1MHCB

Model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I ANTIGEN H2-M3
publication title Nonclassical binding of formylated peptide in crystal structure of the MHC class Ib molecule H2-M3
pubmed doi rcsb
source organism Mus musculus
molecule tags Histocompatibility antigen/peptide
total genus 14
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhcB00
5DMYA 5BVJB 5MP6L 4NIKB 3MODH 5F7EH 3FB6A 4Y5XC 3GMOA 4U1SA 5F44A 4M7LH 4JDVA 2YPKA 3UO1H 3LRGA 3CVHA 3EIFA 4YO0A 1R5WB 4XMLL 2C7UA 4GAYA 1T3FA 4J6RL 5DZNA 3UDWA 4AMKL 1S3KL 4F33A 1I9IH 5FYKD 1Z5LA 4X98A 4UTAH 3TBSA 4R97C 3HRZB 3CDGA 1IKNC 3GGWB 1ZLSL 3IB4A 3EKCA 1RHHA 3GSNA 3DMMB 3U0WH 4OI7A 4XPAL 4KRPD 5E6ZA 2WLZA 1NGXB 4H20L 3D87B 5FM4A 5IV2B 1A9EB 32C2A 4DKDC 4O2CA 5ILTL 1F3DH 4S1RL 3NCCB 1ZLWK 3IDJB 4KKCC 1XZ0B 1YEKL 2IANA 5ITFB 4MB3A 1X9QA 2NX5D 5IG7A 4PJDA 3HPLA 5MI0C 3C5JB 5ITBH 1KPUA 2DQCH 2EIDA 2J88H 2HVKB 2B0SH 1NGQH 1RZKC 2X4PB 4C4KT 1EJOH 5SWSD 2Z9TA 3QXDA 1RFDH 3IGAA 1YY9C 2JJTA 2Y07H 3MRKB 4XBGA 4JG1H 1D3CA 4ODHL 5FFLA 3X11B 1FO0B 2R0LH 2EH7H 4G8FB 3VG0H 4PJBF 5HVHC 1QBAA 3C2SA 2QADB 1OAXH 1TJIL 1IT9L 1A6TA 4HUXA 1PQZA 1FNAA 4FG6C 2OI9C 4BQCA 2H9GA 4RAHA 4IHOB 1Q0YH 1KTRL 4QKXB 4ACPA 2EDXA 4ZQKA 5EC2A 5CJ8A 1I9RL 2GJZA 1ADQL 2GCYA 1INDL 4KFZC 1OAUL 2W0LA 4OCYL 4FABH 5I66A 4ZAKB 5I30H 4KMLB 5AUMA 4ZUWB 4K7FB 4K3DL 5ISZD 1JL8A 4JFQB 3DVIA 1ED3A 4YHKH 1JPSL 4G9FD 5T5FH 1HIMH 4X99A 5BW7A 3IFLH 5LGKA 4AH2A 2YA2A 3QEGH 2BVPB 1MAML 2BOBA 4S10A 1FVDB 2G75A 2W91A 3IDMA 4TSCL 5C8JB 3AXLA 4TULH 5AYUL 1NL0H 3ES6B 3KR3H 5SWZE 1RURH 2Y06L 4I3RL 4XCYB 2YRZA 3SE4A 4YE4H 3B2VH 3SKMA 2BNRB 1LO2H 2EEDA 2ENYA 3GSQA 2NXZC 3MA7A 5F6IC 1R3IL 2NW3B 2DRUA 2ZCLL 3T4AA 4KZEH 4LKCB 2RIKA 5JOFA 4QOKD 4P2RB 4JPWH 3I75B 5I8CB 1G9NC 1Z0NA 2NY5L 5ACZB 3GIVB 3DX7B 2RFXA 3MR9B 1ZANH 4YHOL 1CD9B 3U0TB 2EDHA 4EDWL 3I6KB 4TOYL 4K3HA 4XPHH 5FYKE 1F13A 1JWUA 2YD7A 2C3HA 2ZUQC 3TIEA 1ZHKA 4JRXA 4L4JA 4NZDA 5DD1L 3LQAH 4D8PA 2ADIA 3ARBB 3BP5A 3LMJL 4WI6A 1F8TL 4QRTB 2HT3C 5DYOB 3SOBL 3WS3B 2VABB 3D6GA 1DE4A 2IQAA 1LO5A 1YMMA 3WYRA 3QDJD 5F7UA 2XOTA 5D7LD 3QI9C 1Q0XL 1SY6A 3BI9X 1MEXL 3SY0A 5I19H 3KS0H 5SX4I 3PWVA 5KVFL 3T77B 1RUPL 1OVZA 2X6MA 3O6MH 3MBEA 5EU5A 4I77L 4I2XA 2NX5E 4NCDA 4XVSH 1BFSA 5CMAB 5B22A 1U95B 3QEQD 5I6XB 5KVDH 1LVEA 3RBSA 3LKQB 1G9EA 5SWSE 4Y1AB 3VH8G 4AIZA 4OM1L 1YY9D 3TN0B 4ZFGL 1U8JA 1V7NH 3MOAH 1AFVL 1AP2B 4ELMA 3SPVA 4CNIA 2W1NA 3AMKA 1YNTB 4EUPB 2XZAH 3QQ3A 3BRDA 2FD6H 1FGNH 4KKAC 5EUKB 3GSWB 4OZGB 4X7SL 1UZ6E 2D0GA 1CXKA 1YEEH 4FG6D 1IEAA 1SM3H 2QQKL 3VFUA 3VD4A 1C7SA 4BKLB 4JPKL 5HSFA 5D1QB 3QWRA 1FH5H 3K8KA 4M7JH 1AD9A 2VLKD 3VFVB 4KJYA 2HTKD 4GAJL 4ZSOE 3H9HB 4KROD 1EVUA 1T04A 2XKUA 2JELL 2B2XL 4RAUB 5IFAL 3SHSA 5ISZE 1P84K 4U6VL 3CVIL 1RZJH 5KVMC 4G9FE 2EE9A 4G6KL 5EZIH 4MDIA 1U6AH 5DRZA 3BH9A 3O6LH 4CMHC 4LPVA 4OSUL 1AQKL 5DJ2A 4JM4H 1TZHB 4HLZG 1T4KB 3BPNB 3T09A 2WNGA 3T3MF 5B21A 3QCVL 5DMKA 1DQJA 2C3VA 4L8SB 4HG4K 3OKEB 2EC9U 3HAEH 1IAKA 2DMBA 3DECA 4WWKB 1P4LA 1A5FH 2NLJB 4NUJA 2EDEA 2F5AL 4QNPE 1ZT7B 4HS6B 4M9OA 3EGSA 2NXZD 4OD1L 1FCCA 1IQWL 2ITDA 4QOKE 4XPTH 1MFDH 5TJWK 1UQSB 4FFVC 3C9NA 2Z35B 2E9JA 1M7IB 4H0HB 1YEGL 4TUOA 2MOVA 1IEBB 4LHJB 3IDIB 1FNLA 4CMMA 2Z92A 3ZKSD 5T3ZH 4AIXA 3GHBL 4R96A 3I02B 2FR4A 3O3AA 4M48L 1J9CT 1U8NB 4KKLC 3O6KH 4RMSA 5E4EC 1NEZB 1MIML 1VA9A 4HDIB 4UUJA 3U9UB 4JFEA 4JM2C 2E8YA 3QJHB 4YZFF 3AS2A 4MAUH 1UB6A 1CLYL 2HT3D 5I76B 1GC1L 3PWPB 2GJJA 1S7VB 1IMHC 3JSSA 2J8UF 3PGCA 2K1MA 1DVFA 3QDJE 4N5EC 3K4DA 5D7LE 3QI9D 5DFTA 3FO2A 4NZJA 4LRIA 3E2HB 4OGAC 5JDJA 4XPGH 5DQJA 4QHKJ 3LKNB 4F37F 3X12A 3T2OA 1CLOL 3WBDA 3NGBB 4CDGC 4PGEA 2HFEB 1CLZH 3JWNC 1OL0A 1QFWL 3LN4A 5DC9B 2DQUH 4RAVB 1FV1B 1T0PB 1KJ2B 1KELH 3WS6C 3EO0A 1JBJA 3QEQE 1KCVL 2ESVA 4X9HA 3VXTA 1ZVHA 3FO0L 3MUGA 3U48A 1KBGH 3EYSH 3GHEH 3VXMD 2C1OB 1MQKH 2DQTH 1OQOA 2JTDA 4NGHL 1XGRB 4FQCL 4YWGL 3RWIB 2NCMA 3WN5C 2CRIA 4NNPL 2AK4A 4KKAD 1N64L 3KVQA 1WIUA 1YY8A 5TE7H 1PSKL 5I1EH 5T5NF 4HMDA 1DZBA 1EAJA 2BZDA 1S7QB 3RIAK 5C0BB 3ARYA 1BBDL 4EOWH 2VDQH 1E4XH 4NKIL 1JHTA 4KWUA 1CDGA 2C9AA 2FGWH 4M1DL 1FFPB 2VLKE 2A6KB 3BO8B 3IDNA 2GTZA 5DF0A 3BVNB 3MXVH 3U6RB 3V5HA 1GSMA 3NFPA 4A6YH 1OSPL 1YEDA 4JO4L 4IS6A 5DS8B 5D70L 1P1ZA 2IJ0C 4RFOL 3P4NA 3EOTH 1GAFH 4L9LA 3CSYB 2XWTB 1X6NA 4TNVK 3QFDA 4NT6B 1I1FA 3SJVA 3VWKB 4JAMB 5IR1B 2P5WB 4PP1C 4X5WA 3OJVC 5E2VL 3K8LA 3ZKXB 1ORSA 3SGEI 3D85D 5ANME 1KCRH 3QUXB 2BOCB 1TDQA 5FAAA 3MV9D 3MJ7B 4OCMC 4ZFFA 5L2JB 2LTQB 5J11C 1S9VA 5F7WC 1AQDB 1S7RB 1RJCA 3BSZL 1QVOB 4O51B 2XTJB 3CDCA 2OTUA 1I1YA 2VUOA 3GMRA 5CHNA 2V2XB 1N5YH 3DO7B 3MRCB 3PXJA 4PJHF 1HWGB 4ZXBB 3VMPA 3FAWA 4FFVD 2Q7YB 1X3DA 1C5DA 1HXYA 1ZS8A 4FZ8L 4AM0B 1JZ3A 1FIEA 5GS0H 1W2KT 4NWUH 4BH7B 4KKLD 1RZ7L 5JIPA 3D39B 2ADGB 4UDTA 3MGAA 4JKMA 1RZIA 2NY0B 3S5LB 4JM2D 1V7MH 4MJ4A 3VXSB 4OIIL 1R5VA 5DK2B 2DL2A 4MD4A 1I1RA 5GGSY 3HAEA 4N5ED 2E9BA 4P2OC 3H8NA 4W6WB 1CDJA 1CG9A 1WTGT 4OGAD 3QJFB 1N8ZB 4FFYL 2YSSA 5T1LD 4N90E 1NCTA 4N0UA 1CICC 2HJFB 1J1OH 25C8L 1LE5A 