1MHCB

Model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histocompatibility antigen/peptide
molecule keywords MHC CLASS I ANTIGEN H2-M3
publication title Nonclassical binding of formylated peptide in crystal structure of the MHC class Ib molecule H2-M3
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhcB00
1F4AA 2FJFB 1U8LB 3W2DH 2BC4A 4WGWB 1C16A 1Q9LA 2VE6B 3WHE0 4XP1H 5DD5H 2X7LB 3V5HB 5EC2A 1NMBH 1HHJA 4X4XA 5F7EL 2ENSA 5D1QB 3BYYA 3H9YA 4NN5C 5DD6B 1HI6B 1A5FH 1DBAL 3HAEG 4PRAB 1YEJL 3SPVB 4HKJA 3LS4L 1DDHA 5JQHC 2HT2D 2JIXA 4HQQH 4PG2C 4FQHA 4QRRE 4J8RA 2DIBA 2WV3A 2Y36H 4LKXB 5I1HH 3NZHL 1ITBB 1F3JA 3L3OB 3U7AA 1AJ7L 4GKSB 3U6RB 1G9MC 4O2FA 2AV1A 4N8PA 2P5EB 4XBEH 4Y1AE 3RVTD 4UNUA 1WSST 1XCQB 4ODBD 3SDDD 2X4NA 3ZDZE 4BUHA 2B20A 1H15A 4OLZL 2A0LD 5FYLL 1DQJB 1K9TA 2D0GA 2YA0A 1T7WA 3FJTA 3PWPA 3UAJD 2WP3O 3PIQB 1T1WB 4JG0L 1L7IH 4MNGE 4XB8A 2NXZC 3MLZL 3CH1A 1EV2E 5IG7B 4EI5A 3EO1B 4N68A 1H3PH 1ND0B 1FGVH 4HEME 5F93C 1AFVH 1KNOA 2QHRL 3G5ZA 5DUBA 5TE4L 1OAQH 3B9EA 4GG8B 5LXGH 4TUOB 3FB7A 1RV6X 4GRLA 1ZT7A 2L4OA 3C8HA 3U9UB 3FFDA 1YPZF 4I9WD 4MQ7B 1QRNE 3SO3B 1CLZL 4XGZA 2GTZB 2YS4A 4BKLA 2IAMC 2V2WA 5AAMA 1ADQL 2OZ4A 4KVCL 3WLWD 4ZDHB 5B39A 1G6VK 1BLNA 1EZVX 1Z5LA 3D2UA 3NA4A 3BIKB 4ONGL 1U93B 5EZIH 3C60A 2P49B 1QVOB 2BVUA 4PJEA 1FFPB 1FL5A 4P49A 3ULUC 3H42H 3TT1H 5E70A 2G75B 2B8OT 4V1DB 4NC1C 2AGJL 4L1DA 5B3JE 4B50A 4LEOB 5HHXH 4OCSL 3TESA 4Z6AT 4UV4L 1KCLA 4C57C 3QFJE 1KLUA 5IJVB 3HE6C 2NY2C 4Q9QL 3DLQR 2BVQB 4Y4KD 3TNMA 3VXTA 3QIWA 3UTPD 1U3ZA 1F02I 3E6HA 3DXAB 4ZOAA 5BMFL 2QBWA 2H6PB 4I5BA 5IFHH 2XY1A 5J06A 4MSWB 4PB9L 3TBWB 4X7SL 2FYYB 3QFDA 1Z9LA 5CEZL 2YD3A 3OGOE 1WIOA 1WAAF 5I9QC 4XAKD 4N0FA 2BXYA 4Y4FA 5FECB 4HUMB 2VLLB 2PYEA 2I07B 2W59A 4NT6B 1R5WA 2OTWA 4G8GE 4RISH 5HYJB 4B0MM 4D9LL 5EPMB 4CW1B 5DJ8B 1UQSB 4M3JA 1FN4A 1T5WB 2VUOA 2D3VA 2W0PA 1N6VA 3TYGH 1D5XA 1D5ZB 4R7NA 2YPLD 3MXVL 4F15C 4PJDE 3QWOA 1U8OA 3GSNB 1MCQA 4HLJA 4Z8FL 3KXFA 1OAKH 1PW3A 3O45B 3ULVF 2W60A 3RU8L 5T3ZE 2DM3A 3R8QA 1CK0L 2AQ3A 1CXLA 5I19H 5DS8A 3L5XL 1KB5H 4WW2A 1UH4A 2DL9A 1NJ9A 5F72S 1GPOH 2DLFL 2ZCHH 2GY5A 2HFTA 3OB8A 4J3WA 4NRXB 3ZYIA 1A3LL 4U1JA 3EO0A 1CICC 1HXYB 2XWJA 4P3WA 3FAWA 3EW3B 4OFYD 2VXSL 1BAFL 1K2DA 5DJ6A 2VSCA 3MSPA 3AM8C 5DURD 5E7BA 3QCVH 4L9LC 3RGVD 4QRRB 4PTTA 1MNUH 2Q6WA 2BJMH 1QFWI 1UH2A 1IZJA 3BH9B 4ZXBB 2HFEB 3P2TA 4M5ZH 5I1EH 4ODTH 3KPQA 2R0ZL 1VFMA 3GO1H 3T08A 4JFDB 3H7BB 1YMHA 4X8XA 5GRUL 5C0BD 4MAUH 4OSUH 4U1GB 1QKZH 5TDOB 1RIHH 2EXWD 4G7YL 3T1FA 5EU3A 1IC7L 1YMMB 3VFGL 1IAOB 1OB1B 2A9ML 3NFPB 4Y16C 2J8UA 1UXWB 3MODH 3G5XB 3MV01 3O6FC 5MEOA 1OWRM 1JNLL 2JK5B 1WBXA 3U36B 5ENWA 2UYLB 5MHSE 2EYRA 1NMCB 3B6SB 3RDTD 2WMPA 3X14B 4EDWL 1QRNB 3QEQB 1IC4H 3OR6A 4RFEB 3DOSA 4YO0A 3ARBD 4PRHD 1UEMA 4NQSA 1X5ZA 4Y4HD 2A6DA 3WNOA 5I1LA 4BJLA 1MFDL 1MI5E 5DVNA 1Z2KA 4YPGB 2X4RB 2NTFA 2P7TA 1FVEB 5D7LD 3OAZK 2XXMB 4F2MB 3VXSE 1RZGB 4KQ3H 4UBDC 1KCKA 1HKFA 3AB0B 4Q97A 4OBSA 1FFNA 3QFJB 5ANME 3EFDH 1T21B 1X9QA 3UTQB 4ZFOA 4HHAB 5CJXC 1R3KB 4M5YH 3NFNB 1MVUB 2VISA 3HMWL 4K8RC 4JRYD 3NMEA 1T03H 2VDRL 3VFNA 3WIHL 2R69L 1JGUH 2AI0H 2J5LC 1WFNA 4YGVA 4GKZB 2DYPD 5DGRA 1LO0H 4NPYB 5I17A 4G8GB 2Z8WC 3WS6A 1IGIL 3MV7A 2DWEA 1U95B 1KN2L 4ODVH 5HI5C 1I85A 1N3NA 1A8JH 2OBGA 1YQVH 3A6BL 1NFIB 4TVPH 4PJDB 3JWDL 3EOTL 1AY1L 3VFOB 1T2JA 4RZCB 1U3HC 3UYRH 4M8QB 5DEFB 3DETD 5TF1L 1I8KA 4M9OA 3HI6L 3VJ6A 1H3XA 3LS5L 1N0LA 2AXFA 2VR9A 5BW7A 5KSBE 4X6BB 5IOPB 3DARA 1NC2D 1MFNA 4M48H 4XB7A 1JPSH 3HC4L 2F54E 1YY9C 3EIFA 3AS0A 5JORA 5KVFH 5MERB 4PLNC 4YHYB 2VQ1A 1ORSB 4K7FA 1ZLSL 1EHLH 3O0RL 3V52L 2IG2L 3OL2A 4LDEB 4XH2A 3HE7A 4HS8H 4NYLA 5B39G 5DJYB 2H32H 1ZS8B 5F96H 5IMLA 4G8EB 1ZAGA 5DJDB 4ZFFB 1YEEH 2YMXL 3QUXD 3KYMA 4KK6C 4L8SA 5IVXF 2H2PC 2PTUA 4N8CL 4M7LL 3HG1E 5AZ2H 4XPAL 5GGSA 2OX5A 1T1YB 3JBG7 3QI9A 4PYHA 3QDAA 3VCLB 4YFLF 4MLIA 4LAQL 2DKMA 4DN4H 2AK1L 3ALXA 4MLSA 5DMIL 1RUPL 4GFTB 4F7MA 1FNEB 3T3PF 2FEEL 5LCVH 4JPVH 3D1MC 1A3RH 5ACZA 1DJSA 2FGWH 3P4MA 5K9QG 3HFMH 3EBAA 3LQZB 4L5FH 2VDLL 1CGUA 4E42B 4HUVB 5D93B 1P4BH 5EIIA 1VACB 5FB8A 1R3IL 2VDKL 5D1QD 2ESVA 1QD0A 4UUJB 4D0DA 1RVFH 3PWUA 5EBLA 5DMKA 1DVFC 2YK1L 5JHLH 1IM9D 1MHPL 5DTFB 5EU6E 1EO5A 4J23A 1EJ6A 4TULL 2PKDA 4M1GL 1JPFB 4ZUVB 4K94H 2P5ED 4NKMA 4O2CB 1IGYB 1P7KB 1HZHL 3ORJA 4EIGB 3HI1B 2ATPA 5HYQA 1MI5B 3FO1A 2PF6A 4O02H 2VLRB 1BQSA 4FQIL 3MLWL 4X83A 3ULUE 1Q1JH 3L5JA 1WFOA 3EOBA 1MFCH 4NC1E 2OTUB 3EGSB 3VXSB 2V7HB 4Z7WA 4ZSOE 3FFCA 3UO1H 4G6JH 3VH8A 2YPKA 5DQ9A 1Q0YH 2X40A 3C5SA 5T1LB 5ANMB 3VFRA 4YWGH 4OZGF 4QRUA 3MA7A 2XXCB 1BQHB 4U0RB 1A6ZB 5B4MD 3IFPA 4UU9A 1ONQA 1XF1A 4K2UH 1ZA6B 2OR9L 2ZCKL 1IBGL 1RZFH 5J6HA 2ENYA 5EULV 4P5TB 1FPTL 4BH8B 1DQDH 3OG4B 4LQFL 4PJGE 2HVJA 2VB5A 3S7GA 3RKDC 1C12A 2XZCH 1E28A 3BD3A 3U46B 7FABH 5C0GA 4KI5F 1UG9A 5EUOE 1KJ3L 5E5UB 3UDWC 4KJWD 2R23A 2ZUUA 4CBPA 3NFSH 5KSAB 3MJGX 5KSBB 4IRSB 4MCYB 5EN2B 4UMGA 5EZOH 2H9GA 1T22A 3K46A 5H94A 1RUMH 2F54B 5GXBB 5ID1B 5F9AC 4L8DB 5SWSD 3SKOB 1PY4A 4Y5YB 3QXTA 