1TO5A

Structure of the cytosolic cu,zn sod from s. mansoni
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
GSNMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGLAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structure of the cytosolic Cu,Zn superoxide dismutase from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 44
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1to5A00
4A7TA 2E46A 1SXSA 1E9PB 1F1AA 1HL5A 3GQFA 3F7LA 2WYTA 1JK9B 4B3EA 1EQWA 1SDYA 2AQPA 1IBHA 2C9SA 4FF9A 2WWOA 1YSOA 2WKOF 1S4IA 1TO4A 3GZOA 1B4LA 3GZPA 3KBFA 1B4TA 2JLPA 1JCVA 1SOSA 4BCZA 2AF2A 1IBFA 1AZVA 1QUPA 4L05A 2WYZA 1MFMA 4A7QA 1FUNA 4A7GA 2Z7WA 1PZSA 2AQSA 4N3UA 2JCWA 1XTLA 1OAJA 2SODB 1IBBA 3H2PA 1E9QA 2XJKA 2C9UA 1XSOA 3PU7A 2ZKXA 3CE1A 4U4IA 1XTMA 1IBDA 2VR7A 2AQTA 1CB4A 1YAIA 1HL4A 2AQRA 3ECWA 2V0AA 2WWNA 5CU9A 1COBA 3K91A 3ECUA 1SXZA 2VR8A 2E47A 1OZTG 2ZKWA 3L9YA 4MCMA 1RK7A 1SXNA 1E9OA 1IB5A 3F7KA 3GTVA 1F1DA 1PU0A 1SRDA 1OEZW 1KMGA 1L3NA 2Z7YA 1CBJA 1F18A 3T5WA 3L9EA 1U3NA 1F1GA 4MCNA 2AEOA 3HFFA 2K4WA 3QQDB 4OH2A 1SXAA 2GBTA 2AQNA 2VR6A 4A7GF 3H2QA 3CQPA 1DO5A 4A7VA 3KM2A 1E9PA 2R27A 3KM1A 4A7UA 1Q0EA 2Q2LA 3MNDA 1BA9A 1Z9PA 3KH3A 3ECVA 1JK9A 1SPDA 1EJ8A 2WZ6A 3GZQA 3HW7A 2ZOWA 2ZKYA 1N18A 3LTVA 1Z9NA 2WKOA 1SDAB 1ESOA 3SODB 5KBMA 1SXBA 2XJLA 2WZ0A 2APSA 3RE0A 2LU5A 5KBKA 4A7SA 1N19A 4OJAA 2NNXA 1SXCA 2WZ5A 1E9OB 1UXLA 4BCYA 4BD4A 1YAZA 1TO5A 2Z7ZA 3QQDA 1E9QB 1PTZA 2GBVA 3MKGA 2GBUA 1UXMA 3KBEA 3S0PA 2Z7UA 1P1VA 1OALA 1BZOA 4N3TA 1DSWA 3HOGA 3GTTA 2C9VA 1OZUA 3KH4A 2AQQA 3CQQA 5KBLA
chains in the Genus database with same CATH superfamily
3HJEA 2X4TA 3F6JA 3G6JE 1QMUA 3MZTA 2DQMA 3GMRB 3FYIB 1F1AA 1MVFA 1QR4A 2PP9A 2H1PL 2DLTA 2DQDH 2BSRB 1FN4B 3IM1A 1IQWL 2SEBA 2YK1L 1DL7H 3LN4A 1MDTA 2JB5H 4JFPB 4TLTA 2R0KL 3VRLF 4F7EA 1RIVH 2BIOA 1C7TA 1I1RA 2VNCA 4FQXD 4ZUUA 2YO3A 4PRDB 1VA9A 5TE6H 1JCVA 6FABH 1EJ6A 1WFUA 2VXTH 2YD0A 1E27B 3GSVA 5DS8B 4OCSL 4AW7A 4HCGA 5I1DB 3RWEB 1JZGA 4JPIB 3ETTA 3AXLA 1R3LB 3HI1B 4JJHA 4JCMA 3GK8H 4IU3A 1ZANH 4ZSOA 2R39A 4PTTB 2P7TA 4AYEC 3KPTA 3QZOA 5C0CE 4WU5A 5EUOF 3WJMB 3VW3L 1PDKB 4O51A 1QASA 3V8OA 4KMTH 1HKFA 2ZP0T 4KHTL 5HGDA 2EZ0C 1MAMH 1EMTH 5D7IF 2YAQA 3VB9A 3RBGA 2Z31C 4NP9A 2F54B 3DVNA 4HIHB 4FG4A 3QAZB 3L13A 2ROYA 3PAYA 3VXUB 2HT2C 4Z7NE 1S78C 3QDGD 1T83A 4KRPC 5J13B 5AFAA 4XWOD 3VQ2C 4KX8A 4P2CG 1SQ2N 4UM9A 4JY5L 2A0LD 4L3CA 2X6BA 3P3UA 3NCBB 3O4LA 3HG0A 2KZKA 2ZXCA 4FLSA 4Z6AT 5T1JA 3V4VL 3HI6L 2WW8A 3TVMD 4QRPB 1UB6B 1XAUA 2C4FU 3NSDA 3SIKA 2WNKA 3DI2B 2Z35B 4HISA 4NNYA 3DX9A 5DRWA 2X89A 3PNWB 1DCEA 1A8JH 4HK0A 5DHMC 2BZ7A 2FLRT 1KXQA 4ZOCA 5GZND 5B3JE 2EYRA 2O5ZH 5I1EL 2FB4L 4K94L 3NAAL 1ZHNA 4WFED 4ZAKA 4Q9QL 3OB0H 3P30H 4GW1B 2YBGA 4OKVB 2OL3H 1AGBA 1UURA 5C0AA 3QZLA 1FCCA 3F12B 1ZIAA 1S2EA 4LSUH 1FNEB 5ID1B 3II3A 2FWUA 4GXUM 4NQEE 4PJBE 2H8PB 4NOBA 1YEWA 2I60L 2IDUA 3CH1A 4WJKB 3R19A 5AVTB 1WUZA 4XNDA 4PB9H 5JXAH 2CR6A 4X80L 3IWUA 4IK7A 4XPBL 4PJ6A 3C2AH 1U8KB 3Q8AA 3F7VB 2O72A 2VRKA 3JZYA 3KVDD 1A7PL 4XC3L 2ZXWB 3WIFA 1XIWD 2GJJA 5EOCH 1R3HA 2WLIA 3ESPA 3JTSA 3CZLA 3G5XA 3P2BA 4IIQC 2VR3A 4LSVH 4P9ML 1OCOB 4WSJA 2XV6B 5JDSA 3ZQXA 2OW7A 2AQPA 5FO8A 4QTHB 2PWGA 5CILL 4FNTA 2Z91B 3ZGHA 4PRPD 4JPQA 5LBVA 1AQMA 3DGGA 5EO9B 3AGWA 5J6HB 4LL1A 5CJ8A 3CZSA 4Y4FD 1JG9A 3G5VA 1CE6A 1EBAA 2YEQA 3OMZA 4WY7L 3O41A 3R7RA 3U7AA 5B22A 4TL5A 4DCQA 1TTUA 4G7YH 1QRKA 4K2UH 3QCVL 1YHPA 1FPTL 2XACC 1XSOA 4KRLB 4G9FA 1V3MA 4Q74A 3F6IA 3DX4A 5FKAA 4HJ0D 1T1ZA 2HLAA 4IM8A 3L17A 1ADQA 5KJ4A 3Q6FB 5JPNC 3M7OA 4Y5VB 3QS3A 1Q1PA 2EEBA 2YUZA 4OVVA 3D3VB 4WENB 1E0OB 2HSIA 2OJZH 1HTYA 5A43C 4LHJB 2AV1B 4E2OA 5T3ZD 5JO5A 4NAMA 3CK0L 4E9WA 1HHHB 2DLEA 5DJCB 5D2NA 5I5IA 4E9TA 1G0DA 1H0DB 3IETB 4PJ9B 4Q9BA 4PRHE 1KFAH 4HDIA 4R7XA 5EORL 3FN9A 3PY9A 4QY8A 4LXFA 3B7SA 3RBSA 4BQBA 5FF6B 1A9EA 4ENZA 5E8DL 5CEYB 4OAWB 5KSAA 2WAHA 4MS8D 3ESOA 3WGUB 5HJDA 1WIUA 5DJ0A 3S3JA 3W0WA 3SGJC 1BA9A 2WGXA 5KVDH 4JFYB 3HG5A 4R84A 1ZT7A 3E80A 3IMBA 5CNHA 2EDXA 3LVTA 5BJTB 2XIDA 2ATPA 2Q20A 4XC1H 4JO2L 2XOTA 4Y1AB 3UO1H 3L5HA 5HYFA 3N9GL 3W57A 1VF5C 3D85A 2APWA 3SBRA 2L4OA 4R2GB 3QIBC 4GS7B 4UTAH 1MHPH 2IH9A 5L4MA 1OLZA 2WBJC 1ACCA 3I6KA 4PJ8C 3KDPB 1H3PH 3MNVA 7FABH 1NC4A 3QXDB 2OM5A 3QJFB 3G04B 4NUMA 4XNYL 2YQBA 3Q2VA 4AX3A 4O02B 3NDZE 4HKBA 3T77B 4JHWH 1GGCL 1MREH 3D12B 2M2DA 3UPCA 3ZYJA 3GDCA 3B9KC 5DD3H 1C08B 3LEYL 3DX2A 4Y2DB 3B1UA 2QMJA 1PAMA 1OAUL 3LIZA 1QFWI 1SDDA 4NQXB 4XAKE 4XVJH 5B21A 2VR5A 3LRHA 4DP1X 4P23A 4WV1B 2AJVH 5T1LA 3ARGC 3GMPA 1IKFH 4HHAA 1EFQA 1SY6L 4HAGA 4AIEA 4Q97A 3SDYL 5I0WA 2YQ3A 4H8VA 3TBBA 1H3XA 2Y7QB 3FHQA 4UOW1 2FWLB 4HOWA 5FA4B 1BV8A 5JIDA 1KDIA 3BZEA 3HG1B 1BMWA 2FE0A 2VZVA 3DSNB 1WAEA 3H55A 4F80A 5D2LE 1KIPB 4FG0A 3DX0A 3FTGA 1XSIA 4KRMB 2XN9E 3BZDA 1O5PA 2EEFA 3ARVA 3BT2H 3QORA 4AMXA 5KVFH 4MJ6A 4PP1D 4R4ND 3SJVB 1TVHA 5EUOB 1A1OA 1CDCA 3WDHA 1WAAE 3RVWC 3HNTH 2Q7AA 3D18B 5D7IB 3CN0A 4C56E 4TSCL 4WTZG 2NY4C 2ITCB 2JE8A 4XT1C 5TFSH 3WKML 1T80A 1U8PA 3ECUA 3N44B 1PCXA 5C6TL 