2W60B

Anti citrullinated collagen type 2 antibody acc4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4
publication title Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B01
5KVGH 2E7LC 1XF3B 5FCUL 4YZFE 4X9GA 4M6OH 1GOHA 2DQDL 2D7QA 3O9WA 4TVSa 1NL0H 4XPAH 3QIWD 4LVOC 4LLQB 1J11A 1OTSD 3RWJB 4E42B 5FEBA 1JWSB 4FXKB 4NZRH 5E6ID 5GRUL 3BPNB 3PNWB 1F8TL 4KQ4H 2I60H 3MRGA 5KS9B 4K7PX 3RVXC 1JNHA 4X99B 5MP6H 2FO1A 3ULSB 1QEWA 5MERB 1F6FB 3GK8L 1BZ9B 5JHLH 3HZMA 1DDHB 1RI8A 1DZBA 5I6XC 4F33B 2EE3A 3AGVA 4OI9A 4OIBA 3R06B 1T1ZB 3D9AL 2F9BT 1U9KA 1LO4L 4F57H 3NCCB 1DQDL 1OLZA 2HJLA 3PJSA 4XAWL 4M48L 1R5WB 5IF0B 2VO5A 1KELH 2MCG1 5E2VL 5CZVL 2W9EH 2XQYK 4LARH 4QRPD 4OD1H 1JFQL 2PW2B 3O6FD 1NCBH 4JO3L 2KDGA 4Z77A 5I1LA 5FXCH 5I8OH 5LXGH 1YEHH 3REVB 1LP9E 3BIKA 4POUB 4Q0XL 4MAUL 4TNWF 5FCUH 4XXCA 2E9WA 1T0MA 4Y4FB 1UM4L 2YMXH 2N7BA 1BAFL 2DQDH 3MLYH 4XC3L 4OGAD 2DD8L 2A6JB 1GJIA 1CT8B 3F62A 3P9MB 4X6DB 2BNRE 1LEIB 3AXLA 3QIWA 1F8TH 4PP1C 5FO9B 4XPHL 5E6IA 3QULB 1EO8L 1PEZA 3T8XA 1I8IA 3CFEA 1YMHA 4KRPD 1A6AB 1P5VA 5ENWA 2VLJB 2AW2A 5JNYB 1JF6A 3HG1D 3S34L 3D9AH 1DLHB 3QUZA 1DQDH 1CGSH 4XAWH 1U8NB 2GW5A 4M48H 3UTQA 4KMQA 5E2VH 3SPVA 2FSEB 5EIIA 5KSAC 5CZVH 2AK4D 3FQUA 4JO3H 1YJDC 5H35B 2ATKB 4P3DA 5GSRA 2HP4A 2HFFA 4P9HC 1NAMB 2DRUA 4QKXB 4OF7A 4QRPA 1CDBA 1LD9B 3MLRL 4MAUH 3O6FA 1VEOA 1UM4H 1UVQB 2BVOA 3G6JF 1CD1A 1BAFH 2E6PA 2HA1A 5D72L 1AE6L 1IAKB 2QKIA 3HB3C 4Q7DA 4KKAC 1HQ4A 4N0CD 4JJ5B 5H94B 4D0DA 1SJHA 2VL5A 4KAQL 1JPSL 2BVYA 2W0FA 3EOAB 3JWOL 3MJ9L 5SX4H 1I8LC 4LRIA 3S5LG 5FB8A 1DBAL 1N0LA 5F6HI 3ISWA 4XPHH 4PREB 3RWIA 3KLSA 1JNNH 4NWTL 4L8DA 3HZKB 4RAVA 2B5IC 4JDZA 4MJ5B 4M61B 1CXEA 1AKJB 1SEQL 3W9EA 4UZGA 3S34H 3RQ3A 3VRIA 3I6LD 1I3UA 2I07A 4LCWD 4GRWH 4Z7UB 4ISVB 2YD1A 5FKAB 3VFGH 1IZKA 3G5YA 3BEVB 3HG1A 2FECI 3M8OH 5ADOL 1LEGA 5TQ0L 4NBYB 2GITB 2JCCB 4LSTL 4YDLC 4XGZA 2YUWA 3MLRH 2AK4A 4Z18A 3ZDZF 2M8XA 1QBLL 2AABL 5D6DC 1LO0L 4YR6A 2EZ0C 4QF1B 4BFIA 1CWVA 4JY6B 4P57B 1AE6H 2DJ4A 4IMKA 5D1QD 3ETBF 3S3JA 5JMOC 2W65A 3D0LA 2CIKA 4KAQH 2XG4A 1JPSH 3VXPA 3JWOH 3MJ9H 4F80A 5I30L 4ZNCD 4R2GB 3O9WB 1DBAH 4Y4HD 4X4YB 1IT9L 4OM1H 4ZUSB 5E7FA 3DV6A 3LDBB 1HDMA 3ULUE 3MRGB 1SEQH 1JNHB 1U3HC 1QEWB 1A8JH 3HZMB 3V95A 2ED9A 4HBCL 3BDBA 5ADOH 4LCWA 3SDAC 1FGVL 3DYOA 3I3EA 4LSTH 1J8KA 3PJSB 2HJLB 2AABH 1LO0H 1TQBC 2CMRL 3QDJD 1NCWL 3IF1A 1QSFE 4JG0L 4Z77B 2IPKA 2V2XA 5I1LB 3AY4C 1U6AL 4HUVA 4EI5D 3FB8A 5GZOC 4C4KO 3BIKB 5EA0L 1VKXA 2CXKA 1GGUA 1T0MB 1T0NA 5D1QA 4N8VA 4P2YA 5I30H 3O4OB 1IARB 4LSUL 4WENB 1IT9H 1UADC 4NN6C 1KTKE 3RVUD 4XTRC 1X5FA 5T5NG 3O2DL 4Y4HA 3AXLB 3U9UA 3QIWB 4MWFA 5EBMA 2Z93A 3MZTA 1I7ZB 1NGYA 4GJTB 5E6IB 4R7NA 5KANI 3BP5A 2A1WH 3T8XB 1I8IB 3N1FC 3CVHB 4GFTB 1DCLA 3CFEB 1YMHB 4HBCH 2YZ8A 5ENWB 1OPGL 1FGVH 3BZEB 3G6JA 1TTFA 2N7AA 2ZZUT 4I9WE 4MA7L 4MD5A 2WWMC 5GQBA 4DK6A 3UTQB 3IT8D 1G7MB 3L9RA 3SPVB 5EIIB 4MVBC 1NCWH 4LSPL 4JG0H 2NY6C 3FQUB 4P3DB 5GSRB 3BD5A 4F2MA 2HFFB 2FHCA 5EA0H 3O2DA 4QRPB 4GXUN 3O6FB 2BVOB 2WANA 1CD1B 2MKWA 3IJSA 2QADC 3H2WA 2CLVB 3ARBD 4EI5A 4HK0A 4NO3A 1KCKA 1NGQH 2QKIB 3X12A 1HQ4B 1A14L 4WHTB 3DVNB 1K6QL 4TPRL 5D7JC 4D0DB 5GGUB 5F9WC 1SJHB 2A0LD 2VL5B 4HV8A 5B39B 3PWVA 4OI8A 2W0FB 5DHVH 5EBWA 1OF2A 2CRIA 1JCKA 1O7SA 4PJ8C 1KUMA 5FB8B 5I1GH 5IOPA 3RWIB 4L8DB 1X4XA 2A6KB 2P8LB 4IIQC 4RAVB 3O4LD 4S1RH 4JDZB 2OK0L 4FFWD 1OPGH 3KPMB 5HPOA 3DO7A 3W9EB 3VRIB 3OB0K 1GPOL 4KRPB 2B39A 2WWKO 4LP4A 2C4FT 4MA7H 3G5YB 1E4JA 3HG1B 1QPPA 5T3ZD 4LSPH 1LEGB 1JTTA 2GCYA 3LS5L 4Y0GA 2FH6A 4X8XA 4HEME 4AQ1B 2VLRE 4JZJA 4I13B 1Z5LA 3O2WH 4XGZB 2AK4B 4JM4L 2RAMA 1YY9C 4H1LA 4YR6B 4BFIB 5TPWL 1NCUA 1TENA 1A14H 5I16A 1K6QH 4TPRH 4WWKC 3ARBA 4Z7NF 3MQIA 2DN7A 1Q9KA 5T3ZL 2K7QA 2W65B 3D0LB 3FO9A 4MZ2A 2CIKB 3AMKA 3BGAA 1KT2A 3DV6B 4N5ED 1EX0A 3NCBB 1HDMB 3GHBL 2OK0H 4PJIE 3CPLA 1GPOH 3O4LA 5DUML 4RX4D 1A7NH 2C4XA 1QHOA 4L8SC 4M3JA 3CIQA 4M7ZC 5FA4A 4U0RC 5DRZA 3B83A 3OKNA 2A73A 3JSSA 4LCWB 4G6FD 3K1KC 3IDNA 3RHWF 5DHXB 5FYJU 3BPLC 4MS8D 3KLHC 1MEXH 4IRSD 3FB7B 4YFEA 4JM4H 4NGHL 4F9LA 1R0AL 3PP4H 4WEMB 4IHOA 2X44D 1VFAA 4KTEL 3ORJA 3JBG7 3F7YB 5TPWH 2Z91A 3IF1B 2BSRA 2BY3A 3BPOB 4PV8A 2IPKB 2V2XB 4XWOC 4HUVB 1H3UA 3FB8B 1ZHNA 5AZ2L 5T3ZH 5DSCA 1ZVYA 5LKNA 1VKXB 2V5SA 3B3IA 1P84J 1T0NB 5D1QB 4N8VB 4Q6IA 2WK2A 3WFBL 3LKNA 3VJ6A 2NY2D 3NA4A 3GHBH 4U33A 4Y4HB 3U9UB 1U93A 4MWFB 5EBMB 2Z93B 4WI3A 1FLRL 2IG2L 5IHUL 1MCHA 2AP2A 1G0DA 1NGYB 2EDEA 5DUMH 5HD8D 4GAGL 4R7NB 3BP5B 3NPSB 1NLDL 1A1NA 2ZCLL 4ONGL 4RX4A 3QI9C 1WWAX 3G6JB 4OZFA 4XNZC 4MD5B 2I24N 4NGHH 5KBNC 4GKOA 3V6ZA 4KTEH 3L9RB 2QSVA 1YEJL 4IRSA 1F97A 4PGJA 1TNMA 2H2PC 1CE6A 4F2MB 2VERN 5AZ2H 3QDJB 1JPTH 3UAJC 1D9KD 1YPZE 2MCPL 2EICA 3SO3C 3AS1A 3AAZA 3IJSB 2HRPL 4QHNB 4EI5B 4HK0B 5I1KL 4MDJA 3WFBH 3HI1A 5J56B 3X12B 4WUUD 4LP5A 4R96A 5GGVY 3BE1L 1XIWD 5INCA 3KYOA 1OF2B 3V0VB 2IG2H 1FNSL 3IYLW 4WI6A 5IOPB 4GAGH 2WV3A 1NLDH 4AEFA 1XGPA 5D93C 3VGDA 1LEKA 1U36A 3D87B 2DL9A 4R8WL 2M26A 2WBJD 1PZ5A 3DO7B 1VESA 1NKOA 1VEPA 1KJMA 