2W60B

Anti citrullinated collagen type 2 antibody acc4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
217
Chain Sequence
b'DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4
molecule tags Immune system
publication title Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
pubmed doi rcsb
total genus 55
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w60B01
3PABB 3BWAA 3WUWG 5GGRA 3ZKNC 1G0DA 4Y2DB 4PR5A 5EB9A 4XPBL 4WGVB 1X5IA 4M48L 1A3RL 1HXYB 2XQBL 3RFZC 1FJ1B 5K93A 5C0FA 2IADA 2EEBA 2WNGA 4LASH 5HYJA 4L1HA 2N4IA 1QHOA 3MJ7A 3Q3GB 4RGNE 3FFCB 4OIIH 2E6JA 1WVZA 4WHYG 4P46D 2R0KL 4P2CG 1HHGB 1S5IH 3LZFL 3T0EB 4OM1L 1AKJD 3FMGH 4OJFL 1IC7L 3F7VB 1EO8L 1XGPB 4M7JL 2EYTB 5E8PA 3S8WA 4OM0L 4XP9L 2GJZA 5DC9B 2WAHA 1HN1A 3D3VA 4NQTA 4M62H 1O0VA 4NFCA 1NMAL 2R4SL 1MEXL 1KT2B 2E9WA 3HN3A 1CLYH 3MA7A 2AJSL 4ELKB 4KROD 1P84J 1XCTA 1AE6L 3KPPA 4QY8B 4NZRL 3GB7A 3V7AE 2I9LB 3GSVA 3QNZB 1QYGH 5AZEL 5CCKL 4ZQKB 1BZ9A 4KK9C 1EFXB 3IRPX 1NBYB 3TBYB 4IIQA 1A6TB 3LEYH 3VWJA 5FKAA 3UEZA 1SM3H 2GAZA 3MV11 5GGVH 1Q72L 2EECA 3KNBA 4X6DB 2X5PA 2X7LA 4YO0A 2I27N 4PJDB 3K81A 4O2FA 2VYRE 2AJ3B 1WCBA 3SGDI 5C0FB 3S36X 4XP4L 4HSQA 3WKNA 3FQNB 4LCIL 5HYJB 3B8YA 4M48H 1MFBH 2BFVH 2PR4H 2YD2A 4AY0A 4LASL 5BOZG 3S37L 3EAKA 2BVPA 5C07E 3UPRB 2G2RA 1WFNA 2UYLB 5LGKA 1B90A 5SV4A 1HILA 1IGJB 4QRQB 5CIPH 1NGWA 3RUGB 4HKXA 4E5XB 4NM4H 1S5IL 3KWWB 1NCCH 2L7UA 2VZ1A 2ZUWA 5ADOL 4TNWF 3TH4T 4L8CA 1SEQH 1PSKL 2B39A 4JFDE 1RZJH 2HFFA 4PJCA 4Z7UE 4QOKE 3F5WA 4M62L 3RIAK 1TJIH 1NMAH 2VXVL 2R4SH 4HBCL 1WCQA 2EDDA 3GBMH 1NFIA 5BZDA 4Y16C 1I9EA 1NL0L 2IANB 2VDRH 3I02A 4LCCB 4LPUA 2HH0L 3FO1B 2EIZA 1LK3L 2FEDD 3P30L 1CI5A 1A6AA 5EOCJ 3V0WL 4CBPA 2J88H 3FN0H 1U95B 1KTKE 4HIXL 1ZA3B 3RVWD 1CDJA 1XR9B 1LDPL 3QISA 5FB8B 2HT4C 5FIEA 2HKHH 5D7LB 3PQYE 5D1ZB 1QRNE 4OZHF 1C7SA 4XP1L 1AO7E 3EYFA 1IAIM 2JCCE 1LDSA 3G5VA 3BQUA 3QO0B 3MR9B 3QJHA 4P2QD 3TNMA 2I07A 4BKLB 4LCIH 5I8CB 1RJCA 3C5JB 4U6HB 2UUDK 5B38A 3B2UC 1YEFH 1A22B 3MLZL 3WDJA 3B6SA 4QRTA 4ONGL 1HEZB 4E5XA 1I3RB 5FF6A 3UTQA 1YMHB 5I15L 4YDJA 3CU1A 1LO2L 5FEBA 5IBLD 4RMSA 1EEZA 4J7RA 3WLBA 4V1DE 4WFFD 4C56E 4NM4L 1WWAX 2ICWI 1BBDL 1OGAA 3SE8H 1IM9D 3ES6A 4LSVL 3OKDB 5BV7B 3BPLB 4MA7L 4HGKC 1T2JA 1SEQL 4HKZB 1NFIB 5C0DB 5ILTH 2C1PA 3G6AA 5DMIL 1KSRA 2QADC 2Y4SA 3DHMA 2ZUXA 4PRAB 4WU5A 3FTGA 1KLGA 3GI9H 3LKPB 2Z35A 2A77L 1ZHNB 3MBEB 3IDMA 5DR5H 1NL0H 1A6AB 1T5WB 1TENA 2VDRL 4K9EC 3PWNB 4JR9H 3VXPB 1FYTB 5D7IE 4F33A 3KPMA 4IRJB 3C09B 3W9DA 5FA4B 3MRDA 4JFOA 4H8WL 4BZ1H 3FN0L 3ULSB 2VQUA 4DWHA 5DJ2A 2V9RA 2PO6B 4GG6B 4QXGL 2QADD 4U33A 3FQNA 3QO0A 3TA3A 3QNYB 5E8NA 3ISWA 3E6FA 1G1CA 4CW1B 1ZLWK 3O2VH 4NJAH 3Q6FB 4HAGA 1RY7B 2IAMC 2B4CL 2ZCKH 4QF1A 3ARBD 4MNGE 1BM3H 4XC3H 2E9IA 4QRTB 1Z3GL 2HJLA 3VXSB 4CADA 1MCRA 2DBLL 4Q6IB 1KG0B 2YEZB 5EU6B 2BOCB 3BPOB 1YEFL 1XH3B 5KSBF 4MQSB 5JNYB 2WWMC 1C12A 3UO1L 5JQ6H 1MIEH 4GRMA 3SDDD 4Y5XC 1KYOJ 3I9GH 5I15H 3QPXL 4DQOL 3EJZC 5FGCE 1WT5A 5HYJD 4NO2A 3ZSTA 4PFEA 5E5UB 1SYSB 2VH5H 4YAQB 3C5ZD 3QXTA 5BZDB 4KTEH 2CKBL 4YNYA 3BEWA 1OTSC 1F97A 3LEXA 4U1MA 4IRJA 4LPTA 1CT8B 4P2RA 1NCTA 3ZDXF 4WW2A 5IROA 1S7XA 4JR9L 5DDHB 2IPKB 4HIEB 2X89A 3L95A 3VG0L 1G9MC 1XMWA 3BGMA 4OCLC 3DBXA 1OSPL 3T09A 1JZ5A 3TO4D 1S9VB 4MD4B 3C08L 1TNMA 1N5AA 1UM5L 4OCNC 2XFXA 1XF2A 3HZYA 3LOWA 4PGBA 1H8NA 5HYJE 3VGGA 3E0GA 1RULL 4RA0C 3A6OA 1BX2B 4Z7UB 3U83A 4ZG1A 3HI1B 5IJVA 1QBAA 4LRNL 1FC2D 2OX5A 1Z3GH 1LVEA 1U8PA 3MFGB 3WFBL 8CGTA 5T33H 4ODTL 5FYLD 3UYPA 3QXWA 4NPYA 3D69A 1F8TL 3B9KD 4NC0B 5IFAH 4FQJL 4PJ7E 4XBGB 1OGTB 3QPXH 1PZ5B 4QCIB 1TJGH 4HF5L 4ZXBC 1JPSL 2PW1B 3O6LH 4WENB 5B22A 4GBXC 2LU7A 1FG9C 3REVA 1V3JA 4JVPA 4LVEA 4XTRC 1T1ZB 4HXBL 2XPGA 3BRGC 5FGSA 5IEKA 5JPMB 5FKPB 4N0UB 4Q6YA 1I1RA 1DL7L 4U2ZA 3F8UB 4KKAC 5ID0B 4JFOB 1KUMA 5A2FA 1GZQB 4HLZH 3RL2B 4Z8FL 3UTPE 1BP3B 1VDGA 2P8PA 1FL6A 2O5XH 5DJ8B 3A0OA 5GGSA 5E2UL 1OSPH 4WO4A 3QCUL 3E6FB 1YJDH 1KB5L 4HFUL 3W0WE 4NQCE 1RZKH 1A7BA 1MNUL 1WAAF 3RA7L 3BESR 1FHGA 2VLRB 2XQBH 4OD1H 3L3OB 4HIIA 2Y7QA 1UM5H 2YWZA 4PS4H 3RY6C 4S2SA 2DAVA 3PHQB 3BWAB 1QHPA 4I5BB 4NYLB 4V1DD 2YD3A 5LCVL 4XZUB 3U4EB 5CD3B 5GSVB 3ALPA 1K8IB 4WJ5B 4A6YB 4RSVA 5DWUH 2R0KH 3O3EA 5D1QB 5FO8A 3KPRD 5D7KE 5DQDH 3IDYC 2BOBB 4ALAH 1IC7H 5DJZA 4X6EB 4P2QA 5C0BB 2YA1A 1TTGA 4YE4H 1KJ2H 5TPWL 2X4UB 5E1AA 1LO3H 5DK3A 1DQJB 3MYJA 2JCCF 3IJSA 5TDPB 3TO2A 3O6LL 2Z31C 2CH8A 5GS3A 3WIHA 1CDCA 3DV4B 4OZGB 2GJZB 5IBUB 5JOPE 3G6JA 3ULVE 3FFDB 2PTTB 4WWKC 2W9DH 4OZGF 4D3CL 3PGDA 3S3JA 1YEKH 3L3KA 1U3JA 2V2WB 4N8VB 5IMKB 3DBXB 2HTLD 3RZCC 3VMPA 4LHUB 3SDYH 5E95B 1KF9B 4FFVC 1GGIL 3KYNA 3TBWA 1H8OA 3ULVH 2APWA 1XGTB 2FLRT 4F7EB 1M7IB 3T8XA 5F7UA 3O4LE 4PJ9A 4D0BB 1DANT 2ICWA 3L6FB 3BRFA 4XP4H 4TUKH 2WBKA 5JDJA 1HQ4B 1MNUH 5DK2B 2DMKA 4NYLA 2R15A 3SDXB 5IIEA 2XNAB 4G6ML 1MFBL 2VQTA 5I73B 2KQNA 3RKDC 2PR4L 1MRDH 3MFFB 4YO0B 2MHAB 4KFZC 2HTLC 4R8WH 4RWHA 2FJFB 2CR6A 4G3YH 4S0SD 1W0VA 2ENSA 1IC5H 3EYSL 4UI2A 2HJFA 3GSWA 3X11A 1U9KA 3N9GH 3ORJA 2FYYA 1MCOH 1BIIB 4LPCA 5IESH 2PYFA 