2DYSB 1JYXA 3PQYB 3MRNA 3PWVB 4IKIA 5CZXC 3MBED 1ZGLM 3A24A 2PTTA 2VQUA 2NY7H 4P99A 4FFZL 1KLUB 2P5PA 3PABB 3SD2A 3UEQA 1MCIA 4F7TA 1T20A 1RUPH 3MXVH 3SKMB 5HHME 1JWUB 1I9IH 2A4CA 2E5EA 4WEMB 3RHWF 1MWAL 1RJCA 2MQ3A 1W8NA 1DVZA 3P9MA 4XB8A 5E7BA 1KPVB 3V0HA 3UJJL 4ZQKA 3QAQA 5B38B 1ZHLA 4D0BB 1NMBH 4Z23A 2NQCA 2ZJSL 3DVIA 4XVTL 1NCCH 5C3IA 1RUMH 2BVTA 2YQ2A 4Y16A 1MFCH 2PNDA 1T4WA 2AFNA 2GIXA 4TULL 1ZE3H 4AJVA 1IIIA 2LE9A 2XSKA 5TDOA 4OLXL 4X0KB 4EMZA 5C0JB 2APFA 2ITDB 1KJ2B 2QZ5A 4KGLA 2FGWL 3DUSA 4JMXA 2Y1VA 1NGPH 5F1NA 1IO4C 3V0AC 2A9NL 3UAAA 2VDOL 4XPTH 1M71A 4ZUVB 3B9VA 3U0PB 4WFGD 2BY1A 3ARZA 4FP8L 2ED8A 3K71A 4LIQH 3CFQA 3B9EA 4G6JL 1KCKA 3PRZA 3QNFA 3MV8E 2GSMB 4YFLF 3AJ7A 2X2UA 3QUML 1YEIL 3VA2C 2DJMA 2RTTA 5L2KE 5DUPL 5EBWA 1X9RA 4OB5L 2YC1B 5J7CC 1MPAL 3O2WL 1A1MB 1I8UA 3FN0L 4I3RH 2CUIA 2HA1A 2XZZA 4JFTA 4Y4KA 4PJEA 2C3WA 5F9OL 2PWFA 4WKZA 4YIQA 3L4UA 4PGZA 3RWCA 2YPVH 1LK2B 2D2CC 2P5WD 4PGCB 1IKNA 3W11D 4ZZKA 2PYFA 1XF5A 4WWID 3GKWL 4TNVK 4RGOL 1LO2L 1OB1B 1JZDC 2BHFA 5D7LA 3BCFA 3QJTB 3R06A 1TTGA 5DMYA 1N4XL 1DFBH 1JERA 1T89C 4XN7A 3PWUB 1MH5A 1MJ7L 5F88A 3EYQD 4K9JA 3RNKA 2V9TA 3IRCA 3T0EE 1KEGH 4WGVB 2HFGL 2D3NA 2VMJA 3Q01A 2VLMD 1KB5B 3D7PA 3BH4A 2WO2B 1FZMB 1NCWL 3AU0A 3K46A 4FE9A 4Y5YA 5F7DA 2MH4A 3FUMA 3QUYB 5F89B 5I5JA 4HEMA 5CEZH 1KPUA 4UOZA 4GI9A 4JN1H 3LKSB 4NGHH 2Q3ZA 4LL9A 2W07A 4YSPA 4BGDA 1PQZA 2FEEI 1KTDA 4NYLA 2O5XH 4P2QD 3TA3C 2YGVA 1KIUB 3G7TA 1N0LB 1KB3A 3AADB 3OF6A 4MQ7A 4ECNA 5IG7B 2YPLB 1BLNB 4K3DL 5J1TC 1X5KA 5GISH 3SEPA 2LU4A 2YMXH 3JVGA 4M93B 1LO3L 4ELME 5JPMA 4CW1A 4RRPA 4L3FA 1A9BB 4GAJL 1P7KB 1OPGH 2VZ3A 2WB1A 3NSYA 4FEMA 4TF4A 4FFYL 3LXAA 3O8XB 1EUUA 3K6DA 1GZHA 1FZOA 2PTUA 4S0HA 1HXMA 1IX2A 5L4IA 4CGUB 2WQRA 3CFUA 5DYOA 1KY6A 1D5BB 5KSBE 2DQ6A 4UV7L 1UZ6E 3K2UH 3A4EA 6CGTA 2XKNA 4RZCB 4A7SA 5E8PB 4WDIB 4YQXH 3V55A 3WKYA 4KKPA 4YHOL 2BS9A 1NCAH 1QFWM 3OXSB 1PY4A 3S34H 1PZCA 3PPSA 1FORL 1PD1A 1BZQK 3T3MF 2JXMA 3ZW3A 3ARXA 4U6XA 4FQJL 2IJ0C 4HIEB 3D2TA 2NXYC 1SHXA 1VEMA 5ADOL 2J2ZB 3ARDC 3SQOH 5SWSD 5E1AA 4Y9FA 4BZ1H 1S7VA 3QDGE 3VE0B 4JREC 3HS0C 4Z7UA 4FZEL 4DUXA 2VRQA 5E5MA 2N01B 1DJHA 1VCBC 4NCC1 4L37B 3UAEA 1FH2A 2VDNL 2X41A 3EG9A 5DTFB 2XWZA 1IBFA 4JS7A 5CWSA 3JBG7 3LKNB 4HFUL 4A7QA 1YY8A 3VFMA 4BWUA 1WT5A 2E74C 3BPCA 5FW6A 4DGIL 5B3JF 1UWGH 2D3VA 2QQKL 4JPKL 3UH8A 3QDMB 3BEVB 3AQDA 4WIQA 1MFEL 4X7TB 1QX1A 4DESA 5JQ6L 1YYML 1RUKL 5L4FA 2WWMC 1N3NA 1CTNA 4OW6A 3Q1EA 1KG0A 4XVUC 3V4PL 2C26A 4JE4B 1GGBH 4OGXL 4XO9A 3PV7A 3UTQA 4C47A 1CXLA 3ABLB 4NM4H 1H8SA 1FYTD 3DC0A 3V2AR 1BQKA 4J3OH 1WPCA 2YPKB 1OZTG 1A64A 4YZFE 2FNBA 2TSBA 3MUZ1 4WW2F 5ANMB 5CJBA 1P7QA 3O6KL 3V6FA 5D1ZA 4AQ8C 3V8CA 4KUCD 5I1CH 2Z7YA 3SQRA 5SV3A 1U3NA 2YSTA 4JO1H 4I0PA 4Y9CA 1G84A 1UT1A 4GUPA 5FCUL 4JM0A 4EI5D 4L8CB 3NFPB 2OMWA 3U9UB 1MUJA 3PHQB 3ABKB 2ED9A 4QNPE 1IM9D 4GBXC 1BM3L 2KDYA 4YXLL 3ZYOA 1WA1X 4N0YH 1DVFB 3MRKA 1IMHC 3UCRA 4LVHB 3ULSA 2MOQA 4HUUB 1CE1L 2R83A 2CDEB 4H1LH 2O5YL 4G71B 4PRPE 1C9SA 4JY6A 1KV3A 1V7NH 2A9DA 5MI0B 5KBMA 1SXBA 1KIRB 3CSYB 3FU0A 3IU4H 5DMJB 1OK0A 5TJWK 3ZHDA 1CDBA 2GJ6A 3B1TA 4JN2B 1YEKH 1CI5A 4UV4H 5JOFB 4P4RA 2WUCH 3JYCA 3C6SA 4NLHA 1E9OB 3K0YA 4JG1L 2EO1A 5DJ6A 5FC9A 3CHSA 4FJYA 4E42B 3T1FA 1JI2A 4XO8A 4KK9C 3TFBA 3HB3D 2V7NB 1MQKL 2YA2A 2EKSA 1IAOA 1IZJA 4GFXA 2G5BA 3BZFA 3DDGA 3FB8B 1ROWA 3OC8A 3QEGH 4YDIL 3ZOAA 1DSFH 3VO0A 4OCLC 5ID0A 1EAJA 5LXGL 2W94A 1PEWA 1M05B 2CDFA 2X5PA 1CLVA 1P5VA 1MZZA 3GQFA 1PPIA 5DJDB 2X53A 3B9AA 5CJ5A 1JZ4A 2UVFA 3SGDI 5T3ZE 4CSPA 1FFNB 1AD9B 1WISA 4PG2A 4N0FA 1VFUA 5J11B 2Z8WC 1XCTA 3HR6A 1R5WA 4TM9A 4D0DB 5DI8A 1M7DB 1RVFL 4OFVA 2XWXA 2VXUL 2VLRE 2QHLA 4ZTPH 3DJ9A 4RAVA 3GINA 5A2CA 5E08H 3C09C 3ZKSD 3CFKA 1MRDL 3L1OL 3OXRB 3RPIA 3BUQA 2JCCA 5FKPA 3A6BH 3KPSB 1J0ZA 3ATAA 3GXDA 1NGQL 4OZFA 4WHCA 4QRQB 1AOHA 3HUJF 2ZUTA 2G2NA 3EOTL 4FQCL 3VQ1C 3MRLB 2BRRL 3VNZA 3BKML 4PJIA 2CLRA 5HJ3B 1EUTA 3SKUD 2OMTB 3WNPA 1U91B 1DJGA 2BMKB 3FQNB 3FOLA 5TQ2H 1URZA 4AQEA 3G6JA 2BNUB 3P4OB 5C0NC 1RHHA 2CG9X 4XTRD 43C9B 2YXVA 5HI5D 4R4FH 4AM0B 4BH7B 2F1EA 3QPKA 4CVUA 5F9WC 2FJHB 2WINA 3HC4H 4MMXC 4WHYG 1KEMH 2VXQH 1RK0A 2ADYA 4YHZH 2DLFL 2EE2A 1N6VA 2AI0H 4H0HB 2XZCH 1PZ5A 4U1GB 5KG9B 4PCSA 1X5JA 3BPLB 3GFUA 3WIHH 4CRPA 2EJ1A 5DD0L 5C07D 1NDMB 2M8XA 1HN1A 3EBHA 3D5OF 4FI8A 1TNNA 2OBGA 4U1LA 2VT0A 2R2HB 5C0CA 1YUHA 1L0YA 2EIJB 1A1NA 3KYNB 1ZGLB 5D2LF 3Q3GB 5JNYB 4HPOL 4LEBA 2YUWA 1IT9H 3W9EA 3QW9A 3SDCC 5EU6D 2DM4A 1T7VA 4LQFL 1RSYA 2MOGA 4MDJA 2WBKA 3O9WA 4MNGE 4P4KD 1CDJA 1YNKH 1OSPH 3QJHA 4L9LC 4MHHG 3U4BL 1S9WA 1PAZA 3C5JB 3LHPL 4M7ZC 3T3MB 3W82A 1T0NB 4ZMAT 3IJ8A 4Y89A 2CBPA 3HFMH 3QYCA 3UPRB 1K6QL 1AQKL 3S35X 3ZXAC 3O2VH 4TSAH 3IGAA 4OT1L 1AKJD 2EYSB 3IMTA 4XCEA 5CBEB 3HLAA 4DZBB 3Q48A 2NUPA 1X4XA 2WLLB 5CP3H 1KTJA 5T3XH 2WAQA 1KCUH 1T7ZA 4O2FB 2F9BT 1ZY9A 4LVNC 2CJUH 1IC7L 1W72B 3N40F 1NEPA 5A2AA 3JV4B 1MI5D 5ALCH 3NN8B 4XO3A 3UMNA 2H0EA 1R3KA 3VAEA 4NFDA 5DRNA 1KLFB 3MA7A 1AIFA 3QUZB 4PG9A 2KYIA 4Q6IA 2CDGA 2Q7NA 3DIFA 3ABZA 3H4HA 3V0FA 1AXTH 