1IKFH

A conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
228
structure length
228
Chain Sequence
EVKLVESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQNSEKRLEWVAFISNGGGSAFYADIVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCTRHTLYDTLYGNYPVWFADWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/immunosuppressant
molecule keywords IGG1-KAPPA R45-45-11 FAB (LIGHT CHAIN)
total genus 45
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 1993-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfH01
2KDGA 4ZS7H 3QBTB 4PB9H 2DI9A 2GSGA 4NJAH 2DI7A 4IIQB 2P43B 1JZ4A 1HSAB 1D5MB 4M6MH 1S7UB 3C8KB 5IIEA 2QSVA 3UTPE 4EOWH 5EC2A 1JUFA 4E41D 1HHGA 3LMJL 4OZ4A 1UZ6F 2X9YA 1NFDA 1X4XA 1FVDA 4DFHA 1JZ7A 2A6JB 3IKCA 4PJ9A 4AEIL 3OJDA 4JFHD 5KSAC 2V6HA 3WFEH 1H5BA 2J1KA 4QLRA 4RQQB 4HS3B 5C86A 3U9UB 1A47A 5JPNB 1GIGH 2CRMA 3MA7A 4DAGH 3HC3H 2R0ZL 1JNHA 2ZUQB 2F9BT 3DUUA 1QFWH 4WGVB 1XCTB 3TT3L 4QHNB 5LVEA 1KT2A 5CIPB 1JZ2A 2VXUH 1HCVA 5AAMA 1JGLH 3O6ML 4WY7L 4MXQD 2EO9A 2APXA 2IQ9H 4P5TD 2NCMA 4YHYC 2E9WA 3FO9B 4G80B 4YHNB 3GBNL 2ZG2A 3MLXH 4UOJA 5EU5A 3D39E 1MH5B 4N0CC 5DFVD 1EMTL 2Q7YB 3SGKC 1T03H 5GISL 1A2YB 3L3GA 4LLDB 2XWJB 1BJ1H 1N2RB 2YXFA 4X6FB 3MV7A 3QUYA 2AXGA 5BW7A 2H6PB 3T0WA 1LO4H 4IDJL 1MHCB 4MXVE 5DT1L 5IBUG 3O9WD 2NR6C 2CO6B 5F1KC 4YGVB 1SYSA 3NIFF 1CCZA 5C0IA 2YPKB 1HINH 3KPNA 5FUOH 3WMSA 2R0ZH 4NKIL 5C7XH 1WLHA 3S36X 3BUTA 4OGXH 4Y4FC 3RY6A 4O2CB 2LTQB 4Z76B 3MRPB 3MSPA 3FT2B 1IMHC 1IC7L 3IXTA 4F7CA 3PGCA 3SKMB 3I6GA 2Z92B 3LHPH 3BAEH 3AMLA 1D9KD 1I3VA 3MREA 3RUGB 4X99B 2XWTA 1QNZH 1BAFL 1QHPA 1L7IH 4OFKA 4O58H 1LP9A 3BQUD 5ISZA 1YYML 4OCWL 1JPSL 2X1XR 3A0OA 4R2GD 3T09A 1JGLL 4P2OC 3QWQB 4ZUVB 3MOBH 3QUMB 4LASL 5DA0B 1FNEB 2JCCF 3H3PL 3OQ3B 3F7RA 5D7IB 5J1TC 1CFSB 2O5XH 1YNTA 3WFZA 3RBSA 3MRJB 3TNNA 3W2DH 4RFOL 3HI6H 3VFPA 4L3EB 2IH3A 4XCFL 1UYWL 3WUWG 4U1HA 4U1SA 2GSIA 3UJTH 1Q9WB 1IGIL 3QDJD 4XRCB 5CJXC 2EXYD 5FYKH 2DQGL 3VWKB 1QLRB 1XFPA 1WISA 2E6PA 2GSIB 1CD0A 3AXLB 3ARDD 3K4DA 1AGDA 2NTFA 4PRAB 4OI8A 2DD8L 4J2XA 1P7KA 5JOPD 2AV1A 2Q7YA 3O11A 5FFLA 4H25B 1J0JA 1T1XB 3L3OA 5IP4A 4WDIA 4EBQH 2AJVH 5EUOB 3WDJA 2VUOA 5HI5D 3SDYH 1FJ1B 4LSSH 1T80A 3IRPX 2LVEA 3CXHJ 1KBGH 1U8HA 4RX4D 3V79C 3BP5A 4TNWK 2FIRT 1UKTA 5JMOC 5CBAA 2GK0B 3PHSA 1IE5A 4N8VB 3OV6A 1QFOA 2DI8A 2VN7A 3O2VH 4LLYA 4HGMA 4LU5H 4L8DA 3ULUC 3TIDB 4P5MA 5IB1A 3TEUA 3V7AE 1FZJB 4DZBB 2A1WL 3WNPA 1NC4D 2J2ZA 2H2PC 1QRNB 3FB6A 3FFCE 3QYCA 5FYJU 4C55A 2UZYB 3V4VL 4G7VH 4FQXA 2GY7B 1S78D 4K7PH 2IAMD 4H20L 4TVPD 5EZIL 2VIRA 4IMKC 5DO2D 3ZO0A 1OTTC 3AB0C 4IRSC 3HPJB 1FL6A 5EO9A 1SBSL 4J8RB 5JDSA 1F8TL 2G9HA 1OT1A 3QUMH 2PKDA 5D6DC 3VI3F 1J05B 3QWOA 4M5ZH 4PGJA 5I6XB 4XVJH 1KIRA 4JQXA 4H20H 3BN3B 2FEDC 4WI5A 3SDYL 5FF6A 2W59A 5J06A 5EU3A 1NMBL 1BECA 2R0KH 4OCMC 2EE3A 5K93A 3OAZK 3U1SL 1M7DA 3K0WA 1X6LA 5F7YC 1NUNB 2ZSVB 3IDXH 2I60L 3OXSA 5IVXE 1GZPB 1ZWIB 3H9YA 3M8OL 4M8QB 2H45A 3T04D 4WI4A 5C0AD 3MOAL 4P9MH 5T1LB 1KENL 2NY4B 1HDMA 4RGMB 1JMXA 4JFFD 2D7PA 1ONQB 4OM1L 2J8OA 4HQQH 2QQNH 4CDGC 2P24B 5C08B 5JR1H 5H2BA 1T20A 4QNPE 3FHAA 4QHKI 2X44D 3NGBC 5DJ2B 3ALPA 4HWZB 4Y5VB 5FO7B 1ZANL 4FTVE 4UINH 2FL5A 5TF0A 4UAOC 4AEHL 4GRMB 1QQDA 2BDNH 5DLML 2OTUB 5EBGA 3PIQB 3FKUS 4G8IB 3PWJB 1I3UA 5ESVB 3C60D 3PP3K 4NQVA 2OTUA 2HLAA 1AO7D 2ZUXA 1P7QB 3NCYS 4N0YH 2CLRA 1U8QA 1F8TH 2RHEA 5AZ2H 3TO4B 4FQ1L 4POUB 2H26A 2NY6D 1BD2E 3B9AA 4HJ0D 2IANA 5KVGL 2ITDB 4OBSA 3BH9A 3CNKA 2MHAB 1H9VA 1C7TA 2H26B 3U6RB 2GITB 1FSKC 3O45B 5I1IL 4WHDA 2E7MA 2FGWL 1DQJA 4PG2A 1K6QL 3MJ9L 4U1MB 4JJHA 1JWMA 1S3KL 2OP4H 1IEBB 3QRGL 1Y6NR 3O3AB 3GNMH 4IEFB 5IMKA 3EGSB 4FA8A 1U8OB 1A3RL 1A7QL 4M9PA 5ADPL 3FQRA 4AQOA 5I74C 2NQCA 2A6JA 4CVWA 1G7LA 1SYVB 1S78C 5DR5H 5E8PA 1GZQB 1RUQL 2CDFB 2R0WH 2WINA 1AFVH 5C08E 1FO0L 4JFDD 4DUWA 2MCPH 1ZVSA 1GGYA 3FQNB 2B0SH 5I1DA 3B6SB 3VXPB 2Z35B 1I8MB 4NO5A 5HYIA 2VXSL 1RU9L 1I3RB 1QFUH 3A67L 5D1ZA 3WJLA 4BSWB 4HPYL 1F6FB 3EIFA 1OL0A 2WBJD 4XMLH 1OCWH 5GJTL 1OAZL 1K6QH 3V5DA 3RX5A 1U58A 4PYGA 1N64H 4U6VL 3RUGF 3FOLA 3PWUA 1IGTB 3ROLB 1C1EH 2VLJD 1RJCA 1IGJA 4IDJH 4WWKD 2PO6C 1JNJA 4H88H 4PY8I 3SE3A 5E5UB 4URTB 4RGOL 4LVHB 2XY1A 1IKFL 4WTZG 3HN3A 4U1GC 4M7JL 3SN6N 3ZSTA 4QGYA 3GSVA 5A2LH 2IADB 4GQPH 5IJVA 2GJ6E 3MLXL 2APVA 4Z7WA 4NHCH 3SDAA 3QIUD 2VXVL 4OZGB 4AZ8A 3IFNL 3VXRB 3D6GA 1XEDA 3PNWB 5JZ7D 5BS0D 1I3RA 4H8WC 2NY0D 3OKMA 3UJJL 3FQUB 1EO8H 1A6TA 3D2UD 4AEHH 1UG9A 1MF2L 3VXNA 5T1KB 1DQQA 3UCRA 3HE6D 4Q9QH 1KXTB 1R5VA 1EEYA 2ZCHL 3MJ7A 43C9B 1JF5A 5IHZB 1ZHBA 4TNWF 3MV9B 4NQCE 5T5NG 3RZCD 4I5BA 3SGDH 4EUPB 5JIPA 3H9ZA 5DD5L 5EOQH 2A73B 4BK5A 1CGUA 4YX2L 1DBBL 3DSFH 3EGSA 5HHMD 4JVUA 5KSAA 4AEFA 3D0LA 2BX5A 3D48R 2VDRH 2FLBT 4PFEA 4BZ1H 2CR3A 4RFNB 2H2SC 3H9SB 4GW1A 4L4TE 4JR9H 5J4MA 3L95A 3MYJA 4P46A 4ZFGH 1U95B 4AT6B 3AM8C 1KEGH 2LAGB 2HH0H 5CP7A 3VFWB 1QFHA 5ITFA 3UJIH 4ZDHA 1LO2L 4PLJC 2XQBL 3QHZL 1CGSH 4MB3A 3AREA 3DGGB 3RVTC 4NQCB 1FLTX 1KJMB 5D4QA 3GBML 3FONB 5T33L 2NW2B 2N7BA 2R1WA 3X3FL 1A6VH 1R5WB 5INCA 1A6AA 3W11C 1P1ZB 5JUEL 