1TO5A

Structure of the cytosolic cu,zn sod from s. mansoni
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
GSNMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGLAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Structure of the cytosolic Cu,Zn superoxide dismutase from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 44
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1to5A00
1HL5A 2Z7UA 1IB5A 1SDAB 1YAZA 4BCZA 1SXAA 1E9QA 1N19A 1IBFA 1SPDA 2AQSA 3CQPA 4MCMA 1SRDA 1Z9PA 4BCYA 2V0AA 3K91A 2Q2LA 1XTMA 2ZKXA 1PZSA 3L9YA 4A7VA 1SXZA 1QUPA 1SXNA 3HFFA 1OZTG 4A7GA 1EQWA 4L05A 3SODB 1XTLA 4A7UA 2AQPA 1EJ8A 3CE1A 1UXMA 2GBUA 1E9OA 2JCWA 3KBEA 4N3TA 2VR8A 1IBHA 3GTVA 3MNDA 1PTZA 4MCNA 1BZOA 2JLPA 1TO5A 2LU5A 5CU9A 3CQQA 4B3EA 3ECWA 1MFMA 3GZPA 3GZQA 1KMGA 1F1AA 1P1VA 1DO5A 1OAJA 2VR7A 3KM1A 2C9UA 2GBTA 4A7SA 1SXCA 4A7QA 1Z9NA 1E9PB 1FUNA 1SXSA 3L9EA 3PU7A 1F18A 2C9SA 4N3UA 2XJLA 3KH3A 1F1GA 2Z7YA 1OEZW 1B4LA 2E47A 1IBDA 4OH2A 1B4TA 5KBLA 1AZVA 1IBBA 2WKOF 2WZ5A 3GZOA 1CBJA 4FF9A 2ZOWA 3RE0A 2AEOA 2AQRA 3H2QA 2WYTA 1XSOA 2AQTA 2E46A 3HW7A 1ESOA 3QQDB 1E9OB 1SXBA 2SODB 3KBFA 3S0PA 3F7LA 3LTVA 1COBA 1OALA 2Z7WA 1JK9B 1Q0EA 1HL4A 1PU0A 1OZUA 2ZKYA 2WZ6A 1S4IA 5KBKA 1RK7A 1CB4A 4BD4A 2WKOA 1SOSA 3GQFA 1E9QB 3KH4A 2WWNA 3KM2A 2K4WA 1E9PA 3MKGA 2AQNA 2NNXA 2GBVA 2WYZA 1L3NA 5KBMA 2AQQA 3ECVA 1F1DA 2R27A 4A7TA 3H2PA 1UXLA 1DSWA 3HOGA 1TO4A 4OJAA 3GTTA 2C9VA 2AF2A 2WWOA 2Z7ZA 1N18A 1YAIA 2ZKWA 3ECUA 3QQDA 3F7KA 3T5WA 1U3NA 4U4IA 2WZ0A 4A7GF 1BA9A 2APSA 1JK9A 1SDYA 1YSOA 2XJKA 1JCVA 2VR6A
chains in the Genus database with same CATH superfamily
4UV4L 3HRZC 1HDMB 3BMVA 4XPBL 3BW9A 5HYJB 3BO8B 1AJ7L 1UUNA 2PABA 4MCZB 2EH8L 1S7WB 3CHPA 4WGKA 4RMBA 3RFZA 4XB7A 1YYLL 1AY1H 1ECZA 5CEZL 1Z3RA 3K80A 3LAFA 3RZCC 2OTWB 3VWKB 4BEIA 4WHYH 1A14H 2FO4B 4FQIL 4FXKC 3W0WE 4UNUA 2YK1H 5D70H 4FQXD 4Z7UE 3JWNE 1G6VK 5TQ2H 4JZJB 3OG4B 4NO0A 3WTXA 5EUOF 3NYKA 4D8PA 2LABA 1FZJA 5I8KH 3VXSE 1KENH 3KPRD 1TPXB 4TMPA 4JY6A 5C09B 2EC8A 3VQLA 3FH7A 1ZJAA 4L8CB 4WI3A 2ZF8A 4NRZA 2W9LA 5EFIB 5I5MA 1AGBB 1P4IL 2DQFB 4WV1C 4S1QL 3V2AR 2JF1A 3Q5TA 2QQLL 4WDIA 2NY5H 3KM1A 4J3OF 2P52A 2WVVA 5I75C 4BFFA 3BUYB 2R7EA 1DQIA 4C47A 1XT5A 4G1MB 3HG1E 2BW4A 1BGXL 5LDUA 3IGKA 2X1PA 5BZZA 5I24A 1I1AA 1R17A 3NMEA 4DGVH 1IZJA 4AMKL 2J25A 4FFYA 1Y0LB 3WO4C 3HS9A 4P06A 1KCLA 4LMQI 1C16B 4PLJD 1QLRA 3MNWA 4MA7H 4IOSA 2E47A 3SDXE 2X4RA 3EF4A 3ULUH 1ZT7A 3ELAT 1F58L 2WZ5A 5BJTA 5F7BA 2CLVA 1E3FA 1HI6B 3CK0L 5ANHA 1JZFA 4FQQA 4JUSA 4KJPC 4AEFA 2ZXWB 1ZY9A 4DGWC 1GC1L 3RDTB 1S9WA 1VACB 2J8HA 1N64H 1G9ML 1HSAA 2XXGA 5CWSB 1NUFA 4J4PA 4ENZA 1OQOA 1K4CB 2WZ6A 2DIEA 3ZL4H 5IEKB 4JFDD 2QDWA 3UG3A 3FFCD 4JM2F 1IUZA 3PDGA 3OPZH 3MKGA 1AYOA 1MCKA 1LE5A 4P2OD 2CHDA 4JFDA 4M3KB 3O3DA 1CYWA 5T8IA 3GSWB 3KLAA 4K5LA 1NIFA 5KYUB 5A43C 5JLZB 1T1XA 4UTBA 4A2GA 5DO8A 5JW4R 3TF7C 4JFED 2FL5B 2XN9D 3OKKB 2H0JA 4C83B 3DIDA 1OT4A 4HV8B 4L0ZA 1RZFH 1J0KA 2BVPB 3HE6C 2Y06L 5LXVA 3DRQA 4XAWL 4OFVA 3ZPDA 5DC4B 1DEDA 3TF4A 1NLBH 2DDQL 3ARFA 3QZWB 4HJJH 4X0KB 2KZBA 3TFKC 3DV4B 1NMBH 3PAYA 4TLSA 3TYGH 3VI3B 3JV5A 1SJHB 2EVGA 1KTDA 2OMXB 3Q6GL 1RUML 3QDMB 4HUKB 1ZA3A 4RMSA 1KCWA 4BSJA 3IGFA 1YEHL 3BAYA 3CH1B 2EE2A 1YA5A 4FHKA 4P05A 5IQMA 4L05A 1KYOK 4WU5A 4ODWA 1U3HA 1EJ8A 1IGMH 1ADQL 1L0QA 3QRGH 3II3A 3T1FA 4PMEA 5EOCH 3ZHLA 4OGAD 1LWJA 2Y7NA 4WWID 3V5HB 4DZBA 1OTUD 4XE5B 1T3FA 4RDQG 4XP5H 5AKSA 2NXYB 2P48B 3VTTA 1GKOA 4N2KA 4IQHA 4X6BA 2DIJA 3FU8A 3IJ8A 5IB4B 1XVSA 5MP6L 3PJLA 2VDKB 2CLZB 2EYRB 2IPTL 2XYCA 3WIHH 4JRYA 2BSTB 3IE9A 5F7LB 5MEPB 3VGGA 2ZX8A 4QRSB 3TS8A 4LSRH 3IBEA 32C2B 4KROC 1H8LA 4HW6A 5JORA 5INDB 2E7LA 2IBGA 2XWBB 4ONHB 4ZO8A 1SLUA 1YY8B 2IF7A 2Y1AA 5E5UB 4HIPA 4FYSA 3MLRL 4NXKA 4U4BA 2PF6A 4BFNA 1AIZA 2DKUA 4WI4A 4ZMLA 2P7TB 5EULV 3SE8H 3N1FC 5MENB 4M6OL 3LTVA 2VW7A 2J1YA 2D4FA 3BH8B 4MNQD 4QXGL 4QY8A 4WZ9A 1FL5B 2OR8A 1TT6A 2B08A 1J9SA 2YMXL 4HK0A 4MJID 3S6CA 4TF4A 1CB4A 3AITA 3O11B 4XP9L 3NIDF 5DLLA 3HZMB 4NHUA 3EYVA 1E9PA 4S2SA 1I7UB 1GY1A 3BH4A 3SGKA 3ECQA 3VXQA 1MVUB 1GHFH 2AJSH 5CIPA 4K3DH 2C5DC 2GHWB 3WD5L 5DHYA 1OHZA 1JZIA 3KPSA 2MOVA 4QHLA 4G5AA 1FNHA 1PLCA 1TO4A 5JDJA 1G6RB 2ADGB 4JQIL 3GSNA 3MRLA 4OZGA 5DS8B 1G7PA 1OGAA 2NY2B 1WA1X 1OTSD 3AWFA 3BAJA 3CFEA 1PFCA 3U7AA 2OMTB 3MJ8B 2W1NA 3D0VA 5GJTL 1R75A 1U4FA 1MRDH 4EIUA 5MERA 5IFAL 2ZUQB 4WY7H 4AVKA 4Z7IA 1ID2A 5DUPL 1XAUA 2PPCA 4Q0XH 2WK2A 3DO3A 3FHQA 1RXLA 4JFVA 1CIDA 4MS8C 2HJKA 4BCZA 3UAJD 5DC9B 2IAMC 4XCCH 5IWLA 5EU4A 3O2DH 4F7PB 4G83A 2V0AA 3QDGB 2WQXA 3H1ZA 4F7EB 4AG4H 1USQA 2CO2A 5A6LA 4PY8I 2I9TA 4ICWA 1NGQL 4A6YB 2BSRB 3WUZA 1GYAA 1QYGH 2QADD 1RD6A 3QUKB 4DGYH 4DK6A 3CSGA 1NEZB 3KBEA 2W0FA 4Z8FH 1ND0B 4HMCA 5AWNL 4J3WA 4EI6B 3LRKA 1CLZH 4KHTL 1OF2B 5EPMA 2KERA 4PYGA 1UTDA 1NC2D 4YEFA 5ACLA 2OZ4A 3NZ8A 3ULVD 4ZW8A 3ECWA 4LF3B 4FAAB 4HKBA 4O2FA 1NH6A 3N41B 1S7SA 3FQTB 2UY7A 1OV8A 3U9PH 2DLHA 2WV3A 3GSXB 4GRLD 3VSVA 3RQ3A 3NIDE 2XTJD 5DHVB 1KXTB 2YC1B 3LN5A 3NOIA 3RVXD 2FEEI 1RU9H 1AAJA 4X8XA 3STLB 