1IKFH

A conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
228
structure length
228
Chain Sequence
EVKLVESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQNSEKRLEWVAFISNGGGSAFYADIVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCTRHTLYDTLYGNYPVWFADWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/immunosuppressant
molecule keywords IGG1-KAPPA R45-45-11 FAB (LIGHT CHAIN)
publication title A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 1993-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfH01
5B39A 5FHAL 3TT1H 3HE7B 5BQ7B 5JR1H 1REIA 4KRPD 3W0WA 3OTTA 2E7LC 1DN0B 2FJFB 2B4CH 4UINH 3OX8B 5MEPB 4DFIA 4NBZB 1UFUA 4JFQA 3QUYD 4DCQA 3F7PC 4GRWE 4LKXA 3FMGL 1E4XI 4NUJA 4KJWC 5D7LD 5JIPA 1XZ0A 1K2DB 2XTJD 4KRNA 2A0LD 4J1UA 3QDGB 2R4SH 2YRLA 3ETBF 1AGFA 3HRZB 3B8SA 2F74B 4JFEB 3DRQA 1DVFA 2APFA 4M5ZH 2QADD 3B6SB 3AM8C 1CT8B 2X4QB 3GKWH 3TJHD 3IDNA 3T1WA 2N7AA 1CLYH 3T2QA 2CRMA 4GRLB 1T0NB 4K7PH 5HHNA 5BVPH 2GHWB 5HY9B 4X7TA 5F7KC 1UM5H 3QI9A 4OCXL 2YD8A 1LO3L 2BNRD 3BAEH 2MKWA 1HINL 4KVNH 1CR9H 3VD3A 3KLDA 3KXFA 4HT1L 3LIZH 4CNIB 5KSAB 4Z7WE 3V4VH 1FFNA 2PYEA 3EO1A 5EORH 1XF5B 2BVQA 5IROA 1ZA3A 3L3IA 2OJEA 3IJHB 2JJSC 4R0LA 5EU7C 3TA3A 4Z7QE 1M7DB 3RX8A 5EZIL 3W5MA 3T3MF 3NFSH 5K9KA 1B4RA 4PRDA 5MENA 3IRPX 4DW2L 1F3JB 3STBA 3EYVA 1SEQH 3C6SA 3NA9L 4ZAKC 5F89B 4OV5B 1S7QA 4NBYB 2Y7QB 4PUBL 4WFFE 5EBWB 3VXOA 3C5ZD 3DI2B 5EU6D 3VXUE 3HCVA 3MLSL 4JHWH 1YEGH 1WC7B 5GJTL 1XF2B 1QSED 2Q8AL 4QRSA 3QBTB 4HS6B 5JHDB 3GBLA 2X44D 1A7RL 2IMNA 3LKSB 4URTB 2DBLH 3LRHA 1F42A 3WBDA 1VKXA 1HHIA 4EI6B 1P7QB 1X5GA 3INUH 1KJ2L 1ZK9A 2AJUH 4DK6A 2R1XB 1FE8L 3DMMA 3FO9A 3QCTH 4QEGA 4WI3A 5D2LA 1OAZH 2P45B 5FA3A 1BGXL 2CK2A 3CFEB 5BO1H 3KPOA 4P46D 5E2VL 3RKDC 4F2MB 1FNSH 4JZNB 5C0BE 5EBGA 4ZNEE 3LKRB 3D69A 2X2YA 2XNAB 1R3JB 4UBDC 1L7IH 4Y1AD 3FO1B 1W72L 4U1GB 5E99H 3QQ9D 4L8CA 4YWGH 4LKCA 4PJ5E 3VU2A 3MREB 4L3AA 2DIJA 5SX5K 1S5IL 5TE4L 1HEZA 4HIIB 4JHAH 2W9EL 1BJ1H 3CX2A 1A21A 1VADA 4HUUB 1NBZA 1IM9A 4G3YH 2VKWA 4JFDA 5DA0B 3UTTB 5F21B 5DDHB 1J11A 5DGRA 4R7NA 3PWUB 5DTFB 4PJ8A 4J3UA 4D3CH 4HJGA 4UAOC 4QRQB 4YNYA 2E6JA 1VGKA 2ATKA 2HKFL 4XCEA 1UGNA 1YY9D 1V3MA 1A7PH 1ZVSA 4OI7A 4LSSL 2BSSA 4PJEA 4XPBH 1CLCA 3U0PB 4OZIA 2FL5B 3Q1SH 3EFDH 3PHQB 1NGWA 1G9ML 2R15A 1MF2H 3SGEH 5E24E 1FG2B 3RIAK 2EYTB 1F3RB 3G5VB 4P5MB 1JCKA 1ACYH 1B0RB 4X5WB 1IEBB 4N0YL 2DQCH 1INQB 4WW2A 3C6LD 3GNMH 2CD0A 4EXKA 1DQDL 3MJ9L 2FSEB 1H15A 5EBLA 4KUCD 4KDTC 1BX2A 5CEZD 4LCCA 4NSKA 1PLGH 2ZCLL 5HDBE 3SDYL 1JHTB 4JO1H 4GRMA 