2W60B

Anti citrullinated collagen type 2 antibody acc4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4
publication title Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
pubmed doi rcsb
total genus 55
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B01
3C60D 2GSIA 2VDNL 3MJ9L 5IMKB 3BVNB 1UWGL 2FJHB 4KAQL 2R9HD 1T7ZA 2KL6A 3DV4B 3BKYL 4G6JL 4P9MH 1DBMH 4KY1L 4KTYA 1T0NB 5D7IE 5BXFA 1FAIH 4B0MM 4QTIH 1LEKB 4JPVL 3Q3GA 1CT8B 4QHUB 4Z7UA 1MCKA 4D8PA 4ZPVA 4OT1H 2QBWA 2F5BL 3GMQA 4JFXA 5D1ZD 2ZWLT 4EDXB 2Z8SA 4QXWA 5E7FA 4M6MH 1E6OH 3TYGL 4JFEA 1N59A 3TIDB 1R5IB 2FO4A 3F7VB 4JFYB 3WO4B 4HK0A 4JG0H 3HCVA 4V2CB 4WHDA 3RVVD 3E3QC 2R4SH 1P7KB 2AGJL 3U4EB 1S3KH 5LKNA 3FFDB 4FN0A 1CF8L 4RMRA 5GS0D 5B4MC 4PRNA 1TETL 2BSTB 3MJ7A 3WEXB 4HUUA 1GZPA 4BSWB 1F3RB 4XPBH 3CFBA 4KKAD 5EH1A 4YHZL 5I8CB 3R0NA 2NXZB 1L0QA 2NY7L 4Y4HB 2HN7A 2P4AB 4LNRB 1WQVT 3ARBD 3WL9A 3E8UL 1SYVB 3VWJD 2PYEA 4JDVB 5DEZA 1IILE 2ZJSL 1AC0A 5HYJD 1OLZA 1C12B 1WBYB 1VFAB 1CFBA 3VDAA 3ECBB 5E2VH 1NKOA 3P4OA 3V6OA 5A16A 4NO2A 2OJEA 3MLSH 2A1WL 2EDTA 3BSZL 5HYQB 3UPCA 4YNYA 2VDML 3O2WH 4KJQC 1TVHB 4YFLF 1XGYH 3O6LH 1OSZB 3X14B 4EI5B 3JWDH 3SJVA 2ENSA 4KJPD 1HIML 2HVKB 3TO4A 5GXBB 2AEPL 5IOPB 4H25B 1PG7W 3OTTA 1I1AA 3VXMA 5DMJB 1MELA 3LQAL 1FLTX 3KLSA 5CZVH 5ACZA 2WIMA 5C70A 4HKJB 3D3VE 3EOBA 4GRLD 3EJZD 1XGTB 3UPAA 1WFUA 2EDXA 5F21B 5CZKA 2VUYA 3P0VL 5E9DB 3E3QE 3ULVD 3DIFA 3HLAA 1B0GB 1U6AL 3WLWD 3A67L 5BCAA 5ILTH 4XPTH 1QSFA 1CGVA 2ZOKB 3VFGL 2FZ3B 4RMTA 3C6LA 4HZLA 2VE6B 1KN4L 5L8JB 3ARGC 2XWJB 4V1DA 3UTSB 2V17L 2YEZA 4JO3L 3QEHA 2LU3A 4GQPH 4U1SB 4P2QA 1H3XA 4HJ0C 3RZCA 1UCBH 4XC3L 2AJ3B 4K7FA 4OCYL 2G9HA 1CGWA 2DQGH 1EGJH 2W0LA 2VDKH 4YDVA 1GIGH 2OXGA 5A1AA 2YOCA 4AM0A 5FUZH 3S37H 1FGVH 5IMMB 4G9FD 4IDLA 5JA9A 1W0WB 4WFGD 1P6AB 4K7PX 1LNUB 4X6BA 3BP5A 5ID1A 1XZ0B 1UB5A 3QULB 5ACLA 3GSUB 1HXMB 3GSXB 3OXRB 5CEYB 5IW6B 1TCRA 4P4KA 4UU9B 2E7CA 3UTQB 4AH2A 1ADQL 3V0WL 2DQDL 4RISL 3T4AA 5F1KC 2Y6SC 4ZTOL 3O8XC 1BVLA 1UWXK 3QG6B 3AS0A 4YXLL 2G2RB 1HH6A 1G6RB 5HGDA 4ENED 2VKWA 1KPVB 2FGWL 5MENB 5BO1H 2DJ4A 4OUOA 1EO7A 2OL3A 4L9LC 5I71B 5T33L 3GI8H 3K4ZA 4G6ML 3VG9C 5D7KD 4X8JA 4PGEB 1HEZA 4M7LT 2P5WB 1J05B 5J1SC 5TPWH 3DGGB 4KI5E 5DEFA 5EUOE 4JR9L 2DOCA 2CJUH 5C0DB 1BP3B 4OD2A 2XACC 5DC9B 1XGPB 1P9MA 5EO9B 3T09A 2CLVA 1BJ8A 1KCUH 3BZFB 3EJJX 2B1HL 3MNVB 5KSVA 1U8LB 2UY7A 3U9PH 1GSMA 1J8KA 2YC1A 3F7QA 3O3EB 4ODHL 4RDQF 1I1YB 4N8VG 5HPMA 3QR2A 4PJCA 5FB8A 2QQNH 4JRXA 3CH8A 3IETB 5D1QD 4XH2A 3IDYB 4OQTL 5HYSA 5F7DB 4G8FA 4Y4KB 4AMKL 4Z0XB 4HFUH 4U1MA 2FD6L 4QHMB 4FQPA 3WIHH 2Q87A 3WIHA 2Q8AH 1PKQE 1XF5A 1DVFC 3QUMH 4E41B 3KNBA 2FX8H 4QRUA 3DXAE 1A3QA 3BI9X 2WP3T 5IP4A 3QHZH 1SYSA 2FHFA 4L5FH 3QEGH 4PJ9C 4QOKB 3K4AA 5GJSH 2RCSH 3D69B 3PHQB 2R4RH 4KZDH 3QIWB 4MXVE 1PQZB 2VH5L 5JIHA 2J3SA 3SBWC 3HI5H 3QZWA 3D0VA 3IXAA 5D8JH 2R15A 4KC3B 5KSBA 2BNRB 3L95B 1GGBH 2MPAL 3FFCE 2GUOA 5JXEA 4H1LB 3PP3K 4U0RB 4ZXBC 3IU3B 2W9DH 4HWNA 5HI4C 1SEBB 4LBEB 5EWIH 1YEGL 5AZ2L 2F8VA 4EJ1C 3O9WD 1ORQB 4K3HA 5E1AB 4YFLI 1FL5A 5CBAB 2PR4H 5D1ZA 5TQ0H 3BJLA 4HWUA 1FPTL 4Y2DB 2P44B 2AV7A 2WUBL 5JUEL 3WCYA 3HE6B 3M8OH 5F1OB 3RJQB 3BESR 1HYSD 4X7SH 4NT6B 3STBA 1CXLA 4WEBL 4ZSOE 3IDJA 3AU1B 3B8SA 1V7NL 2APTA 2C1PA 4XBEH 3X3FH 1T7YA 2OR8A 5GS0H 2ADFL 3UROR 3VCLB 3W2DH 5IBTL 3CXDH 5I73C 2D9QB 2HFEA 4JQVC 3BZ4B 4NJ9L 1HXYB 4GOSA 2OX5A 2ZUYA 1A8JH 3ALXA 1EO8H 3ZE0F 1JV5B 2GJJA 1QNZH 3BH9A 1KB5H 1KB5A 3DRTA 3VWJA 1T04B 1H8NA 3THMH 1CR9H 4UT9H 3KJ4B 3RWEA 5HYJA 2PNDA 5DZNA 1N4XL 5HI3D 2P47B 4F8QA 2IANB 2XZZA 3LKNA 4F37K 1QFPA 5HGGS 3MNWB 1NCCL 1UZ8A 2YRPA 4EUPH 4NBXB 2HG5A 4EUPA 1OP5K 1BMGA 3I50H 3QUKA 5SWSD 4ETYA 5AYUL 3B43A 4CN4A 3Q1SH 2X4PA 2ZNWA 3BDYL 4IOIB 3UYRH 1VFOA 2BCKB 3MRIA 1D9KD 1RMFL 4LSRL 4R7DB 4Q6IB 2PTTA 5C0RL 3KHQA 3ARXA 1CVRA 3MV9B 4ZS7H 5FHAH 4N8CL 4WW2B 5DR5H 3WHE1 1ZANL 2C9AA 3QDGB 3BZEB 4GRLA 2QQKL 3O0RL 3D39D 1E0OB 5FYJL 4JKPL 3VGBA 3B3IA 3PV6A 2P8MA 3ULVH 3EYOA 1NGWB 1DLFH 2EDRA 5LXGH 1V3LA 3AGVA 2YA2A 1FORL 4HUWA 1H3UA 3MCLH 3H9HA 2PKDA 5JW4Q 2BSSA 1MFAL 2ADGA 2VNCA 3K1DA 1EJ6A 1HILB 1MWAH 4HGKC 1MWAA 3GHBH 4JY4A 5CSZA 1KN2L 2COQA 3IDUA 4PJ8C 3DX8A 1N0LA 2J8UF 3REVA 1HZHL 4KKLD 3TIEA 1ZGLP 1XF2A 4Y7MA 4M6AA 1C7TA 3AXLA 4NQSB 5TFSL 5K9JL 4I5BA 5HTSA 1KJ2B 4QRRD 5DRNB 1AD0A 5GGSA 4G7VH 1QZ1A 3HE7C 4MQXD 3FB5B 4LCUB 3GGWA 3U4BH 1JN6B 4WHYH 4HK3J 4G9FA 2AEIT 1NBYA 1PG7X 1FNFA 2DI8A 3BQUC 3KYOB 5FGCB 5H2BA 2GSGB 3TN0D 4EI6B 3HG1B 3QAZB 1LP9E 4Y16D 1SMOA 2M8XA 1FL3A 1F8TH 2N56A 5IJKA 3CCHB 5ERWA 1IAOA 1NKRA 4FP8H 5C0AA 4WFED 4AL8L 1YN7B 1YECH 1L0YA 4RNRB 4RAHA 3W9DB 2RR3A 4Y19B 3HNTL 2Z93A 5GRWA 4HD9A 3IVKB 1WZMA 5T1KA 1INDH 3WSQH 4XP5H 2VLJE 2ORBL 1WBZA 3IU4L 5GSVB 5HHVH 2RB8A 3C5ZD 5DRZB 3U7AA 1OLLA 4Q9RL 2VR9A 2YS4A 1TQBC 3NIDE 1VFBA 2DQCL 1VACB 1KJVB 5IR1B 4KQ3L 2J8UB 1F11A 5DT1L 4WUUB 3O3AA 4P49A 4PIRF 5J13C 4HGWA 1MCRA 3MROB 2ZKHH 3FB8A 3M07A 5FCUH 4CMMA 5HYSG 3WNKA 1F4XL 4M1GL 3ZKQD 2Z8VC 1AY1L 2OTUA 5HDQL 4CVUA 4H0GA 1BX2A 1H5BB 1WZ1H 