1IKFH

A conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
228
structure length
228
Chain Sequence
EVKLVESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQNSEKRLEWVAFISNGGGSAFYADIVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCTRHTLYDTLYGNYPVWFADWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA R45-45-11 FAB (LIGHT CHAIN)
publication title A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/immunosuppressant
total genus 45
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 1993-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfH01
2Y9RT 3WLWC 3G5VA 5HHPA 3SKOA 3VXUD 4RA3A 3ULSB 1N7ML 4WWKA 5LQBL 4ETQB 5C0CB 4ODWB 5JUEL 4FQ1H 2EH7H 1PZ5B 1E27B 5A3IC 1INQA 1IKNA 2RGSA 4NBZB 5T3XH 2DICA 3HE7A 4QRSA 1KTLB 2E7CA 4OCMC 4XRCB 2EIZB 3PHSA 3UPCA 2APBA 4HIXL 1G7HB 1ITBB 4XP9H 2AI0L 4Q9BA 5EBLA 4F37F 2XA8H 4X7SH 3BJLA 4B7LA 2MCPH 3QUML 3IDMB 2J8UA 1AIFB 5F96H 1YY8A 1FZJB 1XF3B 3QA3B 1GAFL 3B2UD 5DGRA 1HINH 3N85H 1NCCL 3WIIL 5A40E 1X4YA 3W5NA 2X9YA 2VIRB 4L5FH 3EYUL 1NMCC 2Z8RA 2A77H 4HKJB 5BVPH 2EECA 2I26N 4Y19D 5JHDE 1TJHL 1INEL 1CGVA 4YDIL 3TA3D 3V5DB 3R0MA 1DN2A 1IQDB 2W65A 5LWYH 3D2UD 4ZXBC 4NQSA 1T83C 4UQ3B 1NC4B 3H2WA 4NPYB 3AXLA 3AS1A 3HZKA 3GSOB 1OP3K 3OKEA 5BS0A 3OKDA 3TGXA 2ILLA 4PTUA 4Y4HB 3PJSB 3C60B 4UV7L 3WFDL 2Q86A 5K9JL 2JE8A 3SJVE 4LVNC 1ZLWK 4LSSL 4LAJH 4M6OH 3MOAL 4WO4B 4JZJA 2DQFB 1HHIB 3DUSB 1NGXB 3NIGF 2F5AL 3BN9C 1DUYB 3ARFB 4UBDD 2G9HA 1A0QL 1WWAX 1HSBB 5CBEA 2Z4QB 4M1DH 5H37G 5J11B 1JGLH 4KK9C 2VKXA 3WXWL 4ZMAT 3FQTB 4ZPVA 1ZLVK 2YPLA 2GI7A 4OIBA 5EZOH 4OF5A 4HEPG 1EDQA 1BOYA 3O3DB 2P5WA 1XH3A 1NLBL 2CDFA 2ZNXA 5F3HB 1WIUA 4JB9H 1ZGLM 3OXSA 4UDTB 4XXDA 4OFYD 2BXYA 3QQ3A 3DIFA 1H8NA 3L7FA 3UTOA 3GO1H 2D7OA 4EBQL 3BGFB 1A7QL 2I07B 3RGVA 3KGRA 2DQHH 3KPRA 4P5TC 2P5ED 4L3EB 4P2QB 2XXCB 3UDWC 4WRLA 1RZJC 2ICWB 4JY4A 1OTUC 3NFPB 3MZTA 3SCMC 3QUZC 2RIKA 1KUMA 1FGNH 3GKZA 2OJZH 4MNGA 3VFMA 4BZ2L 2YD7A 4FMKA 4E0RA 1MJ7L 3WUWB 1KV3A 1KPUB 4GS7C 4S0TD 5C6PB 1JNHA 3BO8B 2H2SC 3C9NB 5IB5B 4NKQB 1FORL 4WUUD 3IDGB 4GXUM 1UM6L 3Q6GL 3TN0B 1MFEL 4X6FA 5F44A 1FQ9C 4LQ1A 4NN7C 4JRYE 2OYPA 5EORH 3W39A 3KXFB 1HHGA 2UZYB 4UT9H 2CGRL 3D0VB 3LKNA 5GXBB 4OI7A 3IGAB 2UVFA 3C6SB 2YBRA 4HUVA 5IVOA 1AQDB 1DR9A 2R4SH 2VZOA 4UT6L 4G7VH 3MC0A 2ZCKL 4MJIA 3L6FB 5F1SA 4Q2ZA 1A7OL 1RSFA 5FHBL 5KANI 5ETUA 4DZBB 4UILL 3FZUC 1BQLH 5D5MF 3U36B 1A6TA 1K85A 3AU1A 4Z77A 2X2YA 3CH8A 4MAYA 5D1ZB 2R1YB 4MB4A 5D7IF 1N6QL 1CU4L 3IFOB 5GZOD 4G9FB 3RVXD 1LP9B 5IMLB 5ISZB 3MNVA 3SDXB 3HE7D 3V5KB 3GMOA 5HYJA 1I3RB 4FP8H 3O8XB 2YRPA 3PGDB 2IADA 2BJMH 32C2B 4QHMB 1DQTA 5C8JA 4OLWH 1R24B 4L4TA 1EO8L 1CVSC 4IRSA 1A02N 3MQIA 5TE4L 3C2AH 3EO9H 3EYSL 1JHKL 1QSVA 1KLUA 1CBVH 2KDGA 3TBWA 3TBSB 4ENED 1A6WH 1RFDL 1IFHL 1BQHB 2FO4B 3FQWB 3GK8L 3NIFE 4HJJL 1JGVL 4UNVA 3CFDB 3MLXL 3RIFF 4BSVA 1UB6A 3P4LA 1IGCH 4B7IA 4DAGH 5CLTA 4QRRB 3TLRA 5CSZB 3UAJC 5LAXB 5F3BB 3UC0L 3RFZC 1DQQB 3DVNB 1IARB 4AEIL 5BS0D 5IVZB 1NGPH 1BLNA 3LIZL 2YEZB 4NQCE 1YEDB 1VGEH 2C1OB 3CSYA 2FIKB 1AR1D 5B8CC 1FYTE 1IL1A 5INDB 3C87A 5ILTL 4DVBB 4Z7QE 2H8PB 4RNRB 5HTSA 2NY4B 2F58L 4Y5YC 5JHLL 4Y5XC 1JNNH 2XTJD 1T0MB 3LSOB 1ZKAA 3BHBA 1I4FA 1OGAB 2XQYK 5JIHA 2WBWB 4OB5L 4U0RC 1AHWB 5E2TL 4PYHA 2YPLD 1F4HA 4TNVK 3NCEB 5C07E 1HHKA 3OAZH 2P5WD 3MRNA 4WI3A 3MX0A 3DXAE 2XIDA 4RWHA 4YWGH 5HYQB 1T6VN 3QIWA 1MCPH 2QR0A 4LU5H 4PJXA 4M7ZB 4YFDB 3U4BL 4CL7A 3W9EA 3WNNA 4LBEB 4ZXBA 1BJ1J 1T83A 3W11D 5D1QB 4QHLA 4AT6A 3KPRD 4JFPB 2W60B 4HS8L 4JPWH 5B3NA 5T1LB 1IGTB 2KH2B 2EXWD 2X4SA 3MXWH 4YHKL 4KTEL 4HPYH 3O2VL 3IF1B 5HHME 5C0BA 1NAMA 2FX9H 4JGJA 2R0WL 3BXNB 4P9HH 5MI0B 1JZ8A 3LN5A 5CJOH 1TFHA 3QRGH 1CD8A 1Q9KB 4ORZC 1UWXH 5IW1B 5MEND 2DWDA 1T03H 4YK4B 4RFEA 5EIIB 3T1WA 1R3JA 3GBNL 4DCQB 2UUDH 5C09A 4Z8FH 5F9AC 1CCZA 1T0NA 1AXTH 1A1OB 3DHMA 2F53E 3G5XB 5J1AB 3MCG1 5KZCB 5D7JA 4FA8A 1XR9A 4PJIA 1HOCB 3O6ML 3E2HB 2QADC 4E5XA 2V7HA 2FYYA 3DI2B 2XKSA 1AKJB 3Q2CA 3U83A 1A6ZB 1IRAY 2C7UA 4I18A 3QUYC 4MJID 2GIYA 1PG7W 2NY3D 3EJYC 4LQFH 4J3VA 2VL4A 1ZLUH 3H6JA 5I1EL 1MJJB 2AJ3A 4EN3B 4GRLA 4EEEA 1L9MA 4ZYKA 2RQ8A 3PDOA 5ID0A 1FG2A 4UOJA 4HUXA 5GISL 4CVWA 1JYXA 3OR6A 1NBZB 3MA9H 5TQ0L 3MPCA 3V0WH 3JWNC 5DFVC 3U30B 4MAYD 3OKKB 3CX2A 4NKDB 4ZAKD 4WEBL 3SCMA 3QUZA 2M8XA 5F8RC 2DM7A 2BVEA 2W0LA 3RHWK 3SE8H 4WFGD 3I3BA 4M6NL 4LHUA 2AXFB 1XT5A 5HJ3B 3NACH 4GMTL 3VXRD 3V5HB 2QSCL 3DUUB 3HR5B 1VFBA 1FL5A 3VXSD 4LHUG 5H94B 2HFFA 5BXFB 4GSDH 5HYEA 3NZ8B 5JW5B 4L4TD 4PGCB 4QXUH 3VG9B 1ZHKA 2ESVB 1GC1H 5I0ZA 4OV5B 4YXHL 4HK0A 4RGMB 1ZMYA 1PG7L 4JFQA 5JXAL 4G6AD 3VU2A 4YO0A 2MHAB 3UPRB 4CMMA 3NCYS 1A3RH 3RY4A 3QDHA 3IXAA 1T7WA 2FSEA 3FO1A 3WLWD 4JM2B 5DJZB 2R56H 3V2AR 5ABDE 2HKHH 5CBAB 3P73B 2YKLL 3ULVE 5I1CH 1MF2H 4RGNC 1G6VK 2RCSH 5KSAC 1K5NA 2CH8A 4N8VB 3PV6A 4PY8I 5F97E 5A3ID 1AI1H 4RISL 3JSSA 5DD1L 4XCCL 3ULVL 2N7BA 5I71B 3O6KL 1CDIA 5DR5L 3GB7A 3UJIH 2HVJB 4NWUL 1SJEA 1QRNA 4NHCH 1TXKA 4JPIA 3LEVH 3AREB 5I9QB 5JZ7D 4OZHA 3L5XH 3QFDB 3LS5H 2UUDK 5DWUL 1UH4A 2VQ1B 3IU4L 4MXVE 5DVOA 3CFKB 2AABL 4XMLL 5F7MC 