRL 3B9VA 1JTTA 1NUDA 2OSLA 3VGHA 4MZ3A 4WDIB 4HJ0C 4PRPA 4PV9A 4GUPA 4ZXBA 1CCZA 5I1LB 3CU1A 4R7NA 1CXLA 1X7QB 3KYOA 4H0IA 2I25N 2G60L 3MLSL 2BFVH 2Z8VC 3MTRA 1GPOH 3D39D 5DJ2B 4JKKA 1BZ7B 4F57L 3PWUB 4KROB 4DTGL 1WVZA 5I15L 3EOYG 4YDJB 4CJ1A 2I9LB 3PHOB 3KYKL 2ATKA 1MRCH 5CEZD 1I7RB 5BCAA 1E28B 1OP9A 2APWA 5DSCB 1YC8A 5CBEA 4YHKH 4LU5L 3RWCA 4MD5B 5C0CE 1M7DA 2A9MH 2EEDA 2KKQA 2PETA 5CEXB 3DV6B 4HPYH 5EU5A 4J4PD 5EN2B 4CVZB 1FNEA 4PJAE 4QRTA 1F11A 1FFOB 5GSRA 4Q6IB 5IFJA 1ACYL 2CKBB 1I3GH 1FC1A 4TSCH 3MLYH 3SCMB 2JIXD 4QCIB 4K9EH 5EBLB 3VRLF 4BA8A 4O9HL 3QWRA 2DKMA 2FGWH 4MQTB 1HIMH 1K9TA 2CIKA 4R2GD 4PJIA 3IFOB 4OIBA 4OZGE 2ZUYA 1CGVA 1HI6B 4XTRD 1U3HD 1K4CA 4RDQG 2MOVA 3TV3L 5CD5D 3MUGA 4J6RH 2GFBA 1JFQH 3BGAA 2VDKL 3LHPH 5L2KD 1GHFL 2XA8H 4U6HA 1BJ8A 1D9KB 2ADJA 3T77B 2YZ1A 1QFWI 3BE1H 4GMTH 3HR5A 4OCSL 3W9EA 4U7SA 1R6VA 4G9FD 2ZNWA 3D25A 5E6ID 1QR4A 3MV11 1UH2A 4PJAB 3EHBC 2EH7H 3D87B 3RWFA 5LBSH 1S3KH 3OQ3B 1FRGH 4P5TA 3O6FA 2CD0A 2ITDA 2ZNXA 4OFYA 1MFDH 4PJDF 5D70H 1MHEA 3HZVB 1MPAL 3L1OL 4JDZA 1TJGL 4YDLB 2VXTL 4GG8A 4BH8B 3H3PH 3LY6A 2BNQE 3F5WB 5EFIB 4WEUD 1S78D 3L5XL 5B38A 1D5ZA 1KCSL 1HILA 1IKNC 2Z0BA 3C6LD 4N0CC 3JTTA 1EHLH 4XRCA 5DK3A 4QXUH 1GSMA 2M1KA 4MNGA 3ZTJG 5CUSH 1A47A 4IOFD 4NBXB 1RJYB 5KW9L 1KCSH 1Q9LB 4MVBC 4XCFL 3VD3A 2X2YA 3PP3H 5EOTB 1JV5B 1BQHA 2RBLA 3VRJA 1FLTX 3OKDB 5L2JA 5C6TH 4OZGB 3ZTNL 3PWLB 2HA1A 1KV3A 5HHQB 5BJTB 3RWDA 4PRHD 3TH4T 4Y4KB 5HYSA 4WY7H 5DFVC 1O5DT 2FH8A 5IBLD 5D6CB 4QTHB 1N6QL 4AL8L 3QIBA 1YEEL 4TNWF 5D7LE 3FFCE 3DBXA 4OZFH 4CVXA 4YWGL 3V4PH 3VXRD 3MXWH 3V7AG 4Y19E 4LVHC 4GQ9L 4JFPA 3BMWA 3QUYD 3TBSB 4PJ9C 4QT5B 5AZEH 3HMXL 1WEJH 1KELL 2DIAA 5DD5L 3MXWL 2YRZA 4K3GA 4LSDA 3BP7A 5J6GB 4RBPH 32C2A 1VESA 3QQNA 4GT7A 1IGML 3IJSA 3H42H 3O3DB 3SE3C 4C56A 4M62H 4FABH 3S5LG 1N3NB 4NGHL 3RUGA 4YC2C 3VXMA 3DROA 2O5YH 1NJ9A 1QYGH 1YPZE 1MVFA 4OI9A 1LGVA 1DR9A 3CFJA 1J8HD 1HOCB 3VWKD 1CFNA 2OK0L 4JG1H 4LRIC 3CVIL 2UWEB 2GW5A 2VXUL 3SE4C 2W9EH 2CRYA 3EYQD 1OTTD 3GJFB 1WF5A 3OXRB 4PLKC 2VLME 5KVEL 4PR5B 1A21A 4ZG1A 3B9KD 5E8EB 2Z8SA 1K3ZA 4NO0D 4NKIL 1O7VA 5KSBF 1JPTL 4NOBA 2BDNH 5KANI 4YHPA 3GSVA 4FMFA 3T04D 1RURL 3C60C 1T0NB 1ZGLM 3MFGB 3T0AA 4K8RL 5B8CB 4PJDA 1OB1A 4RIRB 4OBSA 4P5KB 2YBRB 1WGOA 2ZUVA 5HHVH 1MJJB 2DJUA 5I1IH 4NHCH 2V7NA 3RL1B 4JHWH 1WZ1L 5DJZB 4ELKB 4LDEB 2NW3A 5A1AA 1XF3B 3KPQB 4L1DA 4X6FA 4X9GA 3S5LA 2Q3ZA 4N90E 1E4XL 5IESH 2E7CA 2V5YA 1FNAA 1DQMH 2QQNL 3HS0B 4ZFFA 5BW7C 4NO5A 4L4TB 3TBYA 5C2UB 2F54A 4S1RH 4JHWL 5JW4N 4FG6D 1SY6A 1KPUB 5J57B 5J11B 1JHKH 3MV7E 5I71B 3WXVH 5E4EC 4CNIB 4PJ8B 3BZEB 3ALPA 4MA8H 1QSFB 2XWJB 1T83A 3WDHA 1BBJB 3GM0A 3MX0A 4APQD 2HFGH 2OI9B 1ZMYA 2AJUH 2OJZH 3R8BB 4NNYB 4Z0BH 1WBXB 3OKLB 1GZPA 3MV8A 2X1OA 2D2OA 3GK8L 1JUFA 4AM0B 1E6OL 5FGCE 4WV1B 2FZ3B 2QQLH 5MHSE 2YA0A 2X7LB 2F74B 1CLYH 4Q97A 2ARJQ 5FGSA 3VG0H 1BLNB 2R23A 1S7WB 3F7YA 2G9HB 3V5DB 5IIEA 3RVTD 