5EZOL 3BN3B 5TE4H 1HH9B 2Y7QB 3O6ML 4PLKD 2D7TH 3MRLB 3MX0A 4JGMA 3IDXH 1P5VA 3ZSTA 4Y5VA 4MXQD 4ZUVB 2MHAA 1QFWM 3BH8B 5HI5D 3T2PA 3HC3H 3K81A 1MFDL 3IFLH 4HUNB 1QFHA 5D1QA 4TRPH 1EFXB 3PWNA 4TUKH 15C8L 2X4UA 4GRWE 1KJMA 1E27B 1U8OA 4G7YH 5IB3A 1T80A 3BN9C 3CZFA 1D6EB 2Q20A 1G7LA 1WIOA 5GGTH 2YZ8A 1IEBA 4NGHL 1GCFA 1RZKL 2R23A 4BZ2H 1B4JH 1N0XH 3EHBD 3GJFA 2UWEA 3QZWG 1NCTA 4YX2H 4WGVB 1IZKA 5DRXA 1OPGH 1X44A 3L7FB 3DVGA 4EVNA 2FECI 1QBLH 1JTPA 1N3NB 2FJFA 3B9KC 2NY2D 2IGFL 3WO3B 3ZDYE 5D5MA 4LGSB 5J1AA 3WE6B 1ZLSH 4OGZA 4WJ5B 3CLFH 4NNPH 2MJWA 2BZDA 3VD5A 3ET9F 1CGSL 5EC2A 4D3CH 1JGVL 4P2RE 5ID0A 1QLRA 1LDPL 2BC4B 5EU4B 1F3JB 4ZNEE 2ZCLL 4Z76A 3JSSA 5JIPA 5EOQH 5LGHL 1OSPL 4U1KB 5E6ZA 3MA7A 5GGRA 5FECB 1F4YH 3MV8B 3T65A 5B3JE 2AJYH 2RHEA 4W6YB 4FFWD 5ESAB 4U1NA 4ZQKA 3TGXA 1W8OA 1FH5L 1MI5D 2ZPKL 1WVZA 2HT2D 3OJVC 3GSRA 4AIZA 1Z6JT 4G6KH 4ETQA 4H5SB 4Y4FA 3QIBD 1YNLH 3QWQB 1JHTA 4R0LB 2A74B 5FYJE 1IKFL 3TYFB 2ZP0T 5DVNA 4GXVL 5D2NC 2IADB 3OPZH 2NY1C 2YD2A 5C2BL 3KLAB 4KQ4L 1GH7A 4PJXA 4QY8B 1R6VA 1RUAH 3ROLA 2Z35A 4UZGA 2OMBA 4JFOA 4PJFF 3RX7A 1T66D 5EPMA 3VFUB 5DK0A 1C08B 4EUPG 4MJIE 1KGCD 2UUDH 3OAYH 3DX9A 2YN3A 5FYJU 1R5WA 2FATL 4HWEH 3P77B 4JQXA 4AEIH 4PRDA 2X10A 1VPOL 1GPOH 3F7YA 4CU7A 2A77H 1U8IA 1RK0B 4X0KA 1S5IH 2EH7H 4NNXB 5T1LB 1ETZA 3UTPD 3WFHA 1SM3L 1DUYB 4WI7A 4I13B 4XT1C 1XR9B 4CVWA 4HJ0D 4KUCF 5FGBC 1MLCB 5TE7H 2WUCH 5I1CH 3FQRB 2IALA 4DKFH 1MQ8A 4PB0L 1NGXA 1D9KA 1NEZB 4LEXL 4Y1AB 2FJGB 2XWTB 3DGCR 3LEYH 3D39A 4J4PC 3PGFL 5I1KH 3LV3B 4LARL 1RHHB 3QEUB 5D2NE 5C0EA 2APWA 4TTDC 4MAYC 1EHLL 3I6GB 3SOBH 4ELME 2NY0D 1HQ4A 4ISVA 3ZKMD 3CDCA 3CVIH 3ULUF 1TZHB 1UXWB 3KAAA 2ZUTA 5IEHB 2CDEA 4S1RH 5FV2A 5ISZB 4MZ3A 3I84A 4WHYG 5BRZE 1RSFA 4PJFB 4PRPD 4DUVA 2I60L 2FR4A 4JDZB 2Y6SD 3O8XD 4JFDB 1AKJD 5C6WH 4HMDA 5IFJB 1OAXH 2R0ZH 1HWGB 3GSWA 5LQBH 4LSUL 1S7QB 5M7QA 2DRUA 3SQBA 2Q7YB 3RGHA 4E0RA 4U6XA 5C2UB 2FDBP 5C6TL 4L8CB 5ADPH 5IFHH 4AEEA 2VITA 3R06A 3SDXE 3QIUA 4OZGE 4NRXA 1OCWL 1SY6H 4YBQC 1SY6A 1FVDB 2E9JA 3TN0A 2FHBA 2CR3A 4CW1A 3MR9A 1MVUB 3MODL 3S37X 5DMKA 3P9MB 4TNVK 1EEUA 4WTWA 1XH3B 3B6SA 3WS3B 2DQEL 1FZOA 2DWEA 1F6AB 3FFCD 5DUMH 1TTUA 3WNNA 4X7FC 5I1DB 5I9QC 4XNQB 2FX9L 4HKBA 5BS0E 2DN7A 3E6HB 5D7IA 1E4XI 1AR1D 3U1SL 2FYYA 3UYOD 4RZCB 5DVKA 4KU1A 2I07B 3BEVB 2OR7A 2FNBA 4XPFH 5B39B 2W0KA 3O6KH 4G80A 2H8PA 3GSOA 3ARFC 4YO0B 5C9KA 2F53E 1RZIA 1FSKB 2UYLB 3UJJL 1OD7A 4IEFB 3FQXB 5HHOD 1S7TB 1KTKE 5GZND 1KF9B 4IRSC 3EOTL 3EIFA 4MCZB 1DVFD 4P3CH 3Q5OA 3A6CH 2B1AL 3G5VB 4P99A 4XXDB 2DQUL 1NFDE 1JZ4A 3D25B 4PGDB 4N0UE 1RULH 1MIML 3TFKC 3SE8H 3V6ZA 4ERSL 1S7WB 2Y07L 4POYA 4PJ9D 4R90L 5D6DC 2WINB 1JBJA 1CBVL 3GM0A 3IS0X 3ELAT 3VXRD 4NYLA 1FL6B 2HLFD 3T2NH 4X9HA 3TC9A 3TWCL 5F88A 3NIFE 4XPHL 2O5XL 2QADB 3EO1B 3R8QA 1FRGH 3BPCA 3NFNB 3TBWA 4D0DB 2E7LC 1U93B 1JF1B 1OM3H 5ITBL 1ZMYA 5I19L 1XIWB 4YFEA 4ZXBD 3TVMC 1FE8H 2WWKO 5KVDL 3AC0A 3GHEL 5EZJB 3ROOA 2EE9A 2CK0H 4CDGC 1HHJB 2NY3D 4XWGL 1MJ8L 3G5ZA 3L1OH 4QRQB 2XZCL 3O3DA 1IC7H 1N6UA 3QNYA 5CGYC 3QCVL 1J8HE 4ODWA 4XVJH 1YEIL 3BMWA 2W0PA 5HGHB 3EYFB 4F57L 3FKUS 5IKCB 3D3VA 1J12A 4XNYL 5HD8C 5ESVB 1CD9B 25C8H 4XPGL 1AJ7L 5E5MB 1KIQA 2PO6B 3MRBA 1MFEH 4GO6B 2APVA 5ICYB 1IAKB 1KC5H 2GK2A 3HI1B 5BZDA 1A4JB 1JGDA 3V6FB 4D9RE 1HSBB 3QQ3A 5ACMA 3SDCD 3HZKB 1Q8MA 3OMZA 3MLVL 3AM8C 2VN7A 1T21B 1XR8A 3FQWB 4YBHA 1N5AA 3VXTB 5F7HA 1TJIH 5GRXG 3VW3H 4MB5A 5CJQL 3TBYB 4U05A 3PL6D 1OWRM 5JNYA 4DAGL 2KZ1B 3NZ8A 5T1DH 1MCBA 5HHXH 3QIBA 4Q9QH 2ICEB 3SGEH 3KPSB 5AG9A 5D7LE 1K3IA 4NQXB 2HJFA 2G5BB 3LZFH 4OD3H 3VWKB 5ESQB 1FYTB 4ZUTB 3UPRA 5E4IA 4BFBD 4ZAKC 4ZS6C 1KEGL 3MREB 5ITFA 3PJSB 1BBDH 1P7QB 3ZT5A 2X4SA 5IK3A 6FABL 2XFXA 5DGRA 3NPSC 1WISA 3E1F1 2JELL 2R2CA 5C0NC 2Q8BL 5GZOC 4XBPB 2IH3B 1JK8A 3QI9B 4JPKL 4YHNB 5DD0H 3O4LB 1PBYA 3WFCH 2N1KA 1MRDL 1FVEB 4WV1B 1AO7E 2NXYB 4Y8AA 4LCIH 1J7VR 1IQWL 5DSCA 2GFBB 1ZLUK 3QHFL 4WWKB 1I7RB 3H7BB 4LMQE 2VLJD 4L4TB 4OIAA 1LO3H 3FO0H 2AERT 2NX5B 4J1UB 4FA8A 4WUKH 5I6XB 2VLRE 1DLHB 5DQJA 2YPLE 2EZ0C 3H9SB 4OZFH 1U8NA 4J3VA 4OZFA 4LLUB 1URLA 1IC5H 3FO2A 1U8KB 3IF1A 2WMPA 4YH6A 3L9RA 2XZQL 4JFFE 5C1MB 2WWMC 1T2JA 3ARGA 3RL1A 5I17A 4FZ8L 3MRCA 2XKUA 3MJ9H 3MJ9A 4JJ5B 1P4BL 4QRPE 3VA6A 3T8XB 5EUOA 5CJ8A 1AGEB 2GIYA 3O2VL 3R0MA 4NO5A 4KJWC 3KPRB 3B8YA 5DJ6A 3MYZA 1I7UA 3PE9A 4X5WA 4LLWB 2X4TA 3FRPA 2W07A 3KDMB 4IRZL 1MREL 4QO1A 3IYLW 1LDSA 5DC4B 1DEEA 2EDKA 3F6LA 1R3KA 2HFTA 3MRMB 4HIIA 4X9FA 2PTUA 3VFSA 4X6CB 2WBJD 4HXAL 4OIIL 3MOBL 3CVHB 2DI7A 2Q1EA 3CSYB 3P4MA 2Q86B 2KQMA 4PRPA 4OD1L 1A6ZA 3K2MC 2A6JA 4DZ8A 3FN0L 3JUZA 1PKQA 2NW2A 3O8XA 4Z7UF 1IGCH 3PWPE 4JVPA 1YEJL 1TETH 1HN1A 3TT3H 4OF7A 1BOGA 2CUIA 4MDIB 2CIIA 3U0WH 1UJ3C 3MFFB 1G7MA 3TNMB 2AKRB 1T1YA 5DMYA 1WCBB 1YC8A 1BWMA 4YHZH 2C1OA 3UTZB 4KMQA 2VZTA 5DI8B 5CINL 4D0CA 4L9LA 1TZIB 1UB6A 1WITA 1OGAE 3QJFB 5K59F 5IIEB 3CC5A 3E8UH 1H3WM 1F4AA 3K4DA 5L2KB 1QBBA 4F15B 1JNHA 2X6MA 5T5NF 3HS0B 1AGDA 5SV3A 1TVBA 4N8VB 3MLTA 4B53A 1KB9K 1ZWIB 2BRRH 5EU6E 2VAAA 3FFCA 3KXFB 