5HDBE 3JWNC 4OD2A 5F1NA 4X7EC 1YMMD 5DJDB 5J57B 3U9PH 3O8XC 5D6CB 2MFNA 4O4YL 1A6UH 1SJXA 4HC1A 4PJBB 1VACB 1RVFL 5BVPL 2NTSP 1KIUA 2IBGA 4R4NC 4OAWA 4U1GB 1F4YH 1A4KB 1BWMA 3S3JA 3DO3A 5TQ0H 2Q86B 4L8BA 4NQUA 2AJXH 3R4DA 3L5XH 4CMMA 3G5ZB 2RCSL 4KROB 2OJEB 4ZO9A 2WAHA 3NIDF 1OP5H 4Z7UE 5C8JA 3MA7B 2XTJD 1P4BH 3TH4T 4PJXF 5CCKL 4OLYH 2VZSA 1T21B 3ARTA 3NPSC 4NJAL 5HYEA 1AGEA 1AQDB 3V52L 1KCKA 4FTVD 3HPLA 3O6FD 1CVRA 3FQTA 4RFOH 1CDCA 4FQPA 1KCUL 1C5BL 4I9WD 4MQSB 4QXGH 3OSKA 3QIWB 5IMMB 4QRSB 3ALWA 3ZL4L 3VFGH 4MDIA 2O5ZH 3Q3GA 1VB9A 4R0LB 3MUY1 1FNEA 1X9QA 5B39B 5EOCH 4BELD 1J0HA 3LEXB 1JGEB 4R4FH 5ACZA 4M6NL 4OZFG 5D1XC 3WXWH 3D39A 2F8OA 2WUBH 5T3ZD 2DQFA 3BWUC 1JPTH 4FP8L 4I0PA 2E6JA 3FAXA 4GKNA 1HHIB 4PJGE 1ETZB 2VSCA 2WLYA 4KJYB 3CMOH 4F33B 2I60H 4RBPK 4K3JH 5CP7B 2KZWA 4ENED 4O2CA 1YEEH 5I8OH 4FQQB 4DOHB 1FO0B 5TDOB 3SKNB 4ETYA 3KNBA 3HPLB 3PQYD 4HKZA 5D5MB 5I1GL 2L0DA 1CLCA 2OJZH 1SJEB 4JO1H 5B3JF 1QSVA 1KB9J 2C1OA 2AJ3A 2HJKA 3DX8B 3ARZA 3LDBB 2ZCLL 3U79A 1EH9A 5CUSL 5GGUB 2W9DL 1UJ3B 5IJKC 3U36B 1CBVL 4JREC 3DX8A 4GRWE 4XWGH 4NUJA 5EZLA 4KQ3L 4GG6E 4Y2OA 1F00I 5J0BA 1NKRA 2GYSA 3QO1A 1A9BA 1FAIH 3CFBB 4NNYB 1F58L 1HEZB 4G8GD 1DVFD 1DBMH 1E6OL 4KQ4H 1F6AA 2NY2D 4NT6A 2QSQA 4JPVL 3KPMB 3VH8B 1AKJB 2EDBA 3WHXB 3ZYJA 5JXEA 3CFBA 2AEQH 3MRCA 4DW2H 3QO0A 3JV5A 3BD3A 5D1QD 4L8DB 3VRLE 2VXUL 5EBMB 5GHWH 4S11A 4KZEH 5K33A 5C07A 2VLKA 4H1LB 4JRXD 3UMTA 4W4OC 3V7MA 1LK2B 1ES0B 3HG1B 1U3HB 1QRNE 3PGFL 4OZHE 2WWMC 2Q8AL 3MR9A 4EJ1C 1S7WB 4XP5L 3CDGB 4KI5F 1RZIB 1KLGB 2VABB 3OZ9L 3QDGB 4XWGL 1T5XA 4C56E 2ESVE 1Q1JL 1P1ZA 5KSUB 1BJ1J 3SDXB 3SDCC 2BSSB 1MPAH 1YDPA 4M6OL 1JGEA 1SMOA 3MYZA 3G5XA 3VXOB 2J6EL 4PJ8B 1Y0LB 4QO1A 3SO5A 3ES6B 5FKPB 1G7QB 4AIZA 3QO0B 4M93B 4OTXL 1SJHB 2BDNL 4IMLA 4OIIH 1PEWA 3ZKND 3WNOA 4F7CB 1XF2A 1UCBL 4IRSB 2GTZA 5JW5A 4Y4KB 4OCYH 4ZUUB 4UUJA 3UYRH 1XR8B 1VEMA 3QQ4B 3IETB 4UT6L 3MV9A 4G80A 1S9VA 2UZXB 3TESA 1Z9SA 3T3PF 5CZVH 2E8ZA 4BH8A 3RVWC 5ECJE 4CGTA 4WI2A 3TFKD 5DSCA 4PB9L 2QR0B 2BSSA 4J3UA 1XCQB 4LASH 4PRNA 2ARJQ 4F8QA 5DD0L 1X3DA 4I77L 1JMZA 3IDIB 5I15L 1INEH 1K9TA 2A6KB 4WNQA 4DEPC 2CO7B 4XBEH 4U1IB 3CJJA 1GHFH 3BKJL 2AXJA 2MKWA 4Y19B 3V5HB 1SVCP 4LHUA 3C9NB 4DN4L 1L0XA 5D7JA 3OZ9H 1KC5L 1I1AA 5T3XE 2AJYL 3OKMB 4HGWA 1P4IL 4ONOA 2NXYD 2X4SA 3QUXA 2DIJA 5HI4D 3KYOA 4I13B 2R29L 5T1KA 1INQB 2GT9B 5HY9A 1QEWA 3DSNA 3TO2B 1DN2A 1M4KA 4ONGH 3CU1A 1FL3B 5GJTH 1MY5A 1CICB 3PWLA 5D2NA 3GJFK 1XZ0A 4R97B 4XPAL 3TO2A 5C9KA 1V3KA 4Y1AB 2HKFH 5GS2H 3I75A 4OLZL 3GGWA 3MGTB 2PYEA 1FYTD 4GRMA 3IFPB 3QDJE 3SKUD 4HHAA 4HXAL 3SDDD 3QIUB 4KI5C 1TVDA 3SGJC 1FZMB 5B38G 1S8DB 1JNNL 3CVHL 5EH1A 2EYTB 2V2XB 4NHUB 1T89C 3FO0H 5CSZA 1H3VA 5J12C 5ETUA 1CXLA 3LIZL 3IU3B 3S3PA 4ONHB 1JF6A 1NLDL 4NNPH 1U8JA 3TT3H 3HNTH 4HIHA 4CUCA 2NMSA 2VLJB 2Y5TA 1E28B 3P0YH 5I1CH 1CG9A 1U93A 5GQBA 3SE9H 4U33A 1CFQA 1X5HA 4FQXB 2EIZA 5I8KL 1QSEE 4K3JL 4OCXL 4MQ7A 3E1F1 5DQDH 4KDWA 5FYLE 1B3JA 3RU8L 4KQ3H 3BH8A 3LPWA 4KY1L 4NQED 4ZUTA 2ORBH 4NQEB 4R7DB 3O6LL 3OAZH 1GRWA 3QWOB 2EDQA 3MROA 4YBQC 5ICYB 2ARJB 2IPKA 4WUUA 2VDNL 3RVWD 4Q0XH 4R7DA 1VCAA 3HUJA 5BJTA 4RIRB 2VC2H 4HC1H 3K4AA 2X5PA 5IWLA 3MROB 4YDLB 1D6VL 1G7QA 3DYPA 4QRTB 1NANI 2W65B 5F21B 2CK0L 3UAJC 1LO5A 2RJMA 5CJQH 4BH7A 4MA1C 3PWUB 3MCG1 5ENWA 4TOYH 1CXHA 1BIIB 4HJGA 2VDLH 3SCMD 3T65B 4A6YL 4K94C 2IGFL 4L1HA 4BSWA 2FZ3A 4YPJA 3QNZB 4IRZL 1KIQB 3TO4D 1FL5A 1OAUH 4WO4C 4F58H 2E7LA 4Q2ZB 4X9IA 3VFGL 1ED3B 4HPOL 3HZYA 2BY2A 3EYVA 1YN6A 1J8HA 5F3HB 5DJAB 4DZ8B 4UDTB 4YHOL 2Z8VC 3WHXA 1GYAA 4L29B 5BRZE 4ONGL 5C0CE 2E5EA 1ROWA 4L4VD 5DTFB 1JF1B 2EE2A 5E5MB 3V7AG 1FFOA 3NGBB 2R56L 2RR3A 2QQLH 1X44A 2AJXL 3MZTA 4M1DH 4IIQC 3TYGH 4KPHH 4M7LH 2CKBH 2GKIA 3F12B 3TM6A 3WXVH 1V7NL 3VXSA 1KYOJ 2GITA 1XH3B 4B5EA 4JKPL 2VABA 5B8CB 3K46A 2ZJSH 3DROB 3O4OB 5KOMC 4LNVA 3DVNA 1T20B 2DRUA 2PF6A 1UVQA 3IDNA 1BQHA 4N1CA 1MCWW 2ADJA 4FOMA 4F7MA 4NC0B 4Z7VF 5D2LF 3AAZB 5GXBB 1V7MH 4PJHE 1KG0A 4WU7A 5FKPA 3TLRA 2ZPKH 5HGBB 4JPVH 3OGCB 4MAYD 3U4BH 2YPKA 3WCYA 3X17A 3JV0A 2RQ8A 5E2TL 1B90A 4XCEA 3BQUC 4Y4KD 3D39B 1ZVSB 4MD0A 1EGJA 3CFJA 4HZLB 2UZIH 4OZHF 3ZLQC 5LQBL 5HYFA 3EOAA 5FCUH 2VLRD 3GKWL 5T1DL 4MNQD 1MFCL 3RGHA 1F4XH 3WV0A 3IXTB 1U9KA 1BFOB 2CJUL 1KJ2L 4IHOB 1JWUB 4M6ML 3H7BA 2X89D 4L3EE 1NBQA 2OQJA 1J8KA 4MJ2A 5CZKA 3KPPA 1AGEB 3IU4L 1YN7A 3BPNC 5EPMA 4U05A 3ULSA 2EDEA 3AC0A 3ARFB 4UTBL 4YE4H 3LKSB 3GBLA 4ZUTB 4N8VG 3JV6B 3X11B 1UJ3A 2YS4A 1Q1JH 2X10A 2DYPD 4O02H 5EIQA 5EORH 2D0FA 4D3CH 1B0GA 5JPNA 1WQVT 1FZKB 1X4ZA 3N9GL 1T2JA 1TDQA 1VKXA 5E5RB 3EYFB 4U6XA 4F8TA 2YEZA 1HN1A 3BMWA 3U2SA 4L3EA 5CEZE 2Q8AH 4NN7B 3RGVD 2X4RA 3LN9A 5ISZD 2D0HA 3C6SB 5IFJA 3PGDA 3H9SE 4PRIE 1EO8L 2DQFB 2FX9L 2XACC 1RZFH 5FKAA 3WNLA 4YEEA 5GSRA 3VXUA 4TYUA 2XZCH 2JB6A 4LEXL 3ZKSD 3RDTD 1MFAH 5IVXF 4X8XA 5AUMA 3EJZD 3P2TA 5B3JE 1ES0A 3AS2A 3HG1A 3LSOA 2FWOB 1J88A 3GMMB 4BH8B 4U6YB 2ZKHL 1YUHA 3SKNA 4O5LL 1FORH 5HD8C 4LMQE 4IOFC 3MREB 1ZT7A 3QEQB 5KANG 4J3TA 4KKLD 2KKQA 5IMOA 3D3VE 5CCKH 4KV5F 1G7LB 4DVBA 2QADB 2Z91A 4BQ8A 