5C7XL 1QQDA 1UYWH 3LH2L 3IFLH 1EEYB 2LTQB 5HY9B 4HJGB 4NM8H 1WWAX 1F45A 1ES0B 5EO0B 1MJ7H 1F4HA 4CKVX 1A4JB 4OM0L 1U2HA 5HGBB 3C6SA 6FABH 3W5NA 1AD0B 2UV3A 4HT1L 3QQ9C 4G6MH 4NO5A 4RAVB 5AYUH 8FABA 3HG1B 1F2QA 4NN5B 1KGCD 4KJQC 1I8LC 1T20A 2WBKA 1GJIA 1P69B 3HHRB 5IFJA 5GGRA 1NLBL 1S7QB 1FNAA 5DVMA 5BJTB 5IF0B 2A73B 3W0WD 4WV1C 5IHUL 1NAKL 3CUPA 1CE1H 4U6VL 3C5JA 1TJIL 3D3VD 3O41B 5FUOL 2P5WA 5E7FA 3QPXL 1PFCA 4YK4B 5C0AB 5DJXA 1FZMB 3IDXL 4FFVD 4KK8D 5D7SL 5F3BB 1KENL 3WJLC 1D9KD 4YZFF 3VFUA 3MFFB 4JR9L 4EZMA 3V4VL 3G6DL 1TLKA 4IMLA 1IVLA 4Z78B 5C0RH 1EXUA 3KDMB 5AD0B 4DZBB 5DZLA 3SO5A 4N5EC 5FHAL 3DWTA 2J6EH 3EJZD 3LV3A 4LSUH 1G0YR 3CC5A 4ZD3L 3MUJA 4I18C 1R3LB 4XP5H 5E6IC 4BELD 3FO2B 1X5AA 5IESH 1FIGH 3A6CH 4AM0B 3H3PL 3HI5H 3EYVB 5I71C 4JZJA 3O11B 4M4RA 2IAMB 2XKNA 4Y1AD 2PO6A 1DP0A 1FFRA 3L3HA 3VG0L 4X7DC 2Y5TB 4DCQA 3I2CL 5JMOC 4LPCA 4XVTH 4FABL 2FZ3A 2CK0L 5IROA 2XY2A 4OUUA 4ZSOB 4G8IA 1I1FB 2IBGA 3CNKA 4HK3N 3RTQA 1S9YB 3D9AH 5E8OB 2R8SH 3PHOB 3BE1L 4Q0XL 4YXLH 5TQ0L 1MJJA 3DUHA 4HIHB 3QCUH 3RA7H 2Q20A 3DV6B 3HE6B 2NY2B 2VZSA 1PG7X 2VDMH 4LFHD 4YHLL 3MV9A 1CFTA 1J12A 1X4ZA 4OCRL 1DBML 1MJUL 4LCIL 4F9LC 1U58A 1JTPA 3GGWA 1ZHBA 3VXOB 3EHBD 5E4EC 1J1PH 2PETA 5I9QB 1EO8H 1A0QL 3HNVH 4Z18A 2G60L 4PJGB 2GFBA 3SOBH 4NGHL 3P77B 4POZD 3NIGE 1I1AD 1OD9A 2AJSL 2QV2A 4HUUA 1IL1A 4L4VE 4D0CA 2A9NH 3PGCB 1IAIH 4U31A 3JSSA 4NP4L 4F15B 4RGOL 3BEVA 3LQAH 3P4NB 3IDGB 5HGDB 3BKMH 2XWBB 2DQUL 4DN3L 5L88H 2I27N 1MREH 4NQDA 1EHNA 3MLXH 4YHIA 2IPUG 1AO7E 1U8KB 2OXGA 3UBXI 3SE4A 4PGBB 3BKCL 1V3LA 2IH1A 3R0NA 1J18A 3T4AB 2FBOJ 2X6MA 4R4NC 5FUZH 5KSVB 1DE4A 3PL6A 4JFOB 1CFQB 4PREB 1QLEL 2QTEA 2BY2A 4GKOA 3MLSL 5I2IB 1SJVA 3DROB 4OI8A 1CICB 2ZUTA 4YHZL 5I66A 1AGBB 3PXHA 4JFZL 5GGUA 4JQIL 1M4KA 2AJXL 1NFDA 4TSBL 2VZUA 3BGMB 2RFXA 4GJTB 4RFOH 4X5XB 2PCPA 3L7FB 1N5YH 2EYTA 4HPYL 4L9LB 3RI5K 3VH8G 1NAMH 4AIZB 1FL3B 2F53A 3ILPA 1S7XB 4MD5B 5JW5B 5EBWB 4J3XA 4IDJH 1ZA3B 1K5NA 4A6YA 5EIVA 4M62L 2BMKA 5IMOB 5C0DA 1AI1L 1DFBL 1FYTE 1FZJA 4ZQKB 1WV7T 4KUCD 4RIRA 2WBWB 3HR6A 1MLCB 1HDMA 3WO4C 1HQRB 1PSKL 2YBRB 2ZWLT 2HLAB 3LB6C 4QRTA 4ZUWA 5A43C 4MDIA 2ADGB 2ZOLA 3ARYA 4LVHB 1PX4A 3O6FB 2APFA 3RHWK 5CSZB 5J9PB 1S7VB 2DDQL 5HYIA 1IAKB 1BX2A 3QEHB 1N59B 3QXVA 5I74C 3RVUC 5KVDL 4EI6A 4WY7H 4KPHL 4NQXB 3QIBA 5C9JA 3C8KB 3WXWH 1A2YB 3ZZ1A 3SJVE 3NOIA 2Q8BL 3FQTA 2XI9A 4M7LT 4BQCA 5LGHH 5GZOD 1IGFH 4AG4H 4QXUH 1XF5A 1B88A 3FQUB 1SMOA 3I3DA 1H5BC 3MROB 4CDHA 1KIPB 4YHPA 3KLHC 2C9AA 4HWEL 4IMKC 3GSUA 1GOHA 4MGXA 1YC8A 2DN7A 3EDEA 4IEFB 4EN3C 1HSAA 4WO4D 2E7BA 5FKAB 4JDVB 3ZE0E 5FYJU 2ZPKH 5BO1H 4RA3A 4PGCB 4GSDL 1AXSA 5MENE 1G6RH 4M7ZC 4UINH 3GNML 5BVPH 1IGCH 2ZOKA 1KJMB 3IDIB 3SKUD 3VD9A 3I6LD 3TPUA 4GG6A 1AHWC 3MLTB 5GHWL 3ZDXF 3WN5A 1BVZA 3CK0L 4LGPB 4YFDB 4F37K 1MI5D 1TZIA 3QG7H 2OMNA 5GS2D 3GMMB 4CVXA 4XNXL 3IJHB 3G08A 4LARL 3MBEA 1E4WL 4EQ3A 4GW1B 4GW4B 3BP4A 1AGCB 3OPZL 1Q9OA 1MJ8H 4L4VB 5C9KA 3DNKA 1U3HB 1A4KB 2VRAA 3FONB 3K80A 4WWKC 3ZMRA 1OY3B 4TSCL 4Z95L 4JFQA 3STZA 4HS3A 5ELIA 1RD6A 4MXVF 3L5IA 1QG3A 5GGSY 4ZS6D 1AO7B 4MX7A 5EWIL 5HHME 2DQJL 2AXHA 5D7KE 3CZFB 4MJIA 4JFFE 1FO0B 3HLAA 1F6AA 5EOCH 3WIFB 1LK3L 2VUYA 3QH3B 1XGTA 4P5TD 3LRGA 4W4OC 5F9OL 2ZG1A 2GK2A 4YXKH 1G7JA 4JCMA 3VWKC 4KHXH 4IOSD 4O00A 1IT9H 3GM0A 4PS4H 3QULA 3QA3B 3U2SA 1P7QB 3BD5A 3MX0A 2GEEA 1KN4H 5CD5C 3L3JA 3EYOA 2FIKB 4KI5D 4N90E 4JCLA 3IJSA 4RCAA 4TNWF 1UM5H 4KRPC 5D9SA 1FNGA 3LQMA 5FM5M 1N64L 1C5BH 5IW6B 2BSED 1RK0A 3BFOA 5BS0E 1P4LA 2CD0A 5C08E 4C58B 4U49A 1NGYA 3EJJX 3I02A 1C5DB 1QBAA 4XP6L 1FYTB 3QR2A 4ODUB 5CGYC 2DJSA 5C6WH 8CGTA 4OZ4B 1NCDH 4NJAL 1W8OA 5CEXA 3HZYA 1Y18B 3OXRA 5C86A 1RHHB 2X41A 1ORQB 3OKEB 4NQEE 4NWUH 1KJ2A 3MJ8A 3HZKA 4M61A 2BVPB 2AQ2A 1WIPA 5ALCL 4EKXA 3D39D 2FX9H 3SDXE 4N0YH 2QSTA 4WI6A 4PJ8A 3SJVB 4JFHD 3IAQA 1BQLH 5F7KC 1SJXA 1NQBA 4UIKH 4WNQB 5IHBA 1NGWA 1OCWH 2Q76B 2HKHH 4ZO6A 3KLDA 4C4KO 5JUEH 1RZ7L 5E2WL 1VADB 4UB0L 5EOCJ 1ETZA 1LO3L 1LEGB 1NKOA 3CVHL 2NXZD 2K7PA 4GRMA 2FWOA 1D5BB 2Q87A 3OF6A 2Y07L 4OGXH 4HG4K 1CGSH 5E99L 3U1SH 3B4NA 4QXWA 5FO9A 1A6VH 3FL7A 4HUWA 4JY6B 3GSVA 4LLUB 5MENB 2AJYH 3Q6FB 3QUYA 2HJLB 4G7VL 5EU6D 2EDTA 3D85B 4F7TA 2P24A 3MRGB 1CVRA 4KVNL 4KJYA 4LASH 5FV1L 2X10A 3IXTB 3WL9A 5JW3H 2P45B 4JDTH 2IAMD 3HPJA 2Z8VC 1D5IL 5K59F 3I6KA 4KUZL 2VDPL 3HRZB 1J8HA 4XBPB 2C3GA 3SE8L 4ZMAT 1CF8H 1XGQA 1CT8A 3DRTA 3PV7A 2ZSWB 3QDGA 4NO0A 1BJ1H 4LHUA 4GS7C 5DYOB 3WXVL 4BQ6A 5FAAA 3U7YL 1JK8A 3DTXA 1P5UA 3MRKA 4QHKJ 3DGGB 4QNPE 3J7HA 1S7TB 3D18A 1UKTA 4X98B 3T1WA 1N5AA 3MNVA 1LO2L 1DLFL 5JOEA 5A2FA 4MJ5A 5HHMB 3VFSA 2VLJD 2DWDB 4N0UA 3BT2L 1V05A 4MAYC 1BREA 4R4BB 1LO5B 3BVNA 5ESAA 3M17A 4PR5B 3P9WB 4X5WB 2MHAA 2XZAH 5EU4B 4PRIB 1BZ7B 1DR9A 1SEQL 4OCYH 4APQA 1F4XL 3AREC 3OKLA 2O5ZH 4GAFB 3PABB 3LEVH 4XVJL 1O0VA 1KB9J 5CJQH 5CSBA 4XWOD 1ERNA 1NCWH 2WIIB 1C7SA 2VL5B 3O6LL 4ALAH 1NPUA 1FSKC 3PUCA 3ULVH 4BK5A 4PJXF 4UTBL 4P2CG 3KYAA 3B9KD 5BS0B 4EI5C 4WV1B 4LP5A 3VW3H 3QB7C 4U1LA 1KYOK 2FX8L 4WTXA 5CJBA 5C07A 4LLWB 