5CP3A 3PP4L 4UBDC 5MEOB 5FM4A 3JV5A 4LEOB 4WI8A 3RDTC 3IJSA 2DM3A 3HC0A 3NACL 4YHKH 3U46B 4Z8FH 5C0IB 3UAJC 5IHZB 4HKZA 3H3BC 4G8IA 5GISH 1RZ8B 1U9KA 2YUZA 4LVNB 2GSIB 2Y36L 4M1CD 3BW9A 2C3VA 3OR6A 4KRLB 3LN4A 3BN9D 1A6TA 1GGIL 2BOCA 3D0LA 4XAWH 4ZSOA 4WCYH 1U6AH 5BXFB 2E9IA 3A67H 1X5FA 3Q3GB 1DVFA 4XB7A 4Z7UB 5I1HH 4D8PB 3VFGH 4ZPVB 4JHZA 4EBQH 1WTGT 4JFXB 3LHPH 1KN4H 3RVTC 1BFOA 1TPXC 4GAGL 1Q38A 3VI4F 1I9IL 3QG7L 4JFEB 2OCFD 1KIRA 1N59B 1YEEH 2IPTH 4PJ9A 2UZIL 2AEWA 4OCRH 2FO4B 3VFPA 4XC3H 3HCVB 4GW4A 4G3YL 3VXRA 4C83B 3JZ7A 3SGDH 1NFKA 3WXVH 2ATKA 5C71A 1ED3A 1VKXA 3WKMH 3SBWA 2VDRL 5I16A 4WTXA 3QDME 4DUXA 3NIGF 3ETBF 2DKSA 1I9JH 4PRNB 1EHXA 3MJ7B 1DQJA 3RHWF 5A2JH 3LIZH 4HUUB 1GZPB 1LWRA 3U6RB 4ZXBA 2NR6C 3CFBB 1MCFA 1LO2H 3DV6A 4I0PC 2D0FA 3LQZA 3S88L 1NAMH 1NAMA 1P4LA 1MCQA 3WL9B 2PYEB 1KIPA 4MNGA 3MFGB 1ADQH 4GAFB 1ADQA 3V0WH 4RISH 4PUBH 3SPVA 2JCCA 1I75A 3P4OB 1KCSL 5A16B 5CZXC 4NO2B 1JGLL 4YQXL 3ARWA 3S36L 4K8RL 1D5MA 4YNYB 4M93C 5DHXB 4U6YA 2Z91B 4HS6A 4PJIE 5F7LB 4NQED 4JQVA 5EA0H 3TO4B 2YA0A 3ARUA 4JDTL 1M1SA 4H88H 5HY9B 1I1AB 4I1NB 3QSKB 1UJTA 2O5YH 5FGSA 3SDCA 3VXMB 5ACZB 5ADOH 1J0ZA 1B4RA 3EOBB 2AK4E 5J89A 3U30B 3UZVB 3DIFB 3HLAB 3IFOA 3BWUC 5F3BB 2BOBA 1E4KC 1EDQA 2DQJL 2IF7A 1QSFB 1CXEA 3GB7A 1NUNB 4FQ2H 3C6LB 3KS0J 5AZEH 5TDNB 1HINH 2I25N 4LVHB 3DLQR 4V1DB 4NHCL 1BZQK 2GITA 2YEZB 1H3TA 1LP9A 1I1FA 3PWJA 1L4IA 3SHSA 4P2QB 1BWWA 2OSLA 3IRPX 1NGYA 3RZCB 3HA0A 4CADA 3VA2C 1YNKL 2ZOLA 4K7FB 2G9HB 4OQTH 4HXBL 4OQTA 3LEVH 1RIUL 1EEYA 4OZFG 3H8NA 3F62A 5JMRA 2HH0L 5BS0D 2FB4L 4AM0B 1KENL 1N6QL 2EDQA 2BVEA 3HZYA 2JJSC 2B5IC 1M7XA 5C6PB 3IKCA 4FZEL 2W0FA 5KOMC 2VLJA 5F7KC 4X6BB 1EEZA 1RZ7L 4XXCC 5ID1B 2QHRL 5BV7L 5I8OL 1UB5B 3PDGA 4U1GB 4ORZC 3VG0L 4LCWD 4RGNC 1BPVA 1TCRB 4P4KB 5C09B 3QFJE 4YR6A 4K3EL 5KW9H 4U7MA 5L7XH 2DM4A 3FRPG 2CGRL 4UNUA 4YE4L 5EOCL 4JFZL 5DWUH 4PJ8A 3NPZB 5J56B 4LOUC 1RVFL 4G8GD 2AAVA 1FFOA 2ED9A 2F5AL 3CSGA 4NQTA 1HH6B 2JTDA 5HGDB 3WIFA 1MCWW 4ACPA 3HE7A 4PYGA 1RHFA 2OL3B 3BKML 2VR5A 4LU5L 1UH2A 3HKFA 3MGOA 4O2FA 5JHDE 4X8JB 3BQUA 2HTKC 1HEZB 1FPTH 1A1OA 2VXUL 5IFAH 5DEFB 1PZUB 4JO2L 4O4YH 1CD8A 4UV4H 1B2WL 4OD2B 4P46D 5IB2A 2CLVB 4S2SA 1MAMH 3K7UA 5KSVB 2FBJL 3D48R 2YC1B 2EYRA 3K1KC 4K7PY 5HPMB 4PJCB 1NGQL 5FB8B 2F19L 4OZ4A 4JRXB 3T0EC 3ARFD 4M5ZL 1S7VA 5SWZE 5D1XC 1GGUA 1Y6MR 4KVCL 4Z7QE 4RGNE 5I76A 5M94B 5HYSB 1VCAA 4G8FB 3PWUA 2C4FT 4U1MB 1T2QH 5MEPA 4CMHB 1RIVH 3C2SA 1S9VA 3B5TA 2OR9L 1WSST 4KTEL 1XF5B 2C5DC 1A5FL 1ULVA 3KNBB 3QUMB 4QRUB 4JAMA 4NJAH 4PJBE 3SE4C 4CL7A 4ZNEA 4R4ND 1SYSB 3KPMA 3HB3C 5HVGB 3NZHH 2VZ1A 3I6LD 2LV4A 3CH1A 2WIIA 4M43L 2ED7A 3BDYH 2Z9TA 5C3LD 4LAJH 3AS1A 4L8BA 1MJ7H 1FJ1A 1IC1A 3QZWB 3D0VB 4W68A 3IXAB 4NZJA 2E9WA 3DHJA 1ZANH 3L3JA 5IF0A 3D18A 2GUOB 4Q7DA 4JKPH 3DI2B 3N1FC 3KPOA 3C5SA 4KRPC 3TVMD 1U8HA 3CDYA 3MLYH 2IBZX 5BV7C 4OM0H 1U3JA 4QNPF 3RTQD 3MACL 1QFUL 3MBXL 5F7NC 3SDYH 3LS5H 5D1ZB 5C0BD 5DA0B 2O93L 3T0EE 1X6NA 5E2UH 5EZIL 2C7UA 2NY6D 1HDMA 1D5BA 2AV7B 3B9KA 2PN5A 1AO7D 2Y5TA 3KS0H 4RX4A 5HD8D 4NZUH 3ULVF 4JB9H 3IDJB 4LDEB 5IBUB 1J1XL 5F7UA 1TNMA 2C1PB 4LNVA 4OCWH 2V2TA 3QO1A 2Q6WA 2VR4A 4MA7H 4X6FB 5E08L 4LSVL 4X7DC 3BXNA 3RIFF 1RFDL 1OP3K 4FFVC 5DMIH 4JFFD 4QWWC 4PJHE 4XVUD 1KB5B 3OAUH 3DRTB 5F6IB 3VWJB 3S9DB 2W59A 3SKJH 5HYJB 3NCJL 3RWEB 5JOPE 1WJ3A 3D85D 2WQRA 5J11C 4M62H 1EUTA 1AP2A 2XN9E 3LKNB 2ARJQ 4QXUL 3C87A 2IAMC 1UZ8B 4EUPB 2HG5B 1ZVYA 2DDQH 2DLFH 3GKZA 3SKUD 3LRSA 2AJUL 3OL2A 1ZLVK 5HVHB 3QUKB 2ERJB 2ORBH 4ELMA 2X4PB 1MJUL 4JKLA 3KYMA 4NQEA 1CICD 5C0ND 1OQOA 1HHHA 3MRIB 5GZOD 3O45A 1VFUA 2PTTB 3JUYA 2P5ED 1AGBB 4GRLB 1FIGH 4KQ3H 2EDYA 4HEPG 2FL5B 3B3IB 1AXSB 3MXWL 4M5YL 2CSPA 3PV6B 2P8MB 4K3GA 3EYOB 3PG2A 1MHCB 2HWZL 4HUWB 3G6JE 4S1DC 3PV7A 1AY1H 4L3CA 2R1WA 5HDQH 3H9HB 3WKNA 2BSSB 3RQ3A 3SDXA 4JM2C 2ADGB 3O6MH 5HXMA 5J0BA 5SWQB 1MWAB 4JY4B 3ARYA 3NGBC 1EBPA 2WWMD 1X5HA 3MOAL 3DX8B 3TIEB 4Y4HD 1XF2B 1OGTB 3AXLB 2ZUVA 2X9WA 5GGVY 4FQXD 5KG9A 4I5BB 4A6YH 2VTFA 5K9KA 1AD0B 4LRIC 5GGSB 4KJWD 3GMRA 5I74C 2QR0A 2D2OA 2HT4C 4MVBC 5BS0A 3DBXA 3DWTA 1RUKH 3O81A 4NM4L 3GGWB 3QDJE 3WV0A 4GQ9L 2YWZA 4G9FB 4RMQA 1MCCA 5B38A 4HJGB 1QHPA 1NBYB 5F6HJ 5H2BB 1KXVC 3RKDC 1CFVH 2JJWA 1KOAA 1Z9OA 2L0DA 5EO1A 3GKWH 4LQFL 5CGTA 3CFJA 1FL3B 2IPKA 2PXYD 4FNLL 5ERWB 1IAOB 2F53A 4LCWA 1BFTA 3VGHA 3QCTL 4I9WE 1EAJA 1M7DA 4NZTH 1MAJA 4NC1C 1CGSH 1S7UA 3REWA 4CNIA 1MAKA 1JGVH 4K3DL 1RJZA 4FQCH 4HS8L 2V6HA 2FX7H 5SX4I 2Z93B 1KB9J 1C5BL 1LDPH 1XGRA 3BAEH 4ZO8A 3ZYZA 2VLKE 4LSDA 5T1KB 3GNML 1L9NA 4U4BA 3BGMA 1R0AH 1NFDA 3KJ6L 1WBZB 5D5MF 2YD7A 4ZUUA 1JPGA 4C55A 4J2XA 3PGDA 2KQNA 1G0XA 1IC4L 1VFBB 1ZS8A 4HC1L 5B8CC 4DVRH 2UV3A 5FUOL 1F11B 3SCMC 2ZUXA 3O3AB 4HGWB 3FB8B 4LPXA 2UZYB 3SEPA 4CMMB 5KOVC 4YHLH 3KPNA 2OTUB 5HYFA 1BX2B 4DN4H 1G7HA 3F6IA 4HUVA 2EDWA 5I15H 1K6QL 1KULA 1PDKA 4XWOC 5SX5H 3L7EA 1NCWH 1S78D 4PG2A 4ODXA 4NUGL 1F02I 3AAZA 4Y5VB 3NH7L 1J8HA 4Z7WE 4YK4B 1RUQL 5E2JA 3VFMA 2YA1A 4HF5H 5CLTA 5D1QB 3ARFA 4JFHE 3PWNB 2X4UB 3UBXA 4DFHA 