1TO5A

Structure of the cytosolic cu,zn sod from s. mansoni
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
GSNMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGLAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cytosolic Cu,Zn superoxide dismutase from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 44
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1to5A00
1RK7A 3QQDB 2AQRA 2WKOF 3SODB 1IBFA 4OH2A 2ZKYA 1HL4A 3H2PA 3KH3A 2WYTA 3HW7A 4N3TA 1SDYA 1UXMA 1N19A 1SXZA 3GTTA 1P1VA 2AQSA 3HFFA 1E9OB 1JK9A 5CU9A 2VR6A 4MCNA 2ZKWA 2WZ5A 1QUPA 2APSA 1TO4A 3HOGA 1SRDA 3F7KA 1EJ8A 1E9OA 1SOSA 1HL5A 1IBHA 1OZTG 2VR7A 2JCWA 5KBMA 4A7SA 1AZVA 3LTVA 4A7TA 3F7LA 1CBJA 3ECVA 2WKOA 1OALA 1IB5A 2AQTA 3L9YA 3MNDA 3MKGA 3KBFA 3CQQA 1Q0EA 2E46A 1SXBA 1CB4A 1JCVA 1OEZW 1XSOA 1FUNA 1E9PB 1UXLA 2WWNA 2V0AA 4N3UA 1SXCA 1E9QB 2ZOWA 4OJAA 1PU0A 3KH4A 1YAZA 4U4IA 3CQPA 1DO5A 1JK9B 2WZ0A 1MFMA 2R27A 1E9QA 1SDAB 2E47A 2SODB 1YAIA 3GQFA 1F1GA 3ECWA 1F1DA 3K91A 2AQQA 1SXNA 1ESOA 1U3NA 3GZPA 2Z7WA 3ECUA 4A7VA 2GBVA 1OAJA 2K4WA 3GZOA 4BCYA 2GBTA 2JLPA 1F18A 4A7UA 2WZ6A 1TO5A 1N18A 2VR8A 4MCMA 2C9SA 3QQDA 1SPDA 3T5WA 1PZSA 1F1AA 3GZQA 2XJKA 4BCZA 1B4LA 4L05A 3GTVA 4FF9A 3H2QA 3PU7A 1Z9PA 3RE0A 1S4IA 2Z7UA 1DSWA 3KBEA 5KBLA 2AEOA 2C9UA 4A7GF 2GBUA 2AQPA 1L3NA 1BZOA 1XTMA 3S0PA 1Z9NA 1E9PA 4A7QA 3L9EA 1IBBA 2C9VA 1SXAA 1EQWA 2NNXA 1B4TA 2ZKXA 3CE1A 2WYZA 3KM2A 2Q2LA 1PTZA 1YSOA 2LU5A 2Z7ZA 1XTLA 1COBA 4BD4A 5KBKA 1BA9A 4B3EA 2Z7YA 2AF2A 2XJLA 1IBDA 2WWOA 1KMGA 3KM1A 1OZUA 1SXSA 4A7GA 2AQNA
chains in the Genus database with same CATH superfamily
2E74C 1VIWA 5I19H 3HAEA 1J8HA 3TZVB 1KXVC 2VL5A 5EF0A 4EF3A 2ENPA 3AS2A 4PJDE 3M1OA 1RUPH 3MRDB 4GLRH 4WK0B 3VH8A 4LP4A 3I6GA 2LLNA 5IFHH 2EO1A 3L3OB 4NC0B 3KW8A 5FW7A 2WYHA 2AZUA 3BAIA 3BP6B 1E65A 3VD3A 2BOLA 3IMUA 3VXUE 4YBQC 1HCYA 1VZHA 4PJGB 3OC8A 2XQYG 1HE8A 4PLKC 2EH8L 3D1MC 2EEAA 1NEUA 3JWNC 4PRIB 5K39A 3GLAA 4YFDB 5KSBE 3D30A 1D7BA 5GRZA 3L95B 3NRQA 1DVTA 5BV7L 3L7FA 4S1QH 5TH2B 3AW5A 3JWDL 1HTYA 3CVHH 3HFML 1BYPA 4NRYA 3UP6A 1PG7L 1FH5L 2HT4C 3BPLC 2IOIA 4LKCA 4NO2B 4X8GA 5FIEA 5HJDA 4P4KB 5EZLA 5AZEL 5E08H 4PIBA 1GW6A 1YEFH 1W0VA 2BVUA 3QZPA 2FJHA 1QRNA 3K8KA 3KVDD 2WLYA 3S4SG 2AV7B 3PIQB 1Z9LA 3SPIA 2C26A 5DMGC 2HKHL 2BHYA 4TPRL 1KTLB 3WJLC 1A7PH 3CX5K 4ZMTA 1GZHA 5FR3A 2J1WA 4P4KD 2DLIA 2CRMA 1YNLH 4WI6A 1HHIB 3ME0A 1ZT1A 4POZC 5I8OH 1P4LA 1AZUA 2FBRA 3MNZB 4WGVB 1V7ML 3Q9PA 3OMNB 2I25N 2XYBA 2VJ8A 1CDHA 4AT6B 4ZXBA 1G84A 2P42B 3L4UA 1S9YA 4YDNA 3HNSL 1XF2B 3KGSA 2RB8A 3SKNB 4PJCA 3HC4H 4DTGH 3FQ2A 3CN2A 2IOOA 4GG8B 4HF5H 4U05A 4V1DB 3VNYA 4OIIL 4DK3A 1N18A 3QNXB 1OARL 1W72L 4XZUA 1OM3L 2X05A 5J9PA 4TSBH 3DHPA 4HV8B 3C8HA 4QLWA 4KQ4L 1JI2A 4N0FA 3WGUB 5ILTL 2HMIC 1B4LA 1HWWA 3GT6A 4IGBA 4PHZA 3N04A 1NL0L 5F7BA 1WS7A 4F7TA 1HDMA 4TKWA 3WKQA 2EIBA 3PPEA 1UWXH 3OMAB 4HAFA 4DPCX 5A16A 5EBMA 3VE0A 3FB7A 2H1XA 2NY3D 5EPMB 5DU7A 4MNGB 1FNFA 1AGBA 3RQ3A 1RZJH 3VFSB 1XSKA 1S2EA 2A1WL 4RMTA 3IEAA 3VGEA 5FDYA 1NUFA 4O00A 4DUVA 2OI9C 4X6EA 2F8IA 4PP1D 3QH3A 1B4TA 2FECL 3FB5B 5ADPH 3LH2H 3T3ME 5T8IA 3TCTA 3RWFA 3B2DC 1J8RA 1GGBL 1ACYH 4LVOB 3BDBA 4AGQA 4BD4A 1A6WL 5D1ZC 1VGKA 4B0MM 3DSNB 4QF1B 5GGTL 1J8KA 4K5PA 1DQVA 3H56A 2XN9D 3GMLA 4BWTA 3EFFA 4I7ZC 4Y2DC 4ZMPA 2EVIA 3ROOB 3IJYB 3HW7A 1TQUA 4KKCC 1LP9A 4HS6A 2WW8A 1EFXD 2PP7A 2EE6A 4LNRB 4YC2B 1SJEA 3GSNA 1Y6KR 6FABL 3Q8BA 1RV6X 4IMLB 3US0A 5SWZA 4NAMA 4EN3A 1VFBA 4PV9B 3QHZL 2V33A 1OGSA 1M1XB 3MA9H 2HN7B 1AQKH 4CSTA 3S96B 3WN5C 1HL5A 3UP1A 4C47A 2EVJA 5AAMC 2UY6B 3QHFH 1U6AH 4QPEA 4YDJA 5E2TH 3QUYC 2GTZB 1WCBB 3DOSB 1UH2A 4M8QB 3BAXA 2ERJC 4PJCE 2WKOA 3JYCA 2DLGA 2Y2WA 3L3JA 4GUCA 4JFWA 5CZXC 3ULUC 1CD9B 4KAQL 1EDYA 3G6JF 5HHOB 3OX8A 1CFBA 3NGBB 1ET8A 3EUUA 3KBPA 3PFQA 5F71A 3UTSA 4G8EA 5E56A 5MEPA 3QVAA 3O3BA 4FCAA 4NQDD 2Z1PA 1A6UH 4G6KL 3FFDB 3MRGB 4PWEA 2IO5A 3ELAT 3UPRA 2BIOA 5K1VA 1ET5A 2XWEA 4OGYH 1L7TL 1CFNA 3SKOB 1VACA 2X2JA 4YBQD 4KV5F 3FPXA 4TRPH 2R56H 3EH4B 1JHTB 1HSBB 4RZKA 5E7FA 4P5TD 3VFPB 4CMHC 2ZCHH 3K8MA 3KWTA 5BS0B 2XY2A 3RUGA 2QTEA 1DJWA 1ZHBA 3EADA 4LXFA 5EZOH 4X5LA 4JO2H 5FHBH 1OB0A 1KBGH 4Z8FL 4EQ2A 3DX8A 2KKQA 4HDIA 3L54A 1EEZA 3IXTB 5J12B 4F8TA 1IGJB 3QQDA 4AUJA 5IBTH 3E0GA 3A24A 5E6UB 2DJMA 4PD4K 2APVA 2X4TB 1LMKA 3QA3A 3R06A 1T4KB 3NOIA 3BT0A 5DRWB 1KYAA 5CN1A 4TNWF 3DARA 4S11A 1BHGA 4U3SB 3ZE0E 3HS0C 5KZCD 1TQBC 3KYOB 3CQFA 2EYSB 3SPCA 3QXDA 3U46B 4Z7UE 5H8DA 4FQ2L 4G11A 2DIEA 2O93L 2O6DA 1P0SE 1MCEA 5EOQL 4R4FL 3O2WL 2XQBL 4PWIA 5JZ7C 1PKOA 4YHOH 4HWBL 4NO2A 4I48A 4X0NA 3WMQA 1BAGA 3CN4A 4GW4A 2FAUA 1DN2A 4H5SB 1DQDL 1YY8B 5EUOF 4F8PA 4K9EC 2EC9T 1T1YB 4MS6A 4ZPVB 2L8AA 2QVKA 3IRZA 1DUYA 3LZPA 1F90L 2UY7A 4YHLL 1GHFH 4YBLC 1IKOP 2X9ZA 4P5TC 4XB7A 2ZXQA 5DS1A 2R2BA 3QEHA 1AKJB 1EGJL 3A0OA 1KGYE 2YLKA 2ADJA 2OK0H 4HCFA 2HMID 1PSKH 4L4JA 4KX7A 4XI5C 4M48H 2ZUVA 1KT2B 4IRJB 4OFPA 3L81A 3IS0X 1E42A 3O41A 1SDYA 3MNWA 2JELL 2X6UA 1RXLA 5IQ7L 3VMOA 2BSTB 5ELIA 4Q0XH 4YSQA 1NDMB 2E3VA 4ONFL 4S0TD 4P59L 2IFGA 