2W60B

Anti citrullinated collagen type 2 antibody acc4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
217
Chain Sequence
b'DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4
publication title Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B01
5F7MC 4X5XB 5GQBA 3QFJB 2NY3C 2FSEA 2C3VB 2I07B 1T2QL 4TUKL 5D7IE 4LHUA 1NCWH 3GI9H 4QXWA 2FGZA 2W92A 1FZOA 3P3YA 3ET9F 3PABA 3G5YA 3SBWA 3AMKA 2FO1A 2VDLL 4YUEL 2YD2A 4I9WE 1MRFH 4F15B 3EYUH 1XH3B 3BP5B 4M5YL 2BSSA 3B2UD 4WHYH 2ARWA 3LKQA 1G7JB 2UWEB 1AD9B 5EWIL 2WP3O 5L88H 4XZUB 4HH9A 5ENWB 1UCBL 2HFGH 2ESVE 5CGYD 2WLZA 2BOBB 2H9GA 1MRCL 5F7KC 2FH8A 2Y5TA 1JTTA 1MHEA 4PYGA 4KUCD 4HWBH 2JJTA 5ELIA 5DHVH 5E70A 1I1AA 3ARPA 3D87B 2P43B 4ZFOL 3WLWC 5EUOE 5JPNA 1EAPA 1EX0A 1BD2D 4D9QD 4PJFB 3JTSA 1FSKC 1X5YA 1I7TA 3ROOA 5C3LD 4KK8D 4GXVL 3WD5L 4P3DB 4N0YL 1IAKA 3RTQB 1T2QH 4TUKH 3CSBA 3CJJA 4WHYG 5J6GB 4TNVK 3SBWC 2VLKE 5FAAA 2VDLH 5C2BL 3F7YB 4YUEH 4LGPB 1UWGL 4KI1A 4M5YH 3L7EB 2DTSA 3BZFB 4MDJB 3B2VL 1N3NB 5EWIH 1HXYB 5EA0L 1UCBH 3FB7A 9CGTA 4OFDA 3O3EB 3INUH 1MRCH 4TSBL 4AM0B 4YR6B 2JJTC 3AM8A 1I1AC 1AGFB 2V7HB 1I1RA 4MNQE 5IB3B 5CBEA 3U82B 1K6QL 3IXTA 3ARGD 4G42A 3ARDB 4MVBC 5DYOA 4N0UE 1QBML 2HJFB 1BAFL 4YDLC 4HGWB 3FT2A 2RGSA 2H2SD 3CMOL 1WBYB 4DVBA 1VESA 3O3AB 1B4JL 4KH2A 4RDQG 2YSSB 5C09A 3C6SA 1N5AB 4NNXA 3HMWL 1JZ6A 4GXVH 4MA1B 3WD5H 5ID1A 3O4LD 4N0YH 1P5UA 1BD2A 3JUYA 2H3NA 2JLLA 3B9KD 2XWJA 3LKRB 4MAYA 5ERWB 3UEZA 4WO4B 3GB7A 3GIZL 1ETZB 1OT1A 3JV4B 2AERT 1I7RB 1PZ5B 5C2BH 4IMKA 4JE4B 2CQVA 1UWXH 2JE8A 2VDPL 4UNUA 2HVJA 5DC0A 1RK1A 1UWGH 5A2FA 4RNRB 4P23B 3PNWB 1DEEB 3B2VH 4QLRA 3T08A 3E6HB 1HHKB 4P5MA 3FTGA 2JJSC 5EA0H 5IBUG 4GLRI 3B2UC 3RNKB 2YPVL 1IKFL 3FT3B 3K3QA 4TSBH 4KMLB 3VXUE 1LEGA 3GSQA 4QYOA 1QRNB 1EO7A 2ADIA 3TBWA 1K6QH 1KPVB 3WUWB 4YNYB 3MPCA 4HH8A 3JVGA 4OFPA 4K71B 4U6YA 4WTZG 1QBMH 1BAFH 5BRZE 1J8KA 2QLVB 4PJ5B 3GUTB 3TO2A 4O02L 4E41B 3CMOH 4R0LB 3FO2A 1HZHL 4KKBD 1B4JH 3WNMA 3HMWH 5CIPA 4F80A 3IS0X 5F7LB 1U41A 3P40A 1A6TB 4WV1C 3IF1B 4NNPL 1RJZA 3ECBA 5EBWB 2GYSA 1ZAGA 4KK8C 4MQTB 5F1NB 1K4DA 4N9OB 2VQUA 3GIZH 4IMKC 4RRPA 4HHAB 2PETA 3C5JA 1IARB 2VDPH 3KPSB 2R2HB 5B39A 4CN4A 5CZXC 4LPXA 4BFIB 1CFNB 4IM8A 1SM3L 3VGBA 2WWMD 1QO3B 5F7DA 5EC1A 3KPMB 1MFDL 2YPVH 3V2AR 1IKFH 1G0YR 4ZDHB 1CDUA 4PJ9B 5E8NA 3HPLB 1YC8A 3JVGC 3UTSA 5GRJL 2DOCA 2IALB 4NRYB 1NCUA 3FOLB 2BXYA 5CGMA 1LO4L 4LCCB 5M94B 5FDYA 3CFJB 2ZUWA 4PJBA 4Y1AE 4Y16A 4O02H 4Y19E 5CP7B 3QQ3B 4RDQF 5CWSA 1HZHH 4DCQA 2GT9B 3FFCD 1WUNT 3P4OB 2AP2A 2WK2A 4X6FA 2V5SA 2EYSA 1CFQB 4NNPH 3IXAB 1HSBA 5LVEA 4F7TB 1BZ9A 5T3XL 1ZLSL 3QXWA 2XI9A 3B9KC 4UNVA 1FJ1A 1T0MA 3EYFA 1A9EB 3ZMRA 1SM3H 1MELA 1G6VK 3O3UN 5AAWA 2MTPA 3TYFB 2PTTA 3RUGB 1MFDH 2BNRE 3U9UA 1CK0L 2J8UA 3FO0L 4OI7A 4BZYA 1A1NB 1JPFA 1Z3GL 5LG1A 2E6QA 2ICWA 1B0WA 4MD4A 2ICEA 4FQ2L 5GRJH 2WIIA 1LO4H 5D2NC 2AW2A 1F2XK 2C1PB 4YGVB 2AVGA 4Y16C 1RUKL 1ODAA 3CIQA 5IJKC 5EU5B 4Z7VF 1DQML 1ZVSA 5JIHA 3CXHK 3RWJA 3HRZA 1L7TL 4WWKA 1T20A 2IH1A 5DMKA 4KKBC 3VD7A 3LCYA 5A1AA 5DRNA 5F89B 1R3KB 2AJZA 2BMKB 1NJ9B 1U0QA 1EEYA 3O45A 4WWID 4PRID 5T3XH 1ZLSH 2Z8WC 2H8PB 3MLXL 1CDGA 4JFYA 4GRLB 4G7VL 2BCKB 5FKAA 1BOGA 3TVMD 5FGCE 5JIPA 4LPUA 3FFDA 1LILA 5FYKE 3EGSB 3GSRB 2NZ9D 3OKEA 4ODTL 3SY0A 1PKQA 4KJYB 1VA9A 1YMME 5D1XB 5D5MB 1CK0H 5HHNA 3FO0H 3QXTA 3REWA 2DM3A 3QIUB 1Z3GH 2C3GA 2M2DA 3VWJA 3F5WA 3HUJB 5IESL 4FQ2H 3LOWA 4FRWA 3OSKA 4IEFB 4YC2B 2APBA 3WFEL 1U8LB 1UZ8A 3KPLA 1RUKH 1KTLA 2EXWC 4I2XE 1FO0A 2EDDA 3QISA 1DQMH 4OZIA 2PCPA 3DURB 3EUUA 3MNZB 2MQ3A 1L7TH 4Z95L 5I73B 1C7TA 4JG1L 1U8IA 2EDNA 4U1HA 1MFEL 3KPRB 4L29B 4CJ0A 4Z7VE 1N6UA 1IE5A 1UQSB 1FP5A 1HHIA 4YX2L 1RZ8B 1JWMA 3MLXH 3HLAA 4UUJB 2P24A 4G7VH 4QKXB 1HH9A 4WFHD 1YECL 2XKNA 4FQQB 3FN9A 1OAXL 3G6AA 4OLWL 4ODTH 4L5FL 1TPXC 3PJSB 4KZEL 2AJVL 4Z7WF 4XNZC 2LQRA 4LCYA 5E4IA 4IS6B 2UZIL 1HKFA 4HWZA 3KNBB 1T6VN 3GMPB 5IESH 2CDFB 4ELMB 4X98A 3WFEH 5B4MD 4JFDB 3U7WL 4XRCB 3QWQB 3MOQA 4P4KD 1S3KL 1FIGL 5E1AB 5FCSH 4LP4A 1ZT4A 1M7IA 5SWQA 3H3PL 2F58L 3SE3A 3CDGA 3V8OA 5IMLA 5FO8B 4N8VA 4Z95H 3C6LB 4JG1H 2DI7A 1YN6B 5E03A 4F3FA 1MFEH 3HE6D 5FO9B 5DRXA 3HCVA 3RA7L 3SO3C 2DAVA 5SWZD 2IFGA 3BPOB 4YX2H 4L3EE 4YHPB 1V3MA 3VFUB 4TTDC 2BNQB 4LPTA 3RX8A 1YEDB 4ZMAT 4RIRB 3ZE1F 2CDEB 3EOYG 3M8OL 4R7DB 1YECH 3IDYB 1OAXH 4OLWH 1U95A 1JZ2A 1XZ0B 4NKMB 4L5FH 1R3IL 3V0WL 5E6IA 2P5ED 3TM6A 3TVMC 2AJVH 5CEZE 4KZEH 1J10A 5JHDB 5IW1A 1WTLA 4ODXB 1T3FB 2NZ9C 3T77A 5EIIA 1Q0YL 1RZGB 2UZIH 1DZBA 1I75A 1T1XA 1MCKA 4QGTA 3QJHA 3RX7A 43CAB 5A2KH 3SKNA 4KKLC 3WS6C 2O93L 3JBG7 4C58B 3AS3A 4ZUUA 3U7WH 3ZHLA 4Z7WE 2XY1A 1U93B 1Y18A 1S3KH 1FIGH 3VG0L 3SE3C 1A6AA 3H3PH 2F58H 2A6IA 5IG7B 3GBNL 1KXTB 1XF2A 2WINB 4UOJA 3L7FA 3M1BB 4ZO9A 2W59A 3HN3A 5DUML 4TVPE 4P4KA 1P5VA 1X44A 2W0FB 4LNRB 4XTRD 4F9LC 3RA7H 4FQHB 4DK6A 4OLEA 5KZCD 1PKOA 4YO0B 2O61B 1IGCL 5CINL 4JANA 4IOFD 2SEBB 1NAML 5HHOD 2D31B 5E5UB 4M7ZB 4S0TD 3SQBA 3M8OH 1MCCA 2FD6L 1DLFL 3TBVB 3V0WH 1R3IH 4CADA 1KJ2B 1QR4A 4NRXB 2LU3A 1JNHA 2WBJB 4LK4A 