1U8IA 4Z78B 2CPCA 3GJEA 4LFHD 3WNPA 5DI8A 1JMXA 5DVLA 1MY7A 1FZKA 4YO0B 1OTUC 3B5GA 2OR7A 4W4OA 2GCYB 1CGWA 1MLBA 1H15A 4JZJB 5CEXB 1Z5LB 3E0GA 4UAOC 4KJQC 1IQWL 4U1MA 4XP5L 2E7BA 2HRPH 3EJJX 4H1LB 2FO4A 3GSWA 4FFYH 3SGKA 5I1KH 1TTUA 3RY6C 1WJ3A 1JWMA 3FKUS 4FQ1L 5H37G 3DJ9A 3OGCA 3ARBB 4HHAA 1Q9KB 1JHKL 3FO9B 3VGFA 2C3GA 2CIIA 1GGTA 2BSED 3UYOD 2GSIA 3DNKA 1FNSH 1KT2B 4MZ3A 4JFZH 5MEOA 1XIWA 5FYKD 4DQOL 1BQLL 3LRHA 1U8PA 4RRPG 3UDWC 1NLBL 4R8WH 4IM8A 5HJ3A 1K4CA 2DWEA 3CPLB 2ARJA 3O4LB 1JI1A 3VXUE 1FVEA 4M62L 2WBJA 4ZXBD 2X7LA 2YXMA 4P49A 3SGJC 5FA4B 1XCQA 5FDWA 5DRZB 1D7FA 2MFNA 3OKNB 1CDJA 2A73B 1EO7A 4I3RH 3IDNB 4QO1A 2KZWA 5ID1A 2CQVA 4F3FA 1H9VA 3HC3L 2BSTA 4Z7QF 5IJKC 5C0ND 4YBLB 5FHAH 1IQWH 4XP5H 4IHOB 3JV6A 1YNTA 4JQVA 1VFAB 3EJYD 1ZT1A 4M8QB 3GNML 1KGCD 2ORBL 3AMLA 3BWUC 2VQUA 2Z91B 4FQ1H 2BSRB 1NFDE 1NMCB 4PV8B 5JW3L 1ZHNB 1OAXL 5DEZA 5DSCB 1JHKH 3B3IB 1QOKA 4QTHA 4OCMC 5IROC 1IEAA 2OTWA 4Q6IB 2HFEA 4JVPA 1HIMH 4WFGE 3VXRA 4M6NL 3LKNB 2GTZA 1C5CL 3NA9L 1X5XA 1YUHA 4E41E 3UTTE 5LG1A 1YECL 2UZIL 1U93B 3IDGA 5F9OL 1RZ7L 4I18A 3ARWA 2XG5A 5E4EB 2ADGA 3LSOA 4M62H 3ZKMD 1A1NB 4D9RD 1IAII 4XVUC 3QH3A 4LIQE 4ZXBA 5ACLA 4OZFB 3IDXL 4XBEL 1I4FA 3HC3H 5L0QB 4JPWL 4G6FB 1VACA 2BNQD 5F7LB 1CDCA 4HUXA 3V6ZB 1ZLWH 5DFVD 4IJ3B 1T7WA 2ORBH 5EU7C 4IRSB 2NR6D 5JW3H 1KIQA 3B4NA 4WU7A 3IB4A 1CE6B 1M7IA 3PDDA 5BO1L 2DIJA 1OAXH 5JXAL 3BXNA 4RDQF 5GS2H 5GHWL 2CO7B 5L9DL 3AAZB 1QLRA 1H3TA 4M6NH 4MDJB 3HI1B 3BZDA 5KG9A 5FFLA 3NA9H 4DUVA 3MNZA 3RUGE 4R96B 1MHEA 5SX5H 1PSKL 1IL1A 1YECH 5EB9A 2UZIH 4L3AA 5INCB 2XTJD 4PJFA 4PD4K 5I9QB 2NY2B 1RZ7H 1S3KL 1UB6B 2EDWA 3SKNA 3I50L 5DMGC 3MXWH 1OP3K 3UCRA 1HE7A 2WIMA 4O2CA 4QRUB 5AYUL 1XGPB 3QNXA 4K7PL 1RUAL 1VHPA 2FATL 3UJJL 1M7DA 1PZ5B 3IDXH 2VDOH 1IGIH 1KJMB 4JPWH 4B50A 3GSUA 1BQUA 3SDXE 2R29L 1KPRA 5DI8B 1INDL 3W9DA 1CL7I 2WUBL 1FZKB 2WWKT 4QXGH 3EYOA 3F58L 1YJDL 1MI5D 4X5WB 2BNQA 2WLZA 2C26A 3FMGL 5BO1H 1R3LA 1H15B 4NSKA 4AIOA 1FRGL 4PJCE 1EFQA 3PXHA 4U1MB 5GHWH 4J8RA 1FFQA 4U2ZA 2FO4B 3GSWB 3DRTA 1J9CT 1A9EB 2D9QB 5BQ7A 1D9KB 2MWCA 3OGCB 4JFQA 4HHAB 3I6GA 4ENEC 1QZ1A 2CIIB 4WUUB 5IBTL 1G7HA 3VD7A 1S3KH 2GSIB 3I50H 4KGLA 4J3XA 5MEOB 1ZVHA 2W9LA 1XIWB 5DWUL 3F65A 4DK3A 2J7LA 2E8YA 5D1ZA 1U8PB 2VZTA 4PYHA 5AYUH 4Z8FL 4K7PH 1RUAH 3UEZA 2FATH 5FCSH 1C12A 3NFNA 4OB5L 3UJJH 3RGVD 5HJ3B 1WBZA 1K4CB 2DWEB 1RZFL 1KJVA 2ARJB 3SKOB 3ARGC 2HTKC 4CGTA 1FVEB 2R29H 3PGFL 2WBJB 1INDH 2X7LB 5FDWB 1TZIA 1UZ6E 2WUBH 4ZFOB 5AAMA 3IDYC 5SWQA 3ZKND 4RBPH 3F58H 1YJDH 3GBLA 4Q9RL 4P9HH 3FMGH 5ID1B 4NOFA 1RVFL 2BSTB 4U7MA 2CR3A 1MI5A 1IVLA 3OXRB 1TQCB 3JV6B 1YNTB 5F6IB 1CCZA 1ZT1B 2VSCA 5DJ0A 5K9OA 3MV9A 2VR4A 1G9EA 1X5GA 4HUKB 4P2QD 1KBGL 2F54D 1MCPL 4DTGL 1WBXA 4RZCA 4QTHB 4RGMC 2IMMA 3FZUD 5IBTH 5FYJE 4F37F 1IEAB 2OTWB 3QUYC 1V05A 2HFEB 4PY8J 5ICZA 3DX9A 3T0ED 5HYJE 1T7ZA 2GTZB 1YUHB 3V4PL 4Z8FH 4G6KL 2DQEH 4OB5H 4LSRL 3IDGB 5J4MA 4OV5A 2FR4A 4I18B 1X7QA 5D96B 1YN6A 2NQCA 2ADGB 3LSOB 3RGVA 3PGFH 4G7VH 5ABDE 3WFDL 3U2SA 3QH3B 4Q9RH 4I0PC 1ZGLM 3ESVF 4ZXBB 1RVFH 2QJDA 4PBWD 2P43B 5ILTL 1VACB 1OP5H 5B21A 1IGYA 4HUXB 2YK1L 5F9JA 3CFCL 1P6AB 1U8HA 1KIQB 1KBGH 4WU7B 5D7IE 5JORA 1M7IB 3K1DA 1MCPH 4DTGH 1YMMD 3DETD 2XN9D 3BXNB 3UBXA 4P2QA 2QQNL 3TCXA 3JV5A 1QR1A 2F54A 1QLRB 3VXOB 1X5AA 3S4SG 5KG9B 1T5WA 3B6SB 4D8PA 3MNZB 3HAEA 3QZWA 3V4PH 3T0EA 4G6KH 1IL1B 3L5JA 4P23C 1RAMA 4P3CL 4PJFB 1VFBB 4OTXL 3S97C 5TE4L 4YHPA 3QPXL 1QP1A 2OCFD 1Z9MA 4HWZB 1CQYA 4P2OD 4O2CB 3VXSE 5JOFA 1KOAA 3HAEH 5ITBL 4WO4D 3QNXB 4LASL 5CKGA 1M7DB 3KPTA 1GGCL 1JP5A 2ZG2A 5FOBA 5BVPH 3NCFB 1NQBA 4BSJA 4PR5A 3HPJA 5ILTH 3GSUB 1KPRB 3W5NA 5CILL 3W9DB 2YK1H 4S11A 3CFCH 2V9QA 2BNQB 4F7CA 1OD9A 1R3LB 4NSKB 2EDOA 3DX8A 2NTFA 4U1LA 4J8RB 1BJMA 3VI4E 2EEDA 1E4KA 1YMMA 3DRTB 1RPQA 2XN9A 5BQ7B 3LZFH 4NNXA 4JFQB 2DMCA 3WLWD 1EA9C 2G9HA 1K3ZA 4P3CH 4OTXH 2E7CA 3QPXH 1BWMA 3TYGL 3BYYA 2XTJB 3HCVA 4JY5L 3HLAA 4G8EA 2AJSL 4NNYA 4HKBA 5ITBH 1SQ2N 4LASH 1C12B 3NFNB 4XI5D 4JQXA 1P9MC 3I3DA 4P2OA 2JE8A 1BD2E 1A64A 1KJVB 4WO4A 3PGCA 4G80B 1LDPL 4O58H 1WT5C 5CILH 1Y0LA 5KVDL 1TZIB 5E2TL 2C3WA 3OV6A 1JJUA 3U48A 4AIXA 5DT1L 4Z76A 3SE8L 3VMOA 2P42B 3VDAA 2EECA 4XBGA 3QRFM 4PGZA 1MI5B 1HYSC 2BSSB 2OJZL 4LQFL 3TFKD 1GZPB 4OJFL 5DJ0B 5HHVL 5JHDA 5K9OB 3J7HA 4WI2A 1LO5B 3MSPA 2FLRT 2B0SL 1AXIB 1WBXB 4RZCB 4FFVD 5DJCB 2F58L 4KJPD 1S7TA 2VABA 5ICZB 3DX9B 1UWEL 3TYGH 4ZPVA 4JY5H 2AJSH 5ERWA 2CRZA 1U91A 3TLRA 4OV5B 2FR4B 2BVTA 2GK0A 1X7QB 2AJVL 1LDPH 1YN6B 4HIHB 4NFDA 5KVDH 2CRMA 3U2SB 3FT4A 3MCLL 1XR8A 1OARL 5DT1H 3SE8H 3QEUA 1CFNB 1PBYA 1H8NA 2LV4A 1IGYB 4EDXA 4LQFH 2OJZH 3NIGF 5F9JB 5HHVH 1BFTA 1R24B 5DMIL 1U8HB 1DL7H 1I1RA 2FBOJ 2B0SH 4XHQA 3EFFA 3QQ9C 4PLKD 5JORB 1EEUA 3E3QE 3E6FA 4M6ML 4PJXE 4ZAKC 2HH0L 3UBXB 2F58H 4P2QB 1AR1D 2YD7A 5E2UL 1QR1B 2F54B 2D7MA 5JA8B 4G42A 2J12B 1T5WB 2Y7QA 4D8PB 3ARZA 3HAEB 3QZWB 3T0EB 1A7PL 4O02L 2BHYA 3UYRL 5EO9A 2AXJA 3FRPG 4R90L 1MAKA 4YHPB 2AJVH 1RZGA 1IBGL 4HPOH 5GS1A 5JOFB 2VITA 3IJYA 3TYFB 2C9AA 