1FFQA 2EE2A 1LO5A 3BUYB 4MMXC 3D1MC 4HXAH 3SO5A 2Z31B 3TO4B 1BD2E 3FL7A 4U1MA 4YK4C 4GKSA 3RWFB 4OI7A 2GJ6A 2DB8A 1TZHA 1VFBB 3BD4A 5TFSH 3P0VL 3P77A 5IJKA 1MFBH 1AO7E 4ONHA 3S3SA 1JGDA 2QHRL 4P59H 3OKNB 5TF1L 4HWEL 4QRPB 1WBYA 3L6FA 3ZYIA 3W2DH 1QBML 3JWDC 3MUZ1 4Y1AA 1VADA 4FOMA 4NCC1 4Z7VE 3IS1X 4W6XB 4DKFL 4X6DF 4UU9B 4JRYB 4V1DA 4G3YH 2VSCA 1YC7A 3JTTB 1KACB 3OV6A 2N4IA 4LLMA 1ONQB 4O58H 5ACZA 5JPNB 3AFLA 3WUZA 2VIRB 4P2YA 4P9HH 4IIQA 4CW1B 3U0TA 1MFAL 1DQTA 2D7TH 1KJ2H 2QSTA 5JIPA 2DQCH 4LLDB 5FDWA 4DVRH 2P5ED 4KHTL 1B0RA 3SDCC 1PQZB 5KS9E 3MOBL 4PJGE 5CJQH 3ZKSD 3A0OA 2NTFB 4K7PX 1BM3H 5DJ6B 3LS4H 4XI5C 2MKLC 5CEYA 2XN9E 2Z8WC 1IFHH 1MEXH 1R3JB 3GDBA 3OKKA 5EO9B 2EH8H 3CFBB 1ZWIA 4OF3A 2ATPA 5ESQA 1GZQB 1CDCA 2FCBA 2C26A 2BJML 4QKXB 1NGZB 5F7MC 4CN6A 1JZ8A 2OI9C 5FA4B 4I13B 1QFHA 1HDMA 3S6CA 3T1WA 4WU5B 4UT7L 5GGRA 3D48R 5SWZE 4ODBD 2MCPL 1BD2D 5DA0B 4R8WH 4PG9A 3SE8H 4BFBD 3ETBF 4UTAL 2EICA 1FVDB 3DSFH 5I1DB 5IHZA 3NN8B 1Y0LB 3MJ9H 5HGAA 3RPIA 4DVBA 2CO6B 1UACH 3AROA 3WFHB 3WIFA 4R4FH 3KPSD 4L29A 3CVHB 4HX1B 3QDGE 4DZBA 3FN9A 4HUXB 2ZUQC 3AAZB 2P5EB 4O4YL 3T3ME 1P53A 1G7HB 4OB5L 2A83A 3QWOA 5KSBA 1N3NA 1AE6H 3EAKA 2QQKL 3WN5C 3JV4B 1N6VA 5D2NB 1NCWL 1U6AH 4TNVK 3SE9L 3U36A 2A6IA 1LK2B 3CFCL 3NIGF 3QIWD 3LSOB 3PWVB 1KGCD 3RWEA 4EBQH 4ZFOA 3SGDH 4MQ7A 1DQJB 3ESUF 3MLRH 3GHEH 1MCOL 4MVBD 4MCZB 3VI3F 4MHHG 2CRZA 2DQIH 4HIIA 4LVNC 4JQXC 3U4BH 3O6MH 1BM3L 4UILH 1FAIH 5C70A 3KLHD 2HJKB 4FTVD 4JJHA 1ZE3C 4TUOA 3GSVB 4OFPA 5CJ8A 1NBZB 4JQIH 3UX9B 4JCMA 3U9PH 1D9KD 1EEUA 4C57C 1LE9B 1QG3A 1ZTXH 4FQQA 3U30B 4J3VA 2V5SA 4YX2H 3C5ZB 4HIHA 3EO9H 5B8CA 4F33B 3TBWA 4ZD3L 1R5IB 3QG7L 1YEGH 2NXYD 2FLRT 1T7ZA 4XXDA 4Q9QL 2BMKB 4U0RB 2HJFB 4XPTH 4ZAKA 3UROR 2FNBA 5IVNA 5EUOF 5IVZA 4KQ4H 1MJJA 4WW2B 1UB5B 3RGVD 3ULUC 4XI5D 2GT9B 1J05B 1XF3A 3JZ7A 4CU8A 1I85C 4JO2H 4HT1H 3BPCB 3WIHA 3QH3B 4HIEB 4LRNL 2JF1A 3EO1B 1J11A 3I3DA 4LCYB 3PV6A 1UWEH 1KPUA 2YPLD 2HKFH 3WL9B 1NCAL 1T21B 5MEOB 1OAKH 5DRNA 3K3QA 5I1KL 4ZQKA 2VDRL 1S7VB 2V17H 3T8XA 4CADA 1QQDA 3UO1H 5IGXH 4UOW0 2QV2A 3HPLB 4HDIB 4HWBL 4DZ8A 1U8NB 5GGVH 2H3NB 3MYJB 1KENL 1E4WL 1OAQL 3O4OB 1MHPH 3GMQA 4LSRH 4U1NA 4WV1A 5GS0D 1NANI 3TZVA 2VLJD 4X7FC 3WSQH 3B2UC 3BPLC 5BMFH 1YEEH 5IROA 3SEPA 4YBQC 3TEUA 2VE6A 1EEQA 3RWGB 3EDKA 5CEZL 4AIZA 2VQUA 4Q6IC 2HRLA 3TO4A 3WXWH 5FYJE 4LCWA 3OWEA 4Y16D 1NLDH 1I1RA 3O2WH 1INEL 4LNRB 3ARRA 2GSGA 2FIKB 1MY7A 3TT3L 1ORQA 4MD4B 4NQTA 3TGXA 3X3FL 1JGDB 2FD6L 3EFFB 3FCTA 4GSDH 3ARDC 2MTPA 5FM5M 1MRFH 1UA6H 3HI6L 2AXGB 3WNNA 1GJIA 3VH8G 3IDYB 4GRLD 1WBYB 5HI5C 4FQXC 4F7EA 1A9BA 3WEXA 3R06B 4KJQD 1BP3B 3W0WE 3WIIH 1K4DA 1RIVH 2BRRH 3WE6A 2BSTA 3G5ZB 5T1KD 4IOIB 1QZ1A 5C07A 1FNLA 4ALAL 1PSKH 1JZ4A 3RPKA 5B39A 4M6OH 2ZJSL 4NRXA 3CVIH 5IJVB 5DMGD 1MCWW 4P4RB 1CGUA 1G9MH 1V3MA 2KH2B 3Q1SH 4J12A 5A43C 2BRRL 1A3QA 5CEYB 1PQZA 3WS6A 5EO9A 2BVQA 4FZ8H 1HHHA 4MNHB 4K94L 4MWFA 3LZFH 