4X7TB 2DTSA 3C6LC 1KG0A 35C8H 3IU3B 3BN9C 1T20A 4KQ4H 4Q6IA 1AC6A 3SDCB 5GJTL 2QBWA 3NZHL 4J4PA 1FVEB 5FGCE 3W9EB 3VXME 1F2QA 2BVYA 3SE8L 4Z7UA 1EXUB 4MX7A 4DCQA 3BAEL 5E9DB 2BY0A 4Y4FB 5ID0A 4NM8H 1UH3A 3TV3H 3UC0L 2EDQA 5C09B 1HSBB 5F1IB 4JN2B 1Z9MA 4PJHB 1WICA 5MENB 4PJGB 4GG8A 3FHQA 5C6WH 2DQIL 1ZTXL 3SE9L 1GHFL 1FJ1A 2F74A 4QF1A 1GGTA 2Q8BH 3CNKA 1Z6JT 3RVWD 3EJZC 2QKIA 2VQTA 5CJXA 1JWSB 5F7NC 4NO5B 4HV8A 4PRHB 3EDDA 4I9WD 1I7UA 5ETUB 2NQCA 1FZOA 2P8PA 1MRDH 1OGTA 2AEPH 3O2WL 1DFBL 4WUUB 3RI5K 3HPJA 3DV6A 4FXKA 2AJVH 2QQLH 3THMH 3HC3L 1GGIL 3E8UH 4WU7A 4P2QA 3GJFK 4RGMB 4ZUSB 1F45A 1I8IB 3HLAB 4LHUB 4DUXA 5JXED 5DD6B 1FE8H 1YQ2A 3GBLA 5LBSH 1FIGL 4PP1D 2CIIB 2I9TA 1EFXD 5ID1A 3TGXA 4P9HL 2JE8A 3WFHB 5C92A 1NMAH 4MDJB 4QRPA 4YGAB 4XVJH 1D9KB 4O58H 4GG6B 3TBYB 3MV9E 3O45B 5L2KD 1FORH 3KPMA 5DRXB 4HC1L 5DI8A 4ZTPL 3IVKB 1ACZA 4UOW0 3LEXA 1PG7H 3WDHA 1DTUA 4HKJA 2GJ6D 4QTIH 2ENSA 3H42L 3RWHA 4E5XB 4LLUB 4RGOL 3FQNA 1OAQH 3DRTB 4MD0A 4NNXB 1JCKA 4F58H 2W60B 2R29L 4A6YA 2F9BT 2M26A 3GJEA 1WZ1H 3ZT6A 3L3OB 2A74B 5D7IE 5IB4A 4DZBA 5HHQB 1G0YR 2VKXA 3QQ4B 1LE9B 1BZ7B 5FGBC 4LPWA 3ARRA 4M6NL 4OV5B 1MCKA 1OAYH 2VZ3A 2VSCA 4M5YL 3TT1L 1EO8H 1WWBX 2ICEB 4Q2ZB 4MVBC 3QNXB 2E9IA 2EZ0C 3L7FA 5F1OB 4H0GA 1F90H 1MCHA 3CFJA 3HG1A 3CZJA 3QHZH 1RJYA 1TVBB 4YX2L 4P3WA 4K8RH 4P2OD 1PY4A 2VRAA 2DJSA 2FJFA 5T33H 2VLJD 3U7WH 3VGFA 5JPMA 3FQRA 3MRRA 4Z7OE 5L8KB 3ZL4L 4F15C 1CBVL 5F89A 3WFEL 5FYLH 5K9QG 5BQ7B 3GEWB 1CICD 1LO3L 3ZE1F 4FQHB 5CBAB 2NNAA 4WY7H 3TO2A 5D5MF 4P9MH 1ITCA 3C6LD 4ORGB 2W65A 1JUFB 3BN9D 3LRSA 5DD3L 4JRYA 3OAZK 3G08B 3ARVA 2YK1H 4NJAL 4X6CF 4D0CA 1FNGA 5KVEL 4M3KB 4Y2DA 1JV5A 3LD8B 5TE4L 3PHQB 2AW2A 4GW4A 5GS2D 2VL5B 2WM0A 4I0PC 2MPAH 4LLWB 3KYOB 3WXWH 4LIQH 2YS4A 2E27H 5HYJB 3EYVA 3RVTC 2VIRA 3RBGA 2BK8A 2DBJA 1IL1B 3NABL 3VRIB 5DUPH 3NZ8B 3F7PC 5KSAC 1SQ2N 4LCWA 2WINA 1NC2B 5IVZB 3ZZ1A 3EJZD 4HS8H 3ARDA 3HN3A 4XGZA 3IJSB 1VADA 1FQ9C 4GKSB 1OD9A 4M7KH 5GRUH 5C08D 1B4JH 1NBVL 1QO3A 4I9WE 5I16A 1INQA 3CX5K 3L3JA 2R0KH 5FDWB 4R4FH 3JWOH 4MXWL 3S34H 4C4KO 3EJYC 1L0QA 2V5SA 3LAFA 3NA9H 1IZJA 1AXIB 1BIIB 1CDUA 4HWBH 4OLEA 3FRPG 3MCLH 1BJMA 3OAUL 3UEZA 3QUML 4H25B 3MLRH 1IGML 1L6ZA 4LEOB 2R69L 4LEXL 4HUUB 1JGDB 1B2WL 3HE7B 3Q6GH 3V6FB 4P49A 1M7XA 2GAZB 2BVTA 3TT3L 1JGUL 1IGFL 2H3NA 1IAIH 4KDTA 1WK0A 3LY6A 1BFOB 5D5MB 3HI6L 4PRAB 4X8JA 5L2KE 1NBYA 2VISB 5D2LF 3ME0A 3MRMA 1XF2B 4OB5H 4G6JL 4K7PY 3RUGB 3D9AL 3NIDF 4MLSA 3RGVC 1G84A 3Q3GB 2GJ6E 1HHGB 4WI3A 3WJJA 3FQWB 2AABH 5JMRA 4DKFH 1X5GA 4GLRH 1JE6A 2FIRT 2D9CA 2J6EL 3H0TA 4LVNB 4MQTB 2IFFH 1FBIH 4XNUH 1UWGL 4PS4L 5I9QB 4F3FA 5BMFH 1HSAA 3L3DA 4HHAA 4I3GA 4NUGL 4X6BB 2CIKB 4LP4A 3HNSL 3TESA 3ULVF 2HJKB 2H2SC 2J8OA 1RZFH 4M7ZB 4XCNB 2R56L 3FO9B 2F53B 5HDLA 3VXNA 4MVBD 5D9SB 5J0BA 1BQHB 2EZ0D 1S7UB 2AJSH 4DEPB 2A6IA 5IB2B 4JY5L 1AGEA 4UILL 3K0WA 3QH3B 3HC4H 1Q94A 4ZG1A 2ITCB 3QG7L 4TUJB 5F7HA 2DQGL 2VLJE 3SDDC 2X41A 2VTFA 5C9JB 1CXEA 3PQYA 4F57L 5A43C 3Q1SH 3BXNA 4JO3H 1YMHA 3RGHA 5KG9B 4XAWH 4EN3C 4KHTH 3RWCA 3FB8A 1JTTA 5ALBH 2AXGB 4LLQB 1A6VH 3SGKA 3PP4L 3WNMA 2X4QA 3LIZL 1FLRH 5D93C 1ZHNA 1FP5A 3RVVC 3W9DB 1NFKA 2Y9RT 2XN9B 1QKZL 4DGVH 1WQVT 4G8GB 4R4BA 4WV1B 3RJQB 2BDNH 4F2MA 4AEHH 4NBZB 4B53A 1Q1JL 3I2CH 2CGRL 5CWSB 2W59A 4I0PD 3HZMB 1TQBC 2EEBA 3GBNH 5E5RB 1FG9C 1BQHG 3TYFA 3RVTD 1F6AB 2WMPA 1MCNA 5DQDH 3DBXA 3MLZH 4JLRA 4Z7WE 2P45B 5KSAD 3QRGH 4YR6B 4M1CC 1WITA 2HRPH 2R0ZH 1CFVL 1H3WM 3B3IB 1G9MC 3R06A 4ZS7L 4NDMA 5DWUL 5J12C 5C08E 1CTNA 4FFWC 1NSNL 1RUMH 3F7VB 3QIUC 2O5ZH 4RA0C 2QHRL 5C0AB 5LGHL 4MLIA 4HW6A 2VH5H 1D5BB 3EJYD 3NBNA 1HHHA 4H8WH 1KIPA 4PRNA 1XGPA 4BA8A 1NKOA 1DBML 1K8IB 4I18B 3E3QC 4ODSL 4L3EB 1DEEA 2ID5A 3HI1A 1NBZB 5ECJE 5EO1A 4L8CB 3TZVB 4XPBL 2G60H 3QA3B 3HE6B 4OT1L 3N0PB 4M6OL 2QEJA 3WSQH 1D6VL 1J5OH 5KAQG 2PO6B 3GSXA 5EBMA 1YNLH 5FYKL 1HE7A 1TCRA 3LKPB 1IGYA 5I71C 3LQMA 3T0EC 2R0WL 1QSFB 2ZOKA 3QQ9C 3GIZH 1TZGL 3WLBA 4XXCA 3OB0H 1QRNB 5IJVB 4QWWC 4R90H 2DI8A 3DVNB 1S7WA 3ZTJG 1QLEH 5DSCA 4MCZA 1I7TB 5EUOA 3QXWA 1SYVA 4BSWB 4HH8A 2MCPL 5B3JF 1N2RA 3ALWA 4DTGH 2EIEA 4KU1A 4HWBA 4RBPK 5A2FA 1KJMA 3CXHK 3B9AA 4PYHA 4CU6A 3RVUC 2H2SD 2OR9H 5HD8C 3WL9B 2HH0H 4HWEH 3GMQA 2NYYC 3JTSB 1VFAA 3JVGC 1KCUL 2R23B 5DJCA 3AVEA 3GDBA 3G9VA 3SKJL 4M62L 2OTWA 3BZ4A 4AEEA 5CILL 5ICXB 1EA9C 4QRQB 4OZHA 1PYWA 4UB0H 3QEUB 2Q87A 2XG4A 3AREC 3SDDD 2JJSA 4HLJA 4ODTL 4X7EC 4BM7A 1QYGL 1UZ8A 1SHMA 1UWXK 2JCCA 5IMOB 4PJAA 1BGXH 3MV8A 4EN3D 1A2YA 1OAKL 3ZHDA 3H9SB 2OJZL 4X7CC 5JXAL 5T3XH 1PKQE 5IW1A 3RVVD 3VFGL 4JB9H 1OLLA 1UXSB 2ZCHH 3NCEB 4JFDE 1DQML 5GGSA 4JQIL 2XXMB 2OZ4L 5FECB 5IFJA 1AGBA 1DJSA 2DIJA 3QG6A 5I17B 1QBLL 3VXRB 4J3WA 2O5XH 1FSKB 3HMXL 2ZJSH 3DXAB 3MGTA 2AKRB 4XNQA 5F3HA 3MJ9H 4AL8H 2J2ZA 1TVHB 5EZOH 3O6FA 5E6YA 1P7QA 2B1HH 2VR5A 1EHXA 4XBPB 2YMXL 5E03A 1XR8B 4M1CD 1I4FB 3KPPB 4Z5RA 2XZQH 4OZIA 5E2TL 3QCUH 5GGUB 1HI6B 4ZOBA 4NOFA 4BH8B 4XI5C 2L0DA 5L7XH 2IH3A 4FFWD 3QIUD 4IDJH 4MWFA 4ZDHB 4PJCE 5J1TC 4RWHA 1D7FA 3CUPB 3SDYL 4KQ3H 1QLRA 4ORZC 4U1NA 