1MCCA 4NQCA 5C08B 1CBVL 4CADA 4NIKB 5GIRA 4GRLC 4AEHH 4O2EB 5E2TL 4R26L 4PJ9A 1G7PB 5JOPE 1KTDA 3T8XA 2R2HB 3C2AH 3DGCR 1JL8A 2BVOA 5D5ME 1ZT4B 2DKUA 2AJVL 2EE6A 5DI8B 5KG9A 3MJ9A 1YECL 3C60C 2EH8H 1PKOA 1J1OH 4ETQA 4LCUB 2X4SA 4K3JH 4OCXL 1NH6A 5E8PB 4RMSA 4I18B 5E6IB 5DHYA 1TQBC 5F70A 5LG1A 5KJRL 2CRYA 2HAZA 3I50L 1B0RA 3U4BH 2EDRA 3U4EA 5I71B 9CGTA 4PJAE 3K2UL 2ITDA 3WFCH 4NM4H 3SY0B 3CU7A 2P43B 4YHMH 1I3GL 3O3BA 4UDTA 3KPPB 1R3HA 4URTB 4OJFL 2YRZA 1CGTA 4OLUL 5EFIB 4OLXL 4Y4FC 5AAWA 4XVUC 5D70L 5GSRA 4XVSL 32C2B 5DGQA 4Y16D 3HRPA 3VFVB 2GAZA 3SKNA 1PQZA 1SY6L 3RFZC 3O6FD 3MYJB 1OVZA 3TJHD 2EDYA 4WHCA 1DCLA 3DIFB 2GJ6A 2FR4A 4KDVA 2AV7A 1N4XL 1QFUL 3EYUL 3MRCA 4UILL 4HMCA 2WWKO 1L6XA 3UC0H 5DK3A 1E4XI 4YIQB 1U8IB 2OL3B 3VXUA 5IB2A 2UUDH 3IDMB 2K1MA 1BFOA 2XIDA 4LVEA 1CDYA 1RJZB 5E4EB 2CDEB 5DD3L 1PG7H 5I6XC 4WW2C 3CSBA 5D2LA 3G6AA 3ZT7A 1XGRB 2VC2H 3ARGD 3MRIA 5T5FL 4I77L 3X3GL 1KCSL 5HDOA 1TNMA 4JHZA 5F3HB 4U33A 3X11B 4PRPE 3MNWA 1EEZB 1EGJA 4P9HC 2R0KL 3OR7A 3ULSA 5FO8B 3U0PA 2IADB 5F7MC 3WHXB 1FCGA 5CD3B 4JO1H 3RVVC 3CFJA 4DFHA 4K8RD 5L9DH 5JW4M 1JBJA 3MUHL 4PJHF 1KT2B 4FZEH 4GXUM 1I9JH 3KPSE 4Z7VA 3FTGB 2XN9B 3M1BA 5L2KD 4HFUL 5EOTB 4HCRA 2EIZA 3EDFA 4OF5A 3LKPB 3BPLC 3P4LA 5HHOE 2VLME 4KC3B 4E0RB 3L6FA 3CPLB 4KMTL 3WYRA 4LHJB 4TTDD 4QHNA 2A74B 4LKCA 5K9OA 2CDGA 2UWEF 4HMEA 5CJOH 4J4PA 3GSOA 4J7RA 5EDXA 2B1AL 3L3GB 4H0IA 1OTUD 4HDIB 1I7TB 2OMBA 5ALBH 4Q6YA 1NBVL 5BZDB 1W0WB 2IPTH 2HTLD 4DWHA 1HNGA 3R1GH 4NZUH 3EZJB 5E1HB 3BKJH 2CDFB 4YHOH 3N85L 3ZL4L 3FO0L 2VLKE 3BWAB 4PGEB 2P8PA 3SPVA 1GGBL 4NFDA 3WO4B 1PZUB 1FNFA 5J11C 3H9SE 3V5KA 1YJDH 4X6FA 1AKJB 1WIUA 4K3EH 2VOTA 2E9JA 1FL6A 1OL0A 3MC0A 1IQWL 1I7UB 3HAEB 5CINH 3WDIA 4U6YB 3L3OA 1AC6A 2WBJA 2R1WA 4LHUG 4NZRL 5IB4A 2H8PB 2R4RH 5I74B 3B2UC 3VDBA 4Y2DA 4JANA 4DZ8B 4PJ5E 3O6KL 1TTFA 3V6FB 1MFBH 4TOYH 1YA5A 4PJAB 1X5XA 4LCYB 2BNQD 1DQJA 2FB4H 5KANG 1N8ZA 3ARDA 3JV6B 1V8HA 5DLMH 2ZUVA 3FO9A 5HGHA 3CXDH 2H45A 4WEUD 5FYJE 3Q6GH 1H5BB 1I3RA 1FORH 3IKKA 4CNIA 4XNUH 1F90H 1ND0A 1MPAL 5INDA 1A1NA 3FMGL 4K9EL 4EN3B 4GG8A 4C56A 1OTSC 2D7TH 2DQFB 3LOWA 1RZJC 2CKBB 3E0GA 3WS6C 1DVFD 1GGCL 4OZHF 3V8OA 4RGNC 5TDNA 1P6AB 3JVGA 3VWJB 1FAKT 1I85C 1WWWX 1IKFH 2IFFL 2UZIL 2MQCA 2VKWA 3L95A 1SM3L 3BYTA 4M7ZB 1SYSB 1HOCA 5AZEH 2O93L 1UWEH 3BDXA 5JQ6H 4JJHA 2G75A 1AHWB 5BW7C 3PP4H 1Z9SA 3PNWA 5HD8C 1U8HB 1OAZL 2RAMA 4N9GB 4D0BA 4GAGL 1BGXH 5CUSH 1KLFA 2RGSA 4P3CL 1KIRB 4H25A 3S35X 1E6OL 3KNBB 5IJVA 7CGTA 3WNMA 4RWYH 1QSVA 2WW8A 2Z31D 3T77A 4HIJB 2DD8H 1EMTH 1MSPA 3HE7C 1KC5H 1X7QA 2W0LA 3I85A 4DKEH 3QUMA 2XA8L 5DWUH 3NCYP 3O2WH 4KROC 1A7QL 4WWKB 1EUUA 4F7EA 4OLWL 1WBYA 4L8SC 3QJFA 1RSFA 4P57A 2W1NA 3UCRA 2AK4A 1YNTB 4G43A 4JPIA 5KOMC 1UCTA 3GDBA 4J3OC 3QI9C 4CW1A 4Y7MA 4QLRA 3V5DB 5ADOH 3VI4F 3KPSB 5HGGS 3RJDA 3T2NL 2GK0A 2YEZB 2MTPA 3HNTH 2IGFL 4DW2H 1W72H 2AQ1A 5FOBB 1IILE 1I8MB 5DRXA 3VWKB 3GSNA 5BZWA 2GITB 2Z0BA 1OW0A 3RKDD 1G0XA 4HCRL 3O45A 4KHTL 3MRNA 4TRPL 5HHOB 1QFWL 5EC1B 1QEWB 4AL8L 1N0XL 3PWVA 3GRWA 2NPLX 4NKIL 3BUTA 2UZXB 3BDYL 3IDNB 3PWPE 4GAJL 3JWOC 2H3NA 4KRPB 5CHNA 1VGKA 2BSRA 4ZNEA 4JB9H 5HHMD 4XCNA 5HTSA 1CG9A 2OP4H 3IETB 3K4AA 3O4LB 4S2SA 5D7KD 5INCA 4JFFD 3TCLB 1HH6B 3PQYA 5SWQB 1J05B 1MF2H 2Y06L 2YKLH 3DX6B 4XC1H 4R96A 1HILB 1IQDB 3FT3A 1HXYA 4A2MA 3HC0B 5C0IB 3NN8B 4XNMB 1WWBX 1TTGA 5GS0L 1CFSB 4NQVB 2VLKB 4BZ2L 2G2RA 1T1ZA 1X5HA 4GQPH 4BZYA 2FX7L 2GYSA 2CGRL 2ZUXA 3FOLB 3QDMA 4PJEE 1A9EA 3BZ4A 4PG9A 4X9FA 4I4WB 5H2BB 1U8PB 4BQ9A 2EC8A 3EDJA 3GEWB 2ILLA 4GKNB 4PJ5B 3OKDA 1FZOA 4JFDA 3VD7A 1E27B 3Q3GA 4R4FH 1QOKA 4PB0H 1NCAL 5C08D 2IH3A 5E8EA 5LGJB 5C71A 4ODWA 1RFDL 5HHVH 5I1DB 2H1PL 4HXAH 4RMWA 3ALWA 2E7LC 3G5XA 1WZ1H 2JK5A 1TCRA 4QHUB 4PIRF 1C1EL 2UYLA 1Q9WA 4IRZH 4UT6H 4YDIH 2XACC 2PYEE 5I16A 3BAEH 4Y0GA 2BSTB 2VR5A 2NQCA 3BN9D 3LIZL 4LSSL 3X14A 5CCKL 3QEQA 5DC4B 3STLB 4PV8A 3IB4A 5HDQL 1JMXA 3P11L 4NQED 5L2JB 3UJJL 3O4OC 3GBML 2PXYD 3DX7A 2C1OA 3WV0A 3OV6A 3MMEA 4GUPA 1S9KC 1G7HA 4K7PL 3RWEA 5IT2L 1YYLH 2EH7H 2OSLA 2JE8A 3MGOA 3QXAB 4YLQT 5KVGH 2WNGA 3AGVA 3KXFE 2YUWA 3H8NA 3WUZA 2CJUL 2X4RA 1QFHA 2GT9B 5E9DD 4ODHL 1FVEA 4H8WH 1A7NH 3JZ7A 1DQMH 4F2MA 5D1ZA 5DUPL 2PR4H 2ICCA 2NW2A 4ZUUB 5FDWA 4WU5A 1ZT1A 3AMKA 4I8DA 3MUZ1 1VKXA 3MLPA 4HUXA 1U91B 4NDMA 4WI7A 3UTQA 1QBLH 3FOMA 3NFNA 1X4YA 2BC4B 4GS7B 2Z8SA 1JNJA 1C16B 1DLHB 1Q9LB 3GSXA 1RPQA 4YDKL 2W9DH 5EC2B 4PJCF 3AFLA 1KCVH 1MQKL 1PD6A 3D25A 1HHJB 4X4XB 5T3XD 3MLRH 3EAKA 1RHFA 1S9VA 35C8L 3DV4A 1CI5A 1XGPA 4NPYA 3K8MA 3CX2A 4HKJB 1DDHB 2JELH 4PJIA 2X4TA 4KKLD 1UWXK 4MAYB 2JIXB 4FQHB 1S7SA 3HMXH 1FRGL 1T83A 4J8RB 4QRPA 4M7JL 1U95A 4TUKL 1J1XH 1F3JB 3QIUD 4WFGD 4OT1H 3AREB 4O2FB 3GSNL 5CIPH 5TE7L 4M8QA 3PGDA 3RIFK 3DMMD 2X4NB 4X6BA 3V7AG 1H15B 4NZDA 1QYGH 1F58H 1OTTD 2N7AA 3PWPB 4KRNA 4YBLC 5GJSL 4F8QA 1FSKB 1FC2D 1AE6H 3VGBA 3S36X 3CH1B 4S1RL 4JRXA 2J8UE 4PJFF 1ZEAL 4EI5B 2P4AB 3ARFD 4GBXD 5D1XA 1KNOB 2FHCA 5K9JH 5DUBB 4HC1L 1KB5A 3I3EA 3FB7B 5DT1L 1ZS8A 1ZT7B 4WFEE 2CLVA 3DVGA 1MRFL 4JZJC 