2FQFA 3BZFB 1IX2A 4HS6B 3H9HA 2PUQT 1N59B 2NXZB 3FU7B 1EXGA 4HZ1A 4GO8A 3THMH 3QEGH 4PYHA 5F7AA 4D0BB 4R7VA 1NAMB 5MENE 4K94C 2VUOA 2WP3O 5D4HA 2GC7C 1R47A 1UFUA 5MHSD 5F44A 2C9QA 4WFHD 1XBRA 1HAUA 3OJDB 2VAAB 1XSOA 1H3WM 2P52A 4L8SC 4QT5A 5DD1H 3V5DB 4KQ3L 3ATDA 4M4PA 3TCXA 3A6CL 5DEGB 1FZOB 5TQ0L 4Z7UA 1OAUH 3PQYE 2H45A 1T66C 4GP4B 4Y4KD 2ESVE 3X11A 4KNUA 3WAJA 4M6MH 4GT0A 4S0HA 3SDXB 3MRFB 3PDGA 4ZFZB 1KBKA 3IXAA 1PDKA 1C1EH 2EKSB 2QQNL 4KKLD 3NJMA 2QADD 1KIPA 2K4WA 2Y7MA 3IB4A 1QFWL 1UXSA 2AJSL 1AZBA 2NPLX 3RNQB 3UIZA 4LLDB 4G59C 4AEEA 4NUGH 3I9GL 2Z92A 5AW2B 1BQHG 1TXKA 1CXIA 2C7FA 1NAML 5EBLB 3GTVA 3FTWA 3NZHL 3D07A 4AK2A 1UVQB 3ARRA 4Y2DD 3BVUA 1AQMA 5IMOA 4JDVB 5BO0D 1S9WA 4ZOEA 5BRPA 3G6AA 3OKDA 3EO0A 2QHRL 5LB1A 4NO3B 1FL5B 5IB1B 1KJ2A 2HKFH 3LZNA 5IT2H 4P5KA 1FE8L 1UH4A 4JFYB 1D5RA 1OKEA 4J3UA 1BFVL 4NQSB 3L2NA 5EU5A 4M1GL 2JCCA 1IIKA 1R4XA 4JANB 1GGBH 1P4IH 3IF1B 5LNGA 2Y07L 3NABL 4HT1H 2GSGB 2BW5A 2VDRH 3O6FD 2XVGA 4PM1A 1XSJA 3E6HB 4MDJB 3EUDA 2VOTA 1RAMA 2KDGA 3POHA 4OZHA 3FN9A 1KJ2B 4HWUA 3QRFM 1E8ZA 3GGWA 3SKMA 3BEVA 3L08A 1UWYA 3FUKA 5IW6B 1KCUL 1JYVA 2DZEA 4K2UH 3MR9B 4GH7B 2XN9A 1EO8H 1QZ1A 5ABDE 2WBJD 3K3QA 4ZYKA 5IMLB 5F2FA 1Q9KB 5DMYA 2G2PA 3C6LA 1NFDF 1D5XB 4IRZL 1MWAB 4JAMB 4PU2A 4U1NB 5C0DA 3ZE1E 4CKQA 3UJIH 3PV6B 4YZWA 4LCWD 2CUHA 1O7VA 1R3KA 4OF7A 5D5MF 2IGLA 4AGMA 4XBPB 4CSPA 5C09D 3KAAA 2BSRB 4OFIA 5E6IA 4BUQA 5IJKC 4Y5XA 1BG1A 4RISH 3BP5A 1H0DA 2VZSA 5C6TH 4OLVH 1K8DB 2EDTA 3HA0A 3ZKND 3FQWB 1J88A 4QXTA 4L5FH 3PUUA 4AGPA 4YHYC 1BJMA 3U4EA 3B9AA 1L7IL 1KBPA 3VG0L 3QJHA 2FSEB 3LIZH 4DZBB 3OPUA 1I8MA 3OKMA 4ZUSA 1JZ6A 1DBMH 3HPLB 3ZE0F 3RFZA 1BVOA 2AJ3A 2LTQC 4PG9A 4UIMB 1UATA 4LCCA 2OL3A 4NZFA 4B97A 1JCKA 1IT9L 4ELME 2OSLA 1PY4A 2XPYA 1DBBL 2APTA 4Y7MA 3LEXA 3X1NA 5LGHL 3VRLE 3HB3D 1M6UA 4LCVA 1WA2X 3K6SA 1B3JA 2J72A 3NK3A 2AS5M 4L4VE 3DX1A 2Y36H 1HH9B 2VW4A 2X4QA 3OGOE 1E9QA 2QSCL 3Q43A 1W80A 3CHPA 3EDKA 5BS0E 2KC0A 5EEZA 3ERXA 3AQYA 1BMZA 2ZWKA 1ESOA 3PXJA 2ENYA 3S2CA 4WV1B 4JKNA 5DD3L 2GG1A 3GZOA 3VXSE 3LZOA 1CTNA 5CLYA 4J4PA 2NX5A 1NIEA 3WIIH 2EIMB 2WZPD 1H3VA 4OZHE 2A74A 1AGDA 4R3SB 3VGAB 4U3HA 1NOLA 3FBKA 4R7LA 1YMMB 3WUWB 3GS0A 4E9VA 3MODH 3UG4A 3C08H 2JJWA 4GXVH 1OCOB 5D55A 4KUCD 3LZFH 1SY6L 4Y1AE 1IAOB 3TIDA 3MZGB 3REVA 2VDOL 1A2YA 2RGSA 5DJ2A 3QO0A 1N5AB 2RJMA 3DNKA 3HMWL 3RDTC 1CFSA 7CGTA 1ECYA 1HJBC 1U3ZA 4MAYB 2X4NB 35C8L 1SLXA 5J3HC 3QWOB 1IBBA 2ATAA 1F90H 4QRFA 3DTXB 2CDFB 3O6LH 4B9KC 3P4MB 4F92B 2F53D 3NPZB 1KSRA 1PLBA 2JVUA 4NM8H 5LXGH 3O3EB 2XT1B 4PPTA 4NN7B 2IGFL 5DI8B 4EO5A 5I15H 1X5GA 5L4FA 3VXSD 1TU2B 3MHZA 4IRSA 1SXSA 4CC4A 1GOGA 4ZAKC 3S5LA 1NMAH 4KXZI 5JQ6L 2G0KA 5CCKH 3HI6H 2ZKYA 4IOSD 4JQIH 3UIYA 2H6UA 2R7EA 3KJ4C 3KHOA 3GMRA 3HG5A 1A5FH 4CVUA 3GTTA 3KL3A 2PWEA 1BYOA 2BFGA 3D39E 3AU0A 1I31A 3D4ZA 4BFOA 2CUMA 1JNNH 1L7TH 3C9NB 1CGSL 1QABA 2F19H 2X2IA 3M8OH 3RDTA 3I75A 2GK2A 4QJ3B 5D1XB 3O4LA 2AKRB 3D6GA 4NHUA 2J6EL 4PBXA 3EFDH 1CICB 2F6AA 4P48A 4MNQD 1IGMH 1TQCB 2EAEA 4ELDA 1R3KB 1WPCA 3FF7A 2K9FB 4HMCA 5IP4A 4MNGE 3D2TA 1MXDA 1QSVA 5JIPA 1UYWH 4ZYKB 4U1JB 5IEHA 4PLOB 4KKQA 4F9LA 1EXUA 4NUQA 2VC2H 3LDBC 4G5ZL 4L3EE 4LCUB 3DETC 3I85A 5TJWK 2B3IA 2AC0A 1U93A 5FYJL 4Z6AT 4RIRB 4N86A 3TFBA 5KVEL 3N43F 1RHHB 2VSCA 3KLAB 5E2UH 4WK2B 1Z5HA 4LLYA 1SXCA 3OKEA 3MU3A 3FTSA 3U2IA 3DVNA 2GSGA 5DLMH 3C8KA 4J39A 4N0UE 1DTUA 1R3LA 5C0CA 5D1XD 2WHVA 2XNAA 3MJ7A 4FJYA 3HZVA 3EJUA 4B6ZA 3ZZQA 2PO6D 3UAJD 4GY4A 4G3YH 2NW2A 3MRJA 1Z5LA 2F1EA 3AQDA 4X4XB 3S48A 4NYLB 4K3DL 5J6GB 4H8VA 1JDAA 3TBVB 1SF3A 3LV3B 3QJOA 2X5PA 4MCYA 4EMZA 5KUKA 4FABH 3ARGC 1NCNA 1J5OL 3CHXA 2OK0L 3F8UB 4ZFFA 2Q20A 2BRRL 4L3ED 1N68A 4OZIA 3FT2B 2QGEA 3I2CH 2H6PB 3WTYA 3EDFA 2P43B 5T1MB 5I74B 1RSYA 3SQBB 1F00I 2QZ5A 1X3DA 2RCSL 1X7TA 3WNLA 5J57B 1NANI 2Y24A 5FDWB 3CXHK 4N2NA 3S3SA 3THML 3CWGA 4LK4A 1ACXA 1DVFD 1TZGL 3C8DA 2FBJH 4QD2E 3T8XB 3VXMB 3VXUB 5AAWA 1VCAA 3MX0A 4UINL 3M7FB 5JIIA 1WAAF 3IPFA 3UC0H 1U41A 4FLHA 5GGVY 3GLEA 5BUGA 4L3FA 4ZQKB 4LBEA 3V0JA 4U6VL 4R7XA 3UZEA 3DVFA 4NQDE 1X9RA 4AZUA 2OP4L 4P2YA 2X42A 4ZW5A 4KY1H 4TNWK 2X4QB 3ZW3A 1MFCH 2F74B 3OTTA 1SLUA 3NRFA 4H8WH 4KZDH 4HOZA 1MRFH 4OGQC 3ZRSA 4LU5H 2O5XL 1CIDA 3LXCA 4R5VA 4RGMB 4JE4B 5C6TL 2JSFA 2J1YA 2EDYA 3UJTL 1TO4A 3H7BA 3OV6A 3TYGL 1KTDB 2AEQH 4NJAH 1A7OH 2W81C 4G8IA 3DI2B 4WO4A 4UDTB 4ZMLA 4Y1TA 4D94A 4IRJC 1JHKH 2CKNA 5C3LD 5D96C 1CD8A 2DTSA 2FGWH 4GFXA 2YIHA 1GY1A 2PMZA 2UY7B 1EHKB 2V8LA 2GFBB 3FMGH 3IU3A 4LSRH 3X12A 4YBHA 4LHUG 1AKJA 4MJHA 1E6OH 2BSEA 1JGLH 2WVTA 3TN0A 4NZUL 1PZUB 3HCVA 4HPHA 2ARJA 4FXGB 1KIUB 1MG3C 3P0GB 5LCVL 4AQAB 4OCSH 4NO0B 5DEFB 3K80A 3MJWA 2WGXA 3WIAA 1T6VN 1VEOA 2EECA 1L0QA 2GYSA 3CMOH 4MD0B 4NCDA 3SDDD 4IM8A 4ES8A 4N1CA 3RB7A 3MRHA 4OFYA 5IMKA 2XTJE 3HI5L 4OUUB 2GB2A 3L4CA 3GQFA 3VXPA 3PP4L 3KL0A 3QG7L 1JGEB 1U3NA 3BUDA 1F4XH 4WO4C 3W11C 3WHE0 4E2OA 1RJCA 5EIVA 1ZT7A 1UHVA 3QRBA 5DJYA 3GNML 4WDIB 1DVZA 1P2CB 4P46B 1AXTH 1XR8B 3BO8B 4B9YA 2JJTA 5BOZG 2YAPA 2BCMA 4EPSA 1Z5LB 2MPVA 1A1OB 2UXVA 4TQHA 