5F7EH 1YQVL 2IFFH 2BNUA 1ADQH 2P4AB 3V4PH 4Z7NF 2DL2A 3FN0L 1DANT 1QKZH 3K74B 4WUKH 2VLJE 5KS9B 4GBXB 2X40A 3B2VL 4PD4J 4PJIF 3RL1A 3FB7B 3T3MF 5HHOE 1JBJA 3VFVB 1RHFA 3BD4A 1QQDA 2NY0B 1WZ1L 3S36H 1ZLUK 3G9VA 1ZEAL 1ZT4A 3FFCA 2R2EB 2Y7QA 3HS0A 4ZXBD 2YD1A 4I9WE 4NWTH 4Y2DA 1CLYH 3QXUA 4BFGA 5DMJB 1JPSH 2FRGP 1Q9WA 4LGPB 1XFPA 4ZODA 4PREA 1EAPA 5J1SC 5C0BD 5AZEL 5E8EA 2EH7L 5J1TC 5ANMB 4WEUD 4JCLA 3IDXH 1XF4B 1CFVL 2X1PA 1RZ7H 2C1PB 3BN9D 2XZAH 5EBGA 1MJ8H 4Y5XA 3O3UN 4P2OB 3BDYL 4I13B 3MRFB 5C09D 4KK9D 1FO0H 1T7ZA 2HVKA 2X9XA 3VMNA 5GGTL 2MCPL 3WHXA 1QPXA 4LPXA 4KJYB 1XR8A 3O4LD 4WHCA 5KG9B 4I77H 1QLEL 4P5KA 2OL3A 3EGSB 5EIQA 3VFOA 4R7NB 1RMFL 2AKRA 1YJDH 3SGJC 5DTFA 3VFRB 3Q3GB 2D9CA 1TETH 3RDTC 1G0YR 3QUXC 4GRLD 3EBAA 3G6JF 4W6YB 1TPXB 3T77A 4P5TD 2E6QA 4DK3A 3MLVL 5IMKA 3ES6B 2BVPA 1AGFA 4P2RB 5EUOF 2X4RB 1G6RL 1OTUD 4LDOB 2DQEL 5C1MB 4MA1B 3SCMD 3QUZD 3MRPA 1OSZB 2B5IB 3IKKA 1WT5C 1EEQA 2DDQH 1U95B 3MRHA 4LHUD 2XY2A 3BKJH 4EUPH 2AEPL 4P9ML 5BCAA 3VRIB 4R8WH 2JK5A 2XRAH 2DQTL 5L2JB 2AGJH 4KV5F 4PJGA 3VGGA 2H2SD 3VWKB 4PRDB 4PRIA 4QT5B 3L9RA 1MWAA 1C5CL 2WMPA 4PJ7A 1BGXL 3QJFB 4M8QB 3HN3A 4S1DD 1JWSB 4I1NB 3R8QA 2FX8L 4XWOC 4K71B 1ZANL 1ED3A 1JV5B 4GAJH 5HGBA 5GHWL 2YOCA 3P4MA 3ARVA 1WTGT 3LQAC 5EFIA 5LXGL 4FABL 1JMXA 1KULA 4GXVL 4LMQE 4OAWA 1U6AL 3H9SD 4M1CC 3K8LA 3QAZC 4JB9L 2ZUTA 2A74B 5C0DB 3MOBL 4A2MA 1NMBL 2OXGA 3GI8L 1M7XA 3FZUD 3GO1L 5DK3A 1BFOB 2J1KA 3CVHL 1MCOH 3SGEI 5GS0C 3NABH 2EKJA 1UXWB 1CT8A 5DK0B 1F4YL 3D0LA 3EYFA 3AY4A 3SKNB 1D6VL 3BP7B 3O3BA 3A6BL 3CJJA 4WIQA 2IBZY 3ROLA 1E6JH 2ZZUT 1R3HA 1QSFE 2GSGA 2DLEA 4K9EL 2W91A 4O2EB 4WNQA 3L3GA 5DF0A 1KC5L 3V4UL 1I1RA 1FNHA 3RY6C 3MRRB 5TQ2H 4OZ4B 4M8VA 1RJZA 5CKAA 5A2JH 5EZLB 4QHUB 5EORL 4U1GB 3U4EA 1T1YA 1DJSA 4UT9L 3WSQH 5E8PA 4KDTA 4E42A 2VZ3A 3SDAA 3MLYH 4L8CB 4U1KB 3ARTA 4U1IB 4ZFOB 3T0DA 2X7LA 2I9TB 3UAJD 1NANH 1FNAA 2AV1B 5SWQB 3WE6B 5D7KD 2P7TB 2ERJB 2DQJL 5C2UB 3Q1SH 1AGEB 1CI5A 2W9EL 4YDKH 1IC4H 2C26A 4NO5B 4MGXA 4X4MA 1HH9A 5CUSH 1YN6A 1L0QA 2GJ6A 3B9EA 3X3GL 4KQ3H 4HS3A 2D03L 3MLSH 2Y23A 4FP8L 5E1AA 4WHTA 3SGDI 1MFCL 4U6YA 4XXCA 5CEZE 3RWJB 4LLWB 1IAOB 4MXQD 4K07A 2IPKB 4HH8A 4HUNB 2BJML 4PJGF 2HFTA 1U8JB 3PWPB 4OLWL 3VWJA 5FF6B 3BPCA 3PNWA 1BEYL 4LMQI 4F15B 1W8OA 4OD3L 5CEZL 2V17H 3O6FA 3ARZA 4YBHA 3C2AL 3EO9L 5I8CB 1PX3A 1FJ1A 1RVFH 4GW4B 3B8YA 4LSTL 3C5SB 2LQRA 1MREH 5MEOA 1RZKC 4PRPB 2VH5H 3VFWA 2NW2A 3UJJL 3WXVL 4UOW1 3SQOL 2F8OA 4Z7OE 4TUJA 4G8EA 3RVWD 2QEJA 4L1DA 1RJLA 2WP3O 1LD9A 1QSEA 2AAVA 5DGQA 4ACPA 1MCHA 3M45A 3OJMB 2G5BB 3GSVA 1OAQL 4YEFA 2CK0L 1UADC 4KVCH 2LABA 3MCKA 2JCCE 4CVXA 1UT9A 3WFHA 3IKCA 1FSKC 4FQXC 3HMWH 3NAAH 1YN7B 5HXMA 4GT7A 1CZ8H 4YFEA 1QUNA 1Z9MA 5TE7H 1PLGL 4O5LH 3JTSA 4PJEE 3M8OL 5EWIH 3JV0A 1I1YA 4JQVC 3B9KB 1Q0YL 2CIIB 2QADD 4NCC1 5E99H 1UA6L 1ZLSH 4Z7WF 4QXTB 2MPAH 5K9QG 4MLIA 3EJYD 1MCPL 4E41A 4LU5L 3RDTA 4MS8C 1F6FB 2GY5A 4XX1E 4GQPH 3RP1A 3HAEH 3BGAA 3B3IB 2GTWA 2CKBL 5KVFL 4KU1A 2OQJB 4CADA 4OLXH 5DFVD 1FFRA 5FGBC 1MHCA 2Y5TB 3K4ZA 2VWEE 1NDMA 4JPWL 5F1IA 2NMSA 3MSPA 1CN4A 2DIBA 3UTPE 4WHYH 3GSXB 5FM8A 1FC1A 1I1CA 1WT5A 3V6OC 3PQYE 3QDGA 3DARA 4HKZB 1M7DB 3QFJE 4P9HL 1E28A 3HUJA 3NIDF 5CJOL 4JPVH 4G42A 1UJTA 3VXPA 2DYPA 1ND0B 5B3JF 4R3SA 1FP5A 1QYGL 4Z9KB 1WSST 1YEEH 2ID5A 2Q8AL 4J3XA 1U8QA 3MJGX 4Z8FL 4I48B 4MQXC 1CXFA 4G80A 3SDCB 2N4IA 3P30H 1BBJA 2BOBA 3RBGA 1WEJH 3QNYB 3LQMA 4FFZH 3ZSSA 5D6CB 3VXUE 1AD0B 5DLML 1IQWL 3TNMA 4JFHD 2V5YA 3EYVA 5DD6B 4RMSA 3KHOA 2OSLA 3LEXA 5DK2B 3ZE2F 1U3YA 2VABA 1D5ZB 1IVLA 4RGND 5EOCJ 4Y16C 5IFAH 5KSAD 1BIIA 3K80A 4NQXA 2J5LC 4ODHH 3MA9L 5CJQL 3SQBA 1G7IB 1RUPH 4G6ML 4XP1H 1J5OL 5D7LB 1MIEL 4PB0H 1HHJA 3D25B 1ZTXH 4JKWA 4PLKC 5GJTH 4JE4B 1VEMA 1KCSH 5JLZB 1SBSL 2XKNA 1SEQL 1X7QB 5FYJU 2RBLA 5HGDA 4D0DB 4WFED 4TSBH 4IHOA 3PGFL 2DTML 4X7EC 4JFOB 5GZNC 2DJ4A 3K2UH 2COQA 2JKXA 4UQ2B 5GRUH 2O5YL 2FWOA 1BZ9A 4LHQB 5JW4M 2FH8A 3RY5A 4Y19E 2EDDA 2BVQB 2GYSA 3O6FD 2AXGA 5IGXH 3I9GL 1GCFA 3CSPA 3GSNL 2L7JA 1DBML 1AO7B 4AENB 4JY5H 1S7SA 2KQMA 3HG1B 5HYSG 1OW0C 1AP2B 2VE6A 3L3JB 1VDGA 5T1KB 5EBMB 4ZO7A 4FXKA 2D31B 4XHQA 3BZEB 2ADIA 3GNMH 2ZSVB 3GM8A 1NAKH 3OKOA 5DI8B 4LVHC 4ODXB 1CD1A 2Z92B 1KJ3L 1QSED 2RCSL 4H20H 3L5IA 3WL9A 1FVCB 5I1KL 1I1FB 4JDTL 1F90H 2Y1VA 1NC2A 4UZGA 1K6QL 3DYOA 4M7LH 1IC5H 3OKMA 2OJEA 1CLZH 3S97C 4N9GA 3TVMB 4YHIA 2PTTA 1YPZE 1F2QA 5MHSE 1BVKB 1NMAH 4FQQB 1BM3H 4OKVA 3NH7H 1VKXA 1ONQA 2FJGA 1FIEA 2Q6WA 1CL7L 4JVWA 1SJHB 4ZOEA 4X4XA 4ODSL 4YHZH 1QLFA 4LSPH 3QNXA 4V2BA 1RY7B 2V2WA 4JPKH 2FX7L 4DN3H 4OF7A 1DSFH 3EOAA 1WBYA 4E41D 4FNLL 2X1WL 3RDTD 2P5EE 3QUXD 1KIRA 5E24E 5T1MA 3S36L 2X89A 1QBAA 4MQSB 4HGMA 2X6MA 2JIXB 4ZPTA 1ZHBB 4MA7H 1BD2B 3QNZB 4C4KT 2DM4A 2A9NH 4KRPB 2AJXH 4NZJA 4XMPH 4XC3H 5HVHC 3KG5A 4WO4C 5C6TH 2CLRA 2A6KA 1D5IL 1U93B 1CXIA 4G8GE 3MXVH 5HDOA 4KZDH 5C2BH 2VR4A 1NEZA 4MD0B 5IJVB 3QDGD 4BZYA 1CG9A 5J11C 1NLDL 1I1AB 4NKIH 1IGYB 4ZO9A 1SVZA 3V7AG 4WUUE 5CZVH 1YNTB 1NEZG 1WLHA 3VCLB 5J6GB 1YEKH 1RZ7L 2DYPD 1J10A 4WDIB 5BW7C 4YR6A 2CKNA 4JO3H 4XWOD 3PUCA 