2WUCL 1CWVA 3MO1B 3WJJA 2OMNA 4PRHA 3MNWB 4NBZB 4WW2F 1A0QL 5EFIB 1Q0YH 1MJ8L 4ZFZB 1NL0L 5C92A 3VWKA 2DQTL 1F42A 2B4CL 1J8HE 4R9HA 2YZ8A 3VG0H 2D7OA 1SJEB 5HHMB 5DK2B 3V9FA 3GBNH 5ISZB 1HHHA 1JPTL 4JPKL 4P4KC 5DUMH 2P8MB 4XCCL 3GMOA 3SE4A 5AD0B 1GGTA 3KDMA 1C1EL 5I0ZA 5EBLB 4Z76B 5DVNA 3QZWB 4EKXA 2FR4B 4XCEB 2FZ3A 5T3XE 3M17B 3CFCL 3RZCA 3HE6C 1IGCH 2E5EA 5CINH 2IWGA 2X4RB 1NAMH 2DWEA 5GRXG 2C4FU 4D9RD 4NQDD 5J11B 4OLXL 4LCUB 3BIAX 3RVUD 2FD6H 1DLFH 4FQJL 1NFIA 5HYJA 2VQTA 4Y4FA 1R3JB 3GMNB 3RHWK 4XI5D 2AJYL 4P2RB 3ARBB 5ESQA 3CFKB 3QNXB 1O5DT 3WJJC 2DMKA 4DN3L 2WUCH 2PW1A 3LQAC 3CFDB 1A0QH 1UB6A 1QSFA 3T1FB 1MJ8H 1OSPL 3GMQA 1UT9A 1QG3A 4KJWD 3WXVL 3VWKC 5J12B 4L4TB 1NL0H 2ID5A 4WI3A 4KTDL 5HGBA 1X5KA 2DQTH 2B4CH 1CU4L 2EYRA 3MV9D 1AGCA 1I9RL 1XF3A 1GHFL 3TA3A 5A2IH 3LZFL 3S4SA 4F33B 1LO3L 3DUUB 1JPTH 2Q7YB 4JPKH 5C0AB 4BKLA 2D4DA 5EOTA 4XCCH 1JUFA 2X10A 5INDA 2YR3A 2NXZD 5F1OB 1NBYA 1J9CT 2D7QA 1C1EH 1U8MB 4JHAL 3QI9D 2X42A 1T7ZA 3RZCC 4XP4L 5C6WH 5TGBB 1TQBB 2GKIA 3CFCH 4HKBB 1S8DA 4XTRC 32C2A 1UB5B 4LF3B 3QUZA 4CL7A 4OLXH 3WIFB 1EO8L 3ZT6A 3H0TB 3MRHB 4FQJH 5I8CA 4ZUWB 4IOFC 1I3RA 3W82A 2AJYH 1YEIL 2A9NL 3L3OA 4NQDA 4DN3H 4NBYB 3L3DA 4NC2B 2W60A 4U1GC 1FYTE 1CGUA 1F45A 3GSOA 4MCZA 2QQQA 4NHCL 3PIQB 2HT2D 3NIFF 1OSPH 3GHBH 3PWPE 3WXVH 2FEEI 4KTDH 4LLAA 1XR8B 1MAJA 5I1DA 4U1LB 2DQFA 3VXTA 5C0BD 1CU4H 4U1JA 4M5ZL 4YPGB 5KOMC 1I9RH 2CRMA 1G84A 3SJVA 1GHFH 5FYJU 1A7PL 1MIEL 3C8KB 3LZFH 4FXGB 5HYIA 1LO3H 4U1NA 1EGJA 4IHOB 2ZKHL 3S96A 4MWFA 4HFWA 1E6JL 4M4PA 2GQHA 3FQUB 4JHAH 2AKRA 5TDPA 3PDGA 1JGUL 4H0IA 4NSKA 5E94B 4WFED 4XP4H 5K33A 4IOSD 4QRTB 4ZUVB 2W65A 1YYML 3QUZC 5D9SB 1BX2A 4DWHA 2PYEB 3UMTA 3IFPA 2VL5A 3OX8A 4UMGA 1UM5L 3DXAA 1EO8H 3QI9A 1OQOA 3PWLA 5BXFA 4XHJC 3GJFH 2EXYD 5CP3H 4EN3B 5IMKB 1UGNA 4NQXB 4NQTA 1YEIH 1Y6MR 2A9NH 2CLVA 1E28A 3RVUC 1ZE3C 3QWRD 3KYOB 4LMQI 2I24N 3NPSC 1WISA 3RGVB 4XI5C 4NHCH 4TUJA 2P5WD 2ITDB 5JOEA 2ATPA 5ACZA 1ORSB 1PD6A 1RZJC 4MNHA 4JJ5B 1EEZA 1CIUA 3EO1A 1IGFL 1A7OH 4M5ZH 4JM2A 4KJWC 2CIIA 4H1LA 4WW1B 1A7PH 3PP3H 1MIEH 3Q5YA 1QFWL 3NIFE 4TSCL 1OD9A 2ITCA 3QDGE 2HJKB 5KSBA 4ZUTA 1S7SA 5C0BA 2ZKHH 2NTFB 3KLSA 1NMAL 4MD0B 4NN6C 4PGBB 1E6JH 3VMPA 5GGVY 1TVHA 1JGUH 4S1RL 2X9YA 1AP2A 1I1FB 2PTVA 4Q97A 5IIEB 3HC4L 1YYMH 4ZPTB 2UZXB 2A6KB 4AMKL 3ZSSA 3QI9C 1ZVYA 3MBED 1NGYB 1U3ZA 1UM5H 2R9HD 5E2JA 3KPPB 2BFVL 5FKPA 3MNVB 5HHQB 8FABA 3V4VL 1EXUB 5JW3L 2IQAA 3NGBC 3BUYA 4JGJA 3RWCB 4PRAA 4G6AC 2XZQL 5F3BB 4HD9A 4ZO8A 4WI8A 4HUKB 4U7MA 2VDNL 3QWRA 4JM2C 4EVNA 4LVHB 1IGFH 2HT2C 2C3WA 4HS6A 3BP7B 4Y2DD 5F9JB 5BW7A 1BFVL 3O3DA 1QFWH 2P5WA 4UNTA 1EFXB 3JV6B 4TSCH 3B3IB 4G8GA 4FTVB 3OAYH 5AG9A 2EIZB 1NMAH 4S11A 3BZEA 1J05B 3I75A 5L2KD 1CDIA 2CSPA 4QF1A 4S1RH 4G8EB 1FNGB 2IPUK 2Y9RT 5ACMA 3HC4H 1XGQA 4AMKH 1G9ML 4LLVB 1OW0A 1ONQA 2Z91A 4F2MA 1SQ2N 1T22B 2BFVH 2ZSWB 1DVFD 2VLLA 2Q86A 3MJ6A 3V4VH 5JW3H 1T1YA 1UADC 3WKNA 5FV1L 2P8LB 1FLRL 1KG0A 4DZ8B 2EXYC 3A6BL 5HI5D 5JDJA 2GCYA 3IKCA 2XZQH 5HYFA 1U92B 4HT1L 1ITCA 3ARWA 2NY0B 1W0YT 4YFEA 4CUCA 5E2UL 3FQXA 5EO0A 4U6VL 2VDNH 2BY2A 3MRRA 2OLDA 2QTEA 4RQQB 1FVDA 4UU9B 5BW7C 5EZJA 3QDMA 4Y0GA 4F58H 1BFVH 2F74A 2E9IA 2M8XA 3MREA 3O41B 2BZDA 4GSDL 3U36A 4PJ8B 3QXDB 1QLRB 2AXGB 1JTOA 4N68A 2R0ZL 2VO5A 1RPQA 3RBGA 4PTUB 3W0WD 4P46B 1UXSB 2J12B 3DUSA 3X13A 3U0TB 1S7WA 3KYMA 2HT3D 1A1OB 1OW0C 1UM4L 3MGAA 1G9MH 2RQ8A 1BVLB 3O8XA 1XGYL 1AGDB 4C56E 4YHNB 2H32H 3PUCA 4MSWA 3MBEC 2R9HC 3VMNA 1FLRH 2IH3A 4NUJA 3GKZA 3A6BH 3K4ZA 4MD5B 1QFOA 4HT1H 1GGBL 2R2CA 2VDOL 3QA3B 3U83A 4UIKL 1DTUA 5GGTA 4M1GL 5E2UH 5IT2L 4U6VH 1I3UA 4LGRB 5B21A 2ZNXA 1RZKC 3S3PA 4NKOB 1TITA 2N1KA 2W0KA 2AJ3A 1PJ9A 3T65B 5FYLL 2JKXA 3SKOA 4ZQKA 4CU8A 2ESVA 3FO9B 2R0ZH 4MB3A 3FQRB 2D7PA 5EORL 2X09A 3WFHB 1U58A 1D7FA 3FL7A 3CX5J 3MRLB 3BD3A 4JRXE 2DLHA 1QPXA 3MA7B 4WUKL 1EFQA 1UM4H 3OGOE 5D96B 1RK0B 4EI6A 5EUOA 1LMKA 2EDOA 1LEKB 3EJYD 1XGYH 4AIZB 2NX5D 4G9DA 1CDBA 2C4XA 4MLIA 1GZQB 3UROR 1F11B 3HB3D 5EU6B 1X5FA 3D85D 1DVFC 3MRFA 3KPTA 1GGBH 1HHJB 1CD0A 2VDOH 4JKMA 4UIKH 4M1GH 3WKML 4KDVA 5IT2H 2YMXL 4L8BB 4JO2L 5IFJA 5H94B 1CDJA 3TIEB 5I76B 1NUNB 4F57L 5INCA 4X6DF 2YRZA 2A73A 2VE6B 3I6GA 3OJVC 5FYLH 3PWNA 3RIFK 2NY5C 5BS0B 3CZFA 3W9DA 1JGEB 3DWTA 3UTTD 2ORBL 4DEPB 2J2ZA 4QRPA 2CLRA 1KOAA 5EORH 4MNQA 4X7TB 4ODUA 2YBRB 2MJWA 4AK1A 5HYSA 4U4BA 2LU7A 3OXRB 1QBAA 5C8JA 3QH3B 4WUKH 3BAEL 4N0UA 4GKNB 3VA2C 4L9LB 4OZGF 3VFTB 1LK2A 2AK4B 1BVKA 1H3VA 2HT3C 3QIWD 5SX5H 3MFGB 4NC1E 1KLUA 5FGBA 3K81A 1ZT1B 3VW3L 4DQOL 2HFTA 1W72L 3W9EB 4ZNEE 3BH9A 4OLYL 3BP6B 1D5XA 5DQDL 3MRMB 3HE7D 1Q9KB 3ZKSD 1M6OB 3TCLB 1AY1L 4PJGB 1FDLL 1IM3B 1D5MB 4PY7B 2D7NA 3ARTA 3PHQB 3R06A 4GAYA 2MKWA 4R7NA 3WKMH 3WN5B 2O5ZL 2YMXH 3ZYOA 4JO2H 3O0RL 1PBYA 3OJDB 2ZWLT 4ISVB 2EEDA 1FVCB 4F57H 4R96B 4IMLB 4W4OC 3ZSTA 1XGTA 3RPKA 1K4CB 4W68A 1NC4A 1WCBB 4GRWH 2IAND 5I8EA 5BVPL 1P7QB 2ORBH 1HIML 5F9WB 3BH8B 2XV6B 3VXUA 4OF0A 4X6DE 1HI6A 5JOPD 2GY5A 5T1KA 5IVZB 1G7LB 1Z5LA 1VEOA 4MJIE 1CDHA 3BAEH 5KS9F 3KPQA 