4H44C 1OAQL 1SHWA 1K8DB 3B2MA 1S7TA 4HDIB 4WKZA 3MV8D 1ZGLA 3MRNB 4QO1B 4XPBH 4IDJL 2CNZA 3HC4H 4WEBH 1QVOA 5GRUH 4TUJA 3HZYA 5CCJA 3MRKB 4AIZB 2YA0A 1DN0B 3S88H 3MLXL 3W9DB 4FQIH 5DJ6A 1IM3B 4J7RA 3CXHK 1HDMA 5HYJA 2EDOA 4JL2A 2BNRA 2J55A 1A7NH 1OZUA 1S7WA 2EXSA 4J1UB 4MWFB 4RA3A 4TNVK 2MCG1 1DVQA 4TNWF 2NTSP 3DWTA 1RULL 4X8JA 2CO7B 3VWKA 4PLNC 3PY9A 2FO4A 3KM2A 4F8PA 1N6VA 4HZLB 1A1MB 2K0RA 4O02H 5FEBA 2CRMA 1FE8L 1HEZB 2PWDA 5C09D 4JR9L 3NJFA 4JZJA 5TF1L 4AUYA 5C0BB 3RX7A 4GRMA 2DQEL 2QQLH 2L8AA 4GQRA 1QO3A 4NP9A 3CQFA 5AZUA 5C09A 3QHTC 4KY1H 1BGXH 3S5LG 3VI4B 4L8CA 1JGIA 2FT7A 4K23H 4JY5H 4MX7B 4AMKH 2JWYA 2YRPA 1CL7I 4X4YB 3F7KA 5CN3A 5DQDH 2FBOJ 3WEXB 4AC4A 2Y7QB 2ENSA 2IH8A 4ZFFB 3HJ0A 4N86A 1F58H 5I23A 3AJ7A 5K1VA 3HS0A 2VLKB 1KZYA 1KF9B 1TR7A 3CK0H 2Q7YB 3BYTA 5E99L 1GC1H 5K5YA 4ODXB 3VG0L 3WMQA 3WFDL 4M93C 3D08A 4B9JA 1P6WA 2DQHL 1JZHA 3HNSL 3Q2NA 4AUUA 3H3KA 3OKLA 3RDTD 3UTSE 5IMMB 1TQBB 3GMRB 1JVKA 3CXDL 5D71H 4YFDB 3TEYA 1J5OH 4OF0A 2VLRB 1BAWA 5CD5D 3QEUB 1IGFL 2FWOA 2EEBA 5F7WC 3KYOB 5CWSA 3FUIA 4NC1E 4FI7A 3NSDA 1G43A 1K4CA 4ELMA 4LL4A 2AXFB 1TETH 3KCWA 1PG7W 3V79C 5EBGA 2QKSA 2AERT 1UA3A 4GMSL 1KCVL 3D4GA 1RIVH 1WS7A 4HBQA 4L9LB 3QR1A 5CHNB 5IT2L 2DDQH 2RMNA 2R9HC 3BGMA 1BJ8A 4FNUA 3FB8B 1PDKB 2FL5A 1QPKA 4LPUA 4C83A 3HMWH 1EEUA 3OKNB 4HV8A 3ARRA 2VL5B 1OEZW 5HJDA 3C09B 1UOWA 3TBWA 2XXMB 5HDOA 4E0RB 2P44B 2ZD0A 3IDJA 5IB5B 1DSFL 3E2HB 1OW0A 4G6AD 3IYLW 1B0GB 4UZSA 4X9YA 2NW2B 2VXQA 3LRMA 3AGVA 3HNVH 3VI3A 1IMHC 4OF8A 4CNIB 2DICA 3V0DA 1E5YA 3QDMA 4IGBB 2PPFA 2WNKA 1PZ3A 5G4NA 1ADQH 2YA1A 4Z7WF 3FT9A 4Z7QF 3WENA 4FD0A 1MFAH 1UB5A 2ICWB 3RAJL 2OMUA 3MRBB 3WKYA 3PQYA 3C08L 1U8PB 4BK8A 2CRYA 4UBDD 2OM5A 5K1JA 2R56H 5MP6H 2VUKA 5E00B 5CJ5A 1C7TA 5LGKA 4UQAA 5AG8A 4OCYL 2NXYD 1HEJC 3TO4B 4HALA 4AQZA 2IV9A 1DQKA 1Q1PA 3ARDC 2IPTH 1G1KA 3WAKA 3V5HA 4P59H 3DO7A 3HZKB 2BNQE 3GRBA 1WVZA 3FUJA 4OTXH 5JOFB 1YVLA 2EO9A 2VKXA 5IB4A 5L7XL 1F97A 4L1BA 1RK1A 3THML 3O2VH 4XNZC 3OWRA 4X42A 5F9DC 5IVXB 4PEEA 4L29B 4E41B 1KFGA 3MLVL 1X5YA 5KYYB 2EYRA 1B90A 1EXUA 3KCPA 1TVHA 4ZX5A 5HYQA 4NZUH 4HOMA 1S3KL 3WV0A 4NHCH 1PG7H 4JKNA 3B6SB 1DP0A 3W39B 1KTKE 4L8SB 3CC1A 4ALAC 32C2A 2F7QA 1KGCE 3BVNB 1W72A 4GRWE 3TTSA 4ONHA 4E42B 4QXGH 5EEUA 3LOWA 4IU3B 2OYPA 1YN6B 3HTLX 2CE6A 3UPRB 2YMXH 3UG5A 1RZIB 2UZIL 4I3RH 2ENQA 3ZHFA 2NZ1A 1LK2A 2DQGH 4DN4H 3CFTA 1HZHL 3VYOA 5MENA 5A40E 4LU5L 5T3ZE 2VITB 4AVJA 2GKIA 4OB5H 3PJSB 3S3SA 1LQSR 3C87A 4WUUE 1A6TB 5F1IB 1X5XA 3WD5H 3O3AB 4B3EA 1WIUA 2VQUA 3LVEA 4UAOC 4ESKA 3P69A 4JQIH 1I7UA 1GRWA 4I85A 4EZMA 1XH1A 2FRGP 5EMYA 4Z7QE 1FZMA 4A2DA 2EYTA 5F6HJ 1MVUA 1OTTD 1H5BC 3WNNA 3NIGB 3D09A 2AABL 3DOIA 5GJTH 4F33B 2MNWA 2CJSA 3PXHA 4DSYA 3ESUF 4P99A 2E3VA 2A0LC 1FAIH 1G6RA 2ADGA 4WI9A 4BZ1A 5L2KA 4BRVA 4P46C 3EJUA 4B27A 2VB5A 4FJYA 1P5UC 2OMTA 3MJ8A 5KG9B 2QSTA 1RP8A 5DHMC 2D7QA 3T0EA 1TQWA 2H26B 2L3BA 4Z3IA 4I2XA 5IQOA 3HC3L 4Y2OB 2AQ3A 4LQFL 1NGQH 4KI5D 1NBVL 4OZIB 3QDGD 5DA4A 3IJEA 3SIKA 3I85A 4U7KA 3UAAA 2WQRA 4XXDB 4XN2A 5ICXB 1XBDA 4MXQC 3SDYL 5AWNH 1UJ3B 2V7NB 1KDIA 4NQSA 4WEMB 4AXWB 4F7EA 2FWLB 4D9RD 1I7TB 3KPLA 3F7VA 4A6YA 1DQVA 2BSRA 2NNXA 3HJEA 3JWDL 1RZJC 5HHME 5BXFB 2HKAA 3BP5B 1I3RA 4GUCA 3U1QA 2FX7L 3ZGIA 3KL3A 2F8IA 4PJIB 1BD2B 1BQUA 2D9CA 1NUGA 1PKQB 4J3TA 5AZEL 2K6YA 1P7KB 1H3TA 2Z7ZA 3FQRB 4YHOH 3JTSB 4BQCA 3RVVD 3FO9B 2B1OA 4ZQTA 5JIDA 1KWGA 1OAQH 3FQTA 2O6DA 5JR1H 4IRSA 8FABA 4MAUL 4X5QA 2AJYL 4IDJH 5JA9A 3ET9F 4KRMB 1DJSA 4TQPA 1KXTA 1DUYB 4WTXA 3I9GL 5IB3A 2VL4A 2Z31B 3IF1A 3IKCA 4G6JH 4N28A 4NSKA 3MLXH 4FJ6A 3BPOC 3CC5B 2I25N 1K8DA 1X5MA 4HDIA 3VVVA 3MRNA 4QO1A 3PREA 2GJZB 3W0WB 1A66A 3PG2A 5CUSL 2GVYA 1A65A 2OMBA 4JFOB 1BVOA 4Z7UB 3PABA 4FI8A 1RULH 4BGDA 5JNYB 1NL0L 5I1CH 3SDDB 4WWKB 1R1CA 1TTBA 3W9DA 5E6RB 3LQMA 2YPVA 1IM3A 3FN0L 4X6CE 1HU8A 4EF3A 2WQAA 3AGWA 3VFSB 4MWFA 3SBQA 4FG6D 1JFHA 1ZLUH 1EJ6A 1U9KA 2QHRL 4P2QA 3TEZA 1OIOA 3EF7A 5C0BD 1JWUB 1ACXA 2BVUA 3TWYA 5HHPB 3TN0A 5C0RL 4HZLA 1MPAH 4K0OA 1A1MA 2R2HB 3T2PA 3BZ5A 3HG1B 3KYMA 1RIUL 3SE3A 2J3SA 3VXPB 2GSIB 1RJYB 3PAUA 4JO2L 3US9A 4OLXL 4G9FB 3O45B 4LGPB 3VFUB 1KFAL 1BZDA 2CDGB 1SYSB 4N26A 5ALCL 3SDXB 1L6PA 2R0KL 3F62A 3VFWB 5KTEH 3VI4A 1O9VA 4MKMA 4MX7A 4KUZL 5E8PA 4FADA 5JPMA 1YNTF 5EBWB 5E99H 4X4YA 5JXAH 1ZLSL 2VLKD 3WEXA 1TTGA 2FBRA 4ZFFA 4HWEL 1SLWA 2DQHH 3HNSH 1FIEA 5HY9B 3L4YA 1DJGA 3CXDH 1U3JA 2DLFL 3V0GA 3SE4A 3BVWA 4PVLA 1BW8A 5DTFA 5FGCE 3UTTD 2E75C 2VM3A 4ODXA 2VLRD 2EJ1A 3DK2A 1A3LL 2ZOTA 3GMRA 1OT2A 1TJXA 4G3YH 3L81A 2EDTA 2VN5A 2VLRA 4AEIL 3UTPE 4Z78B 5IQ9B 4QUOA 2X3CA 3QEUA 4UOJA 4JKPH 5EUOB 1MQ8A 5KSVA 4PCYA 2Z92B 3AWGA 5GZNA 2XWDA 2YPKA 4DO5A 3KYOA 3CFCL 4LGSB 2XWTA 1HHHA 3DDGA 1NJ9A 2ILLA 1UB6B 3CZLA 3QXWA 3LNHA 4EOWH 4KGJA 1ZV9A 1MRFL 3B3IB 4LT7A 4IIQB 4MFHA 2G5RA 4N1HB 3ARGA 5LNEA 2ORBH 3JVGA 5KYWB 4ZNCD 2BY3A 1KV7A 4LLQA 4LSQL 5CHNA 2PO6B 3WNLA 4PI2A 5DS2A 2A7BA 1PDKA 5DO2D 4HH9A 2VL5A 2IWKA 3RWFB 4ZMVA 2M2DA 1H9DA 3A5VA 3HI1B 4E0RA 3JV0A 3A23A 4M8UA 4IGBD 2Z35A 3OB0K 3QUXD 4M6ML 1B0GA 