4UB0L 3VG9B 1RHHB 3W82A 4NQTA 3OBAA 2DLIA 5D5ME 5A16B 1V5JA 3L5WB 5EG6C 3MXWL 1A1OA 3RA7H 5BXFA 4MSWB 1UH4A 2F53E 4ONFL 3V0VA 5DJ0A 5GGSY 2F74B 3HC0B 1KELL 1YEEL 4J3WA 5C8JB 3F6IA 1AKJA 3FN3A 1IQWL 4GRLA 4YJZL 2W1NA 4MA7L 5MHSE 1B6UA 4R2GB 3CCHA 4JG1H 1OGAD 4OGZA 4HW6A 3DPBA 4MLIA 3GBMH 1E4WH 4GQ9L 5D72H 3GHBH 2DKSA 3FB7B 1CICA 1N7ML 1CLZL 4PTTA 1BOYA 1CBVH 1P7KB 1IAKB 2VIRB 4NP4L 5IEHB 4O9HH 3FOMA 4PJ8A 1FIEA 1E4KA 4PTTB 3JTTA 2C1OB 3BGFB 1G9MH 5IEHA 3C6LA 1UWXK 4G3YL 4RDQG 1EXUA 1A7PH 4DZBA 4PRPE 3U9UA 4AH2A 4BQCA 1TPXB 4G6ML 5IOPB 1ZHKA 5GRWA 2YD8A 3OAYH 2BY3A 1DUZB 5J6GA 1HYRC 1QBLH 4HWEL 3SO3B 3E2HC 4NOBA 5AZ2L 1EEQA 2XTJC 2YSSB 4NZTH 3MLVL 1A4JB 5J13C 5KN5A 1Q9LA 4PJ7B 4RFNC 5AZEL 1Z9MA 4MMZC 5DHVH 1HXYB 4NQDB 1TXKA 1NL0L 3BN9D 4X7DC 3FB5B 2J5LB 1T83A 3T65A 1RHFA 1RZJL 3EYSH 1FJ1A 3K2UH 1G9MC 5DRWA 3ZL4H 4EI5C 2D7TH 3ZDZF 2CK0H 4ZAKD 4PJEA 4F9LC 3MJ8B 3OHXA 3SY0B 5MEQB 3QO1B 2WWMD 5DFWH 4Z77A 5IW1A 4Q9RL 3I6KA 5BZDA 4NQCD 1RZJH 2VRAA 2AK1L 4PJIF 3NCMA 2EDTA 3AMKA 5GRJL 5C70A 5IESL 4QOKD 5E6IB 2VL5B 1NBVL 4HDIA 4X7TA 1CDYA 5JW3L 3MUGA 3NCJL 5CSBA 4I3GA 2Q86A 1RI8A 3FQUA 3WUWB 1CXEA 1NCNA 1L6XA 4LSVL 1LEIA 4WJ5B 3H9SD 5C09B 3GI8H 2R8SH 4PD4J 4OZIF 3P9WB 3ARVA 4BH7B 1ZGLP 4KFZC 4LLWA 4KXZH 2EZ0C 2UVEA 4K3EH 3O3DA 1AP2A 3E6FA 4H26B 2DMKA 1OVZA 3JUZA 5GRXG 1LQSR 1N5YL 3LPFA 3VGFA 4LSVH 3PWNA 1HHGB 4OZ4B 3ROLA 1W0VB 4JHAH 4RMTA 2ORBL 3BT2L 3RGVB 4YDIL 4K94L 4ZSOA 4XCCL 2G60L 3LIZH 3VXMD 1IGFL 2B4CH 4GUPA 1QD0A 1AO7E 1J10A 4HS3A 1MUJA 3O2DA 5HHOD 3AY4C 2OZ4H 3WS3A 4LFHD 1ZAGA 1A4KA 1T89A 1TITA 4ENEC 2FCBA 2VQUA 3ZTNL 4XGZB 1XR9A 3RUGE 5MP6H 4EN3D 4W6YB 5E99L 5F9JA 3ARFD 3B9KB 3DIFB 2NY1C 4BUGA 1EFXA 4HMCA 4QRPE 3ARYA 1MF2H 3QEGL 4O9HL 1V3MA 3UJJH 3D87B 3PXJA 3L6FA 2PXYD 1UM6H 5EIVA 1A0QL 1MCSA 4NJ9L 6FABH 3HI5L 5KVDL 1KLFA 4N5ED 4Z7WF 1FE8L 4NO3B 4TSBL 3O2VL 3S36L 1W0WA 4JPWL 1MCWM 2DM2A 5HDOA 4MA1B 4TUJB 2FHBA 5CHNA 1D5IH 4XI5C 3VFMA 3MA9L 3KPSD 1QSZA 1I1FB 1I4FA 5B38A 1FHGA 2PTVA 3F65A 4MAYB 4NHUA 3ZDXE 3H3KA 3QQ3A 4XMPH 3DXAE 1UQSA 4XBEL 5F7HA 3BZ4B 1OW0C 4I0PB 4I3RH 4WV1A 2PR4H 5BV7H 4J1UB 1N0XL 5DJZB 4CRPA 1U8QB 3WIIL 3WEXA 2BVOA 1IGCH 4YDJB 2XA8L 4KK8D 3GMLB 2D0GA 3HA0A 4F3FB 1NBYA 1TVBB 1F4XL 5DD6B 1REIA 3HS0A 3GDBA 4TNVF 2X41A 5E5MA 4DKFH 3LQMA 4D0CA 1U58B 4OD1H 5LJYH 3ZKXB 5C0RH 2X2YA 4LVOB 3SQBA 1OP3K 1BBDL 2I07A 3MCLH 1AGBA 3W9EB 1DVFC 2HAZA 3BH8B 4M7JH 1RUMH 5GRYA 2EKSA 3FQTB 1KTDB 1XF4B 1TNMA 4LSPH 1LE5B 4MA7H 4ODBD 4JKMA 3SDAD 3ZZ1A 3QHFH 4L4VB 1RZFL 4Y5VA 4J3SA 4PJ9C 5E2VL 4KMTH 3M8OH 2ICWJ 3ILPB 3VWJA 5LWYH 4WEUD 3SY0A 5KVFL 3VGBA 2CDFA 4LSRH 5CJBA 1BVKB 2PW2B 4ZOEA 5FUOL 4MJIE 4JAMB 4JZJB 5FECA 3FRPG 3HFML 1QPXA 4XGZA 1KG0B 1G6RB 3BDBA 4KVCH 4OLVH 4UT7L 5GGQH 2HG5A 4R26L 2IADA 1RZKL 1TVBA 4LARH 4OD1L 3QNYB 4DKFL 3P4MB 1S7VB 2Y5EA 3MJ7B 1EEYB 2QJDA 2CLVA 1NFIB 4C4KO 4XP5H 3VDAA 4PRHD 1ZA6A 4MA8L 5FGCB 1B2WL 1YYLL 3WIIH 4XTRC 4QRPA 2BZDA 4QEGA 1NFIA 1RZIA 1H3GA 3RWIB 2VMFA 1FL5B 2CJUH 4G6FB 5ALBH 4U1NB 4FFZL 2Q6WA 3UTSB 4LF3A 1VGKA 3FT4B 3UC0L 1QR1A 3QXAB 3NBNA 4OLXL 4YDKL 3I50H 4XP4H 3O2DL 1NGYA 2VITA 1ZT4A 1I8KB 4NZJA 5HHVL 2JJTA 5GS2D 4HUKB 4UTAL 2AV7B 4JDVA 3EYQD 1V05A 3T4YB 5F8RC 3M17A 5HHOE 2V17L 2P5WD 2HVJB 4NO0D 2Q8BL 1T66D 2HJLA 1MREH 1YEDB 2Y5TB 3GSUB 2H8PB 2GHWB 3BDYL 1U2HA 2BCKB 3HC3L 4L3CB 1U3HA 3RWFA 4JKPH 3Q6GH 1E6OH 4KQ4L 3SBWC 1JWSB 3D85D 1F58H 1A5FL 1HHKA 1MFBH 4BYHA 5DSCB 1KJ2H 1BZ7B 4OLEA 3PQYE 3U6RA 4XNYL 1SJEA 1U6AL 3V6OA 4IOIB 3V6ZA 3FO2B 4KJWD 4EEEA 3QUZC 2R56H 2FEDD 2FYYA 4NZDA 4U1LB 3QDHA 1F3JB 1OAKL 3TA3C 1UH2A 5C0GA 3ULVE 1QO3B 1WV7T 4IDLA 1T22B 3MCKB 3MO1A 4JRYA 1VA9A 2R2CA 4Z18A 2HFFA 3PWPA 3UBXA 3SKJH 1EJ6A 4M9OA 1MRFH 3KXFE 1W8NA 1T04A 4NDMA 2R0LH 5FB8A 2V7HA 4PJCA 5CWSB 1RUKH 2P45B 1KCUH 1AD9B 3VWKA 4PJ5B 3DX9B 4J7RA 3QDMB 1GVIA 4K55A 3ARXA 1HI6B 5HHOB 4TUKL 1S9VB 3DXAA 3WXVL 3X3FH 5HGHA 2H32B 4OLUL 2AV1B 2NNAA 1IC4L 3VRJA 3CDFA 1N7MH 3CFCH 4WFFE 4D0DA 3BRFA 3S35H 1DE4B 3F8UB 1JZ8A 5LGJA 4UZGA 5FAAA 1J0YA 4N1HB 1B0GB 1OW0A 4IRJB 1T1YA 2BNRA 2BHZA 4CN1A 1QQDB 3Q6FA 5HTSA 3G5YB 3WS3B 5I6XC 2B5IC 3DRQB 3QUZD 1DQDH 1YEHL 5GS3A 1N6VA 1ZT1B 1AXSB 3NABH 1IGMH 4ERSH 3RY6C 2BFVH 1WTLA 3VFPB 3BIAX 2R4SH 1WBXB 4WHTB 1A3LL 2G75B 1OD9A 5JW4M 1ZGLA 4CJ1A 1QA9A 3OG4B 3QFDB 5AWNL 3QDJB 4LLVA 1RMFH 1LEIB 3G6JF 3LB6D 1I7TA 2CSPA 4CBPA 1GSMA 2C26A 1RULL 2BJMH 4UIMB 3TVMA 4M1GH 2XPGB 3FOMB 3U0PB 1UM5H 5BW7C 3IJSB 1QLFA 1AGDB 1FN4B 4PRAA 4YO0A 4G8GA 3UTOA 3FB5A 3TVMB 1VADA 1JTPA 3G6AB 1OARH 5IKCB 2BRRH 5D5MA 4CW1A 5LXGL 3CDGA 3JBG7 4EI6A 1FQ9C 4CMHB 1R5IB 2WM0A 2YRPA 2ADJB 4F7MB 5CP3A 2VLKD 2CDGA 2IQAB 2XWBA 3TBWA 1T1ZA 1Y6KR 1X7QB 2XQBH 1D9KB 5CZXC 1OWWA 1V3LA 3WO4C 1VFOA 4X98A 1XF1A 1EXUB 3EOTL 3NIFE 4WW2B 4HCRL 5ILTL 3BPOB 5EOQL 1XGRA 25C8L 3NTCL 2ZUVA 3DWTA 1DQDL 1YEHH 1QRNA 3FB6B 1RK1B 1DQML 1IAKA 2NNAB 2HYMA 3IDYC 4EDXB 3IF1B 2OQJB 3S98A 3VRIA 5IQ9B 5D7IF 3QEQA 4PJEE 3VFSA 3GSNB 3KXFA 4G9DB 1CFSA 1P2CB 4JLRA 4WFED 2BSED 1MIEL 2R69H 5DF0A 4XZUB 5EZLB 3VGGA 5DZLA 4WW1B 4NNPL 2AJYH 4NKDB 5IV2B 