3ZDZF 4K7FB 4AENB 4YK4C 4HWNA 1EZVY 5CEXB 5SWSB 3O2VL 4UDUB 3VW3H 4DQOH 4NO5B 1U2CA 1DQJA 3ISWA 4JZNA 1W72H 4YDKL 4PJCB 4OLYH 5DQDH 3EJYC 3ILQD 3HG1E 5HI4D 1AY1H 4LFHD 4QCIA 4OZGE 1GAFL 1FDLH 1LP9F 3MCG1 1BLNA 3HB3C 5DJYA 1F4YL 2OZ4L 3P9LA 2O5ZH 3STLA 3O0RH 3VXPB 1ZXQA 2XNAB 1A4KB 3VXSE 1RAMA 1A3QA 3PWUA 3GSXB 5D93B 4IRSA 5DJ0A 3RWFB 2AABL 2ZUUA 4QRSB 1D5BB 2EDKA 2F19L 3CUPB 3RNQA 5BVPH 1M05B 4KXZH 1HIMH 2GJZB 4JDVA 4F7PB 3GSNA 5I6XB 1B88A 3VFOB 3MLVL 3MACL 1NH6A 4RCAA 5DC9B 5I30L 4Z7QF 1A7NL 1NFKA 3SDCD 3DVFA 3HS0B 3V0AC 3MUY1 2HN7A 5D1QD 4V1DB 3MJ8A 4M8QB 4C54A 1KPRB 2YPKA 4Y1AA 1MEXH 2Z9TA 4Y19A 5EO9B 4CKVX 1ZGLM 1F4WL 4UT7L 1EA9C 5JPMB 3UYRL 3K8MA 3O2VH 1FRGL 4YDKH 4P2OA 1G9NL 3QIWC 5KS9E 5ESAA 4WU7B 3ZDZE 5T3ZE 1TIUA 1GAFH 2AI0L 4I0KA 1LDSA 1JN6B 2CRYA 4QXTA 1DFBL 1T7XA 3DMMD 3PDOA 3WHXB 2I5YL 5FOBB 3CVHL 1MCNA 3HE7C 2Z92A 1F4YH 4OFIA 2OZ4H 3AVEA 5TDNA 5GGVL 2NY3B 2OTPA 3CXDL 2XTJE 5IW3A 4X4XB 3G5VB 3WFDL 5DURD 5E8PB 3VXMB 4BUGA 12E8L 3VXOA 1YEHL 4KV5F 4OF6A 5IEHB 1YZZA 2X4PA 4JG0L 1PAMA 2AABH 1HEZA 4J4PD 4FFWC 4KHTL 2F19H 2BNRA 3OKKA 4IRJD 1MCLA 4JVWA 3MRGA 5KOVC 4ZSOB 3MLVH 3MACH 3LN5A 5DHVA 5I30H 1WITA 5GGUA 3GSUA 2P7TB 1HQRB 1A7NH 3U4EB 2DICA 5DJZB 3WFBL 5ETUB 1ZHKA 4EQ2A 2OTUA 4PREA 1NGZB 2O5YL 5F1IA 5DRWB 1R24B 1ACYL 5EZIL 3QEUA 1F4WH 1BWWA 4UT7H 3PWJA 3UYRH 4P2OC 4Z7QE 5E56A 1FRGH 3EZJB 4KRNA 5D1QA 1CE6B 1G9NH 3NCYS 3EYVA 3PE9A 4OAWB 4U2YA 5D7JB 5KW9L 2ZUVA 1T4KB 2AI0H 2XG5A 3U7AA 4B7IA 1DFBH 2I5YH 3CVHH 2RR3A 1FSKB 3ILQC 2GJ6B 2FSEB 4U1IA 5GGVH 4JRYB 4RAHA 3FO1A 3OKLB 3CH8A 3CXDH 1U8JA 4LHUB 3WFDH 3NABL 2YPLE 4R6UA 2X2YA 4XH2B 12E8H 3PABB 5C07B 4CW1A 1PQZA 1YEHH 2P46B 4F7MA 4JG0H 2VLJD 4R4BB 3UTTE 1IGJA 3MRQB 4PJ7F 4JFPB 4KHTH 4HKXB 4UOW1 3DETD 3V6ZB 4PD4K 4KV5E 5DD3L 3DRQB 5J9PA 1F4AA 4LCIL 4ZFOA 4PJEB 4G9FE 1TTGA 3WFBH 2YD9A 4J4PA 5D1ZA 4IRJA 1MHEB 4LLMA 2GW5A 1P84J 1M71A 3KPNA 4I2XA 2FJHB 2O5YH 4JFXA 5CJBA 2DTML 1ZLVK 3SDCC 1ACYH 1BREA 3GGWB 5EZIH 1KSRA 3VFPA 5D1QC 3QUMA 2HRPL 2V9RA 4QGYA 4WTZA 3TPUA 2VB5A 1RUQL 4KRLB 4P5TD 4YDLB 3GK8L 2AXHA 1EAPB 1EJOL 1PEWA 2QADD 5KW9H 3A6OA 5IB5B 1FFOA 2DD8L 4Z7VA 5IBLD 3PGFL 1I7TB 3T0VA 2DQEL 3T0EE 3QULA 2EO9A 4R26L 4GG6F 5GISL 1Z6JT 5DMYA 4UI2A 4LSVL 3UDWC 3NABH 3DMMC 3I9GL 1WBXB 4HIIB 3EW3B 1T66D 3MLZL 4LPWA 4NKDA 1QSZA 4OQTA 4EXPX 2LABA 3O81A 5TE7L 1LK3L 1DDHA 2R0WL 4WI2A 3D0LA 4HV8B 2WQRA 4GQ9L 1RJCA 2GHWB 2APFA 2EDWA 4X99B 3V4UL 4OCNC 2VLJA 5D70L 5DD3H 5MEPB 3FB7B 4LCIH 4J4PC 3V4PH 4IRJC 2X4QA 1CXEA 1UKTA 4KK5D 4BELD 2GAZA 3BQUA 4PJ7E 2P49B 3W5NA 3T1WA 1QEWA 1S5HB 4Y5VC 4DVRL 4P3CL 2IAMD 5IUSA 4TNVF 5CBEB 5HPOA 2DTMH 5DYOB 3DVIA 4L9DA 2DJSA 4N0FB 2VNCA 4M6AA 2W1NA 2HRPH 2R1YB 5M7QA 1FGVL 1RUQH 1X5ZA 2B5IC 3GK8H 4JHBA 1U8NA 1EJOH 5EZLA 2DD8H 3G6JB 4HLZG 1AO7E 2CRZA 3LQZB 3PGFH 5K9QG 2DQEH 2EDTA 4HMCA 1P4IL 5DK0A 5DVKA 5E95B 2QSCL 4R26H 5GISH 1BD2B 1N2RA 2GITB 3VXNA 4LSVH 1EHXA 1IEHA 4WV1B 3CSYA 3I9GH 3HZKA 3MLZH 4JY5L 5DVMA 2JTDA 1U3JA 1QLFA 1YEEL 1XMWA 2HVJB 4OKVB 1RK1B 3SEPA 3T0DA 2NNAA 5JLZA 1HDMA 5TE7H 4GG6E 1LK3H 2R0WH 3IDGA 5CSGA 1OD7A 5K93A 4IRZL 1DUZB 4GQ9H 4LHQB 2AV7A 4PJIF 4P2QE 3V4UH 2QR0B 3UCRA 4OLUL 4ERSL 5D70H 5E5RB 1CN4A 1VFAB 5HDOA 1SBSL 3MROA 3K4DA 1NGXA 1U3HA 1ZGLB 3DETC 5IF0A 4DVRH 1NCDL 4P3CH 2ZUSA 3L5WA 2KQNA 1MVUA 4MJ5A 4PJXB 1YA5A 4RMSA 3ZT7A 1JF6A 1QVOA 1FGVH 4NQEE 4FNLL 3O6ML 5CLTA 5GPRA 3FO2B 5CD3A 1KTDA 1ZV5A 4EQ3A 3ARGB 3H9SE 3HI1B 1ZMYA 5CIPB 2JB6A 3ULSB 1OVZA 4P5TC 2DI8A 1IFHL 1P4IH 4WJ5B 3RL2B 5FUCE 2QADC 2QSCH 5IBLC 3BXNA 1K3IA 5I75C 3BKYL 2BVEA 3ZKMD 3WV0A 4JY5H 3C5JB 1YEGL 3O4LB 2YUXA 1YEEH 5DVLA 1G7IA 1FN4B 3B9KB 3VH8G 1T66C 3ZO0A 1MJJA 4NZUL 4IRZH 4IBLT 2YEZB 3RDTD 1JHTA 1UC6A 1EPFA 3RWHA 4OLUH 4ERSH 5F7DB 5EC1B 1SBSH 1XGRA 3JZ7A 1I8IA 4XBPA 2MHAB 1J8HA 5DJAB 3WLBB 4BK4A 1UFUA 4W6XB 5HJ3B 1NCDH 3STZB 4YXLL 3E1F1 3OKMA 4WNQA 3P0YL 4PJIE 4KK5C 3BDXA 1UZ6F 2Z31D 5E8OA 5JDSA 2Q20A 1VKXA 3EBAA 5D2NB 5JW5A 3QT2A 4PJBB 4FNLH 3O6MH 4JFFD 1Q94B 4X8JA 4PRNA 1AR1C 1DR9A 3F8UB 3S35X 3IS1X 5K9KB 3PQYD 3GBLA 3FQWA 1IFHH 5C0GA 1LO5B 1JMZA 3VGAC 1YJDL 4NUGL 4HUWB 3NFPA 4L4VD 2EE9A 3BKYH 4J8RA 2QQLL 3VRIA 4TRPL 5IFHL 5DJCB 3SGDI 1YEGH 1A2YA 1T0MB 3EYFB 1RMFL 3OKOB 4NZUH 3SKMA 5HHPA 1D6VL 2BNUA 4OZHB 1KYOK 1OWRM 4ZTOL 3U9UB 4QRUB 3SDYL 4HS3A 2Q87A 4PB0L 1ZHBA 4BK5A 2DQHL 4YXLH 4YFLF 5FO7A 3P0YH 3BGMB 4WW2A 4NCDA 4MQSB 2WIIB 1S7QB 3RFZC 2FBJL 3FRUA 1MHCA 2FO4B 5DRZA 3TBSA 1U3YA 4U31A 4MXWL 3QO1B 3TN0D 1UA6L 3DI3B 2MOVA 5D6CB 5IHUL 4G43B 3X14A 5BOPA 4CVWA 5DZOA 1UZ6E 1MLBA 4H20L 5BZDB 1IL1A 3MXVL 3QUXD 5FV2A 2FJGA 5E8DL 1ED3A 2VISA 3LDBC 4JFFA 3EKCA 1YJDH 4NUGH 4R97C 3AB0C 3B43A 5E8EB 2V9QA 3FFCB 5T1LA 4WI5A 3KXFE 3O45B 2QQLH 1MF2L 4TRPH 1QR1B 5IFHH 4U1KA 1TTFA 2N4IA 2X4OA 4JFYB 4Y4HA 5TF1L 1I8MB 1GSMA 1MI5E 5FKAB 3N50A 1RMFH 3WUZA 1MCQA 4L4VA 3ZKMC 3NN8A 3FFDB 5HGAA 3RWIA 5ADOL 1FYTA 3DX9B 1D6VH 4WUUD 2HLAB 3SY0B 3C5SA 3PWPA 4X7CC 2KPNA 3OR7A 1EHAA 1TPXB 4ZTOH 3C60D 4OFKA 4HUVB 2HKHL 3BEVA 3RDTC 3SDYH 5DEFA 4PB0H 2DQHH 