2JJWA 4BK4A 2JELH 1JMZA 5B3NA 1T22A 3HPLA 12E8L 4YHKH 3QA3A 1F6AA 4X4YA 3FOMB 3U6RB 1IC7H 1U8IB 3TH2T 1YEHL 3I85A 2CSPA 3D2UB 4LVEA 1MJ8H 3DETD 3FB8A 4PJDF 5LJYH 1S7VA 4XC1L 2ZWLT 1JHLH 3MRFA 3BX7C 4RGOL 5ACMA 2Q7NA 3SDXB 3QDGE 5E9DB 3ULVE 3QZWA 2DQDL 5IQ7H 3HMXH 4HSQA 4MVBD 5D9SB 5L8LB 3D25B 3P73A 3JBG7 4XI5C 4P23A 4JFEE 5LBSL 2RBLA 1OT2A 4L8DB 2R69L 5INDA 2AEPH 4HIXH 2D7MA 5F7DB 5CLWA 5ESAA 4XPGH 1QFOA 5E6ZA 2BY1A 3VXRE 1BQLH 2AABL 4NQCD 5AWNL 4UDUB 5DQDL 5GGRY 2DQEL 3OKEB 4MNQB 4JVPA 5F70A 4GXVL 2A73A 3KHOA 3OR7A 5D7JD 3BH9A 1NEZA 2A74A 3WYRA 5D7IA 5E00B 5C07D 5IB2A 4XMPH 1YNLL 3TV3L 3BRGC 5FHBH 3N1PC 1AR1D 1RUAL 3S36H 4I5BA 3AMLA 4ETQA 1QRNB 5HXMA 1P1ZA 2PYFA 3CFDB 5CJXC 5T1LD 2VC2H 5B8CA 5FK9B 5DVNA 2BDNH 1Y0LA 4P4RB 4BSWB 4L5FH 3FFDA 1AE6H 2VDRL 2CXGA 3IVKA 1HWGB 2UVFA 1NC2D 1R5VA 4RA3A 5C6TH 3W2DL 1MJUH 3S35H 1OTTC 3BPNB 5KG9A 3UPRB 3H0TB 1A4JB 2O5YH 3U30B 2E8ZA 4U6HB 3D85A 1YMMD 5I74C 4K7PY 3BP5B 3CH8A 3IDJB 5EU3A 1S9WB 3S3PA 3TBWB 1U93B 2VDQL 2DDQL 4NGHH 5AD0A 1C5BL 3JV5A 2WSKA 4JN1H 1UCTA 2PR4L 3VGBA 1BZ9A 1EGJH 1MCPH 1W0WB 2IH1A 3O4LB 4ZOAA 4NKDA 5E7FA 2F8OA 3GB7A 5GS2D 4XVUC 5BCAA 4JQIL 1BQSA 2DOCA 1GC1L 3PGCB 1UA6L 3LD8B 1R24B 1EBAA 2QV2A 4POZD 1HSBA 3P77A 3FB6B 3MLRL 1HNGA 2NPLX 4HWNA 4PJ9C 4HZLB 1QSVA 3JWOC 3PHSA 3O3DB 4AM0A 4HULB 1LWRA 5KJRL 4MNGB 3RWIB 3X11A 1BJ1J 2H32B 5IB4B 4Y4HB 4LAQH 4P57B 4MD5B 5KSBA 5HHPB 5C08B 1GIGL 4LRIA 4HUVB 4G8IA 2MHAA 2FDBP 2Q3AA 4MA1C 1R3LB 1DQJB 3LN5A 4KVCH 3LKNA 4G6JL 3UTTE 2NNAA 3RWGB 4ZUTB 2ZUYA 3H9SA 4ZFFB 4IRZL 4EBQL 1JZ7A 2WINA 1YEFL 4YHOL 4L8SB 5F7LB 1FZKA 3A6BL 2AJSL 1RJLA 1D6VL 1ZEAL 1U8LB 5I1CH 4HS3A 2D3VA 3QI9D 2YPVH 4FNLL 3VFRB 3MGOB 4HUWB 1OOAA 4IRJC 5GISH 4BFGA 2P8PB 5L7XL 3MBEA 1DEDA 1S7UA 4OGYL 3Q5TA 3IU4H 5D1QC 3BP6B 1HHKB 3QUMH 5AAWA 1CDGA 3C2AH 5E94B 3EYOA 4OD3L 3KLAA 3QFJB 5EO0A 4QHKJ 5FOBA 4B50A 3TH3T 1X5JA 2KZWA 2V6HA 3W9EB 1IKFL 4LL9A 1MFEH 3CSYB 4EVNA 1CXLA 5EO1B 4XXCA 2NY1B 4EDWL 1I9RL 1C16A 1KF9B 3MRNA 5HGDA 4YUEH 1U2HA 5J12C 3IGAB 1MELA 4FQLH 1NFDF 2IPUK 2CR6A 4LLDA 1ZTXH 5IVXA 5TE7H 1XT5A 5ESQA 1I7UB 1QYGL 4XBEL 5K9QG 2X4RB 1DQQB 1VFAB 3RKPA 2IPKA 6CGTA 5F3HA 3V0WL 4QRRD 4FMFA 4S1DD 3MLVH 2NMSA 1WIOA 1PBYA 5CINL 3HR6A 2XFXB 3MLYH 2UWEF 5CLTA 5DJ0B 1UWEH 3S5LG 4JFYA 1AFVH 4YGAB 2GI7A 1PYWA 5LXGL 5FB8B 1KPUA 1A14H 3PWPD 4L4TB 4MNQE 4U1IB 3PP4L 4OZFH 5DUML 1L7TH 1VERA 5DD5H 2NY3B 1N2RB 1NMBH 2IPTL 2H1PH 3FQNA 4NM4L 3G04B 1F4XL 3RPKA 1G9NL 3VI3F 3UTQA 1FL3A 4GKSB 4H26A 1JGEB 4KK9D 3VXMB 2QTEA 1EZVX 4U49A 5BV7H 1OB1A 1NPUA 2HKHH 