1KYFA 1AS8A 3ILQC 3MRRA 3VD1A 5F0LB 4I5BB 1KPRB 1LILA 4ZDHA 1QI3A 5IVNA 1MFNA 4NQEA 1G6RL 3US0A 1MHHA 4OFKA 4PJBA 2VAAA 2RB8A 3K6SB 3FF8A 4XO5A 5B1JC 1IAIH 2PR4L 2X44D 1BECA 1W91A 3CUPA 3MV9B 3D2UD 5DHVA 1IJNA 1BDYA 3QFDB 2XICA 1OGTB 2AXGA 4DAGL 1MELA 2DY2A 3LYRA 4JR9H 5LVEA 3BP5A 1A4KA 5I16B 1WBZA 1XZWA 2ODHA 4MAYB 2W0LA 1BIIA 3LRKA 4XBPB 2DQTH 5E6ZA 4XNBA 5KYNA 5EIQA 1MCWM 1YEEL 3CLFH 2RMNA 1I7RB 1I7ZB 4U6YA 4Z5RA 5HY9B 2ZNXA 1IB5A 4LLUB 4WFGE 3CZKA 1WF5A 2EIKB 4KY1H 3QAZC 3H4FA 2DW5A 5D9SB 2ZWSA 5BW7C 1LO0L 4LLWB 4RMQA 5J13C 1ZWIA 4RMVA 3UYOD 3ZO0A 1YN6B 4PBWD 5IB1B 1O6VA 5JORA 1DVTA 1Y18A 5BRZB 1NTDA 1SOKA 2ZUVA 4LEOB 3UAJD 4MJ2A 4HH9B 1ACYL 3HC3L 2PO6D 1CDGA 2AXJA 3HEIB 3KJ6H 4JFUA 4KWUA 5H37A 5J0BA 5DVMA 4LSTH 1HHIB 4AH2B 3EYVA 4N8VB 2A83A 2EP6A 4ODVL 3SE8H 3PWNA 4MD4A 5JZ7D 2VE6B 2P5WE 5DJXB 2ETWA 4JZOB 3CTTA 1PIGA 4W1TA 1VIWA 3L3KA 4TNVF 5DHXB 1X5HA 3L95A 4U3CA 1KXTA 1JF5A 3C5ZA 4PB0H 1INQB 2HAZA 5A40E 5HYJB 2DQFB 2YXWA 3APCA 3ARRA 1XXDC 3FTZA 4PVNA 4FNSA 3R1GH 1BVZA 3G08A 3MX0B 2VL4A 1RURH 3VJ6B 1HH6B 4YXHL 2X4UB 4GSDL 4TTDC 4MB3A 2BJML 5KVFE 2B5IB 4UU9B 3SDXF 3QYMA 4PRHA 3QZWA 2QR0B 3FK3A 1LLAA 2VQ1B 2Y07L 3BVTA 1DANU 2CALA 2X6MA 2A9MH 3MJ7A 2YJQA 2RCSH 1KGWA 4JZJB 5KEZA 1OTUC 2C9PA 3MGTB 3F7LA 3TJPA 5T3XD 8CGTA 4AUUA 5IZ7A 4JFEE 1NCGA 2OZ4A 3T2LA 1TCMA 4P2QE 4ODTL 3QBTB 2C9XA 2XZAL 2F5BH 1S3RA 4HU2A 4R3SA 1AZRA 2QHRL 3D0VA 1LO4L 4ZOEA 1KGIA 3D0LB 4IBTA 4OLUL 4OR1A 4LCWD 1KT2A 2BFVL 4X4KA 5GGRA 1HEJC 1V3JA 2H2PD 1MXDA 1I53A 5ITBH 2UY6B 1DVUA 4Y4HD 4BKLB 1F5WA 3X11A 1LHZA 3MJ8B 5IEHB 4AQAA 1OAZL 2Q9OA 1A2YA 3HUJB 4NJAL 1M9SA 2A1WL 2YD5A 3GJFH 5HDRA 5TD4A 5DSCA 5D4HA 3NIFE 1XCQA 4OUUB 1F00I 4OM1L 3Q6GL 3QS2A 4NO5B 5IMMA 1MJ8H 4G6AC 5MEPA 2VL5B 1B2WL 1NH6A 3CJJA 4Y5VC 1P4IL 2DM3A 3ES6B 5I15H 3IGLA 3WDJA 3L1GA 3VU1A 4CKQA 2A6KB 3EUDA 5D1QD 4WI6A 3T8XB 2DBJA 1TJGL 1IEBA 4X8GA 4B6ZA 5DK0A 1F1GA 4LNRB 4MCNA 3TH3T 4BSVA 1KCSH 2OA9A 1F3JA 2FEDC 1GOGA 2F8VA 2PPEA 3OX8A 4LIQE 3ZJAA 5AAPA 3UJTL 5B38G 4ODXB 5ICXB 4PJ9C 5SWSE 1LEKA 4Z8FL 1MLBB 2WXRA 3WELA 5IOKA 2C1OA 5CR8A 3FFCE 5E6IB 3B2DC 2HRPH 2PF6A 1F4WL 4FKKA 4H0LC 5IFJA 5HI3C 4JJ5A 3F7YB 4DGWC 1XF2B 2VLJD 2BS8A 4OQTH 3WN6A 4YK4B 1WAAA 3L3DB 5D2LB 4RFEA 3ZKNC 1L7TL 2BVQB 2WZPD 5L88H 1GZPB 1T03L 4JQIA 3QCUH 2OJEA 1VFAA 3OLIA 4C56A 3IU3B 2Q6WA 4EBQL 1L0QA 4KV5E 4QLRA 5HHOD 1YO4A 3SZKC 3HHMA 4J3XA 3UDWA 2Y5TA 4W81A 5MEQB 3WHE1 4PS4H 1VJSA 1TZAA 4XNXH 5E2TH 4R83A 1R47A 3AS2A 3K72A 4DN3L 3DRQA 2RR3A 3T8MA 1E9QB 4FTVE 4R2GC 4XP4H 3ARBB 3DTDA 4GS7C 5FO9A 4F91B 3LX9A 5GGVL 2DN7A 2CMRH 3FB7B 2FR4A 3AVEA 3KPOA 3CFBB 2WXLA 2GW5A 3A22A 1FYTE 3BE1H 3VFSA 2Y3AA 1I3UA 2E46A 1O9ZA 1U8JA 3V5HB 3ZL4L 5F71A 2EEXA 1ORQA 1PY0A 2J8OA 3ARFB 3RZCC 5ISZD 1YEJL 2DIJA 2L8AA 4OCXH 5CGTA 4Y2DC 5GRUL 3IVKA 3HVNA 3K6FA 2Z4QA 4WV1C 3KBFA 1CXEA 1S7QA 5BNXD 3U1SL 1B4JL 4DKEH 2R7EB 4PRAB 3WTXA 2GK2A 3U4EB 1YJDC 2FL5A 5IB4A 4MX7A 4GAFB 3FTVA 3NCYS 3FYEB 3UYPA 1K8DB 3VD4A 2F6AA 1ZA3A 3FBKA 2D8KA 3CC1A 4NQDB 4ODSL 5E2JA 5I26A 3RWIA 4ANVA 4IQHA 3ZVVA 2QGDA 1EFXB 1NGXA 3B83A 4M5YH 4NQCB 4I9XA 4TNWK 3TZVB 4HU8A 2APXA 2OZNA 1JXGA 2YAMA 4M8QA 1UQSB 3HPLB 3MV8A 2JIXA 1I8KB 3TBSB 5KSVB 3NSXA 2Y22A 4EN3D 1TENA 2VDQB 3K74B 2VMFA 1BWMA 1CFNB 5BZWB 4DVBA 5E8NB 3EDKA 3LKOB 1DN0B 2N7BA 4PWFA 4QYOA 3X14A 2JKSA 4YGVA 2E6QA 2DQUH 1H8OA 3S2CA 5C71A 4K9EH 3E6HA 5JHMA 5D7JB 2WTRA 1OCRB 1N67A 5FM8A 2X4PA 5LNEA 3NCEB 2CM5A 2WQXA 1DQML 4LCCA 1AGCB 1KBGL 4JFXB 3KLQA 3QVAA 4ES9A 1TVBB 2YGPA 5SWQA 5EFIA 4HZLB 4G43A 4OF7A 2ZXGA 1QHPA 4PJHE 3WG7B 1EZLA 1QWNA 3M6DA 4DFHA 3R8BB 1HWGB 1N9PA 2ZOWA 5E4AA 4F9PC 1ES0B 3T0EA 3L54A 3SGKC 4MCYB 5D4JA 1IBYA 2VZOA 1CF8H 1VPOH 2V3EA 4QJ5B 3B2VH 4M03A 1J0JA 3TBWA 1CK0L 5KJRH 1F56A 1JHLL 1WITA 2IADB 3CVIL 3JXAA 3QDJE 1SXCA 3MKKA 4M4RA 1E7UA 4YHNA 1I8AA 5HHPB 4O58H 1ITCA 2AJZA 4MNQD 5HVWA 1NKGA 3GRWL 2VN3A 3NA4A 5KW9H 3AWFA 1T22A 4AYSA 5E4OA 1H6TA 2E7LC 3AREB 1B0GB 2J4WH 4F7PB 1NBYB 1XGQB 2EUWA 3SDXB 3L5WA 3OJVC 3S37L 3STBA 1YJDL 3FMGH 4WWNA 2W38A 4ELMA 4YSUA 3L2MA 4TRPH 3OTTA 4HCRA 1PS3A 2YR3A 3ASWA 4Q6YA 4CC0A 5EEXA 1FH5H 4J4PC 4AYDC 3ECBA 1I9JH 4LSQH 4ZO7A 5DCCA 2WCSA 2P9RA 3FT3A 4PREB 4AC4A 1X5AA 4CC4A 2IANB 3L4CA 4HF5L 4LSDA 1KCBA 5HVHC 4F8OA 1TSHA 4HLZG 1HKLH 1XGTA 3CVHH 2FECL 5KSBA 5B1CA 1NAMA 4FQXA 2EQDA 2RD0A 3QZMA 4CVZA 3BWSA 3IJHB 1F4AA 1KCLA 1UOWA 4IEFB 1OT1A 4NQTA 1XH1A 3P11H 5ES4B 5ICYB 2LV4A 3T3PF 3EFFB 4L8BB 2Q5BA 4KJYB 3F01A 4WSKA 1T0OA 4KDTC 2X2JA 3ZKMD 2A4ZA 3GSXA 3LN5A 4LCUA 4JM2F 1CIUA 1AYRA 1E3XA 1I3GH 1WZLA 3MGOB 1B2YA 1HCFX 4ZS6D 3WS6C 1TQCC 3EBIA 4GAYA 3WI9A 1A25A 1YYCA 3B2XA 3KYOA 2P8MA 1L4IA 5EU6E 2ZKHH 4BA8A 5F70A 5DD1H 3EOAA 3QRGH 5C0BD 3IKCA 3QDGA 4IDJL 1OGSA 4ILDA 1NBVL 2GC7C 1MEXL 2D31A 2J6WA 4L4JA 5EMYA 5I1JH 1P2CB 1RI8A 2QVTA 3D8MA 5IOPB 3QUYC 4CUCA 4EKJA 4DVRL 3WLWD 1IFHL 4POYA 5I5RA 2CLVB 1G4RA 2H3NB 3MO1B 3VXMD 5GZOC 1HHGA 1P7BA 2IAMD 3TVMA 4DTGH 1RIHL 4N1HB 1BFVL 1KJ3L 4Z76B 5DQ9A 1M4KA 3FQWB 4GP8B 4MBRA 1KJ2L 3KXFB 5FOBA 1WIPA 3AT9A 2LR4A 2X2IA 3BH9A 