4PJ7F 4JAMB 1CXEA 3AS2A 3OAYH 5DQDL 1NCCL 2H2PD 4Y5YA 4U6YB 4RZCB 3CVHL 3FONB 4ZSOB 2A1WL 2FSEA 1BQLL 5FHBH 1ZLUH 3VGHA 1B2WH 4NRXA 4RFEA 2J5LC 1LO3L 4G43B 1EVTC 3FO0L 3PL6D 4QHNB 2GSGA 3G6JB 2DI7A 2P4AB 3MLRL 4APQC 3OHXA 5ESVB 4UILL 3X14A 1UACL 3BP7A 4WNQB 1HYSD 2F74A 3PGFH 2XWBB 4PJAA 1NJ9B 2NXZC 3ZE1F 5IEHB 4HFWB 4LLYA 5LXGL 2G75A 5JDSB 1IEHA 3QDGE 3BO8A 1LDPH 4F7EA 4IRSD 5FGRA 1ZT4A 3QXAB 2VC2H 1AGBA 4HUWB 3N0PB 2VQ1A 1TETL 3IFLH 3H9SE 1Z9SA 1SBSL 4K2UL 2AV1A 1QTYT 1RHHA 4ZDHA 3GDBA 2EH7L 2Q7YA 3EDFA 1CD8A 3NVQA 1E27A 2P8LB 3Q0HA 3V52H 4HMDA 5CIPB 1MCPH 3VFSA 2IBZY 3NMEA 1BIIA 4YBQD 3OR7B 3R0MA 1EBAA 4YEEA 2VZUA 2N7BA 3RHWF 3TIEB 3HUJF 3IU4H 1N4XH 4IEFB 4NQVB 2NTFB 5IOPB 1S3KL 4XVUC 3KPQA 3SGKA 4Q9CA 4MXWH 2D03L 3L3HB 1BREA 5F7KC 3VRLF 1S8DA 4RFEB 5FECA 4HUXB 2R4RL 1LE5B 5DMIH 3VFTA 2NX5B 5AD0B 1QLRB 3L3IA 1L0YA 4HC1A 4QOKB 4QXUH 4I0KA 4N1CA 3W11D 1SYVB 3UP1A 4G8IB 4CN6A 4TNWK 4X7DC 1ITCA 3VGAB 3UPCA 5JTWA 3MLRH 2FIKA 3IXAB 2QHRL 3GIVA 3QG7H 3ZHLA 4TYUA 5KSVA 3WSQL 4X9GA 4Y5VC 5FYJE 5GS2H 5F9DC 5LXGH 1BZQK 3OAUH 5SWZE 3NCJL 4D0BA 5IGXL 1EJOH 3KHQA 2YUVA 3NN8B 1PBYA 4GLRH 3CFDA 4QRPA 5GGSY 5JXAH 3IU3B 5C9JA 1NGYA 2B4CH 2MHAA 1QSEB 3U9UA 3V6OE 1BM3L 5E4IA 4GG6A 3MJ8A 1TETH 3U7AA 3IFLL 1SBSH 1ZHLA 5EPMB 1F42A 3W5NA 4U7KA 1H3UA 2EH7H 2PYFB 3ARWA 1P6FA 4DJMA 5IOPA 1RHFA 1JUFB 4NQDD 1BIHA 3TCXA 4HX1A 5L8LB 5DVNA 3VXSA 4JVUA 4BZYA 2XIDA 3W39B 3BXNB 1T2XA 5T1DH 4MXWL 1A7QH 1HNFA 5JA9A 5J3HD 4LKXA 4KTEL 3DX7B 1EHNA 3IXTB 3FO9A 4NRZA 2YR3A 5EU4B 3BP4B 3X14B 4APQB 1X6LA 4QXUL 5DJAA 2P45B 3P11H 4G6AD 3HS0A 2VXTL 1KJ2A 3G9VA 4KY1H 4OGXH 5IEHA 5I75B 4WHDA 5F96L 3S4SB 2Y5EA 3EYUL 5E2WL 1EZVY 3VG0H 3LEVL 4MCZA 2A0LD 5D2LF 4XMPL 3K8LA 1R5IB 4JREB 1V3MA 2OXHA 3ZHKA 3BZFB 3HAEB 4PJHA 4U1IA 4K3HA 2EZ0D 3W0WA 4PJXE 2RBLA 4G6AC 4PJ5E 5H94A 3NCJH 4NN6C 4YHOH 5DK0B 2YC1B 3PL6A 1EJOL 5KSUA 1MJ7L 3MGTA 5E9DD 4ZFFA 3HPJA 1RULH 4ZTPH 5FYKD 1HQRB 2JF1A 2DLTA 3GK8H 2VR9A 3PWLA 1JZ3A 4AZ8A 4ETQB 3HG1B 2WUCL 3STZB 5CJ8A 3WFBH 2Z31A 5T33L 1QR1A 1OAZL 2XY2A 4R4BB 1CLOH 2X1PA 5HHMB 3WEXB 3SKJH 5IT2L 1J5OL 3L3HA 1F8TH 5LBSL 2VLLB 1XF1A 2QSCL 2R1YA 3VH8B 4BZ2L 3GBLA 3MV9B 3OKNB 2IJ0C 2N56A 3SGEH 4LKXB 4OF0A 3QA3B 5IQ9A 4BQCA 4L8SA 1NMCB 5FXCH 3TVMC 3QFJE 3EOTH 1U8KA 1NBVH 4WWKB 3DSFL 4ZUSB 4X6FB 4FFZL 1IZKA 4NBYB 4ZOCA 1KGCE 5LAXB 4MZ2A 5KG9A 4KDTA 1EHLH 4YFDB 3REVB 3HE7D 5HHQA 2V7NA 1PY4A 2VITA 4QKXB 1EBPA 3GI8L 3VDAA 5DMKB 4NKMA 4LMQE 4ODXB 1ZGLP 1QSEE 4FFYH 4MJIB 5DI8B 1YEDA 3BEVB 4JRXB 1GZQA 1D5BB 1KB5H 2I5YL 3QXDA 2FATH 4X7CC 1FYHB 5DK0A 4MNQB 5FM5O 5F1NA 5EIVA 1CCZA 5CSBA 4X5LA 1NBZA 4KXZH 4L4TE 1K4CB 2A6JA 3TZVD 1YPZE 4AEEA 5EORH 3B4NA 3DUHA 1JFQH 4GKSA 4U1LA 5JPNB 1FLRH 3RKDD 3QUKA 4WI6A 3MNVB 5DWUL 4MAYA 2RB8A 3EOAB 1AI1L 4C83A 2MQCA 3C6LB 4BA8A 1GGCL 2IQAA 1C5BH 5KJRL 1OHQA 2Q76A 4DUVA 1MQ8A 1CLOL 5DJXA 4WTWA 5EZIL 3Q2CA 3C60C 2VDPL 3LMJH 2ZUSA 3GJEA 3QIWB 1JNHA 4OLYL 3O8XC 4BZ2H 3D3VE 1G7HA 3VGDA 3MV7D 4MJ5A 3BQUD 3HNSH 2GUOB 5AYQA 5F3HB 1OPGH 1WBYB 3GSOB 1FZJA 3TBVA 1IKNC 5DJAB 3HE6D 1DQQA 4YDVB 1CTOA 4QHUB 5JORB 3PGCB 5E70A 1AGCB 3EO1A 1RI8A 2DTMH 4R0LA 5CINH 5L2KB 2BMKB 3O4LA 4O9HL 4Z0BH 1YEKL 4S1QH 5DRZB 4OF6A 5I1HH 4F80A 1GOFA 5GIRB 1CD1B 4EBQL 1U58B 4ODXA 5DHVH 5GSRB 1YEDB 4IHOA 1BBJB 1JGEB 3GEWB 2QQKL 3BMVA 5JR1H 4N9OB 1S5HA 3RGVA 1YEHL 4N0YL 4Y5XA 5HTSA 3HHRB 4NO5B 1GRWA 2FHFA 3AU1A 4WDIA 4WCYL 4TUKL 2MQ3A 5E8OA 4XRCB 4FABH 5C09E 4U1LB 4RIRB 3GSXB 3PWLB 3FQXA 1X4YA 3GMMA 1YN6A 5J6HA 2X4SA 5DGRA 3WIFA 4U1KB 5CGMA 5C09D 1VGEL 1MHCA 5HVHC 3D0VA 3ZTNL 1HI6A 1JVKA 4G3YL 2I24N 3KS0J 2GJ6E 1RUKH 3M45A 1FPTL 4XWGH 4HUVA 1MCOL 2V6HA 5D2LE 4OCSL 1E4XH 1LO5A 5A2LH 4WW2C 3OKNA 1ZLWH 1UZ6E 3SE9L 1EO7A 2A83A 4EN3D 3DVGA 5CGTA 2XTJE 5F9JA 5GZND 2X4QA 4G42A 1G7LB 1NANI 3MRQB 2VDML 3HRZB 4LCWA 3O2DL 1QZ1A 5DJ6B 1I7UA 2AJYH 5GJSH 4UILH 1OP9A 3MRCA 2ZUVA 2ZUYA 4K9EH 5I2IB 1UACH 4LEOA 4HWBH 4Z0XA 3ZTJG 2LU4A 2QHLA 3EYQC 2DYPD 3IF1B 3V8CA 1CD1A 1JBJA 5CSZA 1IJ9A 2F19L 4PRHD 4MJIA 1RPQA 4ZPVA 1EAPA 5C6TH 2NZ9C 3PV6A 3HMWH 3LN4B 3DGGB 4Y5XB 5BCAA 4WNQA 2R0LL 3V5KB 5FDWA 1GGUA 1CD0A 3FHQA 3QUZA 3SDAA 3HCVB 5JR1L 2WWKT 4GW4A 2OBGA 2ESVE 1WC7B 4U0QB 3F6IA 1GPOH 3BO8B 3WIIH 4FABL 1CDUA 2BY1A 1MHCB 1QVOB 1EAJA 4XX1E 3GMPB 2Q3AA 1J0HA 3QWRA 4C83B 3QI9C 2EDJA 1VGEH 3RJQB 4EI6B 5E7FA 2R8SH 2F5AL 5GGQL 3NZ8A 3KXFB 4X6CA 1Q38A 1MRFL 2ARJA 4J3SA 2B0SH 4R96B 2LV4A 4OI8A 4TVSa 1E4XL 2ICEB 3IKKA 2DQGL 4GW1B 2GHWB 3O81A 4B50A 3JWOL 4E41B 3HMXH 5IHUL 2NXYB 3WNMA 1JPTH 3T65A 5C0BE 5I18H 5JW4M 2C1OA 3H3BC 2RGSA 4K8RC 3SOBL 2AJYL 2GJJA 3GHEL 5GJSL 5FUCC 1JV5A 3CFCH 4ZMAT 1FV1A 2YPVH 1YNLL 35C8H 3BGAA 1KTLA 1QLRA 1VFUA 1C1EH 3L3IB 3N06B 2X1QA 5TGBB 1ACYH 2IBZX 2CDEB 3DXAE 4ODVH 4U49A 1OP5H 3A67L 1CWVA 3T4YB 1LGVA 4DGVL 2FIKB 1T83A 1P4LA 4WY7H 5DZOA 2FO4B 3HMWL 1C5DB 4JHBA 3BDXA 5C0RH 4PRPE 3OKMB 2HG5B 3CFKB 4U1KA 3TO4B 1MCLA 4M43L 1NLBH 2DQCH 2DIAA 1O5DT 1I7ZB 1JZ4A 4OZIA 2VE6A 2NQCA 3EJJX 1MCHA 3DHJA 2IAMD 4KMLB 4L8SC 5MENE 3GSQB 3TNNB 2YBRA 1YZZA 1P69B 4MD0B 