4OJFL 3BJ91 4G8FB 5BJTB 1F11B 2P5WB 1LE9A 2HRLA 1FJ1A 3EHBD 3DVNA 1BM3L 2O5XL 3GIVB 2YR3A 4QTHB 2R2CA 1MHCA 2SEBA 4N0CD 4DGVL 1TJIH 4NWTH 1BOGB 4IMLB 3O2DH 5DRWA 2BOBB 3GSQB 1HYSC 4K2UL 1LK2A 3QUXD 4KKNA 4PJGB 2JB5H 5FYKL 3O6KL 3O6LH 1QFWM 5D1ZC 5J9PB 1P84K 5GRVK 4B7LA 2QQNH 1HZHL 2H3NB 3PQYD 2NXZB 2NY6B 4U1HB 1Q72L 2RCSL 4GJTB 4F7EA 5HGBB 2Q20A 3GJEA 3DX7A 3TNNB 4BH8A 1I1FB 1BWWA 3FRPA 2ZSVB 1OP9A 4OSUL 1O0VA 3MRLA 4JZJB 2Q86B 3O4LE 1T1XA 3ZKQD 2GJ6D 3QUKA 4R4BB 2CMRL 1FYHB 2V2WA 1KN2L 4NO2A 4D8PA 4XNMA 2CR3A 1FFPB 4J4PD 2CRZA 2GAZA 1JNJA 3G5ZB 3SE3A 1FV1A 3QHTC 5ANMB 5B38A 4OLYH 4YE4L 4I77L 4U3XA 1KLUA 3WD5H 5F6IB 4PREB 4HWEL 1OSZB 1T66D 4PR5A 4PS4H 2Y23A 4GBXC 5TDOA 4P3CL 3LQAH 3BWAB 4R97C 1C7SA 5HYSA 1IAMA 2XQBL 1XGTB 3EZJB 4MWFA 2EKSB 2UV3A 3STLB 4LLWB 4X6EB 2ZG2A 3TN0C 3DRTA 1WWWX 1YPZA 4IIQA 1YYLL 3EYQC 1EO8H 4K8RD 5BS0D 5I6XB 5JPNA 4XAKE 3MRCA 3HNVL 1IGCL 3VFUB 1YQ2A 2VQTA 3ARGB 5J11B 2GYSA 2XT1B 1PKQA 4QTIL 4S2SA 5L0QB 5A3ID 2O61A 2M1KA 4Z7NF 3P11L 4JVUA 2OSLB 2CGRH 1I3GL 3MOAH 4F9LA 3QFJE 4ONHB 2NY5C 15C8H 5HHOD 4XNYH 2QSVA 4PJBE 3V79C 5E5MA 5FM5M 4BKLB 4GRLC 3O9WA 3QUZB 1DBAL 2VAJA 2HLFC 3MNWB 4LCYB 5DEFB 1MY7A 5KBNC 5I2IB 3OPZL 1LO3H 4ZTOL 2EDFA 1HINH 3S37L 4F7TA 2AJYL 4Y16C 3QCVH 5KSAC 4P9HC 3UTSE 1T2QL 4PBWD 4I0PB 4CMHB 2JJVA 4GSDL 5F8QC 3VWJD 5T3XE 1E27A 1KB9J 3MA7B 3BZ4A 4EXPX 2ZOLB 2BHUA 1LNUB 1F4HA 1Z0NA 4F8QA 4Z0XB 2BHYA 5EZIH 4HFWA 4LARH 4Z7OF 2Z8WC 5DUBB 2DS4A 1ES0B 4P5TD 5DEGB 3NA9H 1JPTL 2ERJB 1FZJA 1RHFA 5K33A 3FN3A 4L4TE 4U3CA 1KT2A 3KPRA 5EC1A 3MLSH 5H35A 1WAAF 4KJPD 4H25A 1U91B 1I7TA 2Z31C 3VXME 1AP2B 4OGXL 4XGZB 2AEQH 2VLKE 1BFOA 1A3QA 1A7RH 1CK0L 3LOWA 3QB7C 2AJZB 1U3HC 1XCQB 2X05A 4QF1A 5CJOL 3H7BB 4YDIL 1QPXA 4PJCF 4WWKD 2AXFA 4FTVA 1KJ3L 3MJ8A 4KHTL 5I66A 1FBIL 1S3KH 1EGJA 1BFTA 1F2QA 2J12B 3VMOA 3GUTA 1F97A 2VAAA 1ZHLA 2X9YA 4PJGE 1JYNA 2LAGB 1FZOB 1A64A 1BGXH 1RULL 1U8PA 5FECB 4HMCA 1ZXQA 5E2VH 4OD2B 4O9HL 5FV1L 3OKKB 5KVGL 1D5IH 1J86A 4U1GC 3KYNA 4LSUH 3CVHA 1KPVB 5J3HC 1MCBA 3C09B 4FXKB 2IH3B 4F37F 4FG6D 3H9HB 1S7XB 3VFMA 4PJAA 2ZOKA 3L5XH 1WBXA 4GQ9L 5IWLC 1OAKH 4HIJB 3V0VB 4ZOEA 4OZGB 3U0WH 4H8WC 1FLRL 4JJ5B 1OL0A 1MQKL 3QIUA 2AXHA 1SY6A 5DD6B 2LTQB 4OFIA 1M7XA 5SX4H 4X6FA 4FFZH 4U1LA 2YD1A 1H8OA 5FIEA 1SVCP 3BISA 1ETZA 2RQ8A 5ANME 2ESVB 3CC5B 3GRWL 3VRJA 4NUGL 3AC0A 1SVZA 3CPLA 3TCLB 2CDEB 4LSSH 1QLRA 2DYPB 1ZHKA 2GTWA 4HDIA 5C9KA 1M71A 1W0YT 3WCYA 1KB5B 1T21B 4MB5A 3WHXB 3CX5K 4KTEH 5JHLH 3HZYA 1JPFB 2JCCF 4X8JA 2OR8A 3K2MC 3QPXL 4QRPE 4N0YH 4MX7A 4HWBA 5JW4R 