3OJVC 2CMRH 4OQTA 2CQVA 4HG4J 2KUTA 1XIWA 2YMXH 3JWOH 2R2HA 4DFHA 3BGFC 4M1CD 3P11L 3P0VH 4PJAA 1JPST 4MX7B 4K94C 5DJ0B 3PV7A 4FRWA 5AYUH 1YEGL 4NQUA 1DL7L 3U0PB 4OM1L 1CE6B 3ARBA 3NA9L 3DVFA 4OLVH 2IGFH 3Q6FA 3I6LD 3DGGA 5A16B 1JGDA 2GITA 4Y4KA 3V9FA 2APXA 1MFBL 3BPLB 4ETYA 4YDJA 5GS0D 1GGCL 2R39A 4PLOB 4QRQB 4ZUTB 1CL7I 2PKDA 4XPGH 3NBNA 2H32H 3PWLB 3ULUF 4D0BA 5T3ZH 4KROC 3RU8L 5I18H 4RBPK 4NKMB 2J8UE 5ICXA 1A9EA 2NY5H 3T4AB 4U1NA 2PN5A 4WVRA 1NGZA 2FEDC 3JXAA 2XRAL 2MFNA 1IKFH 4X0KB 1C12A 2AGJL 4IEFB 5IB4B 3U9UB 3BE1H 4WW2B 1B4JH 1OT1A 3OGCA 2J6EH 4OZFA 5GGSB 2BHUA 4JG0H 2VLMD 2F19H 4OZFG 3ABZA 3EHBC 3QXTA 1EGJA 1LO5A 5F88B 3FQUB 1S9VA 4FXGA 2KKQA 3BD5A 4ZUWA 1WK0A 3S98A 1PY9A 5K59F 1CDCA 3MR9A 3QUKB 1DDHB 5GRXG 5BS0E 4HULB 4OGYH 1UVQA 1D5MA 2LE9A 4Y16A 2BP3A 5GJSH 1JGEB 1Q94B 2BNQB 2GAZA 2D7QA 3QEQA 4Y1AA 4D9QD 2OZ4H 3KPPB 5D70H 4GKSA 2WWKT 4X6CB 2I24N 1NC2D 1URLA 3NABL 3R06B 3NCJH 2DD8L 1B3JA 1KJVB 5DRNA 1FGVH 3CDYA 3BAEH 3UTTA 1S7UB 1J8KA 1KCRL 3D18B 5BV7L 1QLRB 3VFUA 1EVUA 2EDNA 3VXMA 3K81A 2CXGA 2P5WE 1OCWL 1QD0A 5EU4A 2VLKB 3DMMA 4OFDA 3VA2C 5C0NC 4R2GB 2XWTB 3N0PB 4D0CA 1P1ZB 2C4XA 3FQXA 4PBWD 2I60H 2V2XB 2YSSB 5IVXB 1NKOA 4LRNH 1JGUH 4U1HB 5DEGB 1DLHB 4F2MA 1U3JA 1J1XL 3S5LA 3WSQL 2WUCL 3KPRE 2Q3AA 4J1UB 4ETQA 1CR9H 5C0CA 4ODWA 1OAXH 5IIEB 4MD4B 1NH6A 3GI9H 1PZ5A 1E27A 5B38B 3LH2H 1WAAA 2VLRB 3FONB 4UU9B 1ACYL 5LG1A 5CJ5A 2DAVA 1KTLA 4M4RA 5AD0A 1OARH 4XRCA 3AMKA 4MNGE 2EIZA 4P4RB 3V52H 1P4IL 1G7HA 1OM3L 4P23B 2XQBH 3IDMA 1AIFA 4JVUA 5JXEA 1FZJA 3QA3A 4JAMB 2NY2B 1AHWC 4I0KA 3FOLB 5HVGB 4QTIL 4FQXD 3MLSL 2VIRA 5DEZA 3KPSB 1G0DA 3I6GB 2BERA 1XGYH 4HKJA 4PBVC 15C8H 4PIRF 3DI3B 2ZUXA 2PR4H 4M7ZC 4MJIE 3ZDZF 1IBGH 3V5DA 4O4YH 3H42H 2RHEA 4UQ3A 3AS2A 1NC4A 4NPYA 2UV3A 4MS8D 3ARDC 3GSOA 4HZAA 3TM6A 1CICC 1S7XB 3TZVB 5DJXB 3VDCA 3ZT5A 2DQUH 4Y4HA 3PJSA 3C60A 2IG2H 5GRYA 2VDLH 4NP4H 2Y06H 3AB0C 4Y4KD 1I85C 3FKUS 3G5YA 4WCYH 3O4OC 4WO4A 2DQFA 5HYJE 1HHIA 3GEWB 3DUSA 1NGXA 2EC9U 3DO7B 2V5RA 4YK4C 1DUYA 3BSZH 3ARFA 4PJ8B 3I84A 3WKML 1QSZA 1HSBA 2WM0A 2XTLA 2Z4QA 2YS4A 3UTZB 4XNYL 1DVFB 2ZCHH 3FQTA 4L4TE 2UWEB 2EC8A 2E9WA 2BHYA 5D6DC 4FZEH 4WV1B 5CINH 3SDYH 5IEKB 1N3NA 3O3DA 4LFHD 4HQQH 4HKXB 4MQXD 2VUOA 5A2IH 5MEQB 2O5XH 4N0UB 4UDTA 1QRKA 1MCJA 2VSCA 3TJEL 4OCWL 4WJ5B 4C56B 3ZHKA 3C6LC 1E4WL 3NPSB 4AM0B 3U6RB 4PUBH 1ZGLB 1OTSC 1AD9B 2I07A 1PD6A 3OAYK 3CX5K 5E99L 3GMQB 3MGOB 4D8PB 3RI5K 4ZS7H 4L3EA 4P2QA 1G9EA 4F3FB 5CILH 3X14B 4MZ3A 3U30C 1G7JB 2CR6A 3MUY1 4U49A 3KPLA 3NFPA 1BBDH 2BNRE 5TF0A 3TNNB 2A83B 4Y16D 1U2HA 1PEWA 1J87A 4KMLB 1SMAA 1AFVH 4XBEH 3QEQD 3W9DB 4N5UA 1T22B 4QXGH 3P3YA 3WUWA 1Q8MA 3QDJB 4S1SH 3MRLB 3IDNB 5ELIA 1TZGL 4MAUL 3BO8A 3C9NA 5IB5A 4EIGB 3WUWG 5JQ6H 4PLKD 1A21A 4UI2A 4M03A 4BFEA 3IDGA 3MV9B 2J4WL 3P9MB 3TN0A 3UTTD 5F9OL 4OGAC 3ZMRA 4RGMC 1UJ3B 3VGDA 3KXFA 3VXMD 5DQJB 3D0VA 2E9JA 5ENWB 3IGAA 4M6MH 3MREB 5DHVA 4IIQB 3VD4A 1AQDA 4PJXE 1LE5B 1NL0L 2MQ0A 3L6FA 4WGWB 4G3YH 2HG5B 3VH8A 5HVWA 2FGWL 1UYWL 2PYFB 5C7XL 2FHCA 4DZBA 3UROR 2IPTL 1CGSH 3U36A 1JF1B 4CVZB 1T6WA 4P3WA 2ZSWB 5F9JB 5C0CD 3O9WC 4X9BA 5LGHL 4Z7UB 1FDLL 4NC2B 2R1YA 4OLZH 4XCEA 3IFOA 4G9FA 1TVDA 3RZCC 2VRAA 1LP9A 2AJZB 5IMLA 4HBQA 5ISZA 1RURL 5C0BE 3C5ZC 3WS6A 3AVEA 3V5KA 3D39A 4DGYL 4LEXL 5IFAL 1M4KA 3O8XA 5CHNA 3I3DA 3S37H 4DVRH 3ZKNC 3PGDA 4KXZH 3IAQA 2VUYA 3AREC 4XP5H 32C2A 4QHMA 5I9QC 1NAML 5DEFB 1AH1A 5C09E 5DD3L 1R24A 4LCCB 1W8NA 4URTB 1YMMB 5EULV 2PO6C 3WBDA 1ZTXL 1U41A 1I8IA 1EHNA 3F65A 4TVPE 2HMID 1D5BB 5I30L 4PJIE 2YK1H 5ADPH 3T3ME 3UYRH 1H3UA 5H2BB 1J1OL 3QCVH 2FO4A 3FQWA 2NY6B 3CFDA 4MNQB 1BFVL 3GBLA 2ITDB 2Y6SC 3K2UL 4TVPL 5GRUL 1BQHG 5FYKU 3QHFL 4K3DL 2MKLC 3DJ9A 5IGXL 4QRRA 5LAXA 5F3BA 3WNMA 2DF3A 3DVNA 1EFXA 2AEIT 3PHQB 1H5BB 4NZTL 5IVZA 3S36X 4XGZB 4V1DB 2YEZA 1JRHH 1U8IB 1YEDA 2DQDH 2C1OA 5IW6B 3LS4H 4R97B 5CMAB 5C08B 5INDA 3GNML 3VFTB 1X6NA 2B2XL 4FQPA 4WO4D 4YFLF 5E2VH 4DVBA 2H8PA 4RNRA 1RZJL 4TULH 2ARWA 5C0AB 4WFFD 3ARFD 3H3PL 1UZ8B 4LSVL 2VDPH 2WANA 2D3VA 1T0MA 1DCLA 3CUPB 5JDSB 3LSOA 1F90L 1DBBH 1OGAA 3BKYH 4WTZG 5IBTL 4LSQH 1AHWA 3P9LB 4M7LL 2QSQA 5J89A 5K9OB 3F5WB 4OI9A 1QBBA 1S3KL 2XY1A 5D2NB 4NZRL 5L2KB 4NO2B 4NO3B 2E6JA 5FCSH 5TDNB 5HYQA 3WFCL 3RKDC 3LMJL 1BM3L 2I9LB 4Y5VB 3W2DL 3M07A 2R0ZL 3G6JE 5EIVA 2BCKB 1KJ2B 3QH3B 4LBEA 5HPMB 4B0MM 4OCRH 2OI9B 5L7XH 5KJRH 4JPKL 4OF6A 5EUOE 1CF8L 4JGMA 4L3ED 4JFPA 4P2QD 1CDJA 1OWRM 3L5JA 1CICA 5T1LA 4NQDA 1L4IA 3DX6A 1RZGB 4UB0H 1ZT1B 4PLNC 1U3HB 1EK3A 5EA0L 1YUHB 3IF1A 5C9KA 3HB3C 2VXVH 1HZHL 1I85A 5D71L 1PZUB 1Q9KA 3D69B 4PV9B 2A9NL 3SDXF 5IW1A 5I1JL 4XC3L 3ULUH 3PDDA 2I25N 1KB9K 5EIIA 4JQIH 1QRNE 4DCQA 4O58H 4KROD 1JN6B 1XF2B 1RZFL 3Q5TA 2H1PH 4RX4A 4HMDA 4BK4A 3GSWA 3OR7B 1VCAA 3VE0B 1A1OA 3G5XA 4K71C 4DOHE 4KKCC 4OD1H 4HZLB 5J1AA 3KXFD 2FEDD 1CDYA 1PY4A 3BT2L 3CNKA 1AKJA 1IE5A 3RVVC 3X13B 4BQ9A 5IMMB 1A6ZA 3MJ7A 3EFDL 4UIKH 2B1AH 1UM5H 4EN3A 5KAQG 3QXWA 1TQBB 2ZKHL 3FFCE 5E08L 1DQDH 3CFCH 5E8DL 4KRMB 2GTZB 3V8CA 1LE9B 4WI7A 4XC1H 1KIPB 1NBZA 2AV7B 3ZDXF 2YD4A 2OX5A 4JO1H 