4XO9A 4FF9A 2ERJB 3NJGA 5C7XH 5ALBH 5L2KE 4HEPG 5JDJA 4QHKI 4QWWC 1OSYA 3RURA 1SHWA 3QCTH 4GEJA 2WV3A 1WG3A 4LSSL 5I0XA 3PL6B 4O2FA 4G9FD 2NNXA 3UJJH 4FZ8L 2RR3A 5B8CB 2ZSWA 3IJSA 1RUMH 1H9VA 4FFZA 4NUGL 3UG3A 2J88H 5I1DB 3LPWA 5DJAB 1BOGA 5CBEB 5E00A 2B9AA 1T80A 2PO6A 4ODVH 4PBDA 4Y4HA 3UAJA 3VFRA 3T08A 5JW4M 3AS1A 2A7BA 4DCQB 1QKZL 2UY6A 4N2EA 3BRDA 1S9VA 2N7BA 1JGDB 1OTUC 1DCLA 2VLJB 3FO2B 4KRPC 2ZXCA 2BMKA 3V4LA 3IU4L 2GCYB 2X3CA 2FEEL 2YARA 1E27B 4PJBB 5EUOA 3RPIB 3IYLW 3K2UH 5BW7C 2NY4B 2WQRA 2BXZA 4JJHA 2J6EH 3HG2A 4A2MA 1W6LA 2GQHA 4DP8X 3U9UB 1TFHA 2GK0A 4LASH 4KC3B 3CDZA 1F2QA 3ARED 4LLVB 3VO0A 4BHUA 3D0LA 1GH7A 2CIKB 3C6SA 3ZYJA 2J8UE 5CLXA 2OMNA 3WFHA 4IDLA 3FQTB 3CC5B 4JRWA 2VAJA 1EANA 5AOZA 1BBDL 5DMJB 2AERT 2NY1B 4M8VA 4IBZA 1YUHA 5E4AA 1DVSA 4R6UA 4QKTA 4JLRA 4Z7UF 3QQ3B 4XGZA 1PZ3A 1OP3H 5FM5O 4NUPA 5ISZA 1KXTB 4JO3H 3MBEA 4OM1L 2VDOH 2AXGA 5C0IB 4UTAH 3QQXA 3CDGA 3NVQA 4DJMA 3TVMA 4OJEH 1JK9B 1GYVA 1KT2A 3W0WE 2QJDA 4XNUH 3I6SA 3Q8EA 1ZTXE 2LU4A 2V9UA 2VN5A 2R9HC 4ODSH 5TPWH 3BP6A 1A14H 1NPNA 1INDL 1O6SA 1JPEA 2G2RA 4KTDH 3X12B 2AANA 5HY9B 3G7TA 1FZJB 2WZ6A 4AV5A 5IFHL 4J7RA 1K2DB 2WQWA 1JZFA 1MFDH 2NY4D 5GSRA 3WO4B 3FU6A 1G7JA 3VH8G 4DW2H 2PYED 4LPUA 2E4FA 1E5CA 1NMAL 4O2CB 5F7KC 4ZXBB 4KKZA 3AWGA 3NCJH 5EB9A 1OGAD 3QUZC 1MUJB 2EH7H 2JCCF 2XXGA 3QZLA 1CGYA 4TVPE 5I0WA 5DVNA 4KPHL 3ZKMC 1I9IL 1BSIA 5I6LA 5F6IB 4JRYA 1AC0A 2OZ4H 4JKMA 4YMPA 1O9ZA 5ALCL 4WEMB 2Z6FA 1R46A 4OI8A 5IQOA 1JXKA 4G9FB 3BXNA 3T2NL 3FFCB 1WD9A 2VR4A 3T2PA 5FYLL 2ZUXA 1NCWH 4R90L 4KI5E 2A9MH 4Z3EA 4UQDA 5FS5A 5F7WC 4TV3A 2YUXA 2X2UA 1YMHA 1CL7L 1XGYH 1PJ9A 5G4MA 4GXVL 2F5BH 4ZNEE 3DSNA 3ZIYA 1HXYA 3PAUA 2WVUA 2I26N 2G5BB 2VLRA 3CHRA 1T5WB 3FCUB 4LNVA 5F9OH 4DNLA 3BZ4B 1CU4L 1UXWB 2NCEA 4E9SA 1CUOA 1KJ2H 1MH5B 3FB5A 1LYQA 3H42H 4XXCC 5JHDB 1KB3A 4Y19A 2VJXA 3TF7C 4P9HC 1MFBL 4J3OD 4TUJA 4DN3H 3KPNA 1BFOB 3ULVH 1BPLB 3FFDA 1Z5YD 5BS0D 3LHPL 4JB9L 4PS8A 2GFBA 5ANME 1UWFA 2BIIA 4DERA 3G9AB 5L8JB 1FYTB 1U4FA 3G5ZB 3J2PA 1D9KB 2XRAL 3AWEA 5EBMB 2VH5L 4N90D 5JHLL 4NBZB 2BNRE 1I85C 3WE6B 5JPNB 3F6JA 3NJNA 2HLEB 2Y4SA 3T04D 3AS0A 4WTZG 3MRQB 3PHOA 4Y4FB 4GKSB 2K1MA 4KK9D 4TULH 3WO3B 4TSCL 1ZD6A 4YR6B 1G7MB 5I1EH 4GG8A 3NEOA 1O75A 2A1WH 3BYYA 3WSQH 3IDJA 3PP3K 4X6FB 3Q1SL 2VABA 3BPCB 3ZDXF 2QEJA 1NEZB 5B3SB 2I9TB 4D0DB 2Q7YA 1FNHA 1MF2H 1OSPL 3OXRB 5LUMA 1KWKA 3KYMA 3BN9D 1CFQB 1N5YL 2GUOB 5ADPL 1MQKL 5GRWA 4JO1H 5D7HA 2R29A 3FTGB 3N85H 5AW5B 3V8OA 3T71A 2AXFA 5KS9F 3SZ6A 3LQZB 5AZ2L 3OX8B 2UZXB 4OZ4A 3OKDB 2YFNA 4MNHB 1NUDA 3BSZA 4Y4KA 1RUKL 2BP0A 1HVXA 3JWDH 5HYFA 2OMXA 1RK1B 1REIA 1WJ3A 4MMZA 1GCYA 1IC1A 4UNIA 4NQSA 4OBSA 3JV4B 2FDBP 4P2CG 1YEFL 3QR2A 3L1FA 1D6EA 2HRGA 2CIIA 4ZO9A 4HUVB 3HNVH 5DYOA 1USZA 4HIEB 1I8AA 4LKCB 1HU8A 3MLWH 4KKBD 4FNSA 3GHEH 2OMZB 5ANMB 3V6ZB 1FLTX 3H9SE 4ENZA 4UQ2B 2FJFB 2BY0A 1RZ7L 2WLLB 1J8SA 4KZDL 3ZU8A 1K4CB 5JIKA 1WBYA 4HPYH 4JVPA 2BP8A 4MQSB 4J2QA 1UB5A 2CE6A 4IBSA 1T3FB 4MLSA 3UZQB 4BQBA 4M3KB 3BVTA 1RZKC 4XVJL 5ANMA 5CJOH 4W9GC 1OCZB 1TSRA 2XY1A 2CKBL 2DYPA 1A7OL 3MRDA 4GKZA 2H4EA 5DZOA 1RUPL 4RAVA 5F1IA 1QRND 4WI5A 4XNZB 4RGOL 2UX6A 4YAQB 3FFCE 4LEBA 1OANA 3SKNA 4ZW3A 1T83A 2FEDD 1P6WA 3RWIA 4EAEA 2X4RB 3PABA 2P26A 3VGAC 4JG9A 4B9FA 5C09E 3CFBA 3RA7L 3RAJH 4E41A 2RCSH 5DK3A 5D1QE 4C83B 5JW5B 5G2NA 3VI3F 1T22B 2KHAA 5HHOA 5C2BL 1QYGH 1QBLL 1PIGA 1I7UB 4V33A 4DZ8A 2EIJB 1SDDB 1U8HB 3BFOA 2WKLA 2PABA 1BW8A 2WCGA 5B7MA 3DGCR 4HU2A 5JOEA 3AREA 4IBLT 3V0VB 3US1A 3T8VA 3OR6B 3ZTJH 1XFPA 2QT6A 1SOSA 4P2AA 3A5VA 2WJ7A 1A6WH 5ETUA 4RWYH 3NCWA 2WNGA 1N7MH 5ADOH 3BDYH 1W8NA 5D1QB 2I5YH 3S36X 1XIWC 3DGDA 1T04A 4D9RD 3FU8A 2EDFA 4NQQA 2CO4A 2AQ1A 3HPJA 4XX5A 2WJ5A 1T1YA 2VQUA 3QORC 1MZYA 1A6TB 3QORB 1U8KA 3SBWC 4Z77A 1DQDH 4YHYB 5EN2B 4KK6C 2R2BB 3QEHB 3ZTNL 4FADA 5LNDA 5IB3A 4G8EB 4YO0B 2YGOA 1K72A 2IFFL 4HF5L 4IBTA 1CD1B 2Q10A 3IVKA 2ZUUA 5BOJA 4NQEE 3U46A 2O5YH 3L4XA 1T7YA 2FB4L 3KLSA 3T2QA 3GMRB 3CVHB 3NEEA 2F54E 4MNQB 5GZOA 4I77H 1R19A 4YS4A 4G82A 2P5WE 1ZLDA 4LKXB 5CWSA 4AEHH 2ICEB 4DSYA 2LFEA 4FZEL 4R7NA 2YMTA 4YK4B 3P2DA 5BMFH 1NJ9B 3FZUC 4F7CB 2MKLC 3U0TB 4ISVB 4MJIA 4XOCA 3WDJA 1MCFA 3VB8A 1ADQH 1IZJA 1KIPB 3Q2VA 4U1JA 2JXMB 1GGIL 4X9IA 2YSTA 5L2JA 4XPTL 3K6OA 3C5JB 3VFTB 1IGFL 3VG9B 3UTZA 2PP8A 5JIMA 4GSDH 1WFMA 2G3NA 3L9EA 1M7DA 4JJ5A 3GJFK 1DJGA 1XGQA 2V2WB 5AKVA 3WKMH 3I75B 2XVKA 1AXTL 4WI4A 2NNRA 4RZCB 3CZUB 3SDDC 3TEXA 3KPOB 3OZ9H 5H37G 3TV8A 1S7VB 3RPBA 3BUTA 4WWID 4HIIB 4LRNL 2P5EA 2JB6A 4PHXA 1NSNH 3MRCA 4JO8A 2DJ4A 2J25A 2HPOA 4FQ2H 2F7IA 4ATTA 3MUHL 3W37A 2CRIA 3HJ0A 2J5WA 1KTRL 2OX5A 2R83A 4J3WA 3VSQA 5ITFA 1WGVA 1OOWA 4FAAB 2N59A 1PS3A 5DSCB 5E5LA 4CVWA 2HTKD 3P9MA 3ZO9A 3X3GL 5EEUA 3R7RA 4WK4B 4BUGA 2HUEA 5DJ8B 3MACL 2VITB 4PJAE 1UT2A 4R26H 3TT1L 4AZ8A 2F54A 5GS1A 3P3YA 2J2ZA 4WFFD 5D5MB 1M9WA 5B1CA 5LN8A 3GM0A 1GS8A 2J1KA 3KLDA 5E6IB 3WXVL 1UT9A 2UZIH 5D7JA 4Z5RA 3UX9B 1QA9B 3U30B 1OAXL 3QUKA 1UJ3B 3UXFA 3KNBB 4GRLC 2Q3XA 3JBG7 1ES0A 3FTVA 3TL5A 7FABH 4H8PA 3VMNA 4GINA 2QZQA 2VDQB 