4X5LA 2FHFA 5DMIH 1ED3B 2C1OA 5EOTB 2FJGA 3V6FA 3P30H 3MUGB 4LAJH 5F9OH 1DQDH 1MLBA 3F8UB 3MJ9H 3QUMA 1GGCL 5CSZB 1OP3K 1AQDB 1QBMH 3VRIA 1I1AB 2WP3O 3HZKB 4PRPB 1NH6A 3HAEH 4EOWH 5I1AA 1MNUL 3PV7A 4HWZA 3GSXB 3IJYA 12E8H 1VHPA 4OLUL 1RZFL 3E3QE 4Y19A 3RVVC 4R4ND 2GFBB 1DZBA 3LVEA 3OKMB 4NM8H 4XC1H 3T0VA 1NFIB 4TQEH 4RGOH 3NPSB 1KELL 4Y5VC 3SJVD 4DVRH 4U2ZA 5D2LF 3IJSA 1OHQA 1P6AB 5C0AB 1X5HA 2IGFL 4U1SB 5LBSH 5AYUL 4AIZA 1LGVA 4M7JL 2Y36L 2VR5A 3IFNH 4JFFD 3QEQA 3FO0L 1I7ZB 1FL5B 1UZ8A 2AABH 4HJ0D 3TN0B 1TQBC 2VLRA 5AWNH 5DQDH 1KCSH 2DQEH 1GPOL 2WIMA 1DVFC 1U36A 3HMWH 4MDIA 4DUVA 4UTAH 1KXVC 3LS5L 4OZFA 5EU5A 2RFXA 2V9RA 1MCEA 3BI9X 4PP1C 1MSPA 3CDCA 3IXTB 4O2EB 1RUAH 2F54B 1X5AA 2EC9T 2Y06L 1UJ3C 4JN2B 4JO2L 4QY8B 1S9VA 4ZS7L 3ZE2F 1FO0B 3SCMB 2ID5A 4YR6B 3AUVA 5DC9B 1CFQA 4R0LC 3BPNC 2BNUA 4MJIB 1I8KB 5DZNA 3W2DH 5K9OA 5IMOA 3U30C 3RIFK 1X44A 3X12A 3EW3B 5HYJB 4OIIL 3O2DA 2A38A 3HUJB 5D1XB 3DX6B 4Y7MA 1CDHA 1MRDL 2LU7A 3TBTB 3C60A 4LSVH 4JO4L 2W1NA 4OFVA 4RMTA 4OAWB 2DDQH 2PW1A 4WW2F 5E2WL 4DKAA 2P5EB 1UYWL 2PR4H 4OUUA 2F53E 2Y6SD 2D9CA 5L2KB 3EYSL 4LVHC 2BNQE 5FKPB 1FN4A 2IAMA 4EI5A 4JG0H 3K81A 1BFVL 2AK4A 1QHPA 4PLKC 1Q0YL 3HPJB 4PTTB 1GC1H 4KGLA 1A6TA 1UA6H 2J8UB 4POUB 1IBGH 2PCPB 3JTTA 4P3WA 2HFEA 1I9JH 1K4CA 3UDWA 5L2JA 5IB1A 5SWSB 4MZ3A 3TBYA 2BP3A 5KVDL 4P2RD 1B6UA 1JV5A 2HJLA 5CJ5A 5KJRH 1EXUA 3LH2L 1XR8A 3ARDB 4OZGE 3EOAA 1MCHA 5EOCJ 4P2OA 5CZXC 5ENWB 3T04D 3ELAT 4N9GB 1ZA6A 2L0DA 3O8XB 4G6JH 5BRZE 4OGAC 4GAGH 4G8EB 5KSUB 2RHEA 2WQRA 3PHOB 2R56L 3SDCD 1KJMB 3IETA 5SWZE 4PJXA 1E28A 1P4BL 3MRHB 5I1KL 1NLBH 2E3VA 1XIWA 4JFPB 5EIIA 3KLHC 3UPCA 1H0DA 3ARFD 4YHOH 5GRUH 3A6BH 4ZXBB 1D6VH 4O51A 2IWGA 4J2XA 1BD2D 3N1QC 3MV01 4JRYE 4KV5F 4TNWK 3EZ8A 4U6XA 3FCTB 2NY4D 3WFHA 4FNLH 3T0DA 3FT2A 4XPFH 4F7MB 1AD9A 4P3DB 3RX7A 5FFLA 1GGUA 3RVWD 1CQYA 1NUNB 5FYLD 4GAFB 3NIGF 4C56E 4MLIA 4Q9BA 5DJ2B 5GIRA 4QOKD 4OF0A 3ZHKA 4KJYA 4X9FA 4KK5C 3C8KB 5F7EL 1RHHA 5BW7A 5CJBA 1F58H 1IKFH 3Q6FA 1UACL 4KRPB 1N6VA 1QUNA 1YMHB 2W0FB 4PRPE 3L95B 4X5XA 4EDWH 1CBVL 2YWYA 4JLRA 4FXLA 4WI5A 3BW9A 2NW2B 1SJXA 1XF4B 1M7IB 1ZGLA 5E8OA 2MQ0A 3BE1H 3R4DA 2FH8A 2X89D 2ENSA 2XTJB 1JVKA 3PJSB 4LFHG 5KANG 2YK1L 1I1YB 1A1MA 3BD4A 3CDFA 5GS0D 2I9LB 3CXHJ 4LPWA 5HPOA 4L4VA 3V0WH 3QDMA 4CADA 2QADB 2VH5H 5K9JL 5EZOL 1INDL 4PGCB 2UY7A 1A7BA 5AYQA 3MFFA 4Y4FD 2NZ9D 3WS3A 5JXEC 2J1KA 3OF6D 1SMAA 2XRAH 3H3PL 5HHVH 5TE6L 4F3FB 5DQ9A 1RJZB 2A2QT 2BNRB 4GW1B 3TJEL 3PP4H 4Q9QL 4ETYA 1A6ZA 1MI5D 5BZWB 2ORBL 3PIQB 2IPTH 4QXUL 2NY2D 4NM4H 2EIZA 