4XGZB 4BKLB 2V2WB 4LDLB 2NY5L 5ERWA 3VGEA 2PO6C 4L8CB 2OJEA 1J0JA 5B39B 1BLNB 1JJUA 1F97A 1KF9B 2LFGA 3D2UB 3QEUB 4JM2A 4U1KA 2X44D 1T1YA 4XP1L 4U3CA 4LVOC 3VCLA 1A14L 3C60B 3EKCA 4PJEB 1I1RA 1FL5B 1K3IA 3V6ZA 1XIWD 4DUVA 3S5LA 1JP5A 5IROC 1I3VA 4FQ2L 4LQ1A 1ZHNA 2DMBA 3RTQC 3G04A 3VXMA 5HXMA 4Y5XA 1TQBB 5DMGD 3WO3B 1KLUB 2QJDA 3LQZA 3LKRA 2APXA 4XPGL 5I1HL 3MTRA 4E42A 5GGQH 3QZWA 3TNMB 3VXTB 1RUKH 2W92A 4JFED 4E41D 5JOPD 3E6HB 5ILTL 4I5BB 2ADFL 1I9IH 3K8KA 2DQTL 4U7SA 1JHLH 1WLHA 3GB7A 4X9GA 5IVZB 3QFDB 2MKWA 1IEAB 4KMLB 4OLVH 4XBGB 4N0FB 4Y4FB 2PYEB 4LSTL 1HK6A 3VGHA 1R5WB 2OTWB 2ZKHL 4NO3A 5C6PB 3C87A 3SQOH 1NC4A 4QRSA 3B2VL 1MCRA 3MLYH 4ZUVA 3MV7E 4RGNE 4WIQA 4LGSB 5IR1A 1HYSC 4M43H 4XRCA 1R0AH 4R7NB 1GZPA 3QWOB 4ZUTB 4MA8H 4HK0B 4R90L 2EE2A 2WSKA 2W60B 1Z3GH 4AEIH 1UACH 4XZUA 1T66D 5ICZA 2OTUA 3EGSA 2OK0L 2V7HA 4ZOEA 5DS8B 1OHQA 5I6XB 3SE4C 4WW2B 2ADIA 2F5BH 4DVRL 1URLA 4WDIA 1NJ9B 4X80H 3CDGB 3IS1X 3IF1A 3L5WB 4P2OD 4EN3D 3PL6C 1NDMB 3HUJA 4YDVB 4NRZA 5F6HJ 1J87A 3VRJA 5HJ3A 3U4AA 4U1JB 1CR9L 3EO0B 1A6ZA 1RIVL 5GGVY 1E6JL 2XWJB 5CZKA 1ZA6A 1FV1A 3IXAA 2ZUSA 2XZQH 2RHEA 3NCMA 3UTTD 1K2DB 3VU2A 5DJ6B 2BDNH 3QWRD 4BH8A 3QUZA 3L1OH 4RGMC 5C6TL 3CJJA 4ZO7A 2HJKB 1ZANL 2UVFA 2Q6WB 2VTFA 3E3QE 2BY3A 3WFZA 5E2JA 1ZTXL 5JHDD 1VGEL 5IBTL 1NGPH 4IS6A 4LCWA 1CCZA 1YMHB 2RIKA 5T3ZL 5EN2A 1HHIA 3BPLB 1TETL 4PRPD 1EPFA 2G9HA 2BNUA 2WUCH 1RUQH 4WWKD 2VXTH 1IRAY 3T1FB 5EU3B 2J8HA 5HY9A 2F5AH 3P3YA 2ESVE 1FNSL 4P4KA 2J8UB 3SGKC 5C0CA 2E6JA 3GSRA 4MXQD 4ZS7H 5MEOB 4TYUA 4LF3A 4OB5H 4NNPH 2I60L 5ISZB 4N8VA 5ENWB 3GI9H 4FQ1H 1Q9KA 2EYRB 3KPSD 3OKOA 4JO4H 3RWGA 1RULH 3QIBC 4Z0BH 1T5XB 1FBIH 1UM4H 2XA3A 3OR6B 4L4TA 1JGVH 4M6AA 3RX7A 4YO0B 5C2BL 2DQEL 3OZ9L 4JKPL 4NQSB 4U3HA 2X1XR 3GM8A 1RZKL 5J11B 2A6DB 2H32A 3A67L 2CRMA 4DK3A 4OIIL 5I1LB 2VLMD 2VZ3A 4MB5A 4HPOH 2VN7A 5FYLD 5SV3A 2VIRA 3GKWH 1F3RB 4QOKD 3O41A 5KN5B 2P7TB 3INUL 4KRPD 4RQQA 2HFGH 3MRLA 2B4CC 4Z7WE 3FFCE 4FXGA 2M26A 5CSGA 2GJZA 1FFNB 2F58L 5F3BA 4K7PY 4GXVH 5A3IC 4ZFOB 1JWSB 4OFKA 2MJWA 4M5ZL 3KDMA 2VISB 1A7OH 2QADD 4UQ3A 4ODTL 1MEXH 1S3KL 2X9YA 3MRBA 5T1DL 2XZZA 3FQRA 4DZBA 3S88L 3VFNB 2BOBA 1LP9F 4YGVB 2JKXA 3H9SD 4U2YA 3WN5C 1F6LL 3T0VA 4ERSL 4FXKA 5JOFA 5I17B 1S7RA 3MBEC 2VXVH 1E4XH 1QZ1A 4UQ2A 3JTTB 3MV7B 4RGNB 2W65A 3MODL 2DWEB 1FFQA 3KPLA 1D3CA 1H9VA 1N3NB 1NDGA 3MACL 3UXFA 3LRSB 3CX5J 4U1IA 1OP5H 2Y5TA 3CGTA 1I8KB 3DJ9A 5ETUA 3VJ6B 2AXFB 1MIEL 3UZQA 4NUGL 4LSQH 1V5JA 4YQXH 1KTLA 1I1FA 2X4OB 1S9YA 5I0DA 4M7KL 5GJTL 4I2XA 3BZFA 2EDNA 1RURH 4OZIF 5JORB 1M7XA 2VQ1B 4QGYA 4K7FB 1XFPA 4HS6A 1HNFA 4FFWC 1AQDA 4XH2B 3HE7B 3HPLA 4NC0B 15C8L 1WT5A 4KROB 5IMLB 1KELH 3NCJH 3RIAK 5LAXB 3S35H 3KYMB 1HINH 4QEGA 3S5LG 4ZAKA 1LE5A 3ZHDA 1A6UL 4W81A 3KPNB 4HW6A 3S37L 3QI9B 1NCCL 5TPWL 1ACYH 1D6VL 3A0OA 3KYKL 3MPCA 4LPXA 1CDBA 1MFAH 1Q72H 3PXJA 1INDH 5CJ5A 1MCWW 3PGCA 2R29H 2P5WE 3QZWG 3P4NA 2CO6B 4F7MB 5KS9F 1SVCP 5ACZB 3K74B 1BPVA 1JPGA 3WSQH 2BNRA 3CMOL 4XWGH 1TCMA 4I3RL 5IMMA 4OKDA 2XQBL 3VGGA 3SCMA 4H20H 1J5OL 3TO2A 3AUVA 2A77H 5EIIB 2ESVB 3T4AA 3PWUB 1MIMH 5EBLB 5DMKB 5SX4I 5F7LB 3GJFH 3KG5A 4JFOA 3T3ME 4MA1B 1DEDA 4P9ML 1AGFA 4MJ2A 3UTSD 3ZYOA 5C0NC 2FD6H 3OXSA 5BQ7A 4PJ8C 1F4YL 3BGMA 3MRPA 2Y7QA 5EZLA 3OBAA 4NKMB 5C2UB 2Z4QA 3WE6A 3L7FA 4FZ8H 4DOHE 2ATPB 5HYQB 4XMLH 5FCUH 1CLCA 1A21A 1LEIA 3MGTB 3IU4H 5JW5A 3PWPD 3FB8A 3EOBB 3M8OH 1MH5A 4MNHA 3QQNA 4Z7WB 5DSCB 4YX2H 1G9ML 3FFCB 2BXZA 3W9EB 3VH8B 2YPKB 5DQ9B 3C5SB 4LOUC 3E1F1 2HWZL 3RPKA 3SGEI 3VRLE 3GIVA 4ENED 5ITBH 3QUYC 3HNSL 4GRLD 1ZMYA 1GOGA 4QRUB 3MV9E 1QBML 3SDDA 4HAGA 4AEFA 4I3SL 4H1LH 4OF3A 4R7DA 3H9HA 3IFPB 4UU9B 1ONQB 4ONFH 2YD7A 3UJIL 4X6DF 4EOWH 5J6GB 3WFEL 1MWAH 1H3WM 3WIIH 2VZOA 5J6HB 2IJ0C 5E08H 3MBXL 2HP4A 3C60D 1KCRH 4ZTOL 2QQKH 1Q94A 3QPQD 3U79A 2HVJB 3ZKMC 5CKAA 2B7DT 1E28B 2J6EA 3O4OB 5C0GB 5CZXC 1FJ1A 5EG6C 1LO4L 4LEXL 2NCMA 5TQ2H 1OP3K 2Y4SA 2R23B 3FQUA 5GRWA 4H0GA 4TQEH 1KSRA 1GC1C 2EZ0D 5MEQA 1Y6KR 3ULUL 2QQNH 3GUTA 3QIWD 4NQDE 4NO2A 4YE4H 2H9GB 1T22B 4X9HA 5H94B 2DLHA 3EYSH 1UZ8A 4XNYL 4ELMA 4N8VG 1YEDB 5F1KC 1QQDB 1CLOH 4U1MB 1CZ8H 2PYED 1GSMA 3GJEA 4APQC 1IMHC 2V2TA 1T80A 3WCYA 2MQ0A 5T3XH 3CVIL 4BA8A 4D8PB 3C6SB 4NJ9H 3THMH 2F19H 3MLTA 4NO5B 4Z7QF 8FABB 2KBGA 3B5HA 1NFDE 5FYKU 4KQ4H 4HWZA 3KXFD 5DD0H 1T20B 2DQIL 3GMMA 4XPTL 4K3HA 3RQ3A 5GGRB 5IFJB 4K23L 1ZLVK 1L7TL 5DR5H 3CUPB 2F53E 1Q8MA 4RMRA 3C5JB 4XI5C 1U92A 3ZHLA 2P5WB 1ZXQA 3WFDL 3PDDA 1U0QA 1FGNH 5DJXB 3FONA 1KJVA 2HT4C 4PJ9C 4AZ8A 2YPLA 1LVEA 1B3JA 3RWDA 2V2XB 3MRQB 3VFUB 5JA9A 2VXQL 4IMLB 4XCEA 4QWWC 1CTNA 1G9NH 3VFMA 1EXUB 1FO0A 2NY6D 4O58H 4YBLB 3ZYZA 5JO5A 3LHPH 2OJZH 4P59L 1I8IA 1QR1A 3IFNL 25C8H 4PRNA 2QQLH 1NMAH 3LV3B 2FATL 3OJMB 3UZVB 4GT7A 3CC5B 5I8EA 5ICXA 4X7CC 1JZ5A 3MCLH 4KKCC 1P7QA 5KW9H 3U0WL 1CTOA 3WLBA 1GIGH 4G42A 5KVEH 4JZJB 3ZE2E 2XKNB 3QHZH 1OAUL 1J9CT 2PO6B 1JYWA 3L3HB 3VDAA 3HUJF 4CN4A 4DOHB 1BP3B 6FABL 5I76A 4XP9L 2C7UA 4LVOB 2C5DC 4DCQB 3NTCL 3C08L 1NEUA 3ZTNH 2FZ3B 3RGVA 4OUUB 4BH7A 5I1JL 