2F58H 4ZFOB 5TDOB 2UZXB 1RMFH 3OG6B 3FB5A 5GGQH 1ZHLB 5EPMA 4NCDA 1MUJA 1UQSA 4PRIE 3UXFA 5F7DB 3FQRA 3VW3L 3BPNB 4S1SL 3HRZA 4W6XB 4XMKL 1CQYA 1VEMA 4TOYH 5F1KC 2YPKA 4JKPL 2JJSA 1CG9A 4M3KB 5CLWA 2EDTA 4YH6A 3QPQD 4UNTA 5C3LD 1EHAA 2ED7A 3KDMB 1I1AB 3HI5L 3W39A 4TTDC 2Z91B 1JPTL 4FMKA 3P4LA 4OGXL 3RGVD 4UAOB 5KSAA 3PP3K 3EYUH 5E2WH 3QUYA 2W59A 1C1EL 3SDDB 2O61A 3RDTC 2UWEA 4KK8D 3VFMA 2OL3B 3HS0B 1P4LB 1T1XA 5DJ0A 5A16B 2DQUH 2CLVB 3C9NA 4I0PD 3S4SG 4F2MB 2IAMB 3P4MB 3LS4H 3F62A 1DTUA 1KPVA 2ADJB 1M05A 1OAXL 1ZS8B 3MRMB 1NCWH 1AQDA 4X0KB 2ZG1A 4M43H 1NLBL 2ESVA 1DBML 4XNQB 3U4AA 1MAML 4DEPB 3MV7B 2DLGA 3HRPA 3D39B 3I6LE 4OLXH 1G6RH 1IGML 3SPVA 2D7QA 3SKMA 4Z7QE 4U31A 3CSYB 4I0PC 5T3XL 4JDVA 3LRGA 2VNCA 3BE1L 5CEZE 1PFCA 1WWWX 4PTUB 2WLYA 2X4OA 3DMMC 4LFHG 2VR5A 4S1SH 1RZ8A 2Z8SA 3WEXA 2W07A 3EOTL 1NBVL 3OPZH 1NCAH 3DSFH 4JFXB 3JSSA 4QRRD 1G84A 4GMTH 1A6TA 4PBVC 3AREA 2EXYC 1U8LB 5EN2A 1R5WA 2GTZB 3P73A 1FSKB 4JANB 3PABA 5EIIA 4CUCA 4WHCA 3I50H 4ZOBA 3IFNL 4MJ4A 4P0DA 2VZVA 1NGPH 1ZLUK 4XBEH 4CN4A 3EO0A 3GI8H 1I8MB 4Y4FA 4NHCL 4CMHC 4RFNB 4OQTL 1RZIB 4YGAB 1R24A 1CL7H 5MEOA 4P99A 5HI4D 3P0YH 4WEUD 2R0WH 4BFIA 1AQDB 1WAAE 2OTUA 2Z8VC 3VXQB 4GRWF 3TYGL 4JM4L 4ZUTA 1ZVYA 4LOUC 4L8BA 1FLRL 3PWUB 4HK0B 1T2QL 2DQDL 2E9JA 5F70A 3MRIB 1KLUA 3F7YB 1VFBA 3CH1A 3M17A 1VGKA 4LU5H 3LDBB 3CSYA 3T4AB 2OMBA 3KVQA 4OLXL 2V9TA 2XN9A 1LO4H 3LN5B 3JV4B 1FO0A 1JPGB 1UYWH 4MA1B 4X5WA 4E42B 4Z95H 4EN3A 4ORGB 4OLYH 5KAQG 4X7FC 5LWYL 1RZFH 1R5VB 3AFLA 4Y7MA 1TMCB 5EO1A 5F72S 1D5ZB 4ZSOE 1JMZA 1BOGB 4LVNC 4NSKB 4KUZL 2G60H 4X80H 3P3YA 4PRIA 5E94A 5CMAA 4LAQL 2Z91A 3JWDC 3AB0C 1Z0MA 3UTSE 5GRYA 2KZ1B 3CNKA 2XG5A 1SVZA 3KLAA 2BRQA 4OKVA 5BRZA 4M03A 4DVBA 1G6VK 4GXVH 3L7FA 4G9DB 1BOYA 4JFPB 4S1QL 1UJ3C 1U8JA 1QSED 2J8OA 4QT5A 1WUNT 1KJ3H 1J8HB 1FRGH 3HNVH 2H8PB 3AXLA 3IFNH 1HINH 3EO1B 2FX7H 3QNXA 1RUPL 3UTZB 2EYRA 5IJKC 1P7KB 4OGAC 4OQTH 3V4PL 4MDIA 1U92A 8FABA 2G5BA 3MXVH 1Q9LB 2VL4A 1BQSA 2W0PA 3NCBB 3NFNB 1AKJA 1WIOA 3PQYB 2GFBB 2IMNA 4TN9A 3I6GB 4BUGA 3L3JB 4JM4H 4AQ1B 3ZTNH 3A6BH 4HS8H 1IQDA 2EKSB 3OKLB 5ID1A 1ZXQA 4UU9B 1KB5A 2VZOA 2I60H 1OLLA 2FNBA 3QAZB 3JV4A 3O41B 3HZMA 1T1WB 3R1GH 5EU7C 5MEND 1UM4L 6FABH 4TSBH 1CLZL 4NQCB 1CXFA 1NUNB 1U8HB 2PN5A 5INCB 5CZVL 3MRRA 1MCFA 2Q8BH 1FVEA 3O3BB 1ZVSB 4GW5A 1RZFL 3DROA 3ULVD 3BJ91 4FQ2L 5D71H 4OIBA 5DHYB 2XTJC 2NXYC 2G60L 5E9DE 2EC8A 4ZAKB 2JK5B 1YYLL 4AIZA 4QGYA 4HWBA 4JFFD 5DD3H 3QIBC 2WINA 4GBXB 2AQ1A 2BJMH 1V3KA 3FRUA 3ALWA 5DMGD 2P5EE 3R06B 4QXTB 3T0ED 1OY3B 2FX7L 4PRPA 3UTTD 4J3OC 1XGUA 4F7TA 2IALA 5B39A 4R7DB 3SKOB 4XP6H 3FB6B 4PJFB 2VL5A 3MLUL 4F7PB 4OBSA 3QQNA 5FM4A 4KRNA 2ADIB 1GPOL 1I4FB 5CBAA 1GHFL 1I3RA 5FF6B 3WIIL 3L3JA 1U8MB 4BSJA 2F53D 1FAKT 4N1EA 4UU9A 1FCGA 3F7QA 4NNYB 2ZUTA 1X5XA 3WHE0 4ONFH 3QJFB 5KANG 4Z7VF 3V8OA 4OUUB 3CCHB 2P46B 4KK5C 4RWYH 4Z7QF 2JTDA 1HWHB 1IE5A 4PRAA 1EXUB 3HE7B 4LSPL 1CN4A 1V7NL 4HJGA 3LKNA 5KSAC 4UTAL 4Q9BA 2EDWA 3VFVB 2DI9A 1L6ZA 4PJIE 1ZLVK 1MIML 1TPXB 1CDIA 1BZ7A 1FL3B 2FJGA 1A7RL 5AZ2L 2VJXA 1JPFB 1CYGA 1M7DA 5E4EB 5GPRA 5I18L 2AEWA 4KVNH 4F58L 3OB0H 1HHIB 1DFBL 1NGXB 4JLRA 2YPVL 35C8L 4MQXC 3FKUS 3TA3B 1FQ9C 1PEWA 3GSNH 1KB9J 4JCLA 4ODVL 2BJML 3V6ZB 3ZT6A 2FCBA 4MDIB 3QIUB 2X4RB 3NIFF 1FL5A 4WY7L 4CADB 1JF5A 5C0RL 4AT6B 3C8DA 5DVKA 1QRKA 4B0MM 1F4WH 4P4RB 4XP6L 3BAEL 3MLUH 1P84K 1HXYA 4FOMA 3OKLA 4MX7B 3KPNB 2XTLA 3LKQA 3D69B 3WJJC 4X4YA 2VDKH 2YD8A 4Y19A 4GLRI 3BUYB 3WD5L 5KVEL 3EW3B 3ARFC 4PRID 4R0LC 1E0OB 5K59F 1NFDE 5I1EH 1FDLH 3PWPB 4P23C 1ZVSA 2JJWA 1KCVL 2CRZA 1DSFH 2A9MH 2YBRB 1XZ0B 3GRWA 1R6VA 1FL3A 2FJGB 5EBWB 3P9WB 1AHWB 3C09C 4DZBB 5GGRB 3HUJB 3BKJH 4BFBD 3BGMB 1KXTB 2HMID 5EU3A 5E0QA 3QDME 3T2NL 1EGJH 3U46B 4X6CF 1DFBH 3GB7B 4LNVA 1CGXA 5IFJB 1YQ2A 3R06A 5IM7B 5GJTH 2C3WA 1IMHC 4E41E 4JQIL 4GG8A 3HAEG 1BZ9B 1DEDA 4NJ9L 2Y36H 1F3DH 1A1OA 3CLFH 2J1KA 4JM2D 3GIZL 5EOQH 2NY6D 3G5YA 5HGDA 1K8IA 1P4IH 4X6DA 1A3LH 2CUHA 1J1PH 5TQ2H 4YHYC 1OAXH 2YA0A 4XCCL 2JJUA 4O5LH 5EOCH 4LSQH 4HV8A 4NGHL 3BAEH 1HDMA 2IFFL 3NCYS 3RTQB 3ZYOA 3OKOB 4HBQA 5EZOH 3V5HB 2VWEE 2DKMA 1HE7A 4OB5L 1MI5D 3VMOA 4DGIH 4TRPL 1GGBH 5CD5C 3OZ9H 5KVEH 4ZPTB 3QQ4A 3C60D 4K94C 2CLZA 5T3XH 4WI5A 3FB7A 1UEYA 2YD7A 1F4HA 3U7YL 2IPUK 2FBJH 4WFHE 1NBYA 2RHEA 3TBYA 3GRWL 4RRPG 4E0RB 3ELAT 1NDMA 3MA9L 1DSFL 2A9ML 1DR9A 3REWA 3OPZL 4D2NA 1NCAL 3FT2A 1BWMA 4OTXL 4RISH 2NX5D 1VKXB 3MV8B 2XKUA 2D0FA 4MA8H 1CFSB 5FV1L 5KW9L 5GGSB 2EDFA 1GCFA 4UT9L 1MFDH 3VD5A 3U6RB 5ALCH 5ISZE 1RUMH 1JZ8A 1MPAH 4QHMA 1ZMYA 3RPKA 4L4VA 3EYVB 3G5XA 4TVPL 4DZ8B 3EFDL 3I85A 4KDTC 5B38B 1KELL 5CZKA 1R5WB 5CILH 1LO0L 3LQAH 1IGJA 5IFHL 5HGDB 3DIFB 3KXFD 3GGWB 1D9KC 4Y0GA 3MLXL 4GXUN 1IILE 3VXRE 5FO8B 1YPZA 1N0LA 3OKDA 5CKGA 2AJXH 2VERN 3K2MC 3NIDE 5I74C 3UZVB 2OJEB 1A8JH 2VUYA 1KFAH 1G6RA 4UT6H 3T77B 4PJEA 2IANA 4U6HA 1ODAA 4M02A 3RWJB 2V5RA 2CLZB 1CVRA 43CAB 4NKDB 4CVUA 2IQ9H 4X99A 5F9AC 4UB0H 3SO3B 3WBDA 1FYTA 4Y8AA 1P4BL 4RX4A 1R3HB 1UYWL 2C3GA 5HI5C 4PP1D 2Y25A 3KYMA 5LWYH 2FECI 2WP3O 1XR8B 