5TF0A 1G9NH 4BUGA 5KSBF 3QIBC 1CDIA 4WUUB 5ISZA 2R0KH 2VZSA 3V5KB 1G84A 3CJJA 3CGTA 1JWSA 5K9QI 4XH2B 1IGYA 2BVTA 3WIFA 4Z77A 3ECBA 4PJDE 2QSCH 4H1LH 1TQCB 2O5XH 4N1EA 1XGUB 5JO5B 3T8XB 1OTUD 1MJ7H 1YEJL 2XZCL 4LSPH 1X5IA 3QZWG 3DIFB 4CVXA 5EU6B 5HYJE 1PQZA 5TH2A 3VXSB 5FYKH 1WWAX 3HUJE 2E7CA 1J0YA 4E42B 3MUZ1 4MGXA 4Z0BL 2LVEA 2NXZC 3BZEB 3O45A 3LN9A 5IR1A 1HZHH 3AVEA 3OZ9L 5CHNB 1Q72H 2EDDA 2RCSH 4LIQE 5E70A 4HPOL 4M1CD 3T2NL 4JZJC 3QXDB 2P5EE 3WN5C 3OL2A 1NEZG 1JGUL 1JTPA 3OGCA 5LGJA 5L2KE 5CD3A 1I3UA 4NT6A 1B2WH 5HI5D 3DV6B 3H8NA 2FB4L 1TZHB 1J8HD 3RI5F 1P7HL 1DN2A 4CL7A 3HE6D 2CMRH 3RDTA 5IIEA 1KN2H 3FL7A 2J8UE 4PD4J 1S8DA 4P46B 4JPWL 3SBWA 1NCBH 3VW3L 1S7TB 4Y5YA 3R1GL 5SWSE 4GMTL 4Y1AB 4YE4H 3GMQA 2YUXA 1ZT1B 1AD0A 1JNHB 1VFUA 2CLRA 3I50L 2H9GA 4NFCA 1ZLWH 3IXAA 1N64L 4MSWB 3BQUC 4HWEH 1MUJB 2R1WB 5FM4A 1NAKL 1WEJH 2M2DA 5HI3D 1V3JA 4M1DL 2E5EA 5IV2B 2XQBH 3U4EB 2EC9U 2P8MB 4DN3H 1GHFL 1MLCB 4NQVB 4QWWC 2W92A 3KR3L 4HHAB 3QO1A 2X4UB 3BEVA 32C2A 3GI8L 1YYLH 4KAQL 4PJHA 3L3JB 3MJ9A 5IT2H 4NWUL 2B5IB 4LBEA 1KG0B 1PX3A 4GKOA 2DWEB 4CN6A 3KYAA 2DLIA 4P9ML 3HAEA 4OQTL 2JJUA 4NQEA 4BFBD 4QTIH 2EDRA 1U8KA 1IEAB 3O3BA 3VFWB 4CN1A 4O5LH 5HDOA 3D48R 3VFTA 3M8OL 3V4PH 4UU9A 3MMEB 1MPAL 1E6OL 1A3RH 1QA9A 3K4DA 5D96B 5FGCB 5J6HB 3WNNA 2X1XR 2X7LA 4DZBA 1OPGL 5HTSA 2FZ3B 4IOFC 5LAXB 1T1ZB 2DQFA 1YEKL 4IOSD 4ZS6C 4D9QE 1BQHB 1Q9OA 4NQUA 3RWEA 1CFSA 1HHHB 2HAZA 1LO4L 2OLDA 5DSCB 3OPZH 3IFOB 5ITFA 4ZO9A 1LILA 1RZ7L 1CXHA 3S37H 3TF7C 1LQSR 1MFBL 2AJYH 2AI0L 3STZB 3QH3B 4TUJB 3AAZB 3N1GC 4UUJA 3RTQA 1QR1B 3A6CH 1BLNB 3N85L 5DMJB 3RRQA 1LEKB 3GMPA 4GSDH 4OF3A 43CAA 4GXUN 1NC4D 1FSKC 1RUQH 4R2GD 4CJ0A 2HVJA 4Y88A 1RSFA 3WKMH 2V9QA 4PY8I 4UT9L 4L29A 4PTUB 4I2XA 1H3XA 1KB9K 1UH2A 4ZQKA 3TZVD 5J1AA 3MCKB 1JPTH 1MAJA 4UNUA 1IQDB 2AV1B 5D71L 2VDLL 2VZUA 1GGBH 4TNWF 5C07B 3ES6A 3O2VH 3RAJL 1ORSB 2WLZA 1IZKA 1RZ8B 2NLJA 4WUUE 3I6GA 3DURA 2DQGL 1NFDE 1MAML 2BX5A 4XPTL 2ZUTA 4DOHB 1F90L 1S7RB 1YPZF 2QLVB 4NN5C 2PTTA 4KHTH 3EOBB 2Y9RT 1FBIH 5CGYD 3S88H 1ZKAA 2BXZA 2XXMB 4DZ8B 4GLRI 3S34L 3RQ3A 1EFQA 5EFIA 3WNKA 5DJAA 3VXSE 1RULH 1YMMB 4XVSL 3VCLB 3GMMB 4OCSL 4O9HH 3HI1B 1O7SA 4PJ7A 3GEWB 5T1MA 4YH6A 4EN3D 5KVGH 5DJDA 1OD9A 1CVSC 4XC3L 5I15L 3V7AG 5F9AC 2WK2A 3KPSE 3MROA 2I27N 5DJZB 2C26A 3VI3E 1AXSB 1KGCD 2J5LB 1MIML 4DUXA 4FFYL 1ZGLP 3NCJH 3BVNA 3T4YB 3REWA 1U8QB 3WXVL 2JB6A 3S96A 3LEXA 4PGDA 3OB0K 1MQKH 2FHCA 3WFCH 1NQBA 2NTFA 4LCIL 1KIQB 1J88A 1XGYL 3RUGB 4HXBH 4C55A 5B39B 2KBGA 1W2KT 3FFCA 1IAIM 3C5SA 4S0SD 4YGVA 3UJJL 