4OTXH 3MLWL 5E9DB 2GJJA 3OKKA 4NKDA 5DVLA 1A4KB 3BVNB 4G9FD 1FO0B 1JPGB 1MIMH 2YHGA 3L5WA 4EDWL 4UINH 4NN6B 4POYA 2J88H 5ISZD 3BWUC 2M2DA 3D39D 5KTEL 2AW2A 3D3VB 3RWCB 2AXFA 1P4BH 4OUOA 4PJBB 5HJ3A 2EIDA 5KN5B 3V5HA 3HR5A 5SWZB 5H94A 3SPVB 5DQ9B 5BXFA 1G9MH 4L9LC 3NZ8A 4Q74A 5JW5A 4XPGL 4TTDC 2ADGB 5T3ZL 2ESVA 3ROOA 4OV5A 3PWNB 3MCLH 4P46B 2C9AA 2NY5L 3CK0L 1FNLA 2MHAA 3UPRA 5EU3B 1UWEL 1OAYH 4MB3A 4WW1B 1IKFL 3QCUH 4PS4H 3KYKH 4MXWH 3BE1L 2R0KH 5F6IB 4JM2A 1MHPL 1MJUL 5DJZA 4OCNC 2GFBB 5CBAA 4QRRD 3GRWH 2F19L 2W0KA 4POUB 3B5HA 3ZKXB 3CPLB 4EUPB 1EFXD 1J9CT 3AAZA 1B88A 1JZ2A 1HXYB 1YEHL 4N8VA 4XMKH 2EDRA 2ZG3A 1LO0H 4BH8B 3ARSA 4PRHD 4D9LL 1JZ3A 5HHVH 2VDOL 3EOTL 3T2PA 3S34L 4WENB 5GGQH 2HVJA 1IILE 25C8L 3K4DA 5E8OB 3DRTB 4D2NA 1X4XA 4DTGL 3AREA 3QFDA 4PJGE 3I3EA 4XPFL 3CFKA 4PRIE 1II4E 2YR3A 3TO4B 3ZKMC 4PJ7E 2ZUWA 1GGTA 5D5MB 4M3KB 3HE6B 5FA4B 5I74B 3H8NA 4LLDB 1IGJB 4QOKA 4XVJL 2AQ1A 1UWGH 5KS9A 5LGKA 1NDGA 4GBXA 2G2RB 4KK6C 3F7PC 1FNSL 1W2KT 4F7EB 3KLAB 3CXDH 3VFVA 3HNSH 5KAQF 1K8IB 1VFAB 2DI9A 2R2EA 5BO1L 1NCBL 3OJ2C 1JGUL 4RIRB 5ICYB 2D7MA 3SOBL 2VLLB 1CICD 3LKRB 5T1LD 4NQDD 1LEIB 5E8NB 1G9NL 2X4UB 3OXRB 4XNZC 3NCCB 2DQCL 2JJWA 3ILPB 1MCEA 3FFDB 3LH2L 5MP6H 5ANMA 1QOKA 4GAGL 1LO4H 1X5KA 1XF4A 1EHAA 2C1PA 4F7CB 4OI8A 2ZCLL 3MRFA 4ZTOH 4ODTH 3B9AA 4DKAA 1LK3H 5GRJL 2LAAA 8FABB 4HXBH 3SBWC 2JJUA 5KZCD 2F8XC 1U42A 4LASH 5KG9A 3GSRB 1INDH 5EDXA 1SYSB 3PWUB 3M1BB 3RTQC 5FGSA 4OSUL 5ECJE 1WITA 1RU9L 4RAVB 2M1KA 2AJVH 3VFRA 4JFHE 1V3MA 3C6LD 4QHNB 1E4KA 3QUMA 3JBG7 1OTSD 3X11B 1KN4L 4G7YL 1IBGL 3H42L 4QRPB 1SVCP 1WBZB 3ES6A 4J2XA 4P2RA 3PWVB 2X4RA 3UX9B 5FYJH 5JNYB 1K4DB 3BEWB 5D93C 3QI9C 2A1WL 1KB5H 1KTRL 2N7AA 2BSRB 1OSZA 2HT4C 2IG2L 4X4ME 1U95A 3NIDE 2GJ6E 3SE9L 3GKWL 4WCYL 4TUKH 1CFTA 4XB7A 3VRIA 3BI9X 4M62L 3F7YB 2DLFH 2E7HA 2YD9A 5B3JE 4H5SA 5L2JA 4R4FL 2AXHA 3CLFH 3VWKA 1Z5LA 3LRSB 4PRDA 3TYGH 1BVLB 4QT5A 4WFEE 3ZO0A 1B9ZA 2ESVD 4M8QA 1JWSA 1PAMA 4OGAD 1YZZA 4YH6A 1JV5A 4G6KH 1CDUA 1OSPL 1U0QA 2VXTH 3OKNB 1P7KA 3UCRA 5KS9F 2H6PA 3RX5A 2HP4A 2D7TL 2JB5L 3QIBC 4WY7H 2QJDA 4FTVB 5C0FB 1M6OA 5C0DA 5DUPH 2A74A 3HC4L 4JM2D 2NY7H 3S88H 3ZE2E 4F33B 4NRZB 2C3GA 4YHOL 5FUZL 4DQOH 2WZPD 4NRXB 5LBSL 5SWSB 2VDNH 3O11B 1RIVH 5JDJA 1J1PH 3O9WD 1BFOA 5AZ2H 2YPKB 3N1MC 3SGKC 3EKCA 3LY6A 4G9DB 1CD0A 1QSEE 3RZCD 5CILL 5I1LB 5HSFA 2YWZA 5DK0A 4UT7H 3C5ZD 1P84K 3SKNA 3BP7A 1MRDH 3MLTB 1EHXA 5IW3A 3MJ6A 1R3IL 3KJ6L 5E6IB 1JF6A 2EH8H 4R90H 5DYOB 3ZKND 2AJUH 4ELMB 2Y07H 3E8UH 3O0RH 5T1DH 2ATKA 3ARED 4O2EA 3RAJH 1OAKH 4YHML 2QQKH 4PJHB 2XZQH 2PO6D 3GSUB 2E7LC 1L7TL 5IB1B 3MRRA 1FVDB 1KEGH 4OZ4A 3E0GA 4QOKD 4C83B 5GPRA 2DMCA 3HAEB 4NQED 4QHUA 2BZDA 3V4VH 4OZIA 3EJJX 2IQ9H 3KR3H 3H7BB 4L8CA 2Y6SD 4U1KA 3EJZC 4U1IA 1WIPA 4E41E 2L4OA 1FZKB 5TDOB 1W0YT 4PGDA 4G3YL 1PSKH 2I9TA 3EDJA 3WE6A 4QGYA 2P7TA 4KUCF 4QEGA 2VDRL 2LTQB 4LSUH 5ALBL 3ZHLA 4P4KC 2I27N 4NO5A 1SY6H 2OXHA 5EUKB 3MYJA 4M7JH 3TBTB 3RWDB 2NXYB 3MRDB 3QDGE 4A6YH 3HUJE 3CU7A 1CQKA 3RWJA 2FZ3B 4LLWA 1IAOA 2YRZA 5KVGH 5L8KB 2YD3A 4LRIC 1NCTA 3PWJB 4QWWC 2IPKA 2PYEB 3T3PE 4XZUA 2HA1A 1U8JA 1FYTB 3PWPA 4IOFC 1EUUA 4CW1B 5FF6A 4KJPC 4D9RD 3U82B 5DJ8B 3ULVC 3OKLB 1E4JA 1DBJH 5DFWH 4JO4L 3RKDD 4DFIA 2X4PB 1GH7A 4GW4A 2YK1L 5HYIA 3MUZ1 3UYRL 2Z91A 4LPTA 1IGIH 2WIIA 3O2DA 1F13A 3VG0L 1UM4H 3NGBC 4NN5C 5DJDB 2BFVH 4P2RD 3WLBB 1HHHB 4CU7A 1VSCA 3I6LE 4M9OA 1NBYA 4UUJB 1MAML 2YUXA 4OM0L 1ITCA 3HB3D 4TN9A 4JHAH 1BVZA 2G5BA 1A7PL 4K7FB 5GS1C 4GAFB 4PRBA 3GBMH 3LS4L 3CLEH 5BRZB 1A1MB 1Q1JL 4XBPB 5GS0L 1GSMA 3QWOB 3P2TA 2J12B 4KKCD 3SBWA 5DVMA 5H35B 5CS7A 2EXYC 3B9KA 2CIIA 4XVTH 3FT3B 1U9KA 3EFFB 3K2MC 4QXTA 5DJ6A 5I8OH 4X6DA 5C0EB 4G6FB 1A14H 4MCYB 1FNGB 1RUQH 3S7GA 4CU6A 5ACMA 2HFEB 3SJVD 4L8DB 5IQ7H 1MRFH 4HXAL 4BKLB 2O61B 1H15B 2H41A 5IFJB 3B3IA 1VB9A 2NCMA 4LIQH 5I6XC 3ZTNL 3HNVH 3HZYB 3BPOC 1ORQB 2Y5TA 4I5BB 1OAUH 3QZWG 3FHAA 3NTCL 4LKXB 4D9QE 3BP4B 3C8KB 2GW5A 3GSXA 4UB0L 1F58H 4TPRL 3TBYB 1O7SA 3HC3L 2JJTA 3P9WB 4HKZA 5D1XC 1GGYA 3WNOA 4KI5C 5CWSB 5CZXC 2NTFB 5I19H 3ULUL 3GMMB 3K7UA 2Z93B 3BP6B 4TTDD 5HDBE 1QHPA 4FQCH 5F70A 1RUML 4I48A 1IM3B 3SDCA 4ALAH 4HGWB 2AQ3A 4YIQB 1Q38A 3I50H 2Z0BA 1OQOA 3KNBB 2CUHA 1F02I 4GKNB 5D6CA 4X9HA 1AD0A 5K59E 5FOBB 2CJUH 1D9KB 4XHJC 2FBJL 3D5OF 5DD6A 1M05A 1A8JH 5GGSY 1G7LB 3OPZH 2WLYA 3U7YH 1UM5L 2R69H 5FGCB 1D5ZA 3BWAA 4ZNCD 3SGKA 4LLVB 4LPVA 4OF3A 1RZKL 2HRPL 4XC1L 1P6AB 1HDMB 1NSNH 4M9PA 4X8JB 2Y5EA 1P7QB 1DLFH 3QCTH 5D7LA 2F53A 5TDPB 5J6HB 1N0XH 3V7AE 1MIML 3D25A 1A9BB 1WVZA 4UINL 5GS2D 7CGTA 3VXOA 4K7PH 5JLZA 3TWCH 1A4JB 3WN5B 1X7QA 4U6VL 1MNUH 4YX2H 4D0DA 4NJ9H 3OJDB 3ZKMD 1ETZA 5JW3H 2E7LA 4JFOA 4R2GC 2QLVB 1IT9L 2M26A 2R8SL 2Z35B 2BVQA 4KKAC 1YY9C 4O00A 3KDMA 3MCLL 3S9DB 3U1SL 2IJ0C 3CVIL 1AO7A 2AK1L 4AENA 4XPBL 2HTLC 3HG1A 2BHZA 4OCYL 3UTQB 1OAYL 4K9EC 4PJAE 1AP2A 2GK2A 5CGMA 1KN2H 3KYOB 3L3JA 5FDWB 5T1KA 4DKFL 5EBMA 1A6AB 2H32B 4NGHL 2D31A 3BZEA 4GRWB 2ZSVA 4KPHH 5B39B 3VRJA 1A5FL 4ODXA 5DI8A 1G7MB 3T4YB 1A3QA 2Z92A 3FO9B 3TYFA 4L4VB 1MRCL 2EE3A 4H25B 2IAMC 