2YZ8A 2XKNB 1RJZA 2UVFA 3GUTB 3MOAH 3U7YH 3CJJA 4PJGA 3WS3B 3STLB 4WFHD 4KUZH 3BDYL 2OS7A 4HCRH 2V5MA 4JHZA 3MA9H 4I3RH 1EVUA 4JHAH 4X8JB 2EXWC 1MF2H 2AK1L 3G6AB 1IGFL 3DYMA 4KDVA 4OTXH 3S35L 4KAQL 5IB5B 4HJJL 1NH6A 5KW9H 1XGTA 1DBJL 2EKJA 3X12B 5E5MA 4JPVL 5I8CA 2FL5A 1KJ3L 2X4NB 3HNVL 2CIKA 4N0FA 1BVKB 1S78C 1IVLA 2BNQD 1MPAL 4ELMA 3KPRE 5D7KD 1RUPH 5J13C 2G5RA 4KJWC 2BOCA 3MMEB 1RIUH 1XF5A 2K1MA 3DRQA 3R4DA 5T1MA 1J8HA 1D5MB 1KCUH 2I25N 3MXVL 4PYHA 3KPSD 5C9KA 3DV6A 3NIGF 1QG3A 3HFML 4MJ2A 1OGAB 3BIKA 3BHBA 3Q6FA 2OJEA 4YK4B 1A7OL 3TIEA 2ZWLT 4HS8L 5HHNA 2NY2B 4KQ3L 3PJSB 3SEPA 3FTGB 2LU3A 2ZCLL 2UWEF 1JWUA 2ZCHH 4AL8L 1YUHA 1T5WA 1ZANH 1QSFA 4Y2DC 1FE8L 4WIQA 5F21B 1I7TA 2EO9A 2HA1A 4POYA 5J11C 2XWTA 4TSBL 2R1XA 1P4BH 4XX1G 2DWDB 3LQAC 5BW7A 3B2UD 3VCLB 5I9QC 3MOAL 3ARDB 5KANI 5F1SA 1SYSA 4HCRL 1BLNB 1AR2A 2YN3A 5F1IB 4I3RL 2D31B 3K74B 3DO7A 5GS1C 4JHAL 3UC0L 4D0DB 1JHLH 1EZVX 4HK3J 4YXLL 2HN7B 3U6RA 2N7AA 1I9RH 3IS0X 4HLZG 4KAQH 5C0EA 3MRKA 2DYPA 5DF0A 2AXGB 4M1DL 1CGSH 4BUHA 5EBMB 2HJLB 4BSWB 1NBQA 4XPHL 3BYYA 4AIZB 3Q5TA 4Y2OA 4G6JL 2Y5TA 3U9PH 2GK2A 5GZNC 2WANA 2AK4D 1A21A 2OQJB 1XF5B 4U0RB 2WP3T 2HLFD 2M26A 3E8UH 3U9UB 3RZCD 1SJHB 5FUOH 2OZ4A 2YN5A 3HTLX 1C12B 4LGRB 3IYLW 4M7LT 4ZNEA 1RIUL 5I1DB 1DBKL 1DQMH 2E9BA 4LQFL 2CQVA 2P5WA 4P23D 4RMQA 3CC5A 3DSNA 3OJDB 2XZZA 5DURB 3OSKA 4NQVA 4M6OH 1CFTA 3S98A 43CAA 3RUGA 1IEAA 1A2YA 3AMLA 2VAJA 3PDOA 4KQ3H 3W9EA 4PP2B 1S7SA 4OCYH 4O02L 1R3HA 4I1NB 1ZANL 3WYRA 3GUTA 1X44A 2CRYA 4A6YL 5IB3A 3MLSH 1OD9A 4DCQA 3RWGB 4TUOA 3F5WB 2HKFH 1A64A 1RZKC 1JRHH 5MHSD 5KVDL 5CGYC 2R9HC 3GSRB 3LH2L 5FYKE 2CDFA 1DDHA 1YMMB 4OD3L 3VWKA 1ZOXA 3CMGA 3HE6B 1II4E 5D93C 3DGCR 1HH9B 5L2JB 3BD5A 3OKYA 3L3OA 3QDGD 4HIIB 2CIKB 5AAMA 3ECBB 1I9RL 4NHUB 3ROLB 5ICYA 5K33A 5F6IC 3M8OL 4L8DB 1OAYL 1CGSL 3SQBA 1SJHA 3O3EB 5D1QA 4LNRB 5L9DL 1S7UB 1QA9B 1T5XA 3K8MA 3EHBD 3E8UL 4YHIB 4WO4B 1F4WL 2NNAB 5GGTH 3S35X 1B9ZA 1UWXH 2EE9A 4FTVD 1W72H 1XCQB 4AIOA 5DUPL 1PJ9A 4WFED 3VFWB 3OTTA 4K23H 4PB0L 3E6HB 5ETUB 4I5BA 2VDKL 4D0CA 3R0NA 5C09B 5DD0L 2XPGB 2P1YA 3HZKB 2IEPA 1UXWB 1EEZB 1N6VA 1JTOA 1FP5A 5L7XL 2BY0A 2NY3D 5ABDE 4PGDA 2UUDH 4JY6A 1JGUH 1BFVL 2MJWA 4WHTB 1H0DB 1J8HD 3D3VD 1JNLH 1A6WH 3BH9A 4EDWL 1U3HB 3S37X 4H26B 1YECH 2NZIA 2D31A 3H3KA 2G9HA 2IAND 1OWRM 4ZO8A 5KTEL 2CGRL 4OV6F 5HHQB 4Y1AD 5L2JA 3KPMB 1XZ0A 1A9EA 3CVHA 3MLYH 4UQ3A 3ROLA 3CMOH 3W9DB 4XXDB 3SE3C 1SBBA 2V2TB 1HZHH 5KSAD 4K94H 3MNWA 1O7SA 5E1HB 3L3KB 2CO6B 5LGJA 4XPGH 5J3HC 4TULH 2Y36L 2UZIL 5TH2A 3VXNA 4XHQA 2WIIA 4UBDD 3GIZH 5EOQL 1JL8A 3C6LD 15C8H 3UROR 3CC5B 3MJ9H 4JY5H 5TQ2L 1MLCB 4PJ9B 5TE7L 25C8L 1Z9LA 4XCCH 4ZYKA 3HC3H 3TV3L 1LEKA 2HP4A 1KBGH 1FGVH 3D2UA 3FO2A 5DTFB 3DVIA 5DJXB 1J1XL 4K23L 4GKZA 4DGIL 4NDMA 4E9LA 4M7KH 3U0TA 4LHQB 4W4OA 4MAYC 3TN0B 4HLJA 3QZWA 4POZD 2OJZH 5HVWA 4ODSH 1U8KB 3FQTB 3ULUH 1IM9B 4WHTA 4X6FA 4LLDA 5L7XH 1MFNA 4JAMA 2IFGA 3EZJB 4Y1AB 3N85H 1UB5B 2EYSB 4H5SA 5L2KA 3IDGB 2VDOH 2CIIB 1T6VN 3BEWB 3KYNB 2AJZA 2R2HB 3E3QE 3WXWH 5J12B 1YECL 1MJJB 3FT4B 1ACZA 1J9CT 4QRRA 1UGNA 3GJFB 4LLVA 3W0WD 4DAGH 4L5FH 4W70A 2DWEB 4XXDA 4MS8D 5KTEH 1ZA6A 3WXVL 1I3UA 4J4PA 4HUWA 4POZC 1A4JB 2CXKA 4JDZA 1S5HB 5CJOL 4F9LA 1F13A 1UKTA 2D7NA 3GKWL 4LCUA 1V7ML 3F12A 3X17A 1NGZA 4ISVA 4UT7H 4ZUWA 2FJFA 3VXNB 1CFSA 3NPSB 3RVUC 1DLHB 1OF2A 2ITDA 3JV6A 1FNHA 4GRLB 5I66B 3K4ZA 5ACLA 2B1AH 3O6FD 1YJDC 4O2EA 2ZOKB 5JW5A 3QQ3B 2AJXL 5DTFA 5IJVB 1LO5B 3CFEB 3QEQB 1YPZF 2WBJB 2FHCA 1LE5A 1QSVA 5KSBE 1CGYA 5MI0B 2X89D 3DVGB 3NCCB 4NQSB 1BPVA 1I1YA 4Q2ZB 5CIPA 2X4QB 1SJEA 3LS5H 2JB6B 4Z5RB 4MNQE 4N5ED 3B9AA 2VWEC 4OCRL 4HGWB 5D5ME 1N0XH 1UB5A 4PJEB 3OAZK 2W60A 1D7FA 4LOUD 4XMLL 5I2IA 4M1CC 3GZKA 1MJJA 3FT4A 1F45A 2Z8RA 2VDOL 1RURH 3LHPH 4F7CB 4N0UA 1LWRA 4TSAL 2ADFH 4L4TD 2F53A 1GZPB 2Z0BA 3WXWL 1Q9KB 1U8OA 4CU8A 4ETYA 3MNWB 32C2A 2C4FT 2AKRA 3WXVH 4CVZB 1QSEA 2RFXB 3S96B 4X8JA 3SDAB 3AU1B 3ARBC 4IRSC 4P59H 1JF1A 3PP4H 4LLMA 1N6QH 1CK0L 1BF2A 4KH2A 1MJUL 2XQYK 1YN6B 5J6HB 3D0LB 4GRLA 4CVXA 1JMXA 3UBXI 1KCRH 1EEUA 1INDH 3T1WA 5SWSE 4P23A 4DKFH 3PHQA 4X7SH 4OFDA 1H5BA 4OZHB 1Y0LA 1N5YH 1JP5A 5C6PB 1YQVH 1A7OH 1FIEA 3TZVC 3IAQA 3B2VL 2PXYB 3L7EA 4JZNB 2FZ3A 1A4KB 1KIQB 1SYVA 3H2WA 5EU4A 3OX8A 4N8VG 1RSFA 4QRSA 3DWTA 2OSLB 3KPSE 1I8LC 4HGWA 1FE8H 4E41A 1HXMA 3I84A 2ADGA 4Q9QH 3BZEA 5MENA 2NY1C 3GIVB 4NCC1 2DQEL 3LIZL 3T0AA 3MC0A 4FXGA 4LEOB 1A7NH 4OZIE 2L4OA 4FQQB 3MBEC 3KPTA 4X83A 4U6XA 3NAAH 4OLZL 4LVHB 4N1HB 5KVFH 5C0JB 3T3PE 1R3IH 1M7XA 5KSUB 2IH3A 5EDXA 3LN4A 5J4MA 3FJTA 4KK8C 3GSUB 3RDTD 4Y16D 3QT2A 1MAKA 4ZUWB 4F7MA 3WDHA 2F9BT 3RX8A 4ENED 3LQZB 1I1FB 4LLQA 4NWUH 3ARPA 3R8QA 4XPHH 1YYMH 2GEEA 2VXSL 3TO4A 4P59L 1I3GH 1EDQA 3QIBA 3PP4L 1PG7L 1N6QL 4MQ7A 1CK0H 1PY9A 2AW2A 4ENEC 1C8PA 5FUOL 3TJEH 1QFHA 4D9LL 3QDJB 4PRPD 3UTTA 5EFIB 3TH2T 1AY1L 3SDXA 4HX1B 4LSUH 3TPKA 3GHBH 4XB7A 1N8ZA 2YC1A 5D96B 4X7SL 3X3FL 5K9OB 4X5XB 2HWZL 3BUTA 5LGHH 2XZQL 3VGBA 4NQSA 5A2KH 3GSWB 3X11B 5I1DA 3C2SA 3T2OA 5L2KD 1YY8B 3WMSA 5CJQL 1QBLH 2Q8AH 4X9HA 