3GRWH 3W0WB 1VENA 2NZIA 3GMRA 5HYIA 3MRJA 4ZTPL 2I07A 3NZHL 3ESVF 1JN6A 2EEAA 1R3IL 2OP4L 1CE1L 3D3VA 5I9QB 3RGVD 4LKXB 3TO4C 1KN4H 4NUJB 5IMLA 1XZ0B 1U8NA 2HJKB 3QPXH 4J1UB 1MCOL 2CXKA 3L3DA 3BKCL 2A1WH 4IRSA 1AGFB 4S1QL 3FRPG 4F80A 5CP3A 4L4VD 3DRQB 1HILA 1PZ5A 1F3DH 1T83A 2A9NH 2IFGA 4O58L 3OKDA 1E0OB 3O2WL 4M5YH 5J6GA 3B3IA 5GHWL 5HHNB 3QI9B 2L4OA 5GS3A 5DMKA 3JVGA 3JWOL 1C08B 1XGPB 4GKZA 4F7PA 4IIQC 4E0RA 4LEXL 2VXVH 4XHJD 1HNFA 3SDDA 4TVSa 4OLUH 1CGXA 4WUKH 2OM5A 3VE0A 4NRXB 3FT3A 5B38G 1YC7A 2X1OA 3EO1B 2BVQB 5EWIH 4EDXA 1ZA3B 3L3IB 4L8BA 5AUMA 1K4DA 2Y07L 4XP4L 2HJFB 1LO5A 4LIQL 1SYSA 3SDAA 9CGTA 4PRDB 5CEZE 5MENB 2P1YA 2IGFH 1QFWH 3MV7D 4M7JH 1CD0A 2J3SA 3EYVB 3WLBA 4X80L 2J4WH 3WDIA 4XNZB 1NCCL 5F1OB 4O4YL 1HHGB 4KGJA 3HCVB 2VZOA 2R0LL 3VD5A 5HHQA 3RVTD 5ALBH 5I1GL 2OJZH 3O9WC 3TPUA 3LS5H 5ALCL 1P7KA 4Z5RA 1X4XA 1NCNA 3J7HA 4KTDL 1RZGB 2C4FT 4K3DH 5HVHC 2ZUQB 3X3FL 1WFOA 4P2CG 4QRRB 2Z9TA 2JK5B 4YPGA 1N5YL 1L6XA 4Z7NE 3HNTH 1KEGH 1WZLA 2BVUA 3I3EA 2BC4B 3FO9B 2EE2A 3PDDA 1CE6A 1ZT4A 1G7PA 2VLLB 4HH9A 3KPQA 3ROOA 4MMZC 4KZEL 4H1LA 2YD9A 3CH1A 1I4FA 3PWPB 4M1GL 2VSCA 5D1XC 1S7WA 1AXTL 3IDIB 2Q76A 5C0IA 1MHHA 3KPOB 1UB5B 2OS7A 4E41A 3KLSA 1H5BC 1FGVH 1FNHA 5I75C 1NEUA 2MPAH 3CSGA 3F62A 1MRDH 4LLAA 3BIKB 2UZYB 1G7MA 1UEYA 1ND0A 2EH7L 5I76A 1DFBL 4L8CB 4K55A 3DUSA 4LKCB 1QPPA 2VKXA 1MCIA 3GHBL 5T1KA 1UYWH 1NLDH 1JF6A 2DKUA 4DOHE 1HEZB 3LKQB 1A02N 4XP6H 4NZRL 1JNNH 2EYRA 1VADB 1P2CA 2VE6B 1CGTA 1G6RL 1BFVH 5D2NB 3QUXB 3WXWH 1TCRA 4HKZA 4OCYL 3TVMD 4Z7OE 1I8LA 4RX4A 1IGIL 1T7YA 1P69B 5HHXL 4F15B 4PJ8B 4HJGB 4YNYB 5CS7A 2VISA 1VGKB 1WWCA 4HGKC 4XCEB 2EDWA 1KLFA 1CVRA 3PQYB 3EOTH 1ZVSB 2BSSB 1NDGA 1JGDA 1RIUL 4OM1H 4PJEB 5F93C 1PSKH 2VXTH 4OZIB 2W9DL 3SY0A 1NGWB 2XKNA 1WAAE 3BUYA 3SHSA 5F96H 2WZPD 5EUOF 1GGIH 5EBMB 2OX5A 5HGAA 2VL4A 4XCNA 2GJ6B 3ZT5A 3O8XC 1EJOL 4RGMB 1IGFL 4BZ2L 3ULUD 4XT1C 2YC1A 4UNVA 5T1DH 3WFDL 5EBLB 3ZKSD 1JZ8A 1JUFA 4LCCB 4NSKB 1E4KA 4V2CB 1RZIA 3IKCA 5I1KH 2VITB 4M3KB 4J7RA 4ZXBC 1QQDA 3ILQD 2APVA 3RNKA 3T1FA 4GRMB 3DGCR 2XYCA 4HIEA 1G0XA 3W0WE 4IBLT 3QIUC 4R3SB 4UILL 4HFUH 1U8OA 3NMEA 1T22B 4NQDD 1OAUH 3HPLB 4W4OA 4MS8D 4X4YB 2YPLD 2LABA 4IDJL 4LQFH 4FA8A 1AHWA 2PO6A 4R6UA 1Q9LA 5CD5D 1MHPL 4MQXD 4QYOB 2OYPA 4LHUG 1F3DJ 3SGDI 1RIVH 2H6PA 4LOUD 4MCZB 1DUYA 4IEFB 5DC0A 3P73B 3HN3A 2ARJA 4U1JA 4JREC 1JI2A 5F7WC 4KRPC 5BS0B 5ESAB 4M7KL 1EPFA 1UACH 2FYYB 5DD1H 3MLWH 5GSRB 1AKJD 5JPMA 1CBVH 2KQNA 3MRBA 3QUYC 5C0JA 2A73B 3OR7B 3BH9B 5D7IB 4P5KB 5IB2B 1IM3A 2VLJA 3KXFE 1FYTA 3P4OA 