5IOPB 1HKLH 3GKZA 3TPUA 3P9MA 1RI8A 1RK1B 3W11C 3S9DB 2CSPA 3O6LL 3FT2A 3VFUA 4DEPC 4R97C 1RU9H 2P7TB 1RJZA 4G6AC 1QA9A 2CK2A 2HT2C 2PW2B 2XG5A 3HLAA 4WU5A 5FYKE 3RVWC 4O00A 4KK9C 4QWWC 2AQ1A 3C5ZC 4RMTA 1OAXH 5BZDB 4MDJA 1IGFH 1JNNH 3MCLL 1FFRA 5DT1H 3K7UA 4LHUA 1U8JB 5EPMB 2WQ8A 3CPLB 5F7DB 4OCWH 5FO8A 4MXVF 5KN5B 1CLOL 1EMTH 2Y07L 5F3BB 4XGZA 2Y36H 1DTUA 3HI5L 1C1EL 3PABB 2IQAB 3LN9A 4JRXB 4UV4L 3LD8B 5EULV 4JO3H 5E1HB 4APQA 1FPTH 4HX1A 2W65A 4QY8B 5I18L 4KHXL 3UTZB 4YHNB 4Y2DC 4WRLA 5DQ9B 4J3TA 4GW5B 5F9WB 4PYGA 2ESVD 3QA3B 1J0JA 3QWOB 4YGAB 3BYTA 3IKCA 1FORH 2OJZL 5A16B 2RFXA 5DUML 5D93C 4F3FA 4JDZB 3ILPB 5DD6A 3D0VB 1PSKL 4LVOC 2GQHA 3VWJD 4PJ7B 3KGRA 5ESVA 1KIUA 1T2JA 1DQJA 3CX5K 5CJOH 2QKIB 5KVFH 1CLYL 4OAWB 2Q87A 4JR9L 3BIAX 2JJUA 4FQCL 3V5HA 4PJCE 2NX5A 1MFCH 2PCPA 4RAVA 5EU6B 2CGRL 3RKPA 2YD3A 3TBVB 3NCYS 4KTEL 2WWKT 4BSVA 4YHLL 3QAZB 1K5NB 3LCYA 1L4IA 3IDXL 3PL6B 5FGBC 4HWNA 5TE6L 3BJ91 2XZAL 1U8MA 1SEBB 3C2SA 2F53E 4GRWF 3AY4C 2DD8H 4ZUWB 3TYFA 3LMJH 3QDAA 3GI8H 3V2AR 2ENYA 1I9RH 4OCXH 5K59E 5CAYB 1MCWM 1NGXA 4HCRL 2F5BL 2B39A 3B6SB 3VFTB 3OR7B 4WFFD 5HYEA 3U7WH 3IKKA 4JFEA 5MENE 3H9HA 3BWAA 1A7NL 3IAQA 2BP3A 1C7TA 3HAEG 4EN3A 3TNNB 2P8LA 1SMAA 1WCBB 5KOVC 4TVPL 1EXUB 1UGNA 4IRJB 4L8SB 1IL1B 1IGIL 2X4NB 2GCYB 2R8SL 4PJXF 2GAZB 1LO4L 1RUPH 1ZANH 1XMWA 4D0DA 3UTSE 3GMOA 2GUOA 4HKXA 4CN1A 3N06B 4U3CA 3WCYA 3PGFL 4RISL 4X80L 3ULUF 3U4EB 4FQ1H 3PQYB 4ZUUB 3P4OA 4P46A 4LGPB 1EAPA 1HNFA 1MFAH 2D7TL 4ODSL 4Y4FC 1Z2KA 1T89A 4KAQL 1ULVA 4S0SD 1T6WA 3AM8A 3Q5YA 1K6QH 2XNAB 2JTDA 4NKDB 5K9OB 3S37L 4D9QE 2F19H 5B3NA 2C3GA 3DI2B 3EW3B 5I66A 5E8EA 4Z7UE 3ZHLA 1B0WA 4PJCA 4Q9BA 3UAJD 5J3HC 1QRND 4WWKB 3O8XB 1ORQB 4NO3B 1NFDA 2VH5H 1YEJL 1XCTA 1I8IB 5JW4Q 4ZO7A 4NP4H 1S7TB 4PJBA 5F89B 4BFGA 1Q0XH 5DJXA 5IQ7H 4P2CG 1KCVL 1AY1H 3RWJA 3CZJA 1JYVA 3TPKA 1CE1H 5DO2D 3IFPB 2HAZA 4WVRA 3D85A 4ODUB 1PG7H 1QD0A 4IOFC 4R96B 4U2ZA 3RX7A 2DLGA 2CKBH 3CUPA 1QFWL 4JREC 4JVUA 2P5WE 3RL1A 3PQYD 3G6AA 1GOGA 3HG1A 1NDGA 2PW1A 3CDGA 4ZUSB 1NANH 5CIPB 3P11L 4N9OB 1VA9A 2B1AH 3C60D 1FP5A 5IEKA 1CE6B 4L8BB 4I3RH 3EIFA 3VRIB 1A7PH 1IKNA 3GI9H 4GO6B 3VXSD 4LVHB 3VG0L 4Z7VF 5CSZB 3UTSA 1P4BL 4ESKA 3GB7A 3CC5A 1IGIH 1Y6NR 2LFGA 2DMKA 1FV1A 3E8UH 2PYEE 4EN3C 3JWDL 4GW1A 4MZ2A 1ZTXL 4U1IA 3ARBB 3KPNA 4HKJA 4FA8A 2BSSB 1Z6JT 3G08B 1UB6A 3IFLL 2VL5B 2NY6C 4LCWD 1J1OL 3QDJE 5IQ9A 4MJ6A 5KS9F 3BGFB 5E8OA 3LQMA 4UNTA 1XGRB 1D6EA 2NY5L 3P4MB 1W2KT 4NN7B 5KN5A 3S34H 4R4BB 3WV0A 5B3JF 3L5HA 4L3EA 2P44B 3I6GA 4NZUH 5FFLA 1S5IL 4QHNA 4NZTH 2D0HA 3HNVL 4XP9H 3EOBB 1LP9B 1YJDH 1F4XL 4U1JA 2DYPA 2NXYB 5GS0L 2FR4B 4JFQA 2GITA 5TGBB 2Q76A 4GW5A 4WCYL 4MA8L 1CD0A 4F7MB 5ID0B 3UTZA 3HZMA 1LDPL 4RAHA 4PLJC 5AAMA 5SWZA 1BJ1H 5J1TC 3L95B 3TJHD 1KJMB 1YNTA 3N1GC 4UUJA 2ZOLB 1C7SA 2WANA 3DX7B 4ZUVB 1FYTD 1NDMB 3OB0H 3BAEH 1NCCH 4GLRH 1IEAB 3A67H 5ITFA 3VXSE 2Z31C 1F3JA 3PNWB 3RIFF 4OZFB 3RGVB 