1J0KA 2PW1A 2CLZA 1KJMB 1U8OB 5IB3B 3CZFB 4NC1E 3WIIH 3F7RA 5I1EH 1G7LB 3PNWA 3EYQD 1RPQA 4YBLB 1IEBB 3IXTA 4PJXF 4IRSA 2R23B 1E6JH 2QV2A 1Z9SA 4ZD3H 3QNXA 1OAKL 2B2XL 4TVPL 3GJFB 2UWEB 4KZEH 5IT2L 5DRXB 4IM8A 1UA6H 3DVGB 4EVNB 4OZHE 3ZE1E 1KNOA 1PJ9A 3BWAA 4MAUH 2FJFB 4NN7B 3HZMA 1SM3H 5D6DA 4NKOA 5D5MB 1KEMH 1O7VA 4OLYL 5EBLA 5J1AB 1ZLUH 5GRZA 1I4FA 4DK6A 4OLVH 4KK9C 5EC2B 4PB0H 5ID0B 1QLRB 1OW0C 2YPVH 3ULSA 2E7LA 5D7LA 5I30L 1DR9A 1ZVSA 2AS5M 1HHIA 4P5KB 4OBSA 3TVMA 3MA7B 2NR6D 5GGRB 1I9RL 1TJGH 2D9CA 3T65B 4I0PD 4JN2A 4MNHA 4U1NB 5DJXA 3NA9H 4XTRC 1YEKL 4ZQKB 5IMOB 1WAAE 3CFKA 1AI1H 3VGGA 4AIZB 4OI8A 4QGYA 5C0BA 4ETQB 4M6NL 4X6DF 4D94A 4Y4FB 4JY5L 3TBVA 1JHTB 2H6PA 5A3ID 2Z8RA 4QTHA 4ZTPH 1AO7A 1X9QA 2OZ4L 4LSUH 2NCMA 4PY7A 3JWOL 3N9GH 2P7TA 2YXMA 3ARZA 4DQOL 2BXYA 1X7QA 5C6TH 1O5DT 4DGIL 1UZ6E 4PJXB 2GJZA 2VLRA 5CJXC 3ROLB 2Z35B 3UC0H 2Y06L 3ZDXF 5KS9E 4JFOB 1WLHA 3BRDA 5EPMB 4XCFL 5E6IC 4JFFA 1VADA 3FHQA 2N7BA 3JTTA 1HCVA 1FHGA 3HUJF 4FTVE 4PJ7E 5JHLH 3AM8A 4QYOA 3T04D 3BD4A 1NGZA 3DX9B 4MA1B 5D7JD 1R5WB 5EIQA 4QRPA 4O9HH 5F93C 1UGNA 1MCOL 2VLMD 3BPLB 4M4PA 2ZUSA 1FNLA 3GMMA 3QIWD 4PRDB 1JPST 4U31A 2X4QA 1RV6X 3WNPA 3F7YB 4WI2A 4X80L 2FIRT 2BNRD 1U8IB 1GRWA 4F58H 4X0KB 3WFHB 1ETZB 1NCDH 5FDWA 1T4KA 3MCG1 3INUH 1A6UL 4OBRA 1IEAA 2IALB 4KXZH 3MNZB 1CICA 4MMXC 4QT5B 1D9KB 1G7PA 4X6DB 1EK3A 1QEWA 2P5EA 2H2PC 4UOW1 3D39B 5HPOA 5H35A 3PWPA 2AK1H 1QBAA 1BD2E 3B9DA 1KBGL 5JPMA 2DQUH 3QO0B 4M7LH 2HFFA 3O3UN 2VB5A 1U3ZA 4BK5A 1CDYA 3PHOA 2J8HA 4ISVB 3D6GA 4Q9BA 3TEUA 4BK4A 2CDEB 1H3PL 4RGND 4H0HB 1IGJA 5MP6L 2YK1L 3QPXH 1JWSA 5B38G 1W2KT 2FR4B 2CO6B 5IHUH 1QRNE 4LOUD 4ONGL 1NSNH 1LO0L 4BSVA 2XRAL 4QLRA 3GSWB 5TE6H 3R8BB 4KHXL 1A3LH 5ANME 5I19H 4QGTA 3CU7A 4E0RB 2I27N 3BGFC 4U6XB 2E7BA 4U7KA 3V4PL 3WHE0 4LMQI 1NUDA 2VITB 4ZDHA 4UINL 3R06B 3QIUB 4KKNA 4XWGH 3QUYC 3MV7E 5EBGA 1XF4A 4NRXB 3BT2H 3TN0B 4XX1E 4CW1B 3MR9B 3L3GA 2HTKD 2ILLA 3EUUA 2PXYA 4NP4H 1JTTA 2BJMH 4ZOBA 4YHYC 4M03A 3B6SB 2X7LA 3RVWC 1FZOB 5IB4A 5I1LA 1MY7A 4RFNB 4XPGH 4HKBB 4WEUD 1L9MA 2R56L 1UACH 2OMNA 5D7IB 4BFEA 2J2ZA 3MV9D 4TVPE 1AC6A 2FYYB 5KSAC 2GTZA 2DBJA 3EYUL 1T3FA 3HMXH 4ZO6A 1UJ3A 1IGIH 1E28A 1HQRA 5TF1L 4G80B 2JIXD 3GIZH 2H8PB 3GSOB 2YPKB 1RZIB 2J6EL 1JPFA 1DQMH 1FFPB 1G9ML 1AHWA 2CKBL 1DL7L 5CEZL 4XCYA 3C09B 5IESL 2ID5A 3QDMA 1T6WA 4G8EB 4J3UA 5A2LH 2R0WH 1JF5A 1R3JA 3DSFL 3UBXG 2AJSH 5DDHA 1NBVL 5JW4M 3V6ZB 4HCRL 1MY5A 4Z95H 3EDKA 4HSQA 5F44A 1YJDC 4ODTL 3VD3A 3RDTA 2V5MA 3UJTH 1WCQA 5F7WC 3GBML 1B0RA 3ISWA 1CXHA 5F88B 2Q8BH 2EIZA 5D70H 4JPKH 3VMNA 4AEHL 3BPCB 4MX7A 4JHAL 3TBWB 1MRDH 2W65A 4WU5B 2Y5EA 2KZWA 3ZYJA 4FQIH 2ZSVA 3QA3A 4N0CC 4PP2A 4E42A 1JHLL 4KRPD 4N1HB 3VGAC 5E8NA 1BBJA 3F8UB 3L5HA 1ZXQA 3G5ZB 5DVOA 3O3DB 4P3WA 1T03H 1OAYL 2MMXA 3LSOA 4PJIA 4Z7OF 2BK8A 2A9NL 4XMLH 4ELKA 4E5XA 5C08D 4ODWB 5KJRL 1J87A 1G6RH 4RGOH 3KG5A 4JZNA 1RAMA 1PEZA 3CUPA 4H20H 3EYSH 2NY2B 3W0WE 4CAGA 1TJHH 2ICWJ 4JN1L 4DTGH 4DVBA 1AE6L 1OP9A 3EO9L 1KIQB 3MRBB 4IDJH 4TSAH 5L6YL 2CXKA 4LHUD 1IGYA 2PUQT 5CJBA 3ZZ1A 5BZDB 4EKXA 2DLHA 2OI9C 4WUUD 3FO9A 2XG4A 1JGDB 1MREH 2CRIA 1OAZL 3QQ3B 3WDHA 2OJZL 2D7MA 3CMGA 4I0PA 4JANA 4QCIA 1XR8B 3RU8H 3UO1H 1D3CA 1N5AB 1UYWL 2CLRA 5FYKD 2XNAA 4YXHL 4NBYB 3Q0HA 4EIGB 4GLRI 1BHGA 1CU4L 3MLZH 3MOBH 4ZOCA 1RU9L 5JNYB 1NLBH 3NZ8B 4HT1H 3QIBB 1T7XA 4N5EC 4OD1H 1ZLWK 2WWKT 3TP4A 1A7RL 1MCEA 3QUZC 4M7JL 4N90E 1M7IB 1EFXD 4I77L 2OQJA 2I9TA 2HJFB 3H6JA 1FDLH 3UTTD 1ZHLA 4YDLC 3V5DA 4O51A 5ITFB 5J3HC 1CFNA 1GGCH 1CVSC 5JQHC 1PAMA 2DF3A 3FRUA 3GMLA 2X4SB 4OLZL 4KK6D 1JZ3A 1P4IH 3MCKA 1R3HB 1PGRB 4H8WL 4NM8L 2B4CH 2XFXB 4GMTL 1WC7A 4R6UA 3TCXA 1G9MC 4DKDC 1HOCA 2R1YA 1T22A 4L8SC 5HHPB 4PJAF 1BM3L 5IW3A 3IJYA 1DBAH 3UMTA 5JOEA 4P9HL 1NMAL 3DOSA 3H9ZA 2F8XC 1BQHA 2J8OA 5GS2D 5D7JA 5DSCB 1DQTA 2OM5A 1IBGL 5I1JH 1U8MA 2AJVH 3K0WA 1EH9A 2NZ9C 5EOCJ 5I18L 1E4KA 4S1DD 5DQJB 3F58H 4LSPL 4XNUL 4HPOL 1NUGA 3OKDA 5ALBL 3QRFM 4TOYH 1U8NB 4OZFB 2OTWA 4Z7NF 3FO2B 2V7NA 3IF1B 3BKCL 3L9RB 3ARGB 4H1LH 3BIKA 5JR1L 4YC2C 3RL1B 1OAUL 1FNSL 4HIXH 5I17B 5CS7A 3VE0A 1INEL 1XCQA 2FEDC 3LEXA 3SE9L 5E70A 5I1IH 1KPRA 1P2CB 3N85H 5EUOB 5MI0C 4HX1A 4DN3L 3DVFA 2AQ1A 1T1XA 4YHMH 1RD6A 5DJAA 4NO5B 5DUPL 5DJ6B 1E4WH 2HT4D 5D72L 1JTOA 1I7UB 4X5WB 5C0FA 2X4TB 3HNSH 5IBLD 5DQDL 4ZO9A 2JJSA 2XIDA 2YD6A 3I3EA 1DEEB 4UTBL 2YKLH 5H8DA 2NY0B 3RUGF 4F37F 4XXCA 1DSFL 1HHKA 4HIIB 2NXZC 3VFSB 2UZIH 2HRPH 5J57B 1TLKA 4D9LL 3WDJA 3B83A 5HHME 2MKWA 4JO4L 3LH2H 3P4MB 5CEZE 2IG2L 3LS4H 4PRPB 4PJAB 1A6ZB 2QTEA 2A6JB 4DZ8B 2MCPL 1PKQB 2NW2B 4Q2ZA 3O8XB 4I4WA 4GSDH 5J8OA 4HW6A 1L0XA 5GS3A 1BOGB 5T1MA 3W81A 5HVFB 2CIIB 4PJBA 1G7MB 1T1YB 5TGBA 4HBQA 3S35H 2C1OB 2VOTA 3OKMA 4P3DA 1DZBA 1P6FA 1T5WB 4OLUL 2EE2A 3VH8A 3HC4H 4D0CB 4L9LB 5ALCH 1UB6B 1Q0YL 1K4CA 4EI5C 5HGAA 2VSCA 1CK0H 1SEQH 3VI3E 1JNHB 1UM4H 1AGDB 1NH6A 4YQXH 2D7QA 2VAAB 3FFCB 5FAAA 4BQ6A 2HKFL 4DGYL 1YQ2A 4GG8A 2VDPL 3S36H 4KVNL 1ZHKA 1QVOA 1U8QB 4HJJL 3TJEH 3IJSB 4B7LA 4H8WC 3HC0B 3R1GL 4PP1D 3U9UA 2ICWA 