4JZJB 1NCDH 1IGCH 1JWMB 4L3EB 5IKCB 4XGZB 1KTRL 4AENA 5JIKA 5DZLA 2COQA 4NKMB 5K9JL 3QA3A 1H3VA 4MHHG 3P0VH 4Y16B 5ISZD 4QLRA 5E2VH 1MQKL 3WNNA 2GQHA 1D9KA 1KENL 3TBTA 3NTCL 5DZNA 2AQ3A 4TUOB 4CKVX 4KWUA 3TJHD 2A6IA 3NOIA 4M9PA 2DD8L 4JZOA 3IB4A 3MLWH 1F3JB 2NX5E 1QUNA 3DUSA 4F2MA 2BP3A 1DQDL 2VMFA 5CEZH 5J8OA 2ZOLA 4ZD3L 1L9MA 4ZOEA 5L9DH 3CDYA 3GMRB 3C6LA 3WFHB 3T0XA 3NACL 4FP8L 1PG7H 5DSCB 4ZO9A 4TQEL 1DLFL 3GSQA 1MVUB 4PTTB 2C4FU 4HT1H 4QOKD 3F58H 2EDRA 4FQLL 4JFDD 2OZ4L 4LNRA 5EU6E 5EO0A 3WUZA 3TZVB 4NN5C 1CE6B 1KIQA 5DD0H 1P7QA 5LGHL 4ZUSA 3QUKB 2DRUA 1VADB 2J8UF 3KPRA 4GAYB 5FYKU 1P9MA 4IM8A 1U3ZA 2CDGA 3O6FA 4IRZH 1A0QH 1KN2H 4CU7A 4JG0H 4JRYB 4FXGB 2M8XA 2XV6B 1AXSB 4ODHH 3VFOB 1WLHA 3ZYIA 1A6WL 1FZMB 2ICCA 1KOAA 4FG6D 4BH7B 3HUJE 5HXMA 3DMMA 4OCMC 3TBTB 1F90H 4K55A 2J6EH 4OUOA 4LK4A 5TF1L 5F1NB 4OZGE 2NPLX 4LPXA 2CXGA 4P2OA 2P8MB 1E4KA 4PYGA 3HC0B 2RJMA 1DN0B 4K3DH 5JORA 2NZ9D 1H15B 1RD6A 5B8CC 1HZHL 3FOLB 5D7SH 2FX9H 1K5NA 5EZJB 2D2OA 1TZGH 3T08A 5EFIA 1OQOA 4ZD3H 2H3NA 3QB7C 3CFJB 1PX4A 3MRFA 4OFKA 2E5EA 3MACH 3IDJB 1IRAY 1Q0XL 5F6HJ 3OKKA 3QI9D 4WW1B 3IU3A 5C9JB 3MRPB 3NPZB 2NR6C 4X5XA 5TE7H 4PJ8B 1D5IL 5GS0C 2XI9A 2Y07L 3LN5A 5GHWL 3ARDD 3BP6B 4MYWB 5FA3A 1GOHA 1WEJL 3NIDF 3UAJC 4M7KL 1PX3A 4H0GA 5ESQB 3E2HB 3SHSA 2ZSWB 1BOGA 4ODSL 2BMKA 3O4LB 3ULUL 4KXZI 1AXSA 2DQJL 3TCLA 4IRZL 4NQEA 4PLKC 2HRLA 3KJ6L 1A6ZB 1A0QL 1KN2L 2QLVB 4HJ0C 5D7LE 2RCSL 1IC4L 3B3IA 4XI5C 2GTZA 5D4QA 4ODHL 4QTHB 2XA3A 5BRZB 4Y16A 3FO9B 1YNKH 5ICZA 1EAPB 1G9NL 4QT5B 1L0XA 1Y6MR 1DZBA 4YPGB 3EO0B 3QUZB 5DJ6A 4KK6D 3ET9F 5TF1H 4GW4B 3DUSB 4H0IA 1JNNH 3JWNC 4OGZA 2NY6C 2XT1B 3PQYD 1P7KA 5J9PA 1KPUB 1FAIL 3WN5A 1V7MH 5D93B 2NCMA 3OMZA 2VABB 4TPRH 4OLWL 3W2DH 1RUAH 4Z7WE 5FO7B 4Q9RH 1E4WL 1KLFA 3CFJA 4J1UA 3DRTA 3AM8C 1G9NC 3M07A 3BQUC 4YBQC 3CVIL 3RPIA 2P7TA 4G9FE 4KKBD 3CH1B 5LQBH 4LCUB 3OR6A 3PHOB 4M4PA 2W92A 1FBIL 4UNVA 1H3GA 3K4AA 4L9LC 5EO0B 2HVJB 1RJYA 1BFSA 1FFPA 3QAZC 4GW1A 4KUCD 4GAGH 1X5YA 4PJFE 1W0WB 3ROOB 1JHKL 1Q1JL 1MHPL 4GAJL 1ORQA 1P7QB 5FM5M 3QWQB 4NO3A 4P5TB 5ESQA 4NFDA 2NY4B 1U8HA 1NC4B 3RWFA 2VLRE 2KL6A 4CRPA 3LS5L 2BRRH 5IVZB 5DJDB 1KTDB 2WBJA 3IFOB 2HLAA 3QCVH 4PJDE 3VE0B 4YHML 1HH6B 3B9VA 1KEGL 4ZO6A 4MA3A 1INEL 3QRGL 1DUZA 1HSBA 4M4RA 4NP4H 1IGTB 5BO1L 3JUZA 1DBAH 1U8JB 4YHKH 4KRPB 3IRZA 1CICA 3GJFH 5C2BL 1FNEB 3QRFM 2WINB 1BJ1J 1T1YB 4JFFE 5LAXA 4YHLH 4ZO7A 1QBML 3IJYA 3V0VB 5BS0D 3I2CL 1KPUA 4LLUA 4JO3H 4EI5A 3IFPA 3G04A 3K0WA 3Q6GL 2VITB 4M7LH 2EXYD 3KPLA 1HHGA 3MXWL 3AB0B 4HXAL 4LKCA 4JKWA 5TFSH 5FUZH 4PIRF 1MJUH 1U8OB 3D6GA 2BNQA 4LSSH 4NCC2 1KXVC 4EOWL 3TNNA 1JHTB 4HMEA 3TVMD 2NYYC 5DUML 3WFEL 5I8OL 1P7QD 2GT9A 1INDL 4YIQA 5C8JA 2Q86B 1WICA 2HTKC 4Q58C 1BEYL 1KJVA 3HNTH 4Q7DA 2EDNA 3B2VH 4QNPF 5ALBH 4RAUA 1MHPH 4EUPB 5INCA 2NY5L 3ZE0F 3QXVA 3EJYD 3H3PL 4ODBD 5ERWB 4IIQB 4G8GD 5SWQB 2FH6A 4G80A 4I13B 3O9WC 1ZAGA 2LTQC 1LP9A 4JFDA 4PJCE 5EU5B 5IVXB 3AY4C 5ICZB 1Q9OA 3VG9C 4Y2DA 1LNUA 5ICXA 3RIFK 4QRSB 1QACA 3KYOA 3SDDA 2O61B 3FN9A 4JREC 1MFCH 1WCBB 4YDVA 3VWJD 1J0IA 3VXOA 4OLZH 2YPLB 4YHKL 3BZEB 3C9NB 3JWOC 5IQ7H 1CG9B 2EDQA 2ZUQC 4Z77A 4FQHB 4Y88A 1QPPA 5KVFL 1NDGA 4D8PB 4EI5B 2VB5A 1MCEA 1CFBA 3P4OB 3PHSA 4I8DA 1K8DB 1I7ZA 4ZUUA 2Z92B 3I2CH 4LKCB 5C7XL 4M6NH 3RWHA 1BJ1H 2DJSA 4IHOB 1EJ6A 2VXSH 5E08H 1IAKB 4N68A 1A1MA 1KULA 3KWWA 4GS7B 2DQFA 2AEQL 4F7MB 3SCMA 4S11A 1WJ3A 4Z7NE 1MHEA 3GHBL 2GK0B 4J3UA 1A14L 3BUYA 1ORQB 3TT3L 1WSST 2OL3H 2HWZH 1QFUL 4JDTL 2EIZB 1UXSB 2ZSVA 4ZFZB 4H20L 4I77L 3WJJA 5DJCB 4XPAH 3MV7A 1QBLL 3AREB 3VE0A 2Q8AL 5A3IC 1AHWA 1NFDF 1BZ7B 1A02N 3GKZA 3WIHL 5IVXA 1A7PH 3K3QA 4PJAF 3S97C 1T20B 4AM0B 1IGCL 1EFXD 4I18A 5HVGB 4M93C 1EV2E 2IGFL 5D7JB 5KN5A 3K2UH 1RZGB 5I8EB 2UWEB 1FVDA 4JRWA 5D9SA 3G5VB 4P5TD 2NY7L 5E2VL 4MDJA 4UV4L 1KENH 1NC4D 3AC0A 3VWKD 3P2TA 3ZDXE 3MREB 5BQ7B 3CSPA 3C5JA 4QTIL 3VXQA 2ICWJ 5CSZB 5TE4H 1TJHH 4JPIB 3B6SB 4OGAD 5HI3D 4WEBL 5I9QB 3V4VH 2V2XB 4XNQA 5GZOD 3QEHB 3F7YA 1LP9F 2FIRT 1VSCA 3L3DA 1T3FA 5DC0A 5FDWB 1J12A 3BDBA 4JPWH 3F7RA 1DLFH 5HI3C 4HKZA 1UA6L 4HT1L 2BNRE 3VXME 2NXYD 4FQLH 2OZ4H 1XGYL 1A14H 1MAJA 2C3VB 4LDLB 4WU5B 4XC1H 5BS0A 2H1PH 1BD2A 4V2BA 2P43B 4PV9B 3UCRA 4M9OA 5FK9B 3AMKA 3MRIA 4AMKL 5H35A 4XVTL 2H9GB 4PTTA 1Z6JT 2J2ZA 4Y8DC 1U8QB 3C5ZC 2JCCB 3IDIA 4KGLA 5DEFA 2R0ZH 1L7TH 3I6KB 3O11B 4G9FB 4PGJA 4XNMA 3SDCD 3ZDYF 2ENYA 2FJHB 4PJBE 1NAMH 1BGXH 3WNKA 2YD4A 1J7VR 1MFAL 3K2UL 3DI3B 4GRLC 4MD5A 4JQXA 4NSKA 1EIBA 3JTTB 2C3XA 2BZDA 1A5FL 3UJJH 4MCYB 1U92B 2NY7H 3DX9B 5CMAB 3ARFD 1DBBH 1JV5B 3ZSSA 4XP5H 4DZ8A 5ITFA 2VAAA 1UWEL 2HRPH 4RGND 4XCNB 3DMMB 1X5GA 4Q6IA 4DKEH 4LSTL 1HHHA 3RAJL 5TE4L 4Y4HA 5D1XB 4H88L 3HLAA 2UV3A 1GC1C 2DMBA 3T4AA 4S1RL 3GO1L 4G8FB 4M93B 3ARGC 2GKIA 3MACL 2LAAA 3FFCA 4ZOAA 2EYRB 1CIUA 3EDKA 4YR6A 1G6RB 3KPPB 4EI5D 4F57H 3U2SA 2X70A 3B9DA 3O45A 2MCPL 4Z7WB 3BZ4A 2F54B 2IG2H 1NCUA 1CD9B 2SEBB 1AGDA 1I1AD 5FK9A 1TZIB 1CGWA 2Y07H 3FB7B 3MBEA 1XGYH 2GY5A 2CK2A 1XGPA 5T3XE 2ATKB 2XXMB 2YXMA 1R0AH 4FQCL 1GYAA 3MLVH 5I71B 