4GOSA 4I3SH 4XMKL 3IJHB 2VISB 1KNOB 1I1FA 2FB4L 2R2CA 4ZUVB 3CFBA 1DEDA 4MJ6B 1KGCE 5I1HL 1LO0L 3VD3A 4DEPB 1RZIB 5HHVL 5I8KH 2VDKL 1F8TH 4C55A 1CFNB 3LDBC 1BVKA 1KXQE 4XNUL 1XGTB 3RPIA 3CXHK 1EIBA 1YNLL 4JKKA 5KVEH 1SJHA 4HV8B 4IMKC 2XI9A 1O5DT 5L6YH 4JHWH 2GHWB 3RPKA 1LO2L 2FHBA 3RTQD 3PXHA 1UWGL 4ONFH 1I9IL 4HDIB 3U9PH 3QBTB 4S1RH 3P40A 5TF1H 1KJMB 4JFZL 3KLDA 2JIXA 1ZHBA 5AWNL 3PP3H 1BD2A 2EE6A 4HWEL 4H1LH 3MA7B 3QNZA 4NHUB 3HMXH 1BP3B 2CXKA 3QEQE 2R9HC 3QI9D 4Y1AE 4Q97A 1U93A 1E4XH 4YXKL 5EPMA 4LLMB 3ZYZA 2HT4D 4MD0A 5IJVA 5C07D 2XZZA 4RMRA 1DVFC 5L9DH 1IGYA 1JJUA 4Y8AA 1J11A 1U8PB 1PQZB 1IAIH 1YNTA 4UAOB 3VCLA 5J6GA 3UTTE 3MBXH 1F4WL 5HHOA 3ARGB 4WI4A 3VXME 1X5XA 1KELH 4WDIA 1SM3H 4FG6D 3SDCD 4ZTOL 4F8TA 1OLLA 4GG6F 5CD3B 3JV6B 3N1PC 4HXBL 2W9DL 4OFPA 5T33H 1IEAB 3NPSC 4HS6A 3SO3B 1INDL 4MX7A 5HHMD 3BKCL 4M43L 4NO0D 5C0CE 5LJYH 3U0PA 1U8HB 1K8DB 2J7LA 2R1XA 1WAAE 5A16A 2ARJA 1HQ4B 2Z31B 2QQNH 3GMRB 4CMHC 3HLAB 4PJ9B 4QRQA 1MCIA 2PW1B 4ZUTA 5I66B 2F53D 1OQXA 3PWLA 2VXUL 3CMOH 3QISA 4K55A 5GGRB 4HIEB 3MJ9H 4NKMA 4Z7WB 4PG9B 5FYKH 3T4AA 5IJKC 1SJVA 1OP5K 4JJ5B 2DKMA 4Q9QH 4KRNA 2DLFL 4X0KA 2QSTA 2ZUQC 4I0PB 5IB4A 3U9UA 1UXSB 1J18A 4WW2A 5IHZB 1YEFL 3A6CL 3B6SB 5F9DC 5I1DA 3JTTB 5GGSA 4DKEL 4IIQC 4U2ZA 4JM4H 1UC6A 4O9HL 1S7QB 5J7CC 1ZSDB 5F7FA 1AO7D 5F88A 2VXTL 4P9HC 3HG1D 4XPHL 3FQUA 5D8JH 1SEBB 5T1KD 4KKNA 1NCDL 3QUKA 1DDHA 2CRYA 1A22B 4H0HB 4NC1E 3U0WH 1GOHA 1LDSA 1NFDA 3JWDL 5EO1B 1T7XA 4LCWB 5BZDB 5ACLA 5D9SB 2NX5B 3QWRD 1Q94A 2BNQA 2IC2A 1IC7H 4PBXA 4P4KD 5AZ2L 1M1SA 6CGTA 2DLTA 1AGDB 4X6CA 5JR1H 4YPJA 4WFFE 4NT6B 3FRPG 1B6UA 3R06A 4OIIL 1KJVA 4GG8B 3O3AB 4LCCC 3K4AA 1MRDL 3QEGL 4TOYH 3VFPB 4HF5L 4D94A 3SDDC 1S7UA 5E2UH 3DSFL 4NUJB 3S37X 1QLRA 3L3DB 2J2ZA 2Y07L 3WFEL 5B4MC 3KLHC 4QWWD 1MCSA 4FFYL 2X9WA 1AE6H 3RAJL 3FL7A 4IOFD 2QQKL 2VLKA 2D4DA 2J8HA 4ORGB 5I15H 4X80H 3IFNH 1J0JA 2O26U 4KJPD 2XWTA 4JRWA 2NY6C 1JI1A 1P1ZA 3WJLA 3ULVD 2V2XA 1TJIL 2YSSA 5IVXA 4UV4H 1CWVA 4U1HA 5DEGA 1EVTC 4KKBC 4CGTA 4LARL 1NUGA 4N1HB 3MBEC 2UY7A 4IDJL 3C8HA 5E00B 1ZS8B 5F71A 2IQ9L 3REWA 4KQ4L 4L3EE 3CFEB 4P2QE 2BSTB 3T09A 3BP5B 5IIEA 5D96B 4HK3N 4MD4A 2XZCH 4S1QL 2C5DC 5B38A 2JIXD 2VLRA 3FONA 3WUZA 4J3UA 4UU9A 1PSKL 4K94L 4R97C 4F58H 1Y18B 3QDMB 5DD5H 5AAWA 4M61B 4GQ9H 5I8EB 4P4RA 4K3EH 4X6BB 2H26B 3OX8B 1SJXA 1JPFB 3G6DH 2IBZX 1DBAH 4P23A 4H88H 2WINB 2LFGA 2VLJD 3D87B 2X1QA 4JAMA 1N5YL 3U0TB 1NUNB 3VXNB 1RJCA 3FOLA 2NXZC 1JWUB 3QSKB 3IETB 5HHOD 3VRLE 3V6ZA 5EU6B 3KXFE 3RGHA 4LKCB 3TBVB 3KPSA 3ZYJA 3I6GA 2D4FA 4I9WD 1FC2D 4KK5C 3SE4A 4R96B 5EO9B 4WW2F 2EXYD 3MRKB 5BQ7A 4L8SB 1QFWH 2D0HA 4UMGA 4J3WA 1GIGH 2BSED 2OI9C 3DV4B 2PETA 1FFOB 2QHLA 4TQEL 1F6LL 3VI3E 4DKDC 4FQLH 2MQ3A 1HNGA 5T5NF 1J88A 1FNEB 1RIHL 1S7XA 3TZVA 4YUEL 5DJXA 1P5UA 3MACH 3UTSB 1Q72H 4G9FE 3HC0B 4HWUA 2AJYL 1LP9E 5ISZE 2X41A 1A3LL 4KI1A 2FEEL 2WQRA 5FXCH 3DO7A 2LU3A 5T5FL 4K3JL 1K3ZA 4PJ8A 1EJOL 5DXWA 1J8HB 1JPTH 4OJFL 1MFAL 4EI5B 4X6CF 5D1XD 3UTZA 4KI5D 1DVFA 1IAKB 3EOBB 5CZXD 1YYLL 2UWEA 2NTSP 4DGVH 1RULH 4WV1A 4CN6A 1RIUH 3LQZB 4ZFZA 3N06B 4HKXA 1J0KA 1CGUA 1FVEB 5MEQA 4L3CB 3V95A 2X09A 1RZ8B 1P4LB 4N0UA 3F58H 4WJ5A 4Q6IC 1U2CA 4C56A 1MLBB 5KVDH 1YEJH 4NM4H 3U6RA 1KBGL 3N9GL 4XVTL 1ZGLA 1E6OH 5IVXF 1AD9A 4QRRE 2OS7A 3GMQA 3MGOA 4D8PA 3LEYL 3HZVB 4XHJD 3ZKQD 5TPWL 2ZPKH 1S9KC 4HX1B 1FPTH 1LNUB 4F3FA 5I8OL 1IMHC 3MV8A 4YFLI 1G7JA 1T66C 2DQGL 3TNNA 2A83A 1FBIL 2OTWB 4HHAB 4JHBA 3WFBH 7FABL 2FD6L 1V3LA 2E7MA 5CIPH 5KSBF 3W9DA 4YC2C 1U8LB 1T22A 4TNVF 2WUBH 4XAKD 2UYLA 3MLZL 3MRLA 2B0SH 3IDNA 3LQAH 1XCTB 3MV9A 1OGAE 3P9MA 4Q6YA 3IAPA 5IJKA 1UJ3A 3G9AB 1FFQA 3QG7H 8CGTA 5ENWA 5ITBH 4WWKC 2VLKD 4YHYB 2K1MA 4R2GD 4YHPB 3MREA 4IIQA 5L8JB 3T2OA 1DFBL 3F6LA 4MDJB 5TH2B 1TMCB 1LE5A 3MV7B 4LLUB 4M02A 4KKAD 1YY9D 4AMKH 1CFBA 2W92A 4P3CH 3ARYA 3F7VA 1DE4B 4DZ8A 4ZFFB 5ID1B 3BZ4B 2PYFA 2EICA 2HTLD 1BJMA 2H3NB 2FEEI 2ICEB 5D4QA 4F57L 3BKMH 1NCWH 1JF1A 4CVZA 4LPCA 3IDJB 4JLRB 1QBLH 2ZSWA 5BMFL 2ORBH 1I9RL 4OLEA 3S35H 1IM9D 1HI6B 1IGMH 4NQDE 1QSFD 3LPGA 2AJZA 1MCLA 3LV3B 3X3FH 5JIKA 1EEUA 4MNHB 5HHNB 2JELL 5DURB 2P24A 4UIMB 3PGCB 5LCVH 5DEFA 1S7WB 2AJSH 2A6JB 3QCTL 3EDKA 3I2CH 4LCCA 3TO4C 1KCVL 1YMMA 2UZXB 4PRNA 5C0GB 1MELA 3GMLA 5I74C 3KPSD 4RAHA 4LDEB 4Y0GA 1FL3B 5F93C 1CGTA 5FDYA 3B43A 3MODL 2C3WA 4NDMB 5IFHH 4MNQA 2ITDA 2EE9A 3A6OA 3L7EB 3GJFH 1WICA 2KPNA 4TSCH 1FFNB 4X7TB 2ZUVA 5EN2B 5EU5B 2FL5B 3RHWF 3OB0H 5CP7B 5BV7C 3PHQA 1H5BA 3B9DA 2IQAB 2WV3A 1KN2L 2VKWA 4XGZA 4V1DA 3E1F1 1N4XH 1B0GB 1HWGB 2FO1A 3VGBA 1U8IA 3FB6B 5IW6A 3UEZA 2Z8SA 5CMAA 1OHQA 5C08A 2R9HD 4ZDHB 5C92A 4UNTA 2JB6B 4LLYB 3G5ZB 5C0AA 2NNAA 3I85A 5CZKA 3HNTL 1UZ8A 1BAFL 5JDSA 1EMTL 2BRRL 1DVFD 5IROA 5GRZA 3AGVA 1Y6NR 3P9LA 2A9MH 2VJXA 4I0CC 4PRAB 2ESVE 2QHRL 4RWYH 1Z3GH 1L9NA 1OPGH 5DD0L 1GZQA 5K9OA 3F5WA 1A6UL 4XWGL 3GIZL 1FE8L 3RGVC 1DQMH 3MJ8A 4NO3A 5TDNA 3ZZ1A 4MWFB 5TGBB 4ZSOA 4HIJB 2I9LA 4XH2B 5JTWA 4DGIL 4Y5VA 4WUUB 1ORSA 4YE4H 4YDLC 4C56D 2BCKA 1BECA 1YNKH 3QH3A 5HPMA 2EO1A 1GHFH 3OAUL 1TENA 4ERSH 3TPUB 5E1HB 