3ES6A 5D2LE 4XWOD 4RA0C 1FBIL 4AIXA 4HKZB 1L7TL 2QQLL 4G8IB 4HQQL 4UT7H 3I9GH 2JCCF 3T0EA 2JIXA 4P9HC 1MQKL 3BW9B 4PJGE 4D9QD 2C3VB 1IAIL 1PFCA 3OR6B 4R4FL 3LN4B 1ZLVH 5D7SL 1A6TB 2BOCB 3D0LB 4ZSOB 1H9VA 4I3RH 4OLXH 5CILL 2YHGA 1DVFB 1JHKL 2C4FU 3BIAX 5B3NA 4RBPK 4X5XA 2GAZB 3ARDC 3SE4A 3W11C 4G42A 4XPAH 1BFOB 5BQ7A 1A0QH 1VESA 4LSQH 2P8LA 1KJ2H 2WANA 1KIRB 4PJ9B 4TUJA 4R96A 4RFEA 5FV1L 3VFPB 3VXRB 4GW4B 4YHOH 3SY0A 7CGTA 5DVMA 3SQOH 4K2UL 1FZKA 4JLRA 1GC1H 3JV4A 2ATKB 1ED3B 2QSVA 5CD5C 1VKXB 5I16B 3ZE2F 1YNTA 2HH0H 5D4QA 1J0HA 2FB4H 2DQIL 1WFNA 2XN9A 1KYOK 5C0GA 1NEUA 4HIJA 4Z5RA 5F7MC 2B0SL 4ZXBB 1I85C 5E9DE 3OKEA 2DQHH 4F7EA 3DV6B 3DMMC 4QHLA 4F9LA 5C07E 2YMXL 3LQZB 3WFDL 2NY3B 1NAMB 4G6FD 5I8OH 4MNQE 2ZCHL 4IRJC 1P4LB 3RVXC 1P5UA 1KELL 3S98A 5C08A 1JRHL 1KIPB 1UWEH 4MNGB 7FABL 4LIQL 2CGRH 4KKBD 2E8ZA 3UTSE 4EQ2A 3CD4A 2XA8L 3MPCA 4MSWA 2JCCB 1NQBA 3SPVB 1Q72L 3LKRA 1T89C 5DRWB 4KI1A 3T3PF 1GHFL 1BD2D 1I3GH 2NTSP 1D5MB 5HJ3A 1CLOH 4U6YB 1ACYH 5I73B 2FWOA 4NQCD 3PQYD 4D0BA 3MRHA 1CDHA 2WLZA 1NCBL 4G5ZL 4UT6H 3SDCB 2QQQA 5FYKH 2VXUH 3JTSA 2XY1A 4M1DH 1KXQE 4L1DA 3IDYC 5K33A 3IFOB 3PL6B 4UOJA 1WGOA 5DD1L 2BOBB 1W0VA 2QADD 3WDIA 3U0PA 3ZTJG 3QDJA 3MV7D 1JVKA 2FO1A 3OB0K 2BY3A 1BQHG 2GITB 1M05A 1XIWD 1NGQH 4LPYA 5DD3L 3T3MF 1LP9B 1I1FB 3E6FA 3PWJB 2OSLB 5MENE 4U6VL 4M5ZH 1NGYB 4CADB 2ZOLB 3C9NA 5I8KL 4FQHA 3TBSA 1BZ9A 2NTFA 4N0FA 1DQDL 1FO0H 3MRDA 1FO0A 2FECL 3GDBA 3QCUL 5LCVL 1SBBA 3BP6A 1T83C 5F96H 1X4XA 3RWHB 5SV4A 4XP1H 5T3ZD 1M71A 4PS4H 2P5WE 3HZYB 2BX5A 5GS2H 4GAJL 1ZT1A 3MRKA 2VLKA 5D71H 1TTFA 3IKCB 2HAZA 2W0FB 1QSZA 2PETA 2VLJB 3BPNB 4BFGA 3DTXA 2BFVH 4U0RC 5GRVL 2IWGA 2PO6D 5DLML 4FQQB 2UZXB 4J6RL 4JM2A 2J4WL 4Z77A 1QFWH 4KPHH 1BJMA 1QBMH 3ZL4H 5KVEH 1MF2H 3QXVA 2DBLH 4YPGA 5JPNA 1FFOB 1ORSA 3RPIB 3HE6C 3CLEL 1CDBA 1FFQA 3WIFB 2VC2L 3HI6L 3SO3C 4LRIA 4R8WL 2G5RA 3HE7B 5GGQL 5IMLB 4OCMC 4ZFGH 4BELD 4E41E 3KPSD 5F1IA 1QFUH 3MGOB 2ZUUA 3QHTC 4O2FB 4OGXL 3VWKD 3BQUB 3RNQA 4BUHA 4Z7WA 2HMIC 3GBNH 2MFNA 1A1OB 1ZKAA 5DZLA 2CDGA 3D9AH 3RVWD 1JNLH 3A0OA 3HMWH 3KR3H 3VH8G 2DYPA 3RX5A 5IB2B 2SEBB 4S2SB 1J1XH 3MGAA 3X11A 4HBCL 5CKAA 1NANH 5KSAD 2C3HA 2XTJC 4HG4K 4OZ4B 3BP4B 1IE5A 1IKNC 2D03H 5FYLL 2NX5D 1S7VB 1RZJC 4GMSH 2E6QA 5I76B 3EBAA 4G9DA 1CGYA 3PWUB 5MEPB 2DJUA 2NQCA 1H15A 2R0LL 1S9VB 5B8CA 4M7KH 2D31A 3CMOL 4FFYL 4OCXH 3ARED 1UXSA 4OCSL 5J13B 2C3WA 3PXJA 1DTUA 4O5LL 4LHJB 4YEFA 3KPMB 5IVZA 1X5IA 4YDIH 3KPRD 1PD6A 3CH1B 5KN5B 2WIIB 5GRYA 2C3GA 3HR5A 4BH8A 4W6XB 1YPZF 2ADJA 3BO8A 2NY5L 4L8BB 4XP6L 4WFFE 4LIQE 5EN2A 1FJ1B 3BP7A 4EDWL 2QJDA 4TPRL 5AYQA 1QPXA 3L3JB 4N90D 3D18B 3G04A 3EYVA 4N0CD 3KPOB 1V3KA 1ZHBA 3C5SB 5KZCB 1U8HB 2OK0H 4NWTL 3NCCB 2CR6A 4RWYH 2A9MH 2M2DA 5TDPA 1IGML 1AXTL 4PYHA 5KS9A 1KJ3L 1QACA 2IANE 2XTJE 3NTCL 3CX2A 4I0CC 2C7UB 1HDMB 4PJEF 1D5BB 4FTVA 4P5MA 1YYMH 2Y5TB 4NQDD 4JRYE 3QQ4A 3Q6GL 1D5IL 4WU7A 3NCFB 3CX5K 5CAYB 12E8H 2V2TB 3QO1B 1DFBL 2Q6WB 1HYRC 1JWUA 2BDNL 3G9AB 3BXNB 4HFWA 3UCRA 3VFNA 3HNVH 3G9VA 2OLDA 3HR6A 4DGVL 1A6AA 3KXFD 1BAFH 3T0DA 1EHAA 3BD3A 4IIQC 3TJHD 2AJXL 3KYNA 3GK8H 3LAFA 5F9OL 5IVXA 3QCTH 3CZJA 1YPZB 3GSQA 3X13A 4P23C 2X1OA 3TZVD 1YZZA 2BVTA 1I9EA 4NHUA 1AP2B 3V5HA 3IGAA 1C5BH 4JHWH 4K7PL 1MJJA 2EKJA 3ZE0E 4NBZB 2V2WA 4KKCC 2IBZY 3LRSB 1BD2A 3VXUD 1KCRL 1NC2D 4DUWA 2NY1B 1TQCC 4NOBA 3SKNB 4ELMB 1MH5B 5CJXA 1H5BC 3KYMB 1OB1A 4NQEB 32C2A 4NQCA 3PQYA 3O45B 1X4YA 5E6IA 5FGCE 3MLPA 4HC1H 5C0CE 4HC1A 3WHXA 3HG1E 4R3SB 4LLQA 4HK3N 4L1HA 4WTZA 4Q0XL 4WI3A 4CN6A 5C7XH 4JZOA 1J18A 2DQTL 5EUKA 2NZ9D 4OM1H 4FQ1L 4L3CB 1A14L 2R1WB 4F2MA 1R3LA 5L9DH 4R26L 1F6FB 2UVFA 5DJ2A 4I3SH 3SDXB 1KTDA 3MV7A 4QHNA 4HPYL 4EIZC 1NCUA 4TSBH 1N7ML 5E8EA 5FHBH 5E4EC 4PBXA 5GRVK 4NPYA 1MCHA 5KG9B 4A6YB 2EKSA 5K9KB 4OIBA 5H37H 3GMRB 5CUSL 2QR0B 5BS0B 1I7TB 2WW8A 5T3ZH 5E2WL 2J8UE 1MCPL 5CGMA 1JGEA 5B38B 2BY1A 2WBKA 5TQ2L 1IL1A 5EO1B 1HNGA 3CFJB 3E2HC 1FCCA 5FYLE 1XGQA 1MIEL 3QWRA 2F53B 4LCWB 1A7NH 4JG1H 4TSCH 3U7YL 3SJVD 1M7DB 1U58A 3RL2A 3I2CH 3AUVA 2CDFB 1S7UB 3TT1H 5IHLB 1J0JA 3REWB 1F3DJ 4CNIB 5DJ8A 1I1AD 1RJZB 3VXMD 2R29H 1ZEAL 3VD9A 1D5ZA 3PABA 1XGRB 4G8GB 3SDDC 1A6VL 4JVWA 1N2RA 4MA3A 2DTMH 4HH8A 4NRZB 5A40E 1N5YH 2BRQA 2HTLD 3MRGA 4RMVA 4PLNC 4N1EA 4WY7L 1CE1L 3DETC 3OGCB 4KK5C 2DL9A 1JPGB 3S4SA 1KTRL 3QUYA 1PY4A 2AXFB 1EJOL 1ZS8B 3A6OA 2ESVD 4V1DD 2CUMA 3RWCA 4HHAA 4LAQH 3U4AA 3MRNA 2VQUA 3ULUL 4WFHE 1BGXH 1T0PB 1DQQB 5DURD 4IOFD 3KPNB 4DQOH 3OJMB 3RWGA 1G7HB 5HGBA 1FYHB 4HUVB 2X4NA 1S7SA 4MNQD 2H3NA 5KSAA 3L7EB 4J23A 4E9LA 4ODXB 3AAZB 1J8HB 3MOQA 3NCMA 3K3QA 5DK2A 1T2XA 1YQVL 3MV8E 3ARFB 1JYXA 4PGBA 3UBXB 2F54E 2IFFH 3NFSH 4OLEA 2PW1B 2CLZB 1DE4A 1SVZA 1TCMA 2D0GA 4LPWA 3S35X 5E2TH 4P4KD 5DFTA 4HWZA 1LK3H 3PNWB 2CMRH 3IXTB 4IRSB 5BVJA 3QNXB 1KYOJ 5E8OA 2LABA 3MV01 4XAKE 2VYRE 2O61A 5D93B 4X80H 3W11D 1YEHL 3H0TA 4OZIF 4HWBL 1KNOB 3GO1H 3DYOA 3BWAB 3BHBB 3RKPA 2ED8A 1YJDH 3HZMB 4HS3B 4CU6A 1BVKA 4NKOB 4YIQA 5EBLB 5LBSL 3V4VL 1A6UH 1I4FB 4M8QA 1A22B 4RGMC 5GGVL 3S36X 3MUGB 5CJOL 