1I1RA 3S35X 1PNDA 2AV7A 4ADIA 5J13C 4G9FE 1RZJC 2OLDA 5LBSL 3VD7A 2PLTA 4X4YA 5D4QA 5ALCH 4AQZA 1XF5B 1MAKA 4Z78A 1VHPA 1D5XA 4U1NA 3RB5A 5C0DB 4N8CL 3E8VA 3KR3H 4G42A 4GT7A 4A55A 4LVEA 4H25A 1HOCA 1GTFA 1VF5C 32C2A 1LO3H 3QXVA 4GAGL 5CFAA 5TH2A 1M57B 4MASA 3VFVB 1BQKA 4HHAB 4IRZH 4NS0A 1TETH 4KMTL 2WWKO 4JFQB 2XTLA 1JFHA 3NAAH 5EOQH 5D7JC 2ZKMX 2YMXL 3FH8A 5CP7A 3NCMA 2IPKA 1T21A 4OT1H 5DS8B 2Z4QB 3B56A 3DXAB 3QNZA 4O02A 2Q2EB 1YNTB 1IARB 3OKMB 1G1OA 1MFBH 4RCAA 4KDVA 3EO1A 3GSNH 1P1ZB 1WIPA 4KK6D 3SGDI 1VEPA 2H32A 1PZ2A 2JB5L 5L4MA 2WZAA 2V17L 4Y16C 5B4MD 2VB5A 5C08A 1MWAH 3EGDA 4HIHB 3NJJA 2CCWA 3KPRA 3PWPD 3GJFA 3VWJA 4PWHA 5JR1H 1IU1A 1G7HA 4JVUA 4N0CD 5DQJA 2W94A 2E7BA 1A4JA 4F15B 5C0RL 2JJVA 4JHAL 3IJHA 1A1NB 1IGCH 4W9DC 4A6YB 1D9KC 3SE9L 3VI4A 3ZKXB 1AGFB 2CHXA 3QNYB 4RAUA 3ZKXC 2VSKB 1U8JB 4X0KA 4HD5A 1X6LA 4JL1A 2EH7L 1A6ZB 3RJQB 1MCNA 4XMXA 4HSAC 3LQAL 3T4AA 1LEIB 1Y6NR 4JFXA 2Q86A 3JV6A 3DUSB 5ICXA 3OWEA 2BZCA 3VTAA 1BBJB 1E28A 3ECBA 3J7HA 3Q6FB 5HGHB 1OTTC 5AZUA 1OVZA 5CEYB 4D9LH 4HOWA 3SEPA 4M3HA 1BP3B 2GTWB 4UM9A 2YD8A 3FH7A 1ZY9A 5C07A 3QUZA 4U1LB 2RD0A 3VW3H 3KPPA 4DQAA 4CA4A 1LEIA 2AAVA 1CTMA 1JF1A 4AGLA 3EIFA 4M5ZH 4R96A 2BNUB 1OPGL 1CDJA 2X10A 3BWZA 4YXHL 4YPGB 3HNVL 3HEIB 1KC5H 5HP5A 2VLJE 1OGAE 5FXCH 5J6GA 2WNKA 4XN5A 3SE3C 7PAZA 1Q9OA 1CIUA 3ATBA 4DN3L 3LEYH 2CGYA 1VFMA 1R1CA 4KVNL 5ACZB 1SUJA 2AJUL 1NKOA 3Q8AA 1BLNB 1A9EA 5F9WC 1OCCB 1S9VB 3KDPB 1FYTD 3G6JA 2BOBB 3RZCA 4ODWA 1EA9C 2VM9A 4BK5A 1NC2D 2AMUA 2IQAB 3TBBA 3RPIA 5DRZA 5ID1B 4PJHA 4IJ3B 3JUYA 1U8NA 4UZUA 4X2UA 1JWUB 4B41A 2GIXA 1U8MB 4IOSA 1RP9A 3CSYA 4JQIL 2P7TB 1NGXA 1KENL 1KELL 1R3LB 4FQXC 5C0CB 1WCBA 2CU9A 2R1XA 2A77H 4DETA 4WO0A 2D7MA 1QLFA 3V4PB 4C54A 1BOGB 3CV5A 1SMAA 4ZBJA 4GBXC 4FFVD 1N26A 4WNJA 2QADC 1Z32X 1HNYA 1GC1L 4LVOC 2DQGH 1LILA 3G6DH 2V5YA 3MFGB 5GGSB 2BW4A 3LAFA 4ZX5A 4BZ2L 3SSGA 2FL5B 4Y9FA 1F3JA 2QSCH 1RUKH 4NO5B 1PEWA 1NOFA 3QQ3A 4XGZB 5E1AB 3N0AA 4D0CA 3QPKA 1L3NA 2QQLH 4B27A 4X9FA 3O3DB 2PTVA 3QXDB 3V0HA 2YSSB 4AGNA 2HYMA 2P3YA 4K9JA 1HS6A 4PJ9B 1IE5A 1CDCA 5B38B 2ADYA 3D08A 1AHWA 3IM1A 3QI9B 3GUTB 3JTSA 1AS7A 2Z0BA 2DM7A 2MOVA 4H20L 3DXAD 5HI4C 1INEL 4M43L 3OC5A 4L9LC 5BZWB 4PCYA 1YEKH 2Z7YA 4CJ0A 2WXNA 3HUJA 3D3VA 3MODL 5I1KH 4LCCC 4H4NA 1AGEA 2OJZH 3O3DA 4P3DA 5BXFA 1P69B 1IKFL 4IIQA 4O51A 2WKOF 4HIQA 4KKLC 3WENA 4LQ1A 1D5BA 4XWGL 3FBQA 4UU9B 4ATWA 1UD8A 1XXDC 2C3WA 3CGTA 3OHXC 4KDWA 5EZJA 4X5RA 1I9RH 4LP5A 4PB9H 1TMCB 3VFWA 2KH2B 1S7TA 5I76B 3KLAA 5DUBB 4UTBA 2VO5A 4K3DH 5KN5A 4PWKA 3N44B 2Y1ZA 4XB3A 3AU1A 5KUMA 3WXWL 4WO4B 2IGFH 3MOAL 1S7SA 4WHTB 2R1YA 4YFEA 3B3IB 2XFGB 4L18A 5CZVH 1DQQA 4OB5H 5D1ZB 4FS0A 1G4MA 4GW1B 1FGVL 2Y36L 4LMQE 1QYGL 5H94A 1A5FL 1KGWA 2YZ8A 5JA9A 4WLCA 5ESQA 5AALA 4MZRA 1HZHL 2HVJB 3ILQC 3T2LA 2H2SD 3VXME 3WY3A 1TLKA 3RVVC 5I17A 1XGUB 2QQKL 3JVGA 4LAQH 3ZZSA 1U8HA 3FO1B 2WLNA 4X8CA 1QLRA 5EOCH 4NP4L 5C0JA 4L4TD 1L9SA 1BQHB 2AQQA 2CUIA 4OGXH 4OAWB 5LQBH 4OKVA 2A83A 4GAYB 3S6CA 3T4AC 1KYFA 1OSEA 4G5ZH 2XBTA 3UEZA 4Q9QH 1TO5A 4XPBL 3Q44A 4HQQL 4N9GA 2C9SA 4H8WL 3BFWA 4TUKH 1V55B 1MEXL 1CDBA 4ES9A 3BSZL 2IWKA 5LKNA 2V2XA 3QWOA 3VRIB 4W9JC 1IEBA 4DEUA 2H2PC 3RE0A 1ID5I 5IM7B 1TJXA 4KXZH 5D5ME 2V4LA 3MRNA 1WS8A 1IAKB 1JDCA 1EHLH 3MROA 2EUVA 3MXVL 4U6HA 2D0GA 4PYGA 4QWWD 3OR7A 4PP2A 5I1CL 2QR0A 3MUGA 3RWJB 5F9AC 4MZ3A 2IDUA 5D71H 3NSCA 1UH3A 4KHXL 3AY4C 4LCYB 3V6FA 6PCYA 4X9HA 3TM6A 3WJJC 3I74A 2H26A 5JPMA 5HDRA 4J28A 5F9JB 1S9YB 1QFWM 4GI6A 4NQXA 5KS9A 4JM0A 3WEXA 3RDTD 4MJID 1HHHB 1DLHB 4F2ME 4TOYH 3C2SA 3QNXA 4CU6A 3DHMA 3CMOL 1P9MC 2AI0H 2OXGB 2DY2A 2WPGA 3ZTDC 3FL7A 3HN5A 4K3JL 5EZIH 2EXWD 1GGYA 5T3XE 4HA1A 4N28A 1DEEB 2UV3A 1G5AA 1KOAA 1PCSA 1SQMA 3O9WB 4I1PA 4OLXH 2DQTH 3HE6C 5FA4B 1WSST 2J57A 3WKML 3AG3B 1HQ4A 3GNMH 3C5XA 3TNMB 1S7WA 3LKSA 4K3GA 4D8PA 3ORJA 4X6EB 1M42A 5L4JA 3VFWB 3HG3A 1A8ZA 4YE4L 3WKYA 4PWFA 1FZKB 3P4LA 3ULVD 2WTRB 1V05A 3HMXH 1UASA 2HKHH 4OLWH 4KMTH 1OLLA 4JRXD 1MDAA 1PEZA 4XCYB 5CGYD 4JY6B 3QZOA 3D9AL 5D1QD 2WXFA 1FV1B 3OLGA 2G3XA 2DWDB 5CJ8A 2P24B 1Z6JT 4Y2DA 2BIPA 1IMHC 5HHMD 4PV8A 4OJAA 1SFHA 3UJJL 1WO2A 1UOVA 1YY9D 1SHSA 4X6CE 2YXFA 4YUEH 3RX5A 1MWAL 1MFMA 3IDXH 1VFUA 4XC3L 3OKOB 5E94A 5AG9A 4D3CL 3S8WA 3NJHA 3GBML 4P49A 1OL0A 1DJZA 1FVEA 2LT9A 3ZKNC 3N2JA 4Y89A 3BH8A 3RTQB 1FAIL 5MENB 1BF2A 2LQRA 1RJYA 3ZRCC 4WIQA 4LGPB 5FK9B 4GAFB 4LCWB 1F11A 2JJSC 4ZTOH 4JFHD 3KWVA 3WOVA 1MRDH 3GRGA 2ZTBA 5FO7A 2ZXAA 1YMME 2CK0L 1UURA 4P8QA 1OP5H 3ZSTA 1A7RH 1QI4A 1ZHNB 2ATPB 1LDPH 3KJ4B 2A9DA 4OD1L 1XDTT 5ECGA 3BVXA 2Z93B 4DP0X 4JNXA 3KEHA 2O6FA 1QWNA 5KSBF 3EH5B 3TGXA 3U6RA 2B20A 5TE4H 3L9BA 1HIMH 2EYRA 3B5TA 2GEEA 1A2YB 4ZS7L 4D0BA 4PGCA 4Z0XA 3V95A 1INEH 1KTCA 3Q1EA 3CVIL 2A0LD 4OZGE 3SPHA 2OP4H 2YD6A 1XB6A 3ZX1A 2OCCB 5GS3A 3DDFA 1P7BA 5BZXA 4TUOB 4AY0A 4DN4H 5EEWA 4XHJD 5IWLC 1VRSA 2BERA 3VI3E 3RVUD 4FOMA 1ZVHA 5I8OL 3CZNA 5F8QC 1KMGA 4UTAL 3WFHB 3MRPA 2W91A 4PLKD 5GGRA 1HXMB 1M2VB 3O6MH 1DDHB 1NQBA 4EI5C 4JFSA 4GKLA 1FNSH 1ROWA 5HY9A 3F6LA 4PB9L 5INCA 1CI5A 