3HN3A 2VZUA 3LS5L 5PCYA 1MI5E 1DQTA 2PP8A 3N0PB 1RIUL 5GZNA 2B59A 1B0RA 1PX4A 2CUAA 3T0WA 3K1DA 1O6SA 3KPRB 4UQ9A 4ZXBB 4GKLA 4NZTH 3LKPB 3MROB 3TN0D 3CX2A 1EWHA 3VCLA 3AFLA 1D3CA 3BVWA 2AV7A 4WK2B 4CNIA 2BSSB 3P3YA 4P2YA 3HZMB 1AD0A 2A6JB 3CCHB 3UPAA 1RJLB 3IDJB 4OD1H 1EA9C 3L81A 3VUAA 3KBEA 3DROA 5IMLB 1E4XL 4ISVB 4MQXC 5DMKB 1O6TA 1CYWA 1KENL 3TASA 4EIZC 4F1ZA 1SYSB 3C60B 5I8EA 4FNPA 1L0PA 1XIWA 2BC4A 2LTQB 4JDVA 5LGHH 4Q9RH 4GMSL 2O6EA 3WE6A 2I32A 2K70A 4ZMNA 1R24A 1SYVB 1A21A 3VU2A 2UZPA 3BP4A 4PS8A 4IJTA 3GZOA 2QTVA 4GUCA 4PRPA 1MY5A 4LEXH 3VRJA 3DVGA 4NXSA 5H2BB 3FW6A 3J27A 1GGYA 4K3EL 3MSPA 4YPGA 3GPEA 4HQQH 4Y4FA 4A7GA 5IBTL 1RH8A 1LWJA 3FSAA 1E8WA 2AQSA 4UQ2B 4FLHA 5JHLH 1XB6A 3H2PA 3SYQA 4K3JL 4Y5XC 1MVYA 3BC9A 3IGFA 3MDJA 1IGTA 4KO5A 2B4CH 3KEDA 1CC3A 5T8IA 3V5DA 1WHPA 2FB4H 3BFOA 4MA8L 5IVXE 2X3BA 4KU1A 1UUNA 1EEYA 3DGDA 3SCMB 5C0IB 2DV6A 4JLRB 4M3JA 1NCBH 3FTXA 3PAZA 3L3HB 3MLXL 3BAJA 3QO0A 5G4NA 4FYRA 2P8LB 1EHKB 4XOAA 3DARA 3TT3H 1G7PA 2CRZA 1F8TL 1UWFA 4I4WB 1J9TA 3II2A 4HV8B 1AKPA 1H8NA 2C3XA 1QBML 4ICWA 4CMMB 4OLEA 5GGTH 1ZPUA 3N50A 1U42A 4AEIH 5F3HB 1EX0A 1MRFH 1P4LA 1T5XA 3D06A 3GWJA 4B9GA 1RZKL 2OYMA 2F74A 3ZLQC 3W5MA 4G6ML 2DQEL 2Y24A 5AUMB 5INCB 2VYRE 2ZCKH 4G42A 2KC0A 1TTCA 1F4XL 3ZUNC 3BVNA 5BQ7B 4WZ9A 2XTJB 4NRXB 2Y7MA 5DEZA 5BQDA 3IJYB 1RPUA 3NIDF 1DJIA 3JWDH 3QULB 2W65A 1A7PH 4UWQB 1XH0A 4XC3H 2X4TB 5FFLA 3KHQA 3QXUA 1XEDA 5T3XE 5I2IA 3D05A 2B77A 4ZUWB 1KELH 3H3KA 4HKZB 4HG4J 5DVPA 4N5ED 9PCYA 2VLRB 1DVFC 4LVHC 1KACB 3WUWB 4LOUC 3LN4B 5JUEL 3ULUF 5KYUB 4MA1B 2LU5A 3K2KA 5BOPA 5DQJB 3S88L 2ILLA 1DLFL 2HT3C 4GFTB 3W9DA 3QUKA 3GSVB 4WY7H 2Z8SA 2OL3A 3GXNA 4YOKA 3AXLB 4KX7A 4IU3B 3QUHA 4ZSOB 5IKCA 1EAQA 1H8LA 2MTAA 4YNYB 2WIIA 3WXWH 1CLOL 3FSOA 4NI3A 2K3TA 3BIKA 5CBAA 5C0DB 4AYGA 1E28B 4R7LA 4YX2H 4QGYA 3G9AB 5HGDB 2WUBH 1WUNT 3N42F 3QWOB 5AALA 3TFKD 4NENB 4PIBA 5CD5C 5DVLA 3QQ9C 3DVNB 2NMSA 1FL6B 2YAHA 5F9JB 1BHGA 5LUMA 3WE1A 4HPHA 2PETA 5D1QE 4FG6D 1LEIA 3OKLA 1NCOA 1Y6NR 4UM9B 1U3ZA 3KWUA 3IFNH 5DURD 1GXEA 1T1XB 3O4LB 1Q4NX 1Q9WB 4V1DD 3FUJA 1AHWB 3FT9A 4WWOA 3SYCA 5GHWL 2NY3B 5J11C 4OIAA 4NKMA 2R2BA 1N2RB 3MLRL 5IIEB 3TWYA 2CO1A 4HS6A 2O6FA 3OAZH 3IAPA 3T3PB 4JO4L 5E8DH 4A1RA 4HJUA 2ZF9A 1YEGH 2CO7B 3S2AA 1Q72H 1S7SA 4KRNA 3L3OB 1J5CA 2BZCA 2C8NA 4M8VA 3ILPA 4LCVA 4JM2B 1HHKB 2VLJE 3GZKA 4KV5F 2K3HA 1MSPA 3T4AB 3UTTB 1UATA 4NPJA 1MRCL 4ZAKB 4LDLB 1MKFA 4G11A 2ZX9A 4KKBD 1DBBL 1UD2A 2EDHA 3VXOA 5HHOE 2VN6A 3CV5A 3NRFA 3E3QE 3MTXA 3KLSA 5EUKA 3ZIYA 4DKTA 2EXWC 1XF3A 2VERA 3MBEA 5E5UB 3KLHC 4OSUL 1PZUB 5I8KH 4D94A 3TEUA 3FU7B 3IJEA 4KI5D 4P46D 4ZODA 3TF7C 1BQSA 3CH1B 2JI1A 2IO5A 2D73A 4YBQC 1OY3B 3BJLA 4KO9A 5IHZB 1O9WA 3H54A 4N8VG 4U6VL 1QO3B 4MLSA 2QADB 1G7QA 1A14H 5D7SL 3D34A 3KGTA 1A7NL 3DMMB 5IF0A 2Y69B 3CMOH 4EEEA 4HGKC 1NUDA 3EJQA 4OCMC 5ISZE 2A2QT 2WLIB 3G5XB 4R8WL 2XXMB 4TUJA 4U1GC 1Z9NA 2V5YA 4YSOA 3U36B 5I17A 2NUTB 1XB3A 5FO8B 1GGTA 4NKDA 1UOVA 5GGQH 2AJXL 3ETBF 4OFIA 1C12B 1Q9LB 2GJZA 2V2TB 1HZLA 4YR6B 2MOVA 2WQWA 3DGGB 2BH0A 3PREA 4TUUA 5HDBE 4TUOB 3S36L 5I0DA 1PD0A 1TEFA 1S3KL 2NNXA 4P3CL 5FYKH 3MTRA 4Z7QE 2ICWA 1CE6B 2CUHA 4S1SL 2EZ0D 4DCQB 4WKXA 2I24N 1UM5H 3ZE1F 3MCLL 4TPRL 3POHA 3GJFK 4HK3J 4D7PA 3SE3C 4YDKH 1U4EA 2X87A 2HT2D 3QC6X 4UTAA 1S78D 4FRWA 2FT7A 3KS0H 4XI5C 1DDTA 4KRPD 5DJAA 1HZKA 5DJYB 3FQ2A 2DLIA 4JFDB 3CZUB 2XWJA 1FG2A 5I82A 1OF0A 3QPQC 3DO3A 1IKOP 4DHLA 3E9UA 4LOFA 2AEQL 3WKMH 1OAXL 2W9LA 1ZSHA 5JYMA 2APVA 2E7MA 4U1HB 5IB5B 5JO5B 1JPTH 3P4NB 1JI1A 4P05A 2P5WA 2H0FA 2NTSP 2IC2A 4Z95H 5LQBL 5D2NB 4NUJA 4U0QB 3U79A 1BJ1J 5GS2H 4XAWL 5IHBA 2EH8H 3RL2B 4A2MA 2E9BA 2WBXA 3BPNB 4J3BA 4U1KB 4H8WC 2XFXB 4HDIB 4TQEH 3ZRSA 2Y7SA 4QY8B 5LGYA 3A23A 1UACH 1TCRB 4POZD 3OB8A 5D4IA 5F96L 5BVPL 4X6DF 3QK0A 5DRXA 5KSAB 5BV7H 4TULH 2NRDA 5DJ0B 7TAAA 3W0WB 3WNIA 1OF2B 1YN7B 4V33A 5D1XD 3K81A 1WBXB 4RFOL 2WIMA 5GXBB 2E3VA 1DQJA 4F9LA 2R1XB 2WLZA 5CHNA 3MMEB 4N0CD 5BOJA 2HX8A 4JDTL 1AFVH 2NY2C 2BP8A 2ATPB 4NSKA 4ZNEA 3PGDB 4MAYC 1EGJA 3L48A 4LSPL 2FSDA 4MNQE 4IHOA 3BDYL 5AW7B 2XKSA 4WVRA 5A16B 4NM8H 4P2QA 3FCSA 3MNVB 2OYKA 2E4TA 1YECL 4RA0C 2YAOA 4HKBB 3UZQB 3QUMH 3S8FB 4NKIL 4YHLH 4G8GD 2F7QA 5LAXA 3NIDB 3VGHA 3V6ZB 3MZGB 1MPAH 3AY4C 5IHHA 1ANUA 1OP4A 2BSCA 4HX1A 5HGGS 3UC0L 1FQ9C 4BXVA 1NAKL 4X6BA 2Y5QA 4Z7UF 2F08A 5E2UH 3MJ9H 3TU6A 3WO3B 1NLDL 3EH4B 3L2NA 3FPYA 3JVFC 4RGOH 5EZLA 3DPDA 2X38A 3BZEB 1BAWA 1S7TB 1V54B 3FUNA 3K6OA 3P2TA 1LE9B 1BGXH 4UANA 1IAKA 1T2QL 2CU9A 5E7FA 1G7IA 2RH0A 3CG8A 4HJGB 4KMQA 5FYKD 3FTGB 3IXTA 4OCWL 1JTPA 3L1FA 3LEXA 2ZOKB 4AJYV 3V10A 3ZDZE 3NEOA 3QORB 3S0PA 5SWZD 2XA3A 2PPAA 1Z5HA 1W72L 3S6CA 2N1TE 3RWGA 1M6OA 2X1WL 1PMYA 2HB0A 4P2RE 1GCYA 2B5IC 5SWSA 4H8WL 5IHUH 3MOQA 3GBNL 1NFIB 4UNIA 5C0BE 4HW6A 3L4VA 4DKFH 4TQ8A 3OMIB 4R90L 4JG0H 5IHLB 4YDVA 4AYBA 4JZJC 3HNSH 1JCKA 2YEVB 4EVNA 3S5LB 4MMZA 3VMOA 5I1HH 2YPVA 1MJJA 1O7SA 1A3RL 2PXYB 1GS7A 3CDFA 1G9NC 3FFCB 3LY6A 3OL2A 4QOKD 3RVXD 4A66A 5IESL 1R5VA 1CL7H 2NY1B 5GS2D 1NANI 3IFPA 1M3JA 1XTLA 5EDSA 