4MB5A 4NM4L 1FFRA 1WFOA 2VL5A 1M71B 5F72S 5ACZB 2PYFB 1QP1A 3BAEL 4P9HH 1FC1A 5BXFB 1WUNT 4TULL 4JRYB 2AERT 1AFVL 4WFHE 2VWEE 3IYLW 3BSZL 4FQCL 1ETZA 2NY6C 4YZFE 1IC7H 4M7KL 2HKFL 3GUTA 1SEBB 1R3LA 1T1WB 3F7YB 1I7TB 1FBIL 1HXMA 4NWTH 2Y36H 2XI9A 3TWCL 3PQYB 1SVZA 5J11C 1C12A 2GAZB 3VFVB 1OCWL 4K3GA 4AMKH 1U42A 3WFCL 4ZTOH 4RZCB 1I9IH 1UA6L 1YUHB 1DLHB 2J8UA 3L3IA 1NGPL 3CAFA 4DFIA 2A38A 4N9GB 4Y16A 4NKDA 5IV2A 3UTSE 4KPHL 4JDTL 3W0WA 5HPMB 4Q58C 4KKBC 2J7LA 1T1YB 2BNRB 3V4PL 1JYVA 1T03L 4JFZH 4KK9D 3QUXD 1MJ7L 3BJLA 5CILL 4DGIH 2F54E 4RWHA 5LGKA 1CK0H 1U8IA 7FABL 3GO1H 3ARDC 4HZLA 4XPFH 4I3RL 4OZFH 4JO1L 2Q3ZA 2WINB 3NA4A 1MCHA 3NACH 4CMHC 4PP1D 5I16A 3GFUA 4LSTH 3MFFB 2Y36L 3GJFA 3LKQA 1LMKA 3BYTA 4K3HA 4PJ7F 4U6TA 3MUJA 5C9JA 1PSKL 4NBZB 3T08A 2CKBB 4XBPB 1FV1A 4XP4L 3TJEL 4G5ZH 1NGPH 5C71A 5FYJH 5DMKA 2FATH 5AAWA 2OMBA 3GSNA 5BVJA 1BOGB 5E2UL 5I0DA 3O8XA 4GXVH 1F3JA 5JIHA 3DVNB 3B9KC 2RIKA 5EA0H 4P2OD 2FH8A 4LHJB 4M02A 4Z7QF 3EJJX 2FBJL 3EDJA 2W38A 4F2MB 3BKCH 3BP7B 1KN4L 2PCPB 3HAEH 4KRPC 4FQHA 3H8NA 1D5ZA 3OPZH 1B2WH 2IMMA 2BY0A 1JHTB 1NH6A 1DANU 2CKBL 3MLRH 1DQMH 3B8SA 1RJYB 4X98B 4P57A 3MRLB 1Q0XL 2X4NA 4BA8A 4GAFB 3HE7B 3EHBC 5FCSH 1INQA 4UT7H 2VXQH 1MAMH 1FCCA 2DJ4A 4TRPH 1P84K 4NYLA 4XPHH 3ZYZA 4U6YA 1EV2E 2FO1A 2X40A 4JZNB 3GSOB 3C8HA 5LWYL 1I9JL 3VW3H 4L8SA 4PB0H 2ZOLA 3FN9A 1XH3A 3KYKH 4XBGA 3SE8H 1N8ZB 3MMEA 5I8OL 3VFNA 1S9WA 3THML 3BO8B 4HJGB 5FYKU 3V5DB 4NIKB 4Z6AT 3QXDA 1NGQH 5MEND 3BSZH 4ZXBB 5TDNA 3B3IA 3T0EA 2AEQL 4R97C 3D69A 3GB7A 3FT4A 4ZMAT 3KPRB 3EJZC 5IVNA 1VACA 4OGAC 3EYVB 3ET9F 1KPUA 3RAJH 1ZT4B 3BN9C 3SCMB 3NCCB 2EIDA 2H3NA 3O81A 1Z3GL 1ZLSH 5DEFA 2YN5A 1GGIH 4QRPB 4OM0H 5F9OL 1XGQA 1XCTA 1MWAH 1MHEB 2VDMH 2EH8L 4L5FL 2NY2C 4N8CH 2W0LA 4NZRH 3HE6B 1FG2B 4S1RH 3WNKA 1IJ9A 4HXBL 3BZFA 3HMXA 4P2QD 1A3QA 1DQJB 4OZGE 3IDUA 1VDGA 4ZUWB 4XNUH 1WFTA 4PV9B 4BZ2H 3T2PA 2NZIA 2AXHA 2HT3C 5EU4A 2VISB 1LE5A 1KIQA 2V5SA 5I71C 1TMCB 5SV4A 1P4IH 1B4RA 1W0YT 1YY8B 5CMAB 1N4XL 5BVPH 1JN6A 5EO1A 3PV6B 1IC5L 5EUOE 1CLOL 2AGJH 5KOVC 4WFGE 1CFTA 4Q7DA 1YY8A 3B6SA 5D1XB 1RD6A 2O5ZL 4JFEA 4O2FB 3O41B 3D18A 3PV6A 4YK4B 4P4KD 4QXGL 4R90H 4N0RA 1FPTH 3S35X 3OF6D 5C3TA 3FCTA 3LV3B 3L6FB 1TZHB 2BMKB 2J4WL 5D1XD 3V0AC 1JPGB 4UU9B 4RMSA 4OB5H 2ZUTA 2V5TA 3BWAA 4OLUH 1DLFL 1JNNH 2YD1A 3BP4A 3QRFM 1MFDL 3UTTA 1S9YA 2BVPB 4HFUH 4S1SH 5ALCL 4UT6H 3RWEB 4Y1AA 5L2KA 1IAOB 3CC5A 3O3AA 4XCYB 4CJ0A 2XZAH 5DD3H 4JAMA 4I4WB 4JZJA 2NZ9D 5EBWB 1KCVL 2Y1VA 3L7EB 3CSYB 1MCIA 4PJAB 1B6DA 1S8DA 2C1PA 4PS4L 1AI1H 3F6LA 4JZJC 4KK5D 4XPTH 5KG9A 2OL3L 5D1ZD 4H1LG 2YC1A 1TQCB 4YH6A 1T0PB 4U1JA 3H42H 1HINL 2Q3AA 2VITB 1R3JA 1HXMB 1Q72L 4TTGA 2VLJA 2MQ0A 3CLFH 4QWWC 4NM8L 2Y7QB 4OGAD 2D9QB 5ID0A 2XQYK 1ZS8A 2NXYB 3QXWA 1NQBA 2BC4B 5D72L 4JFOB 2QLVB 3PP4L 3SDDB 4XNQA 1A7PL 5IB4B 3BIKA 1PKQE 4WV1C 4I77H 3KPRD 3TBSB 1KEGL 3CFDB 1A7OH 3LAFA 5KTEH 4XXDA 5INDA 4EXKA 3T2NL 3VJ6B 5GGRB 4GFTB 2R2BA 43CAA 4CNIB 3VFUA 3BP6A 4ZXBD 2PUQT 3E0GA 3I6KB 1KJ3H 4XT1C 5D7SL 5BS0A 5KG9B 3RVTD 5E7FA 5IQ7H 2OP4L 4QXUH 3HCVA 1HYSD 4JG0L 2FECL 1E4WL 4GQ9H 2P8MB 4HF5H 5E6ID 1SJHA 3CK0L 1OAKH 5E8EB 3REVA 4HD9A 2VR5A 4CVXB 3GK8L 3OJMB 3CVHA 1VPOH 4AEIH 1T21A 4XNUL 2HKHH 5C09A 2COQA 1LP9B 1PY4A 3C5JB 4ZFZB 4C56D 1QEWB 3RHWF 4F7PB 4G43B 4XXCA 1XR8A 1DBAH 1RUAH 5GS0H 1AQKH 2WUCH 3MBED 5C0CB 2D7QA 3PGCB 4X6FA 1B9ZA 2A6IA 3K2MC 3P0VL 3EO9L 1KTDA 4RAUA 5D7SH 1MI5E 3KJ6H 3L3OB 3HR5B 4HAFA 1I4FB 2YUZA 4L4TD 4NQDD 5T3XL 1JL8A 4LCCC 3FJTA 5GRVL 2G9HB 3WHE1 3N06B 5IROC 1G1CA 3IDIA 2CR6A 2XKSA 3SHSA 3QDGD 4G8IA 2EE6A 5DVLA 4P9HC 1AD0B 3KPOA 4MJID 3QCUL 1MY7A 4X5WA 2LFGA 4KUZH 4TSCH 5D7KE 1MI5A 1RZKC 5HHPB 4ODVL 1WSST 4V2CB 1I7UB 4RGOH 1R3KA 2IFFL 5FV1L 4O02L 2WMPA 4ELMA 4HX1A 2GCYB 1I3GH 1KJ3L 4NYLB 1DSFH 1BFTA 4PJ8D 1R3LB 3F7YA 3MRRB 2XXCB 2MNUA 1DTUA 3RNKA 5EBLB 1KOAA 3QXTA 1NC4B 3IDJB 3BXNB 4XMKH 5E2WL 1QFUL 5FOBB 3I6LD 1RIVL 2PO6D 1NCAL 4GS7C 1ZA3B 4U0RC 4ZO8A 1OPGH 1YEJL 4WI6A 1DVFB 1YMHA 3T0AA 3U0WH 2GY5A 4FQ1H 3IJSA 1TJHL 4Y2DD 2GJ6D 4NKMB 3MV9E 2ATKA 4F7EA 4YIQB 2B8OT 1X5GA 3VMNA 4JKWA 1SEBA 4NWUL 4F9PC 1QVOB 1RUPL 4X6CF 1PKQA 5FUZL 2E27L 5I1HH 3O6FA 4YHPA 1RFDH 4BSJA 2JTDA 5DDHB 4BQ9A 4EZMA 4CU6A 2YPVH 1UC6A 2DQCL 1FNGA 2LVCA 4K7PX 1NMCB 3GRWH 1MCBA 1E4JA 3U0PA 3ULVD 3PDOA 5A3IC 1TENA 1WC7A 3ARDB 2CIKA 3EJYC 3IJYA 4Y8AA 2WQ8A 2FX8L 5MEQA 5F7MC 3O3DB 1C16B 1U2CA 3QIWA 2ADFH 4GBXC 3O4LA 4FQIL 1Z6JT 4ORZC 1KPRA 2Z91B 2JJWA 4KKNA 2SEBA 2D9CA 5CGYD 1E4KC 4Y5YB 1G0XA 4OUUA 1QKZL 2EEBA 4K7PL 2D03H 5FOJA 3ULUF 1SMAA 1MI5B 1S5IL 3V6OE 4HUVB 3O6FB 4WWID 2FNBA 4HWBH 3KLAA 2H8PA 3MRMB 1OAUL 5JHDD 4K2UL 3VD9A 5E8OB 5EO0A 5GSRB 3ZKQD 1WICA 2X09A 1RZ8B 3WFCH 2H32H 1HZHL 4LKXA 4H25A 3ZE0E 2H41A 1BZQK 1FRGH 5HHOA 3A6CL 3OJ2C 5DRWB 3L7FB 5K9OB 2VB5A 2E9JA 3S88H 2WZPD 1G0YR 4HEME 4LVHC 2NW3B 4NO2A 1CZ8H 3JXAA 1DVFA 3V5KB 5LXGH 1HHHB 1TZGH 4KKBD 4ODUB 4OT1L 5SWSB 4JDZA 2OK0L 1BHGA 1T7VA 5D1QA 3CSYA 1XIWC 4I2XA 4KH2A 1NDGB 1YPZE 3W9DA 5EU6E 3ARGC 1CXKA 4X6DB 1RHHA 4V2BA 1JGDA 2IH3B 2A6DA 3FFDB 5T1MB 