3Q5OA 3ZTJH 3DXAB 1CFVL 2GAZB 4PJ8D 3MRDB 4JRXE 3WS3A 1E28A 1A9BB 4UMGA 1MLBA 3FQRB 2R0ZL 3RDTB 1L7TL 1HKLL 3MROA 3OJMB 5DQ9B 4EI5C 2BVOA 3HB3D 1IC4H 1WWCA 5IW1B 3BISA 3F7PC 4NQCA 1MELA 4LSDA 5JXED 3MX0A 1YNKL 4UNUA 4LCWD 4X4XA 5KZCD 2R69H 2XFXB 4MB4A 1Z9OA 4Y89A 1IQWL 3U79A 1HHKB 4J3VA 8FABB 4R7DA 1IAIL 3OWEA 4QF1B 5L0QC 1BX2A 3K46A 2CKNA 3QUXB 5K59E 1A5FH 3UJJL 4ELMB 2B7DT 2LTQB 1HIMH 4J4PD 1QFOA 1JWSA 2DOCA 4KMTL 3ZE1E 3KYAA 4NNXA 4KZEH 5IB4B 1EHXA 4MJID 4OLWH 5B21A 1RUAL 4Q9RL 3RAJH 3L5XL 3LRSB 3O6KH 5C6WH 2IAMA 5I17A 4FG6C 4NO2B 4UIKL 4FFVD 4XBPB 4YR6B 3SDAD 1VPOL 3L3GA 4LCYA 4AG4H 4NT6B 2VABA 2E27H 3IDYB 1EXUA 4QY8A 5C08A 5AG9A 2ESVB 4M6ML 3O9WA 3RIFF 1JWUB 2OK0H 4PV9A 1S7WB 1Q1JH 3AY4A 5DC4B 3PF2A 4XNXL 1FNLA 1OL0A 5JA8B 3QUYD 2IF7A 3VWJB 4GG6E 1WT5C 1RFDL 5KSBB 2AV7A 3ARGB 1IAOB 1KB9K 2BY3A 2VSDA 4PJXB 2BRRL 4RMTA 1W0WA 1F11B 4RAHA 4GKOA 1CFNB 1MJ8H 5FFLA 1XT5A 2MPAL 1I85C 3QCVL 5B3JF 1ZWIA 2VLKB 4R90L 2APVA 1HKLH 3IS1X 3MR9A 5D5MF 2ILLA 4NP4L 4L29A 1DBAL 4U1GB 1TITA 4QHLA 1X3DA 3HZYB 2HLAB 1FL5B 3QUXA 3BGFC 3WKMH 3P73B 4JANA 5EIIB 4LL9A 3NCEB 1SHMA 1HSBB 2BDNL 2ADIA 3FZUD 4K71C 2O26U 1HHIA 2BY2A 5HI5D 5IB4A 3WFDH 4M7LL 3MCLL 5L88H 3EYFB 2KBGA 4YDLC 4G8FA 2VDLL 5DJZB 4M1CD 4EOWH 3TGXA 2QL1A 5J06A 2HFGH 1IAII 2ID5A 4O58H 3WFCL 2HT2C 4K7PL 1JCKA 2J4WL 1QSZA 3QIUA 3PIQB 4N9GB 4YXHL 3ULVF 4GMSH 5T1KB 1IGIH 3ARFB 1FVCA 3O9WB 2J8UB 3KLDA 4RGMC 3PJSA 1VPOH 4FQXB 2CMRL 3AS1A 1BEYH 1S7WA 4U7MA 5DRWA 4HJGB 2BNQB 5IMMA 3PWNA 3WO4B 4FQXC 3H9HB 3CU7A 4D94A 4I18C 1E6OH 2EE2A 3ZKXC 1EERB 1JGLL 4R7NA 3ARXA 1QRNB 4KI5F 2R1XB 3ILPB 1MY5A 1A9BA 1JPFA 3KG5A 5I30L 3HI6H 1IAMA 4LP5A 5T1LB 3U0PB 5C71A 2EH8H 4W68A 3KYKH 1FO0B 1JPGA 4X5WB 4I3GA 5EBGA 5SWZB 4EN3B 4NIKB 4ZXBD 3MUJA 1AD9B 2H32A 4KROC 4OFYA 3CZJA 5HDQL 4NFBA 5EIQA 5ELIA 2BVEA 5IM7A 2W9EL 3IDNA 3CD4A 4FMFA 4BKLA 1JRHI 2HT3C 4GG8B 2I9TB 3L6FA 3EBAA 2X4RA 3BGFB 4A2MA 5HDOA 1F02I 2OR9H 2PTUA 3LB6C 4L8DA 5DD5L 3HUJA 1OW0A 1TVDA 4OV5B 4QWWC 4OT1H 7FABL 1WIPA 1X7QA 1SY6H 2J12B 4JKLA 4U1JA 5HD8C 4HV8B 4OIAA 5IG7A 2O5ZH 4IBLT 4YHIA 4KKCC 1U3HC 4Z77B 3UJTL 3OXRB 4MAUH 1I8KB 2R56H 3JBG7 5BMFH 5L2KE 2YRPA 5I76B 4LVNB 2IBBA 4P46A 4PJBF 4QWWD 2HFGL 4XPBH 3RWHB 2Z8WC 4GRWE 4XPTH 4TNVF 5DRWB 5IMMB 4KJWD 3F7VA 3LB6D 4PRNB 1IGIL 3V6OA 3DX8A 5EUKB 4LIQL 5EU6A 1X4ZA 4YC2B 1A1MB 2PYEB 3NA9H 5JNYA 2Y1VA 2DL9A 2OL3L 5H8DA 2GCYA 1IQDB 1NDMB 5J11B 4OIIL 3PV7A 5ID1B 2AXFB 4I77H 3VFPB 1JGLH 2BNQE 4ELKA 5AAWA 1LQSR 3LZFH 1HCFX 5IMKA 2E7MA 1NJ9A 3WUWB 4B5EA 3IGAB 4LHUA 4C4KT 3LCYA 2G9HB 4OM0H 4XP9H 4ZPTA 2EH8L 5C0AE 4IDJH 5BV7L 5IFJA 3HR6A 3WN5C 4KKLD 5JOEA 1Q9WB 1FG2B 3IETA 4PJBA 5T3ZL 5HDQH 3J7HA 1M7IA 3T8XB 4UQ3B 5ACZB 2VDQH 3T04D 5BOPA 4WI7A 3HI1A 4RFNC 4UV4H 3KPSB 1MFEH 3RZCA 1XH3A 3ZT5A 4PJGF 3MV8D 1S7UA 3O6MH 4RGOL 4GSDH 5D9SB 1OM3H 3QH3B 1E27B 3U0WH 1DEEA 4NPYB 4JO2L 2W0KA 4MD4A 5EO9A 1RIVL 3THML 3SE3A 4ZUVB 1I8KA 1KXQE 4LHUG 1MCNA 4RNRB 1AJ7L 4JPWL 4WI2A 2ERJB 3H6JA 4X7TA 5B39B 5E00B 2R56L 3WE6A 5I6XC 1F6LL 3AS3A 3JVGA 3CPLA 2FEEI 4G7YH 3S36H 1NCNA 1UXWA 4QOKA 1YPZB 3E2HC 3S37H 1OAUH 2CJUL 4IMLB 3ILPA 1WGOA 4W4NA 5IV2B 1L7IL 2AXHA 5D7LD 1MH5B 5T1LA 3FT2B 5HYSG 3U0PA 3H9ZA 3WL9A 2XZAH 1G9MH 5EA0L 5DJ8A 4H1LB 1QKZH 3RWEA 4D9QD 4LCCA 1U3YA 1Q9WA 2AABL 5GRZA 3QIUD 4PJ5D 2CLRA 1X5ZA 2OLDA 5E5MB 3V9FA 1ZHBA 4NQCD 4PGBB 4AEFA 3T2QA 5DRXA 5T3ZH 1CTNA 3I6KA 1ZA3A 1E6JH 3PG2A 4MMXC 4JDZB 5K9QI 1G7MA 2AI0H 3NABL 4ZS7L 2VDQL 4G7VH 5D1QD 2HH0H 1MREH 4LVOB 3SQOL 3H9YA 1DBBL 1NGXA 4O2FB 2X9WA 4P2OD 3ZHDA 2NXZD 1DUYB 1B0GB 3P30H 5EG6C 2Q20A 3QWOA 4DVRH 1PZUB 3V0WH 4RMVA 4JQVC 4NKIL 5HHOA 1DLHA 4HQQH 4UOW1 1JK8A 1RZJC 4RGOH 1OM3L 4ZXBA 1NFKA 2BNRA 3VXMA 1CL7I 3VFGL 4XVJH 2BVPB 2BNUB 2BSRB 2OR8A 4RBPK 4W81A 3RGVC 3UPRA 3T77A 1H3PL 1F4YL 2BK8A 5B8CA 1AP2B 3GO1H 4U2YA 5KS9E 4QRUA 5INDB 3RVVC 3NFSH 1S8DB 4YDJB 1U93A 4F57L 2AJUL 2MCPH 5AUMB 3UTSA 1I85A 5DD6A 3U36B 2PYEE 2BCKB 1RJZB 3PGDB 1MWAA 4OFYD 1MH5A 3CZFA 5HPMA 3MLZH 4GRWB 4PREA 5JUEH 3JTSA 2CJUH 3CIQA 1WBZB 2C1PB 3RY5A 4PJ5B 4U1SA 5EZLB 3MLVL 5JMRA 1OT1A 3RX5A 4DFIA 3U2SB 2V9QA 3M1BB 4HHAB 1JZ6A 3FO1A 3QUXC 1ITBB 2HN7A 1C08A 3NIFE 1BBDH 4ZFGL 4ZNEE 3GJFA 3D18A 2W38A 1RZ7H 2AXGA 1NAMB 2E7BA 1T21A 4K3JL 3KLHC 1BVKA 1WZLA 5EBMA 3LN9A 5EU6D 3VFUA 5E03A 32C2B 2Y5TB 1OARL 3QG6B 3UDWA 1BF8A 3UZEA 4JY4A 1IQWH 1UENA 3CXDH 2HT2D 5DQ9A 4KV5E 5I19L 5D1XC 3NCMA 4ZS7H 3MJ8B 3CK0L 4Y19D 5D6DC 5D2NB 1MREL 4WRLA 1FFRA 5GISH 3UJIL 4WTZA 2NY1B 2NLJB 1ED3B 1JI2A 1QEWA 1UWGL 4P5MA 2BNUA 2BSRA 4IDLA 1IFHL 1QR1B 3BSZH 3MRKB 3ZYJA 4HUMB 1ND0B 1PD6A 3ARBA 1NAKL 1H5BB 4N5UA 4KJPC 4O2CB 1KG0A 3ZL4H 4J3TA 1NGQH 1JWSB 1U93B 4I4WA 3RNQB 4HH9A 1AHWC 1F2XK 5AUMA 3OAYK 2YKLH 4FFWD 4OBRA 3NFSL 5B39G 4ZNCD 2BCKA 4AIXA 1D5XB 1HDMB 2BHYA 3QZWG 3SBWA 4IMLA 1Y18B 5EU7E 4XTRD 5BXFB 2JB6A 1CU4H 1H5BC 3JTSB 4GBXD 4XNXH 5C0DA 1LD9A 3QHTC 3QQ4B 4JB9H 3I75A 5GXBB 5MP6L 3W5MA 3I9GL 5I73C 4U6VL 1A2YB 4PLOB 1K4DB 4DQOH 1CT8A 4P2RB 4F7CA 1S7SB 1N59B 1PKQA 1ZT4B 4QHNA 5HD8D 1AO7A 5CJXC 2XRAH 