3PDDA 5C70A 2OFQA 4ZQKB 2Y1AA 4JGMA 3EYUH 1IU1A 4QRRE 1V3LA 5AVVB 3T65A 2EDJA 4Y16B 4YSEA 3S3BB 2BINA 3V6OE 2NXZC 3DO7B 1U3HB 3CWGA 3I02A 1K4DB 4MD5B 1MHCB 2WBJD 3Q7JA 4G1EA 4PJ8D 1KCVH 3RKDC 5HYSB 1PX8A 3AU1A 1FYTA 1BWWA 1EO8L 3MOBH 1H3GA 1QBBA 3DUSB 3QCTH 4W9ZA 3ATEA 5EA0H 1G4MA 1ETJA 5C3LD 1GS6X 5F1NB 2CQVA 3D9AH 4NT6A 4RGNB 4ZUTA 4YHOH 5EH1A 4XN5A 3K71B 4MB4A 3IDMB 1EANA 2B8OT 4EXKA 3STLB 4LKCA 4TV3A 4MNHA 3ARGD 3F7PC 3HA0A 2P4AB 1SXAA 5GJSL 2WD0A 1WSST 2XX0A 3LPOA 4EI5A 1KFGA 4ODHL 3ZT7A 3RG1C 3IDNA 1F11B 2Z6FA 1S7XA 1UJ3A 4K55A 3GB7A 1IILE 3BAIA 3PWJB 3GHBH 3ZRCC 1JGVL 4WO4D 4Y4KB 3TTSA 1SPDA 4FZ8L 5F1IA 2Y2WA 4WKZB 3RWCB 5E6IC 1PSKL 1CPUA 3EJYC 2PYFB 2I27N 4FULA 3C8HA 3MU3A 1Z66A 1RZ7H 5JA8B 3LZLA 1DDHB 2ZAIA 1A6VH 4WI8A 3KLLA 4L48A 3CZFB 3R06B 1QNIA 1PNCA 1SJHA 2VABA 4XMPL 5A2JH 4HFUH 1NKOA 1CGSH 4JO3L 4DGIH 5KZCD 1BVLA 4K71C 1MH5B 3EJJX 4QXUH 3ZE1B 2P26A 3LEVL 2CK2A 4A2LA 4JFFA 4HIIA 5CZXD 1KLGA 4FFTA 4M1GH 4PW4A 3X13A 3V4PH 4G80A 4OGXH 1IE5A 1G9NL 1Q9KB 3ARBC 4RIRB 1I3RA 4YS4A 5F7DB 4GAGH 2CIIB 3CFMA 4X5XA 4PJHA 1EQWA 1J18A 3OJDB 3C2SA 3BUTA 4PJGF 3GXMA 4BZ1A 2V7HA 2R56H 4U1IB 4K5NA 4LRNL 1PQZB 4WCYH 4IRZA 5I1LA 4N68A 3AM8C 4TQHA 4XH2A 5T33L 1GYUA 1QWHA 4PJAF 3BKJL 5EO0A 3OLEA 2EXTA 3CN4A 3PP4L 1CBVL 4IMKA 4OLWL 2EIBA 5JPMB 1I1CA 5K1NA 4TOYL 2JJUA 4X6DB 5IJKA 3FT4A 4PM1A 4XP6H 4KPHL 2EE3A 2P5ED 4AZ8A 4N2FA 2ESVB 2J1KA 4L4TD 3QDHA 3TZVC 4UUJA 5F6IB 3MLZH 1X4YA 3OMAB 1FHNA 1M7IA 1R3IH 5B7MA 2ZWZA 4MJJA 2B3IA 3OHXB 2XKNB 1QLFB 2IXQB 5EB9A 2XV3A 4XMXA 1OEZW 1Z3RA 2WXNA 3BYTA 4LHUB 1H3UA 3VFTB 1JGDB 3AWEA 4Z7VE 4PHZA 5AWNL 4PWIA 4LPCA 4AL8C 2JXMB 3FHEA 4BUGA 1MQKH 2O6DA 4Y88A 4JB9L 4L8DB 2ODIA 4X42A 1BAFL 2GTWA 5D7JC 4KY2A 4OCYL 3L4YA 1OSYA 3PDOB 4N9OB 2Y2TA 4YDIH 4FA6A 2EH7L 3EOBA 3ALWA 3UTSE 1CXKA 2HCZX 3UIZA 5LXGH 4JKLA 3O6FB 5C07A 2BNRD 3JUYA 2Q8AH 5F93C 3AITA 4Z7UB 1QSVA 4U1JA 4E41D 3SODB 4AMKH 1HQRA 1CTOA 3P1VA 1W8OA 3JWNE 4LGSB 4CVXB 2WNWA 4AJ0A 3EG9B 2Z1PA 3H9HB 4HCIA 4H1LA 3I6LD 2NNCA 2EILB 2J6EL 2B9BA 3RL1A 1J8SA 5JW5B 1WCBA 3IDIB 5EU6A 1OM3L 1YMHA 4P4KA 1YY8B 2ADGB 5CJQH 1IGMH 3MV11 3D39D 5DZJA 4PVBA 1E5UI 5E99L 2QPFA 2QSCL 2WNGA 3MREB 1QACA 3DOSA 5M7QA 2BRRH 1FRGH 3BKMH 4R96A 4X5WB 2YEZA 4RNRA 1AKJA 4A67A 4GRWF 3AREC 3LRMA 5I74B 3TA3D 2CBTA 4HKJB 5E4IA 2IPUG 1QYGH 2J25A 1IBGH 5DWUL 3E8UL 5K9KA 4N2MA 3F83A 4QJ3B 5I9QB 3MRMA 3B34A 3MRJB 3WEOA 1MI5A 4FMKA 3NCJL 3R0MA 4FF9A 1UWEH 1P7QB 1YSOA 4I3SL 2YD8A 1BXXA 3CBRA 4DERA 4D8PA 3V9CA 2OMXA 5IM7A 3APNA 2HYMA 3GNMH 5JMRA 2GT9B 3BGMB 2DLFH 3QG6A 4V2CB 1YDPB 3INUL 2VDQL 3KNBA 4S1RL 2AJUL 3PHOA 5E1IA 3RWDB 4XMKL 3R0NA 1BG9A 2QVMA 1CFBA 1JYNA 2VN7A 2F53D 3D2UA 1BZ9A 1MZYA 5K1VA 4AL8L 2ZT9C 4PJCA 4QKTA 1IARB 2IDTA 4Z7QF 5DLML 4IBZA 4LCYA 2GSGB 1IRAY 2WWKT 5SX5H 1J5HA 3BD3A 5DS1A 4NAJA 3DSFL 1GW0A 1M2VA 5SX4H 2FX9H 2QV4A 3ARDD 3EO9L 4F15B 1PKQE 3IYLW 3LZFL 2FEEL 4DOHB 4YAQB 1HS6A 5KBPA 2JI2A 3P4LA 3OSVA 4OH2A 1IAOB 5EDXA 4OY9A 5IBLC 2G5BB 4F24A 1DUZA 1P4UA 3DV6B 1XR8A 2AK1L 3FQUB 4O2CA 4FHBD 3VFOA 3LV3A 4OT1H 1R0AL 1DO5A 4QRUA 4W4OA 3UAJA 2I07A 4HEPA 4WFHD 1AZBA 1N12A 3MCKA 2VXQA 1DBJL 4I7ZC 4LDCA 3A0OA 2PO6A 3VXTB 1P5VB 5GPRA 5LNGA 5CKAA 3EJZC 4ZW6A 3I6SA 4L4VB 3WUWG 3FQTB 4H44C 3RUGF 1CICB 2G75A 2CIKA 7PCYA 3WIHA 1KC5H 3GEFA 4EKXA 4HS8H 3QJXA 1XCTB 2XXCB 4G3YH 2Y6TE 3TH2T 5DI8B 1OD7A 4OZIE 1NBZA 1RJYB 1EEZA 1KCRH 3DO4A 3OAZK 2IALA 4APQD 4ZXBC 1MN4A 2X4QA 3CFKB 1E42A 2QVFB 3ARUA 2WVTA 2B3RA 4ZW7A 1A6UL 2FYYA 4DPAX 1YMMD 2DEXX 2I7SA 4FI6A 2BFGA 4S2SA 4X8XA 5GGVY 3VH8B 3KLAA 3ZUCA 4PGEB 1ACXA 4UT6L 5JYLA 1JYWA 1BJ1H 2R1YA 2FX7H 1ETZA 3H6AA 1A4JB 1W0VB 4QHNB 1QR1A 1UXWB 2TRHA 2X09A 4BQ8A 1J0HA 4H88L 1YYLH 3ERXA 4IS6A 1D7FA 5CP3A 4YSDA 4PJGB 5FYLL 5HHVL 3GSNB 5FGCE 2WWOA 3C60C 4XNAA 5DR5L 4GBXD 1AE6L 3VSQA 3F7QA 1IV8A 2LTQC 4OZGF 4IRSB 4WI0B 3NZHL 2DQJH 4PJAB 4F5CA 3FU3A 4LCWA 1C8QA 1RK0B 4G8GE 5F44A 4G6FB 1RD6A 3TCLB 2E9IA 3WJLC 4Y4HA 2ZOLA 3QFJA 2J57A 3QDAA 3KCPA 3OKMA 4C55A 1U8NA 2LAGB 2HG0A 3AW5A 5E9DE 3CHRA 3HKFA 2IWKA 4ALAH 5CCKH 1HOCA 2D2OA 2QFPA 1U93A 4QPEA 5C0RL 2YRPA 1ILUA 2KQNA 2E4FA 5BS0E 4FQ1H 4KK9D 5F97E 3DNKA 4PEEA 2ISDA 4Z0BL 3C75A 1E90A 2DWYA 3SCMC 1TYRA 4UAOB 5E8EA 3WIIH 4LLMB 1JZEA 4JUTA 5FYKE 3QEUA 3QJHB 4N85A 2PCPA 3PWPD 5D1QA 2YKLH 1VGKB 3U1PA 3WMPA 1IUZA 3DBSA 3P77B 4YXHH 1U8CB 2BSTA 4PRID 4P57A 5SWZE 1BP3B 3GGWB 2BJMH 4XB7A 3ORJA 4KK5D 3IGAB 2Y1YA 32C2A 3BDBA 4IOIA 2N0MA 4JHAL 1JSYA 1UCBH 3THMH 4XCEB 4IBVA 4UZGA 3V52L 2NUPB 5HBBA 5EPMA 4BUHA 3TS8A 3QQ4A 4YUEH 5ADPH 5I6MA 1AMXA 3S37X 4U1MB 2PCXA 2XTJC 4Y19B 3NJXA 1GA2A 3WTTA 4XE5B 3TYGH 1U8OA 3ZYIA 4R9HA 4LSSH 3QH3A 3WOVA 4UTBL 2QSTA 2VLJA 4N2HA 1T1YA 2EDLA 3RDJA 3KYAA 2WZPA 4QOKE 4I18B 3DIFB 1CYXA 4UIMB 5IB3B 4XBEH 2DPKA 5C0EA 3WS3A 4R4BA 5F6HI 4ZYKA 3KPNA 1SHMA 3O0LA 5HHOA 4E36A 1BREA 3C6LA 1A7OH 4MA1C 3KGRA 2JJSA 3VGEA 4P5MB 4G9DB 3NFNB 2FT8A 3F5WA 5GSRB 2VAAB 4NUPA 4ELDA 4TLUA 1AR2A 4LMQE 4X7DC 2ZKMX 2A1WH 4ZX3A 3FB5A 3HN5A 4KROB 4TNGA 5C0ND 2IGFL 1XGPA 3BP5B 1A4KB 4OGQC 3CU7A 