4WTWA 1NFDF 3O8XA 4LF3B 3WCYA 4HWZB 1J0IA 4KH2A 5E1AB 4K3GA 2F19L 1BOGA 4XWGH 1JWMA 1ZHBA 4P57B 2GUOA 5F6HJ 4XVUC 3N9GL 1JGVH 2QR0B 1QPPA 1ZOXA 3O3DB 3VGEA 1JYVA 3KLHD 1ETZB 1X5KA 5H35A 5E0QA 1AO7B 4K7PH 5HPMA 5IVNA 1OHQA 5BOPA 1IKFL 5HHNA 4DK3A 2Q7NA 5I1HH 4LARL 1UCBL 3HFML 4YIQB 5JORA 3B9KA 4W6XB 4DGYL 5A40E 1LP9E 2UWEF 3T0ED 5JLZA 3QQ9D 1RK0A 4NKQB 4QHUB 2PNDA 1X7QA 1CE6B 2C1PA 2E6PA 1Q9KB 1J05A 1NANI 2NR6C 4KK9C 2HT4C 3LZFL 4KDVA 2IAND 3OXRA 3TVMA 1QPXA 3UTSD 5MEOB 4WHCA 2L7JA 5I8OH 1NAML 4PGCA 3BPCB 1LDPH 2P49B 3VFSB 1YJDH 1ZT1B 4YUEH 1NCNA 3SQBA 3RVUD 2XQBH 5C0IA 5HD8D 1IBGL 3RU8H 2GK2A 4NO0D 1CU4L 2NYYD 3DYPA 5M94B 1KF9B 3D69B 4IMLA 5JDSA 1PEZA 5CEYA 4QRUA 4WENB 3BKYH 4P23A 5DK3A 4G3YH 4X0KB 2UZIL 5IB1A 5DD5H 4AEFA 3K2MC 5IIEB 3ARED 4OZFB 3V5DA 3IJHB 3WE6A 3ZT7A 3D0LB 2OL3L 5J57B 1BP3B 3KDMA 4YHPB 3ARBC 3P4MA 4WEMB 1IGIL 2VDLH 2DLHA 4FQ2L 3D18A 3RVXC 5F1KC 1K9TA 3GKWL 3BP4A 3DSFH 1NC4B 3ROOA 4FFZL 3WIHL 1N4XL 5IVXF 3LV3A 2B4CC 4ZODA 5DVNA 2VZTA 2DDQH 1FZKB 2VAAA 4P5TA 3BKJH 1A7NL 1Y0LB 5D8JL 1CZ8L 2EYSB 4IOFC 2AJUH 2VNCA 5GGVH 2HWZL 1AXTL 3IDYB 3G6JB 4XB7A 2VDNH 1R3HB 3EHBC 1T83C 5D7SH 4OCNC 3L7EA 4NHUA 4W70A 3B5GA 4Y19B 3V4VH 5FHBH 1AKJB 2LU7A 2EDTA 3MZGB 3HRZA 5ADOH 2A77H 1J87A 2EDOA 1WWAX 3KLAB 1WEJH 4XI5D 4HEPG 5F21B 2MQCA 4OZFG 4EUPH 1Q8MA 4U6XB 2FEDC 3DMMA 3ECBB 4R0LB 4NRYA 4XP9H 4FOMA 1E6OL 4YXKH 1NGXA 3OB8A 5CZXC 2B1AH 5B8CC 1A9EA 1VGKB 4BQ9A 5F7MC 4JFXB 4IIQC 4BUHA 4KUCF 4GO6B 3PHSA 3E3QE 3MRQB 1P9MC 3VE0B 2DYPB 3IDJA 4XVUD 3K4ZA 5ITFA 3N06B 1UKTA 5E99H 1UH4A 3ULUC 4HAGA 3MJ9A 3TO4A 3UZQA 1F3JA 2K7QA 2HVKA 1GZQA 5HXMA 3QNZA 1I8LA 4LQFH 1JPTH 1I8MA 5E7BA 4G5ZH 4OM0L 1K3IA 4FTVA 3T0EE 4JG0L 4LRIC 1R5IA 3CH1B 4HK3J 3MOBH 5C07E 3X11A 5DGRA 1XIWC 3EO9L 4HIHB 4RIRB 3RIFK 1SVZA 2C3GA 1H5BC 3V9FA 4DQOL 2YPVL 4IJ3B 2NR6D 3BPNC 4KK9D 1JF1A 2HT4D 3BKML 4ODWA 3S35H 3J8F7 4YK4C 3UTSE 1MVUB 4OCSL 5GZOC 4IHOA 4U0RC 1DBBL 4L8SC 5KSBE 5DJXB 4O9HH 3MLXH 4WWKC 3CGTA 3MRHA 4MA3A 4HUVB 2BNRD 2V7HB 3GMMA 4ZAKA 5CZVH 4W81A 1GIGH 5DQ9B 4Z8FH 3SDAA 1FFOB 3OTTA 5FYJH 4K7FA 4P2RD 3QO0A 1MLCB 3LPGA 2Z8WC 4JFQA 3QIWA 2RAMA 2ZUVA 3QDMB 5F9DC 4NC1E 4P59H 1W0YT 2X2YA 3RL1A 4NQCB 1KC5L 3VFTB 4JFPB 4PG9B 3MLTB 4LSQL 4IRJB 1FVDA 1K2DB 3FKUS 5I15L 1NCBH 1DANU 5C8JA 3ARBD 4E0RA 3ILPB 4JZOB 2A6JB 4O00A 3ES6A 3ARQA 3FN0L 4XCYA 4TNWF 1DQQA 2Z31A 3LS5H 4LCYA 3UTOA 1LNUB 2PCPB 3S3JA 2A83B 1YPZF 4P4KB 1MY7A 4LKCA 3QUZA 4IOFD 2IBZY 5GJSL 5I8CA 4NN5B 5A3IC 4BFEA 3DX7A 1OP9A 3W5MA 3MR9A 1MI5A 5AZ2H 3EHBD 4LRNH 3I6KA 5E70A 4YDVB 1RZGA 4I3SL 5D1XC 1ZLUK 2FJGA 1IC1A 2EICA 2Y5TB 3VRLE 4MNGB 5GHWH 2ED7A 3KYMB 4QRTA 4R2GC 2UVEA 1MRFH 3WS3A 1MJ8L 3W11C 1ZA3B 5FK9B 4HIIA 1C16A 3GSUB 5DJAA 3WNNA 3QAZB 5CZXD 1WBYA 3NIGF 1I85C 4WW2C 4O4YL 3IFNL 2YD5A 1MCLA 3MO1B 5IOPA 4UIKH 2XWBB 3RWEB 1SBSL 4MA7H 1LEIA 2FO1A 1JZ5A 4WTZG 1WGOA 4JANB 3UAJC 4JFED 3ULUD 5DJ0A 1T7ZA 4GQ9L 5DJZB 4FZEH 3GMPB 1U95A 4NQUA 4D3CL 1I1AB 3IKCB 1HQRA 3LVEA 3NAAH 4HBCH 1DBAL 3C60A 3OR6B 3LKQA 3LQZB 3O3EB 3CCHB 4Y1AA 4XNYH 2CLVB 4KI5C 3MLWH 2PTTB 4JCLA 3TN0A 3DGCR 3MROB 5ENWB 5KJRH 5E24E 1NCAL 2L7UA 1AP2A 3OKDB 1MJUL 1YNTA 4EUPA 4FQ1L 1XIWD 5K9OB 3GSWA 4PRPB 5FO9B 1Y6KR 4LSSH 1IQDA 2HTLD 4PD4K 4XP5H 5K9JH 4YAQB 2F58H 1TZIB 5D1QA 4JDTH 3O41B 4WWKD 2ZKHH 2PF6A 4QGTA 3BZEB 2BNRE 2DTMH 3KYKH 3VFVA 1T0MA 1AI1L 1UWEH 5GSRB 4HKXB 5CD5D 3BDXA 4RAUA 2AI0L 3TNNB 5JUEL 4ENEC 1AIFB 2D31B 4GRWB 4P2RE 4KZDL 2KKQA 1OD7A 3MCKB 2ILLA 1F58H 2VDPH 2R2BB 5CJBA 4JQXC 1JPFB 3P30L 5FO7B 4F7CA 2N1KA 1T4KA 2HFGH 3IETB 5F9JB 3GI8H 5I2IB 5F7DB 1HHIB 4HFWB 3GJFB 1ZLVH 4GMTH 5KANG 3BRGC 3P11H 2X40A 4HJGB 4XAKD 5T1KD 2ZPKH 3QO1A 3MMEA 3MXWH 2NY2B 1KCSL 2MKWA 1PG7W 1E27A 3OZ9L 4ZOAA 1RUAL 4BFIB 4U6TA 4O5LL 2CMRH 1A4KA 2ORBL 3O2DH 3G5YB 2YD9A 2FHBA 5A3ID 1UC6A 2Z35A 3QUMB 5SV3A 1C1EL 1HDMA 1T89A 2X1XR 3SO5A 3V95A 3L3HA 1FL5B 4WW1A 3GRWH 5D1XD 4HDIA 1TJGH 4BZ1H 2P8MB 5GGTH 1Z0MA 1MJJB 4GMSH 3H7BB 5I76A 2CKBH 3PWPA 1S7VA 4W4NA 3W11D 1BM3L 5EU7C 4L4VB 4UAOB 4GT7A 4LU5L 4Y4FC 4YC2B 1KIRB 4OCRH 4KMTH 4OZGE 3STZB 3DX6A 3HRPA 4PGDA 3BHBA 4GRLB 1P53A 3LKNA 3RWJB 4HUMB 2QQNH 3VG9B 2HFEA 5IW6B 1AH1A 3C09B 1IM9A 2ZG2A 4IDLA 4RAVA 2P43B 3I6LD 4MNQB 3WLWC 3UAJD 1D5ZB 1FV1A 2VR9A 4JFEE 4RQQA 3ULUE 2ICCA 4KKNA 2E7BA 4PJ8C 5FKPA 4LLMB 3LDBB 2Z93A 2KPNA 1KPRA 2IMMA 2JIXA 4KI5D 5GISH 4PLJC 5H2BB 2W9EL 3DV4B 1ZT4A 2AJ3B 1VFMA 3G5ZB 2F15A 1J8HA 1H3TA 1XGRA 4TVPD 4IOIB 1FZJB 2OSLA 3RWIA 1QFUH 3QPXH 3B2UC 5J56B 3B8SA 1HH9A 5MERB 2ARJQ 3MRBB 3VWKD 2FHCA 5IKCA 2P5WD 1XR9B 4YHLL 2CUMA 2VZVA 5DHVH 3MUHL 5C0BA 1D9KC 3DUUB 2PUQT 5T3ZD 2DQJL 1XGUB 4ZUUA 1MSPA 2I25N 4BUGA 3BVNA 3GBML 4FNLL 4ENED 4PUBL 5DS8A 2W0PA 4A2MA 5IB3A 3FQUA 4U1JB 5F71A 1MHPH 2APBA 2J8UA 4XNXH 1UXWB 4W68A 2RB8A 2AK1H 1N0LA 3RTQC 1B0RB 2LE9A 5ALCL 1BQSA 1P2CB 3CSYA 3TBTA 5IWLA 1UH2A 4PTTA 1RUKH 1CE1H 5JOEA 4NT6A 4D0BB 3DX9A 3AMLA 4JAMA 1C12B 3LPFA 3ZE0E 1EBPA 3NFNB 1X4XA 1ZEAH 2NY7H 3Q6FB 2EDNA 3QUXA 2BOCA 1FDLH 4OGYL 3BYYA 4WHYG 4XAKE 4UNUA 5L2JA 3M8OH 2YD1A 