1IC0A 2BS71 1BG9A 2ARJQ 2PXYD 4J3XA 2WBJA 4LCYA 2AK4E 2HT3D 4U3HA 4IGBA 3T8MA 4OCYH 1JMZA 1PIFA 4L4VE 1HT6A 5HVWA 1KDJA 5T1MB 2WKGA 4ZMWA 2OX5B 1R24A 3TO4D 4EE2A 2ICWA 4JM2B 3NSCA 4H20L 2JFCA 3CHOA 1G9HA 1U8PA 2OP4L 5L7XH 5I66A 1Y07A 2AZAA 3OAZH 4TQEH 5KZCB 5CZXD 2CR0A 4IKIA 4FNQA 3TO4A 5J13C 3FZUC 1LDSA 2B5IB 3MLVH 4K5MA 5HPOA 5I73B 4TUOA 3D06A 4PH8A 1CURA 1F3DJ 2GUOA 2Z8WC 4E41D 4XZUA 5AB1A 4Z5RB 5EC1B 1S3KH 5DQJB 5HVFB 3IAGC 3TP4A 1NLDL 3QXAB 4ODVL 4JHWL 3QJRB 4L29A 4UI2A 5KYYA 4AV5A 3CUPB 4Z3JA 5GQBA 3CPUA 2VZTA 4BFBD 4HIIB 3I9PA 1LE9B 1EZUA 4POUB 1VA9A 3QNFA 5JOEA 4NZTH 3UPCA 2R2BA 2VISA 2UZIH 2NY6D 3B6SA 3ATDA 1JZGA 1HHKA 2YD6A 4OT1L 1GOGA 3W39A 2OW6A 4IBUA 4B5ZA 4LU5H 2CRZA 2OSYA 3O6LH 3X1BA 5FYKU 1WWBX 4E42A 1RZJH 1EAJA 1QLEH 1A4KB 1YN6A 4KKQA 4O00A 1BREA 5EU7E 3UPRA 1RZIA 1FQ9C 3RIFF 1QATA 4LRIA 3RWEB 2IO5A 3QZPA 1V5JA 1X3DA 1ZLWK 5LHDA 3VCLA 3ILQC 3ZYIA 4YH6A 1MJJB 5DGRA 2BY1A 1XIWD 4PJEF 1YEWA 1GSMA 2AABH 3RKPA 1A6TA 1MH5A 3K46A 3L5HA 2L7QA 3O3AA 2FSEB 4X7TB 2X4TA 5I28A 4LHUB 4XXWA 2HVKB 2XBTA 1PY0A 1Z3GH 1GGYA 1BAFL 1N59B 5K9OB 4F33A 3O6KH 1H15B 2WWMD 4KNUA 4L4TE 3UBGA 1DL7L 1UD3A 3MGTB 2WANA 5IHLB 4LOUC 3TVMA 3HC3H 4DKEL 4GG8A 4LQFH 2FGZA 3PP3H 1L9QA 1UD6A 4BE6A 3TEXA 3VE0B 1M1SA 5I1GL 1XSJA 4I18B 4JDZB 3DARA 5KG9A 1EEYA 5AD0B 2Y24A 4G59C 3BAIA 3RIKA 3SDYH 4A7GA 4CN6A 1SM3L 3VG9B 3ZT7A 1IV8A 4GG6F 1P5VB 3LH2L 1ZSDB 4MNGE 5ANMB 5E03A 4Y2OA 1OM3H 3P2DA 2HTLD 3MRPB 5IR1B 5ID1B 4QYOB 4X2UA 3HN8A 4PRHB 1EMTH 5FM5M 4I4WB 1L3WA 2GEEA 4F3FB 4DH2A 3Q06A 1F6AB 4XPGH 1R3HB 4ETYA 4XXDA 1E4HA 5ICXA 1P0SE 1UJ3A 2V7NA 3EOTL 4KZDH 4AXWA 4WLCA 1PSKL 4F37F 3GMOA 3NIDB 1UCBL 5AZEH 4H8PA 4W81A 4KVNL 1BD2D 3DX6A 3QO1A 3VFRB 4MDRA 4DQOL 2QTEA 4JREB 4JKMA 3HUJF 5BXFA 4W9FC 3BP5A 1PX8A 4WTQA 1CXHA 4WFEE 4YSSA 1E7VA 4NM4H 2AJYH 1P7QD 1BJ1J 1IKFL 2GTWB 2HX8A 4Y19B 4NFCA 4YHYB 3I9GH 2VJ8A 4N2LA 3FQRA 4PJEE 2DRUA 3VFMA 2DBJA 3X3GH 1FWXA 4XBGA 4YSTA 3K71B 1T83C 4UOZA 5CUSH 4NKDB 3SQOL 1D2PA 3QQ9C 1DUYA 3BAEL 3W0WD 2Z31A 3VU2A 1NL0H 4Y5YA 4E36A 3CC5A 4G1EA 2FQFA 3CDGB 3VWJA 3DHPA 1OARL 1XZ0B 3FN0H 3MLZL 1M05B 3P30L 1A6PA 5HDQL 1VESA 4WWKD 3SDDD 2BWDA 2DQMA 1D5IL 3L9RA 3O4LA 3VXSD 5TE7L 4QRUB 5T1LA 1KPVB 2CCWA 1E5ZA 2PYEE 1XX9C 2V3DA 5JNYA 2OMVB 4X80L 5BOZG 3QUGA 5AW3B 4WWKA 3SDDA 2KPWA 4JGUA 3J8F7 5FV2A 4BA0A 4JN1H 3EGXB 2HUEA 4NN6B 4RA0C 4R4NC 1THCA 4FX5A 2E7BA 2QZQA 3GHPA 4JO2H 4EVNB 1DANT 3B8YA 5F7EH 3HG1D 1KFAH 4K3JH 5DD6B 2Q6WB 4PY7B 2P45B 2R2HA 4KUZH 2ZUTA 5H37A 5KVEL 1MZZA 1RSYA 5IW1A 3VXPA 2GSIA 3LSOB 2P9RA 3CFDB 1FI8C 4MVBD 4AWJC 4G9FA 3O45A 1XGRB 3PGFL 3K6IA 4A37A 4OF6A 3HUJE 1L5GB 5DMKB 1T1YB 1SYSA 3TZVA 1OOAA 3ARBB 1NAKH 3EHBC 2DLFH 2Y3AA 4YSRA 3QWNA 3BVDB 5EBWA 1VADB 4QF1A 1BAGA 2Q10A 3WHE0 3OLGA 1QUPA 1YYCA 4DUWA 4EKXA 1ZS8B 4JFYA 1ZOXA 4F2FA 1BYPA 4KK6D 1A3LH 2ZAIA 4GFXA 1KCKA 2GTZB 5C6PB 5IJVA 4BINA 2I60L 3BUIA 2LLNA 4KDTA 4NP4H 5GRZA 6TAAA 5L88L 4XTRC 5KUMA 3FRPB 4B53A 5AYUL 4LPTA 1MI5E 3FTSA 4ANWA 5EOTB 1GZQB 3BLBA 5C0CE 2VCOA 2ZWKA 1DDHA 1KLGA 5SWSE 3B5TA 1EGJL 4ICXA 3B7SA 1CD0A 3DV6B 5DZJA 5IQ9A 1M6OB 3K6NA 2Y6SD 1UM5L 5EUOA 3UAFA 2Z92A 3FCTB 2IANB 1Z5YD 2D2OA 5KVDE 4N1EA 5AAMA 4QKTA 4LSQH 4HGMA 4PGCB 5A6MA 3B3IA 2ZJSL 4WSGA 1Y1UA 3V4VL 3AXIA 4IIQA 3PPSA 4TQ8A 3MLPA 5TFSL 5E94A 5F9OH 1RPKA 3NG5A 4LCUA 4MAYB 4HEME 4JUTA 5LXGL 1IGJB 2PO6A 1CS6A 1FBIL 3KGSA 2RH0A 4ZFOB 5DRNA 3TH2T 1J05A 1HN1A 1JOIA 2VM4A 4LVHB 3ZR5A 5HVHB 4N2GA 3WS3A 4Q6KA 3QIBB 1YNKL 4G8FB 5KBKA 2Z91B 3RWFA 5F6IC 3HI1A 5AVSB 1E8XA 4FDWA 1ZLVK 2AQNA 2ITCB 2NX5E 4ZO7A 2NCEA 3MXVH 4F57H 1JPTL 4P9HL 4JFZL 5CMAA 3W3BA 2FR4B 1OSZA 4H20H 4NC0B 1HC1A 3MRHB 5C0EA 3M1BB 2B9AA 1FSKC 1LHZA 2QELA 3FO2A 4UF7C 4YXHH 1F1DA 3D8MA 4JM2D 1NCDL 1FFNB 3FU5A 4XNMB 3GI8L 2OL3B 5KZCD 1LTXA 5T1MA 1LEIB 1BVLB 3OR7B 2PN5A 3FQ1A 2OK0L 4QLRA 4KKPA 1AG6A 1FNEB 3SKNB 4P4RB 3UZEA 4NPKA 1TJIL 2CKBA 2C4FT 1AD0B 1NLDH 5E0QA 5D6DA 2YBRA 4K9EC 4CMMB 4ODVH 1JYWA 4GW5B 4JHWH 3GB7B 1CFMA 4FNLL 4GXUN 4K71C 4KQ3H 3BZFB 5DUJA 3GKWL 3P4OB 1M9WA 2LW3A 2Y6TE 4MXVF 5DQJA 5JW4N 5ESAB 2HLEB 5I6OA 2C4XA 1Z9PA 4X5LA 2NY4C 2P5WE 4QXTA 5SWZA 2WNXA 1R5IB 3CUPA 4M1DL 4WW2C 3KR3H 4PU2A 1W6LA 2DIAA 2LLLA 4N24A 4GSXA 4FERA 1RQ5A 4WUUB 1AE6L 3H0TB 3SGJC 1H6UA 2GITB 2I32A 1BZOA 4MSWB 5CZKA 1U8CB 4Z7WB 1KIRB 1HCYA 3NAAH 5FS5A 4GKNA 4Z7QB 1LWHA 1MEXL 4FKKA 1S78C 1BQ5A 5CILH 3OTTA 2GYSA 3EJSA 4NS0A 4XP1L 1LO4L 1S3RA 5FUZL 2AJVH 4H8WC 5FYLL 4IMLA 1F4WL 1MCEA 1EHNA 1BAFH 4AYMC 4LHUD 1VCBC 1RFDL 1KXQE 3T4AA 1YHPA 4DP2X 4UB0H 1DL7H 4PJGE 1FIGH 3R0NA 2FSEA 4X7TA 4X8CA 2MNUA 3TA3C 4PJCF 1CFQB 4NJAL 3CHQA 4R90L 2WIIA 1JYXA 1JPFA 1CGSL 2ALAA 5IP4A 1CBJA 9CGTA 5I1GH 1O75A 4H4NA 5K9OA 3DRTB 3ETTA 1Z0MA 4JG1L 1H15A 4NWUL 1ZCRA 5BRQA 1SM3H 5JW5B 3MGTA 4NQDE 1NANH 3LH2H 4XMUA 4UQ2B 3WTTA 3F6LA 1K85A 4NPYB 4JFFE 4JFUA 5D6CA 1XMEB 1KJ2H 4HUWA 4PJBA 4LSTL 4I18A 1PIGA 3C12A 3KBHE 3UP1A 5AD0A 3RU8L 5D1ZI 1I1CA 1P5VA 3EOTH 2AMGA 3ES6B 1S6NA 1ZSDA 5ANMA 3TPKA 5J06A 2Z4QA 4PYHA 3SE6A 3MV01 1UCBH 3MRPA 5IR1A 4DVBB 5ID1A 4QYOA 