4U3SA 3GSOA 4GRWB 4AMWA 3U7YL 1JPFA 4XPHL 5KYXB 4HD5A 4OZ4B 1GGUA 1OPOA 1JBJA 4HWBA 4O5LL 1OCZB 1E9PB 1BIIB 1MLCA 2BOCB 2VXSL 5IMOB 3PDGA 4ZD3L 2J8UE 1JF6A 4NNXB 5HHXL 5KVEL 3G5YA 5ISZA 1AGDA 2OKMA 4AQZA 4ZW8A 1GIGH 4YDJB 4AKPA 2XCMC 4B27A 5AB2A 1XWVA 1MOEA 4JRXB 5DT1H 1IM3B 1TJGH 1T83C 3U0TA 4BQ9A 4JKKA 2DYPD 2W88A 1MFMA 4LFHD 3BMVA 4JRWA 1AS6A 3GI9H 3QNZA 3NEXA 1NOFA 2X1OA 1G5GA 2Z4TA 3K3QA 1AHWC 4JQXA 4Q0XL 5M94B 4N8CH 2NY3C 1T0MB 3QQXA 3LPPA 4D9QE 1ED3A 3RB7A 3MJGX 2WANA 3PWNB 4XRCA 3U30B 5KS9E 4GKSB 1L6XA 1OT2A 5CGYC 4OBSA 1NPJA 2BCMA 1F58L 4Z7QB 4OLVH 1YNTA 3WXVH 4P59L 3O3BB 4UT7L 3L3KB 3L3OC 1AZZC 3DBXB 4EN3A 4XXDB 3GJFA 4L8SB 1QQDB 3L95B 1YPZE 4XX5A 2GC4C 3EJRA 3MFFA 3MVSA 2LFGA 4WEUD 5IP4A 1RZJC 4NBXB 5KVGL 2RALA 2F7IA 4IW4C 4ZAKC 4UQEA 2XY1A 4XBMA 2WLJA 1QNZL 1ZKAA 1BMGA 4DN3H 1OGPA 2XPGA 3ZDXE 3HHRB 1U3JA 2CRYA 4F3FB 4HUXA 5GGVH 5T5NF 3QZWB 1CTMA 4XO4A 1ET8A 1F42A 2GIMA 3MA9L 4L9DA 3SSGA 2WQUA 1T21A 3FULA 2FGZA 3MJ7B 1EK3A 3X3FH 1KGXA 2XVKA 1UXSB 1WE5A 1YEJH 2QADC 2VZ1A 3RUGB 5A6LA 3DMMC 4CMHC 2HJLA 1ESOA 1NZRA 1FO0H 3AXHA 5GRUH 4A68A 2JTDA 2ZF8A 1YY9C 5EF2A 4JQVA 4G8IB 5F7FA 2WK2A 5LGKA 1DQDL 2XNAB 5F0PB 5AW4B 2IH1B 4A6YH 3TURA 1ACZA 4I85A 4NN7C 3POCA 1ZHKB 3ELAT 4LKXA 4OQTA 1ZS8A 1KT2B 3IAGC 4Y2OB 2W9EL 2QGBA 5DUML 5GGRB 4CDHA 4UDTB 4CSZA 1VDGA 3ZE0F 3CC5B 1E30A 1XD0A 4MNQA 3QQ3A 5TH2A 4NEHB 2VWEE 5JHDB 2P5EE 4ZTOL 2NNFA 1V8HA 4L4TE 4PMFA 1UASA 3U82B 5H35A 1VKXA 2W0FA 1NGYB 3VVWA 2OTUB 3FCTB 3VXUD 3S4SA 3ZL2A 2LVEA 1A47A 4Z7VF 2WYTA 1HHJB 3MR9A 4MWFB 3CZEA 3PP3H 2KZWA 1U95B 1WEJH 4I9WD 3S5LG 4NC2B 3TO4B 1UH2A 3GTNA 4H8UA 4PJ7E 4OZGB 3LAFA 4NO3A 5FWRA 2JQAA 4BSVB 5IV2B 1XFPA 3QRBA 1K8IB 1NJ9A 1KYDA 3OX8B 2DI8A 2E8ZA 5D2NC 4DO4A 1HC1A 2MQGA 3CIAA 1D5XA 4NZUL 1RZJL 2BK8A 3UTOA 1LEKB 4H2AA 4EUPA 3BPNC 5D8JH 5KYYA 2KPWA 2WQVA 1GHFL 3TEZA 1OAYL 3ILEA 4WUUB 3DTXB 1G9EA 4I2XE 5IFJB 3L1EA 5EU7C 2BNRE 3MRBB 2OXGA 5HYSG 5I6XB 3IK2A 5KSAC 3K4DA 2R51A 5I73B 2C1PA 4JCLA 4X9IA 4CJ0A 1EXUA 2G60L 3I6LE 4TTDD 4X7SH 3ZDYF 1WC7B 2PW2B 1VFAB 1EEQA 1CGYA 4O02H 2Q6WB 3WY2A 2QKSA 3CVIH 4NDMA 5C0BA 1PU0A 5J06A 5J6GA 4IKLA 3UJIL 4B97A 4DP7X 5F9AC 1WBYA 1BZDA 2X4OA 3U6RB 4K8RC 3K72B 3KW8A 2CGYA 2EE9A 2F58L 2JQMA 2XC8A 5AW6B 3VXMA 1QA9A 2IPKB 4H0IA 2IAMA 4EDXB 1LDPL 4GRLB 1KTLA 4DP5X 3SBPA 3VFSB 4U6HA 1REIA 3RX8A 5DDHA 3PXLA 4HBCH 4KKLC 5G5DA 5B3NA 1WFTA 2R0ZL 4JVWA 1V7ML 1WD8A 5CUSL 3WUZA 4ZNCD 3ARWA 4HF5H 3V6OA 5KUMA 1X5LA 2YS4A 4U3HA 4KVNL 2NCEA 3PHAA 4NX0A 2Z4QB 5L6YL 2X4SB 1CQKA 3O6LL 4NO0B 5KANI 4RAHA 1JPGB 4QRRB 4GW5B 5I1GH 3TN0A 3VFRB 5E51A 2AQ1A 3ULUC 3X12B 2JI3A 1ADQL 3CFNA 3I75A 5FM4A 5CP7A 4GKOA 4J3SA 4G6AD 1TQTA 3O3DA 4ERSL 1Z7JA 2F53E 4WI9A 2XN1A 5CLZA 4M1DL 5CU5A 4DWHA 4NQVA 4M8QB 2GUOB 1ZVSB 2CK0L 2PYEB 3D3VD 1WS7A 3QORC 4KXAA 2FJFB 5BZDA 2C9RA 4CDGC 1CDIA 2PW1B 3S5ZA 1SN0A 1KTCA 2FJUB 4PWKA 2FEDD 4RESB 3WFHA 5GS1A 3APDA 4YGVB 4N1CA 2DH3A 2NY0D 4NZRL 3CDGB 4TLKA 4KZ0A 4HG4K 3LB6D 1OP5H 3UP1A 1XGUA 2CRIA 3C08L 2Z34A 2PCFB 3WSQH 4D3CL 4DVRH 1NQBA 3NFSL 2DRUA 3S5YA 5HI3D 1C8PA 3SKJH 5CINH 5JW4N 2MPAL 3LZOA 3HNVL 2HTKD 4PSRA 4N28A 4LLYA 5SWQB 3ZKND 2PXYC 4G43B 3BEWB 5EO1A 4X4XA 2LLNA 2WVSA 3F62A 3RX5A 2NY1C 4MQTB 4K7PH 3WIAA 3S96B 4QT5A 2HFFA 1LMIA 4K8RL 3PE9A 3IFOA 2ADJB 3T2NL 4XMWA 4AOFA 1JNLL 2HN7A 2HMIC 3IXAA 4Y16C 1C5CH 2NZ9D 5C3TA 1OW0A 1Y7VA 2VDMB 3ZYZA 2E9WA 1MIEH 1U3HC 1J5OL 2CXGA 3WY1A 4LHUG 5FB8A 4MKTA 2W5PA 4FNQA 1ZTXL 4GI8A 3QNYB 4YHNB 2GI0A 1ORSB 3SPVB 4QUOA 5DZOA 3GBMH 3RA7H 3CHXA 1YMME 2X7LA 1KGYE 3MRCA 3S36X 5DC9B 2DJ4A 3NIGE 1VCAA 3DX8B 3V0WL 4RGNC 4XNQB 3FO9B 4XPGL 3EYSL 3LIZL 1QPKA 5E70A 2GBTA 2IV9A 4C4KT 1QLRA 3MOAH 2NW2B 2J88H 2X70A 2IFFH 5ICUA 4KOBA 4HIQA 5C8JA 3WTSA 5CIPH 3ULUL 4LPUA 1B88A 2JK5B 3O2DH 4Y0GA 4F2ME 1JZIA 2Q86A 4G8EA 2D7TL 2OR9H 4CL7A 3LKRB 4R26H 5JXED 3HG1D 1FVEB 3ARSA 4Y4KC 1UWXH 4DO6A 5GSVA 4LRIA 2H1XA 3IBEA 4GSQA 4BQCA 4KKQA 1Q9OB 1T3FA 2YSSB 4KK8C 4OV5A 3QJRB 1OANA 3E38A 4EIBA 4L5FH 4DPCX 1IKNC 2IV8A 5I6NA 3AZUA 5IBTH 5L7XL 3TONA 3SJVD 1KB5H 3ZE0B 2AC0A 4I88A 5EU3B 1LJMA 3O3EB 3KWWA 3OSKA 1R3JA 1UXMA 4OF0A 3GLEA 4UQDA 4N3TA 3QR1A 2BY2A 4PBXA 3WBDA 4J6RH 2AQ3A 3NABH 2BPBA 4FNLL 3WFEH 4PLNC 3WLBA 1TZHA 4MA8H 1S9VA 5SX5K 4P0DA 2ALAA 5CSZB 3IGUA 3LSOA 3PQYD 5I30L 1ITBB 3MLXH 2Y2YA 3CFJB 4I77L 1DE4B 4ODUA 3OZ9H 2RFXA 3IFLL 4ONHB 4XVOA 1TJHL 2C9AA 5DJ8A 1JVKA 1D5ZA 2A6IB 3TPUA 1A6AB 2MMXA 1AQ8A 1ZSDA 4GW4A 5JLZB 4PJFE 3HC0A 5FUZL 3M1BB 4G6MH 2DQEH 5AVZB 3O81A 1HEZB 4L05A 4V1DA 1DCLA 2UZXA 4KHXL 2BIIA 3F84A 3VXPB 2V17H 5HGBB 3A4FA 4TVPH 4BK5A 2EEAA 3V4VA 1E4WL 1SBSH 2EECA 4QWWC 3TT1L 1OB0A 4RWHA 3JVGC 2LQRA 3AQYA 2YN3A 5DHYB 4DW2L 3WEBA 5JHLA 5JPMC 4S1QL 3F7RA 3AGVA 3OR6B 2VO8A 2NNRA 3KAAA 3GXUB 3STZB 2DH2A 4JANB 1GGIH 1EDYA 1AI1L 1E8ZA 2R69L 1K4CA 1SM3L 4UILL 3OJ2C 4QI3A 3ZDYB 1GZHC 2KLRA 3C5SA 1HCZA 4MDIA 5F6IC 1T1WA 2OMNA 2QV2A 5DEGB 3CXDL 3VCLB 1RLBA 5AVQB 1IQDB 5GRXG 3OKKA 4U31A 2AV7B 5DFTA 3OHXC 1AD0B 2W95A 3QUXD 4UDUA 4P46A 1SLWA 3RFRA 4J4PD 5GGTA 3RI5K 3TYFA 3QNXB 1BVOA 