5KG9A 4XNZB 5D72L 4RFNC 5TH2A 1A7BA 5BOZG 1JNJA 1DUYB 2FBJH 3KPLB 1KTLB 3Q0HA 3NCYP 4Y5YA 1U8PA 3AU1A 4QEGA 4MXWH 3T2QA 4MGXA 2Z31C 5IHUH 2PCPB 3RY6C 4H20H 1U8IB 3D39E 4U1HB 3MXVH 3TZVA 4NDMB 4YBQD 2XWTB 3BWAB 4AIOA 5DUBA 1HWGB 1HYRC 5E8DH 4M7JL 5EC2A 3MLWL 5E24E 2ZOKB 3SO3B 2UWEF 1N26A 1MF2H 3RIAF 5L9DL 3E3QE 4NNYA 5F1SA 1U36A 1E0OB 5D71L 5TF1H 5MI0C 3HLAB 4GKSA 3TF7C 1SJVA 1Y6KR 3TT3L 4LRNL 1HH9B 2F8OA 4PRPD 1F4HA 5ADOH 2XKNB 1BBJB 4PRIB 1J87A 1INQA 1X5IA 1D9KD 5KN5A 1FQ9C 2VAAA 3FB5A 3NZ8A 1NCCL 3BISA 1NBVL 1MFAL 1IZJA 1GOFA 3TVMB 3MRNA 2HKHH 3RVWC 5DFVC 4LCYB 3SDDD 1BZQK 3V95A 1J12A 5GSVA 2VERN 2YRLA 4HWZB 4WUUA 3EYQC 5D72H 4LLYA 4HIXL 4MHHG 2BP3A 4PJFF 2NY7L 1CGYA 3B9EA 4FQIL 3I50L 3QDGA 2VXSL 4WFFD 2MQCA 2BK8A 4XPHL 5BO1L 2ZG2A 1BOYA 1ZT4B 2C9AA 2G2RB 3RWEB 1OAYL 3BGAA 5IMLB 1KCUL 4BQ9A 2VDKL 5KSUB 1BQHG 3O6FA 3QFJE 1KGCD 1NCNA 4M7JH 4O4YH 4X6EA 5C0CD 3MLWH 5IM7A 3QUXC 1AHWB 5L9DH 2VKWA 1I7UA 5D71H 1A14L 2D4FA 2MNUA 3TT3H 4LRNH 3B9DA 3D3VD 1AIFA 2UWEE 5GGSY 1NCCH 4IJ3C 4QOKD 1NBVH 1MFAH 4G8FA 5C0ND 5EN2B 1FL6A 3ORJA 1LE9A 1T1XB 2VXQL 1D9KA 2NY4C 3OAUL 4HIXH 2G9HA 1JYWA 2NY7H 3VXRD 3C60C 5CEYB 3HC3L 4JFED 3SKNB 1JFQL 4E42A 2HG5A 1OSZB 4FQIH 3DO3A 3I50H 5HDBF 4LKCA 4KROD 2VXSH 2EDLA 4JAMB 4XPHH 5BO1H 3VDBA 1OAYH 4M6ML 3GSWB 5F7UA 1BZ7A 4PJFE 5CLWA 1XF2B 4O51A 5GSRB 1KCUH 1MLCB 4KMTL 4HIJA 1G7MB 2VDKH 3TJHD 4P4KB 4U6XA 1NAMA 1RURL 1BQUA 1LQSR 4WI4A 4Z5RB 5CJ8A 4YBQC 4X7EC 1FV1B 4D8PA 3ESVF 2CK0L 3HE6B 3TBTA 1VADB 1W0VB 5IBTL 1A14H 4I3RL 2E7CA 5T5NG 4LCWD 4WFGE 5SWZB 5IP4A 3ULUF 3NFNB 5DMGD 4RX4D 3U2SB 5BZWB 2N7AA 3SE9L 4E0RA 3B4NA 3V79C 4BZ2L 1LNUA 1FAIL 5BVJA 4ESKA 1HKLL 3P9MA 3FJTA 3ZKXC 1IZKA 2YC1B 1D9KC 2MPAL 4F9PC 2VXQH 3OAUH 2O26U 1A6VL 2DBJA 2P5EB 3HC3H 5D8JL 3VWKB 2F8XC 1JFQH 3KS0J 3FRPA 3SDDC 4F8TA 3LV3B 1I85C 5E2VL 4NZJA 2VR5A 4ZFFB 4X0KB 3HKFA 4M6MH 1QQDB 2Q3ZA 4KMTH 4TSAL 3QAZC 1YNTB 5JNYA 2R23A 4ZOAA 5HDBE 4JQVA 4OUUA 2VXTL 1RURH 3HPJB 5EUKB 5MERA 3W11D 3JUZA 3BKML 5E5MA 4C56A 1R5IB 3LEVL 1MCEA 2DYPA 4RMTA 1MCIA 1HCFX 2DWEB 5IWLA 2CK0H 1ROWA 5IBTH 4I3RH 2Z8RA 4QRRD 2HLFD 3NCCB 5KZCB 2BOCA 3I02B 1F3DH 3SE9H 1B4RA 1KTKE 3VG9B 4DUXA 2B4CC 4BZ2H 1FAIH 5HHOB 1HKLH 1NMCC 4KRPD 5J3HD 2VIRB 3MJ7B 4MNGB 1CL7I 5B39G 3EOBA 4U1GB 1RI8A 3IJYB 2MPAH 4HAGA 4I3SL 3TC9A 3ULUE 1QRNE 3BVNA 1S7RB 3VDCA 2R0LL 3T3MF 4OUOA 3ARED 5HGBB 1A6VH 1FORL 4GBXA 5C0NC 3JWOL 5D8JH 1F90L 2DB8A 3O3BA 2EYRB 3K80A 4GW4A 3CCHA 1AGCB 2ZOLA 1ZS8B 1BJ8A 3OPZL 2C1OB 1KT2B 4PJ5E 5E2VH 4E41E 2DQGL 4KROC 1TZIA 4JQVC 3C2AL 4N9GB 4TSAH 1AGBB 4JRXA 3RP1A 1KJ3L 2VXTH 2L0DA 2KH2B 1EMTL 1O7SA 5DJ2B 3IFNL 2DQDL 5L0QC 2DM4A 4YEEA 4MS8D 3BKMH 2FLBT 3NACL 4YWGL 3TJHC 1G6RB 3TNNB 3LEVH 5IQ9A 2G75A 4G8IB 5IWLC 2FX7H 32C2B 3QUZB 3RUGF 3MLTA 5T5NF 4H5SA 3KPSE 1S9YB 5I66B 4PRDA 4NM4L 1KCKA 1P7KB 3I6LD 1JIBA 3HZVA 4HJGA 1NC2D 4JLRA 4NQDB 3OJMB 4GS7C 5E2WL 4HAFA 2Q6WB 3L3DB 5DMGC 5DJ6A 5T5FL 4MCZB 1FNSL 3P77A 4HJJL 3NPSB 4I3SH 1GVIA 3WSQL 1F3JA 2R0LH 1FORH 4HXBL 5FOJA 3JWOH 3OXSA 1F90H 1NFDB 5K9OB 3L3GA 4U1JB 1HOCA 4HXAL 5IVXA 5IJVA 3T0XA 1C5DB 4I48A 2DQGH 3KLHD 4FFYL 3AREA 2DJ4A 2F54D 3T3ME 1DCLA 1N0LA 3CC5A 5GGRA 3C2AH 3MV9B 4ELKB 1KJ3H 4HFWB 3IDIA 1EMTH 3ARYA 4NN6B 3IFNH 4OM0L 2DQDH 2FWOB 3NACH 4YWGH 3OX8B 2NXZB 4ZNEA 5D5MF 3IYLW 3QI9B 4ZPVA 3PWLB 4G6ML 5DDHA 4NM4H 4LDLB 3EOAA 1YN7A 5F9OL 1KPUB 3HUJF 4X6BA 5D2LB 1E28B 2HLFC 5JW4M 3NGBB 4N0RA 5E2WH 3RUGE 3C09C 4JGUA 5T5FH 3BPNC 1FNSH 1HNFA 1YNKL 3GJEB 4HJJH 3MLPA 3WSQH 1SMOA 5FA4B 4KRPC 2E8ZA 4HXBH 2IPUG 1W8OA 3DTXA 4ORGA 3PGDB 4HUUB 1JYXA 1H3TA 4XPFL 2I27N 5A3ID 3GDBA 2L4OA 1HXMB 1OLLA 4HXAH 3DROB 3QEQD 2CIIB 3AREC 1N8ZA 4NN5C 1H5BC 4FFYH 2ITCB 4X6DA 2F5BL 4NQVB 4ZUTB 3L9RB 1SJHA 5C0BB 5CUSL 3A0OA 4JO1L 4M6OL 3BOVA 4E9LA 1X4XA 3D69B 3NMEA 5GS1A 1CT8B 4BQBA 4OM0H 3O6LL 4HK0A 4NC1C 3L5JA 3B5GA 3RRQA 2APWA 5DQJA 2R4RL 3ZHDA 1VB9A 5ICXB 5GGQL 4WEUD 2YD1A 4MS8C 4XMLL 4O2FA 4G6MH 5FKPB 4OZGA 1JNNL 8FABB 4RAUA 1FPTL 5F9OH 5TPWL 1P6AB 4ELMF 2XRAL 1BECA 2BSTA 5D5ME 4XVTL 1MREL 1YNKH 3VXSA 2H45A 4ZYKB 1F3RB 2OM5A 1Q9LA 3HUJE 1KC5L 4XPFH 4XNMB 1TCRA 2YHGA 3AAZA 3ES6B 3FQNA 5EBGA 3O3DB 3TIDA 4PLKD 2P5WB 1UG9A 3QQ9D 4LKXA 3AS1A 5SX4H 4CMMA 2F5BH 1G0DA 2GTZA 3QZWG 1X6NA 1KIUA 5CUSH 3S37X 4JO1H 1LE5B 4M6OH 5GS1C 3KLHC 4ONHA 3I75B 5F7HA 2CK2A 2OR8A 3KPRE 2EIDA 3F7QA 3O6LH 3QDHA 2QSTA 4G80B 4ODSL 1JYVA 3PF2A 3V7AG 4HEME 1NBZB 4N8VG 2R4RH 1WF5A 5JTWA 5GGQH 3QXVA 4XMLH 1YY9D 5KSAD 5KS9A 3BHBA 1IAIL 2VLLB 1JNNH 2F53D 2Q86B 1ZWIB 1FCGA 1FPTH 5TPWH 5CMAB 2XA3A 5D7LD 3H3BC 2VLRD 5FK9B 5FYLD 4FHBD 3T09A 5H35A 2XRAH 1KG0B 3MBEB 3RWDB 4H25B 3BPCB 3IKCB 2BXZA 4XVTH 3DNKA 4LSSL 1MREH 3MMEA 1JGDA 1KF9B 1QOKA 3VI3F 1MJUL 1LP9A 3FQXB 1QSED 3V52L 1KC5H 4ELME 4JFDE 2NW2A 5EZJB 2NY2D 3F12A 2F74B 5BQ7B 3ARZA 3TESA 5A3IC 3OBAA 1I3VA 3L3HA 1FNHA 1G9MC 3OGCA 5IB2A 4Y2DB 5F88A 5MENA 3OKYA 1S7WB 3PL6A 4ODSH 4HKZA 4LDOB 3SOBL 4NPYB 3MRDA 3K0WA 3VFNA 5L2KB 2BNQE 4RFOL 3DBXA 4M3KB 1IAIH 2WNGA 3T4AA 2BRQA 5CSBA 4NQUA 2EYTB 3P4NA 