1AQDA 5CEZD 4MAYB 4RISH 2BP3A 2DQDL 4OLYL 5SWZB 4PRIB 5DZLA 3BUYB 3V52L 1DN0B 4HQQH 1JYNA 3DO7A 1IJ9A 3GI9H 4FQLL 4OZ4A 5T5NG 1ONQB 3V2AR 5B38G 1MREH 4JFFB 4ZXBA 1BZQK 3LEVL 5AD0B 3P77B 5D7JB 5D72H 5F7YC 1UZ6F 3ARPA 1JK8A 3CC5B 4LAJH 3F8UB 4HUKB 3VGAC 2OP4H 5DD0H 3MRNB 5MEQA 4ZNEE 4QXGL 2NY4B 5J1SC 3H3PL 3IU4L 3D39A 2FL5B 1ZWIB 3KPLA 4PLNC 3PWLB 3S5LA 3NCBB 3KJ6L 5GRJL 4MB5A 3LD8C 2B8OT 3RY6A 3K3QA 5DK2A 3M45A 5I73B 5E9DD 1HINL 4J8RB 4Y4FD 1F2XK 4OKVA 4P0DA 3WIFB 4N0CC 3V4PH 1T22B 1A3RL 3VFOB 5EOCH 1NMBH 3QJFA 3RX8A 4P48A 4DVRH 5BVPH 2WK2A 3NCJH 3ESVF 5EBWB 2IEPA 4LVHB 1GGCL 3T1FB 1AR2A 2IH1B 3O2DA 2DQEL 2HJFA 3H3KA 2VLRB 2PXYB 6CGTA 5E7FA 5FCUL 4YXLL 4R4NC 5DVLA 3I6LE 3WLWD 5LWYH 1JPGB 3IU3A 4PRHD 3RA7H 1MWAL 4C56B 2QSCL 4ODBD 3V4UH 1A6UH 4V1DB 2ERJC 3SDCA 2KQNA 4PJ8D 3MRPA 1CGVA 2I9LB 5GQBA 2NX5B 3GRWA 4KHXL 3CJJA 1A9BB 1FVEA 4KI5E 4PLJD 3W9EA 1TLKA 2WUCH 1ZSDB 2VXTL 1U0QA 3D2UA 1EXUA 4FQXC 1H3GA 4QNPF 5GGTA 3HZKA 4TVPE 3RRQA 4FQJL 4PP2B 4P46B 5SWSB 2OMBA 2CKBA 4J6RH 4PJ7E 5DEFB 3B2UD 2J12B 5GIRB 5C09A 4ZMAT 3BP6B 3GM0A 1HSBA 5F1IA 3K46A 3MFFB 4M8QA 4PJHA 3L5XL 2Q6WB 1KJ3L 5MENA 5F9WB 2P5WE 3CK0L 3T0BA 4E41A 4CADA 4IMKC 1UB5A 1FFNA 3DRQA 1FNEA 1D9KD 1U2HA 3K4AA 3RZCA 4JFZL 1P7KA 5T3ZE 1JWSA 3K80A 4XPAH 5HBBA 1ODAA 1RJZA 5B39A 4DGIL 4KGLA 4D9RD 3EYUL 1R0AH 3DHMA 2V17H 3FONB 4M4PA 1NCDH 1IAMA 4WUUA 5ILTH 4AEIL 3L3KB 3SE3A 3JV5A 5ACLA 3RTQD 3TPKA 4LVNC 4R8WH 2I60H 1W0VB 3RQ3A 3UROR 2FSEA 2J1KA 5K9QI 3HLAA 4CVZA 4LHUA 3GB7B 4U4BA 2DB8A 4B50A 4JY6B 1IARB 4MXVE 4L4TB 2BVQB 2N4IA 5H37G 5LXGH 2AQ1A 2B5IB 3MLSL 3LS4L 2UY6A 4KK5C 1HWHB 3VXSE 5C0CA 2AV7B 1YEFL 3X3FH 4QRRD 2CXKA 1TPXC 3KHOA 4MXQC 1CYGA 5DHVA 5DRXA 5KSUB 1CQYA 5M95B 4WJ5A 2XY2A 3NFSL 3S37X 3ZMRA 3FQTB 5CEZE 4JDZB 4JRWA 2X1OA 5DEGB 1IILE 4HXBL 1CDIA 1ACYL 3KPOB 1QEWB 3GK8L 4PJXB 1JGEB 4PBVC 1M1SA 3DRTA 2H1PL 1AHWB 4IBLT 5CJ5A 5I1IH 3QEHB 2W60A 1N6UA 1U8OA 5J1AB 5HHQA 1F4XH 5DDHA 3QQ4A 1LE9A 4QOKB 4Q58C 1BZ7A 4Y5XB 3RZWA 4EI5C 1NCCL 3LHPH 3S7GA 1CK0L 4DVBA 3E6HB 3T08A 5ESQB 1IM3B 3G5VB 2KDGA 1L4IA 1NCWL 3QNXA 3VFWA 1EGJH 1JN6A 4M6ML 5C2BL 5J4MA 1YYML 4R97B 5A16B 3T65A 3V6ZA 4LOUD 5GS1B 1IAOB 4TRPH 1TVBA 5E9DE 5EU7E 5EOQH 3JWOC 5E8EA 3SO3B 1OM3L 3ARXA 1QNZL 4YHZL 2YEZA 3MRLB 2ZWLT 3DUSB 3MNWA 1S9YB 2ZP0T 4HMEA 3WFCH 4PJGE 1EAPA 4U3CA 4WU5B 4KPHL 3RPIB 5BQ7A 5AYQA 2IPTL 5AYUH 3ULVH 1GGUA 2EDYA 2C4FT 1TJHH 4I3RH 4R4ND 1JUFA 1NAMB 4PRHE 4Y16C 1H8SA 2KZ1B 4JQVA 4XH2B 2J5LB 5DJ8B 4L3CB 4Z78B 2R1WB 5HGHA 4LFHG 1S78C 4U1MB 1R24A 3FHAA 1BQLH 3X14B 1U92B 3ARTA 3CLEL 4P3CH 4FQXD 4NSKB 3QEQB 5GZNC 1DBJH 4I18C 4OTXL 2VL5A 4JZJA 3EFFB 5J6GB 3UBXA 3KYOA 1CFNB 4TSAL 3TZVC 3VA2C 3A6CH 5HYJA 3EFDL 2R1XB 2ATKB 5IBUG 3HE6C 1J1XL 4QHMA 2AEQL 2R2EB 2VXVL 4B0MM 4XCCL 5HDQH 1EZVX 5DD1H 1OF2A 2V2WB 2PO6C 1HILA 1UG9A 4DUWA 1NC2A 2OL3B 3H3BC 5HVHB 4GG6E 3HA0A 5C3TA 4NM4L 1CXLA 1MIEH 3CH8A 3SGDH 4D9RE 2LQRA 4C58B 1KN4L 3CZFB 1QG3A 5K9KB 4KTDH 5DJ6B 3PG2A 2GITB 4LDOB 4LKXB 5TDOA 3AY4A 3L6FA 2VLKB 1RUPH 2BMKB 4HGMA 1TETL 4M43H 1BD2D 1KT2A 4H25A 1HKLH 4LEOA 4EZMA 2OLDA 3HE7A 3V6FA 3BIKB 1A7PH 2XNAB 5LCVL 2V2TA 2JF1A 5I1CH 2F53D 2ZNXA 1KV3A 1BQUA 3FOLA 5F3BA 5D5MA 4KK5D 3D3VD 5C2UB 4WI5A 4QRRE 4PRAA 4YDKH 1AFVH 2BNUB 4PTUB 4MXQD 4OLVL 1GPOL 1XF2A 4HX1B 5HDBE 1A0QH 2PYEA 2O5YL 4X6CA 5JA9A 4X7SH 2EYTA 1KTLB 4L8BB 4EVNA 2GTWB 2Q86A 1QD0A 5E6IC 2NXZB 4JPKH 4XCEB 3JTTA 1TTFA 4XWOC 2EO1A 4R26L 3S3SA 5DR5L 3CVHL 5IHUL 3CLFH 5LAXB 3S4SA 2CIKA 4EI5D 2BJML 5HPOA 4NKDB 2XN9D 3NACH 4X6EB 4G8GD 1T6VN 4J1UA 4LL9A 4OGZA 5D9SA 1W0WB 5IFAH 1S7UA 5F88B 1P4IL 4U6VH 4ONGH 3B6SA 1BFTA 3MX0A 3GSNL 4ZO9A 1OPGL 5IQ9B 1HCFX 4KTEH 4D0DB 2PKDA 2ITCA 3F7QA 5FUCC 4OSUH 4K2UL 5E8NA 3TVMC 3T0WA 2J3SA 4XHQA 1H3UA 3U83A 1T80A 3QI9B 1DQDH 3BIBX 5KG9A 5LG1A 5E56A 3OF6D 1JMZA 1X44A 2DM2A 3K1DA 5HVFB 3MLYH 2AXGA 4Y16D 4CN1A 1C8PA 2ZG1A 3TYGL 1A1NA 4N5UA 5AWNH 3W9DA 4KJWC 2A1WH 1KN2H 1S78D 3G6DH 1CGUA 1IQWH 1NFIB 4WV1A 3OKKB 4HJJH 3W0WD 3PDGA 5D2LA 5GZND 4AK1A 1EGJA 4L3ED 1NQBA 3G5XA 5GGQH 1A6WH 3RAJH 2FATH 3TWCL 3TZVD 4UV4H 4LSPH 4M48H 3HE6D 2FLBT 1FL3B 3TJEH 4OLXH 1MIMH 1N0XH 3PV6B 3VRJB 4MGXA 4YR6A 2PO6D 5D7IF 4HJ0C 3F7RA 4YFEA 1CL7H 2EEAA 3TIDA 3VJ6A 4HH9B 3B3IA 2LU4A 3S98A 2C3WA 2AV1B 4WUKL 4JREB 3RUGE 3CMOL 5D6CA 4OF0A 4P5TC 4JM2F 3TEUA 3NPZB 1KNOB 4LSRL 4N0FB 5C0AA 1G1YA 5EU6A 2A9NL 4YNYA 4GLRI 2E7LA 1CLOH 1K8DB 2CUHA 2D7MA 1EEQA 1I3RA 1K8IA 3W81A 1YEJH 1QFWH 1BD2E 4I5BB 3PWUB 1NBZA 2JJUA 3DSNA 4L8CA 2EO9A 2YPLB 1MNUL 4Z7OF 1KLUA 3TCLB 3RNQA 3QA3A 3OJDB 5I8KL 4XMPL 3CFEB 4LSUH 3WD5L 5ERWB 3FO0H 3PHOB 2F53E 3S88L 1WBXB 2R15A 3INUL 4CMHB 2FYYB 3D3VE 5M7QA 4L8DA 4Q9RL 3LKPA 3ARZA 1AJ7L 4U6YB 1NH6A 2Y4SA 1KSRA 1QP1A 4NNPH 2CDFB 1QSFA 4OAWB 3D85B 2ATPA 1FL6A 1QRNA 2ICWB 5JW3L 4HCRH 3MV9B 4ZTOL 4XPFH 2DLFL 4I8DA 5E6ID 1S9KC 4X6DE 4WEUD 3MJ8A 1BBDH 4XWOD 5HYIA 1DBKL 3H9SD 3V6OE 3RWGA 2E8ZA 3TPUA 5ICZB 5BO1L 3TBVB 5DURB 2XN9E 2DM4A 3C5ZB 1CR9L 1IC7L 4G8GE 3RDTC 1OSPH 4JO4H 2R23A 1A6AB 1KB5B 1WIPA 1EEZA 4JN1L 5LGJA 