4GSDL 1EGJA 3MCLH 4ZO8A 1CXLA 1EHLL 1OARH 4BUGA 5FOBB 3GKZA 4NN7C 4GT7A 4LVEA 4LQ1A 4PR5B 3HPJB 4BSVA 3D18A 2RCSL 5FYLL 4TUOA 1AD9A 3DARA 4RISL 4F7CB 5L2KD 1V3LA 3GMNA 4M6MH 4JZNA 1A9BA 3MUHL 3DX8B 4BZ1L 2NTFB 2HH0H 4U1LB 1DQJB 1A6UL 3MA9L 5E2UH 1YMMB 3B9KC 1U2HA 2XN9B 4XMKL 3ILQC 4OCWL 4NNXB 3P4LA 4KK9D 1CGVA 2Q8BH 3RDTD 1Z9OA 3P40A 4NZTL 1SYSA 4O02H 3UYRH 1G9MC 5FGCB 4PJ7A 4R90H 5C0BD 3K46A 1FFPA 5F3HA 5F7WC 3NMEA 3WUWG 3HCVB 4WHYH 1IBGH 2AEPH 2APXA 3HLAB 4G8EB 4JGMA 4JRXD 4YDIL 2AEWA 4HKBB 2CO6B 3Q5YA 3SGEH 4GSDH 4M7LT 3HC4L 4KZEL 4P2OB 1WFUA 3QXAB 4WO4B 3WEXA 1UM5L 3PGCB 1MCBA 1J7VR 1TZGL 2RCSH 2D4DA 5FYLH 5C7XL 1Y0LB 3QUMB 3LH2L 1FORL 3K74B 5CS7A 4RISH 4WTXA 3TBSA 4Z76B 5JIKA 1MHCA 4LPXA 1N64H 1XCTA 4XBGB 3WLBA 2BNUA 2YKLL 2D3VA 3EGSA 4GRLC 4L4TD 3VGAB 5A2FA 5L2KA 3WFCH 2VNCA 1MCCA 4XMKH 4OCWH 1MREL 2IQAA 4WW2F 2DBLH 4NZTH 5E1AA 2DLHA 4PG9A 1S7TB 3RDTA 2VABB 2YA1A 1XR9A 4ZPVB 1BVLA 3VRLF 4YDIH 1B0GB 5ERWB 5C0BA 4P5KA 1CDYA 4PY8I 3HC4H 1U91B 4EXKA 4KZEH 4RMVA 3ZTJH 4XP4L 4JRXA 3INUL 1UM5H 3Q0HA 3CMOL 3WN5A 4NFCA 5C7XH 4AMKH 5HYEA 1RQ5A 1S7VA 3LH2H 5DMKA 1FG2A 1XR8B 4JHZA 4KMTL 4MXWL 4NO5A 4HCRL 4XX1E 5K59F 3QEUB 5DZOA 1RHFA 1HEZA 2CDGA 1OB1A 2BRRH 4EXPX 2ED8A 2YKLH 4EDXB 2GAZA 3UPAA 3H9SD 1QSEE 4N90E 2EXWD 3EFFB 4L4TA 1MREH 3FQRA 3E6FB 1I7UA 4Y5XC 1A7OL 1Z0MA 5F1KC 4C58B 2ZUVA 4GG8A 4G42B 1KTDA 1ACYL 2Y7QB 2Q76A 4HPYL 3MRLB 5T5NF 3GO1L 1OQOA 1H8OA 5EO9B 1SY6L 1J87A 4K71B 4WGVB 1YC7A 4ZYKA 4PIRF 1FYTD 2CKNA 1UZ8A 1D5IL 3RNQA 1RZGB 3CMOH 3BGFB 1FNGA 5GS1B 1TVHA 2VITB 4LDLB 3IJYB 4X6BB 5DRWA 3LKSA 3GMQA 3S35X 1GGBH 5EZIH 3K0WA 4KMTH 4MXWH 3QFJD 4HCRH 1EHNA 2E9JA 5D4QA 1DSFH 4BSVB 1J0KA 5DLML 4P5MA 4MAYD 4LCCC 3CFIC 3UTOA 4TUOB 3WIIL 1AD9B 3AM8A 4XVSL 1RURL 5IWLA 1RULL 2FLBT 3GMNB 4UQ2A 4JZNB 4NP4L 1A7OH 3H9SA 3S5LA 4XNMA 1SY6A 3VFWB 5HVWA 2NYYC 2WQRA 5BW7C 1YQVL 4LVHB 1OGTA 2LU3A 3VI3E 1ACYH 5L2JA 2ZG1A 4A6YA 1SYSB 4NUGL 3GO1H 3DMMD 5CBEB 4PJ7B 2AGJH 3RWFA 5HPMA 1FFPB 5F3HB 4ZTPL 1ZT7A 3MRDA 1D5IH 3CFJB 3MNVA 4BJLA 1FYTA 5DJ8A 3O3BA 4KJWD 4BZ2L 3MJ8A 1XF4A 1IM9D 4KROD 1O5DT 3ZHKA 2IFFH 5KSBE 1KB5L 3WEXB 3WO4B 3BN9C 2ZUTA 4KI1A 3L3DA 5DLMH 3QFJA 4WW2A 2YN5A 1Q72L 3WIIH 4XVSH 4FQHB 1HQRB 2IF7A 4O2EB 4KRNA 1A6TA 3SO5A 3Q6GL 1RULH 1JWUA 4MAYA 5E5UB 3TC9A 3TBSB 4MJ2A 1XCTB 4LCUA 4NP4H 3WLBB 4ETQA 2APWA 2BNUB 1LILA 1DBBL 1DVFD 3EGSB 3FN9A 5L2KB 3CFBB 4LSDA 4U05A 4ELKB 2QQKL 5IM7A 1KENL 4P2CG 1JI2A 4NQTA 2IQAB 3PWPD 5TF0A 1OTTD 4ZD3L 5DD3L 1WITA 5I1DA 5E1AB 4PJGE 5E8PA 3V6BR 4NUGH 2FIKA 5CP7A 4KDVA 4G9FD 4PG9B 4DKEL 4W68A 1F4WL 3RDTB 2XZQL 1Q9WA 2YC1A 5F7MC 1XR9B 3DMMA 4HIIA 4R26H 1BVLB 3CVIH 5C0BB 2GK2A 4OZHE 2F5AL 5JXED 2NX5E 4P5KB 5IFAL 3TN0D 5JR1L 4JRXB 3NIFF 3TZVD 3DUSA 3TO2A 1KB5H 4LF3A 2YN3A 2D03L 3RY4A 4AZ8A 4BQCA 3WN5B 4V1DE 5C92A 1S7VB 5DMKB 1FG2B 3Q6GH 2FL5A 4NO5B 3KPSE 5DDHA 4PYGA 1DP0A 1MCLA 4OZIF 1HEZB 2CDGB 1BP3B 2PNDA 1OB1B 3T1WA 1F3JA 1DBBH 4FTVD 1MFEL 3H6JA 2GAZB 4F9PC 5B4MD 4K2UL 2KPNA 3KPRE 1KENH 2EO9A 2ICEA 3SKUD 2PETA 4L4TB 1YNLH 3FQRB 3L7FA 5FDYA 1I7UB 1IGML 1NEUA 3IVKB 4NJ9L 4GKNA 4DKEH 3PWPA 1F4WH 4GG8B 3K4AA 4M4RA 2XKSA 4PJ9C 2BXYA 5AG9A 1BJ1J 2GJ6D 2MSPA 1KTDB 3DV4A 4G9FA 4XNYL 4L29A 3FTGA 4NQCA 2Q76B 2J8UE 4UIMA 4K3EL 5I75B 5IFAH 2P5WD 3RWEA 3UC0L 3CZFA 4RFNC 5JXEA 2PO6D 2D03H 1UZ8B 3RNQB 3TN0A 1FNGB 3TZVA 4HH9A 5C6TH 1TVHB 4U6YA 5DRWB 1RD6A 1WSST 3LKSB 4PRID 3GMQB 2OLDA 2Q86A 4JJHA 2RQ8A 4KC3B 4X0KA 1T2JA 3RPIA 1LQSR 5DK0B 2R2EA 4HMEA 3UTPD 4FQCH 1S7QA 4P5MB 1MFEH 3LHPL 3C09C 3LQZA 4KDTC 4IOFC 4MQ7A 3TWCL 3ZE1E 5A2KH 4FTVA 4IMLA 2ED7A 5IQ9A 3HFML 5JDSA 3L3KA 4UQ2B 4IS6A 3H9SB 3S5LB 1HHJA 4NJ9H 5C0AE 2CDEA 3MV11 5A2LH 1BIIA 3GDBA 5TJWK 1SVZA 1OGTB 1UWXK 2R69L 4UV7H 4NQEE 3UXFA 4HJJH 4XNYH 3GSRA 3DYMA 2YSSA 2P44B 4A6YB 3HUJE 5EULV 1ITCA 1OP3H 3GJFA 1D5XA 2F53E 4OBRA 4K3EH 3UTZA 4JREC 3RWFB 3UC0H 1FSKC 5HPMB 1R5IB 4GG6F 2RFXA 4WUKL 1ZT7B 2EH8H 3MRDB 3ZE0F 1INEL 1WVZA 2P5WA 4JFFD 3MNVB 4HIEA 5HYQA 1FYTB 5DJ8B 2PO6A 3O3BB 2VDNL 3OKEA 3MJ8B 1XF4B 1DJSA 2OSLA 3S36X 3VFTA 4AENA 4CNIA 2AERT 5DYOA 4PRIA 4GO6B 4C55A 3L3DB 4DN3L 1NFKA 3QFJB 4WW2B 3LHPH 5KVEL 5MHSD 3CXDL 3TWCH 1CQKA 4R4FL 5EZOL 1AXTH 4M5ZL 1A6TB 3EO1A 1YEEL 1JWUB 2Y72A 4MAYB 4H20L 4OZ4A 3HFMH 4ODHL 4J4PD 3P73A 4LCUB 4F7TA 4ETQB 5GZNC 1JPFB 4PJAF 2OXHA 1JZ8A 5JDJA 5IM7B 2R69H 3RKDD 1K9TA 3TT1L 4PG2C 4G9DA 2CUMA 1O7VA 4KK5C 4Y4KD 2EDJA 5I1DB 5E8PB 1GXEA 5J12C 2FIKB 5CP7B 1P7KA 2APTA 1F02I 3GM8A 5SWSA 1Q9WB 2YC1B 4HIIB 4H5SA 4WUKH 5BS0A 3L1OL 1INEH 1NUDA 5HI4D 4UI2A 2W59A 1WAAE 2QL1A 4OZIA 1RZ8A 3QIUD 2IAMC 2VDNH 4N8PA 2BRQA 4JFFA 2QQLL 2FCBA 3DUSB 3TO2B 4LF3B 2FDBP 1IM9B 3LD8C 4DN3H 4KROB 5KVEH 3CXDH 4R4FH 5EZOH 4M5ZH 3T08A 1H8SA 5J57B 1YEEH 2FL5B 5DDHB 3O0RL 4H20H 4HKZA 4YBHA 2LABA 4ODHH 4YGVA 1G9NC 2HJKA 4S1DD 2BDNL 1P4IL 3OG6B 1OM3L 1LE5B 1ORSA 4J4PA 1N4XL 3EO9L 2ICEB 3TT1H 1DVFB 3AB0C 1MCKA 5FA3A 4XXDA 2WIIA 3L7FB 1DQQA 2BVUA 5DHYA 1Q38A 1ZS8A 4GKNB 3PWPB 4ZQKA 5C0FB 2BMKA 4Y4KA 5IBUG 5F21B 1BBJA 4YHKL 