1BMZA 4P5SA 3QIUB 5EF1A 2NT0A 5MERA 3ASNB 4GG6E 2H9GA 1BF5A 4PVMA 2W60A 1JF1B 1EAPA 3TO2A 3RNQA 4QDGA 2DD8L 1WO2A 3LIUA 1AGFB 2MWCA 4JDEA 2DQGL 3UGXA 1S5IL 3HAEB 3MLTB 5I8EB 1NUFA 4FFVD 4JDVB 1X44A 2EXSA 5JIIA 3FZUD 3HR5A 5EC1A 4GPVA 4LDEB 5I8CB 2GIYA 2FSEA 1P5UB 5KBKA 2P46B 1IL1A 5DRZA 5T1MB 3DX6B 3T6VA 2B0SH 5GHWH 4OZFG 1NGZB 3MLRH 3NP3A 4E9RA 5EZIH 3WFDL 2X9WA 3VH8G 3F00A 2GBVA 3VFWA 1CVRA 2E7DA 1Z9MA 5AD0B 3I6GB 1BZOA 1HI6A 1WT5C 1MFDH 4QYAA 4YXKL 5DMGC 3QO1B 4Q7DA 4DPBX 1IGYA 3E2HB 4FTDA 2PABA 3QUYD 4BZ2H 4E68A 2WHVA 3OKEB 3SOTA 4PP2A 2V2WB 1N68A 3JWOC 1XZ0B 3BP7B 2GCYB 4UQIM 3FOMA 1HINL 5I74C 5B7EA 4WNQB 5IQMA 4DK3A 2XVBA 1PG7L 2GI7A 2YPLD 5IFHH 2H6PA 1PZAA 1HOEA 1T5XB 3BXNA 4H26A 1G43A 5F7HA 1E5YA 5EC2B 4DUWA 5IQ7L 4N25A 3BAEH 4ORGB 1JGLH 4YC2B 1KY7A 3MPCA 2E75C 2WYZA 2OX5A 5EBLA 2HZHA 3QXWA 3BVNB 1PZSA 2FHCA 4JPVL 5B7FA 3L9RB 4OZIA 3O8XD 2FBJH 4OJDH 3UXFA 3MACL 5D7KD 4PV9A 2W65B 1GY2A 1RSFA 3RGBA 3JV6A 5LCVL 4JO5A 1FGVH 2FQFA 3E8VA 3QIWB 1GSMA 2XWEA 4LPWA 2AQRA 3GIZL 4FXKA 3LCYA 5D1XA 2FWOB 2Y06L 4F58L 1T5WB 3MLVH 3J07A 3LNFA 4MCMA 5JR1L 2VJ8A 1DQLH 1QFOA 2YFNA 3BSZH 2B1AL 2NDGA 3EYOA 1S9YA 3S36H 1BG1A 5HDQH 1U6AH 4FQLL 2JB6A 2FEJA 3VFPA 1YA5A 2JMRA 2ZWKA 1RZFL 5AW0B 1S5HA 4G7QB 2ENYA 3EIFA 4GSRA 3MJ6A 2WIIB 3PWLA 4F15C 3EGDA 5CBAB 2RGSA 2EDMA 4IIQA 4NO2A 4OD2A 4WI5A 2F54E 3ZU8A 3VXRB 4FLOA 3VXUE 1UT9A 5IROC 4ZBJA 2JKTM 4Q56A 4G8GA 1FGNL 3QFGA 5HTSA 1FL5B 4Q2ZA 1GC1C 1Q1JL 4AJWA 5C2BH 3FO2A 2QMKA 4PJ7F 2NW3A 1UCTA 4BCXA 3SN6N 1W8EA 4H8HA 2MCPL 1EJOH 3CAFA 1XCWA 3WKNA 4HUNB 2ICEB 5D70L 4GH7B 3CDZB 4QRPE 1S7UA 4JNXA 2A74A 3QB7C 1N19A 1SY6A 4FERA 3M8OH 3R7QA 2BSBA 3RWFB 2QT6A 2R0WL 3G6DL 4GIPD 4MA3B 5E95B 4XNZC 2WVVA 4MVBD 3JWOL 3HZVB 4NKMB 4RFNB 2EIZB 2R2BB 1U8IB 4KO7A 4XMUA 4R7DB 1MNUH 2V9RA 3FU8A 2IMMA 2HTLD 2Z7UA 1EO5A 3BAWA 1JFQL 2FJGB 4MYPA 4YHPA 1J5IA 1I8LC 3SKOA 3QHTC 5JPNB 5FUOL 1HT6A 2NSXA 1XQ4A 3C87A 2G4GA 4X6EA 1ZLSH 4HD9A 1NGWB 4JDTH 5KYWA 3VXOB 2KLSA 2V9UA 1G9MC 3MBXL 1BZ7A 1XF3B 2WKOF 5LWYL 3FNKA 2CO3A 1RZIA 2GK0A 1YECH 2ERJB 3VGAB 3Q05A 4QOKA 3SGJA 1F6LL 1DUYA 1K9TA 4OI8A 3RVUC 4IRSC 1DVFD 5AYTA 4NS0A 4GQ9H 2I25N 5GIRB 4LOUD 2D9QB 3JTBA 1LK3L 1MWAA 3K80A 4QHLA 3UZVB 2Z92B 1HIML 3DJRA 1UB5A 4P5TA 5HYQA 4QXGH 4OJCA 1RPQA 4JHBA 3PJSA 1VADA 1C1EH 2XN0A 4KKNA 1H19A 1NAKH 5J1AA 3GSQB 4NJ9L 3HHSB 2QGEA 2WBJA 4PJ8A 3N5AA 1I8MB 1G7LA 2VITA 1CU4L 2RAMA 4UYQA 4QCIB 5IQLA 5FO7A 5J3HD 1BCIA 3GTVA 4ZMVA 3US9A 1RZQA 1GC1L 2F8OA 2J8UA 2FHFA 4NUGH 4MHHI 1U8MB 2GY7B 1BEXA 2D7NA 3MV7B 4UAOC 5AOIA 2IMNA 5EULV 1SJMA 1JUFB 2VDRB 2K4WA 3NPSB 3QQ9D 4HJJL 3QZWG 3T6XA 3O9WC 1GJUA 4K23H 4NZFA 4DGYL 2GTZA 3ZE2B 3ARGA 1DVSA 3D3VE 3SOBL 4YLQT 3FS9A 3MUGB 1JZ5A 2FZ3B 2XWJB 4PU2A 1FG2B 1KWGA 2V8MA 3BZ4A 1E2WA 1PLBA 3PP3K 3QUMA 2B15A 4F92B 2CJ3A 4WI7A 3GBNH 2HG5A 2I5YL 4N9GA 4PY7A 4WO4A 4WNSA 3ULAB 1AIZA 5AW5B 5TE4H 4R90H 4J8RA 2JKNA 3RWJA 5ENWA 4GG8A 2ITEA 3I9GL 4X9FA 2L7UA 5EU5B 4DFIA 2ZSVA 5B8CB 3MJ9A 4P04A 2D03H 4KKAC 3X1BA 1YPZA 3DHMA 1ND0B 3S7GA 1IBZA 3GMOA 3KPSD 3LRSA 2F7RA 1HE8A 1X5XA 4Q6IC 4I18C 4WU7B 3NBNA 1G9ML 2C3VA 1I7UA 2HKHH 4OUOA 4U1SA 1JWSB 2UWEA 2H4EA 2GPZA 3IBOA 5D93B 2JF1A 2BIPA 2HFTA 2A73A 5DHVH 3U2SB 2B14A 2DM2A 1UEMA 4NRZA 4EO5A 3FCUB 5T1DH 1LWHA 1OVZA 1ZEAL 2N7AA 4Y1AE 2DKMA 5TDPA 3HG3A 4ZMTA 1DQJB 2WC7A 5CHNB 3KYKL 5DVNA 4X2UA 4KROC 4PS7A 2BW5A 2Q8BL 4ONOA 2IDSA 4YBQD 3A4DA 4M56A 2XQYG 4BZYA 3S3CB 1QBLL 2N56A 1YVLA 5AZUA 3DKHA 5TPWL 1CVSC 4J3OF 1QTYT 4N24A 1PZ3A 3GMLA 2VAJA 2WMPB 3COOA 4X5QA 3LQZB 1JXKA 5C09B 2FX8H 3DVFA 3RIAF 1EVUA 3NZSA 3T1WA 4QRBA 5CS7A 2BVOA 5GJSH 1TU2B 1U33A 1JV2A 1PJWA 4NRYA 5TF0A 1UKSA 3QEHA 2AXFA 1P6FA 1MVUB 4GUQA 3A67H 4GXVL 4RAUA 2YZ8A 2P5EA 3HG1E 5FGSA 1QSFB 3HZKA 4L4TA 1PSKH 4FFYA 3QPXL 4JCWA 1CF1A 1OHZA 1S7WA 3U30C 3H42L 5EZLB 5CM1A 2EDDA 2VUYA 3ROOB 4YGAB 4XMPH 3SJVE 4M43L 2KI6A 4L8SC 5EUOE 3DUUA 2UZYA 3QPQD 5EZJB 1FE8L 3BWZA 3IRZA 4LAQL 2WTPA 1PKOA 5D7IE 3MLSL 3RPBA 4OCRL 3KGSA 1M6OB 4NNPH 3PQYE 1KIQA 5D72H 4JDZB 3BW9A 3TEXA 4JAMB 3C8DA 4PGBA 4H5SB 4XMLL 3L3GB 1EJ8A 1QFWH 1CFVH 1QZ1A 3I50L 1WZKA 3QUZD 1T4KA 3LTVA 2ATKB 5J1SC 3CDCA 5I66A 1A3LL 1BJMA 1HDMB 2EDBA 1MFAL 1T89A 2BNRA 4I2XA 4J3UA 5ANHA 3FB6A 4E41A 2A9BA 4LRNH 4Q8BA 1MY7A 1QHQA 3K8KA 4LSRL 4XR8C 4YO0B 4DF9A 5J57B 3P0VH 4M5TA 3E0GA 3MJWA 4JFOA 4U33A 2A77L 3GBEA 3V0EA 1AGEA 1M9WA 4G7SB 4N2GA 3MV9D 4OJFH 3I74A 4GLRI 4TNEA 4AE0A 1I85A 1OIOA 2FCBA 2WQ8A 5AYUH 1UD3A 2ALWA 1THCA 1Z3GL 4E0RA 2X9YA 2ZOTA 3CSPA 3D39A 4PJDA 2E59A 1NFKA 1NOAA 1P84J 4UINH 1FA4A 4MAYD 2OCCB 1DZ0A 3P0YH 2GEQA 4DK6A 4RMUA 1CD0A 2VDNB 4FQQA 3BWAA 1MJUL 4ZQTA 3TA3A 1EPFA 5HGHB 1A7QL 3AU1B 3V4PA 3U0WH 3M17A 3D25B 3VD9A 5FCSH 2ZSWB 1J05B 1NL0L 4YMPA 3VWKD 1FNFA 3PAVA 5BRZD 1AS7A 1G1YA 4XX1G 3TO4C 1U8HA 1R17A 3FUHA 2YLKA 3QJOA 4JB9H 5EIVA 3F8UB 1A6TB 2FAUA 4W9DC 1QKZH 2QFRA 4AT6B 4OCYH 4ODWB 2QVKA 1UJ3B 3FKUS 4Z7WA 3RX7A 2ADIA 1UG9A 3CGTA 1GH7A 2XETA 3APMA 4HPYH 2HH0L 3UG4A 4IKKA 1A6ZB 1JHTA 2XWBA 4PR5B 4YSRA 3KYMB 3VFVB 4S0TD 2F53A 2O61B 4F2FA 