5E00B 3EOAB 5FA3A 4U3HA 1UT9A 4KVCH 2VNCA 1BJ1J 4LKXA 4CUCA 3SY0B 4D0BB 4H8WC 5SWSE 4ENEC 3MLTB 3PL6A 1RHFA 5DK2A 3WXWL 2YPVH 3TIDB 4NYLB 1FCGA 5GS0C 4LCWE 2ESVB 4EI6B 1QO3B 3GJEB 4APQC 4LLWB 3L5WA 2N7BA 1ODAA 4Z7NE 1FFOA 5GSRB 2WIMA 5EO0A 4AT6A 3U46A 2V17L 3RVXC 5I8KH 3IETA 4K8RC 2K3TA 5IHUH 1QBMH 3VI3E 4UQ3A 1ZA3B 4FTVA 4X99B 5CP7B 3PP4L 4GW4B 3I9GL 4R4ND 1KTDA 1P7KA 3G6JB 5F7KC 3W39A 3T0EA 4M5YH 1E4XI 2X9WA 5DF0A 3QQ9C 2Y5EA 4BFIA 4OLVH 1OP3H 1TTFA 4QWWD 1KJ2L 5CHNA 3QI9A 1AHWA 1YN6B 1BD2B 3RJDA 4JLRB 2YXMA 3UPAA 2DLFH 3SO3B 3QI9D 5IB3B 4M6NH 1U95B 5KBNC 4X4YB 1RSFA 3FTGB 4Y19A 5TPWH 1N4XL 4L4VE 1SY6L 3D6GA 1HYSD 4MJIA 3NN8A 3RPIB 4DVBB 4JZJC 1DUYB 4P5TB 3C9NA 5EU6E 1S9YA 1M71B 2AXFA 1HKLL 2VISA 2XPGA 4X6DB 1LD9A 2D7QA 5ITBL 1T7WA 2BOBA 3TN0B 1U8HA 3KPLA 3KPSB 1FZOB 2AK4D 3E6HA 3T08A 1ZHLB 4BSJA 5HY9B 4Z8FL 4FFVD 3VWJC 1UCTA 1RU9L 2FH6A 4U6VL 3L3GB 3KPRA 4HIJA 1OAZL 1AP2B 1U6AL 4OCRL 3DPBA 5MP6H 3QG7H 5DI8B 2XYCA 3QSKB 3AREC 1F90L 3QDMD 2BY0A 3MLRL 1I8MB 3ISWA 5ENWB 5DMYA 4YXLH 4FQXA 3LN5B 2OR9H 5AUMB 2V2TA 1N5AA 3OF6D 3P4LA 3ORJA 1XGYH 4OFVA 3AREB 4LLYA 4XBPB 2N1KA 5CUSL 1FQ9C 1JYNA 1CLZL 3O8XA 4Y1AE 3I75B 2ZPKL 1YUHA 3MREB 2ICCA 4RMRA 3IU4H 5SWZD 1H3XA 4QF1B 3SDDA 2DQDH 1PAMA 2Q8AH 1UJTA 3ZTNH 2QSVA 4CVXB 3IXTB 5ACMA 3MLXL 1ITCA 3TBWB 4Y4HA 3QUXB 5HHOA 4NIKB 3RWJB 3TBSA 1HSBA 5GXBB 5F71A 4XB7A 3CLFH 2Y5TB 2A9ML 2CDGA 3OAUH 4Y5VB 4HSQA 3WKML 2A6JB 3VGDA 2AERT 2E3VA 5CIPA 1KNOB 4JFDE 2M2DA 1T5XA 4A6YH 1QLEL 3MLWH 4IEFB 1X5AA 4Y1AD 1D5MB 4QRPD 5JMOC 2H26B 1VGKB 3DYPA 3DX8B 5DJYA 3X14B 1LO0H 3GBLA 3WUWB 2ITCB 5EA0H 1GGBH 3PE9A 4K7FB 5ESAB 4CADB 3QZWB 3DMMD 1M4KA 3E6FB 4TQEL 3MRIA 4LU5H 1FN4B 4GKNA 4LIQH 4NGHH 1TJIL 3P4MA 1AR1C 2O5YL 3PDOB 4TPRL 5DRXB 4BQ9A 3MBEA 5E95B 5D1ZC 4PJEF 2Q7YA 3DVGA 3QNZB 5C0AE 3QRFM 5FECB 2APFA 3HPJB 4TRPL 1GL4B 4NHUA 2VDNL 1YNLH 3OJDA 4U1KA 1U42A 4HLJA 2ILLA 3QEQE 4L3EB 1RZ7L 3WS3B 4PJXE 2HKFL 1RUAL 4P4KA 3VH8B 3RZCA 2PKDA 3ZYOA 2R56L 4KUZL 3BH8B 3QDHA 4LLVB 1Y6KR 4G5ZH 4XPGL 3VXQA 3IDNB 1U92B 2BHYA 3U9UB 1CICC 3PIQA 3MRQA 2Q76B 2A9NL 4D9RE 3CLEH 4F7MA 2D9CA 4BUGA 3SCMA 4ONGL 3LQAC 1RULL 4QGYA 1IC4H 1CU4H 1OW0A 4IHOA 3HZVA 2A6KB 1KFAH 3SGJA 3WIIL 4JFFD 5AZEL 3PGDB 1JZ6A 4JFXA 1QLFA 1F42A 1TVDA 3AUVA 1MVUB 1HI6A 4ZO6A 1QR1A 1LMKA 1OT2A 3MUGB 4PJ5E 5EBMA 2H1PL 1KB9K 4N8PA 1CN4A 1TJGH 5T5FH 2XXCB 4JANB 3ZDXF 3CFIC 2XQYG 2YUWA 1WFTA 3CH8A 2FIRT 5ANMB 5EC2B 4RFNB 1B6UA 5KTEL 5F1IA 1LO0L 4I77H 2NY6B 2H1PH 2MKWA 4NC0B 3V79C 5KS9B 3FOMB 1YMHA 1FO0L 5DHVA 1I9IL 4U6TA 8CGTA 5EO0B 4AT6B 5E2VH 3U46B 5SV3A 1G1YA 1R24B 4PRHE 1HNGA 3IETB 4GG8B 2F53D 3RI5K 1J5OH 4PJGF 1MWAA 5E70A 3UYOD 1P4LA 3X11B 4FS0A 1K8IB 1N6UA 3R0NA 3QI9B 3QRGL 3V5DA 5IIEB 1B2WH 2W9DH 4OD3L 4L4VA 3BUYA 5BZDA 3U4AA 2X4SB 3KYMB 4AK1A 5F7HA 3RKDC 3KYNB 4HZLB 4P57A 4R97B 1H3WM 2R56H 1N0XL 3EJZD 1V3LA 3B9DA 4MB4A 3OKDA 2QTEA 3T0EC 1UKTA 5D7IE 4S1SH 32C2B 2NY2D 