3DV4B 4G9FB 1JPST 3L1OH 2VXVH 1T2QH 4L29B 4OF8A 3FTGB 5DVMA 4ZMAT 2F5BL 1BBDL 4P99A 1QFOA 1U8OA 4UIMB 2OYPA 2V5RA 3FN0L 4WW1A 1HINL 3RWEB 2QQLH 3CZFB 5I74C 1HSBA 3HRZA 3QIUA 1OW0A 2R1YB 1J18A 4DZBA 3TN0B 3TZVB 4H26A 4HH9B 1ONQA 3HR5A 4U6YB 3BP4A 2MKLC 5DQ9A 2Q86B 2OMBA 3O0RH 2R2EB 3MO1A 3CUPA 1S7QB 5IEHA 5CD3A 2BDNH 1YNKH 3SQOL 3STLA 2FBJL 3MRQA 3LQZB 1UCTA 3ARQA 1OM3H 4MQ7B 4F15B 1N4XH 3EO9H 2VUYA 1FH5H 2DF3A 4FTVB 4IMLB 5IQ9B 4Y19D 1CXFA 4R7DA 5JDSB 3L3KB 4U1GC 5D1XC 4GG6A 4CMHB 1HHJB 2RBLA 4IRJD 4LGPB 3HNVL 2CDEB 3F7PC 1BIIB 3N50A 4PGEA 2BERA 4YHKH 4E5XA 3GSRB 3WNOA 2YSSB 2F5BH 3QUKA 1NC4D 2GJ6B 1D5XB 3GJFB 4R4BA 5GS0C 3FN0H 3UTZB 2R9HC 3NCYS 1JYNA 1HINH 3OTTA 5D7LD 3QDME 5C0RL 1SVCP 2RFXB 2MQ3A 2P5WB 5A3IC 4HIEB 3V0AC 4AY0A 1MCNA 4GBXA 3F5WA 5E9DD 4MNQE 1MCDA 2PO6B 5FO8A 1ZE3C 2AVGA 3OKEB 3C5JA 2OSLB 2J6EL 3VFTB 4AENB 4CNIB 4RAUA 5DYOB 4PRIB 4EJ1C 5EO0A 3TJHD 2X09A 1FFNA 3RVWC 2F19L 3SQOH 2FBJH 5F1OB 3VD4A 3UJTL 3EO1B 1QUNA 4WV1C 2HJFA 4OZ4B 4HQQH 1BX2A 1QRND 4F7TB 4LGSB 4Y19A 3HNVH 4GMTL 1A3RH 4KKLC 4RRPA 4IRJA 5C0EA 1PKQB 6CGTA 4G9DB 3O6KL 3U9PL 2IAND 2XQBL 1RJZA 1P7KB 1A7QH 4V2CB 5C0RH 3OJ2C 1NC4A 1OHQA 4NN5C 4H5SB 2HT4C 5IVXE 2XA3A 5D7LA 4OZIB 1RZ8B 2BXZA 1FG9C 2R4SL 4HS6A 2NY5C 4JFFB 2I26N 2J6EH 1KLGA 3NAAL 2DQHL 5CIPA 5E9DA 3CJJA 4EUPG 4O2FB 2HLFD 3BQUC 2F19H 4K9EC 5JUEL 3UJTH 1JE6A 2E9BA 4S0TD 5F3BA 1S5HA 4HKZB 1UGNA 5KSVA 4TVPD 5IBLC 4QTIL 3V5KA 4Z5RA 5SV3A 2HJKB 1B88A 2D0FA 2H9GA 4GMTH 2VL4A 3Q6FA 1QRNA 1ORSB 1BFSA 2P1YA 1L7IL 1LP9F 5DK3A 4RMQA 1LE9A 1A1OA 5FA3B 1PGRB 4XXDB 2WIIB 1I1CA 3CXHK 3O6KH 3U9PH 1G9MH 1DQQB 2BJML 2XQBH 3RIAF 9CGTA 5DHYB 1ZS8B 5KSAD 4ZQKB 2BMKB 2Y6SC 3KR3L 4Y4KB 1F2QA 2IANA 4TVPL 1VSCA 1BBJB 4AM0A 2NY3C 4K8RC 3ALXA 4YIQA 4OFKA 3ABZA 4Z9KB 4EKXA 1KEGL 2EDDA 1U8OB 3SDDD 2PF6A 2R4SH 3TIEA 4Q9QL 1U58A 4WW1B 1AFVL 3C8DA 3BSZL 3NAAH 2DQHH 4UT7H 5T3XD 1HSBB 3HRZB 3QIUB 1RUQL 5F7KC 1XAUA 4DZBB 3SCMC 4RIRA 2VDKH 4H26B 4HJ0D 1ONQB 3HR5B 3OHXB 3BP4B 1FLTX 1UA6L 2VLME 5F1NA 3FHAA 4CMMA 3PP3K 3WKML 3L3JB 3EOTH 2EDLA 1URLA 4AT6A 1V3KA 3MO1B 3CUPB 3RIFK 3A6BL 4ACPA 3SBWC 5IEHB 1J5OL 5CD3B 5FIEA 3STLB 1YEKH 3MRQB 2DBJA 1PX3A 3VGHA 5FV2A 3O3EA 5HVGB 5AEAA 4MXQD 2AJ3A 4R7DB 1VGEL 4Q97A 3RTQA 1OAYH 4GG6B 5DEFA 5J1AA 1FPTL 3KR3H 4NC2B 1UH4A 4TVPH 4E5XB 3LV3A 5KW9L 1QO3A 4R4BB 2Z8VC 4Y8AA 4Q9QH 3V9FA 2GY7B 3O41A 1AFVH 4M00A 4LPVA 2Z9TA 4O5LH 3BSZH 5HYSG 3ZYZA 3SDDA 1RUQH 2LAAA 2IPUG 1N59A 4QOKE 5I1HH 1NUGA 5FO8B 3RVTD 5TF1L 1UA6H 2IQ9L 15C8L 4J23A 3D0VA 1LVEA 3C5JB 3WKMH 2NPLX 1J0YA 1YA5A 1HH9A 4RAUB 5FUZL 2X42A 1S9YA 2NXZD 3A6BH 3NH7L 4MQSB 5EO0B 1FFNB 3SJVD 2QQQA 5DD6A 4X6DE 2DL2A 1PVHA 4M1DL 2BNRD 2HJFB 2B7DT 3VXMD 4EEEA 2OZ4L 1BX2B 1LNUB 1CLOL 4Y19B 4NWUH 3PABB 3TNMA 2CGRH 2RB8A 4IRJB 5C0EB 2VR9A 2JJVA 2EC9T 1RJZB 3BFOA 3N0PB 1P4BL 3E1F1 2ILLA 3GI8L 1NC4B 5IFJA 4X98A 4I8DA 5GZOD 1YEGL 5E8NA 5KTEL 3MR9A 3ULUF 2NY7L 3MUGA 4XP6L 5TF1H 3QNYA 2IQ9H 2P45B 1Z9LA 4HS6B 3WDJA 15C8H 1KLGB 5CIPB 5E9DB 1KJ2A 3FONA 5FUZH 1JF1A 1LP9A 3FJTA 4XTRD 1K3IA 3S35L 4UOJA 2V7HA 2APFA 3GI9L 4M1DH 3SJVA 5F3BB 2H3NA 2OZ4H 4JDVA 1ORQA 4DKAA 3V5KB 4Z5RB 3PQYA 1CLOH 5CEZE 4MQXC 2BNRA 2B4CL 3VXMA 2H9GB 3Q6FB 1IM3A 1QRNB 2IADB 1A4JA 3D48R 5DO2C 1ES0A 2X1OA 4POZC 3EOBA 2DLEA 1A1OB 4H8WC 2OJEA 3BPNC 2WWMD 1UCBL 2NY4D 5BRZE 2A9ML 4K3GA 4QT5B 1P4BH 2IANB 2NY6D 3GI8H 4AM0B 4MCYA 1YEGH 2JCCE 3GSVA 3OWEA 4DVRL 5HDBE 1CGXA 3DGGA 3MYZA 2OMNA 4XP6H 3TIEB 2B1AL 4IEFB 5DF0A 1ODAA 1FL5A 4K94C 2VR5A 4RIRB 3S35H 3FB6A 4U6XB 2FIRT 3LMJL 4AG4L 2XWJA 3GI9H 3JUYA 3D6GA 2X10A 4TTDC 4FXGA 4J1UB 1GL4B 4CMMB 1C1EL 4M9PA 4Y4FC 4AT6B 4BM7A 4DOHE 2O5XL 1CBVL 3CSYA 5T1LD 1TETL 3S4SA 2B4CH 1UJTA 2GYSA 3V4UL 1T03L 4HUUA 3O3EB 2GUOB 4OKVA 3ARUA 2UUDK 2AJ3B 2VLKD 3JVGA 3ULUD 4GUPA 4BA8A 1S5IL 1UCBH 2XRAL 1A2YA 3BH9A 4FN0A 5J1AB 2A9MH 3UO1L 2DB8A 4U1IA 5HHXL 3AREA 3IGAA 2YRPA 3W11C 3P9WB 2YD5A 1PFCA 5KSAB 3LV3B 2ICCA 4DVRH 2W0LA 4HG4J 4BQ6A 1QO3B 5C9JA 3SGEI 1N7ML 2L7UA 2CD0A 1HK6A 3B5HA 4YHNB 1REIA 4ZUVA 1Q0YL 2B1AH 3O41B 3ULUL 4FHBD 4XPGH 1BJ8A 2JJTA 3MLSL 2DYPD 3ZHLA 3SDDB 3MV7A 1N59B 5JLZA 1E4XI 5BV7C 4LSVL 1QSFD 4AG4H 4F7MA 4YDJA 3UYPA 1FQ9C 3HR6A 2XPGA 2NNAA 5ICYA 1C1EH 3D0VB 1HH9B 4U1HB 4I4WA 4Y1AE 4U7SA 1S9YB 2O5XH 3OXSA 5C8JA 1TETH 4OIIL 5DD6B 2X89D 3V4UH 1T03H 2DM3A 5KANG 3T04D 4IIQA 5T1LA 8CGTA 2B5IB 4QGYA 1XGTB 3HN3A 1E6JL 4OCXH 1J1OL 1MPAL 1S5IH 1CFSA 1A7RH 2XRAH 1NDMB 2X5PA 4XAKE 2VLKA 4LLVB 4P46D 3WMSA 3TNMB 3IFOB 1RIHH 1CDIA 1AHWA 3DROA 1M6OB 4X4XA 1ZGLP 4Q74A 3TBTA 4LPYA 4NQXA 1N7MH 1XH3A 1U3JA 4KU1A 1Q0YH 3MLSH 4DW2L 1CXHA 5IFJB 1YN7A 4WU5A 4X98B 4LAQH 5E8NB 2AXHA 4LSVH 3MR9B 5TQ2L 3MUGB 4MXVE 3LQAC 1S7UA 3HA0A 3QNYB 4KI5C 1IJ9A 3FT3A 1NKRA 3KYMA 4ODTL 1KJ2B 2VDML 3FONB 1JF1B 1LP9B 1RZIA 1KSRA 5EUOE 2YRZA 2XI9A 3BIBX 4OIIH 5ACMA 2V7HB 2NXZB 4KV5E 3SJVB 4G6AC 2H3NB 2X89A 1ORQB 1LWRA 1EEZA 1E6JH 1J1OH 1MPAH 4GRWE 4YXLL 2BNRB 3VXMB 4LHJB 25C8H 4ZFFA 1IM3B 1CK0L 2BVPA 2R23A 1A4JB 4L8SA 43C9A 4M4PA 3AVEA 1ES0B 2HLAA 