5CD5D 4OJFH 1Q1JL 4UDUA 3ULSB 4LDLB 3P73A 2VDQH 4WHCA 5D7LB 1MCLA 1ROWA 3KPQA 1JP5A 1ZVSB 1HHIB 3GSVA 4ZYKB 3TVMB 2AABH 5LGKA 3CVHH 3O2DH 3DMMD 3O2DA 4JN2B 1PKOA 4MNHB 5A2FA 1I8LA 5DJXB 3RTQB 3UX9B 3CFKB 1LEGA 2DB8A 3MLRH 1R3IH 5C0BB 3QRGH 1I8MB 1S7RA 3WXWH 4YHPA 2NY6B 1CFQA 2H6PB 3TBVB 4JRXD 2VDOL 4QTHB 1QTYT 4ALAH 1AO7B 1CD1A 4NQDA 3DARA 4FQLL 4JCLA 4YXKH 1XFPA 4PY7B 3RGVC 2P7TB 5E5UB 2A38A 1RZFH 1T7WA 3L5WA 1X7QB 2ATPA 2C3XA 2GJZB 1JCKA 1A47A 3G6DH 4M6OL 1BEYH 2LAAA 1CTNA 4DEPC 1L6ZA 3MLXL 4JFFB 1VADB 3P0YL 3JTTB 3MXVL 5AWNL 4ZPTA 4QYOB 1I8KA 3N1PC 1OWWA 4X4YB 4XCCH 4LRNH 3NAAL 5JZ7C 4QRPB 2AXGA 4X5LA 3U0TA 4PB9H 3GMMB 3FJTA 2DWDA 1WK0A 1C5CL 4PJFE 3TZVA 4AT6A 2VXTL 1MHPL 3WUZA 2X4QB 2CRZA 1PG7L 3QUZA 1G9NH 4JFDE 4ESKA 4WTZG 5JXED 3VXUA 1NC2A 1JF6A 1TITA 4Y2OA 4HH9A 5FDWB 3KYKL 1J1PH 1T4KB 2J6EA 4KJYA 1IEAB 3LRHA 4WEMB 4X7CC 5DD6A 3UZQA 1KIUA 1CICB 3LKSB 2CKBA 4L8SA 1HE7A 5DO2D 1G7PB 4AIOA 2P5EB 1J0YA 1JPTL 2V5YA 1A3RL 2B20A 4XX1G 5EO0A 5JOFA 4AENA 1ZVHA 5CBEA 1A2YA 1U3HD 3PWPB 5H35B 4DKEL 5E7BA 2NLJA 3KHOA 5JPMB 2HFFB 2BMKA 1SJEA 2FJHA 4KMTH 4HCRH 3K2UL 1NLDL 3PHOB 4HCRA 3T77A 2JB5H 3DV4A 4WHTA 4ODTH 2D0HA 5H37G 4BKLA 1T0NA 1B88A 4GG6A 1MFCL 4YWGH 4Z7VA 1IGJB 3GBMH 4KHTH 2D7PA 1CZ8L 1TZGH 1JWSB 3ZKNC 4AEHH 3DX6A 1N8ZA 4JHAH 1F90L 4UAOC 4EZMA 3L3KA 4BSVB 2XKSA 3MBEC 4NWUL 5GRUL 3NCYP 4JPWH 5IJVA 3ULUE 4UB0L 4FQXB 1JMXA 4JFYA 1K3ZA 1MRFH 4HZAA 4CRPA 1P7KA 5DJYA 1CLYL 1HK6A 4ZDHB 1QHOA 1JI1A 1XF4B 1A7BA 1OAYH 4ZODA 5E00A 5D2LA 2X4OA 1DBKH 3L3GB 2J1KA 4JVUA 2HMID 2PXYB 1RUPL 3TH4T 1U91B 1YEDB 2X7LB 4I8DA 2W60A 4PJGA 3S34L 5I1GL 4XP9L 5IB4B 5I1LB 4JN1H 2KDGA 4EOWL 3S4SG 3DYPA 1DP0A 1A7QL 1SYVA 3WNMA 1AQKL 3AMLA 2VABA 2GTZB 3MA9H 1LO4L 1UJ3B 1E28B 2MQ3A 3C6SA 1JPFB 1S9YA 1PYWA 5DJZA 5JXAL 4LASL 1PVHA 4JRYD 1AHWB 4F7PA 1EMTL 4NKMA 1QKZH 2ZUQC 4DZBA 4XCYB 2ESVA 1QOKA 2YUVA 2FIKA 4XMKH 3VRIA 4MHHI 1R3JB 1OTUC 4KI5C 4DW2H 1XGTA 1MFBH 2XA3A 5DDHB 3WFEH 1U2CA 3FB7A 4P9ML 3RDTB 2O5ZL 5C07A 1UFUA 4QTIL 4MNQA 4ZUSB 1IQDA 2V5SA 1B0RB 1IGFH 2FHCA 1PSKH 2EIZB 4OT1L 5BOPA 5DEGA 4MX7B 5GHWH 4LCYB 4M6ML 2IH1A 2I24N 5E94A 2V9RA 2W65B 2VXSH 1A9EA 4OFVA 3JVGC 1BFVL 2ZSVB 3QA3B 5C0AD 3GSNH 3GSNA 4LGPB 1MCJA 4PP2B 2LTQC 3CX5J 4I18A 2XPGA 4E42B 4HV8A 4JG0L 4Y5YC 3S7GA 3ZTNH 1DCLA 2R4SL 2KPNA 1S3KL 1BBJB 3FZUD 5E8NB 5GGUA 4BYHA 5I18H 5H94A 3TESA 4LSPH 3LSOB 4PJIB 4XP4H 5ALBH 4LPUA 4ELKB 3VXNA 2H1PH 4E5XB 3ARDA 5IMMA 5D9SB 5T1KD 5CD3A 3DVNA 4PLOB 1TPXB 4XPBL 4JZNB 3CUPB 5C0CD 4K3JH 5KAQG 2HVJB 5FGRA 3S96A 1ZT4B 3CDFA 4DVBB 2OL3H 3SGKC 3TV3H 5CIPA 2R8SL 1R24A 4HMEA 3GMOA 5CEYA 5IW6A 2X05A 1IGTA 1IGYB 1OTSC 2WNGA 3O4LE 3BE1H 5E2VL 1X5JA 4FG6D 3FO9B 4XI5D 2P45B 3MLSL 4PRHE 1I85A 4L3EE 2W9EH 3DMMA 4JANB 4I0PB 1RUMH 1NGPH 2UVEA 2CLRB 2XNAB 3O2WL 1VGKA 3P30L 5EZLA 4TTGA 1XGYL 4IRJA 4NO0D 3O6LL 3H9SE 3JWDL 4JO4H 3ZHDA 5MHSD 1YMME 2HKHH 4P23D 5DFWH 4APQC 3LQAC 4PGCA 5IB1A 5CZVL 4XB8A 1T89A 1PLGH 2OQJB 2I9TB 2Q3ZA 3ZT6A 4LK4A 3WMSA 2IQ9L 4XHJD 4YDKH 1ZHLB 3V5DB 2HRLA 3QFDA 4O51B 4PLJD 1CFNB 3FRUB 3MCKB 1CL7H 4M93B 4XCNA 3KPPA 1E4JA 2R0KH 4WO4C 1WC7B 4HUKB 3MNVA 5ILTL 3TCLA 3PUCA 1UQSA 4XPTL 3GJEB 2X41A 4YDJA 1HOCB 2VXVL 2R1YB 1T22B 4LSTH 4JKKA 2B7DT 3O3EA 2GYSA 3IJYB 3C08H 1K2DA 3QEQE 4ONHA 4HUMB 3ILQD 4LSSH 1BQHB 3T2QA 1RZGA 5D7JB 3IDIA 4CGTA 1UCBL 3SDAC 1EIBA 1U8MB 2HKFH 5EFIA 2DQGL 1N64H 1EGJL 4PV9A 4Z0XA 2VDKL 3LMJL 4OF8A 2G60H 1GIGL 2OTWB 5C8JB 5FUZL 4MHHG 2V7NB 1FGVL 3S37L 1C16A 1IFHL 3QPQD 4HQQH 3JWNC 4S1QH 2YBRA 2BVPA 3VE0B 1XCQB 3LEXB 1KPRB 1MCSA 3VRLF 4HX1B 2VXQL 1T1XB 4WFHD 5D7SH 3VMPA 5DJAB 1RY7B 5GQBA 1T83A 4RFOL 4Y4FD 1G1YA 4WW2F 1PQZA 3EDDA 5L2KE 1U8PB 5C0FB 2Z4QA 1U3HA 1KG0A 4KDTC 2A0LD 2I5YH 4XC1L 3AY4C 4PV8A 1P69B 4DOHB 1HHKB 1MRCH 5BO1L 3KLHD 3RPKA 4RGNB 1FFRA 2NYYC 3OKNA 2P1YA 3CNKA 1IRAY 3GI8L 4LVEA 4K2UH 3RIAF 4UQ2A 4P2OC 4NOFA 4Q2ZB 4I4WB 2E6JA 1NMBH 2IEPA 3SDDD 5TPWL 1CYGA 1X3DA 4L9DA 4PJBB 3BJ91 1SBSH 1ZOXA 5TGBB 4K94H 2CJUL 1A9BA 3OKMB 4P3DB 4NT6A 5FKAA 1AGCA 2QKIA 4UOW0 1KCUL 1ZE3C 5FK9A 3H2WA 3QJHA 3U9PL 1EX0A 1K4CB 1OARH 4Z7UE 3VRJA 1KELH 4RAUA 1K4DA 5I2IB 3JWDC 5HGAB 2GJ6E 3TO4C 4P5TD 1CG9A 3RA7H 2XKNA 1UH3A 3OKYA 1ONQB 2QQNL 4JFEE 3GUTA 1FNAA 1AD9B 1ZK9A 4IS6A 4N0RA 3U30C 3FMGH 4NO3A 1OOAA 4GG8B 2DLIA 4HFUL 4RAVB 1MEXH 1ZHKB 5HDOA 1QVOB 5K59E 3WIHL 1CLZH 2Q8AL 3ABZA 3U9UB 2ICWB 3QUML 2FX8L 4KV5E 3NVQA 1MCIA 1PX4A 4G5ZH 2JIXB 3T0EB 1J5OH 3QHZL 4X9GA 3V2AR 1RZJH 3QEGL 4PD4K 3Q2CA 1DN0B 3HFML 1WEJH 5GJSL 2RCSL 4JRYA 3MUY1 1Y6KR 4NRYB 2EH8H 3RZCC 1IAII 4M4RA 3OJ2C 2EDNA 2PYEE 1H3VA 4KZDL 2BCKA 5K9QI 2CKNA 3DJ9A 3UJIH 2DIBA 3MJ8A 5D8JL 2IFGA 3LY6A 4X5XB 4XVSH 1Z3GH 3F5WB 4G42B 1GGBL 4MQTB 5BQ7B 1UM6H 3HPJB 5T3XL 2P8LB 2W9DL 1PZ5A 3N1QC 4TNWF 1NGWA 4K71B 5A43C 4OLWH 4PRAA 4TUJB 5EWIL 4R96B 4RFEB 4POZD 3QIUD 1IARB 2ITCA 3SY0B 4BUGA 4JLRB 3JV4B 1BQLH 5LCVH 1HILA 2F8OA 4P4RA 1UADC 2PR4L 1YNTB 2Z0BA 5TQ0L 3RZWA 2JE8A 3RWFA 3VI4E 5C0GB 4Z5RB 1X5GA 1BIIA 3M8OL 3OKEB 4KRPB 4MD4A 3VMOA 3WYRA 2X4RA 3MYJA 4NQSA 