3EDKA 3T0ED 2PYEE 5H8DA 3NFPB 2MMXA 4I5BB 2YK1H 3CAFA 4ETQB 1P1ZB 4D0BB 4N0RA 4X9HA 1Z9SA 5C2UB 4M62L 5HHOB 3KDMA 3TJHC 5MENE 5B8CB 4RQQA 3GK8L 5LGHH 5K9JH 3QDAA 3FFDB 4HK0A 4WI6A 1X6LA 3IVKB 1G7QB 5IHBA 3MLZL 2EDEA 2V7HB 3JTSB 3H3PH 3CXHK 5TE6H 3ZDZE 5KG9B 3QCUL 3TJEH 1A5FH 3D85B 1F4YH 5GGUA 4APQA 4N8VB 3GBML 4NHUB 4ZYKB 2VWEE 4QXUH 3QQ4A 5KZCB 1EFXA 5F3BA 5EU3B 1Y6MR 2ICCA 2I9TA 4KROD 2OXHA 5MEQB 5AD0B 4PJIF 3Q5YA 3NCFB 4Y5XA 1WF5A 3OSKA 1TQCC 2X4PA 2Y5TB 2FECL 2VQ1B 2NY5L 1IAIL 4PJXF 4NKDB 3GB7B 4F7CB 3B9KA 4P5TB 1KBGL 5F7NC 3C5ZC 1G9EA 5D2LE 3IFPA 2BY3A 1YEJH 5BV7C 3KYMA 3RY6A 3OKNB 1CIUA 1X5KA 4LLQA 3P77B 4XVJL 4YLQT 2IQAB 4Z0BH 2F58H 2EH8H 3QULA 4P9HL 4GOSA 4YEEA 5I1JL 3OZ9H 3HZVA 4QNPF 3X11B 4HPOH 1YN6A 1T03L 3V5HA 5LQBH 4WWKB 4YO0A 3LRSB 1N5AA 3MV9A 4OZFG 4EZMA 4WFFD 1F4WL 2F19H 2FGWL 2R1YA 3KGRA 1TITA 1BQUA 3LN5B 3WIHL 4JFDE 3VXUD 3B9VA 3LKNB 3MLUL 2NNAB 5GSVB 4P46C 1VEPA 1UM4H 1IAOA 3ZE2E 3O41A 5CIPA 4ELMB 2YKLH 4JPWH 1DQLL 2WINB 4EI5C 4Z78A 2GJZA 3VDAA 4I0CC 5GGRB 3SGJA 4UNTA 2CKBH 1RJLB 3EYUL 3MACH 1HH6A 3BHBB 3D39A 3OXRA 1U8JB 1XFPA 5D7SL 3LRGA 5FGSA 3GRWA 3SE4A 3I50H 2WBJC 4ORGA 4UI2A 1H3TA 4WI8A 1N64H 4H0IA 4JY6A 4BFIA 1S7UB 2VXUH 3KS0H 4M1DH 4XBGA 2UYLB 4IS6A 2ICWJ 4PJFA 5JQHC 3BPLC 3V6OC 3EYOB 1AQKL 1VPOL 5C0BD 2WIIB 5CAYB 2DLTA 5FOBB 2R9HC 1V7ML 1O5DT 4WHYH 4ZUVA 1SJEB 1YY9C 3FN9A 4RGNE 4EVNB 1MOEA 2OL3L 4KAQH 4QGYA 1OAQH 3LQAC 1T89A 4OIAA 4PJ5D 3C08L 3ARTA 5HGDB 5T3ZE 2AW2A 4JG1H 5A16A 2GITB 4ALAL 1IGJA 5DD0L 2VTFA 3CVIL 3O6FD 1EMTL 4P9MH 3MGTA 5JIIA 3BO8A 4LP4A 4MQTB 5IVXB 3C6LC 3D18A 5HDLA 4WV1A 4AH2B 1HK6A 2IPKB 3GGWA 3M8OH 4H8WL 3CFKA 4BQ8A 5F3HB 1MPAH 3DBXA 1E6OH 1WFTA 5FXCH 4HBCH 5I1DB 3IT8D 4OT1H 3V6BR 2BCKA 4MXVF 1OPGH 5DJXA 5DRXA 2RGSA 1PYWB 1KUMA 3MOBH 4JR9H 3WJLC 1IE5A 2YBRB 1KPUB 2NYYD 4X4XB 1S9XB 4BH7A 1EHLL 1JFQL 5D7IE 1A6WL 3TWCL 3FQNB 4LSTL 1K8DA 3UTQB 1RZ7H 3FOLA 1RK0A 3FHAA 1MFBH 1UXWA 3BXNB 3N85H 4MVBC 4KV5E 5J56B 3MRIB 1OB1B 3SJVB 4LNRA 1SJHB 5I1IH 4HF5L 2ITDB 2P43B 2AKRA 3NIDF 5DT1L 4GKNB 1OY3B 2B1HH 5T1KD 3DVNB 1C12B 3PG2A 5IEKA 3NIGE 4UT9H 2ADJB 1MHCB 2SEBB 3VFNA 1Q0XH 2D0HA 2JIXD 1CGVA 4XMKL 5D7JC 4R90L 1LK2B 1TFHA 3PL6A 4RX4D 3SGKC 3U36A 4QT5A 4TTDC 1RMFL 1CYGA 4CW1A 5JW4Q 2X4SA 4YDKL 3X17A 3QDGD 5E6IA 4ZFZA 3ULVD 1AJ7L 3QR2A 3IS0X 3MUHL 2B1AH 4F7EB 3U2SB 4JFED 3EYFB 4BH8B 1RPQA 2NXYD 5CSBA 2DQGH 4Z7UA 4AL8H 2IEPA 3MRLB 4L9LB 1BF8A 1TNMA 3VXRD 4ISVB 1T1XB 3BPOC 2YXFA 4PRIA 2ZJSL 3VI4F 2F5AL 3QUKB 1MWAB 3H7LA 3S34H 2UUDH 3PP3H 4PPTA 3CMOL 3DYOA 4NQSB 1SQ2N 