2QHRH 1FL3A 3UPCA 2FJGA 3LDBC 4P46A 2OJEB 4M93B 1LO2L 2ZUWA 3QAZB 1IQDA 5GGTH 4S10A 3DX7A 4DUXA 1MFAL 3GB7A 4AQOA 2H2SD 4NHCL 1I9JL 3GSVB 3S6CA 2APVA 5DQJA 5TQ2H 3DGGB 3V6OE 5FM5M 3GSNL 2JELL 2VLRD 4UTAL 3QNZA 1MUJA 1I85A 2X4OA 1FL5B 4ODTH 2VDMH 1S78C 3KGRA 1WWCA 5EORH 5AAWA 3FB6B 2ZNXA 4J3WA 3TBYA 2B1HH 2XWJB 3S36L 3VA6A 2X9YA 4FXGB 4ONFL 2NTSP 4XXCC 4HC1L 4EVNA 4YXLH 3OF6A 3CSYB 4ZPTA 3O4OC 3S4SB 1OGAD 1CK0H 3EKCA 2E9IA 2J1KA 4HUUB 4OKVB 3BISA 4GUPB 3FRPA 1PX4A 1YPZF 1FN4A 1LO2H 1L9NA 4NOBA 2VE6A 2Q3AA 1A2YB 2CR6A 1OTSC 3R4DA 1ZLVK 4U1IB 1MFAH 2G5BA 5E6IC 2NY4B 3OJMB 3IGAB 1BOYA 3DUUA 4NHCH 1I9JH 4TN9A 2IH3A 2NY6B 3IXAA 4Z7VA 3GSNH 2JELH 5C9JB 4K23L 1T5XA 2VXQH 4RMWA 4TNWK 4ZUVB 1KULA 3QUZC 4PB9L 2VLRA 5LGHL 4ZODA 2V17L 1NCNA 5JLZB 1PKOA 4H25A 1MCOL 4F7MB 4YDJB 3S36H 4KKBD 5FECA 3EYFA 1WQVT 2XPGB 1A7BA 1GSMA 4ONFH 1QLEL 1C7SA 1G9NH 5H8DA 3MJGX 3O6FC 4I4WB 5EUKA 4HC1H 4N1CA 3OXSB 4K3JL 5C8JB 2FNBA 4NCC2 3D25A 3RZCD 1UKSA 1IC5L 4IIQB 3FCTA 4M3KB 5DJ2A 5EU6E 5T1LB 3T2QA 4JR9L 4OGAC 1OGAA 3VG9B 4BQBA 1CN4A 1UWXH 1CFSB 3LRSA 2MOVA 3O2VL 3FQWA 4LRIC 2VLKB 2HT2D 3WUWA 3BN3B 5E8DL 1K5NA 1AHWB 5HY9A 4F7EA 3DROB 4X4XB 3TBTB 2Z31D 2EIEA 4QHUA 3WJJA 4NQXB 1DANU 4MX7A 5EOCH 3H3PL 1XH3B 4KGJA 5FM4A 4KRPC 2VZUA 5K33A 3L3GA 5LQBL 4PB9H 1T1XA 1YN7B 4WU5B 5LGHH 4K3HA 4HWUA 2V17H 1BVKB 5JW5A 1MCOH 1KV3A 3U36A 2DYPB 1IKFL 4Y16D 1KN2L 3R8QA 1S7UB 3SOBH 1PG7X 3FT3B 1HZHL 1RMFL 2QV2A 1QSFB 3P0GB 1QLEH 2XIDA 3V6OC 3VG0L 4ZOCA 2IFGA 2EDRA 1RZIB 4LPWA 4K3JH 1NBYA 1RUKL 3OZ9L 1AGBA 4IMKC 3OAUL 1KPUA 1IC5H 1XGUA 1NSNL 3TJEH 4JR9H 5IW1A 3HI6L 4TUKL 2EEBA 2OI9C 3RGHA 1EEZB 4G6JL 3RZCA 1CD9B 4N0CC 1OAKH 4L3EE 1MHPL 5LAXA 3SE4A 4XVUD 2BVPB 2R23B 43C9B 4L8SB 4HKXB 1BEYL 5E8DH 3ZDZE 2HLAB 4U0RB 1FL3B 4P46B 4JO4H 4NKOA 5GS0H 2GJZA 3WDHA 1NGZA 1IQDB 3H3PH 4BFEA 2YPVL 2DKSA 4OLVH 2Z31A 4WFFE 5LQBH 2WW8A 5J8OA 3GB7B 4IOIA 1JPGA 4YQXL 5DQJB 3T0DA 1IKFH 3WHXA 2NY5L 1KN2H 2Q8AL 3QNZB 1MUJB 1MJJA 2X4OB 1I1YA 3B9EA 3VG0H 3V4VL 4Y16A 4JM2F 4CJ0A 1HI6A 2J4WL 3BDYL 1WWWX 2OTPA 1RUKH 3TBYB 2B2XL 4APQD 3BPOC 3MLUL 3OAUH 4ZS6D 3EYVB 4JRWA 1NSNH 1FE8L 4B53A 1MJ8L 3HI6H 4TUKH 1NGWA 5D1QC 5F97E 4G6JH 2BK8A 4EVNB 4ZPTB 4KXZI 3O8XD 1BEYH 4U49A 1VENA 1H3GA 3MLXL 4Y4HC 3O4LE 4I3GA 4ZUTA 1FN4B 3MRKA 1YYLL 3CX2A 3VXUD 2LTQB 2D7PA 3WSQL 1HYRC 1UENA 4K8RL 4N0RA 3NPSC 4XC1L 3V7MA 1CGYA 4JGUA 3DUUB 5FKPB 1BF8A 5T3ZE 4RMRA 3EIFA 4JFHD 2IH3B 3IXAB 1N6QL 2ICES 2YPKA 2HRLA 2NY5H 1G0XA 2XA8L 2Q8AH 1T5XB 3ECBA 1VA9A 3V4VH 4XH2A 2VLRB 1TJHL 4H25B 3F7QA 5E56A 2JJSC 3MLUH 5FECB 3EYFB 1FE8H 4W6XB 1ZAGA 3SDXF 4APQA 1WIOA 1F4YL 3DHMA 5EUKB 4EI5C 2JB5L 3EDFA 1S7XA 3D25B 4O4YH 4D3CL 1BQHG 4E41D 3UTTD 3FCTB 4PJCF 5DJ2B 1I7RA 3O8XA 1CVRA 5D93B 2F74A 4HXBL 1OGAB 3MLXH 4GH7B 2DM7A 1FGNL 1YYLH 3RVUC 3LRSB 5ID0A 3FQWB 4PGCA 3WUWB 4Z7OE 3F12A 3GFUA 3H9YA 3RX8A 4K8RH 4JM2D 1K5NB 4XC1H 4MD0B 2FX8L 4F7EB 5HY9B 3BKJH 3VXUA 3ARXA 3THML 4QHUB 1N6QH 4H88L 2D7TL 4MX7B 2XA8H 2H8PA 2J3SA 4JKLA 3OX8A 3L3GB 4Z95L 3FRUA 1T1XB 4O00A 2HG5B 2A38A 3PL6D 1MIEH 1S7SA 4I48A 3D85D 3U36B 2DQFA 3QUYD 4JZJC 4JAMA 3S98A 4ZSOE 1F4YH 2R1WA 5HGDA 3W5MA 1UZ6F 1KC5L 2QSTA 3PHQA 2JB5H 2C3VA 1NBYB 1QFHA 1AGBB 4QHLA 3MRFA 1KPUB 1P7HL 5CCKL 4BUHA 2ICWA 5J06A 3WV0A 5IW1B 4HXBH 1G6RA 1TMCB 2E6JA 3RZCB 1FGNH 3UTTA 4PRPA 1RIVL 5LAXB 4CJ1A 2A0LC 3MBXL 1QVOB 2HVJB 1MHHA 2FX8H 3CC5A 4LAJH 2ZP0T 2GJZB 4JM2A 1I9RL 1NGZB 5FGRA 5FOJA 4DGYL 2Z31B 4FFWC 4Z95H 4C56A 1JGUL 4HLZH 4IOIB 2Y07L 1JPGB 1II4E 3BIAX 1QR4A 1QFPA 2J5LC 3X3GL 4G8FA 3T4YB 3WHXB 2VAAA 4L4VE 1B9ZA 3PL6A 4KVCL 3WE6A 1MJJB 3D85A 4JKWA 1M71A 1I1YB 4YBLC 3SDCD 1U3YA 4F9LC 4Y16B 1KC5H 3QUYA 1FZMA 1HI6B 1NMCC 5GRYA 5F71A 5CCKH 3AU1A 1V7NL 5F7NC 1NGWB 1I3VA 3RPKA 3B9DA 1A6VL 1IKNA 1RIVH 2BX5A 4Q6IC 5BVJA 4DCQA 2FH8A 3V0WL 2X4SA 5D7IF 3MBXH 3TH4T 4XB7A 3EHBC 3G5VA 2BHZA 3RHWK 1BREA 3MRKB 3NACL 1I9RH 4N5EC 3TBVA 1PYWA 3U30B 4DGYH 1F13A 2CK0L 1JGUH 4EQ2A 4M03A 1T89A 2Y07H 1E4WH 3MV8D 3SDXA 3X3GH 4S0SD 2J8HA 3RY5A 2YPKB 3RWHA 4KVCH 3ECBB 2QR0A 5L0QC 2FRGP 3DO3A 4LOUD 4XH2B 4MS8C 3PP3H 4IJ3C 1SBBA 2LE9A 2MNUA 1PY9A 1RJLA 3SDCA 1QBBA 3RWJA 4FXKA 4YK4C 3VCLB 1L7TL 4XHJD 1Q9LA 1V7NH 4ZNEE 2PTUA 3VXRE 4APQB 5FYJD 4JKKA 1P53A 4PRHD 4GLRH 1A6VH 2OL3L 5HYJD 3KPQA 1S7XB 2C5DC 5IGXL 3VD9A 1V7ML 5B38G 4QHKJ 1QFWL 3NCEB 3O8XB 3QR2A 3CX5J 2F74B 3C5ZD 2BOBA 3DLQR 3GRWL 3RI5F 3VI4F 3NACH 1KF9B 2I25N 3PWNA 2J2ZA 3CZJA 4UT6H 4XCNA 2CK0H 1EUUA 1Z0NA 1J8HE 5E4IA 5HD8C 2MTPA 3VXUB 2GTWA 1JYXA 2ZUXA 3STZA 5K9KB 2H8PB 3MV8A 3OX8B 1TIUA 4MNHA 1IEBA 3FRUB 2FWOA 4OLZL 3DURA 2A9NL 4RGNE 2VSDA 2OL3A 4N9OB 1S7SB 4I48B 4DAGH 5DXWA 2YR3A 1KGCE 4W4OC 3P0YL 1BQSA 3MRPA 1NAML 2DQFB 3QCUL 1QBML 4JAMB 3JV4A 1L7TH 5E8OA 2R1WB 5HGDB 4U6VL 3PHQB 2C3VB 1T21A 3SGKC 1JV5A 4MLSA 4HT1L 5IGXH 4QHLB 2FHFA 2XV6B 3MRFB 3K2MC 4J6RL 4PRHA 2V7NA 3QRGL 2IBZX 4PJFE 1QFWH 3HI5L 5HYJA 2ICWB 1G6RB 1WF5A 3GRWH 5CZKA 4E41B 4LSQH 3UTTB 3VFNA 3WHE1 1XGYH 3K81A 3C5ZA 3TM6A 2N4IA 4U1NB 1XIWC 4KVNL 2FSEA 4PJ5E 