5TH2A 1L7IL 2AJUH 1WBXA 3BH9B 1NFKA 2VLRE 1KBGL 3D25B 5LAXA 2CK2A 4GAJH 1SJVA 2VZVA 3SJVD 3WJJA 1HK6A 5E24E 1FCGA 4OV5B 4K3EL 4L4TB 5ACMA 4DTGH 32C2B 1QLEL 2RBLA 5I18L 3ULVF 4PGZA 5F96H 3WSQL 1AI1L 4XPTL 3PP3H 4NRYA 2OLDA 4PJBE 2YD6A 4APQA 2DICA 4EI5B 2K3TA 1WK0A 3ULUH 3D69B 2G2RA 1A02N 1ZHLB 4G3YH 1RZ7H 4EUPA 3QUZB 2EDDA 2J8UF 1J87A 5LBSH 3P4OA 4PJHF 3UTPD 1WVZA 3QWRA 5KAQG 1I8LC 2A0LD 2Y07L 1VKXB 5DVKA 5IB5A 2DQJL 1UZ6E 2O5YL 2APTA 3KLDA 4JM2F 3ZSSA 1U6AH 1FNHA 4FXKA 5D8JL 4YHLH 3G6DL 4P3CL 5HYSA 1A5FH 1MFBL 3CVHB 3MV9D 4HEPG 1HILA 5E8PB 4A2MA 5JO5B 3IXAA 5EOTA 4UQ3B 4K9EC 1OQOA 3PL6D 4OFVA 4LPWA 3KYAA 5I1EH 1WJ3A 2C4FT 3NFPA 2QSTA 5CD5C 4WY7H 1CU4H 5ERWB 3CVIH 3Q5YA 5HHXL 1KNOB 1XF3A 1TTUA 4ZDHB 2NY0B 3TC9A 4FN0A 1A9EB 3O45A 4OQTH 1I9RH 4JHZA 4LCYA 2XA3A 4UU9A 2VDOL 2BVTA 3LS4H 5F1IA 4W4NA 4WVRA 1GC1H 1WC7B 4NBXB 3VXSB 3SQOH 2I5YL 3CUPA 2P1YA 1OT2A 3ARGD 1U8PA 3OR6A 1KN2L 1QG3A 1J8HB 5D93C 3SJVE 3T8XA 3WLBB 4F15B 2DKMA 2HKHL 1H3WM 3QNXA 1XGPA 3RZCB 1UZ8A 5D7JD 1Z2KA 1DCLA 3MPCA 3RIFF 3DO7B 4LF3B 5FA3B 2VLME 4YGAB 4MNGE 2OSLB 1G6RH 2YXMA 1BGXH 4PRIB 1EMTH 5CLTA 1YMME 4JFEB 1UXSB 3Q6GL 5T1KD 4OZFA 4E42B 2GUOA 3HZMB 4U7SA 2DF3A 3FQNA 3ZE1F 4YEFA 1IEAB 3NIDE 5JA8B 4JRWA 4ELMB 3DX7B 5H35B 1HHIA 1U8NA 5DRZB 1MWAB 1U8LA 4RMVA 1AE6H 1ORSA 2AV7A 4ZS7L 2FX7L 3TJHC 5J9PB 1KF9B 4HK0A 3C5JA 4ZFZA 3FAWA 1WZMA 3ILQC 5J6HA 2DKUA 1F42A 2FB4H 2AP2A 2OTWB 3SPVB 5C1MB 3HAEB 4RMQA 4TUKH 1A6TB 5GGVY 5D70H 1FL3A 4OLXH 3BPLB 3QFJD 3ZKMC 5HSFA 1MCPH 4M62L 15C8L 4HQQL 1INEL 3MLWL 1BEYL 2E3VA 4AMKL 1XGPB 1WCBA 1YA5A 4XPAH 3MUZ1 1L9MA 2R0LL 2V2WB 1CQYA 2V5YA 2YKLL 3R8BB 4AL8H 4NO0A 1S3KH 2MMXA 4DZ8A 1DEDA 4YXKL 3BP6B 1CD1A 1MFNA 3VCLA 2OTPA 3BZ4A 2NX5E 5ESQB 1F90L 2W9EL 4WCYH 3D85A 1MPAL 4M6OH 4OKVB 3ULVC 4HG4K 4OCSL 3VA2C 4DGYH 2F5BL 3JWDH 4FXLA 3ZE2E 4JFDB 3L3HB 5F70A 3VD4A 2W92A 2R4RL 1IT9H 4OTXH 4JZNA 2FIKB 4X7CC 3X13A 1P7QD 2EXWD 1YJDH 2GJZB 4OUOA 1J18A 4JANB 2DIAA 4U6HB 5BS0E 4KVNL 4PV9A 3PWPD 4JM4L 1PYWB 3PHOA 3CU7A 4MNQE 3U7WL 1GOHA 5DD1H 4NQDE 4NRXB 2AJZB 3I3EA 4J23A 5EU4B 4GMTL 2P42B 4XP6L 4GOSA 3TBTB 1ADQA 3QI9D 1I1CA 3OXRB 5FDYA 5DC9B 5HD8D 1BBDH 4B41A 5D70L 1G6RA 3DXAD 2DQEL 4M3JA 4X5LA 5DRXA 5I19H 1JHTA 3HCVB 3L95B 3B43A 1EAPB 4HIEA 3QEQE 2BVOB 4DCQB 3ARBC 4LP4A 1TZIB 3TN0B 2BMKA 2DQDL 1ZA6B 3RVUC 4RWYL 2FD6L 1JWSA 5D1ZC 2F15A 4RISH 1AHWA 2EKJA 3VG0H 5F7LB 3T1FB 4GT7A 5FCUL 3RWEA 2P5ED 5DEGA 5TPWL 5JDSB 5C08D 4L4VA 3MNZA 5L7XH 3VGAC 8FABB 4Y5YA 3WIFA 1F4YL 1UWEH 5EZIH 3VMPA 4MA3B 4LHUB 1KEMH 5CJXA 3UX9B 4YHOH 1XF5A 3L9RA 1D5XB 2XY2A 2JLLA 3CCHB 1UWGH 3MLZH 4DQOH 5E4EB 3RWJA 3MRMA 3RL1B 4PJIE 1KIPA 1E0OB 3FFCB 4KMQA 2R8SL 3QB7C 2JK5B 1XF2B 2WP3T 1WIUA 2IG2H 3PF2A 1WIPA 2D31A 4FNLH 2VDKH 4Y5YC 3T0VA 2OTWA 1HNFA 1IBGH 4Y4FD 3H9HA 1NUGA 4DUVA 2JB5L 1INDH 2EDLA 1C5CL 4HIXH 3MNWB 2A0LC 4RZCA 4MGXA 4TRPL 4POZD 1I7ZA 4YFLF 1T1XA 1UB5A 3DX6B 1T1ZB 1T6VN 1WZ1L 4M43L 3BYYA 1FVDB 2VO5A 3FZUC 3RWGA 5BJTB 3GRWA 4JB9H 3C5ZD 1LO3L 5DLMH 1GPOL 3RWDB 3DVGB 3RVVC 2OL3H 4JQVA 3GMOA 1QRND 4BZ1L 4O4YH 1HHJB 1KCVH 1FNGB 3NIGE 3PABA 1DN0B 2VDNH 4RNRB 1DSFL 1BFVH 1TPXC 3CMGA 5DUPH 1AC0A 5CFHA 1PKQB 1FO0A 5TDOA 3EYOB 1KEML 3RL2B 2GK2A 4MCYA 2HMIC 4R6UA 3LRSB 5EOCJ 2I07B 5J6GB 1CFQB 4LCYB 3ABZA 5HJ3A 1QSED 3MLWH 2FATL 4GRWF 2VH5H 2OL3B 2GCYA 1CGSL 3H6JA 4ZUVA 1UB5B 4KK5C 4KJQC 1LO2H 3BRGC 2X7LA 1DZBA 4EQ2A 3BEWB 4TVPH 3MRQA 4U1MA 3NFSL 4L3ED 4PGDA 4PRDB 2QBWA 5I1JL 3C6LB 2VQTA 5IBLC 3CFEB 5I17B 3I2CL 5K9JL 4BSVB 1Y0LA 2R0KL 3K2UL 4S0TD 4F2MA 1MREL 4HDIB 4G6AD 1T3FB 4PRDA 1TQCC 4PJ8C 5SX4I 4S0SD 4OF3A 3KPMA 4JY6B 1P4BL 1A6WH 2W0FA 3KYNA 1MNUL 4YFLI 3GUTB 4RQQA 1NCCH 2D7NA 3OKDB 3LQAH 2EIEA 5IB2A 4PJ7E 4IRSA 4HWEH 4HX1B 3CD4A 2AEWA 1OSPL 3G9AB 2VXTH 4Y16D 3ZDZE 4ELMF 4OSUH 5F93C 4X7TB 4LAQH 5BOPA 4Y4HA 3DX9A 2JKXA 3D0VA 3KVQA 3RUGA 1A21A 4HXBH 2RFXB 1IC1A 5D2LA 4KRPD 1CWVA 4PJGF 2QADC 5FOBA 3M1BB 3GI8L 5CP3H 3REWB 4CU7A 1P9MA 1A2YA 3L3GB 4LLDA 2R2EB 4K8RD 2SEBB 5E2VH 4S1DD 1YEKH 2O5XL 2DBJA 4JZOB 2D4DA 2O61A 2APWA 1KACB 1OTTD 4LPTA 4R0LA 1A7OL 5KTEL 3WO4B 2FJGB 4UILL 5DJAA 3UPCA 1WBYB 2XQYG 1EHNA 1D3CA 5I74B 4AH2B 5C0IB 4TVPE 1HSBA 1QNZL 5SWZB 4PRNB 4XPBL 2HH0L 1KTRL 5HGAA 2AI0H 2P8LA 4JREB 4NSKA 1HSBB 1A1MA 1BQLL 1KELH 4H5SA 1NGQL 4CVXA 4XVTL 3HAEG 4Y19E 5KN5B 3D0VB 2PTUA 2AAVA 4PJXE 5FKAB 2FLRT 2IC2A 4HUXB 3RI5F 5HJ3B 3QHTC 1IKNC 1B4JL 4HIIB 2Z92A 1U8KB 4U0QB 2BXZA 2HTKD 1IAIL 1QYGH 3C6LD 2FHFA 5KVEH 2W60A 2RGSA 1K4DA 4MHHG 2X4OB 4KI5D 4LPYA 3V4UL 2W0KA 4PGEA 1NDGA 4LAJH 1J8HE 4P5KA 5GGUA 2PW1B 1UENA 2ENSA 4XAWL 2B0SL 1YEJH 2ZKHH 4WO4D 2H9GA 4QOKE 5F6HI 5TQ2H 4ZS6C 5C0JA 4E41B 3IDGB 4PJBF 5E8EA 3GMOB 3P30H 3DJ9A 2APBA 5IJVB 1U91B 3LEYL 3OKDA 1NC2D 5I1LA 2ILLA 1F6AB 4XP9H 1NAMH 1CFNA 4PYHA 2L4OA 3HI1B 2Q8BH 1KULA 1A22B 3QIWC 5L9DL 5HYJB 3FRUA 1OF2A 5CLWA 5DQ9A 4P3DB 4LPCA 1JPST 1MLCB 2WIIB 3O3BB 2Z0BA 3RL2A 1TZHA 4QHUB 2YRZA 5MP6L 4YR6A 5ISZB 2DLEA 5HVWA 4PRPA 1I8LA 3MRNA 2BNQD 4NQCA 3BIKB 3DV6A 4H88L 3O4OC 4W4OA 5LGJB 1TVHA 1PSKH 5DR5L 5B8CC 4AG4H 4QOKA 1KPRB 1N64L 