4NRZB 1B3JA 2CDGB 1A4JA 2EKSA 2XTJC 4S10A 4NUJB 1HHGB 5JHDE 5KSAA 4LSSH 1DVFB 2YPLA 5MHSE 1L9NA 3FKUS 4EI5D 3LEYL 3MV11 3S36L 1P7HL 3ABZA 4Q2ZB 3V52H 2E7LA 2UY6A 1TZHB 3IAGC 5GIRA 2P4AB 5IHLB 4D2NA 2JB5L 1E4KA 4NGHL 3VI3E 1AXSB 4BSJA 4G9FA 2X70A 4PLKC 1VENA 1SVZA 3QQ9C 1U58B 5DZNA 5DVOA 3PL6C 4DFIA 2ZSVB 1OHQA 1MNUL 2WWKO 5ITFB 2X4TA 3FB8B 3SOBH 4J3OC 3W0WB 1FFNA 1C7SA 2I9LA 4J3UA 1T2XA 3FZUD 4XB8A 3QHTC 4RFOH 4U0RC 2FDBP 4YE4L 1U8HA 4NT6B 2ZUXA 2CIKA 2XICA 1UVQA 5GXBB 3T0EA 3SE8L 4ETYA 1YY9C 5KSAC 4X8XA 3GEWB 1T04B 3NCFB 3FT4A 3MRFB 5ALBL 1S7XA 5AUMA 3CH1A 2YKLL 1MCJA 3SGKA 3U0WL 2VITA 1RHHB 1JE6A 3HC0A 3LEYH 3S36H 2CR6A 2DIJA 2EDFA 4PRBA 2C5DC 3ARFA 3O11A 2EDYA 4X83A 1ZSDA 2FIKB 2JB5H 2JIXD 4L1DA 4NQSA 3QIBD 4NGHH 4J23A 3OKDB 5HHME 2FATL 3M07A 5ISZE 3CFEA 4WHTA 4QRPB 5J89A 4PJ7A 5E9DD 1AKJA 1E6OL 1HYSD 3HAEH 1MNUH 5FB8B 4I0PD 1EUTA 2KBGA 5ACLA 4OZ4B 1JPSL 1W72A 2B2XL 1UXWA 2V9TA 5DQ9A 4CMHC 1OB1B 4KTYA 2E8YA 5B38B 4YE4H 3KYNA 1FZMB 1AO7A 3Q3GB 3BH9B 1D5XB 2UYLA 5IW6A 3RPIB 1EV2E 4P2RE 2OX5A 3SE8H 3LRGA 1WC7A 3ZZ1A 2IBGA 4HCRA 1XF5A 3EDDA 1H9VA 2NX5B 3BYYA 5ALBH 3SGKC 3TO4A 3V5DA 2YKLH 3R06B 1HN1A 3U0WH 4QHKI 2PO6D 2JJVA 4L4TE 2QKIA 4G5ZH 4KC3B 2YN5A 3ARFC 4N1CA 5JORA 3D85B 3H9HA 4JZOA 1G7QA 2CO7B 4ENED 5BJTA 5C0DB 4GG6A 2GUOB 5TDOA 4AH2A 4EI5C 1CICD 3DOSA 4LOUD 5C9JA 4P2QA 4NQCA 4MA3B 3HAEG 2FATH 4LQFL 5C0AE 2ZCKL 1WVZA 1U8QA 4OCYL 4BH8A 5DD6B 4O2EA 3B6SA 2NXYD 1E6OH 1Z9LA 3QIBA 3UPRA 5TF0A 3BIKA 3ULVF 5CAYB 1JPSH 5HYQA 2FX8L 3EO0A 1T2JA 2B2XH 4MXQC 2PXYA 4NQEA 1T0NA 5IV2A 5I1HL 3CDYA 4DZBA 3G5XA 4H1LH 3WJLA 3IJSB 3H9SA 2V2WA 2BY1A 5AZ2L 4M61A 2OZ4A 3SGEH 3MX0A 3TO4C 3C5ZD 1ES0A 3QIWB 1N4XL 3PDDA 5EO1A 2A9ML 1NGWB 3LEXB 1BLNB 1HNGA 1XGUB 3OR6A 5DJYB 4ZAKD 1AH1A 3HE7B 4KJQC 4PJHB 2W9LA 4LEOB 4B0MM 3VU2A 2XFXB 3L5XL 4WEBL 2CKBL 2M1KA 3PWUB 3RWGA 3HNVL 1G7HA 4JQXC 5DJ0B 1TVBA 2YXFA 4PJDF 3ZL4L 4ACPA 1R0AL 2W07A 3MUZ1 2LTQC 1IC4L 3QP3A 1AQDB 1QA9B 4LQFH 2ZCKH 5JA9A 1DN0A 3QIBC 1HINL 4OCYH 3GSNB 5F6IC 5FECA 3WDHA 1ZLVH 1NEUA 1A64A 1TXKA 4PJIA 1N59A 2IANB 4KKCD 2HN7B 4HUXA 3MJ8B 1VACA 4HKJB 2OL3B 4LSRL 2OJEB 4Z0XA 3MZTA 5GHWL 2PYEE 1MCWW 2FX8H 5I16B 4KFZC 1MWAB 4RZCA 5I1HH 3WJLC 1HYSC 4XVSL 4S1DD 4I0PC 5ICZA 1CVRA 4KI5D 5CHNA 5H2BB 5ICYA 4LRIC 4HFUL 1MCDA 3CVHA 4GUPB 3ULVE 3J8F7 5AZ2H 4N1EA 5ESAB 5FDWB 2YXMA 3RL1B 2Q3AA 4XVUD 4QXTB 1N4XH 2A9MH 2Q76A 3QWOB 1FC1A 2Z92B 2DI9A 3UPCA 2A6DA 1T0PB 4H8WL 4Y7MA 5C08D 1QNZL 4C57C 3C5ZA 1K2DA 3VXQA 1HILB 2X89A 3L5XH 4HX1B 4WEBH 2CKBH 2PO6C 3WS3B 3HNVH 1GOGA 4ZAKA 3ZL4H 1R0AH 1HH6B 5C0IB 4ENEC 3WNOA 2DLIA 2NY1D 2VJXA 1IC4H 1NMBL 4F37F 1JF1A 3N1FC 3LKNB 3K8LA 2JCCB 3MV7D 4LOUC 1HINH 5DHVB 3P0GB 5DFWH 4QT5A 5L2JA 4QHUA 4N90D 4OB5L 4XPGH 2E27L 3ME0A 1Y0LA 5GGTL 4DUVA 1QBLL 1XF4B 4Z78B 1G9NC 4LSRH 1KXQE 5E99L 5GHWH 3ZKNC 1SYVA 5F1IB 1JWUB 5DA0B 5B3NA 4XVSH 1PGRB 3SDCB 3MRKB 2R1XB 1CBVL 4HFUH 5D1QB 3QDAA 5I9QC 4R4ND 4PTTB 4Y2OA 4GAGL 2Y6SC 2ZUQC 1DANT 1FLTX 2LAGB 1RZIA 3EYVB 2J6EL 2D9CA 1MIML 1ORQB 2UVEA 4LLWA 5DD0L 3IDNA 3KXFA 4U1IB 3C5ZC 2ZG3A 4H8WH 5IMOB 3FO1B 3MV8D 2BSRA 1QNZH 1QBBA 4GG8A 3BO8A 4AEHL 4AT6B 4XBEL 5JW4R 2DL9A 1MI5A 1RZFL 2XN9D 4KQ4L 3DMMB 4ZAKC 1PQZB 2ZZUT 4RMVA 3VFMA 3BDYL 1T03L 1J86A 1AD0B 5T1MA 5C08A 4D0CA 1NMBH 5DURB 1CZ8L 4FTVE 3U6RA 4JO3L 2DL2A 3L3KA 3UPAA 3WMSA 1S7VB 1P7QD 4OB5H 4ZFOB 5JO5A 3VD5A 2E27H 4P3WA 1IKNC 4CU7A 5GGTH 4IRJB 1QBLH 4NIKB 3MV7A 3FN3A 1B0RB 3DRTB 5E99H 5JIKA 3GMRB 3KPNB 4JFXB 4Y5VB 1TNMA 2NZIA 4KVNL 4NO3A 1CBVH 4HGKC 1IAOB 3OZ9L 3RI5F 3BW9B 3LKSB 3D39A 4GAGH 4S1DC 1CD1A 1PY4A 5GRZA 2J6EH 4KI5C 2B5IB 3B5TA 2ZUYA 5D7KE 1AI1L 1MIMH 3LRSB 3LMJL 1JRHI 5DD0H 3RY5A 4IOIB 4QTHA 4XVUC 1T83A 3IETB 4AEHH 4XBEH 1RZFH 4KQ4H 4JY4A 3UJJL 2D2OA 1J7VR 4TUOA 1WIOA 3BDYH 1T03H 2YS4A 1Q9OA 4V2CB 3MV8A 4XP9L 4X4YB 3VD9A 2R1WA 1CZ8H 2CRIA 4HZLB 2XN9A 3D0LB 4JO3H 2VLJB 2NY1C 1R3LA 2X4QB 3DGGA 1BIIA 2NLJB 3WIHA 3P73A 3MJGX 4QY8B 1EBAA 3MRPA 3HR5A 3D0VB 4OBRA 4PG9A 2OBGA 1IGTA 4KVNH 1WK0A 4XGZA 3TGXA 4LLDB 1SY6L 3RZWA 3NOIA 1X3DA 3OZ9H 2GSIB 4X5XA 4POZD 4HSQA 3QFJA 1U8NB 2H6PB 2C3VA 5F8QC 2QEJA 1AI1H 1UH3A 2RIKA 2CXKA 3QJFB 3LMJH 4R4NC 2DIBA 1AC0A 1T83C 2X1PA 1MCSA 4P5TB 1WFNA 3V6OE 3UXFA 1N2RB 4PR5B 4NOFA 5F3HB 2QADB 1VFUA 3BP5A 3DJ9A 4EIZC 3UJJH 4FQXD 4PGJA 2UWEA 3AY4C 1AD9A 2P42B 1FL5A 4XCFL 4JDZA 4XZUA 4XP9H 2NNAB 1HDMB 3K2MC 5ENWA 3IDGB 1K8IB 2HA1A 1VEMA 4RMUA 2Q7NA 1PDKA 1W0WB 2BOBA 1S7TB 4EJ1C 2AV7B 1S5IL 3DVNA 3BZ4A 3FN0L 3GM8A 4X4ME 4X7FC 2A6JB 1YMHB 4P9HL 1KEGL 4BFEA 3MROB 1NGXB 8CGTA 3D2UD 4X9GA 2VUYA 3DV6B 2AJXL 4MJ5B 4PJGF 4XAKE 1DJSA 4OBSA 4TQEL 2UUDH 4P49A 1DBBL 1MOEA 1V5JA 1TCMA 1T89A 1Z0NA 2IAMB 2OI9C 2HRLA 5EU6E 4P3DA 1XAUA 3RTQA 1IQDB 1ZHNB 1E4WL 1S9VB 4YH6A 4OFVA 4U05A 3ZYIA 2BC4B 3N1PC 4OCSL 1P1ZB 3BXNB 4O00A 5IB1B 3DYMA 3MCKA 4FS0A 1K8DA 1JGLL 3L7EA 1Y6NR 3BZFA 4MDJA 4OCLC 2P8PB 1HXYA 4XCFH 2IJ0C 1H8OA 1G7IB 5BS0E 3AC0A 4L8SC 3O3EA 1JHTB 4AM0A 1S5IH 4YR6A 4HUMB 4QXGL 1AGFA 3FN0H 5IB3A 1MCHA 1SBBA 2VABA 1EZVX 4P9HH 1KEGH 