4IRZL 3N1MC 4XWGL 1YMMA 2QADC 2JK5B 2FX7L 5A2FA 3QQ3A 3QUZB 1YECH 5CP3A 1MFCL 3CLEL 5HGHA 4CL7A 2OL3A 2VH5L 5C0BB 2X1WL 3ZDZF 4P2QE 2HMIC 1KLUB 4K3HA 1NC2B 1G7PB 3L5JA 5SX5K 4D3CH 1MNUL 1AP2A 3MCG1 1P9MC 3FJTA 2P4AB 1ZGLP 3LV3B 1DQLH 1MI5A 3LB6C 2YOCA 4JZNA 4EI5D 2W60A 3VW3L 3TZVC 1URLA 5H2BB 4BZ2L 4Z5RB 1HN1A 5F72S 2ZKHL 1NGYA 2BCKB 3QDJB 1DBAL 3FQUB 2FJFA 4Y2DB 2XWTA 2ZSVA 4PJHF 4J8RB 4JO4H 3SKMB 2AW2A 3V4VH 5EU6A 5IT2H 1NGZA 1P7QB 1NSNL 1F97A 2AABH 3EYOA 1RIHL 2PN5A 4F37F 2ZCLL 4RX4A 5AAWA 3HE7C 2ADIA 1S7QB 5GGRB 2DQGH 2QSCL 1A6WL 4TSBL 4PD4K 4I48B 2EDDA 1GGCL 1UM4H 2AK1L 4PBXA 4N0YL 4NM4H 3C6LA 4PJGA 1J0ZA 4U2YA 2RIKA 3BN3B 4Z7UF 1XGPB 3LS5H 1RZJL 2EYRA 4OFKA 1MAML 3UJTL 3LN4A 4PRPE 5EC1B 5HXMA 1KBGL 5BOPA 3HC3H 3QPQD 1KC5L 2XIDA 2UZIL 2EIZB 1DQDH 1WIPA 4NO5B 3MJ8A 5FF6A 1T03L 1A6VH 2X4RB 2EECA 3ZKXB 2M8XA 2DIJA 3U48A 2N56A 2PTVA 1YJDL 4DKDC 5EUOA 1KTKE 2R9HC 3NMEA 2DMCA 3U7AA 4JO1H 3WBDA 1B4JL 3BZEA 5T5NF 1JK8B 2PTTA 4JG0L 4BSWB 1CXEA 2IPUG 2GY5A 5IMLA 4O2CB 2YD6A 3H0TB 2ARJB 2RCSL 5C0NC 5ADPH 2ZG1A 4NFDA 4L4TD 4FXGA 1OAUL 4LBEB 4CMHC 4DN3H 3RTQB 3GSXB 2G5RA 4OBRA 3WKNA 3OJDB 4Q6YA 2GSIA 1XF2B 5DA4A 4WHDA 3NABH 1NC4B 4H1LG 1MCDA 4OIIL 4R26L 5JO5A 4I2XE 3QFJE 3SCMD 4HUUA 4U4BA 1GGUA 3RX5A 1JNHA 2OSLB 2EYSB 2CLVB 4HIXL 3ARDB 4LCUA 4LSTH 3RZCB 3VH8A 3MRFB 4HV8B 4AG4H 1BWWA 4LVEA 5JW5B 5IV2A 4GKSB 3K2UH 4IRSC 5C92A 4JKPH 4PJCB 1UC6A 4ZPTA 4WWKA 3PIQB 4UT7H 3ES6B 4YC2B 1MREH 3DTXB 5C08B 1X4XA 3GBNH 4D2NA 1E4KA 5F7FA 4WUKH 1PKQE 4KK6D 4XAKE 5J1SC 1H3PH 1M7IA 4JZOA 5EIVA 5T3XE 4WI2A 1JGUL 3I9GH 5I1AB 3BDBA 5F7LB 2H2PD 2IAND 4PRBA 3K2MC 4Y16A 5DC0A 2CUMA 4Q7DA 5FUCE 1QKZL 3PV6B 5GSVA 3QHFH 4PTTA 3T4YB 5LG1A 5D2NC 3NFNB 1NEZA 2B4CH 2IAMC 2JELH 4GXVL 4NCC2 3DX6B 3DMMA 4M6NL 4JO2L 1OM3L 3OHXA 3FO0L 2NTFA 5EN2A 1B0GB 2VLJA 4QHMA 3LRHA 1WWAX 3VFSB 3KXFE 3Q6FB 1U36A 3CVHH 2B4CL 2JELL 1EX0A 1IGTA 2VLKE 3TCLB 3EYVB 3MLVH 3O6KL 4WI3A 1TNNA 5DC4B 1A02N 2HKHH 1HZHH 4XPAL 5T1LB 2QHRH 2BY3A 2BXYA 5C86A 3NCJH 3KPNB 5DLML 5I1GL 4LLMB 4X9IA 5JXED 3MLSH 5GGSB 4Q58C 2LVEA 4KKBD 1MWAH 5GJTH 1EUTA 2I9TB 5CD3B 2VERN 3O6ML 1A4KB 1U0QA 3QUYB 3OB0K 1XGUB 4W6YB 1MRDL 3RU8L 5GS2D 4CN4A 5HHOD 1I4FA 5F1NA 5HVHC 4HK0A 1F58L 3FMGL 5JORB 4HIXH 1MCCA 2JCCA 4CDHA 1SYSA 2PO6A 2XQBL 4KMTH 4NN5C 1ZEAL 4NFCA 2FRGP 4TNWK 3D5OF 2MPAL 2OYPA 3UDWA 3MRMA 5M94B 4IRSA 3MRCA 4PLNC 3MXVL 4AENA 3ULVF 1ZVYA 4EQ2A 2EYTB 3K4ZA 1KJVB 1D5BA 3S98A 5KSBB 1T1XA 1S9XB 1D9KA 2ADJB 3F7QA 5D2LA 5D2NA 4KRNA 1G7PA 2R0KL 3VJ6A 3STZB 5HYIA 4KGJA 2DJSA 1FZMA 3NZ8A 4O4YH 4AEEA 1XH3A 1JNLL 3BAEL 4JZNB 3L1OH 3GHBL 4XVSH 3HFML 1KCRL 5E4IA 1H3VA 2HVKB 4JDVB 1HE7A 4LAQL 1EZVX 3WFHA 3IU4L 1M05A 4X5XB 4UTAH 1YNKL 3EOAA 3QXTA 2ZJSH 3BSZL 2IFFH 4LPCA 4G6JH 3M8OH 3CNKA 1I8KA 5HVGB 2A77L 4WWKC 5TDNB 2X4OB 3LPWA 5FCSH 3ARUA 5JDSA 1D5ZB 1NAMH 3VGEA 2XZCH 1MHPL 2NY2B 1R5WB 1K2DA 5CCKH 4TSCL 2VSDA 3P9LA 5I8EB 1EEZB 