4U6VH 4LL9A 1ND0A 3NZHH 4GBXD 3I9GH 4HS8H 3IKCB 4PJ9B 2VISA 1EHLH 2YEZB 2Q87A 1YN6B 1NMBH 2P5EE 3LY6A 4ZO6A 4S1RL 1KCRH 3A6BL 1G7MA 5A3ID 5FUCE 3AREC 1FNLA 2ED7A 1LO4L 1GPOH 1FP5A 3TA3B 3V9FA 2VDQL 4OGYH 4Z95L 2LU7A 4E41E 5JHLH 2OJEA 5CWSA 1RSFA 3N1FC 2Z31A 1DR9A 3VMOA 4AQ1B 4X5XA 2ZCKL 3LS5L 1PLGL 4K94H 1SBSH 3P4LA 5M95B 5ID0B 4RDQF 2G5BA 2LU4A 1IC4H 3LRGA 4Y4FB 1RZJC 5H8DA 3NN8B 1KB5H 4LPXA 3VD5A 5DMGC 3WLBA 5E6YA 2QQQA 5EU6B 5ID1B 2IAMA 4JPIA 2VKXA 3F12A 5D7LA 1R5VB 5TF1H 5DRNB 4I0PC 1AGCA 1T83C 4IOIA 3VCLB 2WBJB 1CGWA 3ARFA 1GIGL 4LCWE 3VJ6A 4FG6D 4XPGH 4P2QE 4R3SB 1TZGL 1FZOA 4Z78B 3OF6A 5FUZH 3T77B 1VGEH 4ODHL 5D1XA 3IDMA 3QEHA 4WU7B 3FL7A 3HZVA 5DJ6B 5JO5A 5GRJH 2BCKA 4L3CA 2Z35A 1I8MA 5F3BA 4E0RB 4OF7A 4WUKL 4L29A 3L3KB 5IVOA 1WEJL 4HGWB 3UTSD 2HFEA 1HSAA 1PYWA 3PHOB 5DHYB 2NY1B 5BV7B 1FN4A 3MODH 4JFFA 4CDHA 3RPIB 4LCWA 4EIZC 1MFCH 1T7ZA 4R4BA 3U30B 4S1QH 1QR1B 2X1OA 2DLHA 3MLZL 1UWGL 1N2RA 4DQOL 5JR1L 4LCWB 1FZOB 1XMWA 3DO7A 3K1KC 3BD4A 4Y88A 4FQXC 1NAKH 2XRAH 2NY6B 5CMAA 2RCSH 3VXOA 4ACPA 2W0FB 4S1DC 3KPLA 4U3HA 2EDRA 5DJDA 5I2IB 2AABL 2NXZC 3MRHB 1O5DT 5FYJE 4G6MH 4RGNC 1T7YA 4G5ZL 5F3BB 1CD1B 4XP1H 2C5DC 4I1NB 2AK4B 3S37H 2JIXD 4J4PA 1NCUA 2CLVB 2X4NB 4C58B 1S5IH 4GMSL 4ETQB 4MNGA 4OZGF 5IJKA 5D1ZB 1ZLWH 3JV4A 4LCIH 4D0DB 3O3EB 3QSKB 4JE4B 1NSNH 4KVNH 3ESVF 4ZOBA 1H3XA 2HP4A 4QTIL 1ACZA 2C3WA 2Y7QA 1HHHA 3EYUL 4UI2A 4PGBB 1N5AB 4LCCB 1T5WA 5DJ2A 3ROOB 3I6LE 3UJIL 4UT9H 4GW4B 3VXQB 4KJWC 2VDQH 5JPMA 1HCFX 5C0AB 3S4SA 4GW5A 3MBXH 3HZYB 1F02I 4HT1H 1KSRA 4Z7NF 5HGBA 3F7VB 4G7VL 2Y6SD 4C56A 5C0DB 3FQRB 4AENB 1X6NA 2I9TA 4OZFB 3SE9L 1JP5A 2AJSL 2ZCHH 3MBEA 4LBEA 1N6UA 2HVJA 3MRGB 3W2DL 1WZKA 3RWHB 4JFDA 5IB3B 3P3YA 3U46A 5GS0C 1LEGA 2ICES 1V8HA 4K3DL 4L4TA 1QUNA 3TCLA 4GAGH 4A6YH 1EHXA 5E8DL 3L5IA 1R0AH 1YJDL 1KJVA 2DS4A 1NGZA 2XN9A 4NCC1 4R4ND 2AK1H 4KTEH 1MCPL 2DTSA 4M62H 2CRIA 3S6CA 4JFXB 3AVEA 4HXAH 5DI8A 3D3VD 3RVXC 2IAMB 3HI6L 1ZSDB 2BOBA 5IMKB 4LCUA 4NQSA 2X4QA 1FDLH 4KZDL 4J8RA 3ZT7A 2D7TL 4XMKL 4I2XB 1NCDL 4L4VE 4JM2A 1D5ZB 5E4EC 3GSQB 2HTKC 1XF5B 3L9RB 3D5OF 4FZEH 4J1UA 1LVEA 4RMWA 5M7QA 1BLNB 1K2DB 1P84J 4Q9CA 5F71A 4L4JA 5EBMA 1OB1B 1G9NL 4POZC 4Y19A 3G6JB 2X1QA 1E6JL 8FABA 5CINH 2CLZB 4UIKH 3VH8G 1NCBH 3UO1H 1G7HB 4NFDA 1CE6B 3X12B 5KSVB 1U8NB 4O51B 5DRZA 1KGCE 5ANMA 4WIQA 1J5OL 4N68A 4HFUL 3ARPA 1OSPH 4XBPA 4LSQL 4PIRF 1GHFL 2UY6A 3BKJH 4MXVF 1XGRB 3QUKA 3HUJE 4YDVB 3LKPA 1S9WB 3S34L 3EDDA 1OY3B 4HWNA 3QNXB 1W72L 3RZCA 3KR3H 3MGOA 3PHQA 1OP3H 3G5XB 3QIBA 2V7NA 3NACL 3A67H 3MRKB 4GW4A 4LOUC 2EYSB 5DYOA 2PYEB 3VXQA 5ADOL 4XC1L 2C4FU 1JTOA 3P9MB 1BQHG 5F89A 3KXFB 1VESA 1QFWL 5FIEA 2JJSC 4F9LA 3E3QE 2V2WA 4KUCD 4K07A 3HHRB 4PJEB 3STLB 5KS9B 3HUJB 1T5XB 5DA4A 4C54A 3VWKD 3G08B 3SJVB 4U3XA 3F62A 2HG5B 1CICC 4Z9KB 4XHQA 1U92A 4YDKH 2YPLE 1UCBH 4JVPA 4K71B 3MTRA 1JYNA 4KAQH 2ZPKL 4ZNEE 3PGFH 2W0PA 2C7UB 4PJ7A 4X4ME 5GIRB 1ZXQA 3KPSE 3TJHD 1UA6H 5F44A 3SKOA 1WIOA 1G1YA 4P46D 4UIMA 1BM3H 3KYOB 3ARBD 4JO4H 4OQTL 2FEEL 4ZQKA 2Y06L 5SX5H 3F7PC 4LGPB 4EDWL 5IFHL 1FBIH 4MJ6B 4A2LA 4JZOA 1MH5A 5IHLB 4JKLA 1UFUA 2EYRA 2FH6A 1JV5B 4MA8H 1MHPH 2CDEB 4ZFOA 1K4DB 5IW1B 4Z77B 4KDVA 1LO3H 3BUYA 2A6KA 1H0DA 4NN6C 4WNQB 1DFBH 3NCFB 2XNAA 2VDML 2WQRA 5DK0A 4NUJB 4GAJL 2EC9T 3BW9A 4X6CB 2PYFA 2V5RA 3HPJA 5JHDA 3S35L 1QFWM 4KK6C 1YQ2A 1FYHB 5DGQA 1M1SA 4M5YH 3LKQB 1HQRB 4JFQB 5CKAA 2XG4A 2OI9B 5ADOH 4WV1B 1IGYB 1J1OL 1DUZA 1CGXA 5I1GH 4OUUB 1K85A 4NKOA 1WTGT 2Z93A 5I8CA 3DMMC 2ICCA 4P9ML 4OQ1A 1C5DB 5I1EL 1BFVL 3MJGX 4P23D 2NX5B 9CGTA 3B9KA 2NXYC 4LKXB 4GRLB 4LIQH 4MCYB 5I1IH 1CN4A 2WWKO 4YC2B 4XVUC 5GZND 2Y72A 3J7HA 2UYLA 5B39G 3WUWA 5JORB 4M61A 5CGYC 2WK2A 3WD5H 3BPLC 4Y16B 2CKBA 2VUYA 3AU1A 4D3CL 4HWUA 3PJSB 1KB5A 1A6AB 4YO0B 4ZSOB 5C0AE 2B20A 3MBXL 5J3HD 3T4AB 3QNZA 5CINL 5KSUA 3BW9B 4X6CA 1WWBX 3BP5B 4MDJB 1WBYA 4ZYKA 4C4KT 1YDPB 5E7BA 3Q3GB 5A1AA 2P8PB 1ADQH 3G08A 3SJVA 3RWDA 3MJ9A 4MYWB 3K1DA 4JQIH 1IRAY 3IGAB 4QRRE 4HKXB 1CT8B 4DTGL 4XNMB 1C5DA 3G6JA 4YHZH 3GKWH 2UY7A 3WL9B 5E00A 3V0VB 5IF0A 4QRUA 3MLSH 4XVJL 1UJTA 1WWWX 4ODSH 3SKOB 5DJ8A 4Y16C 4HS6A 4F57L 1MJJB 5BO1L 4KTEL 2Z9TA 3K8MA 4DKEL 1A4JA 1AIFA 3IVKA 4UV7H 5IM7B 3A6CH 1QPPA 1N4XH 3IETA 5DMYA 4KK8C 3MRRA 5FYJD 4QGTA 4WW2F 3RNKB 1KTLB 2FO4A 4R8WL 4O00A 3VXSE 1ND0B 2OR9H 4G6AC 4WDIB 5SX5K 1S7XA 2B4CC 4L9DA 3QEGH 4X8JA 3HR6A 4HFWB 2DJSA 4KV5E 1JK8A 4LIQL 1KTLA 2AXFA 2LTQC 1NFDB 4E41A 1BZ9B 3S88L 2DM7A 4NKMA 2YD4A 1PG7H 5LCVL 3P73B 1TNNA 5DWUH 4FTVB 5DFTA 1I1AC 4JB9L 4OZHA 5SWSE 3TZVD 4LU5L 4MVBC 4QRUB 2VZUA 1BF8A 4HIHB 5EFIB 4MXWL 3B4NA 1WGOA 3AS3A 2Z4QA 4XAKD 4DKEH 5IFAL 1ZMYA 3QJHB 3ARGA 1UXWB 1T1WA 3RAJL 1JRHL 1P5VA 4U7MA 3SGEH 3OKEB 5C07D 1A3LH 1JBJA 3EYOA 4R26H 4YHZL 3HKFA 3H2WA 4JRXA 4O5LH 1NCAH 3RX7A 2AQ1A 4P5TA 5GGVH 5FHAH 3EO1B 3PJSA 2CD0A 3FFCD 2MSPA 3KLHD 2NPLX 1BZ7A 1GGBH 2OR7A 4Z7NE 5HVFB 3GKZA 4LSRL 1U36A 5DEGB 2ZSWA 3DV4A 4WEBH 3GGWB 5ACLA 3ECBB 3W5MA 3CFDA 2HN7A 5HGDA 2PW1A 1H3PL 1YMMB 4JFEE 3QPQC 1YPZA 4I2XE 1OGTA 1KCLA 4GH7B 3TBTA 1DJSA 4Z7WB 4YX2H 