2W9EH 5DC2A 4E41D 4NQUA 4Y5YB 3MRMA 4Z7UB 3JYBA 5KSUA 1UA3A 4O2EB 2X4PA 3MA9L 2VR6A 3PL6C 5GZNA 3RHWF 5ICZB 3KXFD 4RGNB 1RU9H 2PKDA 4HBQA 3MNVA 4FZ8H 1E4XL 2BO0A 2ZICA 1MHHB 3CZLA 3JT0A 1RIVL 1NM4A 1DQMH 3ZT5A 2A74C 43C9B 2V2XB 1XZ0B 4FXGA 3H53A 1WCQA 3DTXA 3FRUA 3ARUA 3QUXB 4KROB 3N5AA 4XRCA 3DJ9A 3QG6B 2GJ6A 2AJYL 5AD0B 4MNQA 3ECVA 2YPLA 4CN4A 4P2QA 2XXCB 2EXTA 5IHHA 1NGZB 2GSIB 4UDUB 1IGJA 3X3FL 4FE9A 1UD6A 4XNYH 2R69A 1T1WA 3BD4A 1BPVA 3FT0A 3K2UL 3SY0A 5GISH 3MRKB 3DYMA 5EO9B 1EZVX 2FCBA 3D85D 4XHJC 3T3PF 2IBGA 1FI8C 5C92A 1NKRA 5C6WH 3Q48A 2KDYA 5EWIL 1T7XA 3VFPA 5DJXA 4OGXL 1WD8A 3RVWC 1L9OA 1R5WA 4RWHA 5IMMA 2HRPL 1OPGH 1CZ8L 2NT0A 2NXZD 4P5SA 4B9GA 4V2CB 4QHPA 4H26A 2XWXA 3SOBL 4CVZA 3GMQA 5EIIA 5ENWA 4FXGC 4Y19D 3FHQA 2YKKA 4L1HA 1S3KL 2BVPB 1XH0A 2IADA 4XN7A 4M43H 4F33B 1ZLUK 3IRPX 4PTUB 4ZTPL 3FUNA 5GXBB 1R3HA 3U2SB 5FA4A 2HFFA 2AEPH 4AKPA 2TSBA 5K9KB 3CFNA 4HJJH 4JRYE 3NP3A 4PS3A 4EDXA 2ZSWB 2JK5A 3IJSB 1ZLVH 1MRCL 2NQCA 1CT8B 4GMSL 1PX4A 3T6WA 3SE3A 5D4JA 2BNRB 2FLMA 4YR6A 4QHKJ 1ZAGA 1EMTH 1DLFH 3QS3A 3QDJD 3DVIA 1AO7B 1B9ZA 3IJ9A 1GHFL 2HFFB 2VMCA 3N9GL 4ODWB 5EORL 4OZIF 3BHBB 5JORB 3NJKA 1JXFA 5F1OB 4E9YA 3LEVH 4XODA 2XQYA 5B1KA 5G55A 5IOPB 2ZP0T 1VFBB 3QUYA 4PV9A 3V6OE 3P40A 2EE3A 3JZ7A 3QW9A 1LNUB 4BK5C 3Q3GB 4BDVA 5J7CC 2R56L 2YPVH 1N5YH 1WWWX 3AJ7A 1MQKH 3LV3A 1PKQE 3QISA 4YHIA 1M05A 1SLVA 2FSDA 3BKML 5DHMC 4P23D 4DFHA 2ZSVA 3FKUS 5ES4B 3D0LB 4FXKB 1N67A 5EO0B 2OW6A 2NUTA 2Y7OA 3I6GB 4OH2A 3OM3B 3S3BB 4BQCA 3ARBB 1QBBA 1YECH 3QS2A 5T1LD 1X5LA 2NXYD 3UYPB 5GGRB 4CRPA 5HVGB 3QJQB 2FL5A 2OMZA 2QSQA 5E9DE 1JE6A 3T2NH 1JNJA 4L5FE 3HLAB 4O02B 4BZ2A 8CGTA 4HKZB 1E4KA 2JJSA 3BWAB 3FT1A 5EU5B 4YWGL 1WFIA 3SKJL 1YPZB 2BWQA 3WS6A 4YHNA 2CNYA 3BEWB 5BVJA 2EADA 3LQZA 4PUBL 4OLWL 3VXRD 3BXNB 5IROA 2JJUA 3ES6A 3V4UL 3QDMB 2R0WL 3X1GA 2WGNB 1CGWA 4DGVL 4JRXA 1OTSD 5DURD 4H1LA 4WUUD 4OQTL 5I24A 1X9LA 2OSXA 5TQ0H 2ICWB 4NN5C 4N0UA 3VI4F 5HHOD 2HVBA 1F5WA 2CKBH 1WGOA 4OF3A 4B9CA 4NKDA 3LRHA 3TONA 4N2OA 2FE0A 5DEZA 3GK8L 5GGRY 1AKPA 5B39A 2ZIDA 3ZE2B 3EFOB 4PJEE 1IM3D 4PRNA 4UV7H 1FAIH 3UG5A 3MRRA 3MRFA 1A21A 1KZQA 4EBQH 3K71B 4XAWH 4DWHA 1IGIH 3EOBA 3LQAC 1TYEB 2ZPKL 4X7SL 5J12C 4GW4B 5IROC 1YJDL 3CSBA 4ZOAA 3ARGB 3IBEA 2P8PA 4OLYH 4ENED 3U0PB 4PJGE 4NQDA 4O02H 3U36A 4NZJA 2XWTB 2XN9B 3P30H 2XN1A 2DBLL 3QP3A 2NY2C 4DAGL 2XYCA 5KSAB 1EAPA 3KPLA 3PL6D 3BKJL 3IFLH 4PW3A 2ICWJ 1OO2A 5DD0H 1U92B 5EOCL 4HEPA 4F20A 5LXVA 3OVUB 4KJYB 3F7RA 2DOCA 3Q6FA 3TCLB 3FCSA 1FG2A 4JFVA 4KTEL 2IADB 4R4BB 4JANA 2NW3B 5EC1A 3GMOB 3DYOA 3JQOB 2DF3A 2M2DA 5BVPL 3MXWL 1KJ2L 1FVDA 1EXUB 4H88L 1NUGA 3KYAA 2WOBA 1FL3B 1MCDA 2BC4A 2Y1AA 3GHBL 1M3JA 2NY3B 2O6CA 3I02B 3D69B 1IVLA 3IDUA 4QRTB 1BAWA 4YLCA 1NLBH 3KCPA 4AENA 1E43A 3SDAD 1RK7A 2BVYA 3IKCB 4IKJA 3GBDA 3WEAA 4IGBD 3CFKB 4MSWA 3U4AA 2BH0A 2O26U 5DDHB 2E9BA 2ZG3A 4LLDA 4NJ9L 2ZXDA 4OLVL 3AQZA 4NNYA 4RA0C 1WFTA 1I75A 5I74C 3GPEA 3WTUA 2B7DT 4V1DD 1IJ9A 3WIFB 2CJ3A 3NG5A 1OT1A 1SEQL 2B2XL 5HYJB 4HJGA 5C0AA 3S34L 3VFUA 4YH6A 1N70A 1CGVA 1WTGT 4TOYL 1EWHA 4TF4A 5D7IA 1YY8A 5I8EB 5J0BA 3TT3L 4PJHB 5DD6A 4FMFA 1ASPA 4CMHB 5FYJU 5GISL 3MNDA 5T1KB 1I1FB 4ZFOB 3B2MA 1MCOH 3R0MA 3SO5A 1V3MA 4WJKB 4LVHB 1D2PA 4J3OF 5GHWH 2AJXH 2EIDA 4BFFA 4M00A 4G6FD 1J9CT 4U3SA 1LEGA 2D7TH 1RPKA 5L2KA 1VPOH 1TJMA 2OMTA 5ISZB 4OR1A 3BP5B 1OK8A 2WXGA 3L1OH 1DQJA 4PCTA 3RL2B 2VLKA 5GGSA 1G9ML 5D70L 2DWYA 4TLKA 3QDGA 3JZYA 1IV8A 3H9HB 4V11A 5GRUL 4KXCA 2BDNL 3D9AH 3OAYK 1KIRA 3LYRA 2EDXA 3P02A 2WD0A 2ADGB 4ZX3A 1CGTA 3C2AL 4U1IA 5DJ0B 5E8DL 1X7QA 5M7QA 4KK5D 4AZ8B 4KDTA 3NCFB 5I1IH 1HSAA 4JM4L 5CJOL 3FU3A 4Y5YC 1D5ZA 3ZTNH 2V2TB 2Z3FA 35C8H 3FSAA 4WI3A 1YPZF 3D3VD 4M7JH 4WWKD 4HJ0D 3L5IA 4W9HC 3BH4A 2YA2A 4PRHA 2HP4A 3DVNB 2DN7A 3BZDA 3BE1L 4UAOC 3KPMB 4POUB 1IJNA 1YHPA 4NUJB 2FWUA 4OUOA 1R6VA 1T0MB 2HN7A 3GI9H 3BN3B 3TJHC 3WHE1 3ZHKA 3ZTEA 2XLLA 3DMMB 2LAAA 2UZIL 4WWKA 1QNZL 1HEJC 4JVWA 1FVEB 1PZ5B 3RGVB 4BXVA 5GGQL 1HESA 3LN5B 4TUUA 3FQ4A 1V27A 2QSVA 3DI3B 1BX2B 1JERA 3R4RA 3DURA 2F1BA 1KEML 1GYWA 3T6XA 1K3ZA 3WY4A 4RZCA 1J1PH 4B7LA 1HKLH 1N8ZB 1YEWA 3P4OB 3RNQA 1BEYH 5DWUH 1NZRA 3SD5A 1UKTA 4WTZA 2M8XA 4DKFH 3F01A 1AY1L 1BV8A 2XXFA 2EXYC 3ARDB 4UAOB 1A4AA 5I8KL 4FLRA 1U3JA 3GXTA 3RIFK 2V5RA 1L6XA 1BZEA 5GJSH 2COVD 4DVRH 4X8XA 1U95B 2NLJA 2X6BA 5GS0L 4Z7QE 1J1XL 1FJ1B 3SPGA 3VM5A 1JV2A 5KSBB 1LTXA 3A4EA 4UT7H 2EYRB 5I6XB 4NQED 1JRHI 2IXQB 1C08B 3SOBH 3EYUL 4OT1L 1BYNA 2X0VA 3DX7A 3ULSA 3II3A 2Z4TA 5KANG 3BP4B 3QFJB 1O5DT 3AXLA 4JFDE 2J8UB 4CADB 2NX5E 2AQTA 3NSFA 4MDJA 1DL7H 2HFTA 3GYRA 1NFKA 1KCBA 3KPLB 2X70B 3A4FA 3ZDZF 5LNEA 2DQDL 3CHSA 2WXKA 2PN5A 4M5YL 3T65A 1RUQH 3CVHA 1GZQA 2Z31C 4NQTA 1B90A 4CJ1A 5I2IB 3CJJA 2NY2D 2HJKA 4LIQH 2HT4D 3MGOA 5FFGA 4XP4L 4JPQA 1EK3A 2D3LA 1UJ3A 4LZKA 3OAUL 3EO0B 1CO1A 3JWNH 3M88A 3NJIA 4OD3H 1DLFL 3OXRA 2FUQA 1DSFL 4NQCD 3M86A 5DZVA 2WSDA 3V4VB 2BP3A 2VDQH 4QGYA 3ARQA 3R19A 2X09A 1G6RB 2BSSA 4PJDF 3WXVH 5L0QC 2XWRA 1C5CH 4WJ5B 3VUAA 2VR8A 5A2LH 5JW4N 2FTAA 3G6JB 2EDWA 