4UQBA 1PPIA 4PRHA 4I4WA 1R3HA 4PCKA 1LMIA 2XQ0A 5IROC 2D7NA 3SO3B 2KI6A 3ZXAC 2ZNWA 3DROB 3VFOB 2VIRB 2F58L 5C2UB 4YHNB 1SQ2N 1XD0A 2ICEA 4W4OA 5JO5B 2ADJB 5EEVA 1UHVA 3VFRA 4OM0L 1OGPA 1BMWA 5FCUL 2NDGA 2GABA 4RGMB 1LO5A 4I77L 3MCG1 1RUKL 1M2VB 1BFTA 3A4AA 4Y19A 5JHLA 3SQOH 2Y36L 4ODTH 5HI4C 5B39G 2X3AA 1SDAB 1CD8A 4HP5A 1UXWB 1Y6KR 1A6VL 2NQDA 4MGXA 2EDRA 3APFA 4ZMYA 3FCBA 3K2UL 1OARH 4H13C 3P30H 3K71A 3SHSA 1W0VA 4PJCE 1D5IH 5HI3C 4A7UA 2JIXA 4W9GC 3V0IA 1EHKB 4HUMB 2NZ9C 1BZ7B 4HIJB 2R29L 2IDFA 1GZHC 4X80H 5FLUA 1DUZB 5DHXB 4UIKL 3CDGA 1VZGA 3LY6A 4OVVA 4F92B 4XBMA 2VH5L 2WGNB 1M7XA 3RY5A 1KCSH 4YIQB 2CJUL 2D03H 3EXLA 1XGQB 3AFLA 4FZ8H 4FMFA 4NXSA 4QRUA 5DRWA 3WHXA 1KPVA 5IBTL 4DP1X 4HC1L 4OF5A 1MFEH 2OMVA 1UKTA 4X9GA 1EO8H 5GHWL 3IXTA 1UWXH 3PGDA 4WENB 1KPRA 2WBWB 4PTTA 3U1PA 3RTQB 3E6FB 1PZ5A 4XP6H 5DR5H 3OQRA 3QPXL 5EB9A 3WFBH 3E0GA 5JW4M 3L9EA 3FK3A 3HB3C 4EVNA 4EN3B 3QSKB 4LAJH 2H41A 2OR9L 4L8BB 3RZWA 2ZX7A 2Q6WA 1BMZA 4OJFH 3X13B 1O0VA 3BIKB 5J9PB 2JCCF 2FEDC 3ARBD 1AP2B 4UINL 2EDBA 2E9JA 4C8XA 3D33A 2VLJE 3HE7B 3CFDA 3LSOA 4XNXL 3UTSD 1RURL 1XGRA 2E4TA 5E1GA 3T04D 4NCC1 4GSDL 1MW2A 4P23C 4XCFL 3CFBB 1HQRB 1SYVA 2YHGA 4P5KA 4MAZA 2I60H 2HPOA 3LHAA 3WNIA 2PW2B 2CBQA 5ABAA 1XO8A 3RB5A 4AJYV 5L88H 1CDYA 4B5EA 3NCCB 2H1PL 4UT6H 1H8NA 5J3HD 4J6RL 2UUDH 1EGJH 5BRZE 4D3CL 4S0SD 3Q3GB 1RP9A 3PWUB 3NFNB 5ES4B 3FRPA 3QULB 1EZVY 1IKNC 1CGWA 5D2NB 5BV7L 3QRFM 3KWXA 4K9EH 5GGSY 5EOTA 2HLFD 7PCYA 3S4SA 4AT6B 2ZG1A 1IM9B 4EPSA 4I9XA 4FP8H 2FT6A 3ZMRA 1U8JA 3GHEL 2ZJSH 3DV6A 3MTRA 4K2UL 4MA1C 2AJZB 4PVMA 5TFSH 5K9JL 2IANA 1A9BA 1JZ2A 4LVOB 1N8ZA 3FF8A 5FM4A 4PGCA 5LXGH 4DN3L 2L04A 3HI6H 4MMXB 4QCIB 1FBIH 4QHPA 4WHTB 3TJPA 5LWYL 1YNTB 2H2SD 1RJCA 3H2WA 6PAZA 3WU1A 4OKVB 2F53B 4KK5C 3QAZC 4QLWA 3ZDZE 1N26A 1N6QL 1YNKH 1OAZL 1FNAA 3C5ZD 1M3JA 2AQPA 4LLUB 4MAYA 1BV8A 1JPTH 4L4VB 4P9HH 2VE6B 4RGOH 3MO1B 1EZSA 2HFGL 1VLXA 2J56A 3L95B 4EXKA 4ZFOA 5DGQA 4XN1A 5I8CB 4S11A 1HAUA 3POHA 1HKFA 1LK3H 1NCDH 1RH8A 1X4XA 3BP6B 2Z91A 3QIBA 2R0LL 1RK0B 4G8FA 3GZPA 2BNQD 4H8WH 4J6IA 4M5YH 3VXME 4F7TA 1OB0A 1U8LB 3S48A 5J12B 1O6SA 1Z32X 3TEUA 4QTIL 3QEQE 2FR4A 5CSBA 2C9UA 4PRBB 1T5WA 3MPCA 1DVYA 3VQ2C 3MRHA 2XPGB 3NT0A 3CFMA 1LNUB 3I75A 4KPHH 1FFNA 2A77H 3IEAA 4AL8L 3GKWH 2DY2A 2CZNA 2OL3A 4DEPB 2DD8L 1MJ8H 3IJHB 3OR7A 5ACMA 4D9LL 4XOBA 1YMHB 4U1LB 4XAKE 3WXWL 3BPLB 2AEIT 1U0QA 4P4RA 4AMWA 3E7JA 4ZTOH 1AD0A 2G9HB 4GUPB 1KGCD 1VKXA 2W59A 5HDWA 3HR5B 3U1SL 1BPLB 4RNRB 4CMMA 5EZJA 2TSBA 4PB9L 2NSQA 3CG8A 4P57B 1LM8V 3FYEB 2X70B 3ILPA 2APVA 4XZ4A 5ESAA 4LL1A 1AE6H 5T3ZD 5F97E 4AVIA 1P9MC 1CE1H 2WNGA 2XDHA 3SDCC 3TIDB 3QG7L 2X4PB 1R5IA 4WUUD 4XX1G 2ZUVA 4HU2A 4PLKD 4Z7OE 1UGNA 4P5TC 1GGIL 3BGFB 3CFKA 5KBMA 2D31B 2ESVE 4GAGL 3AQZA 5I1LB 1O9WA 5ACZA 4KQ0A 2V4LA 1AR1C 4M7JL 2I24N 3H0TA 2R27A 3AY2A 5BQ7A 3L1OH 2Y2WA 2A9CA 2W80C 4U2ZA 1KB5B 4ZPTB 2ATAA 1F4WH 4I8DA 4MSWA 1EWHA 3BJLA 1IAMA 1JUFB 4WW1B 4Z7WA 4AYEC 5CAYB 3IPBA 4U49A 4XB3A 1RFDH 1U36A 2W60A 1HCFX 2VDLL 5F7FA 3N43F 4KKAD 4NKIH 4M5TA 3A6BL 4WJKB 5D96B 4LCCB 1T20B 1B9ZA 3NCFB 2XY2A 4NJAH 4AV4A 4R90H 1PS3A 4Y5XC 1CVRA 5FA4A 1CGSH 1W0WA 4XH2A 3IRCA 1TU2B 3NPSB 4KFZC 2H1XA 1D7DA 3CHSA 5I6MA 4NQEB 4YX2H 4JG1H 4Y2LA 1IEAB 1M56B 1YAZA 3DO4A 2AAAA 5E6SB 5IV2A 4WVRA 1HNGA 4GKOA 3DBSA 4ENEC 1CFQA 1WA2X 1U6AL 3AMLA 1INEH 1AS6A 3GSOB 1DBAL 2OQJB 4B9ZA 1PF3A 4LSTH 4V2CB 4MBOA 3EYUH 3DRTA 1P84K 2FLMA 1NEPA 3FONB 4NFDA 5JW5A 2VRAA 1TMQA 4EI5B 4UQ2A 4PJDF 5HHMD 3UBXB 3L3GB 5GGSB 1X5LA 5BUGA 4OCSL 4DP5X 4OQ1A 2XYBA 3QZWG 1I8LC 1KTCA 3CVHA 4FL4B 1OTUC 3CVBA 3ES6A 4FYQA 3Q44A 2BHUA 3QUMB 2F58H 4Z23A 1YMMB 2OW7A 5HGDB 4OCMC 3LQAL 2DH3A 3NK4A 4DVBA 1A5FL 3U25A 3GSQB 3QJFB 1T66D 4PJEB 4D7PA 3X2QB 4I77H 3QXTA 4ZTEA 1RUKH 2LHAA 1TZOA 1UURA 4N2HA 3PNWB 1Q9WB 3DROA 5D1XE 3D25A 5IY5B 1NTDA 1X5AA 2C3GA 1MJUL 3V6ZA 1YDPA 1TQTA 4CA4A 2P8LB 3D0LB 4P8QA 3TESA 4M3JA 3PDOB 4N8UA 3FFOA 2E46A 3SQRA 3QRBA 1X5JA 1XZWA 4R7DB 5B4MD 1ZK5A 3HBGA 3SQBB 4YMPA 1IGCH 1UXWA 4TL4A 4N4YB 2R29H 1UD5A 3C5JB 4YHPB 2PYEB 4UIKH 4I3GA 3RKDD 4K5OA 4E68A 2VH5H 3FKUS 4UM9A 4DESA 4GG6B 2JTYA 2WWNA 4OV5B 2CJUH 4KWUA 1E3ZA 2R4SH 3EFDL 3HI5H 3VMNA 4HIJA 1BZ7A 1YEGH 4HC1H 3RWIB 2EE0A 2ZSVB 1DUZA 5GHWH 5H8DA 4ABWA 2YGOA 3UX9B 2NXZC 2EH7H 3ULVL 4YIQA 1HIMH 4PJDE 1IBGL 3L3JB 3RTQD 4F2EA 1A64A 2DF3A 4NZDA 5EU6B 4FFZA 2IDCA 2OR9H 3L3DB 1M9SA 4UOW0 1UZGA 1XF5B 3AREA 3CZUB 4FTVB 3HUJB 4EN3D 2YAMA 5I2IB 3IDUA 4LSUH 4YK4C 4LASH 2VDRL 5LKNA 4UINH 3ELQA 2GJRA 3G5ZB 4Z3EA 4EN3A 4HSAC 1RURH 1YRKA 2BNUB 3ZDXF 5C9JA 1H3XA 1KJ3L 4JDVB 4L8BA 4F37K 3HE7D 4YLCA 5I76A 4FE9A 3X13A 2R2EA 4APQC 4QRQB 3BIKA 2PCPB 5J9PA 5L6YL 4UQ3B 5CGYD 4P2RE 2DPKA 1HL8A 2WXGA 4LDEB 1WYJA 3K6DA 5FC9A 1FO0A 1UA6L 4YE4L 4DOHE 5B1CA 2H1PH 5GGVL 1FLRL 4XNUL 3LXBA 1BBJA 3CFBA 1WBXB 1MI5B 3UTPD 2QADC 1XXDC 3EBAA 5CP3H 3D34A 3RZCB 4JFXA 5J1SC 1Q9LA 3DTXA 4P0DA 1NBQA 4Y4KB 4FXKB 5KSBE 1A4JA 2B59B 1AZRA 1DE4B 4IS6A 1Q94A 5ETUA 5F6HI 4Z76A 5BV7H 4U6HB 1C08B 3WIFA 1HNFA 1NDGB 3ZKNC 5CF3A 2Q87A 1VIWA 