3GMRA 3RWEB 4PREB 3GMPA 3SDXA 5DK0A 1VB9A 2FEDC 3FO9A 4XNMB 1AC6A 5DURB 3A6CL 3V8CA 5J6GA 3T4AA 4R0LA 2YKLL 3RVXD 5GGVL 3EFDL 2HJKA 3MPCA 4UDUA 3ZE0E 3MV9B 1CQKA 2X4PA 3GSUB 4JPKL 4XVUD 2JIXB 4IRJC 2OQJA 4L8SC 5MP6L 2BNRB 2R4SH 3L3JB 1SEQL 3B2VH 5D5ME 4U1GB 3DROB 3DRQB 5DJCB 4PJFF 4N0UA 1RUKL 2Q8BL 2J5LC 3QA3A 2NY4B 2OS7A 3MXVH 3U79A 1V05A 3RY6C 1N2RB 4H88H 4PRDA 4PJ5B 2ARJA 2AKRB 4Z76B 3PJSB 4ZD3H 5CIPH 1NCDH 4V2CB 5DJ2A 1SEQH 1FHGA 3IJYB 4KWUA 2FYYA 3F7VB 4PJ7F 2A9NH 3EDJA 2CUIA 3SBWC 1RD6A 5JZ7C 1FZOA 5HY9A 3H0TA 3LIZL 1ITBB 5ESVB 3SDXF 2WSKA 3UP1A 5DD3L 4TSAL 4ZNCD 3C5SA 2DWDA 1CZ8H 3GIZH 3QNXB 1H3GA 1FLRH 4JFFB 2DLFL 4C4KO 3TBVA 3G9VA 4TULL 3STBA 2PXYC 4G42B 4JHZA 1I3GL 1H9VA 2ICWI 4HUUB 1KTLA 2YRPA 3ALWA 3HMXH 2GJZA 2FX8H 3W0WA 5I30L 3BPOC 5EIIB 1WFOA 5IV2B 2AV7A 4MD4A 2E9JA 3HE6D 1FGVL 4H26A 3S97C 3SDXE 1T2QL 4XTRC 2NW3B 3LDBC 3P0YL 2J88L 4JJ5B 2AXGA 2ORBL 4NN5B 3AS2A 3F65A 2P42B 4Y16B 3AMLA 1WV7T 4M6MH 3GJFH 2R1XB 3L7EA 1XGTB 4WJ5B 3EYQC 4PLKD 4Y4HB 1PGRB 3MGAA 3U6RA 3CSBA 4JB9L 1MRFL 3QHZL 4P48A 3L7FA 4QYOB 3WUWG 2VABA 5F88B 4YHOH 2C3VA 1VFUA 3QQ4A 4LNRA 5IESL 4OKVB 4PGBA 1N0XH 4PJDE 1A7RL 2H32H 3TCLA 1SBSL 3M45A 3FKUS 4DK3A 2X1PA 4EUPB 1EHLL 1T2XA 5DJZA 1UWXH 2EIBA 4HKXB 4I5BA 1G0XA 4MXQD 3JVGA 2XRAL 4W4NA 3QFJA 5E8DL 2X7LA 1Z5LA 5DXWA 5TE4L 5GGSA 4FP8L 3O4LE 1JF5A 2YPLB 2I5YL 5DQDH 3VFVA 2EIEA 2P47B 5D7LD 4N0FB 5IMOA 1UCBH 1GGTA 1DUZB 3HA0A 1S7XA 1MJ8H 1I7UA 4M7LL 4OQTL 1I9JH 3WDIA 4Z18A 3ESVF 2MQCA 4L3AA 2AGJL 3D69A 1JV5A 3CDFA 3KG5A 3W9DB 1MLCB 2D31A 3SDYH 5IBLC 4ONFH 5IOPA 2DQJH 1JWSA 1JGVL 5F3BA 1RK1A 2HLAB 1FGNH 5IKCB 5DJ0B 5GRWA 3RWDB 3AS0A 4L3CB 3RUGE 4WW2F 3DVFA 4ZTPH 4P2OC 5FGRA 4S1DD 1KG0B 5J1AB 3C5JB 1EMTL 5BS0E 3MRCB 4QOKE 3EDDA 5H37G 2Q20A 5JHDD 5HHXL 1KUMA 1FZMB 3NZ8B 4G8GD 1MI5D 3M17A 4LLDA 3MV8E 2VN7A 4XXCA 2J6EA 4IIQC 4BZ2H 1OCWL 4HFWB 3LKNA 2YHGA 3D39E 3HMWL 4HWZA 2VJXA 3ULVH 4AEIH 3NAAL 3VWJA 3PWPB 4LEOA 2YN5A 4MHHI 1CICB 1HH6B 1ZHKA 2W59A 2D3VA 1HKFA 3D3VE 4JRXA 3WFEH 1VADB 5FO9A 3MROA 3HZYB 4KUZH 4JANA 2R2EB 1L7IL 1C1EH 4NQCD 3RWIB 2NYYD 2AEQL 1PKOA 5E7FA 6FABL 2VIRA 5IW1B 1F4WH 1MFEH 2P24A 4LPWA 4FP8H 5C0CD 3SDXB 2EDWA 2P5WB 3BX7C 4JGUA 4IRZH 4XNMA 1J5OL 3TYFB 1F2XK 3KLAA 3WD5H 5D96C 4ORGB 2ZUTA 4DOHB 1BHGA 3S37H 1PZ5B 3P3YA 1OD9A 4NQSB 1EO7A 3SDDC 2DM7A 1EUUA 3RHWK 1ROWA 1JGVH 1T20B 3MRLA 4OM1L 3TLRA 4BSVB 4RISH 1HWHB 2VLRE 2WWMD 3RBSA 2AJYH 3PP3K 4S1SL 4QNPE 3WIHL 4E5XA 4HS3A 5I1EL 2PO6C 2A6IB 4QO1A 5IR1B 4NQCB 4PG9B 3H9SD 1V8HA 3O6FC 5EOCJ 1OAUH 1A7NH 2K7QA 2QQNH 5IWLA 5BRZB 4DQOH 2XICA 1MCQA 5HDBF 4ZUVA 2FSEB 3KPMB 4D0DB 5HGHB 2CLRA 4TVPH 3CU7A 4K71B 3AB0B 1IC7H 1JWMA 2PYEB 1GH7A 4JFFA 3Q2CA 1JP5A 5J7CC 3KR3H 1I9RL 3ILQC 4QTIH 3BZFA 5GPRA 2ZOKA 1BREA 3FZUD 5BXFB 2ED9A 3IU3A 5E8NA 4LHUG 3VGBA 1B4RA 1MI5B 1XGQB 2R69H 5CBAB 4FXKA 2O5ZL 5E6YA 4LLWA 1BIIA 1CL7H 4MNQA 3NPSC 1NCNA 3UJTH 3IDJB 1OTTC 4XP6H 3CSYB 