5E4EB 1N3NB 2CSPA 1VFOA 1XF4B 2IAMA 3HNTL 5EU4A 1N59B 1YN6B 4JM2B 3DXAD 5ICXA 4MA8L 4QRQA 4Y5YB 2IBBA 3B9DA 3QUYA 4F7EB 1SY6L 4G8IB 4HIXL 4OIAA 3TVMD 3B5HA 4MJ6B 5DA0B 2DI9A 1NUDA 3OKNB 1M71B 1TCMA 3SGJA 5TF1H 3AM8C 1CS6A 2BSRB 3MODL 2DOCA 5F7EL 3ZKMC 1DUYB 1HH6A 4M7LL 3UO1L 4R0LC 1NPUA 2HMIC 2NY3B 1YN7A 4KJWD 1E4KA 3KXFD 3SDAC 4C57C 2APFA 2DD8H 2EECA 1I9JH 3X13B 1UXSA 4FXGB 4UTAL 3QIWC 2D3VA 5IEHB 1MJ7H 5FECA 4MSWB 1MF2H 2MQ0A 3W0WE 1NLBL 5I17A 4X4ME 3VXRA 4L3EE 4PRDA 1I7RA 2AKRA 3N1MC 3U0WL 1K5NB 4JFYB 5BJTA 3GSVA 1AXSB 5DJYB 4XBPA 1MRCH 4U2YA 1GRWA 1G7MA 1I4FA 4HJ0D 4XRCB 5TDPB 2GYSA 4IRSA 3ZDXE 1JGLH 2R4SH 3JXAA 5GGUA 4HF5H 1RK1B 2XQYK 2Z31C 4PG2C 4BH8A 2ZCKH 3MRFA 1YJDC 4WFED 3BJLA 3VXUA 1YUHB 4P5TD 1KENH 3HR5A 4UMGA 5KTEL 4FFYH 4PD4J 5ITBL 5EO0B 2DQCL 4LF3A 2B0SL 4HS3B 2GY5A 5DJDB 5FV2A 1NGQL 4HWZA 2B4CL 5E1AA 5EWIH 9CGTA 1RFDL 1FVCB 3R8BB 5EU3B 2Y07L 4JG1L 2QR0A 2HN7B 5C6TH 5GJTH 3N85H 2FX7H 2DLIA 1U8PA 2R0LL 3QFJA 4KAQH 4PJFE 4L29A 3VG0L 1U3HA 5INCA 4TVSa 4Z0XB 5DTFA 3SBWC 5HHXH 1OAZH 1U8KA 3BN3B 1Q0YL 1EFXB 1JJUA 3UC0H 1HCVA 3OKLA 3ZTNH 1DLFH 4JZNB 1WCBB 5J11B 1C7TA 4FABL 2DQIH 5EH1A 3O4LB 3SE9H 3C8DA 5I30L 4HKBB 2O61B 4LSVL 2GJ6B 3E0GA 4X80L 1T0NB 3H9SE 3KPRA 3F62A 3JUYA 2H32B 1G7IA 5BRZB 5HGDB 5SX5H 4LPCA 5MEPB 4Z7WF 1ZT1A 2AVGA 4YHKL 5T5FL 2E6QA 2BVOB 3LN5A 4G7VH 1FYTA 3V0AC 1NC4D 3IFLL 3RDTD 3ULUL 5ELIA 4EXKA 3D69A 3QEGL 1U42A 5TQ0H 3VFMB 1GGIH 1I8KB 1OY3B 2J8HA 1ORQB 3P0GB 3BDYH 1SMOA 3EW3B 2X89D 3FO1B 5HHPB 5CGMA 3T0AA 4TULL 2WW8A 5HHOA 2C5DC 4MQ7B 5C86A 5K33A 1NL0L 3KR3L 4X0KA 3DXAE 1RURL 2D7PA 2ARWA 1QA9B 4YE4L 5FUCE 3TA3B 2XG5A 2F54D 1H0DA 1T21B 2HYMA 3IAPA 4Y19D 4H0IA 3IJHA 4QGYA 5ICYA 3OBAA 4HCRA 3RWDA 4P2OB 3D0LA 1QFPA 3VD5A 4ZPVA 4KZEL 2Q76B 4NQDA 2Y7QA 4B41A 4P9HC 1OSZB 1VFBB 4JPWL 5F8RC 3VFRB 1MCPH 1VENA 4HC1H 1A7OH 2GT9B 3L9RB 3H6JA 1GOHA 3KXFE 3EOBB 2H41A 3H42H 5CD3B 3C6LB 2P46B 3QIWD 2BRQA 4WHDA 3LQAL 1YDPB 1DL7H 2UWEA 1FCGA 1R3LB 3MNVB 4U1HA 4U1KB 2DYPD 3BEWB 3DO3A 4NFBA 1V3MA 1KFAL 4M6NH 1R3HA 4RRPA 4M5YH 2VWEC 3HUJE 1AKJA 4GKZA 3S36H 4HK0A 1AO7E 4BQBA 4OI8A 4G9DB 5I19L 4MNHB 4OJFH 2R39A 3WO4C 3QNYB 3KLAA 3MGOA 4Z7WB 4WFEE 5AZEH 4U6XA 3M17B 2DQFB 2GFBB 3TP4A 2DKMA 4CL7A 3BEVB 1PZUB 5C08B 1T1YB 2AGJH 3OHXB 5KVDL 1J88A 4JFXA 4ODXB 4XTRC 1LO3H 1T89C 1UKSA 3MRQA 4HPYH 5F1NB 1T7WA 2C26A 1NCUA 4N0YH 3VE0A 3T8XB 3JWDH 1V7NL 1H15B 2X1PA 5DD3H 4I48B 1PKOA 3V6BR 2WBJB 1CFTA 1NJ9B 1MLBB 2XZAL 4NJAH 2FD6L 2W92A 4U2ZA 4WEBH 2F8XC 4K7PX 2DBLH 1CD8A 2GEEA 2X4TB 3ALPA 1T03H 3K81A 4LPYA 5TPWH 5TE4H 1YEEL 1SM3L 4S1DC 5EBLB 4QY8B 2P1YA 1OWRM 4MQXC 1EBAA 1C08A 1VPOH 1FH5L 1S7SB 5IVXA 4HIHA 4M7JL 1ERNA 2DLTA 4RIRA 4LQ1A 4NQCD 4QT5B 1TIUA 5E2WH 1R3JA 3KPSD 4PGZA 3IDXH 4TQEH 1S8DB 5C0EA 2AS5M 4GKOA 1Q9OB 4FHBD 1UA6H 3F6LA 4U33A 4HUVA 3HCVA 4OF3A 5JOPD 2LVCA 1IC5H 2V7HA 5EZIL 3P9WB 1U6AL 3O6LL 1MCIA 1JRHH 4JGUA 4JM4L 1NMCB 1BAFH 2WIIB 2DI7A 3QWOA 3QUMH 4PJCF 1IGMH 3IFPB 4J3SA 1NUNB 3G6JE 15C8H 3QDMA 3I6GB 3U4AA 4OF7A 1A5FL 2F54E 3TT3H 4JFOB 4Y19E 4F7PB 5GS3A 4Q0XH 4M1GL 3RY4A 1KYOJ 3MLTA 2AJYH 2IADB 3O2VH 4Z7NE 3EUUA 4HUWA 3HI6H 1P69B 4XPTL 1LGVA 2ZOLB 3ILPA 2RR3A 4JZOA 4PJIB 1MFDL 2A6JA 3B43A 4F15B 4OFIA 2Z8VC 1URLA 2D2OA 3D9AH 4Z76A 5IBTL 1VACA 1I3UA 4UAOC 1LNUA 1QSEA 5T3ZL 1U8HA 3ZKND 2A83A 3MPCA 4P4KA 1X5YA 3O6KL 3FTGB 1TMCB 1LP9F 4GRLC 4A2LA 3QULB 3O3BB 4ZFZA 5E8OB 4MAUL 3V7AG 1ZVYA 3NN8A 3FFCB 2IGFH 4I0PB 4QTHB 1G6RH 2VQUA 1NAKL 4N9OB 1BECA 4L5FH 1B4RA 5E8PB 4UILH 1CLZL 3EOAB 1JVKA 3UMTA 3QPQC 1YEIH 3J7HA 4Y0GA 4EJ1C 4HC1A 3QG7H 4APQA 5FK9A 3GSUA 4PJ9A 1G7QB 5GSVB 1KELL 3MO1A 1OP3H 1P4BH 3SCMA 1QHPA 3LPWA 1BMGA 2XWBA 4X5LA 1KBGL 3RWEA 3T4YA 4PJBE 1KPVA 1MQKL 2DQTL 5FO8B 3PP4H 4TPRH 1AGCB 4JANA 1JHLH 2HLAB 5HGGS 1KEMH 5E00B 3PABB 43CAB 5DJZA 4XB8A 5KANI 2VXSH 4LSDA 5KN5B 1WC7B 1I1AA 1CD0A 3IKCA 3OR6A 4XBEH 5TE7L 5I1EL 1YQVH 1Q1JH 4S1DD 3MROA 5HY9A 4KI1A 5CSZB 3OKDA 4WNQB 4EOWL 4MQXD 2NW2B 3ARFB 3HS0B 1CFQB 1YPZA 2FGWL 4ODUA 4NQCE 2P47B 1LP9B 2G2RA 3KPSE 2MQ3A 5E95B 2EE2A 3RGVB 3PDOB 1YECH 2MTPA 2X4SB 4OLWL 4A6YL 5IJKC 5DWUH 4CGTA 2I5YL 1TZIA 5TGBA 2MKLC 2ZUUA 1QRKA 4GW1A 3BWAB 1BJ1J 3QZWG 4WO4A 4NQVA 5JOPE 4OLUH 1G7PB 5GSRA 5LGHH 2GK0A 3LH2L 4HKXA 2DJUA 3UPRA 1CXFA 3TNNA 2D31A 5IMKB 1MFBL 1LO0H 1KCRL 2QL1A 2YKLH 3QZWA 4X9BA 4XPBH 5EOTB 5LVEA 4GAGH 3WJLC 2R2BA 5INDB 3S37L 1WWCA 2K9UA 2XA8H 4ETYA 1JPFA 4OT1H 4M6OH 3UPCA 5BS0B 1KCKA 3RZCC 3IETA 1TNNA 2XICA 2IFGA 1N5YL 3IFOA 1F11B 1OW0A 5F7DA 4MNGE 1MFNA 4HJGA 3UJIH 4DN4H 5FM8A 4EN3B 4DW2H 4L4VD 4U6HA 5GS0L 3D0VB 1OARH 4NWUL 3WDJA 1F02I 5D93B 4HGWB 1VGEL 4NN7B 3LSOA 4GRLD 5JO5B 1Z2KA 3O9WA 5IW3A 3G5YA 4RNRB 1ZVSA 5C7XH 4TTDC 1SJHB 2PXYC 4UT7L 5I1LA 3P9LB 3QUMA 2WIMA 1KLGB 4MNQD 1OGAB 3OMZA 4IEFB 4R7NB 4Z18A 3S3PA 3WEXB 1I3GL 4Z77B 5KSBF 1TQBB 4F8QA 3P4LA 1U58B 2W0FA 4LASH 1WLHA 1BZ9B 4WHTA 4ZPTA 4NO2B 5IM7B 4M62H 3MYJB 1F97A 1J1OL 3QPQD 5CILH 4NKMB 4P46C 4KVNL 35C8L 4QYOA 1EO5A 1KIRA 1J1PL 4KQ4L 3PJSB 4YBHA 5J12B 1M05A 1JZ6A 3DOSA 1GOFA 2V7NB 1QSZA 