1NZRA 2YXWA 3DETD 4FHBD 1O5DT 5GSVA 3VFNB 3ZDYE 1FHGA 3GHEH 3Q3GA 1BXUA 3NFNA 4K2UH 3ZL1A 2IQAA 2BLFA 5K9JH 5D2NA 3TO2B 2VZUA 5B3SB 4R7XA 2G75B 4WV1B 1F41A 4AT6A 1IM9A 3WS6A 5I75B 3OX8B 5KBLA 3RIAK 1NEZG 1NCUA 2MTAA 4KKLD 5D1QE 2AJZA 3DURA 4DCQB 2Q2EB 4PRPE 2CDFB 1LP9A 3WO4B 3BN9D 4HWBA 1N6QH 1TQSA 1RUQH 1GTFA 3NFSL 3BT0A 2GK0B 2X89D 1URIA 2KQNA 4QCIA 4WHTA 1TXKA 2AK4D 3FH8A 3FPXA 3RWCA 5E1QA 1YNTA 2HFGH 3RNQA 3PWJB 2F53A 2WQWA 1VZIA 7PAZA 5IQ7H 4L4VD 2KS0A 1I8MB 3UC0L 4LLUA 4QTHA 2PKDA 2AJXL 4G6KL 1NQBA 4QTIH 3PAZA 4L4VA 2QQKL 1CYXA 3MLUL 4ORZC 3MO1A 4U6VH 4WWNA 5F1SA 3U36A 3WJJC 4A66A 4IRJA 1WEJL 1JGDB 5I8CA 3QDHA 3MREB 3N91A 4HUUA 2AF2A 3D1MC 3LZPA 3CSBA 4YS4A 1RK0A 4XRCB 4AL8H 5F7AA 1U8LA 1MHPH 2F19L 4W9KC 1ES0B 3UACA 1NC4B 2WXOA 1NBCA 4HGKC 4NUJB 4D9LH 4S0HA 3GBNL 1ZE3C 4HUVB 4S1SH 1FN4A 4PRBA 1BXAA 4O02B 3NA4A 2FNWA 2ATKB 3O3BB 3ZHNA 3T6XA 3U1SH 43C9A 2TSAA 1AZZC 4J3SA 2YRLA 4PB9H 2WQVA 4WO4C 1TCRB 2P5WB 2A74A 3RBGA 3HE6B 3CSYA 1UEMA 1WD9A 2UVEA 3QFJE 1YMHA 2X53A 4W9CC 1XCTB 5TJWK 3U2SB 4CVWA 4EN2A 3QS2A 2G9HA 2DYPA 3NCJL 3NN8A 1RZPA 1HS6A 3HR5A 4RNRA 1O6VA 4TL5A 2NDFA 2XIBA 3WDJA 1HK6A 3B9AA 4ODBD 3FN9A 4P57A 1P2CA 3CN3A 3NSJA 4TSBL 2X70A 4GAGH 2HG0A 2CR3A 3K72B 1JV2B 1WCQA 2CSPA 4M7JH 2J5LC 3SDAD 2C1OA 2YR3A 4ZZFA 4TOYL 3MRCB 5A6IA 2OYMA 1OAYL 3WTUA 1OLZA 1ZVNA 2I07B 3M88A 1J87A 2D31A 4LCIL 5DD3L 3GT6A 4DTGL 4EUPA 1MJ7L 5TDOB 2C9QA 2VDKL 4N0UE 1ZVSA 4UZUA 4ZPTA 3JBG7 4M1GL 1Q9OB 3H9SA 3C6SB 4D8OA 1JUFA 4WW1A 4DO6A 4L4TD 5IEHB 1KBVA 4E5XB 3BWSA 4PS3A 1OSPH 4Y88A 2X0VA 1QBLH 4JFWA 2X12A 4EQ3A 2VZOA 1QHQA 3QXVA 5MEOB 4B96A 4LCCA 2VN7A 1T20A 1T1WA 5BZWA 5I71C 1A21A 1EUTA 4IOIB 4XNYL 4NQDB 2AEOA 1J8HE 2BRRH 1U6AH 3RE0A 4UOQA 2EUZA 4AIEA 5CP7B 4K5PA 4RMTA 5AOZA 3UYOD 4XPTL 4PW3A 2GY7B 4JG5A 4N8CH 1J1XL 4KROB 3FF7A 4NQEA 1IEAA 1K2DB 2RALA 1JK9B 2F6AA 2Y9RT 2CD0A 3APDA 2XWRA 2DMHA 1HHJA 2A9ML 1NCNA 1BVKB 1ZJBA 3RGVC 3BX7C 3EJTA 4DWHA 3NQIA 2ZUYA 1DFBH 3C2AL 5D7JC 1M1XA 2OQJA 4EI5D 3D30A 1WT5C 4ZMNA 1FGNL 5GS3A 1YUHB 4EI5A 3TH4T 3ROOB 2EKJA 5E7FA 3L3GA 2XN2A 3W9EB 3MBXH 2GFBA 4Z1PA 3ARWA 1I3GL 1A5FH 4JRWA 4WFED 2VDPH 2VMCA 2QKIC 4L0YA 2ZOLB 1NANI 1LLAA 3MJ9A 2OAAA 1E30A 2WLLB 1G6RL 1D5ZB 1F56A 2EC9U 3KZ8A 1MNUL 2WXJA 1FVCB 1YMMA 1FGVH 5HGDA 4FLOA 1MJUH 5A2BA 2JXMA 3GSQA 3ILDA 5B1KA 3QJFA 4PJEA 1EBPA 3O2WL 3SEPA 1Q72H 2VT0A 3SPHA 1Q9WA 2WW8A 4PP1D 3FO0L 4PJCB 4RMUA 4NCC2 3X17A 4X9FA 3KBPA 1MCOL 4FQHB 3JTBA 2C3WA 3OJVC 1QP1A 2P8LA 3D0LA 6PCYA 3MJGX 1QWUA 1ZTXE 2A9BA 3OKEB 2R2CA 4LVEA 4XVUD 4OFIA 4JKWA 5GGTA 4HLEA 2PYED 3BD3A 4R7DA 4F15C 2IAMB 3EFDH 2X2JA 4OZHF 1BQHB 4A6YL 2YN5A 1CFVL 3TU6A 2DQTH 1MCSA 4FQ2L 3V0VA 4AQ8C 4N25A 4IBVA 2ZWNA 4ZOBA 1D7FA 2SEBB 4AM0B 1QG3A 3QPQD 1E8ZA 1DBML 1DCEA 1ZT4B 4GPVA 4GG6A 5GS2H 4OV5A 1IBGH 1TQVA 2QVKA 4QI3A 4CSSA 1XGYL 3MNVB 4F7CA 3RWIA 1IE5A 2ZSVA 1A9EB 4KU1A 3RVUC 3MVSA 2XHNA 2O72A 1DDTA 2KLSA 4XI5D 3IPFA 4PJ5E 4NN7C 3L48A 1ROCA 3MLWH 2VDRH 4ODSL 1G7IA 3OAUL 4AH2A 4A2EA 3MGAA 1OAXH 4DPRA 1IJNA 4Y4FC 3QBTB 1F00I 5EU6A 1KJ3H 1CGXA 1IBBA 4GBXA 2BOLA 3L3DA 1MVYA 5IVOA 3NJKA 1XF5A 4FTVA 4U1HA 3WJLC 3WUWG 1ETA1 1YEKL 5HHNB 5T5FL 4A2HA 5L6YH 5FGBC 2FYYB 2ZZUT 1NGZB 3A22A 2ADYA 3FHAA 3MOAH 4YE4H 5D1ZB 4N5ED 5C6WH 5B7FA 4XN8A 3KDMB 2P8PB 1IAIL 1GYCA 4XHQA 2BOBB 3V0WH 4BM7A 1R33A 1MI5D 3G7TA 1ORSA 4TSCL 3RZCD 1WZ1L 5C0CD 3V6FB 3ZZQA 4N0RA 1CICB 2DJ4A 3LS4L 3MMEA 3RRQA 1C1EL 1WBXA 3TIEB 1GGBH 4W9JC 3N0PB 2NNAA 3DHUA 4LAQL 2O6PA 3MC0A 4IM8A 4OZHE 3L6FB 4Y4KA 1ZE3H 2NMSA 3O2DA 2B59A 3N42B 4KZCA 1JNHB 1WFTA 5KVFL 1Q0XL 3BPCA 2EKSA 1IKOP 1C08A 1AIFB 3FQWB 3PS6A 5IIEB 1G84A 3STZA 1SEQH 4U1SB 1NDGA 4HSQA 5AKTA 5FLVA 3ARQA 3VRJB 2J1WA 2NYYC 1G9NL 3F7RA 3VFNA 1MSPA 3US1A 3FAWA 1DQLH 1WFMA 2OKMA 4R2GC 3G5YB 3TO2A 2UXFA 2WIMA 2G75A 1J48A 4U0QB 4WV1A 2ZTBA 3NFSH 2Q2LA 3FTVA 2KLRA 3OX8A 1I1FB 5EA0H 1ACYL 4Z7AA 5IB2B 3SD2A 2JCCB 1EO7A 5LG1A 1DQQB 4DCQA 4JKLA 1DR9A 1BX2A 3TTYA 5E51A 4N0FA 5CSZB 3H3BC 5E8NB 4DP0X 4HUNB 4JB9H 5E1AB 2LAAA 1NGYB 4KJPD 3VXMB 4M93B 2QQKH 1P6AB 3HKFA 2ZKHH 1NM9A 3PWJA 3QEQB 1HEHC 4ZNEA 1WEJH 1W9XA 5AVVB 1T80A 1L4IA 3MFFB 1I8MA 3MODH 5TE4L 5EZLB 1DZBA 3EBHA 2F19H 1SJXA 4XVJH 1J9CT 4IHOB 3WLBB 3ZTDC 3GBNH 4GS7C 3F04A 4UT7L 2EEAA 1WG3A 2EIDA 2LFGA 2WGXA 3M8OL 3QYCA 1NC4D 5F7HA 2VJ0A 3GJFH 3JWNG 3KVDD 3MREA 4LB8A 4QRPE 1DJYA 4LCWB 2F7OA 4XRCA 2QVFB 3BP7B 1ES0A 1YPZA 4NUJA 5GS0C 4HUVA 2P5WD 1Z9MA 5B8CC 3HE6D 3I6LD 2ATKA 3O3BA 3KPTA 4N9GA 5FHBL 3DYOA 1G1YA 2H4EA 3NH7L 4KKCC 1BMGA 4UCFA 1CQYA 1TCRA 3OJDB 1MHCB 3B1TA 3TFKD 5I1DB 5M94B 4EEEA 1HXMB 4G8GB 2BSSA 1ZLUK 1SDDA 2WOYA 3FXIC 4HKZB 4AM0Q 4DGUA 3IFOB 3TEWA 3V10A 4WW2F 5EEYA 2ESVB 3DUUB 2B1AL 1A7BA 4TOYH 3N1MC 4X6DA 2AS5M 4LLYA 5I66B 3QZOA 3WGVB 1OB1A 3IETB 1N0LB 2P42B 2J2ZB 2UYLB 3LKRA 4LCIH 3V5KB 1A8ZA 1FNGB 2LU4A 1V7NH 2NQCA 4MA3A 1JV2A 3UJTL 3HC0B 3Q1EA 3I3EA 5DFWH 3NABL 3QORC 1ID5I 3MRCA 2V9RA 4PRAB 3NJNA 4KGLA 4M1GH 4MD0B 3LMJL 2COQA 4RESB 3U4KA 3WY2A 4O51B 2WYHA 3ARDB 1RUAH 4QAMB 1PD6A 4ZUVA 5TDOA 4BYHA 4UQCA 4XNYH 