3L5HA 1MHHB 3GEWB 4D9RE 1CLZL 1Z3GL 3CC5B 5IMLA 3C60D 4JM2B 2AXGA 4AL8H 4HWBA 5B22A 2A9NH 4PLNC 5I2IA 2WBJC 3BPCA 4ZAKD 1GGIL 2CJUL 3P0YH 4G8FB 2VAAB 1NAMH 3QCUH 5KN5A 3PL6B 1QBMH 3WE6B 3D85B 4YEEA 4RGMB 5D7IA 1KXQE 5ANME 1TQCC 1MELA 4IRZH 4U6VH 3QUYB 4JQVC 3DTXA 3BEWA 2V5YA 4AIZA 3MOBL 4HT1H 1WWBX 1GHFL 1KCRH 2HWZL 4J6RH 3QRGH 4X7TA 3HI5H 4JE4B 3AU1B 3DOSA 2IALA 4L9LA 3V2AR 1F4AA 2YD4A 1I3GH 5BVJB 4DCQB 2R8SL 2X4SB 4NRYA 4PJXF 1Z3GH 3G5VB 4HKJA 1PEWA 1OOAA 5IHBA 3TBVB 1D6VL 3U4EA 1F6LL 1PYWB 3I02B 3C60A 5CUSH 3ARTA 5D96C 3MJ6A 3X17A 5CEYA 3PHSA 3LVEA 3STBA 4OLXL 4HD9A 2X6MA 4WEBL 1U95A 4XCCL 3SDXB 1GGIH 2CJUH 1MI5E 4ZXBC 4ORZC 3RWHB 5DFTA 3D3VE 2QR0B 3QEQE 5AZEL 3MV9E 4ZAKA 1JZ4A 3L95A 2Z8SA 3QCVL 2M2DA 3WFHA 3PUCA 5C86A 4X4YA 3RNKA 4ZUSA 2AQ1A 3MOBH 4RGNC 5HGAA 5C0NC 1RJLB 3KXFE 3SDCB 1GHFH 1VDGA 1TLKA 4K3DL 3EJYC 4MB5A 1QPXA 1Q9LB 4GKZA 2UUDH 1H0DA 3KPQB 5EOCJ 2R8SH 3SE9L 4ZDHA 2W1NA 4JY4A 2P8MA 1TTGA 2BOBB 5E95B 5EPMA 3VXQA 5DUPL 4TQEL 4QRSB 3PWNB 5EFIB 2RR3A 3L5XH 4JFOA 4BH8A 4XCNB 3CVHL 1BLNA 1I3RB 4OLXH 4WEBH 4NBZB 1MRFH 3MCG1 4N8CL 1OP5K 2ZUQC 2GTWB 2V2WA 3STZB 4Z0BL 3ZKMC 4GRLD 5DS8A 1NPUA 1Y6MR 5F9DC 4LEXL 2DDQL 3MV8B 4MNHB 5AZEH 1IEBB 2FWOB 3DURB 3QCVH 4QRRE 5ICXA 5T1DL 2OL3B 3MODL 2DJUA 4BELD 5E03A 4Z6AT 3MRPB 2JJUA 4K3DH 4JPIA 2F54E 5GRUH 3JV4B 2EEAA 2HT3D 1W72A 3VWKD 2NR6C 5E8OB 1I7ZA 1ETZA 4XMLL 3GK8H 1UFUA 1T21B 2EDFA 5E5MA 1JV5B 3IAPA 3H3BC 3P4OA 1OCWL 3CVHA 3P0VL 2W9DL 4PRHB 2AK1L 2V7NB 3WBDA 5HYJB 2EDTA 3IKCA 3BZEA 2Y36L 5HYIA 1EPFA 5DUPH 3VFNB 1LO4H 1DN2A 4TQEH 4CRPA 4ODUA 4MB3A 3K80A 2ENYA 3B2VL 3C5ZB 5MENE 5IMMA 1G7MA 3CVHH 4JHAL 2VKXA 3OJDA 1JFQH 1IC1A 4N8CH 5D1ZC 5IMLB 4Z7WF 4Z0BH 4Q0XH 3DGCR 1DBJL 2AXGB 2FHBA 4EUPA 4LEXH 1CD8A 2BCKA 2DDQH 2CLVA 4MQTB 3AFLA 2AJXL 5I2IB 4PTTA 4XC3H 5T1DH 3MLVL 2DD8H 3MODH 1NGPL 1T66D 3BPCB 4JEGB 4LLDA 3DVNA 4WHTA 3T09A 1JYWA 1X44A 5GGUA 2N56A 5KN5B 1U41A 4FG6C 3LB6D 1YMME 5B39A 1UB5B 5FO7A 5D7IB 4QRTA 1T20A 2VB5A 4XMLH 4PJXA 2YD2A 3BEWB 3DTXB 4AIZB 3VWKA 4M1CC 1EO8H 1L9MA 4AEEA 1OCWH 2DQJL 2A6KA 2P8LA 4WFHE 4OQTL 2W9DH 2JTDA 2AK1H 4X7TB 2P5ED 3GMMA 3KPMA 2IALB 4L9LB 2Y36H 5IBUB 1KIUA 1OD7A 5D2LE 3B2VH 4JHAH 5FUOL 5KAQG 4NRYB 3T77B 1B90A 4HKJB 4M7KL 4X9FA 1DBJH 3U4EB 4ZO9A 3C60B 4ETYA 5D72H 5CEYB 3RGVC 2EYTA 3EUUA 1NGPH 3B9VA 4R6UA 1U95B 5EZJB 2NYYD 4OQTA 2P49B 3ZKNC 2CLRA 5JHDE 4ZAKB 3L95B 4F37K 3U7AA 3WFHB 1MCFA 4FZEL 4GQ9L 1MIML 4ODSL 3B43A 3RNKB 1SM3L 1WTLA 4NWTH 5HGAB 1PG7L 2DQJH 2DI9A 2G2RA 4OQTH 5CJOL 4HH8A 4GKZB 5DD1L 3NTCL 4AEIL 5IW6A 2P5EA 2VH5L 1H0DB 3QIBC 5L6YL 4M02A 1MY5A 3ESUF 4WFEE 5DC0A 4ZDHB 3RBSA 5TQ0H 4JY4B 2P8MB 1ZLVH 3T0EC 4M7KH 5EPMB 3VXQB 3FB5A 5HYSA 3TT3L 3FB7A 4HMCA 4NCC1 4CBPA 1QBLH 3VI3F 4JFOB 4BH8B 4QHKI 2ZG3A 1I9IL 2APBA 1BLNB 1JBJA 3F7YA 3BDXA 4OT1L 2WBWB 5IB3A 1FC2D 2V2WB 5DS8B 1MQ8A 1D3CA 4GQ9H 3KYAA 4FZEH 5ICXB 1MIMH 4ODSH 4KK8D 1KG0A 1RUML 1SM3H 2XXMB 5LGKA 1QSED 1AC6A 1PG7H 4N90D 5JOPD 5E7BA 5IKCA 5KSBF 3ZT6A 4LHQB 1CTNA 5CJOH 4JPIB 1NEZG 1W72B 1VB9A 3BW9A 3NTCH 1ETZB 4AEIH 1QD0A 4X5XA 5E5MB 1E4KC 3DETC 4MJ4A 3BVNA 3P4OB 4RA3A 4Z7WA 5E94A 5L6YH 1A1MA 1OVZA 3IKCB 1FJ1A 1UC6A 1QACA 4PGBB 5CAYB 3OKOA 4ODUB 4YDKL 2CKBA 2FECL 5IMMB 1I9IH 2E3VA 2CMRH 3OJDB 4PJGF 2QTEA 4OT1H 5IESL 1U6AH 4LLAA 5JMRA 1KLUA 4JQXC 3QDJA 2VDRL 4WO4C 4EUPB 2X70A 2BCKB 3BZFA 2IBZY 3KDMA 4QHNA 2Q3ZA 1NUNB 1WZ1L 4GRLB 4PTTB 3ROLA 4LSUH 1U0QA 5L7XL 1RUMH 5HI3D 4JPKL 4LLDB 1AIFA 3AS0A 4LGRB 1T1WA 3O2DH 3VW3L 1ZK9A 2NY0D 1HKLL 4PJ9D 2XICA 3JV0A 1QSEA 5FO7B 1X3DA 3V0VA 4QRTB 1PDKA 2DKMA 1T20B 4FMFA 3VGAC 4YPJA 4PJXB 3I75A 3VWKB 2XT1B 3H7LA 1ZA3A 1A0QL 2QHLA 4PJ7E 3GMMB 3IETA 1N8ZA 2R0LL 5FYLE 3ARPA 4Z78A 3WLWC 4LBEA 4YDKH 3FAXA 2Q6WA 4TULL 2YXFA 4YO0A 5E99L 4EQ3A 3IRZA 1WIPA 1LGVA 5CEXA 2VDRH 2DQTL 3ARVA 4IOFD 3V5DA 2XWTB 4YHYB 5BZDA 5TDNA 4AEHL 4XI5C 1WZ1H 4F9PA 2EYTB 1JUFA 3LEYL 5CJXA 5E70A 4X7SL 5L7XH 1S8DA 1YEIL 3WDIA 1G7QB 3VW3H 4KH2A 5L2KE 1HKLH 4Y5VC 2CLRB 1HILA 1GVIA 4H1LH 4P4RA 4N9GA 5B8CA 1Y18A 4OGZA 4PTUA 1HSAA 5GXBB 1A0QH 2G2RB 3S3PA 4LLMA 4UNVA 5DQDL 4QXTA 1D6EA 2R0LH 1WZLA 5IW6B 3ZE1F 2P5EB 3NIDE 4KJPC 4TULH 1SMOA 3IAQA 1U8QA 4EZMA 4JRXE 3NGBB 3LS5H 3GSQA 4U6HA 3FB5B 5HYSB 4WTWA 2DQTH 4NPYA 4AEHH 1N26A 1INQB 2UZYB 4M8QA 4WIQA 3T1FA 3BGFC 5FV1L 3HUJF 4A2LA 4LRNL 4X7SH 1I1FA 5EG6C 1HN1A 4P0DA 4OLWL 5IB3B 3KPSD 4HFUL 4KY1L 4HWEL 1YEIH 2IEPA 4U4BA 1YEDA 2AQ3A 5DRXA 3QQ4A 4OUUA 4L4TE 4DGIL 1KG0B 1JGLL 1KN4L 1MCEA 1MF2L 4LPUA 1IGJA 3EW3B 1ZTXL 3H0TA 5IKCB 1NCCL 1ERNA 5DQDH 2SEBA 2MHAA 3BW9B 4PLKC 5DJZA 4PJGA 4X5XB 3T3ME 2GT9A 3OB8A 1A6PA 3BVNB 4XNUL 5HHNA 3N85L 1MH5A 5E94B 4Z7WB 5GGQL 1AR1C 1A1MB 4HSQA 4Y8DC 4JDTL 1FJ1B 1D5MA 2XKNA 1UXWA 1MWAL 3OKOB 4GAYA 1R0AH 2CKBB 2ARWA 5EOQL 1MFBL 1ZXQA 2W91A 3ZDYF 5BOZG 3MUY1 4LRNH 3OKMA 5KVFL 1GZQA 4OLWH 3K3QA 1KLUB 4HFUH 4OZFH 4HWEH 3QT2A 2R0WL 2X70B 3WO4C 3BZFB 1X4ZA 3KDMB 3KPSA 3MRIA 5ECJE 2VQTA 5I1AA 3F7RA 3ROLB 4DGIH 1FDLL 1JGLH 1MF2H 1AIFB 2YEZA 3CSGA 5GGRY 5GISL 1ZTXH 1T1WB 