3K0WA 1QBMH 1I8KB 3MV8D 3NFSH 3TT3H 1RZGA 4K2UL 3IFLH 3FCTB 1ZT1A 4Z7UF 1YUHA 5C71A 2OR7A 4XCYA 3WO4C 2VXQH 5HHPB 4GRMB 3LOWA 4EOWL 2FDBP 1ADQA 3MRQB 3VW3H 4UTAH 1X5LA 3D69A 4PV9A 5D72L 4XBGB 3UPAA 1IGFH 2VDQL 4JREB 3KPMB 2QSVA 1J0ZA 3PIQB 4N0RA 1JN6A 1XF2A 1HKLH 5FFLA 5ADOH 4DW2L 4KJQC 2B1HH 2NY3C 3MNZB 1EZVY 4QRSB 4W6WB 4F80A 3U7WH 5IB2A 3OR7A 3QQ4B 5DVKA 3VE0A 4KY1H 4HZLA 4IOIB 2QQLL 1N5AB 3RWFB 4Z18A 5DUML 5IM7B 5KS9E 3KPOB 4J4PC 1OAZH 1OP3H 3X13A 4YXLH 2BDNH 2ZNWA 4HPOL 5IMMA 5I0DA 5I76B 4AEEA 3T8XB 1LO3H 4JN1L 3QG6B 3I02B 2YD5A 5L0QC 1Y6KR 1KLGB 3SKJL 1LE9A 2GTZA 1KIPA 3D1MC 3OB0K 4TRPL 2AV7A 4S10A 3HPLB 5E9DA 3QFJD 3LPFA 1A4KA 3BVNA 1FO0A 1JPGA 4KVNL 1EHLH 3F62A 3B5GA 3IRZA 4IRSC 4NQSB 1M71B 5ANME 2GY7B 3D3VA 1S7VB 4K23H 4PJBA 5E6IC 3RWCA 5KN5A 3J8F7 5SWZA 3SPVA 5DQ9A 3UP1A 4N0CD 4YLQT 3RJDA 1B2WH 4GMSH 2ICWJ 4WI2A 2ADGA 1YMMD 3ISWA 3SDDD 5B4MD 3PWNA 3INUL 5AUMB 4G8FB 4P46A 3KLHD 4XPTH 4D9RE 2HLFC 2H45A 4XPAL 3WKNA 3O2WL 5EU3A 1N64L 2P8MB 1U8OB 5DJ2B 2XTJB 4UTBH 4LLQB 2ZJSH 4WW1A 2ADFH 1NKRA 4P49A 2NY6D 1FZMB 2YD6A 5FUOH 4MNQD 1DEEA 3BIAX 3OHXA 2YPLB 1KB5B 4KKBD 3GZKA 4JM4L 4YBLB 4FQJH 1QA9B 2GFBA 1U8MB 3MBED 2I5YH 4U33A 4NM8H 3BUYB 1V3JA 4EUPA 1CDBA 4P2RE 2XOTA 2HFGH 1HXYA 3OXSB 5JZ7C 5HDQH 4V1DD 3MLRH 4EUPG 2NW3A 4GW5B 5CJ8A 3U0WL 4NJAH 1TNMA 1C1EL 4M5YH 1H3PH 4MD5B 2YXMA 4BZ1H 5DT1H 3QEHA 1F4XH 5E8OA 3DRTA 3T2NL 1I7TB 5C0AD 3TC9A 3QIWC 5JR1L 4JVPA 1NQBA 2VZVA 3D9AH 2AQ2A 2BY1A 3TO4A 3F7QA 1WCBA 2APWA 2F15A 5HI5C 2NXZD 5D5MA 4Q9RL 5FA4A 2X05A 2BMKB 3VFMB 5MENB 1IGJA 2C3HA 5E2UL 4PP1C 3S4SG 1FH5H 5D7IA 4KMTH 3C09B 4Y88A 2ZWLT 3UJTH 4KK5D 5F9WC 1AE6L 4F7EA 3KLAA 4OGXH 4XCNB 2P1YA 1NPUA 1H3GA 1GVIA 3R0NA 1K8IA 4ZD3H 1VFAA 3U4AA 3W39B 4PY7B 3T0VA 2FJFB 1PYWB 2Q1EA 1GPOH 4J8RB 5ICYA 2CLVB 3ZE0F 1MVUB 3IJSB 5KW9H 4XAWL 2VLLA 3LKRA 3C5JB 1LEIA 3FO2B 5E8NA 3T04D 3LN9A 2X4UA 4MJIB 5DMIL 4JR9L 1V7MH 1QR1A 3OXRA 3ILPA 3FFDA 1MAJA 5MHSD 4EDXB 4JFDB 3U7AA 1A6TB 1RI8A 5D7JC 1U58B 3LRHA 5E95B 4F7CA 4PJBF 3GHEH 5KANG 4GKOA 2PUQT 2WBJC 4K3EL 4ZAKB 1PX4A 3MRMB 1FAKT 1XF1A 4I18C 3B8SA 3VFSB 8FABA 4GRLC 4AH2B 3HRZA 3T08A 1T2QH 2VR9A 1X5ZA 3BZFB 3VXRB 5IEHB 1XGQB 3GSRA 3FQNA 3VXSB 1F11A 1FRGH 4OZIE 3PWUA 5DA0B 3M1BA 5C8JB 3QPXL 2CPCA 4KAQL 4RAVA 1V5JA 2V9TA 2WQ8A 4QHKJ 4BQ6A 4HC1H 3X11A 4L8BB 3RWGB 1GL4B 4KTDL 4QRPA 1WBZA 1VADB 4A6YB 5A1AA 4G8GD 4XP6L 5DJYA 1ZA6B 3PWVA 5E9DD 5JNYA 1NCAH 1K4DA 2IPUG 1YEIL 4ZFOL 5E03A 1T66D 3BRFA 5FYLH 3L3IB 4HWBH 2BSRA 4IJ3B 4S1DC 1SYVA 2G60H 4X4YB 1KPVB 2OK0L 3OZ9H 4IRZH 2MJWA 3C08L 1AJ7H 1R3KB 3F7YA 4WI8A 1PDKA 1BLNB 2EDBA 3WNPA 1KPRB 2ZOLB 3I6KB 3LRSA 4WFHE 1BVLA 1RQ5A 2MKWA 2CRZA 3PWPE 2HH0L 5CCKL 1WWWX 4P46D 5J06A 4RMWA 1CYGA 2EO9A 5L88H 4IOSD 4WWKD 1S9YB 1QNZH 1UCBH 3FQRB 4J4PA 3OKNA 4MQ7B 5FKAB 1QO3A 5MERB 1KFAH 2NR6C 1UB5B 3P77B 4JQXA 1A7NL 4FTVA 4F7PB 5C0FA 4OFVA 4AEHH 4RGOH 2CSPA 4F33A 4NRZA 4NRXA 2E27H 5SWSA 1NGQH 5KVDL 1YEJL 1NMCB 4ZOCA 1AQKH 1GRWA 2YPKA 1DQLL 4JFFB 3UO1L 2HKFH 2EE2A 3CDGB 4YHLH 4PTTB 1ZA3A 2IALB 3O2DL 1KCUH 5I1LA 1JHLH 3MLTA 4OUUB 3HCVA 5E6IA 5DYOA 2X10A 4ELMA 5HD8C 2VN7A 1I9JL 4KHTL 5AEAA 4RFOL 3JWOC 4KJWC 3IDYC 1FAIL 3TO2B 2VOTA 4K8RH 4M5ZL 3TO4D 1LDPH 2WIMA 3GSUA 1TVBB 1V7NH 4LVNB 2R4RH 1FVDA 2YN5A 2DWDB 2X4OB 4C83A 2P43B 4Y2DC 6FABH 3HAEA 3OF6A 1W72H 1UCTA 3HAEG 3H7BA 1GGBH 4R4NC 2BNRA 5DRXB 2ITCB 1HKFA 3MLUH 4PJ5B 4X6DE 2F5BL 1C08B 3P0YL 5E70A 3O4LB 4F7MB 1QTYT 5TDOA 4B5EA 5ACZA 5KSVB 4WEMB 4WHYG 1X5HA 4RFNC 1ZVHA 5F7DB 4QXWA 3NCYP 2NY5C 1T3FB 2C7UB 1MFDH 3V6BR 3VXTA 4MXQC 1X3DA 2IMMA 43CAB 2FECL 5EUKA 3TBTA 2EDJA 4LVEA 5DRZB 4P5TB 2L0DA 3MRDA 5EZIH 3H9HB 4DN4L 4RMQA 3B83A 5GSVB 5A2KH 2FZ3A 2B4CH 1KXVC 3QUZB 3RZWA 5DRWB 3PWJA 2PYEA 3KJ4B 4CW1A 1FIGH 4MJ2A 1Q0XH 4U6TA 1Z0MA 3I2CL 3WHE0 3WYRA 5DJ8A 3RQ3A 3RGVD 5I1GH 1T5WB 1KENH 3OKLA 4OFKA 3RVWC 1VFBB 3FN9A 5DQDH 5EU7E 2X4PA 3BDXA 3LD8B 2VNCA 3QO0B 1MQKH 5TE6H 3LKPA 5ITFB 3HPJB 3TESA 5IFHL 3H0TB 4GLRI 3KYAA 5DJDA 4JFEB 3QHZL 4QRPD 3WLBA 1HHHA 3BH8B 4NZUH 4W70A 4EI6B 4HT1H 1KACB 3H9SB 3HFMH 4UNUA 5HPOA 1CTOA 4UUJA 2A0LC 2ZG2A 1RUKH 1SQ2N 4K7FA 5D7LE 3O3EB 4NOBA 1FCGA 1T89C 1EBPA 2X42A 1A1MA 5BRZA 1GJIA 4XBPA 2O5ZL 4HCRH 1MPAH 3PV6B 4ELMF 4V2CB 4QF1B 2WBJA 1ACZA 3FMGH 1QFUL 4KJQD 3ZTJH 2XFXB 4HMCA 4PJHF 1G9NC 4M93C 1EUTA 1UACH 5H35A 1K3IA 1OF2B 2A9ML 1AGBA 1SJEB 3FT3A 4HBCH 1Z3GL 3HI6H 4J4PD 4N1CA 4OZHB 3EFFA 1D6EB 1DQML 5E5RB 1AO7E 3SO3C 4FQHB 35C8H 3HG1E 4AZ8A 3DX7A 1TJGH 5C0EA 4O2FB 4MCYA 1FNGA 5IHUH 2HFEA 2P8LB 2R2BB 2O61A 3IDIB 3AY4C 1FLRH 4FQ2H 4F9PC 5HYJD 4MA8L 3BPNC 4J6RL 3RL1B 4N0YH 1ORQA 4I5BA 3NIFF 4LKXA 1CXKA 4KUZH 3BP4A 1A1NB 4R6UA 4PJ9C 2Y7QB 4IRSD 3FO0L 3TBYA 3MZGB 4XVSH 5E6ID 4WWID 1WBXB 4HFUH 1BFTA 5K9KB 5CWSA 2NTFA 1XGPB 4KDTC 5I75C 4OV6F 2UVEA 4PREB 3SDAC 2VL5B 1MY7A 3G6JA 3ECBB 5B8CB 5GGRY 4RCAA 1HKLL 1CLCA 1IM3A 2UZIH 2W1NA 2OR9L 4PG2A 4KHXH 4HGWA 3NCFB 2B1HL 2HLFD 4BQ8A 5EOQL 4FZ8H 5EUOA 4YIQA 4Y5YB 4Z7QF 4KY1L 4KZEL 4L9DA 3OF6D 1MEXH 3KNBA 4H1LB 3MLPA 4MMXC 1KF9B 1FG9C 4GKNA 4RRPG 4N1EA 1YA5A 2DLIA 2BNRD 