5HGBB 4EO5A 5FK9B 5CFAA 1ZK9A 3I50L 4JZOB 5CCHE 3LEYL 1DEEA 3APNA 4NQDD 4XPTH 1TJHL 4E5XA 5B1AB 3OB8A 5EZPA 1J1XH 2G9KA 4RMVA 1KSRA 3QISA 1U8MB 2YD4A 1KLFA 3NVQA 2A73B 4JFFD 5I0VA 4YNYB 3I2CH 5L8LB 2A9MH 4KROD 2YKLH 3LIZL 1IARB 1FFOA 3ZQWA 4RFEA 1OHQA 3C2AH 4ZRGA 4OIAA 5HGAB 3VDBA 2F54E 4FTDA 4NWTH 1K2DA 2DMCA 5JDSB 1FGNH 4AV0A 3GTVA 5I6PA 1FF5A 1BVKA 2ATPB 5J11C 4B97A 4YDKH 3P4MB 3MKKA 3C60C 2EEDA 3VX0A 5DUMH 5HGHB 3UIYA 1E0OB 5TE6H 4HGWB 3ZMNA 1JSYA 1QRNA 1O7SA 2BZCA 2NUTB 3IS1X 3PL6B 4BK5C 1UT9A 3G5VA 5C0GB 1MNUH 3GBML 2ITDA 3VSQA 3OKOB 1E50A 2NTFB 3W9EA 3SOBH 3IDNB 4MXWH 3QYMA 1UXSB 1G4MA 1ADQA 4YSQA 3O2WH 3C8KB 1IBDA 3N43B 4OH2A 4N8VB 3PUUA 2WLLA 3F58L 1D5ZA 1JZJA 1H5BB 2B16A 2E9GA 3FO0H 3LKSB 4PJ7F 4C4KO 2G3ZA 2AJ3A 2DTML 4AQ1A 4MJ5B 4HMEA 1MCOH 3FSZA 1RZ7L 3HW7A 2R69H 1D3CA 4P46B 3V0JA 1CBVL 4NQCE 3BWAA 5AG9A 1P5UB 4M3HA 1RUPL 5DEGB 3W5NA 3FN3A 2FEJA 4UU9B 3KYAA 4OLVL 4U1IB 3QVAA 4MS8D 4Q9BA 4M6NL 1RJZB 2NY6C 1OOWA 4FQ2H 1RK7A 1V3KA 1A6AB 1JI1A 1WGVA 2GQHA 2JJTA 4PG9B 5TPWL 3OAZK 4LEXH 2ISDA 1XR8B 1DBMH 5B7EA 5JTWA 4M43L 5DEJA 1FORL 3MR9B 2MMXA 2IAMA 4HHWA 2APTA 3F7QA 4ZSOB 2FJFB 5KOVC 1S9XA 3OZ9L 2N1TE 4FXTA 4L2YA 3ULSB 1ZGLM 3B83A 3FQ4A 1AC6A 3BDXA 1XIWC 1U95B 4ODSH 5DHVH 3OAUH 3U4BH 3IGAB 4CU6A 4GP4B 5E6IC 2BSED 1QLEB 2EDEA 2Z6FA 3SBWC 5FYKE 5A2KH 4AIXA 2O5ZL 4YAQA 5KVGH 1TEYA 3PJNA 2R4RL 5DWUH 3VGFA 1A9EA 4EI0A 1UCTA 4Q2ZB 1S5IH 2DWEB 4H25A 2D3VA 4R4BB 3LYRA 2VLJD 3GPEA 1X6LA 3B9VA 3ZHKA 2BJML 7TAAA 3QCTH 4P2RB 1ACCA 2NCMA 3I84A 4UIMB 1IJ9A 1RI8A 2JJUA 1SHXA 3FTGB 3X1NA 3VGHA 4JQIA 4XCEB 4DOHB 4LSVL 2H2PC 4BKTC 3FSWA 1XCXA 2VYRE 4XX5A 4YXKH 2FYYA 4A1RA 2DKSA 4TSCH 2B3RA 4LHUG 1MAKA 4XVSH 5D1ZA 4NAJA 3UFIA 5JIHA 4FNSA 3BEVB 2WLNA 2NUPB 4KRPC 1D5MB 3J2PA 5BRZD 1C1EH 4FXGA 3E8VA 5B1BB 2CM5A 4HJ0C 1RHFA 1EO5A 2ZICA 1KIQB 5IOPB 5AQ0A 4ACTA 1T6VN 1QMUA 2ADIB 2FBJL 3OC5A 3BE1H 4BRJA 5GZOC 5I9QC 4BA8A 5KVFH 5BPPA 3V6FA 2P8MB 1CICA 1MIEL 4X99B 2R83A 1JF1B 1PCSA 5GXBB 3JT2A 3OKMB 5L8KB 1G9NH 1U8NA 3L6FA 43CAA 3PP3K 2GPZA 2GW5A 2YGVA 3DPDA 1JNHA 5BZDB 5JXEC 3LEVH 4YN3A 1THAA 4LSSL 1AIFA 4JFSA 4PRPB 3RB7A 1XD1A 3IB4A 4GT7A 3QWOA 4XCYA 3VRJA 5IHHA 1H3UA 2E59A 1ACYH 4DP6X 3HBQA 1KTLA 3RUGE 4FABL 1Q4NX 4DZ8B 2X41A 1L7IL 4LLWB 4YHIA 4NQUA 3PWPE 1SJEB 1WCBB 5CKGA 1LEKB 4XMKL 4DPCX 1PU0A 3ZDXB 3V8OA 4JMXA 4B0MM 4GQQA 2YAHA 3KPNB 3TBSB 3BKYL 5GRWA 4N0YL 4IRZL 3K2MC 1JYVA 4ZXBC 2JCCA 5DJXB 1AGEB 2AVGA 3VDCA 4WFGE 2GJ6A 3VXMD 4TM9A 4NB7A 2EE9A 3QEQD 5CSZA 5TE4H 4HCFA 4AQEA 1SJVA 1V55B 2ZXGA 1E5AA 4N5UA 3M8OH 4XBEL 1JRHL 3V4LA 1KBPA 5LBSL 2K45A 1MAML 3EFOB 4XAKD 5EZLA 3CBJB 5I6XC 3EGSB 3L3OA 5KSAC 3TBYB 4IHOA 3N1GC 3WLBA 3O3UN 4X5XA 2AJUL 3BIBX 5DD1L 2VABB 5DD5L 3A6CH 3FL7A 3G6DH 3NH7H 5LQBH 4LCWA 2NLJA 4Y1AA 1T6BX 2R9HD 3FT4B 2FHBA 3L1FA 3BAXA 5LGHH 4UQIM 4MZ2A 4X4KA 3K5RA 2W0PA 2BVQA 3ECBA 1WWAX 5EIIB 1EXHA 3U46A 3N5AA 2MQGA 2QSCL 2ESVD 3UC2A 3QHFH 3OJDA 5ID0A 3QUZB 5FA3A 1PQZB 1AANA 2KUTA 4X4MA 5I1DA 2DMKA 4CU8A 4G8GA 1KG0B 1CU4H 2VKWA 4YOKA 2KQMA 4I7ZC 1WHPA 3IFOA 1SF5A 1VENA 3RPIB 3RWDB 2ESVA 3DUUA 3NDYE 3T6ZA 3US0A 3RWHA 3NABH 5IFJB 1AXTL 3ZW3A 3V7AE 3KEDA 3MCYA 1Y18B 4N0UB 3EJZC 3LMJH 4KO6A 3IETA 3QG6A 4HS3B 3V5KA 1VGKA 1UEYA 2R0ZH 3RG1C 4HKJB 3HC0A 4U33A 2AEPL 2F8OA 4TVUA 3ARDD 3KH3A 4IKJA 2GAZA 4PRAA 3RL2A 3LEYH 4M7LT 2ITFA 4QT5B 3VACA 2OBGA 1B6UA 1TJHH 5J13B 3R1GL 2WBXA 4X6FB 3CX2A 5A2FA 3UYRH 4M7KL 5INCA 1C9SA 4UDUA 3FRPG 4Y7OC 4TQHA 5HGBA 2CWRA 2F1BA 3NCBB 1S7UB 4CVZA 4L5FE 4NBXB 3F00A 3UCQA 2XPZA 4TVPL 1U8MA 2IGLA 3FU0A 4P5RA 4AGNA 2Y1YA 4YNYA 4HLZG 1E9QB 4PJFE 4TS6A 2YQ3A 4U2YA 4GO8A 4YSUA 1SBBA 4XPAH 1BFOA 3GK8L 4TULH 4OJDH 1BIIB 1FL6B 5E9DE 2XBDA 4G7SB 2I26N 4G42B 4JDTH 3Q5OA 3Q8FA 2HX9A 1IVLA 2ATPA 4NDMB 3SN6N 3P4MA 4PAZA 5CLZA 4K3GA 1UKSA 3PWLB 1I1YA 4PY8J 4X7FC 5HGHA 5CGBA 4QRRA 4HGWA 3V6BR 3QWRA 4DPBX 3PL6A 3QUYB 3D85D 4U31A 4Y2DD 2NUTA 2UXTA 1ZRUA 5CCGE 2FB4L 1ED3B 4QPEA 5K39B 3A21A 5F7DB 4Q14A 3OKOA 2DTMH 3J7HA 2NTFA 3S5YA 1RZ7H 3O6FC 2HRPL 5GIRA 2D3NA 3DX4A 1EH9A 1JG9A 2VZVA 2QGEA 1QFOA 1X9QA 4MDJA 3EJCA 1UATA 1U58B 1AO7E 2WLMA 3ZHDA 4P46D 4H1LH 1SF3A 5SWQA 4TV3A 4Z7NF 4QRTA 1MIML 4J12A 1XF2B 3WYRA 2WXPA 4P46A 1IBHA 2B15A 1TIUA 4UMSA 3RY6A 3LKOA 5FO9B 1NSNH 5E4IA 4EDXA 4AQOA 2C7UB 1IFHL 2APFA 3EDFA 3ARYA 3OZ9H 5D7LE 2BOCB 5CZVH 4G6FB 4MXQD 3A0OA 5ITFB 3CTTA 1WISA 3QA3A 1DO5A 3U83A 1AVAA 4GKLA 5JUEL 2WWKO 3ZVVA 1JWMA 1SOKA 2D0FA 2B4CC 3G6JF 4HIHB 4ZSOA 2FJFA 5FB8B 4PWGA 1DQTA 2XVLA 2WLKA 5A2CA 2W81C 2R4RH 1SFHA 1HQ4A 2JI1A 3ULSA 5DVLA 4XN9A 4NBZB 1A47A 5JHLL 1FLTX 3CAFA 3UZQB 5DD0H 5IMLB 3IGAA 3FCSB 3T65B 1W16A 3BUDA 1F8TL 2E56A 1AKJA 1VGEH 3IWVA 4NRYB 3U7YL 3VD5A 3MYZA 1E2ZA 4JCLA 5DJ2B 2ZKMX 4GKSB 1R47A 2DWEA 4Q2ZA 2ZYHA 4R4BA 5DLMH 4U1GC 4LSVH 3KBFA 4P2RD 3QYNA 3RHWK 5DJ0B 2K9UA 1QPPA 2PP7A 1OALA 3B9KA 4KKBC 1NGWB 4TRPH 3JWNH 1L7TH 2G5BA 4GMTL 1DO6A 3DECA 4UIMA 4MNHB 1T22B 5C0NC 4YSPA 2HKHL 3B3BA 4GO9A 4JFTA 1YN7B 3GHBL 5IOKA 3FT2A 4XCEA 3T0XA 1IL1A 3PHOB 1YEIL 3IMBA 1JGLL 2H0PA 5DK0A 1RZQA 3DDFA 