3FQWA 1LDPH 4C56B 5JW4R 3UJTL 2ENYA 3EYFA 5EN2A 5L2JA 5EWIH 1CL7H 3PV7A 4JY6A 1L9NA 4NKOB 1EK3A 4RA3A 5GS1B 3DUUB 4W81A 1M7IB 4LNRB 3MV8D 5JIKA 5DURB 3SOBL 1H3UA 2BOCA 2RAMA 1YNLL 1BIIA 3WKML 3BKCL 1R3IH 2DM3A 3UEZA 2ZUUA 1CS6A 1YYMH 3H7BB 1AHWB 1WWAX 4OCNC 4OCWH 4P59H 4JFOA 5LGHH 3WLWD 4XCYA 5AG9A 5DJYB 1MOEA 3VRJB 3BQUA 1UWXH 3ELAT 4IRJD 5TE7H 4AJ0A 3R1GH 2DQHL 5INCB 3IAGC 4IOFD 2HTLD 3LQAC 5E8NB 3EDFA 2NY3C 3BZEA 5GJSL 5D7LB 5ESAB 1UADC 3PG2A 4OFPA 4RIRA 3ZKXC 5IVXB 3O6FC 3JWDC 4I0CC 5I0ZA 2MJWA 1EJOH 2P48B 2YN3A 1EUTA 3V8OA 1RJZA 4PBXA 2VL4A 2EEAA 2QQKL 4F7TA 4MNGB 2HFFB 3PWPB 4ISVA 2KUTA 4TQEL 4XC1H 1I1AD 1KPVB 3D2UB 3HNSH 2F53B 2J88H 3QDJA 4XP9L 1JGVL 2NY7L 3GO1L 5DT1H 3GIVB 4FQCH 3QI9A 3T0ED 3VXRD 3ARDA 1DBAL 5CD3B 3R06A 5DMJB 3EO1A 4XXDB 2PETA 3MV11 5IVZA 1FIGL 5E2JA 4NQXB 4YHLL 2KQNA 3TIEA 1N59B 3HMWH 5SWQB 4XNQB 4O2EA 4Q2ZA 4OJFL 2LE9A 3LOWA 1FSKB 3LN5A 1OLZA 1T0NB 5HYQB 3C2AL 4WWKB 4YHYB 1TJIH 4OIAA 3UBXB 3LD8C 5BZWA 4OKDA 1F90H 5FK9B 2EE9A 2M26A 2GI7A 2JJUA 1LEKA 3D85B 1T0NA 4YIQA 2Z8SA 3GSWA 4P4KB 4XTRD 3F7VA 5DJXB 5TE6H 4Z8FL 1J0KA 1QO3A 3CVIL 5CS7A 1PAMA 4G8EB 2ARWA 3EOAB 3U4EA 3QH3A 4Z0XA 1WWCA 4LKCA 1MWAA 4QNPF 1NPUA 2CLZA 2R1YB 1YC7A 1EEUA 4LLQB 3O3EA 2IALA 3QZWA 2HVKA 4Y4KC 3DNKA 4HK3N 1WT5A 3NFPB 3QEUA 5DMIL 5FGBC 2E7HA 4ZUUA 3RIFK 2NXZD 3PP4H 1ZSDA 1X5XA 1KNOA 1XF3B 1FVCA 1OLLA 5ENWB 5B21A 1NAMB 4TOYL 1KV3A 4NCDA 4X4ZA 1GJIA 1PZ5B 2FJFA 1DBKL 3TV3H 1F3DH 2CXKA 1MQKH 4FQXD 1AY1H 4M93C 1H15A 4FZEL 5I75B 2XG5A 5ICXB 1SEQL 3ECBA 3I2CH 5I66A 3VFNB 4JFXA 4P2QB 5L8JB 5CEXA 3MRDB 4J6RL 3NFSH 1JNLH 2D4FA 4WFEE 1X5JA 1F13A 4JFED 5IW6A 4G6FD 3DUSA 4MZ2A 5HHPA 5F88A 4PR5A 3GSWB 4P4KA 1S9XB 5H94A 3ZHLA 1NGYB 2I27N 1GOFA 3EYSL 3V8CA 1X5LA 4N0CD 2AABH 5F7DA 5MENE 3U4EB 2EH7L 1LEGB 4F7TB 4PRHB 4D0BB 12E8L 2BJML 3RDTC 3TIDA 4NPYB 4QWWD 4YAQB 5GGTL 4R4FL 3STZB 1R0AL 2G5RA 4LRIA 5L8KB 4PJDB 1FFPA 1E6JH 3QEUB 3QG6A 4AM0A 1NUFA 3S36H 3L3JA 4B7LA 3C5SB 5DHXB 1RZ7L 1GC1L 4MVBD 4QHLA 4Y1AD 5FGRA 2C3XA 4JQVC 3K8LA 5FA4A 3EOBB 1NEZB 3MODL 2B7DT 3GMQA 3QAZC 3C60B 1NEZG 3NZ8B 4JANA 4YK4C 5JXAH 1LDSA 4OCLC 4NOFA 2X70B 3O9WA 3WO3B 4YHKL 2OX5A 3P4OB 4X6DE 5DJYA 3ROOA 5DURD 4HT1L 5I1CL 3P0YL 35C8H 4OT1H 4NRZB 2O93L 2J8HA 5B38B 5ALCH 1VFAB 4ZUWA 4OLYL 3VA6A 4JKKA 4JY5L 1XCQA 1CVSC 3WHE0 2V17H 4FQHB 2QHRH 4WHYH 2OZ4L 4L3AA 4YPGA 3UPRA 2PN5A 4PJXA 4LRNH 5F97E 1VEOA 1IM9A 2ICEA 4RRPA 2GK0A 3MRHA 5HHVH 2WBJC 1VGEL 1YPZF 3QCTL 5AWNH 5JDJA 4CMMB 5JOPE 5BO1H 3AUVA 1D9KA 1OF2B 3CXDH 3GI9H 3FB8A 3ARFC 3RHWK 3MR9B 5CBEB 1OM3H 1NBZA 1AR2A 1S5HB 1T0MB 4KDTC 1HQ4A 3ZE1E 1RZ8A 3QCTH 5LKNA 4P2RE 4OSUL 3TYFA 4JCMA 3LRHA 4D9LL 1LHZA 2EH8H 5DC0A 3MACL 4NC1E 4D94A 3JTTB 1WZ1H 4M43H 2YOCA 3QHZH 3TIEB 4ZUSA 1HYSC 2NW3A 4IRSD 3HE7D 4QCIB 3ILPA 1MAML 4P5KB 5I1KH 3DUSB 4S1QL 2BRQA 4DKDC 3QPQD 4R0LC 2R2HA 4LARL 3WS6C 5EN2B 2WBKA 2EEDA 3VD3A 5E9DE 1G7JA 4PJAA 1QSFD 4Y8DC 5FO9B 1K4CB 3CXDL 4PREA 1ZEAH 5I1LB 1CIDA 4Y4KA 2Z8WC 5F9OH 1QFWI 5JQ6L 3UROR 4HUVA 4AIZB 1MRFL 4Z7VB 4ZPVB 4NQDA 3MUGB 2HVKB 1OAXH 3VDBA 2GSGB 1ZE3C 3CFIC 2CGRH 3QUXB 4HKZB 4YDVA 4M3KB 2ITDA 1UWEL 2VWEC 3OTTA 2WW8A 5CEZD 4I48A 3O4LB 2EDYA 3QDGA 2XNAB 4Y2DC 3MV01 4OCYL 4XZUA 4ZO7A 4N9OB 4YZFF 1U3JA 4NQEE 3L7FA 5K9OA 5D93B 3DX6A 1MI5D 4ZSOE 1RJLA 3O8XB 1OGTB 5DK3A 5BRZB 1HH6B 1G9NC 3N85L 2F58L 1B88A 5GRUH 1WAAE 3W0WB 2DL9A 3LEXA 3MFFA 2NY5H 4M7ZC 1A1MB 3LH2H 4H5SB 4OFDA 1EBAA 4XP1L 3GM8A 5TQ2L 1WT5C 3RI5K 2DQDH 2XTLA 5GIRA 5GS0L 1U8IB 2AVGA 5SWZA 1YEIL 3CX5K 3RL1A 4WO4B 1LGVA 3C9NA 2MPAL 1YJDC 3EDKA 3VFVA 1JWUA 2FO4B 5I19L 4XX1E 1BQSA 4Y2DA 2VE6B 4MWFB 5ERWA 3PWLB 2YPLD 4HMDA 5L6YL 4WO4A 2W9LA 2W07A 1IM3A 5FV2A 3WIHA 4CVUA 1NDMB 1C16A 2KH2B 4L8SC 1FNAA 5SWSA 5ADPH 3JV6A 1VERA 2XKUA 1NC2A 5TF1L 4AL8L 5L0QB 1QHOA 3TWCH 4DJMA 3MXWH 1ZK9A 4FXKB 2BERA 4PJFF 1NCWH 1DBKH 4GKSB 4GLRH 3OKKA 4FZ8L 5D7IE 4ZTPH 4FFWD 4PJGB 4HIJA 5EZJA 2AI0L 4S10A 4KKCC 1JGUH 5DZOA 1UXWA 4XC3L 4V1DE 2ZOKB 5IOPA 4Y89A 3ETBF 1ZTXL 3S5LG 5FM4A 2ICWB 2MPAH 3TT1L 4M4RA 2O5YH 3W81A 1TZIA 4HUXA 3VG0L 1AXTH 4HF5L 5EC1B 2FBOJ 3GEWB 3QIWD 2VLKB 4H1LA 4IJ3C 1MIEH 2R69L 1CLYL 2LAAA 2ZOLB 3IB4A 4GRLD 4XBGB 4XPFL 5DUBB 5E00B 5IF0B 3VFOA 1EEZA 4PUBH 3SGDI 3VGDA 4KDTA 3VXTB 1JV5A 2DN7A 2H6PA 4XHJD 1ZANH 2I9LB 3W5NA 3DROA 4UDTA 5DD3L 4KKLC 2ZWLT 3MJ8A 5F1NB 4UNVA 4MLSA 5F9WB 5DFVC 5A2KH 5C92A 5ILTH 5IBTH 3GSXB 1P53A 1FORL 1YY9D 2L7UA 4PGCA 5A43C 3V6FB 1A64A 3C6LC 4WFFD 1IGYA 4PJCF 5DD1L 4JPKL 2FGZA 4HBCH 1K5NB 4NSKB 1U92B 1Q72H 2JK5A 3T2NH 4LMQI 3ARBB 5C0CD 2EXYC 4P46B 2VE6A 2R4RH 1XGTB 2DBLL 1LK3H 1AQKL 1ZS8B 2F8VA 4QT5A 5JOFA 3R0MA 4RAVB 2DIBA 3ALXA 4PLKD 4G9FE 1CXIA 3GMNB 2GTWA 1QBBA 1UEMA 4RAUB 4F80A 1ERNA 1KCSL 1YEFL 3MNVB 4QXWA 4KKCD 1QSEB 3OMZA 1DANT 1EFQA 2YA1A 1C8PA 2GFBA 1WCBB 1IKNA 3ULVH 3MACH 4YWGH 3CSPA 2J5LC 3EBAA 5L2KB 3UTSA 1HH6A 5L0QC 1W72A 5JOEA 4I3SL 4YQXH 5JXEC 4UOW1 2AEIT 4I4WA 5EBWA 2YKLH 2BFVL 1T4KB 1TJIL 2C3VA 1ZLUH 1YEDA 1JHLL 3GMLA 2GIYA 3U9PL 3WJLC 1LO5B 5CEYA 3B2UC 4P49A 4YDLC 1JPGA 4PPTA 4JDVB 1HHKB 1JNHB 5IGXH 