3QIUB 2YWZA 3RWJA 3T0XA 4YPGA 1WFNA 2PTUA 1Y18B 3GMOB 2FBOJ 2CKNA 4U1SB 5JXAH 4JDVB 2EH8L 2YPKB 5DLMH 1IZKA 1CF8H 4NM8L 1M6OA 5HI4C 1CGYA 4NRXA 3S96A 4F33B 1Z5LB 2NPLX 4LLMA 3TBSB 5CIPB 2X4NA 3V8OA 2EYRA 3CDGB 1G6RA 4GRWE 5H2BA 12E8H 4OCLC 2Q8BL 3LKOB 3G5ZA 1TQCC 3NH7L 1RHHB 4IOIA 1FZJA 3GSNB 4Y5VA 4ZUTB 1JTPA 5I1DB 5MERA 3EAKA 5FIEA 1MRDL 5DFVC 1CT8B 3RHWF 4CAGA 2FWOA 32C2B 4XVTH 5F7KC 2VZ1A 3CFCH 2AJVL 3RJDA 3THML 4JQVC 3E8UL 5KSVB 3GO1H 4Y4KA 4LMQE 1XGUA 3V7MA 2IANB 1WVZA 4X8XA 3UTSB 1YC8A 1U3ZA 5IG7B 5KSBB 3HPLB 3SDYH 3VRLF 2XZCH 3STLB 1KPUB 1FE8L 3VMOA 4PRID 3BGMA 5LBSL 3V0VA 5I74C 3KNBB 3QXDB 4JFFD 4U1JA 3IGAB 5IHLB 1NMAL 4LGSB 5IMMA 4XBGB 4XVJL 2EDFA 4O58L 1B0RA 5JHDD 4NJ9H 1FORL 3CSPA 5EIVA 4KKBC 1OQXA 1FHGA 1OB1B 4QTIL 2NY4D 3CDYA 2W07A 4GXVH 3RZCD 5F97E 4MA1B 3I3EA 4ZOEA 1A6TB 1OAQL 3NFNA 1PQZB 3AREB 2MSPA 2H9GB 3Q6FA 4XCFL 3KJ4C 5DHXB 4ZQKB 1WZ1L 5EC2B 4E9LA 5GS1C 1MHEA 3RKPA 2GJZB 1G7LA 4J3TA 1VFUA 4YZFE 2GCYB 4L4VE 4D9LL 3KYNA 4MAYA 3SO3C 2A2QT 5SWZA 4HXAL 1JNLL 1OAYL 4Y7MA 1EO8L 1FAIH 4Q7DA 4G6MH 5F70A 5AD0A 4TTDD 3P77A 5D7JA 5L9DL 3BQUC 1NAMH 2VLRD 2PXYD 4Z0BH 3L5WB 3ARUA 4MNQE 5CINH 2UY7A 3IDGA 4C56D 4K8RL 2J5LC 5I1JH 4V1DD 6FABH 4X99B 3MRNA 2YN3A 1UM4H 4AH2B 5T33L 2FL5A 1EDQA 2BOBB 3QUKA 4GS7B 2G75B 2DWDB 1RZKH 3IDMB 4F80A 4YGVB 4WY7L 1V05A 3C8KA 4P9ML 4P46D 1T1WB 3SKMB 3U2SA 3WIFA 4AQOA 1RMFH 1KIQA 3MA7B 4XP4L 4GUPB 1B88A 2C4XA 2OL3H 3R0MA 3P0YH 5EZJA 1F4HA 1A6ZB 5IMLB 2RFXB 2MPAL 1UM5L 4QXUL 3WXWL 3GKWH 2E27L 2CUIA 5HI4D 2AXJA 2I9LA 1A7RH 2J7LA 1U2CA 1A7NH 1ZHKB 2NX5A 2P5ED 5D8JH 1YNKL 5DUPL 5EA0H 2FIKB 1ZSDA 1F3DJ 4D8PB 2ADIB 1G0XA 2BFVH 2EC9T 3C8HA 5DMJB 2A38A 3GNMH 4HS8L 1VKXB 1J18A 5JR1H 5SWSA 2IQAB 3VWJC 1YMMB 5GRUL 3PP3H 1B4JL 5DMGC 5GIRA 3BP6A 4R4FL 3JWOL 2JB6B 4L4TD 3SY0B 2YA1A 1P7HL 3S34L 3PL6C 1JYXA 3NA9L 4V2CB 4JPVH 4HWBL 3MCLL 4MJID 3MLRL 5EU5B 4D94A 1OCWL 2OQJB 4W4OA 2DLEA 3MACH 3Q6GL 1ES0A 4O2EA 4O2FA 2Y6SC 4PRIE 4E42A 5B4MC 4JKPL 3T2NH 1IC4H 3L3KA 4JFFE 2OR8A 4AIZB 4NPYB 4ZSOA 5EFIA 4LFHD 2YBRB 3RX7A 1UEYA 3GM8A 5D96B 5JHDE 4OZGF 1G9NH 3SPVB 4CNIB 1W0VA 4OB5L 4RZCA 5TE6H 5ISZA 2H45A 1KB9K 3GB7A 3VU2A 4KKBD 4DZ8A 3ABZA 5E8DH 4G9FA 2BVQA 3VH8B 4DKFL 1W72L 1DQLH 3AU1A 4DN3H 4M00A 1EVTC 3UBXI 3VFUB 2AV7A 1P6FA 2H6PA 3ULUF 4N1EA 2EIZB 1AC0A 2D9QB 4JG0H 5E5UB 5L0QB 5IT2H 3VI3E 3BJ91 2IFFL 2N56A 3DHJA 5BMFL 5KSUA 3BX7C 4OD3H 1AD9B 3DTXA 4KJYB 1XGQA 5DEGA 2YN5A 1K4DA 1IE5A 1RZFL 3ORJA 5L88H 3BKMH 4OGXH 3OB0K 4ESKA 1AHWA 2O26U 2PW2A 4Q6YA 3BQUD 4XP1L 2VLRE 3QISA 1GOGA 1J8KA 5AG8A 1QTYT 4QOKA 5C0JA 4Y5XA 4C56E 4Z7QE 4V1DE 3HC4L 3BH9B 3EBAA 1QLFB 4NQSA 5ESQA 3U30C 4KKCD 1IM3A 4LLVA 3G5VA 4ODVL 5DJ2B 4FA8A 4AZ8A 1FN4A 2VAJA 3Q1SL 4XX1G 4K9EH 4JO3L 1DQJB 2A6DA 4TSBL 2Y23A 4XAWL 1BBJB 4KHTL 1IAKB 4Z95H 1IKNA 4JHAH 1P4LB 1FLRL 4NUJB 1KC5H 1J0HA 4CVWA 2QV2A 1E28A 4DGVL 1S9YA 3U36A 3QDJA 4EQ2A 5I15H 5D7LA 4F9PC 2R2HB 3MRIA 5B8CB 1MCOH 7CGTA 2SEBB 3I2CL 4TUOB 4IIQB 1NAMA 4NYLB 4CMMB 4XH2A 4JREC 4R96B 2FR4B 5F7LB 5FM5O 3GBNL 3ZE0F 5A2KH 4Z78A 3U82B 2YC1A 4U1MA 1B6UA 4Z7VE 1V8HA 2P5EE 2IWGA 4NKOA 5DQDL 3MA9H 4BSVA 4JFEB 3MLZL 5BV7H 2R0ZL 1GGYA 2HRPL 2F5BL 4NSKA 3PDDA 3QEQA 1BEYH 1UB6B 1HHKB 2XACC 4QRSB 3VFPA 1QZ1A 5J6GA 3VWJD 4YHIA 3PGCB 1DVFB 4Y4HC 4WI9A 5DMGD 3T04D 1RUML 2ATKA 3FO2B 2O5ZL 2NZ9C 2R2EA 5A1AA 4H26B 1YZZA 5BOZG 4L4TE 5DQJB 5DUBA 2VH5L 2V2WA 3PL6D 1XIWB 4X9GA 3UJTH 1HK6A 1FFQA 4H8WL 4PR5B 1H5BB 4TTGA 2OL3A 4LCIH 3CFIC 4NQXB 1XCQB 4NQTA 2FJHA 4MJIE 4YK4B 5GRYA 2WAHA 4JHZA 1CFBA 4BZ2H 4U0RB 2JB5H 2G60L 1NDGA 2FEEL 3CZFA 3K2UH 1PLGL 2WWKT 2Y6SD 4OFDA 3B4NA 4NRZB 2ESVB 3BDBA 4LKXA 2QQQA 3BMWA 4KUZH 4KVCL 4PJXE 5B4MD 3VXTB 3WSQL 3JBG7 1J5OL 2DICA 2VLKA 4H5SB 3WHE0 1YNLL 2FX9H 4WW2F 1ZXQA 2R1YA 4UINH 1VERA 3I50H 2CJUH 2EE6A 4DOHB 4KK8C 3ULSA 2AK4B 3MRGA 3QRFM 3MJ6A 1XFPA 2XNAA 3C5ZC 5E2UH 4JO1H 1AGDB 1KB5H 2BXYA 1QLEL 4JHWL 1CIDA 5FKAA 4CU8A 4PV9A 4OQ1A 1JHTB 5EB9A 2I07A 5ANMA 1BVZA 2P44B 4KI5F 4Y5YC 2GTZB 5T1KB 2OR9L 2DIAA 2HH0L 4HWEL 1KTLA 1S9XB 1PZ5B 1PGRB 1YEDB 5DO2C 1P1ZB 1WBZA 5DC0A 1KIUA 3P4NB 1JNHA 2QTEA 2EXWC 3U1SH 2JLLA 5LAXA 1U3HC 2NY3C 1JHKH 1FGVH 3QFDB 2EDBA 2XQYG 2VZOA 3LB6C 4X6EA 1I1FB 2DM3A 3DVGB 4LCUA 2AI0H 1W0WA 4X5WB 1MH5A 2J4WH 4UTBH 3UZVB 4L3AA 1ORSB 2VDML 1BGXL 3DUHA 1KACB 5HYSA 2EDKA 5D1XB 4HFUL 3WNKA 2DMCA 1UVQA 4ZFFB 5FGSA 4D0DA 1S9VB 4HIEB 2FB4L 2HJLA 4R2GB 2Z8SA 2YHGA 3FB7B 2OTUB 3AB0C 3GMRB 5CHNB 2ZCHL 1L6XA 3QI9A 4WW2B 4GBXC 1HXYB 4F9LC 2O5XL 4MXVF 4WFFD 2ZJSL 3KPNA 4NZTH 4Q97A 3OZ9H 3MJ9L 4QHLA 4AL8L 5EZOL 2B1HL 1NFIA 4O5LH 4ONFH 5CKAA 5KOVC 2ADJB 5HVWA 2XZQL 3QCTH 1XF3B 1HXMB 4PJ5D 3P0VL 2YD4A 4MD4B 3KG5A 1LEGB 2YPLD 3VXMA 4Y4HD 4EDXA 3KLDA 1RIHH 2R4RH 2P48B 2A0LC 5DC4B 1FL3A 4WTXA 1CG9B 3GSOA 1WZLA 2BNQD 4KQ3L 3PV6A 4J3OC 4PJ7B 4QXTB 3D5OF 4HH9A 1B90A 4RSVA 3AS3A 4OCWH 4FXLA 4Y8DC 1HHJA 1KG0B 5JQ6H 1BWWA 1T20B 1JGVL 3FOMA 3L3GB 4Q6IB 4C83A 4N0FA 2VXUH 2QLVB 3GZKA 4K7PL 2AJZA 3U7YH 5CEXB 2X1WL 2CDGB 1DQTA 3NTCH 2FRGP 1T1XA 4Z7UB 5I1HL 4M6AA 4DCQB 