2R0LH 1S5HA 4G8IB 2UVEA 3RTQB 3IJYA 1HHHB 1A7PL 2WLYA 4KZEL 1CXHA 2OXHA 1TTUA 1NAMA 1MJJB 2IFGA 2FEDC 1LMKA 5LQBH 3MV9B 4UNTA 1CFTB 4PJXB 3VI3F 1C8PA 1ZK9A 1OAXL 3MLVL 4EUPH 5IB1A 3GHEL 1KXQE 1U58B 4GG6E 3P4OA 2YA1A 1FNLA 1IKNA 3GGWB 1ZHBB 5ACLA 5T1KB 2ED9A 2Q7YB 3F7PC 2X70A 1NBZA 1F8TL 2IEPA 5C09A 2GFBB 3TBVB 3O81A 3QNYA 4OD1H 2Q8AL 4AK1A 3RDTA 1GAFH 1MFEL 5DVLA 1JZ6A 4HUUB 4D0CB 3MOBH 3L9RB 4JGJA 4YAQA 3K81A 1IGML 3BEVB 2DTMH 3ARBA 3CD4A 4PRHA 1T7YA 3RUGA 1GL4B 4OM1L 4MB4A 2BHUA 3HC3L 5I18L 3O2DH 4NQDB 4ODSH 4WHYH 1LEGA 4YHIB 4ZYKA 4UTAL 2YSSA 1MCIA 5IB5A 3OKMA 1FG9C 3BX7C 4R6UA 5D72H 1G84A 4MJIE 3OJDA 2IH1B 4BFGA 5D7LA 4JY6A 5JW4N 4BZ1L 1DANT 2HJLA 1DE4B 3PL6B 1Z9MA 1K6QH 4G6FB 4GXUN 3MRGA 2CUHA 3TV3H 1BWWA 1LHZA 3IXTA 5EO9A 2E9WA 3PDOB 4RGND 2VH5L 3QUKA 2E6QA 1ITCA 4HXBL 4K8RL 5I66B 1AD9A 4DGYL 2BY0A 3MCKA 1NFDB 2FGZA 2F15A 1Z9OA 4JRYA 1G6RA 4B7IA 2RFXB 4G9DA 4WUKL 1FCCA 2PCPB 3C6LD 4HJJH 4RGMB 2EYTB 1IFHH 5HD8D 2MOVA 4Y19D 3TNNB 1BIIA 2F53B 3ILPB 1T4KA 1LDPL 5DYOA 3WDJA 1J1PL 4WRLA 1QNZL 4A6YB 1S7TA 1B6UA 4Q58C 1EFXD 5C0DB 4WI2A 1FZJB 2HH0L 4PP1C 4RIRB 4DGIL 3HE7D 2QHLA 5F7EH 1HDMB 1HHKA 5IIEA 4KROD 4EBQL 1UVQA 1DBAH 3LMJL 1YEJH 1QSFE 4R4BA 1FO0L 3LS4H 1NC2A 4ZUWB 3P73A 4MDIB 5FO7A 4X5WA 5L88L 4PRIA 2ZOLB 4S1DD 2YD6A 3NZHH 2WBJC 3F7VA 1WCBA 1KEML 1BX2B 4KWUA 5TF0A 4FQLL 1AJ7H 1RIUL 4XHQA 4Y2DC 2D03L 4OF8A 4EI6B 2XFXA 1T04A 1N6QL 2YUVA 3QIBB 3K0WA 4IBLT 5C9JB 1A6AA 1A64A 3GMQA 3FQTB 4L3CA 5D8JL 3V0WL 3ZSTA 4OLZH 3QO1A 3QNXA 3ARDC 4P23D 4M00A 4U4BA 5FYLH 4RRPA 5SV4A 1QSED 1XF5B 1MRCL 3VI4E 4JG0H 4Z7UF 4PRBA 4YHPB 2EECA 3EFFA 1HKLL 1M05A 4PPTA 4NUJA 3ZKNC 2HTKD 1JHKL 4XPFL 5DJ0B 2QHRH 3DUUA 5TE4H 3JVGC 1CLZH 1OT1A 2YN5A 1ADQH 4TPRL 4KVCH 5DI8A 5J56B 5E8NA 3GBNL 5T5NG 2ZOKB 4ONGH 2JB5L 4GG6B 3G5YA 3ROLA 4F8TA 4NHCL 3BXNA 3U48A 4RDQF 1DBBL 1T1XA 1NCNA 3WN5B 1JPST 2AGJH 1TZIB 4CVXB 1J8HE 1R5VA 4JQVA 3G08B 5H8DA 1YYML 3MBEB 3BP4B 4UV4H 4P2QD 1Q9OB 2AKRA 3QDGE 2AXGA 5TFSL 1BVKA 5E2VL 4Q9QH 3SY0A 3W11C 3RX5A 4HV8A 1IC5L 1WUNT 3QEGL 1DN2A 1FG2A 5BMFH 2AP2A 3KPPA 4KKAD 3N1GC 3ME0A 4JFQB 5EA0L 5FV2A 4HS3B 3STZB 5EFIA 4PB9H 3P9LA 4X7SH 4MX7B 4LNRA 2JCCF 5CEZH 4LLMA 32C2A 4AT6A 5JR1L 4MJIB 3TLRA 4N0UE 3O2VL 3V9FA 3HLAB 1F6AB 2O26U 4JDZA 5A2IH 4D9LH 2O5XL 5FHBL 5T1MB 5BCAA 1XGTB 4UV7L 4KZDL 2ADJA 1BD2A 4UIMA 2IAND 5BV7C 1G7JB 3UPRA 4X6CF 3Q48A 5C0EB 3TN0A 1X5LA 1OW0C 2DF3A 3MXVH 3QULB 1HHGA 3VD5A 3U2SB 2D7PA 2XQYG 4Z8FH 2WK2A 3OAZH 5BRZA 4Z5RA 2W0FA 1CK0H 3L3JB 2D4FA 3EYOB 2CSPA 1YPZA 3ISWA 2GSGB 3L5XH 3CFBA 5D9SB 2EDLA 2DLFH 2CXGA 1JNNL 1RK0B 1P4LB 3OKKA 1NSNL 4PY8I 5C07E 3X11A 5LKNA 4NQCE 1EEZA 3CLFL 4TSAL 1NGYB 1MUJA 1A3LH 3I02B 5HPMB 4UOJA 2Z91B 3WHXA 1C7TA 3AAZA 3L7EA 5BVJA 3KJ6L 3ES6A 3EJYD 1OPGL 2WLZA 2VXSH 5CEXB 1BAFH 3D0VA 5EIQA 2W0KA 3OXRB 3FN0L 4ONHA 4IJ3C 4KTEL 1WTLA 4JGUA 2NY1D 5F8RC 5MP6L 5E00A 2W9EL 5SWSA 3V4PL 5EO1A 4LPTA 4PLOB 4HUNB 1KJ2B 3MJ8B 2XN9A 3HZKB 4M61B 5EOTA 1YN6A 6CGTA 2R0ZH 1WAAA 3L3DB 4PJ8B 5GRUH 4U1GC 4QO1A 5ECJE 3TT3L 1BHGA 1NGXA 3BN3B 3TZVD 4DUXA 3RWHA 5IHZA 4I0CC 1NGWB 4G7YH 2PW2A 4PLKD 4ZO9A 1IC7H 3VFGH 3L3GA 2A9MH 2J1KA 2VKXA 1ETZB 2QKIA 5JDJA 5DO2D 3PF2A 1JNLH 3VFWA 5D96C 1JTOA 2FWOB 3W0WA 1V7NH 2EEBA 2QSVA 4HWUA 5FO9B 4EDWH 4HUWB 2XICA 3GSVB 3S4SA 5DFTA 2UY6A 1NEZA 3QUYB 1WJ3A 2GJ6E 4F7TB 3AY4A 3U7WL 2P24B 5J3HD 4KJYB 3VD3A 1AGEB 1JZ4A 3WL9B 3LDBC 1D9KA 4HGWA 4CJ1A 5L7XL 2QR0A 1QACA 3K1KC 2IBZY 3KWWA 1MFDH 3I6KB 3VXUE 1I7UA 4EVNA 4QXGL 4GMSL 1CFVL 2E5EA 5D1ZC 4RSVA 1B4RA 1WBZA 1J8HB 5D2LE 2VABA 3DECA 3DRTB 5IFAL 4LSVL 3P0VL 3I3BA 1FE8L 2VDOL 4RMVA 5F7NC 4NO0B 5SWZB 3RTQD 4LHUB 3ILQD 4X4YA 3LN4A 1DBJL 3DTXB 3D69B 2XWTA 2YXMA 4Y1AA 2OYPA 2H26B 1U8QA 3HMWH 4KJPC 1WISA 5D7JC 1N5AB 3MNVB 2VDRH 3WIHH 2R69H 5E8DL 4Z77A 4ODXA 2NYYD 2V5TA 4MJ5B 4FG6C 2H2SD 1CLYL 2CKBA 4N0UB 1ZLUK 4WJ5B 5H37H 2RR3A 1MHHA 3BVNB 5ESAB 2DMKA 3M17B 1T83C 1SJEA 1IE5A 3VWJA 3ETBF 2MHAB 1IGIH 2IALA 5FYKE 4Z7VE 1KN2H 1PJ9A 4APQB 4CMHC 3ALPA 1RQ5A 3A6BH 1A9BB 3TBTA 3JWDH 3EOTH 1AY1H 2IWGA 1LWRA 4L3ED 1GGUA 4RRPG 5CWSA 1HYSD 2OL3L 5TF1H 1A6VL 3HI6H 2IMMA 4XCCL 3LS5H 1XGYL 2LU3A 3IS0X 3SE9L 4D9QD 4N9GA 3ECBA 1WEJL 2ORBL 2J4WL 3HC4H 2AJ3A 3RWCA 1SBBA 3C2SA 3BRDA 3MUGA 3R8BB 3NA9L 1QA9A 5IHLB 4BQBA 4U1LB 5C07B 5D1XC 1ZLSH 2F74A 5DFVD 3O0RH 4UOW1 3V52H 2IG2H 1I1AA 4GAYB 4CADB 5GIRB 3WUWA 1QO3A 4PJ9B 3WS3A 1KTDB 3T8XB 3HS0A 4G6FD 2OR7A 3Q1SL 3CCHA 3BP7A 5SX4H 2YMXH 2BVOB 1YNTA 3S9DB 1DBKL 4JM2C 4UT7L 4N8CH 4M7LH 4XPAH 5KG9B 4U6HA 1F11A 4JLRA 4ETQB 2AAVA 2ARWA 1KPRA 2X4SB 3GHBL 4OGAC 4W4OA 2CUMA 4FFZL 4LAQH 2AK1H 2E3VA 5DMIH 1RUPH 4X6EA 4Y5XC 3S36L 2OR8A 2F53D 2I5YL 3MV8B 1B0RB 3PJSA 2D9CA 3I9GL 5CGMA 5KAQF 5DUML 3UX9B 2VDLH 1FFOA 4UI2A 2ITDB 1I3UA 2ATKA 5IK3B 5DDHB 2FHBA 2Q7NA 3O3BB 2R0WL 1R3IH 2AERT 2VDKH 3OKYA 4UDTB 1R3HB 3V7AE 1KG0A 4PUBL 4N1EA 3O4LA 5EOQL 5GGTL 2YK1H 3TWCH 5GSRB 1MHPH 4C56E 2GAZB 1EJOL 5A2LH 3SKNB 1PQZB 4BSVA 2Z9TA 3IRPX 4TULH 1KB9K 2R15A 4M1GH 1UB5A 2GJ6B 2WANA 4DTGL 2FR4B 3BI9X 1G7QA 2AV7B 