1CZ8L 1UWXK 1ZVNA 2FLMA 5HYJD 2IBGA 4FQIH 4JE0A 1I4FA 1WCQA 3IDYB 5I0VA 5I6XC 2ZICA 3RGVD 4OF6A 1XSJA 5D6CA 3T4YA 4K3GA 5DFAA 3WENA 5BMFL 5I73C 4JG9A 4TS6A 2HPOA 2VABB 1OM3H 1RZ8B 4L5FE 4Y8DC 3ARDA 3HZYA 5I28A 4A55A 2Q3AA 3UBXI 5T5NG 3WD5L 4LVEA 2VTFA 3KLDA 3MNWA 4AVJA 3UDWC 3HB3B 4JFFB 3W2DL 1DFXA 4QXTB 3O3AB 1FDLL 3EFDH 2OQJB 4PW9A 3X13B 3MXWH 4NWTL 2DDQL 2OZ4L 1I3RB 5F3BB 2P42B 1HCVA 1WAPA 4X99A 4XP5H 2DMGA 3BUYB 3MRQB 5ESQB 2DTMH 4N2EA 3HS0B 4XGZA 3NCCB 5HHQA 2YPLE 5E6YA 1CFSB 2G2RB 5D96B 4HJIA 1G1CA 3GHEL 4OLYL 4PCYA 1YRKA 3EO0A 1ZOXA 4I8DA 1E50A 2VDLH 3RJDA 5ILTL 1RZGA 1T7WA 1WFIA 2CUMA 3MLWL 4AENA 1XH3A 4M9OA 2H32B 4APQA 1VEPA 4FNUA 3RKDD 1RQ5A 2VDQH 2AJUH 1USZA 3FT4B 1YMMA 4XMKH 5DO2D 3HOGA 1UYWH 2EDRA 4HGWB 4AZ8B 4AL8H 1CFTB 5DZ9A 4XP9H 4MCZA 3LH2L 2HWZH 3IDGB 5DLMH 4EZMA 3LXUX 4AQ8A 2EVHA 1BW8A 4ANUA 2NR6C 1Y6MR 3Q43A 4C54A 1AYOA 4HIJA 5AVXB 1QLEH 2HVJA 5KUKA 4F2MA 1N59A 2HJFA 4WO0A 2UX7A 4GEIA 3EO9H 1KXVA 3GS7A 3H0TB 4WJ5A 4CADB 5HYEA 3F58L 3LZFH 4GBXA 1Z5LA 3X2QB 1RUQL 2X6VA 2F5AL 5EBGA 3VQMA 2DI7A 3GSUB 5E6ID 8FABA 1OK8A 3EJSA 2IBZX 3UP6A 4BK8A 1RJZA 4ZFOA 1FNSH 4JQIL 4Q52A 2X10A 2YOCA 1A5FH 5E00A 4ONFL 3ARTA 3G6AA 4JPWL 3AT8A 5C07B 3PGFL 3Q06A 1LP9F 1I82A 2XN9D 5K9OA 3NACH 3CH8A 4N90E 3ESMA 2X4NA 2ICCA 1T7YA 3MNZB 2ZG1A 3O6ML 2IQAA 3QDME 4IJ3B 2Q0ZX 4LB8A 4XVSL 3RL1B 3ZX1A 4GY4A 1WCBB 1GPOL 2JTYA 4BHUI 1YMHB 3P3SA 1JWMA 2NOYA 2ZXDA 4MYWB 1D6VL 3PWPA 4XCYB 5TF1H 2YA1A 4Y1TA 5DZLA 3EGXB 4PRIA 2EO7A 2E9GA 4PJFA 4QXWA 3ZL1A 5ITFA 2IBZY 3D69B 1HYSC 5I18H 3DOSB 3NSFA 5C7XL 3TA4D 2JELL 3ARFD 3IMWA 4P9HH 4RNRB 4Z9KB 5E1QA 1A7RL 1JRHH 5ANME 1LMKA 3KPPA 1QRNB 3V7AG 5FECA 4FXTA 2X2HA 4AQ1B 1CGVA 3SE9H 1INEL 3QYNA 2ATAA 2OYLA 1CLYH 2PR9A 5HHVH 1B6UA 1T6VN 5I0YA 4J5VA 4D8PB 1S9KC 2XQBH 3MLUL 4Z7OF 4NQDD 3X3GH 4K73A 5AKTA 3HE7B 1N5YH 4BCYA 2LGNA 2AJYH 1N64L 4I48B 3TOPA 2BWDA 1ONQB 1HH9A 2JQZA 2G3MA 4TMPA 2ADFH 1L9SA 1QSEB 2VJ0A 5CZVH 3TNNB 1MCOL 4HXBL 4TVUA 5BO1L 2C9VA 1SN5A 3D2UB 1W6LA 3NRPA 4H8QA 4PJCB 2W8CA 1INDL 1NDTA 2FATL 2X6UA 4LLQA 1JAEA 1F4YH 1NWPA 4GG6A 3JQOB 4N86A 1ZLWH 5I0ZA 1HESA 1AQDB 2AJ3B 2AMUA 3LD8B 1FVDA 2BHUA 4Z0BH 2QVIA 3S97C 3TBVB 5AB9A 3C8KB 3ISYA 4RA3A 2K78A 4XMVA 4V2BA 1KYAA 1M2VB 1XGYL 2Z1KA 4KTEH 1B4TA 3Q2NA 1FBIL 2A3TA 5A2BA 2LFEA 5EEZA 1ZDSA 1PJ9A 4RMSA 4BDVA 3LKQA 3TV3L 3VD2A 4ZFZB 1P69B 1HXKA 1GZQB 2XBTA 2OMYA 2DYPA 3K7UA 4TSBL 3V4LA 4JHAH 4O2CB 3VFOB 1YC7A 4P8QA 1FFOA 5DXWA 2GSIA 5E8OA 12E8L 2R0LL 4M00A 2I07B 4QRUB 5DUBA 3U6XS 3V52H 2VDML 1HSBA 2QQNH 2PO6B 4MAUH 3NDYE 1YEFH 4URKA 1CB4A 1VFOA 4KVCL 5IEKA 1LQBC 5EBMB 3EO1A 4OIIH 2G75B 3WJJA 3VRIA 1Q0XL 3BVUA 3FQRB 5DFVD 3T0BA 2BCKA 1MCKA 5IR1B 1XF4A 5GZNC 4ZZFA 1NICA 1BBJA 5FX3A 4Z18A 5LGJB 1UOKA 3KPSE 3T2QA 2L04A 3B6SA 3ETBJ 5LN4A 3NJHA 3ENEA 1NBZB 4Q6KA 2IALB 4MJ5A 3TWCL 1AZCA 1XMWA 3O45A 2J3SA 3JTTB 4HSQA 3TBYA 2CPUA 1BEYH 5LG6A 2GAZA 4HCRL 3VDBA 5F7LB 5IT2H 1FFQA 1LNUB 4S2SB 2YBRB 1BD2B 4JFWA 4M48L 2IGFH 3B7RL 5TQ0H 1PBYA 2CLZB 2R1YB 3GMRA 2CPCA 4F8LA 3TIEA 4O5LH 1I1YB 2IAND 2JH2A 4AV0A 1FN4A 3EJTA 4E9XA 4U7KA 1A3QA 1NCDL 3SGDH 1IC4H 4JFPA 2IH3B 1MCNA 1BLIA 3CFCL 4A2FA 2EAEA 4PRDA 2OMUB 1XIWC 1TMQA 1E27A 1CURA 5DS8A 1AG0A 3RWEA 4H20L 1K3ZA 1R3LA 3HI1A 1NLBL 3ZHLA 1WG3A 2CD0A 4LCWB 1P5UC 2NSMA 4PTTA 3V4UL 4MXQD 4JGUA 1BIHA 4B9KC 4WNJA 4HWZB 3WJMA 5MENB 1PDKA 3QFJB 2VIRB 4Z1PA 1OALA 2OW6A 2JKXA 2C34A 2YD1A 1ADWA 3MQIA 4M61B 1J0IA 5GRJL 1MCFA 1U93B 3N04A 1F86A 1F58H 2D4FA 4P59H 3VXUA 2X1PA 1JGIA 4UT7H 3V0VB 4A37A 5BW7A 1ZLEA 2DS4A 4XHJC 5L2JB 2WXHA 3E2HC 1D5MA 5IBLD 2G2PA 1LXMA 3T3ME 4HJ0C 2V37A 5KVGH 2DWEB 3GD1C 4Y2LA 4L2LA 2IAAC 3MODL 5T3ZH 1JZ3A 4CBPA 3CX5J 3N44F 3BVVA 2J44A 1B9ZA 3DHJA 4IMLB 2OI9B 4XWGH 4P57B 5FDWB 2UZIH 3EJZD 1UB6A 2ZUQB 1A3ZA 3CLEL 3V9EA 3VWJB 1FAIH 1AJ7L 3QXAA 3L3IB 3FRUA 3LMJH 3K4ZA 2CBMA 4IOIB 4LQ1A 4PV8B 4YC2C 4C83B 4DK5A 2VW6A 1O7DC 1R19A 1A0QL 1TQBB 3MA9H 4IYKA 2I26N 3QQ4B 1F2XK 5JW3L 3W1ZA 5K9JH 3MAWA 1SVCP 1TF4A 4OI7A 3KPRD 5L4JA 4JRLA 1NPNA 1U8OB 3MRFB 1LP9B 1RMFH 1VGEL 1OARL 4ZXBD 2X1XR 4FQ2L 3F12A 3VACA 5ID1A 1FNEA 1DVXA 3ESVF 1T1YB 3QIWC 2DQCH 4NFBA 5IVZB 3SDAB 1XBDA 1TTRA 2VXVH 4XPFL 1WTLA 2C7UB 3MV9E 3KPNB 5KWYC 2M83A 2W9EH 3C6LB 3NMEA 3ALPA 1WDAA 3KR3L 2AQ2A 1BVNT 4HT1L 2CGRL 1FFTB 4K07A 4S11A 4HIXL 4M7KH 1C5DA 3DV4B 3F7VA 3H3PL 5AZ2H 3N1GC 1MW2A 1KZYA 3C60D 2WB7A 3IS0X 4N5UA 1F97A 2P45B 1JPFB 1RUAL 3ECVA 4K4KA 2DQDL 2AABH 4PWEA 1F3DH 4QTHA 3PUUA 1TEYA 2Z91A 4AQOA 1DL7L 5FV2A 2JB5L 3HI5H 4RSVA 1RIVL 5EO9A 1D7DA 5BRZE 5J6HA 2VXTL 1CJYA 5DFWH 3VVVA 2I85A 4ENED 1FO0A 4Z7OB 2ICEC 4D9LH 1N8OE 1ZANL 2QKIA 4X6CF 3MUY1 4M6MH 4M7LH 4A6YA 3P4MB 3QNZB 4NZUH 4UIKL 2E7HA 1RZJH 5FYJH 1IGCL 2UYLB 3JT0A 4Z3IA 3QI9B 4N2LA 1ZK5A 4KMTL 1OAYH 4RFNC 3SCMD 3GRGA 2CJSA 3IAQA 1TIUA 3Q6FA 3N06B 1MAML 1EMTL 2P24A 2RHEA 1EHNA 4QHMA 4XRCB 5HYJE 4OIFA 3D3VA 1G6VK 3IPEA 3TBTA 2WXPA 4PP1C 4MD0B 4LGRB 4EN3B 5CKGA 1ZHBA 4BBWA 2AV1A 3ZR6A 3MFFB 1N70A 3RDTB 1HHHA 5DJCA 5E23A 1S4IA 2V33A 3OKDB 1H0DA 1TETH 3IETA 3UJIH 4YHKH 2FBRA