4YFEA 4PLOB 4XNQB 3ULUD 2MHAB 1PKQB 5AG9A 2NY0C 1J1OH 4RRPG 3QJHA 4DW2H 4BQ6A 2MPAH 2GUOB 2ZG2A 3VE0A 3PGCB 2XWBA 2GTZA 1NLBH 3GZKA 5E2UH 3MZTA 3QULA 3FB6B 1N8ZB 3PG2A 2VZVA 1P69B 4LAJH 5IB3A 2RJMA 4XPTL 4ZS6C 4GUPB 4HIHB 1P9MA 3IDUA 2W1NA 3DURA 4P2QD 3UC0L 1V7MH 4U1MB 4FZEL 1OGTB 4G7YL 1NDGB 2PW1B 2AXFB 2BMKA 3T0DA 3ROOB 5D1QC 2CKBL 1QSVA 1M6OA 1SY6H 1OGAD 4MAUL 1IAKA 4Z7WE 4U1NB 5CD5C 4QRPA 4M8QB 5I8OL 2XACC 3QFJB 1U58B 4J4PA 3F12B 1AKJB 1A7QH 1YEJH 3EYUL 5HHPA 2OCFD 1MWAL 5GJTL 4WTZA 4CDGC 4A2LA 4EBQL 1TMCB 1KJ3L 4MAUH 5TJWK 5LXGH 5GGTL 5FYJL 4BSWA 1WIUA 3U0TB 3WFZA 5KSUA 1I7ZA 2ZUWA 4Y8DC 4IS6B 2OMNA 5E8OB 1QSEA 1JNJA 4JM4H 3B9AA 4Y4HD 3U4BL 3HG1B 5EU7E 3DV6A 1YDPA 1QVOB 4LCCA 4Y4HC 1CD1B 2IPKA 4P99A 1Q9OA 4OF0A 1UYWL 3HUJE 5MI0B 1SHMA 5C08D 4Z7WF 1R3JA 1IEBB 3FOLA 1MLCA 4S1QH 2ATPB 4RWHA 5ESQB 2UUDK 1G7QA 5IMMB 1A7OL 5E56A 3CC5B 3D39A 3Q6GH 1CFQB 4XP6L 3ARPA 3U7YH 1NFIA 4MXQC 4LCUB 3CCHB 4I0CC 1KEGL 4J2XA 2I60H 4PRIA 2MCG1 1OWRM 3ZDYF 1JF1B 2EDXA 1W0VA 1C08B 4M43H 2JJWA 4XNUL 1HSBB 1MCIA 2X70A 3UTQB 4OI8A 3X3FH 4OCYH 4GG6B 2YWZA 5FUOH 3IFLH 3DTXA 3MLXH 4P2RA 4P4RA 1MH5B 5B4MC 5KJRL 2FGZA 4U1SA 1JRHI 1JE6A 4ZYKA 3S4SB 3RTQD 2DWEA 4JRWA 3Q3GA 1HSAB 4NWUH 1C5BL 4FQHA 3P9WB 4PYHA 4AIXA 5JPMA 1KIRA 2HT4C 4OIIH 1F6AB 2IBZY 1UQSA 3DGCR 1DBJL 4ALAH 5ETUB 1Q9WA 1PX3A 1UH4A 3BZDA 3HNVH 4XP5H 3MROB 5TGBA 5B38B 4YK4B 2HN7A 4G6ML 2DICA 3QYCA 5C07B 1ZS8A 4LLQB 3UBXA 3DNKA 4HUWB 5HDQL 1ZA6B 5IW1A 4LNVA 3MV7D 5C0BE 4HPOH 1YNTB 3H2WA 1ZEAH 4P5TC 1UZ6F 1A5FL 1KULA 1H0DB 3ROLB 4WNQA 5F1KC 4CMHB 5ADOH 3P0YH 4N1EA 1HHHB 1MCSA 3VFWB 1MF2H 2NY1B 3EJZC 4GOSA 4UAOB 5I8KL 3T0ED 4TSAH 5D2LE 3WS3A 2I26N 3BI9X 1J18A 1S7UB 2YMXL 3FONA 3LAFA 4HS8H 3BD3A 4P9HC 4S1QL 4L3EE 2EDFA 4NYLA 5IB4A 5T1KB 1CI5A 1T20A 4H88L 5DQ9A 1EHNA 2XQYK 2DMBA 3QT2A 5C0AA 1SVCP 3RA7L 5MENB 4KKBC 4OLXH 3K1DA 1FSKB 4XCNB 5J89A 3W5MA 4KKAC 5IB2B 4WFHD 1JL8A 1UJ3A 2PO6D 1XR9B 3QUYC 4NJAH 5IBUG 3E6HB 2RGSA 1QLFB 4UB0L 1AC0A 4BFIB 3MACH 3BZFB 3V5HB 5GRJH 3IU3B 3D2UB 4TYUA 3BPCA 4JM2A 1JPGA 3HC0B 1MRDH 4MNQE 2VTFA 4KJYB 3GHEL 1QPPA 4OLUH 3OGCB 2JB5L 2P8MB 5D1XC 4JDVA 4I2XA 1OLZA 3ARFD 1DEEA 1N5AB 4LPTA 5C0BD 2YK1L 1JCKA 3J8F7 1RIUL 1BQSA 3DUUA 3MOAH 4TQEH 3QPXL 1CWVA 1CDJA 4KI1A 4XBEL 2PXYB 5DRZB 5DDHB 5IK3A 5DC9B 3KPSA 3OXRA 3LKPB 3RZWA 4LF3A 1J1PL 1SM3H 3BMVA 1BBDH 2DQFA 4HPOL 4NFBA 2XWBB 4LDLB 4R6UA 1S7RA 5TDOB 1BQLH 4KJWC 4R9HA 1YA5A 2XTJD 4LSVH 4ZMAT 1EEYA 4NQDB 1G6RL 3KJ6H 1VENA 4XPFH 2J1KA 5IW6A 1A14L 4JFEB 3FT4A 2EDQA 1U3HB 1OSZA 3JVGC 2BOCA 3OJVC 5GRXG 1ZVSA 4YXKH 3CMGA 4AZ8A 1F13A 2C1OB 1TENA 1MJ8L 5FM4A 5ELIA 5C6PB 5LBSL 4NO2B 4OD3H 5KW9H 1DE4A 1G7LB 1Z9MA 4YQXL 1JZ2A 4LARL 3X12A 4RDQF 5F3HB 4YXKL 3BQUC 5HGDA 4PRIE 1A2YA 3WHE0 1BAFH 4KXZH 4NQEB 5DJ8A 4JPVH 4KRPD 4E0RB 4FQLL 4Z6AT 2Q8AL 1EA9C 2ITCA 4N0UB 3FN0H 4MNQD 3HS0A 1EGJH 3PQYA 3WE6B 2GEEA 4HEME 1U93A 3UZQA 3HKFA 2NXZB 3FQXB 3MRGA 