4PD4J 1WF5A 3ZDYE 4RBPK 3MRCB 1HZHH 2E8YA 2R9HD 5DA0B 3VXUB 5IB2B 1YEHL 4FQIH 3IDJA 1W0VA 3MLWH 3P0GB 1BFOB 5HYEA 2J2ZA 4I4WA 1X5FA 5I1CL 2VERN 4Z7NF 5D2LB 3G6AB 3NPSB 4LDOB 4M6NL 4M93C 5F21B 1YC7A 4JJ5A 5IVXA 4M02A 4YDJA 2NY4D 2EDKA 4MA3A 4PBXA 1P6FA 4Q9RL 4M6OL 4WEBL 2EE9A 3LKOA 3TVMD 1IZKA 1OLLA 4FMKA 3DXAE 3MNWB 2O5YL 2XV6B 1BM3L 4JQXA 4U0RC 2V6HA 1X5JA 4OF0A 3OR7B 3ULSB 4NSKA 3U0PB 3V4UL 3I6GA 2ZCKH 3OAYK 1IBGH 3QUZC 2AK4E 2EO1A 1FPTH 2CKBL 3QBTB 4LQFH 5IW1A 2C3WA 4Z7VB 4WO4A 5HVGB 4C54A 1JYVA 5B38A 1R5IA 4PJBA 3K4ZA 1KJ3H 3BH8B 3M1BB 3QDJB 4MYWB 2R2BB 1CXFA 2EIZB 5TE6L 2GT9A 4KI1A 2VR4A 4P0DA 1S9WA 5KVMC 4JPKL 5JZ7C 3R06A 4ZPTA 1IEBA 3EYQC 3L6FB 4J3VA 2ARJB 1A1MB 5CBAA 5D6CA 5T33L 4ZUUA 2DIJA 3O3DA 3ZT5A 2VL4A 4QHNB 3VGDA 4LKCB 4Z76B 5K9OB 1YEGL 2CDGB 1GZQA 4P4KC 5C7XH 4ZNEE 3LH2H 4Y88A 5F1NA 3GSOB 2PTTA 4GRWE 4PTUA 5KANI 3S4SG 1NEZG 1DLHA 2DLTA 3PQYE 4YUEL 3DVNB 4FQQA 1P4IL 4OM0H 3MJ7A 5C8JA 3DI3B 1KIUA 4FFWD 4MVBC 2KQNA 3OQ3B 2EO9A 4X7TA 4HT1H 4DAGL 1KTKE 1DQQA 4YHKL 2P8PB 4EDXA 3UBXA 4KU1A 1DL7H 4BFEA 1LNUB 5KBNC 4MAYA 2OTPA 3V5KB 4OZGA 4X6FB 3RIFF 1DTUA 1NLBH 3QDME 2A6KA 1FL6B 5IHUH 1NAKH 1VSCA 4YK4C 1MAJA 4U6VH 1TJIH 5FUOH 2WBJB 3AREA 2R1WB 3QPXH 5IB4B 5F9DC 2EDHA 4Y2DB 4JANB 3RVWD 3DRQA 4JFDE 3BGFC 3IDXH 3OG6B 2EDBA 5D7SH 1KENH 1W72A 1ZE3C 1N8ZB 3ARDB 4JR9H 5J13C 3V4VH 1U3YA 3G6DH 3C5ZD 3FO9B 5HGHB 2CIIA 1YMME 1MRDL 3N1MC 1T2XA 1I3RB 4OFIA 1KBGL 4CNIB 5INDB 5IVNA 1QSFD 1A1NB 5FHAH 3WKNA 4C56B 2KPNA 4ZD3H 4OQTL 2BX5A 1BBDL 3QEQE 3FAXA 5TDNB 5JIPA 3RZWA 1TJGL 4L8CA 3H3PH 3ZTJG 3L95B 3QEUA 3OMZA 1HOCB 2VJXA 3OHXB 5E2UL 4NHUB 1UCBL 4J1UB 3VG0H 4YBHA 1FAIL 3F58L 4MD4A 3I2CH 1CGWA 3FT4A 3PNWB 2CQVA 4K94C 2ZJSL 4LLVB 3F12A 1RZIA 4KK5C 3C9NB 3LKSB 3BJLA 4FABH 4D0BB 2CK0H 2GUOA 3UMTA 1AR1D 1F3DH 3P40A 3WUWG 4H25B 4K3GA 2HT3D 1NCTA 3BE1H 3BKYL 2Q3AA 4Q0XH 4S1QL 2JJWA 5TQ0H 3T77B 3D39A 3S97C 3OF6D 3B9VA 4LCCB 2YZ8A 1X7QB 4YHLH 2HN7A 4LOUD 1WT5C 3QUMB 2A1WL 5FYJL 3QUYD 1YNKL 4OCRH 1DBMH 4F7EB 1MJUH 4TOYL 4LCIH 2V9QA 1WBYB 5IVZA 2W38A 3QJFB 1IEAA 4XBGA 4P57B 4ZAKC 3MRFA 5DK2A 1D5MA 3O8XD 2AK4B 4G43B 4X8JA 4JPIB 1Z0MA 5HVFB 3N1QC 1A0QH 3CXDL 3KPRA 4PJIE 2G60H 1H8NA 3REWA 4NGHH 3FB5A 2GK0B 4QRPE 4XMKL 3RBSA 1NL0L 4JFXA 2DICA 2AJSH 5BV7B 1ZGLA 1QPXA 5DRXB 5BZWB 5DEGA 4ZUTA 4XP4L 5EH1A 3G9AB 4HK0A 4S1SL 4NP4H 4B5EA 4RGOH 3QDGD 4NO0D 3DX9A 5D6DA 4LHUD 3MRNB 2DQUH 4DN3H 5L8KB 3SDCD 2DM4A 3PWVB 1BFSA 3SCMC 3BJ91 1U6AL 5F1IB 4MS8D 2H3NB 5CHNB 1VGKB 3CDGA 1O7SA 2BSRB 3BKCH 5I1AA 2F8VA 4JO3L 4XCNB 3L5WA 1MCFA 4JRXE 4GRWB 3VMOA 1CG9B 4S2SB 5INCB 1NDMA 3BQUD 4YDVA 3LD8C 5DD1L 1P7HL 2JB6A 3PQYB 4AIOA 1QLEH 4R96B 5FKPA 3FT3B 3MLSH 2DQGL 1OQOA 1JGEA 4LRNL 4YHZH 4RFNC 4JFZH 2G2RB 4JQIH 2AJXH 2I9LA 4TSBH 1T1ZB 4GMTL 1QLRA 2VO5A 3RVXD 1BOGA 2HJKA 3VA6A 4IJ3B 2X2YA 1UT9A 3QDMB 4HPYH 1A9EB 2VLJA 3BZ4B 2EDDA 2HT2C 3MXWL 4PG9B 3LZFL 5A1AA 2EIEA 1M6OA 3ZDZF 1LE9B 4PJ7A 5EU7C 1MAML 4NZTL 3VXME 1FZOB 1T3FA 3OKDB 3HMXA 4NBXB 5AWNL 1JZ3A 4M62H 3Q3GB 4OAWA 1AI1H 1HN1A 3RVTC 4NQCD 1DFBH 2IQAB 2IH3B 5E8EB 3NVQA 4P4RA 4P2RD 3SDDC 2HT4D 1JIBA 3LN5A 4ODWB 1PSKH 1JFQL 1GVIA 1NCBL 4LVHC 1ZOXA 2NX5D 5ISZA 1TCRB 2VITA 1Q9WB 4DEPC 2DDQH 5D96B 3NIDE 5KS9B 2NR6D 3B9KA 5I16B 1BF8A 2XT1B 1ZHLA 4TN9A 5KVDH 4PV8B 1VESA 1T5XA 5TGBB 1MCJA 3DX7B 2C1OB 2OZ4L 4GUPB 3MMEB 2Q8BH 3TO4D 1G7HB 2GQHA 2Y9RT 3RWEB 2HKFL 2OSLB 3MGOB 5B3JF 3D87B 3LDBB 3U0TA 3WLWC 2FO4A 2VLRE 5DQJA 5KN5A 2AEPL 5I0ZA 2HRPL 1YDPA 1VPOL 4HWEH 2OS7A 4JRWA 5D1ZB 2DRUA 1AP2A 4KXZI 2WQRA 2NW2B 3Q5OA 2MQ3A 2VMFA 5FDWB 4WU5B 3HZMB 4YHNA 1ZT1B 1VKXB 4HUXB 4NDMB 1JWSA 4GSDH 3FOMB 3FB6B 3SDAD 2DI7A 3T0XA 5BXFA 3HUJE 1K85A 3GSXB 3GNMH 4NRYA 3LY6A 5IGXL 2LAGB 3UBXG 3S96A 1EAPB 4DKDC 3D25B 5D7JB 2NW3A 4KKBD 2KH2B 1S9VB 5GHWH 3DV4B 1XGPB 1RK1A 3QXWA 4U2ZA 3RX8A 5F1OB 3CK0H 4PJIB 1FVDA 2X4TB 4JAMA 3VXUD 1AQKL 1OM3L 4HJ0D 1S7SB 2XG4A 4PJDF 3TA3D 3JTTA 5I8OL 4XNXH 1RUAL 4QRPB 4LARH 1E4WH 1U36A 4LBEB 4M1CD 1P9MA 5I15L 3CLEL 3OPZH 4P46B 2V7NA 3LRSA 4CMHB 2EYSB 3BAEL 3PGDB 4MCZA 3W39A 1CIDA 3O9WD 1PZ5A 4U1HA 3ZE1E 5E94A 4LCWE 4TTGA 4TSCH 4Z95H 3V7MA 2X4OA 4TVPE 3LQAC 5EWIH 2DQJH 2EH7L 1N2RA 4KUCF 4WTZA 3S34L 4JRXB 1IGJA 5C0CE 3RIAF 1JYNA 1LK3H 1YEIL 3ARGA 3MJ6A 1BFTA 5D1XB 2JJSA 1KB5B 2B2XL 3Q5TA 2VDQL 4H5SA 4XTRD 3DVIA 2CLVB 3DVGB 4WCYL 4P9HL 3W9DA 4OFVA 5LAXA 2M1KA 1L0XA 1NUGA 4GQ9L 5HHPA 4L4TE 5ERWB 4Y8AA 2A38A 2OJEB 2ICWJ 3KPNA 4U1KB 3B9AA 4JM2B 1R6VA 4FQPA 1KPVA 3OAUL 1MHEB 3V6ZB 2KZWA 2C3VB 2APWA 1N64H 3S5LB 3RGVC 5EUKB 1WQVT 1DQTA 3F6LA 2R2EA 4NKQB 1ZHNB 5C0AE 3BIAX 4J4PD 3G04B 3VXMB 4Y5XB 2YUZA 4OD3L 2V5MA 4KV5F 3LKRB 4XP6H 5L2KA 3L3IA 1K4CB 3QZWB 4NJAH 4AY0A 1ZWIA 1JWMA 4PJBF 4PP1D 5GS0D 1I7ZB 2HLFD 2EXWC 3GB7B 4MWFB 1IKNC 4N0CD 1FLRL 4I48A 2C4FU 4NO3B 5FM4A 1NC4B 3QQ4A 3GSWA 4QRSB 3BP6A 5ALCH 2R4SL 1EEQA 4OZFH 4XNQA 2YWZA 3RDTC 5IR1B 3AS1A 3AU1A 4XRCB 2JF1A 1GZPB 2DOCA 2WAHA 3CFCL 3ARBC 2KZ1B 2C1PA 2L7UA 2PYFA 3MGTA 4Y4HC 4XZUB 5ICZB 1RZ7H 5E2WH 4UB0H 1AIFA 4N5UA 1LO3H 5DSCA 4K7PX 