2V8MA 4PY7B 1NCCH 4TNVK 4RMBA 3CMGA 4XPHL 5BRZD 4AC4A 1JHLH 1AMYA 4DAGH 4OFVA 2ZYSA 3CFJA 4X7TA 5C08E 1RURL 1E4WL 1EZVY 2DLEA 2VZTA 1SOXA 4EXPX 1MI5D 1S46A 1QQDA 5K93A 1SUHA 1U93B 2IAMC 3JTBA 4HK0B 1MCLA 4MD0A 2CR0A 2DQFB 3SJVE 1L9QA 4M1DL 3SDYL 4F58L 2AXFB 1H3XA 1ZMYA 3FONB 2AEIT 2EZ0D 4Q4IA 5D1XE 4YWGH 3SKJH 4N26A 3VXPB 5EDSA 2PCPA 5I75B 4M6AA 1VJSA 2P9RA 2VW7A 1Q9LB 3MX0B 5LDSA 1UWGH 1SF5A 1A3ZA 3QRGH 4NKMB 4U2ZA 4A1RA 1N6QL 4B3EA 2AF2A 3H9YA 4HJJL 4QXVA 1OZUA 3HAEH 1DVQA 3B5HA 2IH8A 1Y0LA 3QQDB 3VI4B 1NINA 3FNKA 4E5XB 1ZV9A 3GSNL 3CFDB 5MERB 2CKBA 2VR5A 3MRLB 3NACL 3TBVA 1VSCA 3K2IA 3SDCC 1FV1A 3TC9A 3PWJB 4RMWA 2E8ZA 2HJLA 2LR4A 5IREA 2VLKD 4YSCA 2WNXA 1KXHA 3GXUB 3O41B 4RVBA 2Q5BA 2H32B 3NSDA 2XZQH 2C3GA 4JHAH 2BK8A 2Y7QB 2KI6A 3I2CL 4LSRL 3QJFB 4C56E 2YPVL 4FG2A 4RDQF 2CO2A 4EBQL 1ZE3H 5JORA 4ZO6A 3VWJB 4RH4A 4TVPL 4JGJA 4CU8A 4FLQA 2AW2A 5I6MA 1PX3A 1ZJAA 5D1ZA 3MPCA 2DJUA 2YN5A 4PJXE 2PXYB 1NFDA 1K9TA 4ZD3L 3SQOH 4LLWA 1H5BB 25C8L 5B1JC 1G9NL 2HWZL 4JPVH 3FK3A 3BIKB 4KV5E 3QUYD 1RK0B 1O0VA 5HHXH 3IFNL 1AJ7L 4Y2OB 1S5HB 5BXFB 5DR5L 2GVYA 4GAGH 3ECBB 2WNWA 3R0NA 1GRWA 4RSYA 4XBGB 4FL4B 2IAND 2XETA 4NRXA 3F65A 4JHVA 3FQXA 4GRWB 5TE6H 1YYML 3TXAA 2AKRA 3FPYA 3MLTA 4NNPL 1MRFL 2GBVA 4PJ7A 5BZDA 1LHZA 2YSSA 4GS7C 1DBAH 2MH4A 3AT9A 3LNDA 4WW1B 1R5VA 4ANWA 4KRPB 1SPDA 2Q7NA 3LPOA 5EHFA 4ELMB 3OG6B 1EGJA 1ZS2A 3GJFB 3GSOA 3HC4L 4LL4A 1LO5A 1R33A 4IHOB 3S5LB 1FFNA 3HHSB 1TENA 1UA6L 1NPJA 1QHOA 2JQMA 1U8CA 4RDBA 4OZIE 2ZNWA 4QOKE 3LXBA 2VDPL 2OJ1A 5IHUL 1JGLL 4ODVL 1AOZA 1A7QL 4CGUB 2TSAA 3CZSA 3LQAH 2OJEA 3HHSA 4AQEA 1JBJA 1KENH 1KELH 5DT1H 5ID1A 4YBLB 3V52L 1J1PL 1F97A 4XCFH 1QO3A 1RJLB 4RRPM 1J5IA 2XJLA 1P7QB 4N2LA 3SBWA 5CBAA 4LP8A 1AFVL 1FJ1A 4HXBH 1NMBH 9PCYA 2R23B 1KCLA 1HNGA 3QQ9D 3BRGC 4HUXB 3ZQXA 3HUJB 2QADB 3HS0A 4JFFD 3LRLA 1IL1B 3RX8A 2KZWA 2P5ED 5ID0A 3WEXB 2KLTA 4KZCA 4KJQC 1OW0C 4GQQA 4MA7L 3QDJE 1YPZE 3RUGB 4B7IA 2E75C 3JWOC 2QPSA 2G4EA 3N1GC 5IVXA 4HQQH 4RNRA 3HI1A 1OP3K 4UIKL 3S97C 2FEJA 3STBA 1WBZA 1D6EB 3FJTA 4Z9KB 4ORZC 4BKLA 4U6HB 4WFGD 4KVNH 3UAAA 4I1NB 4I9WE 4OM1H 3U7WL 2VXTH 3E80A 4AYID 2WBKA 5F70A 3C2AH 1SHXA 1KB5L 5FCUH 1NOAA 2BJMH 4P2QD 3RJDA 3T4YB 4ETQA 3OB0H 3FUFA 2IAMA 1CXKA 2B8OT 3E6FA 3MBEB 1RUML 2WANA 4W6XB 4TS6A 5E00B 1QUNA 4JY4B 4ODUB 1QFWI 1ZHKB 3JWNE 2Z8SA 3CHOA 5EOTB 4OFDA 3CH8A 5EH1A 2O6PA 3CX2A 3VD1A 1QWHA 4PRBB 2F8OA 4N6QA 1P5UC 1MQ8A 4JQXC 3ISWA 1NLDL 3C6EA 5GRXG 3SDXE 2AJZA 3FULA 3UO1H 3K91A 1X5ZA 4Z7WA 4GW5A 1B0IA 5I17B 1U3HB 1DEDA 3GSRA 1N64L 3X1EA 2P49B 2EIEA 1QNIA 2MJWA 4QXTB 4Y4HC 4XMVA 5FWQA 4ADGA 1J8HB 4YHPA 2HX8A 5BO1L 4K23L 2XV3A 4N8VG 5HGBA 4BCZA 1CURA 2FWLB 4YDKH 5JW4Q 1DE4B 5JUEH 2DM2A 1KZYA 2DL9A 4J8RA 4OFQA 4XP9H 3L4YA 4PJ5B 3BIAX 2C7UB 5D9SB 4XBGA 1QOKA 1A1MB 4R3SA 1DSWA 1YEDB 1WISA 5AB0A 5CP7B 2AK1L 1ZT4A 4R97C 4ZRGA 1BXAA 3UPRB 3EH3B 1YEHL 5F9DC 3HG1A 4A7GF 4AIOA 2ED7A 2P8MA 5GS1C 2Z8WC 4DO4A 2YN3A 5KS9E 3FRPB 3QRGL 1EQWA 5D8JL 4TQEH 4HD9A 1NFDB 4MAUL 1GIGL 3KPQB 1NPUA 2Z93A 3O2WH 4ADJA 4F15C 1LWRA 1X44A 3P9WB 1ZV2A 1IEAB 1CU4H 1XL4A 2F18A 2PXYC 5EU6A 2VM3A 2X6VA 2Y7SA 1F41A 2FATH 2D9QB 4BV1A 4WFHE 3OKKB 4XCEB 3ZT7A 4XNMA 2TRHA 1ZA6A 4QTHB 5PAZA 4AQEB 5ESVB 2XUWA 3WFBH 3B7UX 4NQXB 5I8CB 3LHPH 4KZEH 5DHYA 2K6ZA 1XH1A 4M5YH 5K9OA 3ARFC 4Y2LA 4A2LA 4YO0A 4FL4C 4GO6B 3VAEA 3ARGA 2XRAH 5CM1A 2C4FU 3T0AA 5DHEA 4MB1A 2ZWYA 5BUPA 1UB5B 3UZQA 3L5WA 1EEYA 1XD0A 2EKSA 1NDGA 4HCRH 4K5OA 3NFNA 3KPRB 5F7FA 1KUMA 4XCNA 1QHQA 1I9JL 5JW3H 5IUCA 5K9QG 3PWUB 4AI7A 3UTOA 3ZZ1A 1H8OA 3UBHA 4JMXA 1B2YA 3IGFA 4ZUUB 2R51A 3B2VH 1TQTA 3CN3A 4WWPA 3HVDA 2WINB 4K8RC 5JXEC 3BZEA 3FT4A 2CG9X 3WFDH 1G9NH 2HWZH 1GKEA 5DYOB 2IALB 2V7HB 3SGDH 5IQ9B 5HJ3B 1BFVH 1SOQA 1T20B 1YEJL 5D7LE 3L5XL 3DX3A 3GSXA 8FABA 1F56A 5FYLH 5HHNB 1I3RB 4OTXL 4BWUA 3NFSH 5EDXA 2A9ML 3DUSA 5J5EA 1BEXA 3RIFF 4OZGB 1ETB1 2IAMB 4KJPD 3F58H 2X87A 4X6DA 3O3AA 3OKEB 2CGZA 4GEIA 1EO8L 3ET9F 3GSVB 5B3JE 1BECA 1RK1A 4FLOA 4PJFB 3GMQB 2ORBL 1S8DA 3QDAA 1O6TA 3ZKMD 4EIGB 5FM4A 3IFOB 3H8NA 1CDGA 4RAVB 5F1IB 1J48A 3IT8D 1XIWA 1NFDE 1SEBB 3TBSB 1N2RB 4LOVA 3Q6GH 3CIAA 3RKDC 1OW0A 5IF0A 2Q7YB 2WOYA 1ZRUA 1UCBL 1KCSL 1M05B 4TLUA 2EVFA 4XVJH 1P4LB 4GMTL 4NIYE 5F9JA 2CSPA 4BQ9A 3QUML 2BP8B 4HC1L 4YEFA 3LIZL 3MGOB 4QIRA 1PQZA 3NH7H 4PV8B 1E4JA 5DJ8A 1OAKL 5LAXB 3WJLA 3H3PL 3WSQL 4XMZA 4H5SA 1S6NA 2GTZA 5F72S 3WKPA 3PJLA 2HKFL 4AL8H 4X6CB 4YL9A 1FE8H 5J6SA 4ZTOL 1FPTH 2JIXA 4NNXA 4KXDA 3O11A 2BNRA 1ZVSB 2IH1B 4X6BA 1HEZA 1RUAH 5LWYH 1EFXA 4HCIA 1LP9E 3VI4E 1JG9A 2C34A 1OGAA 2X0WA 1PLAA 3IGKA 2FX8H 5E24E 4FJZA 3S3PA 1AR2A 2VLRD 1P7HL 4QOKA 2J8UF 2GY5A 3C60D 2CBQA 1JV5A 5HDQH 3T77A 1A3RH 3K1DA 4PMEA 2V9QA 2I9TA 1P84J 3VSUA 2YBRB 1LEGB 1CE1L 3SYOA 2J71A 5LGYA 5HHQA 4KUZL 2DQUL 3F7KA 2CIKA 2X40A 1RZ7H 1EEZB 1UFGA 2IH3A 3IXTA 4UWQB 4ZUWB 4R2GB 1AZVA 1M71A 2ZX7A 1J0JA 1ZSDA 2A74B 2N1TE 4QTFA 5ESVA 3F7YB 2Y2YA 4C58B 4IDJL 2Z91A 2HG5A 5D7IF 2YGVA 3GBEA 4HZLA 4L37A 3WU1A 3P4NB 2PR9A 3MV7D 3B3IA 5KVGH 1T22A 2R15A 1CICC 4IS6B 3G6JE 1WQVT 