1FFNA 2YWYA 4HKBB 4WUUE 2BSSA 2R23A 3GM8A 2WWKO 2F74B 3MGTB 5HHXL 1SJVA 4CVZA 4MNHA 1T5XB 5C92A 4CDHA 4MGXA 1MRCH 4LHUD 1YC7A 5JDSA 2NLJA 1CDHA 1VEOA 4PD4K 3QP3A 1CR9L 1YMMA 1M1SA 3HG1A 3V79C 1UH3A 4WUKL 5GISL 4U1NB 2OTPA 3G5XB 5C08E 4NWTL 3KPQB 5IW6B 1UWGH 2VISB 1NEZG 4OKDA 3LQMA 1ZHKA 4R3SB 1U0QA 4HH9B 4XHJC 2IBGA 4EVNA 5FOBA 4YXHH 4GMSL 4MWFA 1IT9H 1NGQL 2IWGA 1KPRB 1QO3A 3VI3F 1WZKA 3EJZD 5HBBA 3VJ6A 1MWAB 5F3HA 3VA6A 4OGYH 3RTQD 4X98B 2NNAA 4QYOB 3ZKMD 4WU7A 1E6OL 5SX4H 5I1KH 4OFPA 1OVZA 3PIQA 4N9GA 4LRNH 5IF0B 3EGSA 3UTTE 1BVLA 2GITB 3QO1A 5A43C 3FOMB 4RQQB 1NC2B 4Y4KB 2X44D 3HI6L 2FDBP 4Z7VE 2VLRD 5FECB 4AENB 3NGBC 1Z0NA 3KYKL 5E2TH 3L1OL 4LCWE 5TDNA 5HJ3A 3CVHB 2NX5A 3RIAF 5DMKA 4G8GA 3O4LD 4YGVA 3ECBA 4NHUA 1DQTA 1XIWD 1QRNA 1S7XB 1AC0A 4LLAA 3ARUA 3QXDB 1U91B 2XRAL 5ANMA 5T1LD 1AE6H 4L4TB 1FL6B 3VFNA 3GSUA 2OR9L 4Z9KB 5E2JA 5I6XB 3CFBA 1V3LA 2VXQH 2Q7YB 5SWZD 2VLJB 5SWSD 4KRPC 1F58H 2AS5M 5DD5H 5D2NC 1DL7H 1S9YB 3QUYC 1AXTL 4GOSA 4PY7B 3G08A 3C2AL 4XWOD 5TE6H 3JVGC 1U41A 4FXKA 5HHME 3S7GA 4DGYH 4ZYKB 2IPTL 4DN4L 1CZ8H 4YPJA 3BD3A 4Z8FH 4BQBA 4UDTA 5K9KA 4JFEA 3K1KC 4CU6A 5C09A 1MVUA 1F6AA 5FOJA 4WJ5A 3ZE2E 5BMFL 5DS8A 3CSBA 4MWFB 3VXUB 1ZE3C 2Y6SC 5SX5K 2DIJA 4JKKA 3T3PF 4XBGA 3CUPA 1H0DA 3UAJD 4P9ML 2APBA 1DQQB 4LEXH 2D7PA 2F54E 4CNIA 3PGCA 1FYTD 2QQNL 3S5LA 3FOMA 4Y4KA 1DQJA 3SGJA 4OCWH 4LBEA 2A6KA 2AGJH 3TFKC 1S7TA 5ADOH 4YGVB 1QLFB 1S7RB 2XA8H 1FORH 4QO1A 2D9CA 1ZA6B 5ID0A 5BV7H 3V6FB 2V2WA 5BZWB 2P8MA 3TH3T 3DVFA 3RGVB 4K71B 3GBML 1NGYB 1JYNA 4M1GL 3BWUC 1DN0A 4YWGL 4WDIB 1F3JA 1BLNA 2YD5A 4K8RH 4JEGB 1LK3H 1WV7T 5BVJB 4DK3A 3VRIA 4U3XA 3GMMB 4PY7A 2VXQL 2DLIA 2VLMD 2NY0C 4IMKC 4U4BA 5IP4A 2Z31B 1ZT7A 1S9KC 1JUFA 3O6ML 3TFKD 1T7ZA 2DWEA 4M5ZH 5IBTH 2Y7QB 3OV6A 2XNAA 3C2AH 2VISA 1RIVH 2BNRD 3VXMD 1ZHKB 3D2UB 1D6EB 5F7WC 1GGIH 3OGCB 3V2AR 4A2LA 5C2UB 3VFRA 1Z2KA 1HQRA 3GM0A 1X5FA 4KTDL 5DEGA 2FYYB 3BP6A 2FR4A 4X98A 4X6EA 1VADA 3KPRB 4G6MH 4LLDB 4P4KA 1A3RH 2F8XC 4PY8J 3TESA 4CNIB 3H7BA 2C7UA 5JOFB 2DM2A 3EGSB 2EYSA 4H5SB 2LQRA 5E00A 3WE6B 4CJ1A 5L8KB 3QQ3A 1IC5L 1R5IA 5TDPA 2XZAL 2OTWA 4MZ3A 3TIDB 4EIGB 5IESL 5I1IL 1UCTA 3RY6A 3FMGL 5D6DA 4OJFH 4MA7H 4KJQC 4MVBC 5BZWA 1FORL 2AKRB 4S0TD 1YC8A 3MRHA 2ATPA 4PGCB 1B0RB 2Z31D 1JI1A 3QFDA 2VLJA 3ARSA 1MEXH 5DR5L 1CLYL 2D7MA 4WFGD 4K8RL 3G6DL 1MCJA 4NKOA 3N50A 3EZ8A 5FGCB 5DD1H 4JQXC 4UDTB 3PGFL 4ZS6C 4BZ1L 4HQQL 4WI4A 1P7HL 4UUJA 3QUZC 1JNHB 1UWXK 3I3BA 2AK4B 3S9DB 4KHXH 4QXGH 5E9DB 1F4YH 3QIWC 3CX5K 1W0VB 3O3DB 5CSGA 4YX2L 4LLMB 1Q72H 4WWKA 4OI7A 1ZSDB 4QHKJ 1FFOA 4L1DA 3FFCD 4MSWB 1LE9A 3VI3E 1BQHB 4XC3L 3I3EA 1R3KA 4M7ZB 3S5LB 4K2UH 4XWOC 4Z18A 2DBLH 2XQYG 2BFVL 5ISZB 1I1AA 1QFPA 3RBSA 5FO9A 1S78D 4PGZA 3H7LA 4JFFA 3UO1H 4H1LH 4NQXA 4Q97A 4IJ3C 2XXCB 1OW0C 5GRVK 5JW4N 3BEVA 4JRXA 1Q0YH 3RBGA 1RU9H 5JLZA 1ADQA 2Q1EA 4U6TA 3D48R 3TBVB 3BKYL 2EEAA 2EZ0C 2VH5L 2PNDA 5CS7A 5EZLA 4DKDC 1U3HA 4FQPA 4B41A 1I1FA 4LLQB 2R4RH 2X40A 4WGWB 4U1GC 4WFEE 3MNZB 1OARH 1K6QL 4H8WC 3D0LA 1EMTL 2DQHH 3B5TA 4CVXB 4MQ7B 5DA4A 2NY2D 2VLJE 1MVFA 4HWUA 4HIHB 2XWJB 1YMME 2EIEA 3N1PC 1T21B 2X42A 3DURB 5HGAB 4R97B 3MGOA 2V2TA 3BP5A 1XIWA 2VLKE 3QG7L 5DD1L 3WSQH 3U30C 3BSZL 3BVNA 3QCTL 4PLJD 4XRCA 3OAUL 2WIIB 3ZZ1A 2FZ3B 4KI5C 3KR3H 4UTBL 1YDPB 5DUBB 2FR4B 2A6DB 4PTUA 4YX2H 4WFFE 2OSLA 4JO1L 3C5SA 3D0VB 3T3MF 2YK1L 1A1NB 1AGCA 5E8EA 2P5WD 5JXAL 4PBXA 3LV3B 3MRGB 5KZCB 4NQDA 1E4XI 4IOFD 3OXSA 4O2CA 4MMZC 3KDMA 1N8ZB 5ECJE 4GRWH 1N64L 1NCBL 3UBXG 5SWQA 2P5ED 3FRPA 3QUMB 2LABA 3VFTB 5AD0A 3MQIA 4F37F 1BBJA 3PWVB 4FQJH 3SN6N 5CZXC 1KJ2B 2DS4A 2YPLA 1JPSH 2WWMD 1ETZA 3IXAA 4Y1AA 1WTGT 2DMCA 4IOIA 5I16B 3QFDB 1A7QL 3BKYH 4U3HA 3B43A 5D7IB 2X10A 4LSVH 2C26A 4PRBA 4U0RC 3MBXL 3EHBC 5ILTL 3HAEA 2IC2A 1C16A 3OBAA 4F8TA 4N8CH 4PBWD 2VR4A 4YHNA 1AO7B 1UJ3B 3P11L 2A77H 1CR9H 4RDQG 1OTSD 2YPLE 4J12A 5F96H 5FYJH 1LMKA 2DQFB 4NRYB 3RVXD 3VXTA 3UZQA 2BXYA 5E9DA 4NWTH 4XAKE 4HAFA 2CR3A 1JJUA 2UVEA 5DFVC 4EEEA 1BWWA 3QCUH 4H8WH 1XF4B 4Y4KC 1KJVB 1RZKL 1X5JA 3QCTH 3RA7H 4OD1L 4M00A 1QFWH 4ORGA 3HA0A 4UTBH 5FHAH 4NQDB 1MJ7H 3MO1A 3B9KB 5LCVH 4ZFZA 3IVKA 5EOTB 4PRHA 1EEYA 3O2VL 4JGMA 4JZJC 3AS0A 3GK8L 1AC6A 5I1GH 2AEIT 1I1CA 1J1OL 5C0GA 2ZCKL 3QFJA 3QUML 5IQ9B 2HVKA 5DFWH 3QUZD 4MNQD 1I1YB 1N64H 2WUCH 1EFQA 3IXTA 5J89A 1RZGA 3KGRA 3SKJL 1NLDH 1WWBX 2DLEA 5E24E 1KJ2L 5E2TL 3ZYZA 5MEQB 4IRSB 1MCWM 4HIJA 1WAAA 5I1AA 3HCVA 1AFVH 2L0DA 2VOTA 2W60B 1RZIA 4FQHA 4RQQA 1Z5LB 3RVTD 4MCZB 1FZKB 5D1ZD 4PJFF 1YEGL 5BQ7A 2CD0A 2Y9RT 2H45A 4HIHA 3NFNA 1GZPA 4G8GB 2PETA 3DURA 2W9DL 3EOYG 4IS6B 3OAZH 4N8CL 5EULV 1J05B 1NBZB 2FGWH 4PGEA 5F3BB 4DGYL 3SDYL 3X13A 2HJKA 3CFBB 4CAGA 2EDKA 5FYJL 5D6CB 3MA7B 2GIYA 2VIRB 2VLJD 1CFQA 1B3JA 2HG5A 1UVQA 1XCTB 4FFYL 1SEBB 3BPNC 3IAGC 1XFPA 1INQA 3C08H 4TNVK 5CHNA 5EORL 4PRIB 5FHAL 1JFQL 1YNTB 4R8WL 3QEQD 4JM2A 1WBXB 5DHYA 2PXYA 3GNML 4PJ7B 2GI7A 4L8SB 1T66C 3ARVA 1IL1B 2OR7A 1AI1H 3GSOA 4PLJC 3RWCB 4WWKD 3T0EE 1ES0A 3GMNA 3CVHH 5D2LA 5I8KL 1EO8H 4M7JH 4Z6AT 4KKNA 3CSGA 3FRUB 5FHBL 