3PWUA 2RJMA 4KGJA 4PJGF 5CJOL 5ID0B 2BSSB 4KK8D 5DURD 2PR4H 4FP8H 1I7ZA 1CDCA 1T7VA 3C5ZD 2ICWI 3PHOA 4O02H 1EHLH 5JMOC 1WAAE 4F7TA 2IPKB 2FYYA 3HAEG 4QF1B 1MQ8A 5J7CC 2HFTA 5JW4N 1ZA6A 2DLGA 2CDFA 3D85A 3PV7A 1YJDL 4YUEL 3TA3C 4AT6A 3MV9A 2FGZA 1OT2A 2P8PB 3RU8L 1OGTB 5DVOA 2P8LB 4KY1H 5BZWA 1JNNH 3X3GH 4MZ3A 4FXKB 5DO2D 2BHYA 4WU7B 4POYA 2GKIA 5HYEA 3BKYL 2EXWD 4HZAA 5ESVB 4G3YL 1U3HD 1V3JA 5ICZA 4N1HB 2NY3D 5CP3H 5DD5L 3TBVA 4POZC 3LB6D 2CO7B 5D7IA 3CPLB 5FA4B 4FNLH 3MREB 1MUJA 3VD9A 4GG6F 3WXVH 4PUBH 2OK0L 5ID1B 1AY1H 5D6DA 3UTQB 1KB5A 4QRPB 4G8EB 4CDHA 5F1SA 1N3NA 2X7LB 1XF4A 4CVXA 4JM2A 5DI8B 2VDLL 5GS2H 2X42A 1G7HB 3GMLB 4N8CH 2FX8H 3CIQA 4HKJB 4BSJA 3V5KB 1KLFA 3P4OA 3DSFL 4MJ6A 4OQTH 3ARGC 3GMNB 1M71A 1CL7I 1U9KA 2OXHA 3BKJL 2EDWA 4GW5A 2ZZUT 4OGYH 1E4WH 3AAZB 5IP4A 3GJEB 2AJUL 4GBXD 1DUYA 5T1LA 3SQOH 4DZBB 4WFFE 5GGVL 1T5WA 2DQDH 2VDNL 3JV4A 5D7SL 4NN6C 3V4VL 1A21A 4N8VA 3U9PH 3BUTA 4FXGA 4FQLH 4OFKA 1GJIA 1XMWA 5IEHA 3WS6A 1QQDA 3LEVH 4PJ8B 5HDBF 2A77L 3QHFH 2LABA 1XCTB 3CFJB 1XF1A 2MJWA 3HG1B 1XH3A 1WEJL 4PJ5E 5LQBH 3REWA 1MCDA 3TF7C 1RJYB 3HZVA 2YPLE 3BD4A 3ZHKA 4I4WA 4LLDA 4XP9L 2WZPD 2DN7A 4BYHA 1AXSA 5DJYA 3H3PH 2FJFB 4NCC1 2WBJC 4FQIL 2BNQE 3UYRL 3FQRB 3MRRB 5JIKA 3WN5A 5JPMB 4NZUH 1BHGA 5F89B 4XRCA 1GXEA 5HHVH 4OBSA 1S7TB 2NNAB 4PB9H 3TO2B 1EHAA 3EYOB 1U8MB 3ZDYE 3LRSB 3FT4A 4R9HA 2UZYB 2YRPA 5E99L 5D2NA 5EO0A 1T1ZB 1ZHLA 4D0CB 3O4LD 1FNGB 4YDLC 1UKQA 1Q9WB 4K07A 1BPVA 2FBJH 1BLNB 4UU9B 1J0YA 4LQFL 4P4RA 2W9DL 3REVB 3KAAA 5FCUH 4YXLH 4GW4B 3WKMH 1WSST 5C0FB 4G5ZL 4GKNB 5BRZD 2QSCH 3GKZA 4XMKL 2HN7A 3MOBL 4HWNA 3RTQB 3BKCL 4JVPA 4NWTL 5GGRY 4EQ3A 1C5BH 3VDAA 5EN2B 1LILA 5F72S 1OTSC 2VXTH 3CFKB 5JXEA 1NMCC 5IROA 3ZYZA 2WINB 3QDGD 3RPKA 2YD3A 2HFFB 3MLUH 1CN4A 5IEKA 1EFXA 1VADB 3X17A 1U91A 2EXYC 3MRDB 5I16B 3MLXL 1INQB 3LN9A 5F96L 4QRRB 1WCBA 3TA3D 5I1KH 4PV8A 1IGJB 5L2KA 2VDRL 4GRMA 1JP5A 3P9MA 1WT5C 1RQ5A 5CZVL 4F37K 2CLRB 1GIGL 4Z8FL 2O61A 3ROLA 2GJ6A 5FYJL 2Z8RA 4JFZH 2A9ML 1T0NA 3W39A 2EDLA 43C9A 5CBEA 4DGIH 5MEPA 3U0PA 1FNSH 2IALA 4POZD 3MNZA 4UQ2B 2H3NB 1FPTH 3VFMA 1X5LA 4LK4A 4HKZB 5AG9A 1I8KA 3VGAB 4B7LA 3WNLA 3RUGF 1NCBL 3MTRA 3FO1A 4H1LH 1J0ZA 4X8JB 4MQ7A 3QP3A 2XXCB 1NBYB 3FMGL 3MRMB 5C0RL 5HDOA 3WFDH 1QA9A 4G7YH 3LS5L 4JVWA 3VDCA 2ARJA 3ARGD 2MFNA 4P2OA 3QIBA 1F4WH 1X5ZA 3LS4H 2Q76A 2VLJA 2NY6C 1OSZA 1U8IA 3JWDC 1VFBA 3A67H 4F3FB 2EKSB 2GT9A 1HSAB 3NFSH 5HGBB 2M2DA 1ZLVK 1CICA 5AZ2L 3EOBA 5CP3A 2UYLA 3C6LA 2RCSH 1CDBA 3ALXA 2ERJB 4CRPA 3MV7D 1S5IH 1YDPA 4ALAL 1ND0A 1R3LA 3OKMB 5GHWL 1NFDE 2EKJA 3U46B 4TUKH 3BOVA 1MRFL 3BEWA 2GSGA 3SKOB 1NCCH 3PWJB 1Q94B 4FQXB 4LLYA 3WMSA 4DAGH 4X6DF 4HT1H 2WBJD 4ONHB 2RQ8A 4ZD3H 3ZT5A 2JK5B 4G9DA 4M6MH 1HQ4A 4OQTA 3BXNB 1PEWA 4CJ0A 1RHFA 3BPOC 4UIKL 1YMHB 4X6FB 3RWCB 4Z7WA 4MA7L 3DIFA 3O11B 1HYSC 3M17A 2GFBA 3ARFC 1QNZH 4YHZH 5D1ZC 1Z3GH 4DKEH 4BFGA 3BEVA 4R4BB 5C08A 3O4LE 1T1YA 3OHXA 1L9NA 5KAQF 4KPHH 4ODXA 3NAAL 1EEYA 4HBCL 2IPTH 1UEMA 2VDOH 1BVLA 3MLWL 4RFNC 5F1NA 1IEHA 4ETQA 4X4XB 3T8XA 1EPFA 5EORH 5BRZE 1ROWA 2BC4B 4QO1A 1EEUA 5ABDE 1BD2B 1NJ9A 3WFBH 3MYZA 4FQQA 4JLRB 1TFHA 1FRGH 1KTDB 3QDGE 4LSSL 3M1BB 3R06B 4JKWA 4NDMB 4XP5L 5IGXL 3RKDC 5K9JL 2F58L 4JHBA 1RULL 1C5CH 4JDTL 3D3VB 2D4FA 1S7SA 1J1XH 1TPXB 2W9LA 3KYKL 4XCCH 1UWEL 3U4BH 1XT5A 1HHHB 3IXAB 1KIPB 3TH4T 5GXBB 1S8DA 3NCYS 4I13B 3VW3H 4ZUVA 4X4YA 1Q9OA 1DEEB 5EC1A 4X6DB 2VDPL 5FB8B 1SBBA 2WUBL 2H26A 1N6QH 3ZDXF 4NC0B 4RFEB 3FB5B 4EI5B 5FGBA 4NN7C 2WIIA 3GSXB 2HFGL 3GI8L 4M61A 1TCRB 3O4OC 4Y5VC 1Q9LB 5FUOH 3P11L 3VCLB 5I8EA 3I6GA 1JYWA 2KH2B 1BJ1H 3EOYG 3MXWL 3V79C 1XAUA 3JV6A 5FHAH 4JFOA 3FFCD 4Z6AT 4F7PA 3PE9A 4KRLB 5FA3A 5DSCB 4CVUA 4KRNA 3VXPA 5EUOB 1SYVB 3O2DL 2NY6D 2ZOLA 3IRZA 1N2RB 3S6CA 1FNHA 3DJ9A 2D7NA 4UOJA 1NUGA 1J11A 1G9MH 1KJMB 3UTTD 5GGVY 4PJFF 4KJQC 5GRZA 1W8NA 1K4CA 5I0ZA 3RNKA 4P5KA 3GMQB 4Y16B 5HI3C 1VFAB 1PKQA 4QEGA 5C70A 2RBLA 3MV7E 1TJGL 1RVFH 1F4YL 4BZ1L 4R26H 5GGTL 3OKOB 4LCCA 4GMSL 4ZYKA 4JFDA 2CKBL 4H1LA 2OTWB 3BZ4B 2BJMH 1J12A 1UCTA 3W0WB 3N1QC 3ZDZE 3UDWC 1JPST 5CIPH 4I0PA 4JR9H 4MCYA 4KMTL 4ONOA 5CGYC 3SDXE 1HEZB 1MCWW 3Q5YA 1F3RB 3ILQC 2JCCB 1NANH 4PJAB 1W72B 3C08L 3MV8B 1A2YB 1CI5A 5E8PA 5KSAA 3MRJA 1KCLA 2KQMA 2NXYC 1KJVB 3ARFD 4K2UH 3VXOB 5D1ZD 3SN6N 4LSTL 4AG4H 2VN4A 4Q74A 4IRZH 4OFYD 5GGSB 3RGVD 3IXTA 4PJCA 5IFJB 2IPUK 4GSDL 1EMTH 3DX8A 1U8LA 5GISL 3QG6B 5F7FA 5FO8A 3QDAA 1AD0A 3MGTB 1AGCA 4IOSD 4XNQB 2HLAA 5F3HB 1DDHA 3C2AH 4YDJB 4AQ1B 3QPXL 3O6FB 2D0FA 2NTFB 3PNWA 5KN5A 3V7AE 1U36A 1WC7A 2I26N 1NGPH 4F7MA 3OAYH 1A1OA 4OZIB 1HZHH 1DLHB 4XHJC 3TCXA 5C0GB 3RKDD 4PJFB 2JJTC 5CSZA 2CR6A 2E9WA 4KV5E 2IH3B 4RX4A 3DGGB 2NW2A 1U3YA 2WWKO 1CFQA 4MWFB 2FH8A 2E7HA 3F65A 1LP9A 5BS0D 4PGBB 1QLRB 3IYLW 3T2PA 1BWMA 1OTTC 4MA1C 2ADFH 1BOGB 1JWMB 1T7YA 4PJIE 1ZHBB 5JHLL 3PWNA 1MHPL 3HUJF 4XNXL 1J7VR 2AK1L 2LVEA 4IM8A 3CMOH 5E6IB 2D7TH 5TDNA 3A6BL 2DKSA 3BWAA 4GOSA 4NQED 3VXQB 4ISVA 1K3ZA 1RIUL 3ZYOA 4LSRH 1RUKL 1F6LL 3SKNA 2AXFB 5FOJA 5HPMB 1D6EA 5CSBA 3WUWG 