3EOTL 3QFDB 3ZDZE 1E9QB 3BAKA 4HFWA 2H1PH 3NDYE 3GUFA 5E6ZA 4ZMWA 2Z91B 1Y1DA 4TUJB 1MCCA 4G6AD 4P2OC 2KPWA 4XO8A 3QJVB 2KERA 4FNTA 1AQHA 1QR1B 5CGYC 2XDHA 3B5GA 1AZCA 5BNXD 5IV2A 4LRIA 5HYIA 1OLZA 3RA7H 5KAQF 2D9CA 1U2CA 5HGDA 4G9DB 3B7TA 3GMMB 3S36L 3B9KA 5C2BH 1XGQB 2V2WA 1KXVA 1RKRA 1LGVA 1M56B 3ZHFA 4ZD3H 1JV2B 5IWLA 2YA1A 4KXBA 1EJFA 3QJHB 1WP6A 3WN5A 3PNWB 1FL3A 3HN3A 3FHAA 5IJVB 3TESA 3CX5J 2JKLA 2NY4C 5DYFA 4NZRL 2CMRL 2I07B 3V0EA 1MLCB 3ZDYF 4HWEH 3QQNA 4GSDL 5D1QA 2O72A 1YEEL 2ZWLT 2J6EA 2VRQA 2DWSA 2IDSA 4TLTA 2I5YL 1IAIM 5AVXB 4KKRA 2DEXX 3ZHDA 4DGUA 5DHXB 4B5ZA 5KOMC 2IV8A 4R96B 4HOXA 2OR9L 1MW0A 3DUHA 3FN0H 1T2QH 3V4PL 3G3LA 4Z76B 1JP5A 3R4DA 4FQIL 5MEPB 3RWFB 3SHSA 4KVCH 2X1WL 4L3CB 5LBVA 1YSOA 3IJEB 4LARL 3FSOA 2WXIA 5EA0L 3BEVB 1IBDA 4KJWD 1ORSA 3MNVB 4GRWE 3U1SL 3LSOB 4Q6IB 2WO2B 1TZOA 3UBFA 4EKXA 4I0PB 2PYEA 3ZT6A 4N2CA 1R24A 1W9XA 4ACTA 4MTMA 1OCRB 3IJ7A 4NBYB 5AVRB 4IKNA 4M9PA 3QJZA 3TT1H 3ILDA 3BAEL 1GPOH 1N5AA 2ZD0A 1HFUA 3HI6L 5F1KC 1IC4L 1MIEH 3U4KA 1RZIA 3GKZA 4JO4H 5EOCJ 5IJBC 5DQJB 3ZDYB 4WEBH 5DDHA 1BM3L 3NZUA 2LTQB 3DRQA 3BPOC 3IMTA 1J0ZA 4QY8A 1MHCA 2CQVA 4NRZA 5D2LA 5E95B 5BO1H 3C6SB 2J21A 2DPKA 5DJDB 3ZTCC 4A2HA 1EEQA 4KO7A 3IJYA 3S88L 2PETA 2EDDA 1U4EA 4GQ9H 4FQQB 4PJFF 3WELA 1WIOA 3NFPB 4AK1A 4D0CB 5E2WH 3OXSA 4E9WA 1OB1B 1JZDC 5FYJH 4FQCL 2AVGA 2WSKA 1OAYL 4AM0A 4DP1X 1NMCB 3LRSA 3AFLA 3DV4B 2UZPA 3NCEB 4J3BA 1PYWA 2L7QA 4NXSA 4ORGA 3AGWA 4OZGF 5FYKH 3T8XA 4L1SA 5AENA 5GS0D 1A7PL 3ESUF 1KTKE 4PRIA 4HUUB 5L8KB 3GXMA 1CFVL 2CUAA 2YD1A 3SDDA 3A6OA 1JZ2A 1KB5H 3DK2A 3VFMA 4IHBA 1F18A 2YAQA 3C75A 5D7JB 2EIZB 4BK4A 3VFGH 2FH8A 2XJKA 3T6VA 3K71A 2XKNA 4AIZB 1U8JA 4X0KB 4GMTH 2LLGA 3WFBL 1MWAA 3BRFA 2AP2A 3QUMH 1B0RA 5IIEA 3PCYA 5IFJB 4I1RA 4DTGL 1O6VA 3IMBA 3QEQB 1IBGH 3BSHA 2A9AA 3MV9D 1P1ZA 2OS7A 3EO9L 1D5IH 1NLDH 4X6DE 5F7NC 4ZFZA 3UO1L 4PGJA 5C0EB 2FYVA 3Q7JA 4XVSH 4F8LA 5I28A 3PYCA 1KNOA 3QI9D 1OAXH 2B59A 1IKNA 4I2XB 2YRBA 1M2OA 1FN4B 3QIWD 2BNQE 4K23H 4NGHL 4PJ5D 3U6RB 2VQTA 5GIRB 4HHAA 1WWAX 3FCSB 4I9XA 1MXGA 4WVRA 3V6BR 5JUEL 3ZBMA 1FGNL 2MPAL 3MNMA 2D7TL 3T3PB 1T0MA 4G42B 4JMNA 4LVNB 2MQ3A 3M6DA 4FI7A 4L3CA 3KJ6L 3CFUA 3BWAA 1S5IH 4Y9EA 1LEKA 1SFDA 3WDHA 5KYYB 5DJ2B 1DE4A 5CGMA 5IOKA 4Y4HD 3P2BA 1OP4A 3QDGD 5C0AD 4DP9X 3VYNA 3WFEH 4Q6IA 1NWPA 5IUSA 1YQ2A 2GTWA 1CE1H 4WWNA 4Z18A 1CLYL 1FNLA 4XNAA 1HK6A 3NAAL 3QHTC 4MKMA 2XZZA 3EH1A 4HSCX 4LSTH 5BVPH 3SE8L 4WI0A 1H3UA 3B7SA 2C3HA 2NX5B 4G6FB 5F7LB 5ALBL 1MJ7L 1NCIA 5CEZD 2QKIA 2WQVA 1U95A 2H3NB 1F3RB 2XPGB 3RIAF 3OAZH 4MWFA 4Y9CA 2XN9E 2VMDA 4NAJA 4ZPTA 2XWBA 2UZYA 1V7NH 3D25B 4WI0B 1QTPA 4RSVA 5IBLC 5E4OA 3TIEB 3U1QA 1V54B 2AZAA 5CLTA 3VWKD 1E9PB 2HFGL 3GMMA 2K4AA 4FYQA 5E1IA 4AQ1B 1XH3A 5FGRA 4BSVA 1BX2A 4G6ML 3EYSL 1Q0XL 5IB2A 4WAFA 2ZPKH 4PB0H 1CD1A 5ABAA 2UZYB 3UBXB 2NY1C 4MJ6A 4G8FB 5LCVH 3P4MA 3MREA 5CHNB 5DJAA 2F7OA 4L9LB 4G6KH 3MJGX 4OLYL 4OKDA 4JM2B 1EUUA 4LOUC 3FTGA 3B6SA 3BVWA 3L4ZA 3EBIA 43CAB 1F86A 3MBWB 1P4BH 4U0RC 2I9LA 5F88A 4URKA 2ZWNA 2QGCA 1TZAA 4MQXD 4HOMA 1WUNT 4CC4C 5IVXF 2YEZB 3DROA 1QRNE 4KJWC 4PSRA 3X17A 4Y1AA 1M7IA 3IFLL 1P7QD 5I0ZA 1RZFH 1Q1PA 2OA9A 4UTAA 5GS0H 2KL6A 5HJ3A 1QSEA 3P3TA 1MCRA 4KTEH 3MRIA 3QDME 1U0QA 1W6WA 4PW9A 5T1MA 2XPZA 3LXUX 1HL8A 1NCAH 2F5AH 1JGUL 5AAPA 1XTMA 1IL1A 1VCBC 4WV1A 4AENB 1GXEA 5DZ9A 1TUPA 1GJUA 5DJXB 3VFNA 1RJZB 5FYKD 3O4LD 5F1SA 2ZXEB 3QUZD 5C0FA 2WIIA 1HI6A 1IBZA 2WYZA 4X7FC 4AE0A 3E6HA 1AP2B 5CEXB 4XPFH 2NY6B 3MV9B 4Q4EA 2VDPB 1E27A 2W60A 3FFOA 3OJMB 3W57A 5EBWA 5FF6B 2W0FA 4N2AA 2FH6A 3VU2A 5C0BA 2Y6SD 1CPUA 1A9VA 1ZK9A 4WF7A 2HX7A 1UM4H 2WUBL 4H1LG 5IB3B 2P46B 4ETQB 3LMJL 1OK0A 2SEBB 4XBPA 5E5MB 3M1BB 3SBQA 3TBWA 3IU4H 5EBWB 5JO5B 4E5XG 5IR1A 4YDLB 4FD0A 4JHWH 1QNZH 5DO2C 4U7MA 2EIZA 4TRPL 3ML9A 2FNBA 3V0GA 3FQWA 2EZ0C 2R1WB 4PJ7F 2LLLA 4HJIA 4PJHE 3MRLA 3OHMB 4A7TA 4P59H 3MV7A 4PI0A 5CCGE 5D6CA 4ZSOB 5TFSL 1XEDA 4APXA 2A38A 3S7GA 4MYPA 1E8XA 3VCLA 5BZZA 3P11H 3DV4A 4QO1B 3KBFA 3QEGL 5DHVH 2GJ6E 5GS2H 3RP1A 1YN6A 3UTQB 1FQ9C 3M17A 4KHTL 3H54A 4JFED 2F8XC 4U2YA 4IMKA 1GGUA 3LRKA 4NI3A 1KFAH 2QFPA 2FX9L 2BDNH 3AITA 1I1CA 3O45A 4PGCB 1SN2A 3PXHA 3HTLX 4U0QB 1ZWIB 1G9HA 3INOA 1JJUA 3PHAA 1ED3B 1I7UA 2OBGA 2ZX8A 1YAIA 5ACMA 4IEFB 2G9HB 4KQ3H 3P9LB 3W81A 4G72B 1WVZA 5T1LB 3DIDA 4IIZA 2YC1B 2P45B 1DVFA 2JLPA 1DUZA 3I3EA 1DL7L 3KD4A 5J1AA 1PAZA 3ULUH 1HDMB 4ERSH 5MHSE 2UYLA 4AVJA 2GEQA 4LSQL 2D03H 4NCC1 5GRJL 3O81A 4G7YH 1N0LB 2NYKA 1Q72H 2XFXB 4AQOA 2IANE 5IBLD 2VDKL 5KVFL 1AXSA 1AGEB 4XOAA 3SJVA 4U7SA 1B3IA 2ZUTA 3IE9A 5M95B 3D8MA 3OPZH 4NX0A 2CCLA 5J06A 3QO0B 1MCKA 5EZPA 5CZVL 4HBCH 1BJ1J 1FLRH 1CD0A 1DSFH 4Z77B 2GBUA 4H8HA 3MUGB 2QR0B 3RWJA 2AFNA 4I4WA 4N5ED 5DEGA 1QBMH 4FDWA 4X4XA 4UT6A 4L8DB 5FW8A 3MV9E 4HW6A 4NZTH 2XQ0A 3W39A 1JF1B 2R0ZH 4K3JH 1JAEA 1YVLA 2Z7ZA 2V5SA 1P53A 1BZ9A 1XHHA 3MYZA 3QPQC 4NRXB 4D9QD 5EU6D 5FEBA 1FZKA 4E0RB 3MV7E 3IFNH 4JHBA 4YQXH 1Q9LA 1TDQA 2J5LC 1J1XH 5DRXA 5FYKU 3TWYA 2DQTL 4PJEB 3K1KC 4GP8B 4ZS6C 3D3VE 1QLFB 1BVNP 1ZHNA 4P46C 