1I8IB 4K23L 5I15L 4PJCF 4WGVB 1CFBA 2YD6A 4LBEB 3DECA 4LSUL 1CFSA 1F97A 1YEJL 2AJXH 4HGWA 1OGAD 2AK4E 4MDIB 2R4SL 4RGOL 1WBYA 3NH7L 4TQEH 5JDSB 4PBWD 1I1AD 3BJ91 1DBBH 1T89C 4ZS7L 1VKXB 5MEQB 2JJUA 5LWYL 4NO2B 4JO4L 4MVBD 3R0NA 4XPTL 3H3KA 4PJGE 5LBSL 5BCAA 1E4WH 4Y5XC 3UP1A 3LKRA 5ERWA 1OL0A 1IEBB 4WO4A 4POZC 3FCTB 3UTPE 4PP2B 3JV4A 3DSFL 3VGEA 1WFUA 2EDHA 4OCSH 1I7RA 1PZ5A 3LB6D 4ODHL 4OV5B 1IGYB 1CGTA 4R97B 3AB0B 1RUML 3BN3B 1JGLH 3PNWA 4P23A 4RNRA 3VRIB 1DEEA 4RMQA 2KZWA 1F4XL 4TOYL 4WHDA 3E6HA 2AS5M 1HHKA 5C3TA 1Q8MA 3CLFL 5JQ6L 4KRMB 1FVEB 1ZHLA 5TE4L 3RNKA 2A0LD 4FQXC 3SKMB 4QXGH 1H3PL 4X9IA 3G04A 4JFHE 1QRNA 5DLML 3MUGB 1KPVA 3R1GL 3U79A 2X1QA 4G3YL 4K23H 3DVGB 3VFSB 3H7BA 4HS3B 5I15H 2CD0A 1OGTB 1ZHBB 1S7UB 5DJDA 3RDTB 2X4SB 4LSUH 4PUBL 5FO7B 1YEJH 4ODVH 5FM8A 4C83B 4PJ5A 3QHFL 4E41A 4XP5L 2R4SH 3HZMA 2R29L 4RGOH 5ANMB 3NH7H 5FYKL 1S9WB 5CKGA 4ZS7H 5SWSE 5DRZB 3BPLC 4HPYL 1GGCL 3KWWA 1YJDC 5ADPL 4PJCE 5LWYH 2HJLB 4JO4H 5C70A 1OGAA 1MHHB 4XPTH 3NVQA 1QFWI 5LBSH 2IBBA 1A6TA 3IF1A 2Z31B 5EPMB 1MLBB 5EBWA 3BUTA 2FJGB 5C09D 1BQHA 3DSFH 4HHAA 4WY7L 4JFFB 4ODHH 3PWVB 3KPSA 4LPYA 4ZODA 1RUMH 4MAYD 1F4XH 4BFIA 4TOYH 3PQYB 1B6DA 5JQ6H 3CLFH 3QUML 5MI0B 1QO3A 5TE4H 2BVOB 4L4VB 2YWYA 2X4NA 4HLJA 4XWGL 4ZDHA 4GKOA 3D48R 4PJ9A 1H3PH 3HPLA 1TFHA 4JN2B 4U6HB 1S9KC 5CZXD 3GMMB 5DLMH 1CFTB 1RIUL 1REIA 3R1GH 4PG2A 4G3YH 3BEVB 2IALA 4UV4L 4NRYA 1WSST 3GIVA 3FOLA 5DEFB 5KTEL 4LCCA 1CS6A 3C9NB 4V1DE 4N5EC 5KG9B 5TH2B 3CFJA 4JGMA 4JJHA 3QHFH 4N5UA 1BFOB 2YWZA 4XP5H 3QQ3A 2R29H 4LMQE 5FYKH 2GT9A 2JELL 5D6DA 5JQHC 4OQTL 4HPYH 1GGCH 1U8PB 4PY8J 1JV5A 5ADPH 4BFBD 4CVUA 3IDJA 3M45A 3VJ6B 1CFQA 4HULB 1KLFA 2VKXA 4NO0D 1G0XA 3IXAA 1KB5B 1EHLL 5LGKA 1ZT7B 1CYGA 4F7TA 3VD3A 3TN0B 4WY7H 5EC2B 3S3JA 2X05A 2D0HA 4NZTL 3VXME 1CDCA 1A9EA 3UYPA 3QUXB 3LB6C 2CUMA 4PJEF 3QUMH 1D5ZB 3KJ4C 3TYFA 2HH0L 3RUGA 4XWGH 3IU4L 3V6FB 4POYA 4ZSOE 2Q8AL 1A1NA 3P30L 4PG2C 4WI6A 1JWSB 1RIUH 1UJ3A 2A0LC 4WU5B 3QG7L 3MRNB 4UV4H 5KTEH 5GSVB 3TBYB 2C1PA 4MQ7A 4WUUB 1PG7X 4E5XB 1SYSB 1YY8A 1X4ZA 2QHLA 3C60B 3UTSD 3LVEA 1NUFA 1WZ1L 2JELH 2XY2A 4OQTH 3IRZA 2XKUA 5CEZL 3AM8C 3CGTA 2ICES 1VFMA 2R0KL 4RA0C 5CFHA 3CAFA 3MOAL 1KJVB 2IGFL 4Y16D 5F89A 2HFEB 1R3KA 1DQTA 2BMKA 5L8LB 1EHLH 4L8DB 1JHKL 2GJ6E 2Z8VC 1KV3A 2VZTA 1I1CA 4P48A 4X6EB 3D18B 4JRYE 4NZTH 2ARJB 4GRLA 2BCKA 2J7LA 4NO0A 5DI8B 5C07E 1I7UB 1JGVL 3EGSA 4QHLB 4J6RL 5IHZA 4KJYA 1MH5B 3G08A 2HH0H 4P4RB 3T0WA 4MAYC 4TVPL 5D1XA 5D5MA 3IU4H 5C6PB 2Q8AH 3BESR 1UJ3C 3QIUA 2A83B 3P30H 1BM3L 4HJ0D 3HUJA 2XZZA 4PJEE 1WWAX 3QG7H 1IM9D 4PRPB 3ZKXB 4KUCF 1LE9B 4UIMB 1QTYT 3GHEL 2GK0B 1D9KB 2MSPA 2G9HB 5ID0A 5DS8B 3G6JF 3QCVL 4YIQB 2HG5B 3NIDF 2XZCL 3SDXB 1QFWM 3DURA 5HVWA 4QHNB 1WZ1H 3MNZA 5FYJE 3SDDB 1BJ1H 3RY4A 5A16A 1KCRL 5CEZH 1NDMB 4I5BB 4M93C 2R0KH 2ZUTA 3MOAH 1RJLB 2F9BT 3KPRA 5CBAB 2IGFH 4L29A 2YUZA 2CUIA 2EXWD 4HIJB 3WHE1 1JHKH 5IK3B 4U6XB 3QAZB 1FZJB 1RZ8A 1NKOA 1U42A 4WWKD 4GRLC 4RFEA 4EEEA 1YPZB 3BFOA 4LSPL 3N06B 2R2BB 3OB8A 2CMRL 1JGVH 5B3JF 4FQQA 3ALXA 4J6RH 2EDXA 5C0CB 5F7YC 3LKPA 1SMAA 4TVPH 5FIEA 4X5WA 1CD9B 5B8CA 4E0RB 4GJTB 1LNUB 2B0SL 1BM3H 2DMBA 4PJXF 3H2WA 1CXKA 3GMPA 2CDFA 1A8JH 4YC2C 4ELMA 3D3VB 1NMCB 5CCKL 3BRGC 2VLMD 4JFDA 3GHEH 1CR9L 1A6UL 1EIBA 5E1AA 5TQ0L 1L0QA 2VZ1A 3QCVH 4NFBA 4NN7C 1FFPB 4QOKB 4UINL 3VWJD 1HQ4A 2XZCH 1IM9A 4YDJB 1NCAL 1CTOA 3B8YA 3Q1SL 1KCRH 2F8VA 5GGRY 1YN6A 4KVCL 5DEGB 3VXRB 5DJXB 2W0LA 4JFEB 2WMPA 1MUJA 4RGND 3BDBA 3G6JE 3HNSL 1V8HA 3NIDE 4KROB 4OUUB 1KB9K 3DSNA 4K9EL 3VFUA 3LY6A 1F6FB 1BD2E 2BNQA 3PXJA 4D9QE 1WBZA 2DWDB 3E6FB 3MRCA 4RIRA 3MLYL 2CDEA 5E5MB 5L0QB 4LSPH 4R7DA 1MPAL 2CMRH 2HYMA 4K3DL 3NCEB 4HS8L 4NKMA 5CILL 2XWBB 3TFKC 3BE1L 5JHDA 5B8CC 4ODXA 4TTDD 1T3FA 3QUYD 2B0SH 5B3JE 4JFQA 4LCWB 4GS7B 4UBDD 2IPKB 5CCKH 4YHIA 5C86A 1H3XA 4PJBF 2DQUL 4YBHA 3L95B 1U93A 3KPOA 1A6UH 4HJ0C 5TQ0H 2GTWB 4K7PY 4UINH 3O3BB 1A1MB 4PJXE 2EDRA 3CCHB 1NCAH 3M1BA 2EO1A 4Z7OF 1A22B 3Q1SH 5F97E 2AQ3A 3ZYJA 1RU9L 3E2HB 4LNRA 4KVCH 4KKLD 3T2OA 4F7EB 5ABDE 1TZIB 4FQHA 4JKLA 3HNSH 4MX7A 3W39A 3RIAK 4YO0A 4K9EH 2SEBA 2I9TB 3MYJB 3GJFB 2D31A 3MLYH 4TNWF 4M7LT 1MPAH 4OZHF 4LIQL 4ZG1A 4K3DH 4WWKC 4HS8H 3O4LE 2OS7A 3L5IA 5CILH 1KJ2A 2DDQL 2WBJA 3BE1H 1EDQA 4XPBL 3MO1A 4QNPF 4DN4L 2V2TB 3MNWA 3EDKA 4HJGB 3JWOC 1K85A 3CPLB 4ZFZA 2BHYA 4QRRB 5DJ6B 5E6ID 2BVYA 3C09B 4XB7A 3MZGB 2DQUH 5J1SC 3CX2A 4NBXB 3BPNB 3LQAL 5LJYH 3QUYA 1SJEA 4KRPB 5AYUL 3QCUL 5DK2A 2FCBA 3WO4C 5IVXB 1NANH 3IDMB 5D2NE 1A02N 4PJBE 4XWOD 5AD0A 3MR9B 1RU9H 3AREB 3VWJC 4NN5B 1H5BB 3NPZB 5EBLA 3CC5B 3QZWA 2FR4A 4X7DC 4XCEA 3M17A 4GW1B 3BD4A 1ZTXL 5EH1A 1PX3A 5T1DL 4YDVA 4Z7OE 3JV0A 2X4RA 4QXUL 4RGNC 5FA3B 2HVKB 1X5XA 5EOCL 2Z35A 3MLRL 4LIQH 1KUMA 4U3CA 1R3JA 3GMNA 1DLHB 3QQNA 2WBJC 4P2RA 4B50A 3QNXA 2DDQH 2Z8SA 4MQXD 3EOAB 4XPBH 4DN4H 1YN7B 1OF2B 3VGFA 3GMLA 4KMQA 4OZHE 6CGTA 4L4TA 4PJAA 1PZUB 4YXHL 3FHAA 2KQMA 2Y07L 3QUYC 2PF6A 4QNPE 4PRHD 3LQAH 1GC1L 1NC2B 5DGQA 3DTXB 4JKPL 4MMZC 1TZGL 4UBDC 5AYUH 4F33A 3QCUH 