1T6WA 4NC1C 1MSPA 5IB2B 5F8RC 5HPOA 4L3AA 3FFCE 1X4XA 3CFKA 1ZT1A 1B6DA 4R97C 2YUWA 2DTSA 3FO0H 4M1GH 5FYLH 3DX6A 4HF5H 5I1CH 4YBLB 2AJSH 2OP4L 4PJFA 3SGDH 2P5EB 1YEGH 4QRQA 1UJ3A 3ZKMC 4PY8I 3HKFA 3MRFB 4HKXB 4GS7C 1A3QA 1ADQH 2IH3B 2Y72A 5AZEH 5CCKH 3KXFE 3WV0A 1T1XB 3SBWC 2EICA 5I1HL 1VCAA 3IDXL 3GSXA 1RJLA 4XHJD 1NEZA 3C6SA 3AAZB 4HUUB 1KACB 3RKPA 5CLTA 4WUUA 4JFQB 4JPKL 1HYRC 1KN4L 1UZ8A 4IJ3B 4MAYB 3TN0C 2ZUQB 3WO3B 3QDJA 1T0NB 3UTTB 2EE6A 1ONQB 1YEHH 2J7LA 1BFOA 1UZ6F 1YJDL 3EDDA 3RNKA 4HFUH 3D39A 5F44A 2K9UA 1GOGA 4M5YL 1U8LA 4M7ZC 2DM4A 5EN2B 4LGPB 1M6OA 2HVKB 1J8HE 4QTHA 1MCPL 2FB4L 3WO4C 2NW2B 3VXUE 3RDTA 3QIWD 3VD7A 4K7FA 4LCWB 1FPTH 4PJDA 4XWGL 1FZJB 4P5TA 4NQEE 3SGEI 2WLZA 4OCSH 5HVFB 1RK1B 3IJYB 1N3NA 2D03H 1R24B 4NZJA 4ALAL 2A0LC 1ZT1B 4XGZA 3G04B 1BD2E 1PSKH 4YE4L 2OTUB 5TPWH 3RWDA 1P2CB 2P5EA 1CXIA 1J0YA 5DLML 2VDMH 1TJIL 4HBCH 2VXVH 4NO0D 4R2GC 3O2DH 4AT6A 2DLFH 3NPSC 2WM0A 2OP4H 3QFJD 1BHGA 1HHHB 5HYQB 4FNLH 3UYOD 4PJGE 4HW6A 3WLWC 2QHRH 3QIBD 1QQDA 4HEME 4Y4FB 5TJWK 3X13B 2ZG3A 4HWBL 1ADQL 4L8CB 2BC4B 4ONHB 2XN9B 4OAWB 4MLSA 4PJCB 4D3CH 4NNYA 5IMLB 5MERB 3ZKND 5F7HA 2P24A 4R4FL 4XBPA 1T7VA 5FUCE 1T7WA 2F19H 1QVOA 3IDXH 4E42A 4LPVA 4KHXL 1CGTA 3V95A 1IKNA 2K7PA 3O45B 4NZUH 3L9RB 4JQVA 3ARED 1AGDB 1IBGL 2HKHL 2R0LH 4HZLA 2WZPD 3RWFB 4L8BB 2BVYA 3ULVL 1NFDB 3BIBX 1KLUB 3KXFA 3AREC 4X6CB 4GUPB 1VGKB 5ESAA 1D9KD 1T04A 5B4MD 1DE4A 3O3DA 1PYWA 4GKNB 4DUXA 1MRDL 1NKOA 3OL2A 4UV7H 5BJTB 3CX2A 2E8YA 2X4PB 4I9WD 1FCCA 4P2RE 3CXHJ 1U2HA 5CUSH 2H8PA 5IW1A 4X7EC 4NOBA 3LKRB 2F5AH 2W65A 3N9GL 1Q0YL 1J10A 4AH2A 5F6IB 4FRWA 1MHHB 3K80A 3SE8L 2X9XA 5JW3H 2AQ2A 1HHJB 5JHDA 4JVWA 1BQLH 1CDYA 4DOHB 1K6QH 2JKXA 2PCPB 5HYQA 2XN9D 5CAYB 5DLMH 1S7VB 3GI9L 3OGOE 3GMOA 5L0QB 3MODL 3GHEH 5CEXB 4FNLL 3QNXB 2AK4E 4KROB 3LEVH 4XMPH 4EN3C 1T0MB 3P4NA 1YA5A 2QSTA 3PNWB 3QHZL 1XF3A 2WV3A 4JFQA 1RK0B 5T5NF 1CQKA 3VG9B 1F3RB 3A67H 3MZTA 3O3BA 2ARWA 5E56A 2A38A 3KR3L 4NZUL 5DJCA 3OQ3B 4Z7UF 4DW2H 1IBGH 4JO1H 9CGTA 2YK1H 4ZTPL 3WDIA 4YC2C 4HS6A 1YY9D 5GRUH 4JFDB 3L95B 2VN7A 2XICA 1IEBB 5BJTA 4JFPA 3HPLA 5DJ2B 4X8XA 4YHZH 2FWOA 2J8UE 1JYXA 4GBXA 3TJHC 1E4JA 4Q0XH 5IJKA 1WIUA 1CLCA 4B53A 5LBSH 3QHFH 2QSCH 1RMFL 3DMMD 4OI9A 2QJDA 3QDJD 4PRPB 1L6XA 4W6WB 3QR2A 3B83A 3IU4L 1N4XL 5DRNA 1FV1B 1P1ZB 3SKUD 4RDQF 3VW3H 2Z92A 3DPBA 2ZPKL 1K3IA 3QUYB 2GFBA 1K9TA 5C1MB 3QI9A 1T20A 5HHPA 4TVPE 5E8PB 2CKBH 1IAKA 3D25B 4YPGA 5HY9B 5AYUH 3ARDC 1RQ5A 3HI5H 5DJ0B 1G7PA 2VLKD 5BRZE 2ARJQ 4ESKA 5MERA 3ESVF 4JN2B 4YEFA 1G7QA 1YMMD 5I76A 2D4DA 4OZIB 1UB6B 1FLTX 1FVCB 4URTB 2KZWA 1ZK9A 3QHZH 3RWJA 4I2XA 4JPIA 3S88H 1NGWB 3MYZA 1B0WA 1VACB 2A2QT 2EIDA 2FATL 2FEEL 5JPMA 2DKUA 2NY2C 4GUPA 1QFWL 5IGXH 4K7PX 4E0RA 2QEJA 1LEIB 4ZAKA 4DW2L 4GKNA 4YFEA 4JDVB 1KT2A 2BVUA 43C9B 2OM5A 2PXYD 5GRUL 3WUWA 1J1OH 3QUMH 4HULB 1REIA 4BJLA 4K3EH 4S1DC 2C3VA 5BS0B 1PW3A 3MO1B 4GQPH 5KJRH 2PTVA 4JFXA 1JIBA 1N5AB 4PRHB 4YDLB 1QLEL 1AD0A 4Q0XL 3LMJL 2VLRA 3UBXA 3EYVA 1RVFH 3VRJA 3SKOA 2C5DC 2W0LA 3BE1H 4OF5A 4Z7UA 1KCSH 3U4EA 3HNSL 1QRND 5B4MC 4OZ4A 3QEHA 2X7LB 2ZPKH 5A1AA 5HY9A 1K2DB 2DB8A 4X9IA 3V0VA 2WQRA 4CJ0A 1I75A 2W1NA 4UQ2A 1IM3A 4MS8C 3U48A 1FZKA 3EOBA 2R9HD 1AGFB 5CGYD 1UB6A 2VXTH 4QCIA 4EBQH 4X7TB 4KY1L 3VDBA 4I0PB 4I2XB 1HILB 3BKCL 4CN1A 5IB1B 1LEGA 4PJEE 3HE7C 4JFED 5E2UH 3DV4A 2VXUH 3M17B 3VFVA 5K9QG 1V5JA 2UY7A 4YIQB 4WCYH 5F3BA 1CL7L 2JIXD 4R4NC 2X1XR 2R0WL 4GH7B 1NUDA 4YHOL 4N8VA 4PS4L 1WF5A 3KJ4C 1KV3A 3MCKA 3GNMH 5EC2A 5KS9A 5F1IA 2B4CC 3BZ4B 4KZDH 1RZ8B 3QJHB 2DQIH 4WVRA 4K3EL 3B8SA 1MOEA 3VXPA 3ULUD 3BZDA 5IK3B 3SE9H 4YK4C 5I8KH 4JM2B 1OAZH 5DK2A 1QLEH 1S9XA 5ITFB 2PF6A 4UAOC 4XCNA 2EC9U 1ZGLM 1VFMA 2ZNWA 4LP4A 1PAMA 4OZ4B 3G6JF 1RVFL 1MLBB 3ZKQD 1TQCB 5FYLL 3WLBB 5I1CL 4X80L 3QNYA 4LAQH 1OQXA 3MJ7B 4K9EL 2QV2A 3Q3GA 4C58B 3BHBB 3FT3A 3MRNB 3OJDA 4P2QB 1PEZA 1DVFD 4BELD 4LCYB 4DKAA 3BPCB 4L3EE 3RZWA 2X4UA 2F54A 2VLME 3PQYA 1KIRA 1EHLL 1NANH 4FN0A 3TO2B 1YEEL 1HINL 4AJ0A 4LFHD 4KKAD 4JPKH 5CP3H 1KN4H 3MPCA 3HAEH 3D3VB 1XGQB 4CDGC 2XACC 4HZAA 5FGBC 4IIQC 3JV5A 3OHXB 2VXUL 4Y2DD 4LF3A 2KUTA 2I5YH 4ZODA 4DCQB 4HUUA 1VKXA 3ULSA 1CFNA 3BT2L 2XWBA 3HZMB 1AGEA 4U1SB 4HEPG 4K7PY 4M5YH 1VA9A 4QNPE 1PQZA 4NUJB 3MRJB 2RR3A 2FB4H 5EC1A 3B9KC 4MQTB 3EYSH 5IK3A 4KZDL 3HZVA 1VENA 3V5DA 4OLUL 4F33B 2B0SL 1OTUD 2OYPA 2A9NL 3EYQD 3RJDA 3VXRB 1C5BL 1AH1A 3BX7C 4PR5B 2NW2A 1BQHG 4JY4B 2A1WH 3MV8A 2VDPH 3T0VA 1MI5A 3HMXL 1B2WL 1B0GA 3ARYA 1S9VA 3A6CH 2DLFL 4GAFB 5E8NB 1CICD 3OKOA 1OPGL 5I1LA 4JJHA 3EIFA 3GFUA 2K3TA 1YYLH 2NTFA 1L9NA 4P3DA 5T1KA 1YNLH 3ARBB 5BVPH 1VERA 5DD3L 2KH2B 4O9HH 3MV8E 4Z0BL 2J8HA 4R4FH 5IVOA 3LAFA 4GJTB 3NFPB 2HAZA 5D2NE 1L0QA 1YEEH 5DDHA 5DD6B 3U36A 2BC4A 1Y18A 1KB5B 2D0GA 4JY6B 2QQKH 5T5FH 2CKBA 1AGEB 2VC2L 1F4XL 3I02B 2BERA 5KS9B 3BT2H 5DO2D 5HYEA 1W8OA 4ZQKA 2GJ6A 2DL2A 4UV7L 2FD6L 4NM8L 1SQ2N 3V52L 1ZLSH 5CUSL 2BVQB 3CDGB 1YEIH 2CPCA 4HKBA 5FKAB 4RWYL 1XR9A 4HIEA 4G8EA 3LSOB 1S3KH 5DO2C 3GGWA 2Z4QB 2A9NH 3EYOA 2P8PB 4KI1A 3U30B 4R6UA 1D5MA