4QHLB 5LAXA 4F7EB 3RRQA 4O02H 5AD0B 2YSSA 5BJTA 4L8DA 4XBEL 5DLMH 3X3FL 2EEDA 5GS0L 1QSFE 2IC2A 1CDJA 3NIGE 3W2DL 3CXDL 5C08B 1S7XA 1QFOA 1JPSH 1JRHI 5JW5A 2X1XR 4MSWB 2F9BT 5C0CA 3LKRB 4YGVB 4LL9A 3CK0L 3CLEH 1QNZL 3RGVD 1CFTA 1T7VA 2X1WL 4N9GA 5BZWA 5HJ3B 1YN7A 3TBTA 2NZIA 4LHUB 3THML 1C1EH 4R8WH 1CR9L 2RFXA 4UT9L 4JCMA 1HHGB 3N0PB 2FWOB 5HYEA 3V7MA 3PDOA 2WZPD 4D0BB 3MRHB 2R2EA 3CIQA 2VISA 3F7PC 3I50L 4IIQA 3JTSB 2VL5A 3BKJL 4PJDA 3GEWB 1DBBH 3C8KB 2QSQA 4NO0A 2J5LC 4NFBA 3UYRL 4BH7A 5C09E 2RBLA 1W0VB 4P23A 3U0PB 5J11B 3RHWK 4ZS7L 5FHAL 5DR5L 5IR1A 1ZAGA 4OI7A 3U36A 3DURA 3UTTB 3WJJC 4GUPA 3W9EA 1M05B 1GGYA 2A73A 3MROA 3E6FB 3ULVL 1DLFL 5LXGL 1CGTA 1MVFA 4W81A 1DQLH 4KROC 4JY6A 3GJFH 3C9NB 3TBSB 4FQHB 1BZ9B 3ALPA 4N0YH 4N0FB 3MRDB 1FO0B 1MWAL 3BP6B 3GHBL 2J88H 3MRLA 2VN4A 3IDNA 1KV3A 3TPKA 1QO3A 2AQ2A 1M71B 4FFYH 3C60C 3D3VD 1ZT1B 3MRKB 2VLKB 4HLZH 4C4KO 5CEXA 4UTAH 5D96C 1HI6A 4UV7L 3WFBH 3DTXB 2WBWB 2R9HC 5GJTH 2DL2A 3EJYC 3X3GH 2P49B 4G7VL 5K9QG 1YEFH 1Q0XH 5IB5A 5B4MD 4Z77B 3U4BL 3L5XH 3OJDB 3D5OF 3NGBB 2Z92A 1CXKA 1YC7A 2ADIA 3N06B 1CXFA 3ZKND 1RJLA 2WV3A 4XVTL 4FXLA 4YGAB 5JPNB 1F8TL 4CDHA 1ORSB 2GKIA 4FP8L 4MD0A 1YECL 1JNNH 4WJ5A 1K5NA 4ODUA 4GW5B 1UM5H 2X5PA 4IBLT 2AEQH 3MZTA 1HSAA 2XT1B 1DBJH 3U7WH 3RNQB 1A7PH 1INDL 4PRBA 1DDHA 4XP5L 4Z7WB 3BDXA 3OZ9L 4UIMA 2BY0A 2CDGB 4KJQD 3GI9L 2F54A 2YD3A 2JJVA 5HHVL 5E8DH 2GCYA 2R2HA 5E1HB 2DYPB 2Q76A 2HJKA 3ARBC 3AVEA 5DUBA 1JYVA 2VZOA 2E7MA 1UVQA 4KUZH 1Z9MA 2HLAB 3PXHA 2CD0A 3EFFA 3ZO0A 1A1MB 3X11B 4J3SA 4WENB 2BNUA 4QKXB 3FOLA 3P4LA 3RY6C 3SDDA 4TN9A 1GOFA 3EZ8A 2M1KA 4C54A 1NCAL 3MLUH 2ZKHL 5FCUL 5T3XE 2N4IA 1BIHA 4M48H 2NY4C 1E4XH 4G9DB 1WZ1L 4M8VA 5TE4L 4LKXB 1WWBX 4MD5B 5F9OH 1AFVH 4U3CA 2D7TL 4Z0BH 3S3SA 1H15B 4KJPC 3ARGD 4P5TA 3IDXL 5B8CB 2D31B 4PBVC 4MJ5A 3HC3L 3VFUA 3B2VL 3IFLL 2DM7A 5DFVC 4TRPL 1UXSB 4HKXA 1OTUD 4TUKL 4K7PH 1QPPA 4W6WB 1VEMA 4KI5D 3JV6A 4G7YL 1DUZA 1T0MA 3CFCH 5IVZB 4J12A 1KTLA 3ULVC 4WW1A 2DAVA 3MC0A 5GGTL 4K23H 3HR5B 4BH8B 2CIKA 1RZKC 5IVXF 4BZ2L 1B4JL 4P59H 4YX2L 2ADJB 3BO8B 3VFWA 5CMAA 5EN2B 3BYTA 3BP7B 1OPGL 5FFLA 1QBLL 1RI8A 4KFZC 4U1LA 3G04B 1G7IA 3EYVB 4Q0XH 3V52H 1ZHBB 1MLCA 4YHIA 1ZLSL 3CLFL 4NNPL 2YD4A 3WLBA 2JB6B 4PFEA 2EC9T 4D3CL 1A14H 4U1JB 5TDPB 2CUHA 2EDDA 5KS9B 3FT4A 3DXAD 2OP4H 5EOQL 4ODBD 1F4YL 1N7MH 5ELIA 3K8MA 4FTVB 5BVPL 4P5MB 4QXTA 2AJYL 3QQ4B 4JZJC 2XQYK 4NDMA 4WU7B 5HBBA 4QNPE 3N1GC 4XNXH 1JZ8A 4G6KL 2Y4SA 5IM7A 3EO0A 1JWUB 4PJFA 1YNLL 3O3BA 4HFWB 3VFNB 5DJDA 4JFDA 2WSKA 3EOYG 1VA9A 3LKPA 1A6AB 5F70A 5F7EH 4QF1A 4K9EH 5TQ2H 3ULVE 1S7QA 5IEKA 4XGZB 1GZQA 4ENEC 2Q7YA 4ONFL 4G6FB 3RBSA 3W39B 3KYNB 5IVXB 1RUAL 2NPLX 3GSQB 3X13B 4NHUB 3QH3A 4APQD 3V5HB 1MVUA 1ZEAH 3IGAB 4LF3A 1EHNA 4CJ1A 1MJJB 1F58H 2V2WB 1BD2B 3RGVA 4IMKC 2VDLL 2LVEA 1PW3A 4HWEL 3RAJH 4GJTB 4QRTA 3OX8A 4WY7H 4AEIL 3SKOA 5BMFH 1OB1B 5DD5H 1GPOL 4F8TA 4NQCB 3PQYB 5E6IB 3WHXB 3VDCA 4WFGE 3FQTB 1S5IL 5INCA 2EH7L 4LLQB 4YK4C 4HDIA 4XRCA 1RQ5A 1TENA 2XOTA 2BSED 3KGRA 1K8DA 4RMWA 1UKQA 2V9TA 5TE7L 2WUCL 5I1CL 4JZOB 3SDAD 35C8H 5EUKB 4DKFL 4MCYB 1LE5A 1JFQH 1RURH 4F2MB 2VZ3A 3ARTA 1R3LB 3JBG7 3RIFK 1OHQA 4UILH 5KVGL 4BA8A 5DJ2B 4OGAC 1KTDB 1NBZA 2EICA 3LEYL 3MV7B 2YD9A 3HN3A 1OY3B 4QHNB 2QL1A 3I3DA 1MHEA 2GJ6D 4TULH 4HLZG 4XCEA 5E8EB 5HI4D 2DKUA 3SOBL 5JLZA 4HUXA 4NN7C 3ALWA 3CVIL 4NPYB 3IFNL 3L3DA 1KCVH 3KWWA 3J7HA 4PG9A 4S1RL 1MPAH 2EKSB 3V0AC 5D7KE 1S5HA 4ODVH 4OGYH 3VFVA 3L3IA 2APBA 4ZOAA 1VGEH 1JGEB 2R2BA 1OAXL 2R0ZL 4N68A 3T08A 1RIHL 5LQBL 4MLIA 3NCBB 3L3OA 4HWBA 1AQDA 2A6IA 1XGQB 1YYLH 5ADPL 5IFHL 4KRMB 4XNMA 2ENYA 2VAJA 3O9WC 1M4KA 2NYYD 1U58B 1N26A 4OTXH 3RL2B 5IGXH 5DJ8B 3L3HA 1D5ZB 3PABB 5HGHA 1UWXH 5ETUA 2V7HA 3MBEA 1N2RB 4MA3B 2BXZA 3QXDB 3CXHK 2EIBA 3RWJA 4GBXC 3MRGB 5DUML 5E5MA 4AG4H 5EORH 1F00I 3S4SB 3QUYB 4FABH 5ICYA 1OAQH 1FCGA 2P8PA 3CDGA 3RI5F 4TVSa 3RWCB 4HHAB 4IJ3C 4PD4J 4PPTA 4XPFL 3O6KL 2VDOH 2VJXA 3MRNB 4YHYB 4X6CF 5D5ME 4D2NA 2HFGH 5KAQF 3LKQA 5KVFH 5IV2A 4R7NA 3RWGB 1SMAA 4YJZL 5JQ6H 2AV1A 4OFKA 5HGBB 2X4NB 2NW3A 3HZVA 1JE6A 2H3NB 3VFTB 4M6OH 4P3CL 5KSAB 3A6CL 5E24E 4OKVA 4RMSA 2EE6A 5DK2B 3VFOA 3OKKB 1NAKH 3MXVH 1RULL 1W8NA 3SE8L 4PGBB 5HVWA 3PJSA 1DE4B 1U95A 3QYCA 4W70A 3O4OB 3Q6FA 4HIEB 4MXWH 4HWZB 2AI0H 3T2NL 5FKPB 4Q58C 1D9KC 4M7ZC 4GW1A 4X7TA 3QUXC 4PJ8D 3GRWH 1FRGL 3GRWA 3O4LA 4OSUH 5E8OB 3N1MC 2O61B 3AREB 2VDNH 3MRPA 3EDEA 1OM3L 1UWGH 1NBQA 4KK8C 4KAQH 4AQ1B 4PRHA 1V5JA 4L3EA 5HDBF 3BKYH 4G6JH 2KBGA 1BVKB 4KY1H 4Q9CA 4YIQB 3HE7D 2CK0L 3KYKH 1CLCA 3MRFA 4PJXE 4M8QB 4JPVH 3L1OL 5DGQA 1IC7L 4PY8I 5DXWA 1QLFA 3CPLA 2F5BH 1YMMA 3BQUD 3ZDZF 2AJZA 2GTWB 4XVJL 4UDUB 3TYGH 3P73B 3PP3H 2LFGA 3JVGA 3KPQB 1B90A 25C8L 1ZA6A 4MWFA 3BPOB 4Y5YA 1BOYA 2PW2B 2AGJH 1NL0L 1MFEL 4NKDA 4ZUWA 1KC5L 1VEOA 1CF8H 3BEWA 4LLDA 3M45A 1VSCA 4G43A 1LEGB 3DXAA 3B2UC 1JJUA 1S7RB 2XTLA 4YHPB 3TN0C 1CFQB 3UDWC 3QEQA 4Y16C 3U2SA 1EEQA 5SWSE 4J8RA 1XCTA 1F90H 1CD1B 2NY7H 4NQDB 3V7AE 3SGKA 3VW3L 3KYAA 4I2XE 4YUEL 3L5WB 2ATPB 3V6BR 2ZJSH 