1OAZL 2HVKB 5FOBA 3QXAB 3IS0X 2BY2A 4OLYL 1EPFA 5SV4A 4YXLL 3WHXB 1D9KA 4OT1H 3THMH 1KJ2H 4IM8A 1XR8B 2Q7YB 5C0IB 2XYCA 1G7LA 2KL6A 3WIHH 5IESH 1U92A 4LAQH 2V5TA 3VD9A 2OL3B 3RA7L 1VFMA 1OT2A 1BD2E 2DBJA 4LLVA 4N5EC 3BX7C 4HLZG 1GGIH 5K93A 4XXCC 5EZJA 2D0GA 4YQXL 2HWZH 1HDMA 3DPBA 4TSAH 1RUAH 2DKSA 1P7QA 1ZVSB 4LSDA 5TDPA 3S3PA 5J6HA 3VWJC 3RUGB 3RX8A 1A9BA 1EHLL 2BVPB 3O6FC 3PP4H 3WEXB 3QIWD 1A4JA 3DHJA 3FRUB 4EXPX 4M7KL 3LKSB 4PGZA 3OJDA 4F7TB 2V9RA 2F54B 3K8MA 1BZQK 1IEBB 5EOCL 5HI5D 4OBRA 3KWWB 4XTRC 5EBWA 4N8CH 4BUGA 4PP1D 2Z35A 2JK5B 3D48R 4XPTL 2EYSB 1XEDA 4M48H 5T3XE 3UTQA 1LWRA 1MWAB 4PJ7B 4UTBL 1VPOH 3S6CA 4PJCB 3KYOA 2HT2C 4FQ1L 3BUTA 5FDWA 3OGOE 5FUOL 1ED3B 1A6AA 3EZJB 2H32A 2QADB 1S5IH 5T3XL 1JNLH 3P4MB 4FQJL 4Z95H 1FV1A 5FK9B 5DMYA 5B39A 1G7MA 4N68A 4JG1H 3QUYB 4NCC2 4XP9L 4L4VA 5B39G 3DNKA 4H25A 2HFGL 5GGVY 2XA8L 4X7SL 5HDQL 3LHPH 2VISA 1KNOA 4ZUVA 5F96L 4MJ6A 4AYFA 4TVPD 2J6EA 5D7JD 4M5YL 1RZIA 4KI5E 5BRZD 1HINL 3N85L 5I16B 4I2XB 4G6JH 2NQCA 3W81A 4L5FL 2WBJD 2NLJB 3QR2A 2BVOB 2HJFB 3ZE1F 3OL2A 2A77L 5C0JB 4JDVA 1XGTA 1J12A 2APVA 5BVPL 3JVGC 4CJ1A 1I7RB 3D0LB 3EYFB 3DWTA 3L95B 3ROLB 4ODVH 2P44B 3ZSTA 1R3HB 4HV8A 4LEOB 5FCUH 3TCLB 2P47B 5LWYL 4WNQB 1C8PA 2K7QA 4HDIA 4PJFB 2Q8BH 3HZMB 5DUBB 4G6FD 5A2LH 1A6VH 2OZ4A 3ZHDA 2VDMH 1JWMB 3CZFB 2EDEA 1KJMA 2RB8A 3Q5YA 4ZD3L 1NFDE 1MUJB 1TTGA 1UEMA 3PHOB 1RK0B 3MA7A 1N7MH 2IANB 4M6OL 4U2YA 4BQCA 2EYTB 4NHUA 4QNPE 2BNQE 5IF0B 3IVKB 1C7SA 5JUEH 4LF3B 3LN4B 2ZP0T 4M1DL 4XAKE 4X6CE 4LLMA 4EZMA 1JGLL 5CJBA 4EI5C 1T89A 3T0WA 4RGNB 5EZOL 4PB9H 5KSAB 1PGRB 1U8PA 2DM3A 3CDFA 3RRQA 1KYOJ 1H3TA 4HIXH 4APQB 2AI0H 2GK0B 3ARGA 5J13B 4N8PA 1DUZA 3GHEL 1KG0B 4U3XA 1GAFH 1HH9B 2VLKE 4U1LB 3CC5B 1NCCH 1I8LC 3WIIH 1T7VA 3O45B 1JFQH 5CD3A 3JV6A 3EYUH 5IVXE 1IEAA 4IMLB 2DQHL 5EH1A 2NR6D 2QKIB 4LGRB 5C9JB 3ALPA 1TJHH 1INEH 5E5MA 4YDIH 3IXTB 1T21B 2LU7A 2JJSC 3PNWB 4F9PA 3CFJA 1FGNL 4MMZC 5E0QA 1W0WB 1U8HA 5IV2A 2FCBA 3K8KA 2OJZL 2VLRE 4KFZC 1QRND 5DDHB 5IKCB 5F72S 4GRWF 2Z31A 3GMRA 3W82A 1P7QD 3HLAA 1T1WB 4PJ9A 4UV7H 2PW1A 5I66A 5CP3H 4HWBL 4HIEA 5K9JH 5DMGC 4LSSH 3VGAC 3MOAH 4Z7WA 5HD8D 4PG9A 1HILA 4YPGB 4KJWD 2F5AH 2VR5A 4JJ5A 3V6FB 4IRZL 1A0QH 1YYMH 1AJ7L 3MO1B 1JZ4A 1T20A 3QIUC 3KPSE 2WWMC 1UXSA 1CE1H 2R4SL 4JFXB 3WXWH 5IHZA 3B6SA 4G7VL 3FFCD 1H3VA 3JTTA 5SX4I 5EO0B 4JJHA 3DBXB 2VN4A 2DI7A 4Y2DD 2EDXA 1ULVA 3MCKB 5F6HJ 4CVXB 1S7QA 3IKCB 1ZSDA 4HD9A 1NLBH 4HFWB 1BQLL 4CNIB 1EEZB 4R4ND 5DZNA 4EIZC 1Z2KA 1KFAL 3ULUC 1SEBA 4PLJC 1P9MC 4AIXA 3T2QA 1I1YB 4AEHL 4J3TA 4EBQH 5T3ZD 5EO1A 4LCWA 5BZDA 4YNYB 1R5VB 2EIEA 5J57B 5D9SA 2NX5A 1NGQL 2CK2A 3JV4B 1AQKL 1HN1A 4L4VD 3S35X 1AGDA 3QUXB 3BMWA 2JF1A 4J3SA 4GG8A 2WK2A 3O3AA 5IT2H 4QKXB 3VMOA 4BZ2H 4CADB 1VFOA 1MJ7H 2UWEE 1JYWA 1BREA 4NUJA 2YXFA 3L3DA 1CBVL 4XP4H 3NVQA 2EDTA 1A6WL 3DRQB 1FORH 3QB7C 1UM6H 2VZSA 4ORGA 1M7IB 3Q6GH 1MFEH 3RI5F 1LDPL 4QY8B 4N0UE 1E28B 1IGCL 5CEYB 4DAGL 2R4RL 2CGRH 1U91B 4NQVB 4C56E 6FABL 2DYPB 4F9LA 5JA9A 1JYVA 2X4NB 4H8WH 5E00A 4UT6H 1ZS8A 1CGYA 5CIPB 2ZCKH 1NGPL 4X8XA 4Z76B 3CFEA 2BSTA 3BP5A 1A7OH 5FHBH 5IHBA 3MV8E 1VGEL 3EYQC 4UILH 4ZQKB 4LPYA 4B53A 4GAYA 1Y18A 3QDMA 4JRXB 1N6QH 1NUFA 4M61A 4PRID 1I3UA 5I8EA 1CU4H 2A0LD 4X6BA 1JNNL 4QGTA 1BZ7B 4G8IB 3STBA 2OTPA 3OX8A 1JPFA 3DTXB 3KPQB 2X1XR 3C8DA 3QDJE 2VABB 1SBBA 2WINA 3MV9E 2NPLX 5AYQA 3VXNA 1XIWC 3IETA 4HH9B 4YWGL 5EU6A 5KSUB 4LKCA 1A7BA 2QBWA 3JVGA 3TBVA 2B4CL 1EO8H 1HHJB 4ZO8A 4R96A 4PD4K 5EO9A 3ARBC 3MRKA 3EYSH 1ROWA 3QZWB 2XKNB 1ZXQA 4R0LC 5I1GL 1RFDH 4OLUH 4Y4KC 1IFHH 5DFTA 1EA9C 3MTRA 4ZOAA 1QP1A 3FT4B 4HJJH 2CO6B 3GK8H 5DZLA 1JGVH 1G84A 4FHBD 4RAUB 5IG7B 4H26B 3MLXH 3VI4E 3FT2B 2FWOB 3MXWL 4HPYL 2FX9L 2EDWA 4HIHB 2MOVA 2QQQA 4IBLT 1XZ0B 3UTSA 3GFUA 3STLB 3UC0H 3HC0A 3QRGL 5DZOA 4JO2H 3V79C 2W07A 3CIQA 2Z31D 4AEIH 1DQJA 1T03L 2FNBA 3KPNB 1J86A 3LIZH 2E7BA 4PJ9D 2H2PC 3KYNB 1J8HA 3Q0HA 1UH2A 4EI5A 4ZTPH 3ZDYF 1IAKA 1AXTL 5ILTH 3EOBA 5E4IA 4X98B 1YMME 2F58H 3GJFB 4HK3J 5JHLH 2XNAA 3SDAD 3LQZA 1MPAL 3M17A 3FMGL 4OB5H 4L29A 1NC2B 1FVEA 4L3CA 4BH7A 4LQFL 1RZ8A 2E9IA 3IFPB 1I8LA 1NGYB 3OKMB 2K3TA 4AQ1B 2VZTA 1S7RB 4MNQE 1MLBA 4YHIB 2PTTB 4IRJB 2VQTA 3F7RA 5INCB 1CFQB 2VTFA 3V0WL 3HZVA 5DVNA 35C8L 4HX1A 3U4BH 2JJSA 4NKOB 4OGZA 4I4WA 1CDGA 1I75A 1ZV5A 2GJ6D 1KCLA 4V1DE 4LCWD 3SE8L 2OTWA 4N5ED 2NX5D 1Q9OB 3F12B 1HIMH 3FAWA 1UQSA 2P8PB 4DJMA 3NACL 4HS8H 3LCYA 5C08E 2SEBB 4P3DB 2GJZB 1U8LA 4N0YL 4RMUA 4GSDL 4YHKH 5C0AE 3O2VH 3DMMC 4DWHA 3VWJD 5T1MB 4KUZL 4QXUL 1X5GA 4Z7VB 1GC1L 1TCRB 1XCTA 4Z7OF 2W9LA 1JF5A 5HYSA 1QHOA 1H3XA 3KHQA 4MDIB 3GBNH 5D2NE 1HSAA 1WTLA 3ARPA 3BYYA 3QIUA 1XCQA 3CSGA 1A3RL 4XTRD 4YHPA 5EB9A 2D9QB 5CD5C 4ZSOE 1X6LA 4MDJA 5TH2A 2R56L 2VYRE 3MV7A 1Y0LB 2HKHL 1FSKB 3O6MH 4FQXB 2JCCF 4ZFFA 5ID1A 3CU1A 2E6PA 3E6HB 3BZ4A 5I1CL 1MF2L 4R26H 2HAZA 3OBAA 1MCBA 3IDJA 4JLRA 2HT2D 4NSKB 1P9MA 5F7YC 1AI1L 1HI6A 1H0DB 1KJ2L 3DECA 4PJEF 4RBPH 4AIZA 5JXEC 5ESAB 2IWGA 2R2HB 1MOEA 3UJIL 1N6VA 3LV3A 5GISH 3QDMD 1XGUA 5TQ0H 2OTUB 5HHNA 2A6IB 3X12B 4NHCL 1B90A 2HMIC 2V5SA 