4OZHB 2Q20A 4N2OA 2DQIL 1CK0L 2WP3T 4Z7NE 1BQKA 3QIWB 4KUCF 4P3DB 2IXQB 1ORQA 1MIEH 1D5MA 1QFWM 2NUPA 2R1YA 2XA3A 3BUBA 3KLQA 3S5LA 1KJ2B 1MFUA 3DIVA 4RVBA 5T1KD 4OLUL 4H5SB 1HH6B 4TN9A 1A1NA 4LPWA 3D3VE 4PB0H 2YARA 5BS0A 4X99A 1ZVHA 1NPUA 1P7HL 1JF1A 2V5SA 2WVSA 3TNMB 2OJ1A 3FTXA 3OF6D 5D1QD 2CUIA 2PW1B 3G6JE 4PRPD 3ZGHA 1L7IH 2LV4A 5E8OB 2AANA 2Q8BL 3LZRA 4PM1A 1M57B 5BZDA 2JKNA 5HHQA 3OF6A 1SXZA 4PRPA 1T89A 4OD3H 4IMKA 2VOTA 5CN1A 3QDJE 5IBUB 3BKYH 3X14A 4N0YH 4IRZH 4GI8A 3FB5B 1JHTB 1URLA 1UVQA 4LLWA 2UXVA 3EHBB 4D0BB 2N7AA 2V6HA 4F9PC 1WCBA 2OSXA 5F1NA 1LEKA 5I1HH 3WSQL 1GKEA 1PD1A 2BP8B 3MNDA 2H32B 1FVDB 4PUBH 3KPNA 1EV2E 3QO0A 3MTXA 2HJLB 1JDDA 3DPBB 2V5TA 3CLEH 5DXWA 5DJXA 1M7UA 1AGEA 4L1DA 4PGEA 3WTVA 3CHRA 5D2LF 3IXAA 5F44A 1JRHH 1TFPA 5LBSH 4JVPA 5I19L 1Z9NA 4BELD 2FEEL 1NCCL 3QI9A 4OF7A 2Q76B 4XO4A 3RWGB 3CZJA 2E27L 5A16B 2E6JA 2AJUH 4AKOA 3BSZH 3CU7A 1TQCC 2JQZA 2WZPA 3Q8EA 1SVCP 2VAJA 3KNBB 3NEOA 3GZOA 3SPCA 3MV7E 3ZE1F 3DJRA 1IC4H 3KVQA 3V4PH 3EGSA 1KIUB 2W0KA 3KWWB 3S36X 3TBYA 3NIFF 4HBCH 3GSVB 1J1OL 1PJWA 2VABA 3INUH 3K5SA 1XH2A 1IBZA 2C7FA 4JHZA 3PFQA 5JIPA 5C3LD 2N3JA 4R7NB 1PAZA 2QSCH 3IMVA 4PLOB 5DMJB 1YQVL 1WITA 1BZ9B 2VUYA 1TZHA 3Q8AA 4ZAKB 4ZFOL 1AKPA 2F8VA 1TEGA 2QVMA 3PNRB 1AD9B 1UWXK 1DVFA 3GNML 3G08B 4POZC 3FFDB 1L3NA 1AI1H 3DX8A 5IB1B 4G7VH 5F2FA 3EKCA 5EOQL 1S7XA 4M7LH 4HQQL 3LZQA 3JUZA 3QUZA 2RFXA 5F6IB 2J21A 3W1ZA 4N6QA 4L23A 2F61A 3QNXB 3RWDA 2AEPH 4M5SA 3OAWA 5I6KA 2X09A 3CDYA 1CL7L 5F3BA 3QZBA 1S8DB 2OL3L 1Y18A 1FSKB 3AWEA 1F4XL 4F5CE 2XWJA 4XOCA 3RPBA 4YSDA 2JB5L 3R1GH 5KS9F 3UGEA 5DQ9B 5FGSA 2FTAA 2FJGA 5D2LE 1RZKL 4ZQKB 2XPYA 5E56A 1T7WA 3FZUD 3FOLB 3GSUB 2NNFA 3F84A 2BW5A 3D2UB 3LNGA 2ZE0A 3G5XB 4K71B 2F54B 3V4UL 1QACA 4JDEB 1RERA 3ARXA 5D7EA 5TK4A 3U7WL 4BH7B 5D5MA 2KL6A 4J4PC 4O58H 1FG2B 3RNKB 3ZE1E 1HINL 2UUDK 3KJ6L 3QJHB 2EAEA 3OMNB 1S7UA 5T3ZL 1QUNA 1Z1WA 2WLIA 1P4LB 3IU3B 4LKCB 2NY4B 4PBDA 3NIFE 3GK8H 5DF0A 2V9TA 5I8EA 3U9WA 4KI1A 3P77B 4WW2B 4Q6YA 2IADB 4GAJH 2B4CH 1CDGA 2QR0A 2VDNH 4U7MA 4WQOA 1H3PL 2DYRB 4XR8C 1UACL 3OJMB 1JN6B 2AXGA 2Z8VC 4PJXE 4ZD3H 4Z9KB 1FL6A 1ANUA 3OGOE 2VRKA 4YR6B 2FB4H 2UWEE 3ETBF 1OWRM 4MLIA 5C0AE 4QNPF 4HFWA 3ILQD 4WIQA 4HS8L 3ARFC 3PWLA 5EORL 4OZFB 5EBMB 2X9XA 2J8OA 4JGJA 4LOVA 1Q0YL 2K8MA 5CBEA 3QUYA 3F3HA 5F88B 1EJOL 2IC2A 3FYIB 2IFFL 5IFHH 4ONFL 4OZ4B 5F7DA 2V2XB 3ZBMA 3TA3B 2K70A 2V2WB 1MIMH 1CWVA 3H9YA 1U2HA 4R96A 3LDBC 5DVMA 1N5YH 5EZIH 4XMPL 3CVIL 1E6JL 3VRIB 4ANUA 3VFTB 4BD4A 1U58A 3GO1L 3ESMA 1TEFA 3VA2C 2YJQA 2ZUXA 1SY6L 1IFHH 3PIQB 1BJMA 1T7XA 3H9HA 2XWEA 4FQCH 3A4EA 4CMHB 1FYTB 3OV6A 5JHDE 4BKSC 5A3IC 4PLKC 1U8OB 2BIIA 3O41A 4GINA 4LARL 4WI6A 4G6FD 1DSWA 4RSVA 5FO9A 2YQ2A 5D72H 5HHOE 2WO4A 2C7UA 5M95B 3TBTB 5JPNB 2Y5TB 4PJ5D 3QCVL 2DW5A 4JGMA 5ITFA 5EN3A 3AS1A 4DHLA 1EIBA 2C3HA 1IQDB 3H4FA 1QOKA 3DA0A 1XGZA 4HIHA 3SKJH 4JQXC 1WUNT 1UQSA 5FB8A 1IBYA 5I1JL 2E7LC 1MG3C 4LPCA 4CW1B 3ZK0A 1CCZA 3IDYC 5G5DB 1M2OA 1KXVA 3S35L 3E1F1 1OAKL 2GJJA 2YS4A 1QSEB 2APBA 5EDSA 3UZQA 1HOEA 2AV1B 5J1TC 5IMLA 1QEWB 1YJDL 3FCSA 4BIKA 4QNPE 4NRYA 4JM4H 2QQNL 4PJ7B 4NO5B 4V1DE 2R51A 3KPMA 3DIFA 4BH8A 4S10A 5F9WC 4YL9A 3OR6B 2VMDA 4APXB 4OM1L 3SB3A 4QOKB 5DJ0A 5DT1L 5I6LA 5I18L 1JPGB 2I9LB 4HJ1A 3BFWA 1JGLH 4LRNL 1CFTB 3QQ9D 4DPAX 2F1EA 2JELL 2QQQA 1SN0A 1T83A 2EEXA 1BG1A 3SGKC 3UOAB 3MRQB 1AHWB 4CC0A 5JIIA 4DO4A 4DKAA 3PHOA 1C8QA 4OLUH 1KGUA 3N85L 2H5UA 3ABZA 5F7MC 1OF0A 1UWEH 3EDDA 1IAII 1R3IH 2P46B 3QIWA 4GIOA 4HHGA 2IXQA 3MJ7A 5KJ4A 4KO7A 1KJ2A 4LLVB 1IO4C 4Z18A 4R4ND 2V9UA 4X4XB 2CXKA 1G87A 2OTPA 3WY3A 1VSCA 3OSKA 5IQNA 4ELKB 1LQBC 5BCAA 3T0VA 1JE6A 1EFQA 3AXHA 1KLUB 4P4KC 5IHUL 1KGJA 3PWPB 4NNPH 2P80A 3UBXG 3SBRA 3BZ4B 5IWLC 1F11A 3HB3B 4HOZA 3D39E 4P2CG 1NMAH 3IDGB 4U6YB 4GB9A 4PD4J 2ZP0T 2WMPA 3UTQB 4Q9RL 3VJ6A 2YD3A 2HT4C 1GMEA 4L3CB 1CG9B 3ARVA 2QEJA 3ZTNL 3EHBD 2B8OT 1S7QB 1YEJL 4OFQA 2IDUA 3FHEA 4BUGA 2WXLA 1OCWL 1EEZB 4HJEA 1B4JH 2PWHA 2OMNA 4P23B 2HZHA 3MRGB 2HPTA 1JHTA 2IDTA 4RRPG 3V52H 4B7LA 4ZW3A 4D0BA 2VLLA 4LLAA 2JKLA 2CO6A 4MJ4A 2NYZA 2D0GA 2XBZA 3TV8A 1NCCH 2HJLA 3DPBA 3UEZA 4HLZH 1JZ6A 2E27H 4XTRD 1KYDA 3M17A 4HETA 4QRPD 2FGWL 1GSKA 4R7VA 4B9FA 4ETQB 3HG2A 1UZ8B 4XMWA 4OD2B 4F2ME 4ONGL 1NINA 1FFQA 3LEXA 1ZT1A 2R59A 3BP4A 2AXWA 3GUFA 4TLKA 4WFFE 4M29A 5KJRL 3BI9X 3L13A 5HXMA 3Q2CA 1H6TA 3QCUL 3SD5A 2OCFD 1HSBA 5MEQA 1XSIA 1J1OH 4R0LA 4XPHH 2OXGA 2Q7NA 2K6WA 4ABVA 5L8JB 4YBHA 1R5VB 2FQGA 3IFPA 5CBAB 3P0VL 4WAFA 1YLBB 4MA1B 1LD9B 2BSBA 5LNDA 3DMMA 1YQVH 4OLWH 2MFNA 4Y16B 3BPNC 4I0CC 5AEAA 5CGTA 3VXOB 3CDZA 1I82A 3GSVA 5F7NC 3GNMH 5E08L 5KVGE 5TDNB 2EVJA 3PV6B 3MJWA 1QNZL 3EYOB 2WP3O 2W0LA 1CLYL 1TO5A 2ADFH 5EOCJ 4UTBH 4JZJC 4ZAKA 3L4WA 1I8IB 1H6FA 2P47B 1WBYB 4P5SA 4W4NA 5BMFH 1MLCA 4F7MB 2J43A 3G08A 3WJMA 2XOTA 3FFDA 3SJVE 4NOBA 4LPVA 3BCFA 2DM4A 1AY1L 1PEZA 5DVNA 3GMMA 2UVFA 1A14L 1BEXA 1PZAA 4DP4X 2YUZA 2YK1L 4G71B 2JB5H 4FG2A 5TQ2L 3D2TA 1W0YT 3MRRB 2UX7A 4LEBA 3KPRB 3C6LA 4N2AA 1J7VR 1KCBA 2PCFB 2J71A 2VDOH 1S8DA 1G4RA 5F9AC 