3UTPD 2X4TB 3BP6B 2GI7A 3PHQA 1I1FB 5IM7B 4HG4J 4YIQA 4FG6C 3BKYH 3QUMH 4NJ9L 4F7CA 5ISZB 2NXZC 2EC8A 1DDHA 1VEMA 4OZHB 3RAJH 5ILTL 1EFXA 1SYVB 1TETH 5ERWA 1QVOA 3TC9A 1CU4L 1EZVY 3CZFB 5D7JA 5E99H 3LKSA 3GSOB 3I02B 1KN4L 2A74B 3MRHB 4XX1E 3VXUB 1KCLA 2IFGA 5L0QB 3FO2B 4LSQL 3L5IA 2V5MA 5C0GB 4C54A 3RJQB 3ARGC 2Z31D 3E6FA 5DWUL 4P46B 2G9HA 4OCNC 1T2QH 4GG6A 5I8CB 5F9JA 1NSNH 2AABL 3O3AB 1H8SA 4K23H 4Y2OA 4J1UB 4P2RB 2CDFA 1MLBA 5E0QA 1VEPA 3TO2A 2Z92B 3QO0B 4P46D 3TJHC 5CJBA 3UTQA 3C6LB 2VR4A 4BH7A 2AJVH 3VG9B 1EO5A 2DQGL 4IHOB 3T2NL 3UYRL 2DI8A 1AD0A 3CFKA 3VXUD 1FLRL 5ACLA 2DDQL 1RZIB 2EXYD 5DURD 1GGCH 3VU2A 5GGUB 2X4RA 3BO8A 4QEGA 1YNLL 3TA3D 1KIRB 1KB9J 1WBZA 2NY5C 1PG7X 3FB8B 4BZYA 2AVGA 3BGMB 4APQB 3BQUD 5JLZA 4RQQA 1HQ4B 1K6QL 1F4YL 3B9EA 3VXMD 2NY2C 2PTTB 3QUZC 1TPXB 4PGBB 3ALXA 4O2CA 4F2MB 5BV7B 5F7EH 5D7IF 5DUBB 4HXAL 3GO1L 4RMVA 4MAYA 3BXNA 1ZLWH 5DD5H 1SVZA 2I27N 3LKRB 5DD6B 1C12B 3CH1B 4RNRB 5EU3A 3PGDA 3OKEA 4GG6F 2Q86A 4KRPB 3DETC 1U41A 4EI5A 2VLKB 2FX7H 3KLHC 3RWCB 2C4FT 2CLVA 2DLEA 3ARDA 2A73B 2AGJH 5EZOL 5JHDA 4YDKH 3AY4A 4RRPA 5C0AB 2AEPL 2IALB 4RFEA 5D7LB 3U30C 4G9DB 5FYKU 3REVB 4MDIA 5SWZB 1FZJB 1D5IL 4Y4KD 1XGRA 4HHAB 4I77L 3IGAA 4OKDA 3VXNB 3BN9C 3BRGC 5TDPA 4PGCA 3LPGA 1H8NA 2F8XC 4KQ3L 4TUKH 3B9KA 4WCYH 4PB9L 2P5EE 1NGXB 4U6HB 4OZ4A 1AIFA 4CGTA 4XMPH 3TO4C 4XMKL 4Y5XA 1LWRA 1FCCA 1VPOL 4I3SH 3H8NA 1P6AB 4I0PB 4OLYH 3X3GH 5D2NE 1I8LC 3MLTA 3IF1A 1TTGA 4QHLA 5D4QA 1NCBL 1ZHBB 1JPGB 2ADFH 3HC0A 4NC2B 4KI5F 3KYMA 1J8HA 1X4YA 3K46A 4M1GH 1J7VR 4HF5L 3U83A 4P57B 2ITDB 3JV4A 4JFZH 3W81A 2WUBH 1FBIL 4ZODA 3V5KB 4U6YA 5IEHA 3U36B 4XNXH 3SE8L 4LEOB 3EGSA 1KJMA 5DDHA 5IK3B 1IC5L 4JG0H 1WZ1H 1W8OA 4KTEH 3BW9A 1DLHB 3N1PC 5J13C 1A7OH 4GW4A 3LS5L 5SWSB 4XP1H 1JI1A 2PXYA 1HHIB 3ULUE 3WNKA 1KLUA 3C09B 4MLSA 2ADIB 4HCRA 1A6VL 3LOWA 3SY0A 4D0BA 1EVUA 4X6BA 1OW0C 4IDLA 4EKXA 4HQQL 3K81A 1LEIB 1HYSC 4PRAB 4R3SB 5J06A 3SKOA 3C5ZA 5EU7C 5BVJA 4NKDA 5K9OA 4P9MH 4YLQT 1LDSA 4Z5RA 2NNAA 1IARB 1FDLH 2BCKA 4Y2DA 4XC3H 4RWYL 2FJFB 5B3JE 4YHMH 1A6WH 2O26U 4NQSA 1UYWH 1CXHA 1CE1L 5I6XB 2ZKHH 1Z3GH 2IEPA 3BDXA 4NUJB 4QOKB 2DI9A 3EOTL 3KPOB 4MX7A 4AIOA 1LILA 2NY6D 1A2YB 1D5BB 4O02H 1T7VA 1TNMA 1U91B 1U93B 1ADQA 3WXVL 4HS3B 1XCQB 3C6LC 1EGJA 4LQFL 3FQXA 2CLZA 3I6KA 1T22B 4CMMB 3RKDD 1HHGB 3BP7B 4MGXA 3FQWB 4Z0BL 2P48B 3G04B 4XAWH 5CJXC 3PF2A 1OD7A 3QXWA 1T3FB 2FB4L 1AQDA 1NKRA 2LU7A 2IH1B 3UTTA 5ISZA 4F7CB 1CE6A 4IOSD 4L8BA 3ZKND 1U8HB 1UM6L 4P3WA 4KROD 5HHME 4ODSH 4WFHE 1EFXB 1SYVA 5ERWB 3MRDA 4XWOD 1CK0L 3TIEB 4E9LA 2I24N 3OX8A 5J56B 4PLJD 1KT2A 4XP5L 4WHYH 3NABL 1QHOA 3GKWL 1UB6B 4PGJA 2DLHA 1IQDB 4LOUD 3TO4D 5JA8B 1OARL 5I8CA 3KLSA 1N64L 1U3ZA 3O45B 4J1UA 5CCKL 1D6EB 2X9YA 4AG4L 4XP9L 1MAKA 3GSXA 1F4XH 3K74B 1HINH 2XTLA 1TVBB 2IG2H 4RA3A 4Y5YB 3MLZH 1A1MB 4A2MA 4NZJA 2EXWD 1VGKA 5E7BA 3BGMA 4I9WE 1NL0H 5DD0L 3REWB 1K8DA 1JPST 5DJCA 1J0HA 3QUXD