2XWJA 3PIQA 4PRBB 5HHNB 2GY7B 2CLZB 4JY4A 1M7DA 1T2QL 2NY7L 4OCXH 5JORB 2VLLB 1FDLL 4ERSL 3IS1X 5JLZB 1MHHA 2XI9A 1WZKA 5I8KH 5INDA 3M8OL 1OGAD 4XMPH 4NNYA 1X7QB 3FFCE 3WUWA 4RISL 5BW7C 5J13C 1J05B 4PJEE 5F9AC 3I9GH 2BVEA 2JJVA 4HQQL 1LEKA 4GS7C 3GI9L 4RDQG 3SDDA 4CN4A 3TVMB 5DVKA 1B0GB 1LHZA 3VD7A 3UTTE 1PY9A 4CW1A 4KJQD 5C0DB 2HKHL 2YXMA 4EN3A 3SE4C 5EZLA 1UFUA 2X4UB 5J06A 4X5XA 5C9KA 5DD0L 5HI3D 1FO0H 4HGWA 3D48R 5BXFB 4RWYH 5JDSB 3KXFB 1BFVL 1DBKH 4QRUB 3QBTB 1WZMA 4P23B 2MHAA 3E6FA 4U1IB 2Y25A 5IB1B 4R7NA 1CR9H 5DRNB 4JEGB 5I18H 3V5DB 5CGYD 3WEXA 3WE6B 4YHNB 5EOCL 1NMBL 4DVRL 1D5IH 4G6FD 3WHXB 4ZFOA 1U58A 3ILQD 5BVPL 3T1WA 3G6AA 3HTLX 1QFWM 5T1DH 3VDBA 1BZ9A 3HUJB 3P73B 1QHOA 4JN1H 4XNZB 3KDMB 5SWQB 3P4MB 1BX2B 1P84J 3EZJB 3HNTH 1GYAA 2NXYD 4P5MB 4NKMA 3FRUA 3D18B 5LWYL 5GPRA 3RA7L 4M03A 4LBEB 5D71H 5KS9E 3ROOB 5TQ2H 4V2BA 2A73B 2V7NA 2CK0L 1L7TH 3QIUA 4UT6H 2VAAB 4P5TB 1SJEB 1S5HA 3G6JF 3BT2H 1UM6H 2WUCL 2X9WA 4QWWD 3G9AB 1Y18A 4HG4J 4JGJA 1O7SA 3PGFH 3LEYH 3VGBA 1NLDL 3MBEC 3WIIH 4EEEA 1VDGA 3L7EB 2HKFH 4NHUB 4Z7NF 4U3HA 4MJ2A 1FG2B 5CIPA 3BGFC 1DANT 1NLBH 4XHJD 5F9OH 1SEBA 3LKOA 5D96C 4NRYB 4ZUTA 2AXHA 5I1DA 2H2PC 5BS0E 3VFNA 3T0EA 1R0AL 5IK3A 1CT8A 2V17L 5C07A 1NCDL 1OTTD 4N0RA 5HHMD 2W38A 5EULV 4FRWA 2CDEB 5KSVA 1UJ3A 2HVJA 5L0QC 2Y36H 5GGRA 4AENB 3P2TA 3OJMB 4R8WL 4EI6A 2XRAL 2I60L 4NQEE 3UTSA 5CUSH 5KTEH 5KSBA 1DUZA 2XFXA 3STLA 5EO9A 3TO4B 1F3JB 2P7TA 2BSED 1GZQB 2VC2H 1QFHA 3KNBA 3QNZB 5FUZL 1DSFH 2B4CH 2ZG3A 5LXGL 4NO0A 3FN3A 1I8MB 1J10A 3RDTB 5JIIA 3JVGA 3X3FL 1B9ZA 2COQA 4FTVB 5BVJA 1E0OB 1R5IB 3DURB 1OGAE 3V0WH 4LNRB 3ZHLA 3R8QA 1OB1A 1UYWH 2PW1B 4M8VA 1R5WA 2KZWA 3Q48A 1PX3A 1JF1B 3M07A 4ODWB 2F54B 1HYRC 3HZYB 3AREA 1RIVL 4RA3A 2CRYA 5I1IL 4HLZH 1F4XL 1MAKA 1MCEA 3MRHB 4MA3B 3GGWA 1MPAL 3RIAF 3QXTA 3LHPL 2HTKC 3GMMB 4DK6A 5IFHL 4JFHD 5E2JA 3CDFA 3MV01 4KROC 4LSVH 5CJQH 3SDAB 7FABH 4Y89A 4X80H 1EGJL 3QO0B 5IV2A 1L9MA 2AEIT 1UGNA 4HPOL 3QIWB 5LJYH 3FJTA 3L5WA 1PFCA 2D03H 4TRPL 5EOQL 3RL1B 3KGRA 1AGFB 1A3LH 1SEQH 3O81A 5TFSL 3ULUH 1JF6A 1XZ0A 4OF5A 4JRXD 3WFCL 4TNVF 1F4AA 3OPZH 3C5JA 2DWDA 4E0RB 4YGVA 1ZE3C 3ULVL 4LPTA 1TJHL 2X4PA 5KVGH 1T1WA 1UACL 2ZUWA 1YMMD 4P2CG 1DVFC 1DQQB 2Z31B 4LCYB 4YEFA 2Z91B 5IHZB 3MRKA 5HYQB 4GUPA 5JQHC 1INEH 1BQLL 4GAFB 3ZLQC 1FO0A 3QUZB 4G8FA 1YEHH 2OBGA 4P3CL 4PB0H 1X5HA 1A6ZA 5IMLA 1DBJL 2AERT 1MI5B 3MBED 2IANE 4K55A 3OKYA 4PJBB 4PJDE 3A6CL 1GH7A 1RZGB 1FYHB 4J3XA 5HDQL 2FJGB 2R8SH 1L7IH 2NZIA 2FIKA 2DM7A 1K6QH 3L5IA 3RL2B 1YC7A 3LQAC 1XGYH 1VKXA 1KFAH 4ZUWA 2KL6A 4M9PA 1MIEL 4HIIB 1C16B 5DJAB 1V3KA 3DROB 3W82A 2H2PD 2ED9A 5J6HB 4LAQH 1WBYB 2N7AA 2JB6A 4KTDL 5IOPB 3KLSA 5HHME 3BW9B 1LEIB 2Y72A 3KPSB 4M43L 2BVPA 3S97C 1A7QH 1HKLL 3QWRD 4L1DA 5DJ0B 2OQJA 4MS8C 1YYLL 1A7PL 1KEGH 3C5SB 1HQRB 3RVXD 4EBQH 5I1CL 3C60B 2BNRA 4K9EC 5D7KD 4NPYA 2NW3A 2YBRA 4CKVX 3ISWA 3DPBA 4YDKL 3I3BA 5I0DA 4L9LC 4P2RA 4YDIH 1TVDA 3I75A 1A0QL 5ACZA 3GIVA 1LO4H 1KJ2H 3VH8A 3U0TA 2M8XA 4JCMA 5CAYB 1IQDB 4ZO7A 2MMXA 5MHSD 2EIZA 1EZVY 2R2CA 4ZO8A 1H3PH 1JFQH 3CLFL 3R1GH 2IG2L 3ARBA 5HI5C 5DA4A 1T0MB 3UJJH 4GRWF 5DYOA 4JFHE 2FEDD 3NACL 2VABA 1ZKAA 1OP5H 4M5ZH 5BV7C 1WF5A 2VMFA 1RI8A 5D4QA 5GRVK 3UTZB 4U7SA 4ONGL 3RI5F 3UP1A 3T77A 4OLZH 4KTEL 4M4RA 3TH2T 1RZJC 4UV7H 1QLFA 4F7CB 3F5WB 4JO2H 1JNJA 4JRXE 1T83A 5CMAA 1DQDL 1BJ8A 3CSBA 4EUPG 1A6PA 1BBJA 1ZGLM 3VI4E 3DWTA 3MLYL 3QO1B 3MMEB 3WO4B 5E08L 1YMME 4TVPH 1DVFD 5AWNL 1EUUA 1Y6MR 5DHYB 1E27B 4M1GH 2A1WL 1KN2L 3G6DL 2XV6B 1JZ8A 4NP4H 1A4KB 2R2HA 2BCKB 5SV4A 1W8OA 5B8CA 4HJJL 5EUKA 4OZGA 5I1AB 5IBTH 2VSDA 2SEBA 3HI5H 1NDMB 1U3JA 2YUZA 4IIQA 4NYLA 5GGQL 1A6WL 1HDMB 4I2XE 5GZOD 3QWQB 2FATL 3RAJL 4BKLA 4UV4L 1P9MA 4Q6IC 4YQXH 3BE1H 4EKXA 4LSPL 3L3HB 3F58H 5D6DC 4WW1B 5HJ3B 3TJEL 4OLXL 2ESVD 2K3TA 1N0XL 4PLOB 4J4PC 4W6YB 5GRXG 4NHCH 3VMNA 1CL7L 3K1KC 3H9HA 1HHKA 4QRSA 1EV2E 4ELME 1AR1C 4XX1E 4NBXB 3DLQR 2AK4D 4XC3H 3UXFA 1O7VA 2UUDH 1EHNA 4H26A 1NAKH 3DX6B 4PGDB 3BHBB 4Q9QL 4N1CA 2LFGA 1XIWA 4N90D 5IESL 2Q8AH 1SJXA 1H5BA 1L0XA 4PR5A 5A2JH 2NY1B 1IFHH 4YXHH 4NQXA 1TZHA 1XCQA 1YEJL 1IM9B 5CJXC 4RQQB 4L8SA 3OKEA 4XP6H 4MS8D 2XTLA 3BFOA 4LSUL 5FKPB 4NRZA 5A2IH 5CEZH 2Z93B 1MFAH 4WWKA 1JI1A 3IT8D 1N7ML 2NLJA 1KPRB 2JIXB 4H5SA 1ZT7A 4HS6A 5D7KE 4K71C 1PJ9A 1D5MB 1DN2A 1ZT4B 1J8HB 2VN7A 4DKAA 3HMWH 2OSLB 4K23H 2X4OB 1NEZG 2VXQL 4HZLB 5E1HB 1HH9B 1UQSA 5DRWB 1M7IA 4HCRL 3SJVD 1IEBA 4JKLA 3IDIA 5IKCB 1AGDA 4XPFL 5GRVL 3HR6A 3I02A 2E6JA 5MHSE 1HOCB 1U8NA 3RVWC 3T2QA 4C55A 1NEZA 3OX8B 5DXWA 5D2NC 3U9UA 4JPIB 1OTUC 1T5XB 3QJHA 5HI5D 4ZUUB 4R2GD 5T1KA 2OX5A 1S9XA 1PZ5A 3IRPX 4J2XA 4OLWH 4XXDB 5IB3B 4K94H 3FQUB 2I5YH 8FABB 2J8UB 4ZO6A 2PN5A 5E5MB 3TBTB 1U93B 2CQVA 4HSQA 4PTTB 5JXEC 3CX5J 1XF5B 5IROC 4JVUA 3LH2H 3DX9B 4M3JA 5SX5K 1CGSH 3DVGA 1Y6NR 1QFOA 1KJ2A 1MFBH 1LK3L 3C87A 5TF1L 2LAGB 4ZNEA 1NEUA 4JJ5B 5D1XA 3MBXH 3OSKA 2LU3A 3S37H 5ADPL 2C1OA 4HIEA 3FB7A 1Z9SA 2DD8L 1I9JL 1UENA 2OJEB 4H88H 4NZRH 4OZ4B 4WDIB 2VUYA 4WW2A 1I85A 1MJ7L 4QCIB 1G0DA 5CZKA 1MF2L