3HS0C 1KEMH 4AITA 4UZGA 5BV7B 4GRWH 4JRXA 1ONQB 1FCGA 2ERJC 1VFBB 4HIEB 4UT6A 4XO3A 1UM6L 3V4UH 3D2UD 4O9HL 5I0YA 4YGAB 5KOMC 2DMGA 1EGJA 2X6UA 5HDBF 4MZRA 3RI5F 3CJJA 4MKTA 2HN7B 1FG9C 2F54D 4Z7VF 1HINH 3KJ6H 3IFLL 4PBVC 2XG5A 4W9HC 1LMKA 2K6ZA 5T3ZH 1KACB 1U30A 5EN2B 1R3JB 2W8CA 2AFNA 3K2KA 2HP4A 3MACH 3G5XA 1CGVA 3U6XA 2RA1A 4JDEA 3V0AC 3PHSA 3PUCA 2NY4D 3VQ1C 4ZUUB 3V4VA 3HLKA 3GMLB 3FNKA 1FG2A 3RNKA 2CGRL 1TDQA 2MPAL 1G7LB 3QJHA 1H3PH 4XMLH 5DZAA 5C6TH 3TCLB 4RZCB 1UACH 1P4LA 3IU3A 4KJYB 1GOHA 1ZWIB 1MUJB 3P77A 3WN5A 1NFDF 2IADA 4P5TB 1KB5L 2V5MA 4PRDB 3BRGC 1XB8A 2IALA 2AEQH 4Z0BL 2Z8RA 1N8OE 1JF5A 2B14A 5E4EC 1AR1B 3SGJA 3N2JA 4GI6A 3ZL4L 1S78D 2A6DB 2QFPA 2R23A 3RDJA 4Y0GA 4KHXL 1L9SA 1Q0YH 4AZ8B 3K4DA 5IBLC 1OL0A 1NAML 1U91B 5C07E 1EJOH 1IB5A 5DVKA 1BXXA 2IFFH 3AAZB 4ONFH 1BLNB 2Y25A 1AO7B 1QX1A 3ZYOA 5DEFB 4EMZA 3VB8A 2X3BA 4KNSA 4OZFA 5EBMA 3PP4H 3OM3B 3IMRA 4Y5XB 4X7CC 1RZGB 4XMPH 4ATWA 3TA3D 5JIKA 1E6JH 5L2JB 5CXPA 2NOYA 2XNAB 1H6EA 3TOPA 1U8IB 1RZFL 3SGEH 1CFSB 2EE6A 1QSFE 2H7WA 2V2WA 3Q01A 2K7QA 4GEIA 4QHMB 1MLBA 5D7LB 3MLYL 2DOCA 5HDBE 2XZQL 1NMBL 3NJHA 4LARH 1AQDB 3WY4A 3VFTA 1FYTD 5ICUA 1OSYA 4KK8C 4Z7VE 5E1IA 2CHZA 3T8XB 3SDAC 3R8BB 3DHMA 3KWTA 3UBHA 2DEWX 1FYTA 1I8UA 5DURB 1EFXD 1U8OA 4UANA 3QUML 1Q9KB 2WTOA 3JVFC 3ARPA 1XF4B 2WXQA 5B39B 1ETB1 5I1JH 4TTDC 1Z66A 5EO0B 5LO7A 1JGVL 1F1GA 5JPNA 3QRGL 1CI3M 1IGYA 2Y5TA 3VYPA 3UL4A 3S35H 5EOCL 4LPXA 5IROD 1KULA 2CPUA 5T1JA 4XP5L 1V05A 5E8EB 3DHJA 4WWOA 5C08A 4QHUA 3H7BA 4B9PA 1IQDA 1YJDH 2YSTA 1B3IA 3L7FA 4I9WD 1ACZA 2NNRA 3WIHL 2DQCH 2Y2TA 2E7HA 1QSEA 3KPQB 5DT1H 5TDPB 1OCOB 2J1KA 2J8UE 3O4OC 3ZYZA 3RL1A 4GQ9H 4IIZA 4LRNH 2A4CA 4HIXH 5HI4D 5EO1B 2V5RA 3VXUE 3D0AA 2LVCA 2JELH 4GAFB 4PJ7A 3DOHA 4LSRL 3EYFB 4K7PX 1KYUA 4AKQA 4Z7NB 3OR6A 4PJAE 4QOKA 5I1EH 1YEEH 2V8LA 1JPGA 3CSTA 5L4JA 1XCQA 4OAWA 4HLJA 1U93A 3MU3A 2NZ9D 4IKKA 2C9VA 1E4XH 3L5WB 5LAXA 3SPVB 2Z93A 1AHWA 3GBDA 5AB0A 3D3VB 3I9AA 4XVOA 4RFNC 1G9EA 3AG1B 1GGCH 1I9EA 3CVDA 3EJJX 2YQGA 4RWHA 5FCSH 3ZL2A 4Q9QL 4Q89A 3G6JB 2EUVA 4NIKB 2CGZA 1N68A 2O6EA 4LLVA 1GHFL 2AJSL 4X4XA 2VDPB 3T0EC 3PWPD 3FB6A 1YUKB 3QDJB 4Q9RH 2LTQC 1F90L 3HB3D 1HE8A 1K4DB 1R9FA 4ELKA 3LN4B 1OZTG 4YK4B 1KLUA 1KPUA 4G72B 1FNFA 5CO1A 2JE8A 3W56A 2NR6A 2HMIC 1MW3A 2VZ3A 3IDGA 4JHBA 4U6YA 2IMNA 4WFGD 5D9SB 1T5XB 3UTQA 2EVHA 3F64A 2WXRA 5JORB 4Z3TA 3LKPB 3IJYA 1CG9A 4APQB 2H3NA 2WQSA 1KIPB 3HA0A 2CIIB 1KY7A 4G70B 4Q0XL 4P23D 3VFPB 4X9BA 1GS8A 1D5XB 5DJAB 3UP6A 3GGWA 1S7QA 2EDKA 3TX4A 4XCCL 5DMIH 3RJQB 1NBZA 4RAUA 3O2DL 3P2TA 4P23A 3MRGA 1M71B 3NTCH 2FGWH 2QADB 1II4E 4YUEL 3ALPA 5DJDA 1NWPA 1NWOA 4ONGH 1QYGL 4B9CA 4IRSC 4PWJA 2R29A 5KVDL 3S36H 3MA7B 2Q3ZA 5KJRH 4Z8FL 2C3XA 1HZKA 4X6EB 3T0WA 4ETQA 2FZ3A 1UZ8A 3U0WH 1BQHG 3EZJB 5EU3B 4OD2A 3K6SA 1XFPA 3ZR6A 4PCTA 2M83A 3P0VH 4HC1A 3QQDB 4L3EE 1ASPA 1WSST 5DUBA 1IKNA 3R4RA 1JI2A 1P7BA 1DQDH 2KDGA 2P5EE 3GTNA 2NY0C 4H0HB 4J27A 3U9PL 4YDJB 1IT9L 1JRHI 1K3IA 3EH2A 4AGOA 2VDRB 1M3IA 5E08H 1M42A 1QNZH 4NQQA 1R5VA 3TA4D 4M61B 3I6GB 2UV3A 1CLYH 4FKEA 1JXKA 4G9DB 1E5BA 4WJ5B 4Y16A 3NGBC 4TSAH 1U3ZA 2MRYA 2O5XL 1EAPB 3HC4L 3FU7A 4K94C 4KK5D 4WEBL 4YC2B 1FH5H 2YWZA 3KS0H 5GRUL 1X5FA 1IAKB 3PV6A 3F5WB 4OLEA 3EYOA 4XN4A 3JV6B 3S88L 2E7DA 3TN0C 4E9XA 1XR9A 2KLTA 4JFQB 3O3EB 3SE3C 3MUGB 4KRLB 1I8IA 1XV8A 1WBYA 5E23A 4URKA 3IK2A 1RCYA 3MNZB 1A7NL 4ZOEA 4K3EL 5CCKL 5D2LB 3EH4B 4NYLB 3FDWA 4FQXA 1R6VA 5JPMC 1MELA 1JIBA 2OCJA 1UM6H 4O02L 4O9HH 5CP3A 4ZUTB 3KPRA 1SPDA 2DQJH 3EH1A 4RLDA 3R7QA 1J5DA 3ZT6A 4ECNA 5AB9A 4AGLA 1AXSA 3T0DA 3Q05A 4J2XA 3UPAA 3IFLH 2W9DL 3LKNB 4JANA 4P5MA 5HDLA 4LZKA 3IVKA 3ZE1B 4KY1L 5ILTL 3RWJB 4C56E 1AQKL 2N0MA 3SE4C 1VFBA 3U4EB 4K23L 4JY5L 4WO4B 3PAVA 3ZE2F 2GBUA 3EDEA 1HH9B 3E3QC 1TJGH 3NIFB 3SKUD 1F3JA 2WM0A 5DQDL 3NA9H 4JCWA 3BDYL 2ZXCA 2CGRH 2MPAH 5E9DD 1R3JA 5EN2A 3OC8A 2D2CC 2E9WA 5FDWB 3NJMA 2HJFA 4M8QB 3CDFA 4NCDA 1E28B 1TTAA 4ZPVA 3P3UA 1J0ZA 4UNTA 4KMTH 5GZNC 1KB5H 2DWDA 2IWEA 3LRGA 2FWSA 2G2RB 4P9ML 3SDCD 3GMLA 1WAAE 4AW7A 1G7LA 5DZVA 4Z0BH 3NCYS 2F0CA 5C0AB 3TCLA 2J5LB 4OSUH 4P5TD 1SVBA 5FF6B 1J5OL 1QASA 5D71L 1F18A 3FAXA 4KHXH 1AR1D 2EDLA 1NAMH 3ARGC 5JQ6H 1BYNA 2DWXA 4ZFZB 1G7MB 3S2CA 5BO0D 4UUJA 3FFCA 5I5RA 1MN4A 2YD5A 1KGIA 1JMXA 4P2OA 1IGTB 1AO7D 5KS9B 3GUTB 4AZ8A 1TETL 2VC2H 1JPEA 1L9RA 1U91A 3UJJH 5EV7A 5C0FB 1U2YA 1RIVL 2IBZX 3GJFB 2H47C 5I71B 4JFEA 2XN9A 3CZEA 1KZQA 3E2HC 1OGTB 5DZLA 3MLYH 4Y5XA 2XZQH 4YSCA 2WBJC 4JRLA 3L45A 5JHDB 4ODUB 2EABA 4ENED 5L2JA 2XNAA 3HMWL 5AOKA 15C8H 5D7LD 3REVA 4KFMA 4F80A 1IFGA 4PJHA 4D2NA 1QA9A 1T0MB 1CFSA 4OGXH 1M7DB 3B5HA 2ROXA 5AOMA 3ZE2E 3RGVB 1Z5HA 4LXFA 1GA2A 2CMRH 2OJZL 3B2XA 3UDWA 3W11C 3GJFK 4KITB 5D7JB 4Z0XB 4F8QA 1Z5LB 3QUMH 1AQDA 3VMOA 2DN7A 4RMQA 2ZKWA 3HNVL 4OCRH 2RCSL 5DURD 5HGGS 2OV0A 1OPGH 5F0MB 3T8XA 1JGVH 1JYNA 4BZ2H 2FUQA 2D3JA 4OY9A 1OVZA 3OKYA 1MFAL 2XIIA 1KBGL 1Q9KA 1KV3A 2XVKA 2QKIB 3LNDA 3CIAA 1XF4A 5B39A 2Z9TA 2R56L 4MD5B 2X4QB 2BZ7A 1AC0A 1LEGB 5ISZE 4V1DB 4BSVB 3MCKB 1Z7JA 1P4BL 4XBPA 4Q6IC