4LNRA 1XGQA 3OMZA 1NCCH 1QSEB 3ARDD 4XMPL 1UB6A 4Z0XA 1FLRH 3D1MC 5IHUH 1MWAA 1QRKA 3I75B 3VFPB 4XNUH 1Q0XL 4OV6F 3NFPA 2ZCLH 4QRUA 1ZA3B 4ONGH 1Z2KA 4FA8A 5GRWA 4OFDA 2F53D 1PW3A 4JDTH 2RGSA 5IB5A 3IETB 4WNQA 4YHIA 1N8ZB 1MWAH 3S3SA 1M1SA 1JRHI 5EU7E 4LBEB 2QSCL 3RWDA 2Q6WB 1FYTE 4Y7MA 1MFBH 1YEJH 4X5WA 5DA0B 1C8PA 3WS3A 1MCIA 3I2CL 4MJID 1DQML 4OGXL 3V5DB 4FQXD 2UWEF 2MCPH 5TDNB 5BZDB 3FN3A 4JHWL 3MGTA 4ZFOL 3WN5C 5CMAA 4LSSL 43CAA 1A9EA 1JUFB 3LKRA 1D9KA 1FDLH 4UU9A 2GI7A 4Y5YA 1IEHA 1B2WL 5CP3A 2A83A 1K4DA 2DKUA 3MV01 5AWNL 1S8DB 3BE1H 1HILB 4I1NB 4WUUA 5EWIL 4P4RB 2NY0B 4N9GB 5B8CB 1Y18B 4PJ9B 1Q0XH 1FHGA 4PTUB 1HSAB 3ARDA 3P2TA 4KK6C 3VFSB 2R9HD 2I27N 4LLMB 1AGEA 4FQ2L 3KJ6L 3U82B 4QXTB 1D6EB 5L8JB 4P5TC 2R2HA 5A3ID 3SKOA 3IFLL 5DUBA 2QSCH 2F53A 2EIBA 2R2BA 2LU4A 2KZ1B 3OAZK 3GKWL 4KRMB 4ZFOA 2A6DA 5I8KL 1U8QB 1J05A 1U8KA 3GSQB 5FYKL 3I2CH 4U6HB 1IGFL 5I75C 3FT2A 3RVWD 1EV2E 1EHXA 3DRQB 4OGXH 1AP2A 3NPZB 3OXRA 4NPYB 3GIZL 4MJIA 4JHWH 1FIGL 3T1FB 5KSBB 4LSSH 5DJAA 3WJLA 5EBGA 1I1FB 4FQXA 4YFDB 1B2WH 1KACB 1KTLA 3KPNA 5AWNH 4Q58C 5I8CA 1YEDB 4C4KT 5ESQA 5DRXB 4TRPL 3IJHB 3QQ4B 4OUUB 3AM8C 4UOW1 5IWLC 1EIBA 4DQOH 1IGJB 4NKDB 1BQLH 3H0TB 1S9VA 2R56L 3WCYA 3PWPE 1L6XA 4LLYA 1NLBH 3KJ6H 1T2XA 2SEBB 2HT4D 3NZ8B 2MHAB 2EXWC 4YWGL 5DJZB 1FSKB 4PJGB 1LK3L 2GT9B 4XBPA 3IFLH 5TE7L 4NQCE 5HHNB 1MH5B 2H32A 4X9BA 3GKWH 3CLEL 1WUNT 3QUXD 4WI5A 5JO5A 5I8KH 3EDDA 3U0WL 5FYKH 1D5MB 2XKNB 1UXWB 1IGFH 1EEQA 3BQUD 2ITDA 4GAYB 4OCSL 2H32H 3GIZH 3EYUL 1FIGH 3GNMH 3KHOA 1WEJL 1W0VA 4KWUA 5J1TC 2HTLC 3BOVA 1GZQB 3OKMB 2NLJA 1AD0A 4G3YL 4R4ND 4WI8A 1DE4A 5AUMA 3QCTL 5IVXF 3KPSB 3MRIB 2L7JA 5I1AB 2FGWL 3MTRA 4FTVE 3VXOA 4WW2C 4L1HA 5D7KD 1C5CH 3B6SA 2YEZB 4F58L 2BVQA 2R56H 1V5JA 3EDEA 4LNRB 1XGQB 5M7QA 4RWHA 4N1EA 4MGXA 1MQKL 4GS7B 4MHHI 1VFBA 2VZSA 5F9OH 4Z0XB 5HI5D 1MWAB 2DIAA 2DQUL 4YWGH 3RAJL 3U1SL 3MZGB 4G6ML 1LK3H 1EVUA 5TE7H 4HWZA 3NFPB 2ZCKL 1DFBL 1BGXL 2EO1A 4BYHA 3QPQC 3JZ7A 4HEPG 4YBQC 3U0WH 3G9AB 2FB4L 2UWEA 5IB5B 4WNQB 4YHIB 3QUXA 4XBEH 4XNQA 4Y88A 4OAWB 3RWDB 2BVEA 3GJFK 1S7RA 3DMMC 3DUHA 1JHLL 3LD8B 4AH2B 1WEJH 3MJ7A 3GUTA 3CH8A 4UMGA 3WS3B 4PRIE 4G3YH 2ZUUA 2VZOA 3NCJL 4JVWA 5JXAH 4GQPH 3KPLA 3CSBA 5D8JL 1C5BL 3KS0H 5IG7B 4KJWC 2YRLA 3QCTH 4RSVA 1QFUL 2HKHL 4EI6A 5L9DH 3UTPE 2XNAA 5E5RB 2FGWH 3MGTB 5CMAB 3MOAL 3LN5B 43CAB 3LKRB 5KJRL 1AI1L 1AXSA 2C3HA 4HZLA 4UU9B 4Y5YB 1R3IL 2A83B 1K4DB 2DLIA 4F58H 3CMGA 1PSKH 4QWWD 1MQKH 5IB4A 4PBXA 2K1MA 2ERJB 1W0WA 3RAJH 3U1SH 4G6MH 4GLRI 4M7LL 1N0XL 3FOLA 2ZCKH 3ARDB 5BJTA 5HXMA 1DFBH 1BGXH 5J1SC 3GZKA 1AGEB 5SWSE 2FB4H 4WHDA 2R2HB 5BS0E 3RKPA 1OTTC 4G80A 4I2XE 2Y06L 4PJBF 5DUBB 5KVMC 2F53B 2R2BB 2XQYG 1H3VA 1IAIL 2CSPA 2A6DB 1J05B 1U8KB 4WRLA 3SGDI 5IT2L 3NCJH 1FRGH 1DQLL 3FO1A 3FT2B 3OAYK 5GGVL 3G6DL 3VXNA 1AP2B 3ELAT 5JXEC 1NANH 1QFUH 2HKHH 2BSSA 4MJIB 1GZPA 3TN0C 2JK5A 1KIRA 3MOAH 2NXYC 3TZVC 5DJAB 1LO5A 4TNVF 5KJRH 1AI1H 4FQXB 2VTFA 1R3IH 1KTLB 1LDSA 3KPNB 4N0FB 5I8CB 5DJCA 5F70A 5ESQB 1JGVL 3QYCA 5FM5O 5C70A 5GJSL 1FP5A 4F15C 1N0XH 5DWUH 2DQIL 2PN5A 5C71A 1S9VB 5B4MC 1EJ6A 4LLYB 4JCMA 4CMHC 4X4MA 1TZHA 1RZFH 4N68A 4YX2L 3LY6A 3D39E 2Y06H 4IDLA 4XBPB 4HIHA 4PJHE 2H32B 1RZJC 5I8EA 3UZQA 2VOTA 1KYOJ 1G7LA 2FJHA 2QBWA 5JO5B 2VIRA 3LEVL 4DEPC 1FO0B 8FABA 3L3HA 4CU6A 4EN3D 5IT2H 1DQLH 5GGVH 2ITDB 4WY7L 1W2KT 3M17A 3QJHA 1CFNA 4UTBL 4F7PA 1CL7L 2J88L 1XF5A 3L3OA 2NZ9D 1NC2D 3O81A 4JO2L 5DJYB 4FABL 1J0JA 1R24A 1W0VB 1QSZA 4UB0L 2VLMD 2NLJB 2PO6C 5F9AC 1AD0B 2HN7A 3FFDA 3VFOA 1DE4B 2EKJA 1VCAA 4QXUL 5AUMB 4LLWA 3BKCL 1RJYA 1HH6A 3BUTA 4OGYL 5GJSH 2DQIH 2BVQB 1NBVL 2C7UA 5AG8A 3S88L 4LSRH 3TPUA 2Q20A 4YX2H 4P2RD 5J0BA 1T3FA 2ITCA 3PWUA 3TYFA 2V6HA 3ZKQD 3WFDH 3LEVH 1MAML 2UWEB 3N1QC 5HHME 1V8HA 3E6HA 1WBYA 3QUXB 3TPKA 4XNQB 2E7MA 3TO4D 3F8UB 4WY7H 3RVVD 4ZTOL 4UTBH 1CL7H 2J88H 4QOKD 1S7RB 4EN3A 4NRZA 2W0KA 1MFCL 4I0KA 3PWLA 2EYSA 3ES6B 4JO2H 4XT1C 5DTFA 4FABH 3BQUB 3MRCA 3MJ7B 3GUTB 3FO0L 4R0LC 4UB0H 4BK4A 3PE9A 3K2UL 4P9ML 1GC1L 1NC2A 1FZOA 3KPLB 3T0WA 1DQJA 4QXUH 2QQNH 4OF3A 3CDFA 2JCCF 5IK3A 3UZVB 1TPXC 1WLHA 2XNAB 3BKCH 4NDMA 4EI6B 3M1BA 3QUML 5HDBF 4XCYA 2B8OT 1OAUL 3L5WA 2NY1D 1AXSB 4HZLB 1DTUA 3MRJA 1QYGL 1NBVH 1WK0A 5C08D 2VKWA 4NHUA 4Y19E 1B3JA 1SJXA 5F7EL 3S88H 4PJBA 1N5YL 4OIAA 3VFVA 5IB4B 5TE4H 2HFTA 1W0WB 3REWA 2BC4A 3FOLB 3L6FA 2AEQL 2R0KL 1J1XL 3WXWL 5BJTB 1F3RB 1PQZB 4P2RA 4ZOBA 1GGCH 3HE7D 3RKDC 3MA7A 4PBVC 5J7CC 3QXAA 5J13B 3LN4A 4ZTOH 2LU7A 3VD3A 4YDVA 5D7LE 1MFCH 3QUMA 4KHTL 2UZXB 3QDMB 3TO4A 2C1PA 4NKIL 1TITA 3FO0H 3K2UH 1B0RA 3QHTC 4P9MH 1GC1H 5F8QC 3FO1B 5HVFB 5MI0B 3ZZ1A 3VXNB 2EXYD 3ZDXE 2A6IA 1B6DA 2BY0A 2JK5B 3QUMH 1KIRB 1MLCA 1AY1L 1T4KA 3QWQB 2D4FA 5F7EH 1RFDL 4PPTA 2YWYA 5CEZD 1VFUA 1N5YH 1IGTA 2WQ8A 1K8IB 4FOMA 5C08A 3BRDA 1BQHB 5B38A 2QEJA 2AEQH 4H0IA 2YD9A 2R0KH 2YPLD 1J1XH 1B0GA 2Z0BA 4N0YL 3WXWH 2BP3A 4S1DC 4OLEA 4LKXB 3F7VA 1LK2A 4JFPB 5GIRA 5BRZD 1CZ8L 5GGRB 5D71L 2F15A 3HMXL 1TZHB 1QHPA 2V2TA 3O3DA 4JLRA 3I9GL 1N5AA 4MMXC 