3DUUA 4ODWB 3VWKD 2Z4QB 4L8CA 1C12B 1N8ZB 3UX9B 4I13B 5J6HA 3WHE0 1Z9OA 2RHEA 2OSLA 5LAXB 4W6WB 4PV9B 3GNML 5TGBA 4HKBA 1ZTXH 4XX1G 5EB9A 5T1DH 4OF8A 1UB5A 5GS1B 1JPST 4QXUH 4HK0B 2F54B 1FAKT 2EDBA 3FFCE 3HRPA 4GOSA 3DO7B 3H0TA 5EOCH 3MRHA 4KDTA 3MLRH 4ZUWA 2NW3B 2C7UB 4AL8L 1JCKA 2VDQL 5E6YA 4BQ8A 3RZCD 2EDQA 4LLQB 1F6AB 4RAUB 3OKNB 1FFQA 1WAAF 5MEOB 2MQ0A 4KDWA 1CLZL 5HYJD 4K3EL 4Y4FD 2Z93B 3MODL 4OGZA 4UTAL 4F8QA 4YXHH 4U1LA 2Y07H 1CE1L 3HA0A 2QQKL 1GC1H 3V5HB 1Q9LB 4JKPH 3C8KA 1R3HA 1QSFD 1TZGH 2PW2B 5E6IC 4FXGA 1F13A 3QNZB 3UBXI 1BQSA 4PBXA 4I18A 4JPIB 3TIDB 5J06A 4YHML 4LKXB 1J0KA 4U1SB 4OZIE 3FQUA 3TA3D 4I4WB 4PGZA 4XWOC 3QEQB 3GNMH 3AFLA 4ONHB 1B2WL 5D9SA 3U46B 3CD4A 4PGEB 4KDTC 2H32B 2LVEA 5IFAL 2DF3A 3FONB 3Q5OA 3F6LA 3QBTB 4EN3A 1GGUA 4AL8H 1EBPA 2X41A 1JJUA 2VDQH 3VI4F 1NAKL 4UB0L 5J1AB 1BF8A 5EBMB 3OV6A 3QUZD 3KYOA 4PRIE 5I71C 5KSVB 3RGVA 5H35B 4XHJD 1CLZH 5EU3B 4K3EH 5CGTA 4MQXC 1II4E 3MODH 4OCMC 5IQ7L 1ORSA 4UTAH 4FA8A 3CU1A 3MMEB 4AJ0A 3DV4B 3EJJX 1CE1H 4U1MB 2QQKH 1LP9B 4WW1A 3WFCL 1WAAE 1DL7L 3EHBD 4XT1C 5C0FB 4I18C 5J57B 4QRQA 2A1WL 3O4OC 2HJKA 2V2XB 2YD7A 1PX4A 5HSFA 3VFVB 1DANU 4MD0A 4YHMH 5I74C 1JK8A 3VRLF 2B7DT 4PGBA 5GGSA 3SJVD 4LL9A 3EOTL 4PJDA 2BVPA 2DLFL 2GFBB 5IIEA 3SGDH 4ZPTA 1B2WH 4ZUSB 2A6KA 5MENB 5JW4Q 1NGYA 2LAAA 1WICA 4YHYC 5IFAH 3OTTA 4NWTL 7FABL 1ERNA 3MNVA 5HHQA 3MRDB 3X11B 1EXUA 3SE4C 3VFNB 1XGPB 2HAZA 1NAKH 4UB0H 4CRPA 3DBXB 3RWCA 2F5AL 3OB0K 4Y8DC 3TWCL 4U0RB 3DXAD 5F3BA 3T4AB 1GZPB 3IAQA 1XR9B 3P4NB 2EKSB 2WW8A 5IQ7H 4P99A 1B0GB 4KKAD 5KSAB 2BSED 1CXLA 3T4YB 3VI4E 2X4UB 2DM2A 4WFHE 4WGWB 2F53B 5HY9A 4MZ2A 5D7LB 2VLRB 4XCYA 1XCTB 1M1SA 4Y4FC 3BP7A 5F9JA 3WFCH 4G6AD 4MB4A 1DL7H 1RY7B 1E27B 3MRJA 4R2GD 1EFXA 3JV6A 3U48A 4JPWL 2A1WH 3B3IA 1T1WB 1A5FL 3L3IB 5KVEL 2EIZA 3X3FL 4R3SB 1KIQB 4JM2D 1QSEB 4NP4L 3N85L 4S1SL 3HAEA 3EOTH 1OWWA 4G8EA 1FNGA 2DLFH 2X70B 3FRPG 4DJMA 5GS2H 2NY2B 3HMXA 4LLVA 3TA3C 3V5KA 5IR1B 3VRLE 4X6CB 1T22A 2X4TB 4NWTH 3I3DA 4LIQE 7FABH 1YDPB 4XC1L 4ORZC 2J88L 1FFNB 4XX1E 2I9LB 1J0YA 3X12B 1C16B 2EC9T 4CMHB 2VMFA 1F02I 3CFBB 2F5AH 5SWZE 3TWCH 2CIKB 1I9JL 1U92A 4QTIL 5J0BA 2BRRL 4KAQL 1PYWB 15C8L 3CXHJ 5I8OL 4LHJB 3BMWA 3GSVB 3QO0A 1HSAB 1P69B 3CH1B 3DX6B 2VWEC 4RQQA 4UU9A 2VXVL 4GRWB 3O41A 2P5EE 4WDIA 3LN4B 1J1XL 4JPWH 4PJ8A 3QXDA 1QLRA 2AXGA 1A5FH 1ZSDB 5KVEH 3EHBC 4EI5B 3X3FH 4PTUA 5HGDA 3LPWA 3RVXD 4Z77B 2NQCA 4NP4H 4P46A 4JKKA 3N85H 4S1SH 5DK3A 3N1GC 5AEAA 4G8GD 5EZOL 1QKZL 1BVLA 1WGOA 1VFOA 1AGDA 5HPMB 2X40A 2VUOA 4XC1H 2J88H 1A6ZB 2FB4L 3MRBB 5HDLA 1GXEA 1INDL 2CUHA 4K7PL 4C59B 3KYNB 5AAMA 4MD5A 1I9JH 4QTIH 2BRRH 4KAQH 1AGEB 15C8H 1JZ3A 1NFDF 1Q9WA 5I8OH 5HHOE 3V6OA 5DWUL 4AEEA 1EEUA 3ZYZA 4MNGE 5HGHB 2H41A 3LKOB 4M3JA 3T0BA 2VXVH 4NKOA 1QYGL 2QKIB 1FZKA 3T65A 4KKAC 4PJ8C 4JZOB 1TLKA 1J1XH 4Q9QL 4R8WL 3FQRA 4YEFA 4NQCB 4R2GC 3WFHA 4X4MA 3QDMD 5C0RL 3QSKB 2MKLC 4J1UA 3MRLA 2DKUA 2LTQB 2JIXB 4XXDA 3QDJD 1UH4A 4O2EB 2E9BA 1FL3A 3QIBB 5EZOH 3UPRB 1RK0A 3QEGL 1QKZH 5F6IB 4UQ3B 1PVHA 1LEKA 2A74B 4AIZA 3LSOB 4I77L 5D2LF 5KVDL 3EO0B 5E9DB 2FB4H 1GZQA 3IU3A 5T33L 1INDH 4K7PH 4OGYL 5CSZB 4I0PB 1LD9B 1WFTA 3O8XD 1A9BB 3O9WD 2IBZY 4PS4L 2QJDA 1HHJA 3V6OC 2GSGB 2V5YA 4D9RE 4HDIA 4NQDE 2DM7A 5DWUH 1J0IA 4L8BA 1YYLL 4MHHI 5EO1B 5H94A 4JFOB 2CKBA 5I76A 3REVB 1QYGH 1A47A 3EAKA 3ROLA 1NFDE 2LVCA 5BS0A 1P9MA 4Q9QH 1WZKA 1JGEA 4I9WD 4OD1L 1TDQA 4R8WH 3RWGB 3AGVA 5MP6L 2QBWA 2PO6B 2AXFB 1TVBB 5T3ZL 4RBPK 5C0RH 3FQTB 4UT9L 3MV9E 4U2ZA 3QFDB 1CICB 1I1YB 3QH3A 3RVXC 2ESVD 2NY6D 1T1ZB 2OMBA 4ONFL 4GKNA 1B9ZA 3QEGH 3VCLB 4D0DA 1GH7A 1VGEL 3AXLB 4L9LA 1FNEB 4YDIL 5DMJB 3VFTA 1MY7A 3JSSA 1P4LA 5JHLL 4Z0XB 4I77H 1ZT1A 4A6YB 1PY9A 5KVDH 3QDJA 2NXYB 3W9EA 2RBLA 1KCSL 1NPUA 4RZCB 5T33H 4DOHB 2J5LB 1M6OA 3B9VA 5IMMA 3TCLA 3BT2L 4OFYA 3RKDD 4OGYH 1HCVA 5DR5L 5DTFA 3CVHB 4TULL 1IM3A 1D5MA 4PY7A 4NC0B 4PS4H 3PHQA 2AXJA 4D0BB 2WIMA 5I9QB 2FNBA 2FYYA 5D2LE 3W5MA 2ZUQB 4CNIB 3WN5A 1YYLH 2D9QB 3P4LA 4ISVA 1FVCA 2X5PA 4BZ1L 1GRWA 3BSZL 3O9WA 4R96A 2PN5A 4H26A 4LVOC 2VLKD 5LKNA 2QHRL 2FEDD 3C5ZB 2XACC 3VXQB 2CLZA 3RKPA 5D7SL 4APQD 4OD1H 4KKNA 4UAOC 5D7IA 5HHVL 5MP6H 1MFBL 4ZAKB 4O58L 3BH8A 5T3ZH 3U1SL 3MV01 4KUZL 1N6VA 1BVZA 2BVQB 3RVTC 1P2CB 5C0BE 4UT9H 1SEQL 1G7LA 1UM6L 2IEPA 2RCSL 4L9LC 4ONFH 4QT5B 4MA7L 1VGEH 4QRPD 3R8QA 4YDIH 2H26B 4K7FA 3SPVB 4AENA 4MNQD 1TVDA 4GSDH 3L3JB 1UKSA 5JHLH 5SWSA 1V7ML 1KIRB 2ENSA 5IOPB 4NCC2 4PJCA 1J18A 1KCSH 2J6EA 5M95B 3BT2H 1GYAA 5IROA 3T2PA 4WFEE 5DR5H 5BMFL 1IMHC 5JMRA 4TULH 4H8WC 3RBSA 3WN5C 3TLRA 4OKDA 3UBXB 1F5WA 3O8XC 3O9WC 2XNAA 4BZ1H 1A4KA 3BSZH 4JFZL 3GSXA 4H0GA 4YPJA 2QHRH 3RWFA 5IKCB 1T5WA 3B8SA 5D7SH 4KU1A 5HHVH 1M05A 1MFBH 2GJZA 3NIGF 5HTSA 4O58H 2P5WE 3U1SH 3VFOA 4KUZH 1IEAA 2VLKA 5C08B 1OP5K 1LDPL 1NC4D 3HS0A 1SEQH 4EDXB 4APQA 1ZK9A 1UM6H 4JZJA 2RCSH 3VRJA 4M8QA 1KPRA 4UQ2A 4MA7H 3OHXB 5DUPL 2VTFA 2NY1B 3VXUD 5DFTA 2K1MA 5B38G 1YEKL 3K4AA 3T0AA 5JPMA 5L8KB 3MV7B 2NY6C 1V7MH 5T1KD 4GW5B 5IROC 5I1CL 4TTGA 2VZ3A 1MWAL 4RAVB 