3W9EA 4M93B 2ADIB 3CVHH 4Y89A 5HI4D 4I2XE 4WDIB 1ZKAA 2Y07H 3WKML 1CDIA 2DB8A 4ISVA 3IF1B 5E99H 4POUB 2X4PA 4M1DL 1YUHA 2IC2A 3ZKND 4ZFOL 4QKXB 3HUJB 4G7VH 4NRZB 3VRJB 1YEKL 4ORZC 4LLDA 5HJ3B 4IOIA 3OKNA 4KVNH 1G1CA 2BNQA 3CXHJ 2E7LA 2X5PA 1D5IH 1FV1B 1KXVC 3IXAB 5A16A 5J6GA 4KUZH 1FVCA 2CH8A 4EQ2A 2VDPH 1PKQA 2B1HL 1SBSH 3QUZB 1GHFL 4F7CA 1RZJL 4V1DD 4FQJL 4OD2A 3SE8H 3H2WA 1CL7L 4JG1L 3WMSA 3MQIA 4MHHI 5KSBF 1A6WL 3WXVH 5ICYB 3DI2B 3U7YH 4IS6B 4LCWB 1EA9C 4WGVB 4ELKA 1HHIB 3BW9A 1I1CA 3DXAD 2BNRE 4JY4B 1LO2H 1DLFH 2BNUB 2G9HB 3I84A 3K2MC 2DIAA 4LSRL 3DVFA 3WFHA 3MRDA 1YNLL 3VXRB 1YEDA 4XHJD 1B4JL 4NWTL 3S3PA 4DGVH 4U1MA 3BT2H 5I1IL 4P4KB 5C0CB 2AABL 3H7LA 1SQ2N 3GSRB 4U1NA 2GW5A 5IUSA 3STBA 1G0DA 4LF3B 4QCIA 5HYJD 4N8VB 5DJCA 1SEQH 4D8PA 1F4XH 1Q9KB 3OKOB 4HX1A 3P30L 2BCKA 3RWGB 5FIEA 1UKQA 4G5ZL 4L4TB 5HYSA 1V7ML 1BJ8A 2N4IA 1KYOJ 2Y72A 2PNDA 4OLYL 2H32B 3LKNA 3PWNA 4D3CL 1H3UA 3T0BA 3TH3T 2WUBL 3SQBA 4J6RL 3FQXA 3LEYL 2COQA 2VIRB 4UTBH 5KOVC 4POYA 5F9JA 4NKOA 2FX8H 4M9PA 2GHWB 4RQQB 3MRLB 1CBVH 1VCAA 1PYWA 4FXGB 5E2TH 2GJZB 4R26H 5L6YL 3BSZL 2DTSA 3BGFB 2XG5A 2V2XA 4MD0A 3MRQA 1FH5L 3PQYD 1Y0LB 4XX1G 2BRRL 4OUOA 4JN2A 5LVEA 5J13B 2X89A 4IDLA 2AJVH 4UQ3B 1CU4L 3JWOL 3MRBB 1YECH 3FQRB 3PG2A 1KV3A 3BUYA 5FUCC 2BOBB 2BSSB 3F7QA 2WWMC 5JOFB 4FXKB 4QRRD 4OCXH 4N1HB 3FKUS 1S7RB 4JQVC 4UQ2B 1AC0A 4ZXBD 5KJRH 2W65B 1VFUA 3KPLB 3I50H 3UJTL 3GJFA 2BHYA 4EXPX 3RNKA 1NDGB 5IQ9A 5CZVL 3K2UH 3ULUF 3QQ3A 4I9WE 4JFDD 4FQ1L 4JZOA 4U1IB 1T2QL 2HG5A 5I1KL 2ZCLL 3FHAA 3N9GL 1M7IA 3PE9A 4V2BA 5ETUB 1I3GH 4FTVB 4M4PA 4WTZG 2X05A 4OJFH 4OLUH 1YMMD 4OLXH 4C83A 4Q9BA 1KTLB 3M45A 4HK3J 5D70H 1HHHA 4XVSH 4ELME 4I2XB 2C3HA 3BZFB 3KHQA 3FCTA 2AS5M 1EK3A 1SY6H 3LEXA 5HSFA 4FA8A 4WUUB 4HS6B 1J0KA 1X6LA 1AQDB 1QRND 3HPLB 3TN0C 1HIMH 3QEQD 3X3FL 4PJXA 1N4XH 4RMTA 1QFUH 1GOFA 4UILH 4PJ7F 1TZGL 4OCNC 1PGRB 1UJ3A 3N1PC 4GXVL 4PJGF 5T1KA 5FGSA 2Q7YA 4ZAKB 5ADPL 1LE5B 4JM4L 4H1LA 5DD3H 5EUOF 3TBVA 5GRJL 5TDPA 1II4E 4Z0XA 3HB3D 3CH8A 4I77H 3RWIA 5FA3B 3X3GH 2AJUL 1MWAA 3L9RA 1KCSH 1CS6A 1JRHL 3QFJD 3T04D 2LE9A 4F7PA 1KULA 4PLJC 4RMQA 4JO2L 1SMAA 2PXYA 3O6ML 1VFAA 5J89A 1J0IA 2YPLE 1JPGB 4KJWC 3NPZB 2BNRB 2R0KH 2AXJA 5IMMB 4YJZL 4NN7C 3SCMB 3TO2B 4KJPD 5JXAL 3T4YA 5E9DA 1ED3A 2NY0B 1N7ML 1KCUL 4G8GD 4OQ1A 4DKFL 3LD8B 2IPUK 5DRNA 2ICEA 3PDOA 3CX5K 3EDKA 1DUZA 2FBJL 1AGFB 3IDUA 4HFUH 4Q6IA 1NLDL 5BQ7B 3OXSB 4LPUA 3WD5L 1JPTL 3QRFM 3MRPB 2Y7QB 5EZLB 4RFNB 4XC3L 4OCWL 2Z4QB 3MRMA 3WE6B 1TJHL 4J3UA 5IBUG 4JKMA 5T3ZD 1S78D 4KMTH 3T0AA 5GS1B 4HIXL 3TNNA 3OGCA 2K3TA 1LEIB 4X9IA 3DUSA 1IC1A 3FB8B 2B1AH 3RPIB 1MH5B 2SEBB 4MNHB 1XR9A 2P1YA 1NBVH 3ULVC 3V6OA 4CU6A 5DC0A 2KDGA 3QIUA 3GIVB 5F1SA 1AXTL 2CMRL 3B3IA 3N85H 1H8OA 3AY4C 4FFVC 3TJEL 3ZL4H 3FO0H 3SDDB 1GGBH 4TNWK 1D9KC 1P84J 1INEL 4R7DB 3SGKA 5HDBF 3H9HB 3EUUA 2GJJA 3GIZL 1IQWH 3ZKXC 5EZJB 4DEPB 1K8DA 3HCVA 2A6IA 3MNZA 3EJZC 5F71A 5C09E 4NZRH 1Q94B 3ARFA 4GBXA 4MA7L 3O6KH 3HA0A 3K1DA 3IAGC 1UWGL 2F9BT 3EOYG 1FJ1B 3RY6A 3VXMD 5DHVH 4PJHA 3AXLA 1AGDA 1BVLB 1O7VA 1TVDA 4I1NB 5E03A 5MEQB 4PRHE 2ZNXA 3RUGE 1V3JA 4HWBH 3GUTB 1JF1A 2OCFD 2N7BA 4NO2B 4QTIL 4LMQE 2NZ9D 4P5KB 1MPAH 4H0HB 4MNQA 1J8KA 3FMGH 1UZ8B 4NNXA 5DJ0A 1XIWA 4K9EH 5KTEL 4ELMB 5D7LE 3VWJC 2MCPH 2ZP0T 5MHSD 1GGCH 4YR6B 5J7CC 3GJEB 2V2TB 2IFFH 1NC4D 2UZIH 5HYSG 2UWEA 1SM3H 4AYFA 4QYOA 4JFEA 4E41A 4W6YB 3U30C 12E8L 1NGQL 3B5TA 1TVHB 3NIGF 1OAZH 4JRYE 4HWZB 4NZJA 1RZ8A 5D5MA 2VLRD 4GAGH 3EHBC 3WDHA 4P5MA 4EUPA 4JVUA 1JCKA 2XPGA 5CP3H 4M03A 2LQRA 4P3CH 3VXSD 4YXHL 2ZZUT 1E6OH 5JPNA 1U92B 2R1YA 5T1LD 4POZC 1I1AC 1IAIM 3S37X 4QHLB 3BPOC 1KJVB 1GYAA 2XA8H 2A2QT 3EO9L 2YPLB 3RWDB 1A7QH 3ZHKA 1S7WA 1QPPA 4OLWH 1QHOA 3Q5YA 3FQWA 1FHGA 4HGMA 4XCEB 2B39A 1J0HA 1XCTA 3VFMB 5JO5B 3VFTA 4CAGA 3KLAA 3MRJA 1I8IB 1S9XB 3OJ2C 5GQBA 1LGVA 1QR1B 3O2DA 5T1MA 4PRIE 3T2NH 3NAAL 4PRNB 4G6AD 3QUZD 2IGFH 5EBGA 5I8EB 5ICXB 5C0EA 5JW4R 4JHWL 5CBEB 4LRIA 4P2OA 4XMPL 2B0SL 3WLBB 4HCRH 4KHTH 4G42B 3SKJL 4TRPH 1QFWH 1ODAA 1LD9A 1KEGL 1IJ9A 3SE3C 2ID5A 4AL8H 1N0XH 2AW2A 3MYZA 3B83A 2AEIT 2GSGA 4NKIH 4OZHA 5KSAD 4IRSD 2OLDA 5I76B 3UTTA 3BDYH 2EDWA 2C7UB 4GAJH 3BP5A 2HYMA 3QWRA 2F54D 5DURB 3EYQD 1PLGL 5E5MA 3RGVB 5C1MB 4BH7B 1S5HB 5DD0L 4P4KD 4A6YL 5HPMA 3IJYB 3D48R 4JHAL 4D9RE 2Y06H 2Z91A 1NAMB 4K3DL 1PY9A 5JHDA 2M2DA 1BJMA 5GS0H 4BZ2H 4RAHA 2ZG2A 5C0BB 1VFBA 1UWXH 2BY1A 5FFLA 4MVBD 2FX7H 4H1LG 5IB1B 3HG1D 2CGRH 3P4OB 5FUCE 1A6PA 4XPBL 2X70B 1NBZB 1DN0A 1M71A 3WNPA 2EKJA 4KKNA 5C09B 4GW5A 3QHFL 1YJDC 1UA6L 2DKSA 3L3DA 5DJZA 1RMFL 3QNYB 1OGTA 5C0AD 1F2XK 3RDTB 1NCAH 4HKXB 3BESR 4YAQB 3GMLA 4JQXC 1JTTA 1RFDH 3ARBB 4PRHB 5D7IA 5GZOC 5I1GL 3RUGB 2H1PH 3K4DA 3WNLA 4Y4HB 2APVA 1IGTA 43C9A 1LQSR 3ZE0F 5DRZB 2X9XA 4ZYKB 2YSSB 3V95A 5IB5B 3OKMB 1C1EH 2B4CL 4QOKA 2X1PA 3OJDB 3LIZH 5D7LB 5CCKH 4LSSH 4TUJA 2DS4A 5HDQH 3P11H 4WO4C 3T2OA 3UJJH 3GBMH 1BD2E 4L29A 2LABA 1JE6A 1AGEA 1S5IL 1J10A 2HMIC 2D7NA 5EO9B 4FOMA 4K7PH 5IT2H 3QUKB 1L9NA 4O9HL 1ZSDA 5FA4A 3WNNA 2D7OA 1AD9B 