3LEVL 4NRYB 4W6XB 4UIMA 3L5XL 3LS5L 4WEBH 1T0PB 3BH9B 3PGCA 1IZJA 4OF0A 2GUOB 1RUAL 1TZHB 3MRBB 5F7EL 2IFFL 1FLTX 1S7WA 2A6JA 1W0VB 3QQ9C 1ADQL 3V4PL 1JTOA 1QKZL 4GMTH 3EUUA 4X6EB 5C0GA 4WUKL 3JWDC 5FA3A 4FN0A 4ISVA 5JIIA 1FL3A 3C09C 3EO0B 4NC1C 1MCRA 3RWEB 1MVFA 2XICA 4NDMA 1R0AH 1QG3A 4Y4HC 1PG7H 3C60C 5JXAH 3L7EA 4NZDA 4R7DA 4NWTL 1CLYL 1FFNA 4X7TA 5EN2A 1JPSL 3DV6B 3NIGE 4YBQC 2NY1B 3ZE0E 5EU5A 2FL5A 3OB8A 3V8OA 3B5TA 3ARFC 5E9DE 4HLZH 1J05B 1OWWA 1B0GA 2YKLH 4OZGB 1LQSR 1N2RB 1OB1B 3IDXL 1S5IL 4JFYB 1JNLL 4H0GA 3TIDB 2XZAL 4ZDHA 1MJ8L 3PXJA 3D3VE 1WCQA 4PJBE 3UYPA 2FR4B 3G5ZA 5DD1H 1GOGA 4XCCH 1XF5A 1FO0L 3ULVH 4EI5D 5SWZE 1JI2A 5JPNB 1MAKA 5DR5H 5JW4Q 4W68A 5ESVA 4NWUH 4PRAA 3T0BA 4JHZA 2EZ0C 2J5LB 1YC7A 2VXSH 1O7VA 1JNJA 3GRWA 4I77L 4W81A 2X1OA 4O51B 1YJDL 2AABH 4XMLH 1YQVH 1MI5B 4MWFA 5TGBA 4HIJA 5DRNB 5ERWB 1RPQA 3FN0H 1U8KB 1TETL 2CDGB 3T65A 4Q9CA 5F8QC 3GM0A 4R0LA 3VFUB 3B2VH 5HVFB 1MH5B 3K46A 2AK4B 4Y2OA 1N59B 1NFIA 1HYSD 3TPUA 3IJYB 1WZ1H 4MQTB 1GOFA 1ZEAH 1I8KA 5FO7B 5I1IH 2P45B 4GRWH 4QLRA 2VDML 2DDQL 4IJ3C 2IH3A 4GRMA 3TN0C 4ZG1A 4F2MB 3GDBA 3MRQA 3KYMA 3BKJL 3L3HB 3S5LB 1BF8A 1WJ3A 4NIKB 5ESQB 4R8WL 4XBGA 3KPMA 1O0VA 4H0IA 5AZEH 3PIQA 4I8DA 3QULB 3EOYG 5DMGD 5IWLC 4LVHB 1CFVH 3MNZA 4JDZB 2Q87A 3QQ4A 4GAJL 5AD0B 1OP9A 4PB9L 5D5ME 4IOIA 3BESR 2BXZA 4PP2B 3BDYH 1N5AA 3RWFA 3QIUD 3WV0A 4EKXA 2WWMD 5IM7A 3KPOA 2IH1B 5D7IE 3SGEH 4MCZB 5GGTH 5EG6C 5D1ZC 5I76A 3LRGA 5DHXB 3MV7D 3T8XA 3QG6A 3FB5B 3I02A 5FECA 1A7RH 1QLEH 1JFQL 3WS6C 4MHHI 1YPZF 1ZHNB 1KLGA 4JY6B 1RMFH 4RSVA 3O8XC 1FZOB 3ULUD 4PLJD 3UBXI 1MCOL 1WUNT 3IU3B 2IBGA 3HPLA 2EKSA 2D0FA 5JIPA 3MLVH 2CUMA 1E6JL 2BC4B 2HT3C 2Q76B 1M71A 1G6RH 2GEEA 3C2SA 1S7VA 5DURD 5TJWK 2DQEH 3CZJA 4HWZB 3DROA 3DVIA 5B22A 5SX4H 1AR2A 5HVHB 2OR8A 5TQ2L 2AEPH 3HRPA 1BFSA 4P9MH 5E56A 3G5YB 3VJ6B 5AUMA 1FHGA 4G8FA 2DQTH 2DS4A 3N1GC 3OAYH 5IOPB 3ULSA 2ZUYA 1YYML 1C5CH 1U8OA 2C4FT 2LVCA 2P8MA 1BGXH 3IRPX 3PG2A 3MLYL 4LLQA 5DJ2A 2FX8H 1FZMA 1ZANH 2X89D 1HWHB 1MQ8A 1CE1L 3B4NA 5GHWH 1KB5A 4PJDB 2VAJA 1QA9A 5KSBB 5LXGH 1U8MA 1N3NB 4FABH 3SGDH 5FUCE 4GXVH 4U1SB 3BUYA 3Q1SL 1U6AH 4QRPE 2NY4C 3MOBH 4YDKL 4C4KO 1IC4L 5EOTB 2W0PA 1ZHLB 1NMBH 3EYQD 5F7LB 5F7WC 4GW5A 3GI8H 5GSRB 1XF3A 4N0FB 5CUSL 1CLOH 4WTXA 4CVUA 4KQ3L 4MD5A 4RZCB 3REVB 3CVHH 2KBGA 1I7TA 4EQ2A 5E7BA 1F45A 3KPLB 1QVOB 1F4YH 3BOVA 1D6VH 3A6BH 4FXLA 4G5ZH 3KJ4C 1XIWD 4K9EH 5IT2L 1IQDA 2V17L 3WJJA 5SV3A 2BMKA 5MENA 5D1QC 3BFOA 1P7HL 1KC5H 1CIUA 1RVFL 1CFSB 3QEUB 2HRLA 3I75B 4XP4L 3V4UH 4KROB 1MREL 4XCNA 3LD8C 3ARBD 2VH5L 4FTVE 1N26A 2J8UF 1Y6MR 1R5IB 4PY7A 5MI0C 2AXJA 4HJGB 2FJFA 1PYWA 5SWSE 1IZKA 1TTFA 4J8RA 2CLVA 1MVUA 5IMOB 3IJSA 4H8WL 5DHVB 1KGCD 3C5JA 4Z6AT 3NFNB 3FO2A 1CVRA 3VH8B 3VXQB 5IK3B 2DQJH 4GKZB 2XN9B 4EDXA 4KVCL 4JFDA 1U58A 4XNMB 2W9EH 3T0EB 3E2HC 4ELME 3HMWL 2GCYB 3NAAL 2H2PD 4K7PY 2PTVA 2Z8VC 1CZ8L 5F3HA 4BJLA 4XCEB 4Q7DA 1W72B 4ZAKA 5TE7L 3MRMA 1X5JA 1BHGA 4O5LL 4PJHE 5KBNC 3VFSA 3X3GH 2E8YA 1NANI 1AC0A 5EWIL 3D39B 4EN3C 2D03H 4AH2A 3ETBF 1MFCH 5CHNB 3L3OB 1T04B 4NUGH 3BZFA 3VXRA 1ZLSL 1RJYB 1XGQA 2MPAL 3TH2T 5IEHA 3VXSA 1MSPA 2H9GB 3PDGA 4HJ0C 2R0LH 2ICWA 4FOMA 3WFZA 1BEYH 4OD3H 5CEZH 1I8IB 4ELKB 1SY6A 4L8BA 3MRJB 4Y1AD 3RWGA 4LSTH 4MSWB 2VB5A 1VADA 1HEZB 1EEYB 4OLXL 4OLUL 5GGVH 4A6YA 5K33A 4TYUA 1ZA6A 4L1HA 1KPUA 2X4QB 4U7SA 5CSBA 3UJJH 3WXVH 4BYHA 3SQOH 3L3IA 3VG9C 4NYLB 5JOFB 4S11A 2WWKO 1T5XB 1T7YA 4JO2L 4X4YA 4JPVL 1KPVA 1F3DH 1EFXB 1R3KA 3DMMD 3C6SA 1YEEL 3MFGB 1KPRA 2ZOLA 3I6KA 2EEDA 5IWLA 1OAQH 2F8VA 2Y72A 4KGLA 2CK0H 2PYEE 4PRHB 5FO9B 4ZTPL 4JM2C 4KH2A 1V3KA 2Z8WC 1L6ZA 3P30L 4BFBD 1WEJL 1S9YA 3FQRA 4FFZL 1PW3A 4MQ7A 5FKAA 1PLGH 4HG4K 5MERA 5CD5D 5D1ZA 1UB5A 3P77A 4WU7B 4NNXB 5DHYB 5FYJD 4F7PA 3M8OH 1CXLA 1Q0YH 2A6DB 2MQCA 5I71C 4AIOA 3SDXA 1AGCB 2WLZA 1UA6H 3QXDB 4EXKA 1I3RA 4U6HB 3N1FC 5BVJB 4NC0B 4EVNB 4Z78B 4ODHL 4JFFA 4QRUB 3CDGA 1RUPL 4PTTA 2FATH 2IALA 4XP1L 2F74B 1H8OA 4TNWF 5JXED 4Z7NE 5KVFH 4PB0L 2CKBH 4OUUA 2LU4A 5GJTL 1KCSL 1HIML 3ARDB 1HQRB 1DTUA 5BRZE 3MGTB 1A47A 4GBXC 3TBSA 1CICB 4NQDB 3DX6B 1BQHA 4TSBL 3TO2A 3FAXA 3QQ9D 1WZLA 2NY0C 2FGZA 1TVBA 3AB0B 3O4OB 3KPTA 1LILA 4MA3B 5CSZA 5I17B 1NC4D 2X4OA 1QACA 4K3GA 1DQQA 4JY5L 1QYGH 4FFVC 2Q8AH 1WFNA 4JCMA 3FJTA 3RVTC 3SKMB 5DRXA 2ITCA 1F2XK 4Y4HD 3TV3H 3DGCR 1VGKB 3C60D 4PJ5A 1D3CA 2YA1A 3GSWB 2E5EA 1C08A 2FIKA 3O4LA 4F7MA 5KSVA 1NAKL 4YBQD 3D6GA 1YDPB 5E4EB 4X7FC 3NPZB 5DLMH 5F7DA 1IQWH 3ARRA 4R26L 4WTZA 1T3FA 3MJ7B 3AC0A 4H20L 4P59H 4P2OC 1X4ZA 5HBBA 3C6LB 1J0HA 43CAA 1IC5L 1D7FA 5E2WH 5EC1B 5D2LB 5DRZA 1IC1A 1CLZL 5E94B 4JFDD 4P5TA 1L6XA 1S7TB 3H9HA 3UDWA 5CJQH 1PKQB 5GSVA 4G6MH 1J5OH 3ZE1E 1C16B 1NMAL 3BGMB 2Z9TA 3NH7L 5DRWA 1MIEH 3L5WB 1F00I 1AY1H 5IB3B 5GGUB 4MJ5B 5CAYB 5ALCH 1E4KC 2EZ0D 4YHZL 4LSPL 1SBSH 1SEQH 5D1QA 1TPXC 1JIBA 2B8OT 1T5WA 2FLBT 1N8ZB 2W60A 3HKFA 4DN3L 3PGFH 1DSFL 2DTMH 5LKNA 4KC3B 1IGTA 2O5YH 2HN7B 2YUWA 3QO0A 4MA1C 1A64A 1ZT7B 1MHEB 5ITFA 3ROOB 3HPJA 3I9GH 3BXNA 3RIAF 3GSNH 1R0AL 2B5IC 3H0TA 3WMSA 1DBMH 3OAZK 4MA7L 2R15A