5IJDC 1BBJA 2F5BL 1E28B 1E3ZA 1MJUH 1OD9A 1BIIB 2VXVH 2XHNA 2F53A 1DHKA 5I1GL 4MCNA 4MNHA 3MBWA 1MEXH 1K3IA 5IB1A 4IKLA 1SLWA 5T1DH 3MCYA 1F4AA 6TAAA 2LHAA 3NT0A 3I50H 3DX8B 4EI6B 1N6QH 1TSHA 1C1EL 3IDJB 1OAZH 4X6FA 3SO3B 1KCVL 1LJMA 2BIMA 2B4CC 3SO3C 2WWMD 4KITB 3IDGB 1SYSB 2DD8L 2FEEI 4Q8BA 2KS0A 2CD0A 5JPMB 2D31A 4D2NA 3WYRA 3N41F 2VXQH 5FO8B 3WGVB 3EXLA 3MV7B 3DBXB 1QAWA 1Q0XH 1ODAA 4NI6A 2IANA 5A2BA 1BCIA 4I0PA 4OF8A 2BSCA 4PR5B 5AWNH 1PD6A 4QXUH 5IB4A 5I1EL 4IBUA 5E7BA 4JAMA 5E8PA 1A4KA 5LGJB 4XVSL 1DN0B 1VB9A 1RD6A 1HXKA 1PCXA 1MF2L 1OSPH 4HUWB 1S7TB 4OZFH 2ATKB 5CSZB 5ECJE 3WJJA 3F5WA 5CIPB 4MD5B 1P4IL 1U36A 1T4KA 1SYVB 2VZ1A 5DRWA 1XZ0A 4FEIA 4HH9B 1U91B 1OGPA 4Z78B 1TU2A 1RULL 3H9SB 4JBSA 5BZWA 3PF2A 3JTTA 4PBVC 4WEEA 1I7TB 4HIXH 1KCKA 3JV6B 4RRPA 5KW9H 1QW8A 2L7UA 5C0FB 1AR1B 4FXTA 1TKWA 2FIRT 1F4YL 3CLWA 5LAPA 2JTYA 1MPAL 3N1MC 3KNBA 3WUZA 1AD9A 4RWYL 3CDZB 2EUZA 1TQSA 1GTNA 2ESVA 2FYYA 3QJXA 2XQYK 3DDGA 4ANUA 4WCYH 2CRYA 3X2QB 5E0FA 3FQTA 4FHKA 2QDWA 3H7BB 4JFFE 4A6YL 1CGUA 3CSPA 4QO1A 3CFTA 4YDMA 4L8CA 1RVFH 3HI1B 5BUAA 2Q6WA 4UB0L 1CLZH 3IPBA 4JUTA 3AG1B 1UD3A 1W2KT 3HZKA 1WF5A 5IQLA 2GJ6B 3NN8A 5AD0A 4Z7WB 1QR4A 3WI9A 2DMGA 1TQBB 4PS7A 2KZBA 2HTKC 4I0KA 5KVFE 1TLMA 1N6UA 5SWSD 3KPSA 1AS6A 4F91B 1F6LL 3HHRB 1UXMA 3O9WC 4LPYA 5MEND 5HDLA 2OL3L 3V2AR 4TNEA 1U8LA 4C55A 1EERB 3U48A 4AVKA 3NIDE 3QIBC 1E8WA 5CCKL 1XL6A 2GJZA 2IDCA 3ZQWA 3IAGC 1SQ2N 5DUMH 3QAQA 2F7QA 1CLOH 3LIUA 4OD1H 5J56B 2VR7A 3I9IA 5CIPH 1FGNH 3UTPE 1BQUA 4GKZB 4YDKL 4BQ6A 3DWTA 4IW4C 2IAMD 3H1ZA 4PJFA 4OFKA 4ONOA 2VXUL 1FIGH 3W0WD 1FH2A 5J6HA 5IEKB 3PG2A 2WXHA 1A6TA 1TITA 4WDIA 2KZKA 3WFEL 2YJLA 5EU3A 4EIUA 2E5EA 4G7VH 1C16B 4AIXA 4F7EB 3WN5B 2ROXA 5D8JH 2ITCA 1NC4B 3W0WA 4MAUH 1PLGH 3WJMA 4N0RA 4AMKL 4MJ4A 4R4BA 2NY0B 3DJRA 1G7QB 5D2LF 5IQ9A 2I69A 2RBLA 1OXYA 4RMSA 2VLMD 5E2UL 3IN2A 5FAAA 4XNZC 5EU4A 1SXNA 1UGNA 3S37H 4HPOH 3SDCD 5SWZD 1TZIB 4ZFOL 3F6IA 4JN1L 4CMMB 2QDVA 1NEPA 3MO1B 4IGBB 4KGJA 2GBTA 5HYEA 1V7NL 1TCMA 3SBPA 5I1DA 1B4JH 5AVVB 5LXGL 4KKBC 4PGBA 4WI2A 4Q9RL 1WLHA 5FGCE 1HJCA 1FL5A 2WBJC 1GJIA 2FECI 4NN6B 2EQDA 4YVNA 4XX1E 2J6WA 1CFTB 2KPNA 1LVEA 2MWCA 2FO4A 5EIIG 2ZKHL 4QRBA 2YA0A 2AJVH 2X1OA 2K45A 4BSVB 2YPLD 2XX0A 4PFEA 3OAWA 4KKPA 4R0LA 2BRRH 1K8DA 3VRLF 3VWKC 4YDJB 2KLRA 3K4AA 5KBDA 4UDTA 5DQDL 3V0IA 2X4UA 3MFFA 2CK2A 5E94B 4IOFC 2VLME 3BWUF 4M1CC 1CCZA 5EWIH 4AM0Q 4Y19E 2WTRA 1FH5H 4NKMA 3LNFA 5SV4A 1JNHB 3LEXB 3L7FB 4CVXA 4KHTH 4N2IA 4HXAL 3V5KA 1F0LA 2YQBA 2FO8A 2FX9H 5BCAA 2R39A 1RPUA 4WUUA 4NZ8A 4JCMA 3U2JA 5DJZB 2WUCH 3L3IB 3OXSB 4Q14A 4A68A 1YMHB 4Q52A 2BJML 2CDEB 3L2MA 3GDCA 4P2RE 2A6KA 2H0EA 4KMQA 3NSYA 1ETA1 1L0XA 3L5WB 4F7TB 2MIZA 4NWUL 3QEUB 4G3YL 4XP6L 3QUKB 1R3JB 2YD2A 5IB4B 3T0DA 1D6VH 2A6DA 3QJFA 4GSQA 2P8LA 5TTRA 4MNGA 3FSVA 4BKTC 1T66D 3D05A 1KGIA 2OTUA 3MGAA 1WBYB 4N0UB 1PG7W 4LGSB 2YMOA 4KQ4H 5C0CE 3F62A 3M45A 5ILTH 2WB1A 3VQ2C 4PN6A 3JVFC 5JXAH 2B14A 3OR7B 4OCXH 4Z7AA 5JHLA 5ITFB 3QGVA 1NM9A 1JTOA 3L6FA 3OZKA 1CS6A 4DF9A 2H26B 1ECZA 1TPXB 1DUYB 4C4UA 4F7PA 4FERA 4YGVA 5AL0A 5JMRA 2WQXA 1MFEH 3L48A 3QXUA 1X5XA 4X6DB 1O6SB 5EC1B 1SJVA 4M3JA 5EUKB 5EEYA 3WFDL 4U1GB 2ADJB 3AU1B 4XAKD 5JOPD 5DGQA 3SYQA 2MNUA 2FJHB 1ROCA 1ZT4B 1BD2D 3UC0L 2F54D 2J12B 3CVCA 4N24A 5CU5A 5PCYA 1F4YH 3BEWA 1YDPB 1A3RL 3DPBA 3T0EE 1MPAH 2R29L 2EVGA 2EC8A 3MI6A 5F9WB 2APBA 4QRRE 1NCBL 1LLAA 2QTVA 3BKCH 3PWPE 2W88A 3GIVA 4OI9A 4QRPA 3G5YB 4BKSC 3ZZLA 3AADB 2WQUA 4AQ1C 5KBLA 3QUZB 4U1LA 5EPMA 2R0WH 1G6RL 2Y1YA 2HLFD 1RZGB 5D1XA 4WSJA 3FS9A 2FATL 1H3GA 4KK5C 3MRQA 3PHOB 4L2YA 4N6RB 2CLZB 4BELD 4N5EC 2P1YA 3EOBB 2JB5H 5KJRH 4JHZA 4AYFB 1CQYA 1ZXKA 4F57H 4F7EA 1MHEA 3RWEB 1NJ9A 1OARH 1W72H 1OM3H 4M4RA 2EICA 4GPVA 1ETZB 5KVFH 1GCFA 2B4CH 4IBYA 3ZHNA 4PVNA 1UCBH 2EDQA 2FO4B 4DVBA 3U9PH 4OZHF 3RPKA 4Z3GA 2XFXA 1UWXK 2VISA 4HC1H 1N2RA 1J05A 4DKEH 1XR9A 3BVVA 5DFWH 4NOFA 1N4XH 4XN1A 1ZANL 1I9JH 4L1LA 5JW3L 4JDTH 5KWYC 4K7PX 5IKCA 4LQFH 4OCSL 1Q0YH 1EJOH 3JV4A 5D1XC 1A6UL 3TBYB 1CT8A 4H8UA 2NY0D 5CSBA 2UVEA 3VQLA 3WMPA 2FT6A 3UPAA 5A2JH 2ZOOA 3EOYG 4OVVA 4K15A 3CSYB 2I60L 4MBOA 3DMMA 2IC2A 2JQAA 4PCSA 2HTLC 3KWUA 1L6PA 3VWKB 5EEXA 1KLUB 1A02N 4PJIE 4K07A 5I66B 3KYOA 5T1JA 3L3JB 3QSKB 4UQIM 2W92A 3HBQA 4MCZA 3LS5L 5GSVA 4XVTL 2QQLL 3ABZA 3MJ9H 1TZ8A 2C4XA 4JEGB 4ZOBA 1DZBA 3ABLB 1PLGL 5EU4B 4H8WC 3MXWH 4PJGA 4YFLI 5TD4A 4A2FA 3H9ZA 3TOPA 3OKYA 4NQEA 5EC2B 3IJ8A 1T2QL 4LEXL 1D2OA 1M7DB 4JJ5B 2EDMA 5L7XH 1Z0MA 3VWJD 3FT3B 2VDNL 1USQA 3V8CA 5KBNC 3V7AG 2CLVA 1PAMA 3MSPA 2HFEA 5F21B 3FO9B 3PDDA 2XA8H 4N8VB 3U1SH 3QDGB 5HPOA 3PGCA 4AOFA 2R0KL 4HHGA 4LSPH 4NJ9H 4E41B 3M1BA 2R69L 3MLPA 2BY3A 4UB0H 3QARA 3CBRA 3VA6A 2A9BA 3VFOB 4WY7H 3OB8A 4Q9CA 3AXLB 3N42B 4F27A 2BSED 5JHDA 5MEOA 1GPOL 1EAOA 1MJJA 4KTDL 5FK9A 3ISRA 1JXGA 1AE6L 1WITA 1MCPL 1KXTA 1T03L 5DJ6A 2P80A 2YHGA 1AZZC 2B5IC 4HFUH 2E6JA 3PWPB 1BM3H 1T3FA 1UJ3C 4ZTEA 2HRHA 3ESVF 3I3DA 2EYTB 2JELH 3VU1A 3T0EB 1NGYA 1MCOL 1QPKA 2ZQKA 2E9WA 2ZNXA 1VENA 4LPXA 2PYFB 2KUTA 1VEMA 5TF1L 1OCWH