5T1DL 5HHXL 4F7MA 4GG6F 4X6DE 4P2RD 5GS1C 4Z7VF 3ILPA 1X5YA 2PCPA 2OI9B 4L29A 2UUDK 3LZFL 4OD3L 3VXOA 2A1WH 5CP3H 1IJ9A 3OAYK 3BSZH 3NN8A 4ZPTB 3UEZA 1I8KB 1NFIA 1BBDL 4S10A 3RWIA 2OS7A 2VDMH 2AXGB 3ZSSA 1G9EA 3U0TB 3C5ZC 3ZDXE 2DWDB 1HIMH 2AEPH 3TZVB 4AT6B 3LQAH 3QUZB 4APQA 1T6VN 3WFCL 5AG8A 3FN9A 2GK0A 3HUJE 1ACZA 4LCIL 1AIFA 5FYJD 1OP5H 1G84A 4JFQA 4YDLB 5ICZA 3P0VH 3VXUB 1NC2B 3H3KA 5KZCD 5F8QC 4U6HA 4HH9B 4QRRE 2MKLC 1LO3L 3FO0L 4P2YA 4KJYB 5CHNA 4WO4A 4WUKL 4LASH 2CKBB 4L8SB 3GMQB 5L0QC 3WS6C 1CGUA 5IHZA 3G08A 2V17H 4JO3H 3IT8D 5EO0B 5JOFB 4AENB 4MJID 1A2YB 3B9KD 5BW7C 1S9KC 2NLJB 4RX4D 4HK0B 4WFEE 3SDAA 2BMKB 1GVIA 1SJEB 4OCYH 5MERA 2GY7B 5T3XD 3T77B 5A2KH 4WHTB 3EJYD 2O5ZH 4BKLB 4GG6B 1GAFL 5JTWA 3EHBC 4LCCC 4Z7VB 3S6CA 4OFYD 1A7OL 4YC2B 2JJUA 2GJ6A 3DX6B 1N8ZB 3G6AA 2BSRA 4LP5A 3L3KB 4OUUA 2HN7B 5A2IH 2NY2C 5IJVB 3ESVF 2MCG1 1BFVH 1U42A 5MI0B 3VFRA 4FS0A 3FCTA 4Q74A 4C83A 5EU7C 1Y6NR 2KUTA 3L5JA 5DJYB 1QLEL 1TXKA 2DQDH 4IOSD 1OT1A 1YA5A 4ZTOH 4LKCA 5E00B 1IGCL 4M3JA 2OJEB 2AXHA 5D2LB 3TT3L 2X4OB 4KDTA 4YXLH 3U0WL 2BY2A 4L4VE 3AY4A 3U6RA 2NY1D 2FGWH 3NFPA 4MB4A 2W60B 4PJGB 4FFWC 3PGCA 3VXPA 4AJ0A 3IDMA 1EA9C 4NNYA 3SJVB 1NPUA 5T33H 4M61A 2R8SH 4LLVA 2HT2C 4G6MH 5BRZD 4P2OA 5FOBA 3QIBC 2VABB 2BRRL 4JR9H 2I26N 2Q3AA 4OFIA 3C6SB 1S9YB 5DK3A 1PYWB 2B1HH 2NY4D 5DJZB 4P2CG 3P30H 4F7PB 2Z91A 4NKMB 4YHKL 4HZLB 4Z8FL 4DZBB 4ODHH 2ESVB 4NZDA 5J6GA 2XZAL 4JREB 1T66C 1O7SA 3IAQA 3QEHB 2FIKB 5GISL 4NN5C 3VRIB 4O2EA 5HY9A 3T0BA 2F58L 2GEEA 3U48A 5DFVD 4Y89A 2K7QA 2JJTC 2IQ9H 5L8LB 5DURB 5C0JA 4AMKH 5EU7E 1NC4D 1LO5A 2FD6H 3STLA 5FO9A 3FB7B 3AS3A 4XAWL 4WCYL 6CGTA 5C07B 4YDVB 3C2AL 5F3BA 4MNQB 1IQDB 4J4PD 3MTRA 5D6CA 1U41A 4B50A 5I1HL 2VXVH 1FVCA 4PJCF 4EBQL 3LHPL 3Q48A 4TTDD 2LU7A 4MAYD 5DEGB 5TDNA 1LHZA 2EDJA 2IH1B 3WJLC 3BP5B 5E94B 3QNZA 1A9EB 1YEEL 2IPTL 4OCNC 2H41A 4J7RA 2F53D 3QDAA 4OCRL 3GSNB 4I18B 3O11A 2XPGB 4HV8B 2IQAA 1MI5E 1KFAL 4AH2B 1EGJA 2JK5A 3WXVL 5GGUB 3G5XA 2VH5H 4MJ4A 4XNZB 3T4AB 3OGOE 5H94B 3ZKSD 3WKML 3WNOA 4GAYA 3LMJH 1BVLB 5I1AA 1I9JL 3VXNB 1RK1A 3ARDB 4N9OB 2MPAH 3LIZL 5CD3B 3DVNB 5IQ9A 1IFHH 3I6KA 3A6BL 1LO2L 3B9VA 2NY0C 4L3AA 3S96B 1YEGH 1NAML 5AZ2H 3ZKMC 1ZA3A 5CIPB 1F45A 2VXQH 4ZOEA 1R24B 3GMOB 4GKZA 4YBQD 4PTTA 4Z7OE 1IGTB 2DTSA 5C09A 4ZFOL 3LPFA 4U1HA 1GJIA 4RFOH 2YUXA 1KGCE 5KSBF 1LK2A 4PUBL 5ENWA 5FCSH 2WUBH 5JUEH 1YMHA 4GRWH 1CS6A 5EDXA 5JW3L 1LVEA 4YZFF 1JZ7A 1F4WL 4XC1H 4WEBH 3DMMB 4K8RC 4LPTA 1V7NH 1JZ6A 1VGKB 5EZLB 4IRJB 2ADFH 2J12B 5IBTH 5EA0L 3MO1A 5GSRA 1J8HD 4NJ9H 4H88L 2O5YL 4PGCB 5IB1B 5ADOL 3UTPE 4WI5A 4K07A 4XH2B 1SJVA 1WT5C 2ZCKL 5F89A 3QFDB 2EDHA 1IAIM 4RQQA 4XCNB 3KPPB 4UDTA 3FAWA 2AW2A 4IRSD 4H26A 4P2RA 3TCLB 2H32H 2H32A 1UQSB 1N4XH 4GKNA 5CSBA 4YDJB 1AR1C 4FQ2L 1OL0A 1LQSR 3Q5YA 5AZEL 2DICA 1HINL 1NCCH 1K2DB 4D9RD 4ONHB 3UXFA 3TFKD 5JDSA 3ZKXC 3DUHA 5EBWA 5AYUH 1RZGB 3IDIB 3WN5C 3RWDA 1CDGA 5EFIB 3LEVL 4PV9B 5F7YC 5IW1A 1Z5LA 4PRPE 1RMFH 4LSRH 4PJAE 5GZNC 5C0RH 3TA3C 4N8CH 4OGAD 2QQKH 3O0RH 5KSBB 5EOTA 3QUMA 3T4YA 5FYJH 1C16B 5D7LD 3WJJA 1T1ZA 3CFDA 2YBRB 5IVOA 2BVPB 3UYPA 1FORH 3HFMH 4XMPL 2VL4A 1YDPA 1MFAH 2B8OT 2MTPA 1FL5B 5CGYD 2HLFC 5KW9L 4Z7NE 5L7XL 2E9BA 4Y5XC 1LMKA 4XHQA 1KN2H 5DWUL 2APXA 4MJIA 2Z4QB 1U3HB 3C60A 1HZHH 1KG0B 3CXHJ 8FABA 4JJHA 3OWEA 5TFSH 5K9JH 4PV8B 1WUNT 5T3XH 3BDBA 4R97C 1EXUA 3EZJB 2D4FA 1P1ZA 3HTLX 2NY3C 4JFPA 2VLRD 2YPLD 2HFEB 3OKNB 4OFYA 4ZO7A 5T5NG 4UQ2B 3MZGB 4GH7B 2FSEA 2W92A 1N6VA 3RUGE 5IFAL 1UH4A 4YAQA 4QRPD 3BH9B 4O4YL 4AL8H 4UV4L 4GBXD 1A9BB 1CE6A 5FKAB 1AGCB 2QKIB 5HHOE 3SO3B 4N1CA 1ZSDA 1MAML 5SX4H 5FK9B 3LN5A 3QJHB 3HNTH 4X6FA 3VRJB 5HSFA 3FOMA 4RAUB 1K4DB 1UENA 4F33A 1EAPA 5T5FL 5D2NA 1CG9B 2XKNB 4ZAKD 4KWUA 4ZS6D 4GKOA 3SDCC 2LQRA 3GUTB 2WAHA 1BZ7A 3I3BA 4IS6B 3ARPA 3IU4H 3VXRE 4NO3B 3CK0H 2DM2A 4Q9RH 4TUOA 1T2QL 3ARBA 2ZG3A 2BHYA 3PL6C 3QDHA 4U7SA 4W4OC 1RIVL 4HGMA 5BRZA 3WD5L 1P7HL 3DHMA 2DQCH 5CCKL 1CL7I 3QXUA 3RY6A 3PWPD 5DT1H 4NJAL 2XTJB 5IHBA 1U92A 4QXGL 2XG5A 1QSVA 3T2OA 1BFSA 2IMNA 2HJLA 1F4XH 3NZHL 4M1GH 4KTDL 3QBTB 3BKJH 4P57A 2EZ0D 4JRYB 2FGZA 5EZOH 3L6FA 1RJYA 2P43B 4OZGA 5CSZB 3NCEB 1OGAD 4MNGE 1MJ7L 1QSEE 3QUXD 1MFDH 3REVB 2JCCE 3MJ8B 3ME0A 1AGBA 15C8H 5FGBA 5F9WC 2FL5A 5EU6D 1AXSA 4EN3C 4KK8D 2P46B 1NC4A 3IAGC 1PZ5B 4PRIE 1SVCP 3BPNC 4PREA 4PRAB 4PJDF 3MLYL 1MHCA 1XAUA 4NGHH 1RZKH 4OM0L 2ITCB 1W72L 4FMFA 5EULV 4J4PA 4MB3A 4KDWA 5CKGA 4P4RB 4MGXA 5SWQA 4MAYA 4ZFZA 3LS5L 3SDYL 4BQ8A 3S3JA 5E2UL 3RWFB 1I8IA 1B9ZA 2IGFH 4KH2A 1BIIB 5C0AB 2QSCL 5CSGA 1FN4A 1OGTA 2DMCA 4MD4B 4NZUL 4JB9L 2X4RB 3MYJB 5LAXB 4UV7H 5C9JA 2YSSB 5BJTB 3QP3A 4NN6B 4L8DB 4OCWL 2UWEF 3DVIA 4MA7L 3ZE2E 3T0VA 1G1CA 4LLMA 5EB9A 1S7XB 2H2SC 2ZCLH 5C3TA 4MQ7A 1K85A 2EC9U 3B2UD 3RY5A 5DMIL 4HJGA 2YR3A 4HIHA 3VXSE 5JW5B 5LGHH 1OSPH 5C0CB 3VXQA 4N0UA 1NMCB 4NCC1 4XVTH 4F7CA 1KUMA 4JZJA 4S0SD 1CFTB 1G6VK 1H0DA 4N9GB 5E95B 5BZWB 2WBJC 1FH5H 3OAUL 2ZPKH 3TBTB 4KRNA 3SKJL 4CUCA 2RFXB 8CGTA 2BNQE 4M62L 5IROC 3QDMD 3PDOB 4Y88A 1IKFH 3LD8B