5BRZD 4WU7A 5BMFH 1RJYB 1JN6A 5F7FA 1KENL 1OARL 3RKDC 1OCWL 4IIQA 2NR6D 3RGHA 5E8PA 3KYKL 3VXMA 5C0EB 4CBPA 4JFZH 3VD4A 1R5VB 3EFFB 5IEHA 4OD3L 4FN0A 1U8KB 3IAPA 3H42L 5EU4A 4YHZL 1Q1JL 3PXHA 4Q74A 1U8OB 3MGOB 1CFVL 1Q9OB 1YUHA 2FEDC 2GI7A 5FM5O 1U2HA 3MV8B 4IRSD 3F7VA 3BP4B 2R1WB 1S9XB 4OIBA 4APQC 2P7TA 3Q5TA 1LDPH 2XN9B 4JZJC 5FHBL 3VH8B 5DJZA 4EZMA 5F7WC 3HZYA 1WZMA 4HCRL 3TT1L 5AWNL 5DUPH 4FFWD 1NGZA 3NIGE 5DRWA 1SY6A 2PUQT 1YEKH 4NHUA 3RJQB 5I2IB 1AE6L 3MRPB 1CE6A 4PG9B 5L2KE 5I1CH 4XGZB 1EHNA 5D7JA 4Y1AD 1T4KA 4Y19D 1RHFA 1LWRA 3ARRA 2GJ6A 4IIQC 4PGDB 1KJMB 5EDXA 1KENH 1OARH 2OI9B 4P2OD 1OCWH 1OAKL 4JRYA 3OKLA 3MFFB 5BRZA 3O6KL 4ODBD 4XPAL 1V3LA 4NCC1 3KYKH 5FGBC 4Z7UB 4XH2A 5C07A 4LQ1A 4OD3H 4R4BA 3QNYB 3H42H 3MRQA 2FJFB 4ZOCA 5DSCB 4YHZH 3DX7A 2ICWI 4JFPA 3WIIL 1Q1JH 4OD2B 5FGRA 4HKXA 1KIPB 3TYGL 3C8HA 1CFVH 1FL5B 4YGAB 4JDZB 3K1KC 5GS3A 1EVUA 1XCQA 3V6ZA 4AY0A 3PGCA 3DRQA 1WTGT 5DD1L 5FHBH 4PJEA 1LEIB 1KELL 3INUL 2OCFD 4L8SB 4RMRA 3S6CA 3DVNB 4HCRH 3TT1H 3BZ4B 5I1IL 2BNRD 2YD8A 5AWNH 2FJHA 1SEBB 2ZJSL 3GGWA 4Y88A 1F3DJ 3I2CL 3DHJA 1AE6H 3W0WE 2XZAL 4KZDL 5D7JC 5I17A 4BSVB 2DLEA 1DQQB 4MLSA 3V0VA 5IB5A 4BSWA 5ESVA 1OP9A 5F9AC 4F7CB 1RVFL 1K3ZA 4LFHG 3PV6B 1OAKH 2BY3A 4M03A 3O6KH 4XPAH 2XKSA 5LGJB 1IC1A 4Y5XB 4PGCB 1WBXA 4HIIA 4BJLA 4AG4L 1ND0B 5DT1L 2NR6C 3MCKB 4F37K 1K8DB 3F6IA 4ETQB 3BKCL 3WIIH 1LGVA 1AR2A 2K9UA 3TYGH 4HV8A 4P9HC 3G5ZB 1H15B 4X99A 3WEXB 5FYKD 4OM1L 5MEPA 2ICWJ 4MJ6A 2JJSA 1OTUC 1I8KB 5DD1H 1D6EB 1KELH 4QRPE 4FQXB 4MA8L 4QWWD 2GEEA 1YMMD 1S5HA 1I4FB 4IRSC 3SN6N 5I1IH 4WTWA 3S5LB 3N0PB 2VABB 3ARQA 2RFXA 2ZJSH 3ZLQC 4H0HB 1I7ZB 2ED7A 4AIXA 2ED8A 4N0FA 3I2CH 2FL5B 43C9B 4XHQA 1CFSB 4J3WA 2W9EL 2R1YA 5D1ZD 2XZAH 4KZDH 3ESUF 1QFPA 2APXA 2G5BA 3D2UB 3G6JA 3OF6D 4P57B 3UTQB 3LQZA 2JK5A 3FOMB 4PJHF 4FZ8L 3BPLB 1RVFH 1XT5A 5DJ8B 3SHSA 2QQNL 4HC1L 4CDHA 1MHPL 2NX5E 2GITA 3D9AL 1T5XB 4WV1A 5JMOC 5H37H 4AEIL 5BV7L 2VXUL 1A3RL 1FHGA 4OZFH 4AG4H 4J7RA 5DT1H 1TQCC 4OKVA 5GS0L 3FB6A 3D25B 2IADB 3BKCH 1EJ6A 4FQPA 1DUZA 1NCTA 4GRMB 3QPXL 5GJTL 4S2SA 3NFSL 5J8OA 1ZHLB 2QR0A 3QHZL 4OM1H 2G60L 3LPGA 1VFAA 1A7QL 4K94L 3LPFA 4MA8H 1ZGLA 3G04B 5FCUL 1FZOB 3G5YB 5CGYC 3H7BB 5C1MB 4B7LA 4PJXA 3RI5K 5DJDB 1M4KA 2E3VA 2BSSB 1VPOL 1FG2A 2W9EH 1YMMA 3BQUD 3LKQB 4K2UL 3ZTNL 2K3TA 3HZMB 5H37G 4DW2L 4HH9B 3ARGA 3HI1A 3KWWB 4FZ8H 4OZFG 3VFWA 3ULSA 2H9GB 1OGAB 2QQNH 2Y5TB 4WJ5A 3RL2A 4HC1H 5SX4I 3MLUL 5DHYA 1MHPH 3D9AH 1I1AB 5E00A 4AEIH 3OF6A 5BV7H 2VXUH 4WIQA 1A3RH 1BQHB 4PJHE 2D0GA 3O4LA 4O2CA 4L3ED 5GS0H 2JCCF 1FN4A 3B9KA 5JPNB 5C2UB 4M1CD 3JTSB 4Q9RL 3UZQA 5JXAL 2YEZA 3QPXH 5GJTH 3LIZL 3NFSH 3ROOB 1NEZG 3QHZH 2G60H 3MC0A 1QP1A 2X4NB 1IAKB 1WV7T 1A7QH 4K94H 3KJ4B 4ZOEA 2MHAA 5DJAA 3WLBA 3IVKA 1RQ5A 5CEZD 5FCUH 3STZA 5HJ3A 4HLZH 1A7RL 4FFZL 2IANE 1F58L 1BF2A 3GIVB 4QWWC 4Y8AA 2CKNA 1VPOH 5D2NA 1U3HD 4K2UH 3ZTNH 3ARGC 5JOPE 2B20A 5IJKA 1Q94A 4DW2H 4XNQA 1S78D 4OGAD 5D1ZC 1JV5B 4LSQL 2H2SC 5K9KA 2ARJQ 3IDJB 4HBQA 1W2KT 1LO5A 1OPGL 2A77L 3MLUH 4TVPD 4HUWA 1VFBA 3AROA 2LFGA 2GK2A 4YHOL 4LP5A 3IXTB 4G42B 1IGIL 5DJCA 3WIHL 2NMSA 1AR1D 4C55A 5EOQL 4LPVA 3FT2B 4DVBB 3OKOA 2Y06L 1ZA3A 4Q9RH 5JXAH 5C09B 3C6SB 2W9DL 5F70A 4NNXB 3LIZH 4OZHA 5IGXL 1L7IL 4B53A 4L3EA 1WT5A 5ID1B 4EUPH 4QRUA 1IAII 1LO0L 2JCCE 2H3NB 4MAYB 2XWJB 3IJHA 1BEYL 1VHPA 3GB7B 1OQXA 3IRPX 3BGMA 1UJ3B 1W8NA 1A7RH 4FFZH 1F58H 4KGLA 3MRIA 5L8JB 1S7QA 1Z2KA 4EXKA 4MQ7B 4LLUA 2FO4A 3S35L 2CO6B 1J8HD 3KHQA 1YY8B 2DLTA 2PNDA 3EJZD 3QO1A 4P5MB 3CZJA 5I1LA 2Z0BA 3FTGB 5D6CA 1Z9MA 4G43A 3A67L 4G6JL 4LU5L 3BQUC 5BZDA 4LSQH 2AEWA 1IC5L 4ZOBA 2XQBL 1LEGB 3GSQB 1OPGH 2FHBA 4QYOB 4M93B 2A77H 4POUB 4Z7WA 2ADIB 4DKAA 5E8EA 3TBWB 5CD5D 1JBJA 3FFCA 3VFGL 4YHOH 2VN7A 2DKMA 1QR1A 1IGIH 4OI8A 4U6YB 5A43C 3WIHH 1TMCB 4XNUL 5T3XD 5EOQH 2OK0L 4EUPG 3TO2B 4FZEL 1I8MA 4NO0B 2Y06H 3DX9A 5J56B 1KLGA 3L6FA 2W9DH 2HLAA 1WT5C 5IGXH 4J3XA 5IHZB 1L7IH 3G08B 3QRFM 2KUTA 4M1CC 4HUVA 1LO0H 1RJZB 3ECBB 1BEYH 4OTXL 1K4DB 2WWMC 1U6AL 4Q9BA 1M7DA 4YQXL 1XFPA 2XPGA 5TQ2L 4XVJL 1DUYA 5B39B 4OT1L 5GRVK 1GL4B 4DAGL 3S35H 4C4KT 5ID0B 1YQVL 3RU8L 4NN7B 3A67H 4G6JH 4LU5H 1INEL 1U3HC 5A16B 2EECA 1IC5H 3E8UL 4NDMA 2XWTA 3BWAA 3K2UL 5E8NB 2XQBH 4ZNCD 1S78C 3PV7A 4OGAC 3UTSB 2ZOKA 3VFGH 4R4FL 1CDYA 1KB5L 4RGMC 5IB4A 4XNUH 2OK0H 1KN4L 4MJ2A 4RFEB 4FZEH 1NLDL 4Y16B 4FOMA 4WCYL 5CWSB 4DCQB 3KLAA 4JCMA 2FHFA 1BBJA 4UZGA 5T1LD 3UTZA 1ZGLP 4PRIA 2WQ8A 5JOFA 1GJIA 3N1QC 5JA8B 4X6FB 1JMXA 3LKPB 4Y4HD 1WQVT 3TVMA 2EYSB 4X5WB 5B8CB 4KQ3L 3KAAA 4OTXH 5HXMA 1HSBB 1FYTD 2VLJE 2EDJA 5J4MA 1BZ9B 5HI3D 1U6AH 1WAAA 2CPCA 4YQXH 4HQQL 1DQLL 3PWPD 5TQ2H 4X80L 4XVJH 4UOW0 1FJ1B 4OT1H 4FMFA 4DAGH 3WS6A 1KBGL 1YQVH 2G2RA 3RVWD 5DFVD 3RU8H 2WM0A 1HQ4B 3RWEA 5FHAL 1IM9B 3EYQD 2PTTB 2HP4A 1INEH 4S1QL 5IVNA 5KSUA 3EJZC 2J8UB 3E8UH 3K2UH 4WHCA 2E6JA 4XCNA 1JPFB 1MUJB 2ICWB 2BY0A 4MD4B 3ULUL 4F9LA 2ICEB 4R4FH 4TYUA 1ULVA 1KB5H 1AHWA 4RISL 3CSGA 3O2DL 1JZ4A 1KN4H 3TZVD 5CD5C 1WBZB 3MRCB 1MY5A 3H9ZA 1NLDH 4WCYH 1EERB 5KVMC