2AJUL 1Z0NA 1AIFB 4X6CE 3IVKB 5C2BH 2CH8A 1KJVB 3FO2A 1EVTC 3U0TB 3D18B 4M1GL 5IR1B 3O3UN 1FH5L 2DQJH 2B4CL 3LV3A 1FNFA 1WITA 3SE4C 3WFHB 1S7QB 3HUJF 2IQ9L 4NC1C 4WWKA 4PJ5D 5GGRY 1AR1C 4JFHE 5FGBA 2EDXA 1H3PH 3WN5A 5IB4A 5KSAB 4R90L 3BHBB 3QULA 4H0GA 1N5YH 3GRWL 35C8L 3MO1B 3TPUB 1R5IA 3BISA 5J1SC 3NIGF 1KYOK 3QJFB 5F6IB 5IIEB 1I75A 2YZ1A 5C0FA 1JHLH 4G7YL 5CEZL 4LKCB 3QIUA 5IW6B 4W6WB 1SYSB 4KJPC 1D5BA 1JFQH 3PWVB 4JY4A 4ZOAA 3O41A 1KPVA 3D2UA 2NXZB 3NH7L 4IRZH 2VLRB 4MXQC 3UZQA 3RQ3A 3EYUH 4NPYA 3REVB 1T04B 4NDMB 2K9UA 4UQ2B 2QSCL 4JN2B 5ANMB 12E8H 1VEPA 3SE4A 5IESH 5H37H 3MLSL 5MI0B 4PV8A 1FG2A 2PXYA 2EDOA 4BFIB 1IBGL 1NGZB 1S7TB 3WIHL 3UTTB 2B2XL 5E6ZA 4DGVL 5DEZA 4F37F 2DQIH 2HFGH 1EVUA 5IHUL 2JF1A 4UBDC 4OM0L 3MLPA 1LEKB 4X9GA 3KPSA 1KIRB 4WW2C 3TN0D 5A2JH 3OGCA 2DQGH 4OZIE 5ICYA 2D7OA 3RWHA 3I02B 4GRLC 4LVNB 4U49A 3TNMA 1CR9L 4XPHL 1RIUL 2AK4A 3T4YA 3UDWC 4P2RD 3TBYB 1D6EA 3DMMB 1IARB 5F7DB 4BFBD 4AENA 2LABA 1ZLUK 3QFJA 2EC8A 3P11L 4R96A 5F6HJ 4I8DA 4NN5C 4LQ1A 5J9PA 4G6JL 3RX8A 2H2SD 1D6EB 3DMMA 3THMH 1AGFB 4G8EA 3QI9B 4JFYA 1J12A 2HFEB 2B2XH 4Z8FH 1PG7W 2VDPL 4KGLA 3VXRE 3H3PH 1YEGL 4JO3L 4PGBA 2D3VA 4QHMA 4D9QD 3TFKC 5HHQA 3LN5B 2A73A 3LKRB 4RFEB 2ZSWB 3DV4B 4LLYB 4HMEA 3QG7H 3UZVB 1Z3GH 1F3DJ 1F6LL 2FL5B 1MIML 1ZLSL 3M45A 4OGYL 4Z95H 5ESAA 4M7ZB 3P9MA 3IJHB 5F89B 3MLRL 5GZOD 3I50L 1D5BB 2N4IA 3BGMA 2P46B 4DCQA 4X9BA 5DJ6A 1P7QA 3I9GL 2WBWB 2CIIB 3C5SA 3WFDH 1E28A 4O2FA 5IQ7L 5HDQH 4XB8A 1GZPA 4BZYA 3P77B 1HZHH 5MEPB 5JLZB 2GT9A 2H32A 3JTSA 5EUOF 4D8PA 4RGMC 3QUXC 2B1AH 2ZCKH 1IT9L 3BO8A 3CH1B 3OX8A 3SDXA 5BMFH 4DKAA 4ODSL 4X8JB 2HTLC 1NEZA 5C0RL 1FFQA 4OLZH 4KROC 4YE4L 1X5AA 3U7WH 4FQJL 4NNXB 2YD2A 1RK0B 5FK9A 5EZJB 4I0PD 3S5LB 1ADQL 3QR2A 1T22A 3WNNA 4OZHB 3MRIB 4P2OB 1P6FA 3HMXL 5CBAB 1F3RB 3TCXA 2F58H 5E9DB 3ULVL 4P57B 5C07B 2Q76B 5SV3A 1P9MC 5I1DB 4N8VA 3UTQB 2F19L 2DL2A 1J5OH 3AGVA 4HPOH 1ITBB 4PRID 3LKOA 5CSGA 3UTZB 4LGRB 5HYJA 3GM0A 5CZVL 1BQUA 2F5BH 2DAVA 2P24A 5C08A 1MLCA 1EHAA 3UTQA 3R1GL 3FZUD 4XCFH 2BNQB 3JWOL 3RJQB 1A14H 3ULUE 4Q97A 5HPMA 1HDMB 1MCFA 4NN7C 4UILH 3B5TA 5I1HL 3FMGL 5F9DC 3UP1A 3CGTA 1YPZB 3QXDB 1MRDL 5E03A 1DLHA 2J8UB 4PJ9D 3REWA 3T0BA 3OL2A 4GBXB 3B9KD 2ICWI 4GW5B 2A2QT 4H0HB 4EN3B 4QKXB 4OLWH 4NHCL 5EUKA 3KLHC 1A8JH 3PL6B 3MCLL 3O6KL 4P3CH 1RUAL 2I25N 4Z0BH 3VH8A 1CL7L 4EKXA 4U1SB 2IANE 4HJ0C 1PX3A 1ODAA 3VXMB 4P23C 2X4RB 5I73B 4E5XA 1VPOL 2DQUH 1JRHI 3HRPA 5SWZE 2W9EH 3QDME 4JPWH 3OGOE 4WCYL 5T3ZE 1ZKAA 1BF2A 1HXYA 5F7FA 4EDWH 5IFHH 2EC9U 3C60C 2EDKA 1RK1A 4K71C 1NCCL 2QL1A 3LS4L 1S7QA 3B8YA 4PUBL 3QPXL 4X99A 4YR6B 1GGBL 1UM6L 4HKJA 2UVFA 4HUMB 4QXUL 3OKOB 3SDCD 1QACA 4PGDB 5DRNA 3T0DA 2MQCA 4EI5D 1JHKH 2X4PA 2BRRL 4KUZL 4PBWD 2YK1L 1S7XB 4RBPH 3KS0H 2NY3B 1SY6A 5FGCE 1GL4B 4KJQD 2ZOKA 3T0EE 2FB4L 1EUUA 3RVUD 2B1AL 5TGBA 4Z76A 3GSNL 3QFJE 4M7LT 4RGNE 1IGFH 2HWZL 4GAGL 4X5WB 5IBUB 1YEKL 3OXSB 1ACYH 2C7UA 2DWDA 5F9WC 1FNSL 1G7MB 4TQEH 32C2A 4Q9RH 4MS8D 3HZKB 2ATPA 2R9HD 1QLRA 3OB0H 1U0QA 1GOGA 4LLVB 2HRPL 5EIIA 1F4AA 4MD5A 2XZQL 1IFHL 1BOGA 4KRPB 1BWWA 4MJ6A 4EDXA 4G6JH 3C5ZC 2JELH 5B8CA 3U30C 5J56B 5EZOL 3MRJA 2KBGA 3K7UA 3FT3B 3MLYL 4CNIA 5FYKD 1NCBL 3VXTA 3W9DB 4EOWL 4UIKL 2XFXA 1OGAB 4HH9A 5K9KA 1QBLL 1NGWB 1AXSA 1JI2A 5HHME 2IAMC 3BPOC 2UWEB 1G7PA 4MHHI 3ULUL 4AK1A 4XB7A 2CKNA 5CJQL 4XNYH 1EIBA 3QQ3B 1OTUD 3FFCA 4OI7A 1K4CA 2P5WE 2DLFH 3VI3E 3RTQB 1P6AB 4WJ5A 1WEJH 1MCDA 2A9ML 5FO8B 1NLBH 3ZKNC 5GSVA 4JRYE 5EU7C 3INUL 5E94B 4G8GB 2HN7B 5HGDB 2FIKA 3U7YL 1XT5A 3MLVH 2V9QA 1P69B 1WFUA 3QEQD 1RMFL 1TQBB 2AEPH 3L5XL 2AXGB 3O2DH 1BD2D 2F54A 2R39A 2VYRE 4P5TB 2IG2L 3KXFD 5TQ0L 4B0MM 4X4YB 5I1AB 1GXEA 3CDYA 1UB6B 3EO0A 1P2CA 4JLRB 2HFGL 5IHUH 1LWRA 4FABL 5BRZA 3NOIA 1RURL 2E27H 4ZOCA 4QF1A 5IBLD 1A7RH 2X4TA 5L8LB 1J7VR 1C1EL 5CEZH 4PB0L 4WI8A 5IEKB 4F9PA 1T3FA 4U6XB 4NKIH 3PABB 3QQNA 5C7XL 5DJ0B 1EX0A 3C5ZB 4LLMB 4XAKE 7FABH 4U0RB 3U0TA 3JVGC 1MWAL 2Z31C 4LPUA 4UAOB 2DM4A 4HS6B 1ZHNA 4RAHA 3AS1A 4GKZA 2HT4D 2WIIA 3O3BA 4OZGA 4HGKC 1BREA 4HWBL 1OTSC 1JIBA 4HCRA 1MLBB 2VR4A 4Y2DB 3KDMB 4Y0GA 1S9YB 2BVPA 5ITFB 3VFWA 2R0WL 1RVFH 5DVNA 4EVNB 5C0GB 1URLA 2PO6B 3OPZL 3RKDC 3KGRA 4RISL 4LPVA 1Q8MA 1J11A 3CFKB 5MEOB 3KDMA 1UACL 4M48L 3PDDA 4CW1B 5I30H 5IMOB 1T5WB 4WUUD 2YA0A 2Y23A 4K8RL 2BHYA 1PZUB 1N3NB 4V1DA 5KJRH 3E3QC 3MRDA 1F2XK 1NGWA 4I3SH 4YQXL 1FLRH 3GSQA 2OMNA 2AKRA 3D3VB 5FM5O 3MBEC 1FG9C 2BNQE 5F7UA 1IM9B 3H0TB 3VXRA 3WN5C 3UYPA 3WFEL 2DYPB 2YWZA 4MJIB 2OS7A 4DUXA 3N9GH 3UYRL 2P8MA 2EZ0D 1OOAA 3DTXB 4X7SH 3VXPA 1ZGLB 5GZNC 3LPGA 3W0WE 3C08H 1J0IA 1MVUA 4G8FA 2AW2A 5AD0A 3RWCB 5F7EH 4GW1B 1CXFA 1KT2B 4XNZC 5CIPA 3HFMH 4D8PB 3BESR 1LE9A 5FA4B 1PVHA 5INDB 4U2ZA 4OZIA 5D2LE 1ZGLM 1BMGA 4NC2B 3Q6FB 2P5WB 3BDYH 2Q6WB 3RWFB 3MRQB 4MNQB 1ZA3A 3LKNB 3OXRA 1MEXH 3ZE2F 4WW1A 1H8OA 1FDLL 4I18A 3LKRA 5FYKL 4D9QE 2FJGA 3TVMC 25C8H 4YLQT 1AH1A 5F3HA 5KSBE 3GSVB 3ZKMD 3CK0H 4LFHG 2R2BB 43CAB 1CGTA 3BFOA 4OCRH 3V4UH 3ZTJH 4OM1H 2ADIB 2YRLA 4ODTH 1S9XA 4LEXH 5H94B 2Z93B 1QFPA 1AD9A 1WZLA 3QNYA 2Q76A