2QLVB 1UZ6F 3MCKB 3VE0A 2CJUH 5BRZE 1YEFL 4JRYB 1G6RB 1ADQA 4ODHH 1U8JA 4G9DB 5DUPH 4LIQH 3ULUD 1RJCA 1YPZE 1OF2B 4HFWA 2DYPB 5IEHB 1BIIB 1M1SA 5SWZA 1T4KB 4WVRA 1JGLH 4JN1H 3AVEA 4ZFGL 1VA9A 3D69A 3B8SA 3HE6D 2H26A 2NY2D 4JY5L 1OSPL 4YDKH 4OI7A 2CO7B 1MQKH 2VAJA 5GGRY 1HHKB 35C8H 5IIEB 4BFBD 1CQYA 1UVQB 1YN7A 3NACL 4WJ5A 5ITFB 3S6CA 1NC2B 3P73B 4FP8L 5FO7B 3P0YL 1FRGH 4M7JH 2J88L 5SWSE 5BOZG 4TUKH 3KPTA 3B9DA 3F7VB 1WCBB 2ZUYA 1A9BA 3MREA 2XN9E 2Z92A 3VFPB 3GSNH 1ZHKA 2CLRA 5TE7H 3VGAC 1X5GA 2XFXB 1T04B 2VXUL 1MCOL 3HTLX 1WAAE 1S8DA 1TFHA 1NANI 2WIMA 2J7LA 1A6AB 3GMQB 4L3CB 3PGFL 3QNXB 3QO1B 4BFIA 3QUXB 2QL1A 1QLFA 1X5KA 5GJSH 4HZAA 3QJHA 4KI5C 4PRBB 5CP7A 5JXEA 3SCMD 4S1RH 2FL5A 1UADC 2RCSL 3EFFB 4FFYL 5FOJA 1M05B 1ZEAH 1GH7A 4NUJB 4GAYA 2Q3ZA 4ZTPL 5CS7A 4WEMB 1IAII 3SKMA 3DUUB 4HC1H 3ULVE 5DT1H 4KDTA 2LVCA 1MRFH 3ARZA 1CYGA 5IMKA 1KIQA 1OAYL 2NY5H 1CICD 2Y1VA 2X4QA 5E8NB 1I9RL 4Y5VA 3G5YB 2Q86A 3ROLB 1A14H 2YPVL 4EUPG 3BXNB 4WHTB 3SDXF 3NBNA 1T1XB 5F97E 1KJ2L 4QT5A 2V17L 4Z7OF 1BJ1J 4FQ2H 4PJCA 3OX8A 4R2GC 1R5VB 3MV8A 1IM9B 1UM6L 1GGIL 2AKRB 2AXGB 4XPGH 1BVKB 1JVKA 3MA9L 3UTSA 5B21A 4JFYA 3ESVF 3MLUL 4HV8B 5IK3A 5DDHA 3K3QA 1FG2B 5ILTH 5ESVA 5KSUA 5IJKA 2ADFH 2DQTH 1TVBB 4LNVA 3W82A 3P9LB 4R9HA 4WHYG 4LNRB 4LLMB 5CFHA 3NGBC 1FDLL 4AT6B 2P44B 4LSTH 1T0MA 5GSVA 2EDOA 5FM5O 2ZKHH 4JDZB 4ZOBA 3BHBA 3B2VH 1KOAA 3G9VA 2ADJB 3OJVC 1BD2B 5FGBA 1L0YA 4UIMB 3UPRB 2YD1A 1OSZA 2IBZX 4CGTA 4DQOL 3TN0B 1F4WL 1HHGB 3QO0A 4PJFA 4GO6B 2D0FA 4U7KA 5D6DC 4RA0C 4R90H 4AENA 5BRZB 2J3SA 4Z5RB 2W0FB 1OARH 2OK0H 4GLRI 3NCEB 2FJHA 1YPZB 4DK6A 3CFBB 3G5VA 1I75A 3AS3A 3UYOD 4DVRH 2DM7A 5JIIA 5LWYH 4QNPF 3RY4A 4H8WC 4UBDD 1Q38A 1CD1B 2EXYC 3OKKB 4DJMA 1NFKA 4LMQI 4OGYL 1WGOA 1MUJB 1OOAA 5CKGA 1CR9H 3S98A 1GC1L 5J57B 3EZ8A 1RIVH 2E7CA 1E6JH 2FHFA 3AAZB 3L7EB 5BVJB 2VZVA 4HF5L 2NZIA 2DQCL 3ES6B 3H3BC 2I9TA 4NN7B 3D0VB 3KR3L 1VERA 4YEEA 4ONHB 3LPFA 2VZ1A 1LK2B 3BEWA 1MCEA 5C6TH 2QSCL 3CFDA 4PGDA 1ZANH 5E00B 3WIHA 5SWSB 3TH4T 5EO1B 5I8KL 1P2CA 3BH8A 5TH2B 4EEEA 2WQ8A 1ZTXH 2BFVL 3QDJA 1MELA 1YN6B 2R2BA 5HI5D 1VGEH 1D6EA 4L4VD 5IBTH 5LJYH 3ABZA 1T7XA 5T3ZH 4AH2A 5J1TC 1U3HD 1EBPA 1NGXB 1TETH 2D31A 3RWFA 2ARJA 4NC2B 1A1MA 4HBQA 3RWHB 4UT9L 5IHZB 4O5LL 4XWOC 3SDYL 2PW2B 4Z76A 4HBCL 1AO7D 5E1AB 5I30L 1QSZA 4O4YL 1FNSH 2YD8A 5K9KB 2ZSVB 3O4LE 3SN6N 2QKIB 1YY9D 4FN0A 1VEOA 4FQXA 2I60H 4HKBA 3VFWB 1XF2A 3DVNA 4G6KL 1BEYL 3B9KC 4NCC2 2AEQL 3W0WB 5D5MF 3D3VB 2FLRT 3IDYC 2XTLA 2O61A 4W6WB 4OTXL 3S4SB 2FCBA 1NEZB 2NLJA 1RJYB 5M95B 1P7QD 5C2BH 2DQEH 4KMQA 4LSPL 1LNUA 3OZ9H 4JKPH 3MJ9L 3BWUC 1D9KB 4HGWB 1RZKH 4KK6D 3A67H 5IB3A 2QR0B 3UZEA 4OIIH 2H2PD 3KWWB 2EC9U 5L8JB 4EVNB 3A6OA 1LDSA 4F57H 3ZKXB 3CSPA 1J0YA 1WBZB 3INUH 2DBLL 4PJAF 1J86A 5JPMA 3BDBA 2E6PA 2VABB 4EXKA 2YD4A 5IVXE 2F58H 4QTHA 5IQ7L 3LCYA 5L0QC 1FYTD 4X4YB 2XKSA 3LN4B 4H88L 5B22A 3W81A 4FRWA 4QRQA 2XWTB 4Y1AB 1U8QB 5GISL 1S3KH 1WZLA 1FLTX 3ARUA 5T1DH 3S88H 3MRHA 4Z77B 4ODXB 3AMLA 4AMKL 3T3PE 3RP1A 5EU5A 4ERSH 4M6ML 5J12C 5E5RB 3QRGL 4KV5E 1MHHB 3F8UB 4MNGB 1SJEB 4G8FA 2NY7L 1P9MC 3IFOA 2IALB 1I7RA 4TVSa 3VG9C 1ZVSB 5C09D 4AQ1B 4QHKI 1RU9L 3OHXA 3MACH 2PW1B 4G9FA 4IIQA 1A6TB 4NHUA 4PJBE 3KPMA 4J1UA 3TBTB 5H35A 5CGTA 1V7NL 3SJVD 4IOFC 4FNLL 4N1CA 5CWSB 2BERA 1DQLH 1U3JA 4LLVA 2R56L 3U30B 5GS2H 3C9NA 3LKSA 3VMPA 3PV6A 1MIEH 4KGJA 4NUGH 2MPAL 3ECBB 3I6LE 3LN9A 1NCUA 4Y2OA 2AJ3B 4M7KH 5CILL 5GJTH 1C5CL 3RWCB 5GS3A 1HCVA 3MUGB 1T6VN 3NH7L 5F7HA 1QA9B 3ARGC 1E4KA 4NCC1 3QDHA 3DO7A 1JUFA 2JJSC 5MEPA 4LCCA 2F74B 3EOAA 4MXWL 1I1AB 3WUWB 5MEND 15C8H 3BPOB 1EGJL 1QO3B 3MRRB 3WS3B 3D85D 3HS0B 3MOAL 3CCHB 1BFVL 3BP7B 1EBAA 1P5VA 3QCTL 3E8UL 1TIUA 5EORL 1A6UH 4U6HB 1F11B 1DZBA 3S37H 4HIIA 1BQUA 2ERJC 1XR8A 1KACB 4OZGE 3OB0K 4JLRB 1NCCH 1G7MA 5D7IF 5TPWH 5FYKL 1D6VH 1A7RL 1KPRB 3KYKH 4KAQL 2X4UA 2DL2A 1OP3H 5MI0C 2A6JA 4WU7A 4ZFZB 4DKAA 4X6EB 1LP9A 2QEJA 3PJSB 1RAMA 1KLGA 5GGVL 1G7LA 3CMOH 1FFOB 4I3RH 2RJMA 4R8WL 1JHTA 2XQBH 5F1IA 3G6JA 4NNYA 1FIEA 1J5OH 2ATKB 5DC9B 5D71L 5K93A 1MCPH 1KG0B 3O3AA 1OGAA 2DQDH 4KI5E 3C6LA 4BUGA 4MA1C 4TTDC 1JZ8A 2DI8A 1NBYA 1JI2A 4Y19A 1EVUA 3CZJA 3JV4A 1OTUC 1QUNA 4PRID 4P9MH 2APTA 5DFWH 4BSVB 2HTLC 1UB5B 4ACPA 1F4YH 3ZKQD 2VDNL 3IVKA 3E6FA 1G7QB 1EFXA 3FT2A 4L8BB 3Q0HA 4OF6A 4OZIA 1Q0XL 3HZVA 3QQ9D 5LBSL 3RY5A 1ZLVH 4N90D 5FGCE 4KJQD 3IDJB 2GTWA 1W0VB 5DQDL 4KY1L 4YEFA 1LE9A 2VAAA 3DYMA 1MCKA 1X3DA 2P48B 2X1OA 3MO1A 2DQHL 4FQCL 3GI8L 3CSYA 5BS0D 1G9MH 4JJ5B 4BYHA 5IVXB 4YDJB 2XKUA 4MA3B 2HWZH 4XPHL 4U6XA 4BQ8A 2IQAA 3KYNA 3DSFL 3LKOB 3D39E 4D9RD 3K7UA 1K4DB 3HNSH 3IGAA 2EIDA 5HHNB 4LLQB 1QBMH 4X99B 2LAAA 1Y6MR 1CD8A 1UC6A 4I3SH 4JFHE 3T0EA 1U8NA 4P23A 3U83A 4NSKB 1PG7W 4KTDL 2EEAA 3CU1A 1BBJB 1QSEA 3FN3A 2FO1A 5C3LD 3UJIH 3RNQA 3I6GB 5KS9A 3WFEH 4K07A 4NKDA 3MBXH 4ZTOH 2VWEC 3KPRE 4N5ED 3H9ZA 5F6IC 5H37G 3CIQA 1F13A 5IW1B 4YZFE 2WWMD 5TGBA 2HFFA 2K9UA 4WO4B 5E6ID 3TBYB 1TMCB 3TWCL 5B38B 1R5IB 3IKCA 4PJBB 1LO4H 4LEXH 1CIUA 5IM7A 3GMOA 1B6DA 4UNVA 1YZZA 3ULUH