5GRVK 3O3AB 3HE7A 4WEUD 5I8EB 2R39A 1FAKT 4KHTH 1G7LB 2FJHB 5E2TH 2VIRB 4G8GE 4NKIH 1AQDA 4LLUB 4MLIA 8FABB 3L3HB 3SY0B 5E8EA 3ZTNL 4CN1A 2D31A 1CG9A 3M17B 3QJHB 3C8KA 3VDCA 4F7PB 1XF5B 1IC7L 3L3OB 3LAFA 4OJFH 3QHZL 4GBXC 1EGJL 1EBPA 1AY1H 2JKXA 4CAGA 2HN7B 2UV3A 3FFDB 3VFOB 2YBRA 1RFDH 4LLWB 4TVPE 4PRNB 3HMXA 5FUCE 4HGKC 1RJYB 1HH6B 5SX4I 1UWEH 4K55A 4XPAL 4N0YH 4OLYL 1NAKL 2C7UB 4IOSD 4M6AA 3MRLA 1HCFX 3CSPA 4WHYG 4ODXB 1CZ8H 5EUOF 4URTB 1ZHBA 3NFSL 2YPLA 5D71H 5MP6L 4P59L 2CXGA 3HMXH 1A21A 4NO2A 1T22A 3TPUB 1PAMA 5BRZA 4KV5F 1T3FB 4NC1C 4IRJC 2ITCB 3PWUB 4YPGA 4X6BA 4GRWF 1T80A 5SWZE 5AD0A 1S78D 3E6HB 1WBYB 1F4HA 3ZTNH 3BP7B 5MEPA 2HKFL 4EN3B 4NRZB 4RQQB 3PWLB 2EYSB 5DTFB 2W9EL 2HFGL 5DMIH 3MRCB 3QHZH 1E28A 1EGJH 1YEHL 3MX0A 1X5KA 1NC2B 5I19L 4Y1AD 1FZOB 4NQDE 2YMXL 3VFWA 5IK3B 4NDMB 3MLYL 3M1BB 4XCYB 4GOSA 2JJWA 3L5WB 4DWHA 1BZQK 1SYVA 3MRJB 4OLYH 1NAKH 1JF5A 3TJHC 4NHUB 3FQTA 1A7PH 3B2UD 4PJBB 5CBEA 1F58L 4XAKD 1S9KC 3NFSH 4P59H 3VFVB 4JG1L 4R3SA 4XP1L 3MCKA 3REWB 2P47B 2BC4B 3ZTJG 3L6FB 3CFJA 3HZYB 3PDGA 4HUWB 1BFVL 1CDGA 4HZAA 5JZ7D 3EYQD 3QUZD 4P2RB 4ZOAA 5LWYL 1EHLH 3MA7B 3QXUA 5JQHC 4R97B 4CUCA 1IC4L 3P11L 3LN4B 1CGSL 2HKFH 4YDVB 3JWDL 2D0HA 4ODWB 2GJJA 4FQHA 1HQRA 4O2EA 2HFGH 3TO4B 2C1PB 2EDBA 4PJDE 5KAQF 4QOKB 4OFVA 1B0RB 5HHOE 1JIBA 3P9LA 5DFWH 5I19H 4BZ1H 4HWNA 2X9XA 1A6UH 3MA9H 4X7CC 3CFBA 2A6IB 4ELKA 4Y1AA 3SJVE 5ESAA 2FX7L 1MLCB 4BK5A 3PQYE 1I7TA 5TDOB 4K07A 2HLFC 4UDUA 3TVMD 3CNKA 1T4KB 3VXME 2NY1B 3RIAK 1KCLA 5L8LB 2CK2A 1F58H 1IGTB 4OCNC 4YGAB 5C08B 3MUJA 4JG1H 4XP1H 4HF5L 5B38B 1JNNL 4JRYD 5FUCC 5CGMA 4LHUG 2E27L 1BFVH 3WNKA 3F7VB 1LK2B 5GIRB 5LWYH 3RTQC 3ZL4L 3BJLA 4M9OA 2WNGA 3B9AA 2V2TB 3O3DB 1M05A 4JLRB 3ULVF 1IC4H 3P11H 4P4KD 1N5AB 1TZGH 5EIQA 3VFGL 3HE7B 1U8MA 1OWRM 3M8OL 3JWDH 4H0HB 3RRQA 5BV7B 4Y2DD 1AQDB 5ISZD 1FORH 1ZLUH 1AQKL 1F45A 4QNPE 1JTPA 1QQDA 5E8EB 2D31B 1CG9B 2MMXA 1BECA 2IH1A 3C8KB 3SDDC 2VISA 4LPTA 1OY3B 4KHXL 4MA1B 2FX7H 3EJZD 5EUOA 5C6WH 3VRJA 3DWTA 1TXKA 3IVKA 4HJ0C 2YBRB 3DHJA 3SE3A 1K8DA 1KJ3L 2AJZA 1FCCA 4G5ZL 4X9IA 3TVMA 1W8NA 4HF5H 4OM1L 5CD5D 1MCQA 5C3LD 2E27H 3QXTA 5HTSA 2DMBA 2YA0A 4JRYA 3C2SA 3ZL4H 1ZHBB 1XGRA 2YPLB 4MNGE 4XP4H 4YNYA 4NO2B 3QWRD 1T22B 4MXQC 3INUH 5JW4M 2KH2B 4PLJD 5BRZB 4RAHA 4YPGB 4A6YL 3KS0J 4QCIA 5C0CE 4P4KA 4TUJA 2UYLA 3W0WE 5F72S 2EDXA 5AD0B 1AQKH 1VADB 4ELME 5DK0A 3MV7E 7FABL 4Y2DA 3V6OA 5ISZA 5MEPB 5ITFA 1G6VK 5IB2A 2H41A 3MJ9A 1CGUA 1AO7D 4B5EA 3AUVA 3UROR 4KHXH 1X5LA 1E28B 2HMID 1A22B 4JFDD 3TH3T 1CS6A 5SV4A 1H5BA 3L3IA 3ZHDA 3ZYIA 1KJ3H 5CJ8A 3RVTC 2BFVL 4G5ZH 3GMPA 3ULVD 4DOHB 1SYVB 2NXZC 1UG9A 2VQ1A 4W81A 5EU6D 1Y6KR 2CUIA 4HPYH 2X1PA 3FQTB 2VLKE 5HDOA 5KOVC 4HFWA 1SY6H 5E00A 5TE6L 3T0BA 5D5ME 1R5IA 1HHIA 4R3SB 3MCKB 4MSWA 1NH6A 2PYEE 2A1WL 5I73B 3QWRA 4A6YH 3X14A 3PWJA 3HE6D 3ULVL 4M93C 2X41A 1YDPA 4J12A 2DWDA 2PCPA 3QAZC 7FABH 2JF1A 4LL9A 5DMJB 4TOYL 3TH2T 1QLFA 4L3CA 5EU5A 1MVFA 5IW3A 1RURH 2AV7A 4CVXA 4MDIA 3P9LB 1AO7A 4C83A 3JTTA 4JFDA 1JPFA 3I85A 1P5UA 1EHAA 1YQVH 1ZMYA 2B4CC 2BFVH 2A74A 2XACC 4Y1AB 3UTSD 5ESAB 2PXYC 1NGQL 1VPOL 5FGBA 3DSFL 1I7TB 3IRPX 4UDUB 4N0UE 5IVNA 1WCQA 5TE6H 3VMNA 4L3ED 5EU6A 5C0IA 4J3UA 2YD3A 5I1GL 4ZTPH 2IBBA 2AJUL 1EZVY 4LDEB 4OD2A 4HXAL 4O51A 3JVGC 4S1RL 4JFED 3ULVH 4BZ2H 3MPCA 1KB9K 1UJ3A 3OAZH 5FK9A 3WUZA 1M05B 3PIQA 4MB4A 4WFFD 3CFKA 3HE6A 3QUZB 3T2PA 4TOYH 4Q2ZA 2DI8A 1IM9A 1MNUL 3AREC 1U8MB 5IEKA 2NY4C 1T83C 3BRGC 1Q72H 2JJSA 1DUZA 4FP8L 4B7LA 1S9XA 4M7JL 3IDIA 4Z7OF 1QQDB 3O2WL 4YC2C 1XZ0A 2JJTC 3MLPA 3O6LL 1HCVA 2IH1B 5DHVA 2X4QA 5LCVL 2VISB 1LE5A 2QQKH 1VPOH 1DVFA 5EUOB 1NEZA 4DN4L 3DSFH 3VRJB 5E2WL 3IS1X 5DD3H 4ZD3H 3H9HA 1G0YR 3UTSA 2ZWLT 1K8DB 2Q87A 2AJZB 3VFRA 2FJFA 5C0FA 1GGYA 3TESA 2XZQH 1ZKAA 4LMQI 3TVMB 4GRWB 2AJUH 4L3EA 3IFPA 1B4RA 4HXAH 2F5AH 3VG9C 4JRYB 3ZMRA 4FRWA 2R4RL 1XGRB 1TNNA 5JR1H 4YNYB 2KQMA 3ULUC 3HRPA 4JFEA 1A7NL 2I07B 2R1YA 1CVSC 1RZJL 1MNUH 4Z7VE 1AHWC 3QDGE 4I0CC 4QCIB 4P4KB 4TUJB 2UYLB 3DVIA 4FP8H 3BD3A 4M7JH 1MEXL 4Y2DB 3KJ4B 1J0IA 1T7XA 4DKFL 5ISZB 4HAFA 3O6LH 5ITFB 2ADJA 3PP4L 3ARFD 5IB2B 1GYAA 5E24E 4K2UH 5LCVH 3O45A 1JGDA 5LBSL 4EDWL 1T7YA 4DN4H 1CU4L 2D2OA 1EUTA 3ALWA 5E2WH 1IGMH 2ESVD 3TA3D 1JNLL 1H5BB 2OI9B 3HTLX 3L3IB 1JZ6A 4LEOA 3VXPB 3GMRA 3EHBD 3GMPB 3VWJD 1OGAE 2PW1A 2VQ1B 5ALCL 2FEDD 2OS7A 2GJ6A 1FNAA 4HFWB 5K93A 1VFMA 5E00B 2R4RH 5JTWA 2EDHA 1TCRA 1HHIB 1EMTL 4MSWB 5HGGS 1HWGB 4WTZG 1RZJH 4HGWA 4GAFB 4PRAA 2D9CA 2ZSWA 3X14B 3PWJB 3PHOA 4P46C 1YDPB 3GJFH 5IMKA 5ACZA 2DWDB 4FQIL 2PCPB 4U1JA 4DKFH 3PF2A 1QLFB 4L3CB 5EU5B 5IHZA 2AV7B 4CVXB 1JYVA 2YUZA 4K7PY 1AGCA 1FL6A 2YUVA 2ZSVA 4MDIB 5LBSH 4EDWH 3ARFA 3HMWL 4HULB 1GIGL 4L1DA 1CU4H 5A16A 1UQSA 1I85C 5I17A 1JPTL 1AO7B 1JNLH 3E2HB 4C83B 3CDYA 3JTTB 3VDBA 4JFDB 2EDYA 4BZYA 1R3KA 2ESVA 4X7FC 2A74B 3TA3A 2IJ0C 1FVDA 5C0JA 4XVJL 1NDGA 4YHOL 5F1SA 1PKQA 2EYRA 3VWJA 1FFOA 5ALCH 1DLFL 3C6SA 5J3HD 1J88A 1B0WA 5EU6B 3DXAE 5C0IB 4LVNC 1EMTH 1EK3A 3QXWA 3C6LD 3LCYA 4D9QD 5BCAA 4OD2B <