2GAZB 5C0FA 4XVSH 3L5WA 3ZTNH 3UC0L 4KUZH 4KXZH 2IG2H 1E6JL 3E6FA 1JHKL 1VESA 1PAMA 2WUBL 4PV8A 5I15H 4Z76A 4D2NA 3PF2A 5C9JA 4Q9RL 5KSBE 2O93L 4UB0L 3TT3L 1MIMH 3UXFA 2VL5B 5HYSB 4K3JL 2AEIT 2XWTA 5JW3H 4MWFB 1I7RA 2PN5A 3WDHA 2DJ4A 4POZC 3MC0A 4IHOA 4PRBA 4RA0C 3H9SE 1NCWL 3DRTB 5E5RB 1XGYH 4B7IA 2LE9A 4ZFGL 5IBTH 4J8RA 3I75B 5JPNB 1WZKA 3MRCB 3SQBA 4FXGA 5I1LA 3ZYIA 5D5MB 4HS8L 3W39A 3NZHH 1PKQB 3WFZA 4Z9KB 1R3IH 4OCMC 2OP4H 4KKCD 4NKMB 4HKJA 3AS3A 4RZCA 4TSAL 5GRVL 2H45A 4YDJB 5F8RC 3VGFA 1AO7E 3QEHA 3P9MA 4WDIB 2VXQL 3SDCB 1JYVA 3BDBA 4DEPC 3ILPA 5E5MB 2P47B 1L9MA 3ARFB 3F12A 4O58H 3TBVB 5CBAA 4M6MH 3G9AB 1B4JL 5F1KC 1PW3A 1BD2B 5GS1B 1DL7H 2J8OA 2NTSP 5GRYA 2NY4B 5A2JH 2YSSA 2GIYA 3JWOH 1U42A 1BBDH 4CU7A 3AY4A 2Z93B 3I02A 3L7EA 4L3EA 5IVXE 1J5OL 3LHPL 4OB5H 1E27B 5FYKU 4M4PA 5C0GA 4W6XB 5GGVH 5D70L 2Y07H 2DBJA 4XP4H 2MCPL 43C9B 4HFWB 1KPRA 4M7ZB 3MLXH 5CWSB 3WFBL 2DTML 1KULA 2KH2B 4GMSL 3P0YL 5FO9A 2FX7H 1KCUL 5CCKL 4X80H 1FZJB 3V7AE 5EN2B 5F9WC 2QR0A 2E7HA 3B43A 4TVPL 4YHNA 3O11B 3AB0B 4XNUL 2E7LA 4WO4A 1BFOB 2DQIL 5C1MB 4A6YH 5DI8B 4S1DC 3HI5H 5FCUH 2ENYA 3X3FH 3HAEG 3V4UH 3OV6A 4M03A 3CU1A 1N5YH 2AXFB 4IDLA 1NAMB 4TRPL 4Y4FB 3CK0H 3E6HA 2VQUA 2FJHA 4MDJB 5DWUL 3SGEI 2F5BL 4WY7H 4KRMB 3AM8A 4JEGB 1MI5B 4KK9C 3GSOB 5JUEH 2NY2B 2HH0L 2NW3A 3DLQR 4H20L 5DRZB 1FC2D 4WFEE 3CVHB 1NUFA 3U4AA 5CGMA 4KTYA 3QG7H 2EH7H 3EHBC 5T3ZL 1NUDA 5KN5A 3VFMB 4PJAB 1JRHL 2CIIA 2ZOKB 1WBXB 3GHBH 3P40A 1KIRA 2DKMA 3NZ8A 1M05A 3FO2A 3MNZA 2JJSA 5FUZL 4NZRH 3QUXC 4N5ED 4F15C 5AG8A 1BHGA 1JWUA 4LSQL 4OCYH 5HHXH 4X6FB 1OGTA 3QDJA 4DGYH 4JDTL 1ETZB 4ZAKA 4K3EL 3VRJB 4G6AC 3CPLB 4GQPH 2I26N 5C71A 1RIUH 1XGQA 2CKBA 1N8ZA 2W9DH 4HDIB 4L1DA 1M71B 3M1BA 2JKXA 4TOYH 1FL6A 2G75A 3DUUA 3HZYB 4X8JB 1J8HB 2R2BB 4MXWL 5EA0L 1OM3H 2VZ3A 2YOCA 4MX7B 3B8YA 3HE6B 4OCRL 1ITCA 3DVGA 1XR9A 1YQVL 4M6AA 4P2YA 2DMKA 4J4PC 3HC0A 3VXTA 1KC5H 1MLBB 4YHIB 1A2YA 3QUMB 3WFDH 1DE4A 1YPZE 2OR9L 1YC8A 2G9HB 3MXVL 1K8IA 3QNYA 4LLVA 5I1AB 5HGHB 4HWZB 3RWCA 4UILH 5BVJB 3L5HA 4G80B 3IJYB 5JOEA 3T09A 1FNGA 1MCKA 4OZHB 4GUPB 2IMMA 1GVIA 3VFPA 4OQTA 1ZSDA 4ERSL 4JM2A 5MERA 5ERWA 1FFQA 3GMLA 4B53A 3BH8A 3TIDB 5FEBA 4HX1A 3ZYOA 3TO2A 2F8XC 4MNHB 3O81A 4AIZB 5CEYB 2PF6A 5E95B 3O6MH 1A4KB 35C8L 5SX5H 5I8OL 4YHLH 4M7KH 2C7UB 3WFEL 2RIKA 1K3ZA 4Y4HD 2HA1A 3QHFL 5HVWA 1UZ8B 5IBLC 3FQUA 5HPMB 1Z3GH 2CJUL 3PL6D 3IRZA 4MDIB 2Q8BL 5CEXA 4OF8A 5E8PB 3HI6L 2D2OA 2RFXB 5E6ID 4NN7B 1UB6A 4RNRB 1RK1B 1AGCB 1D5MB 5C0DB 3LZFL 4NN6B 5T33L 3RWFB 3JVGC 4NCC2 1JPGA 2CO6B 5EU4A 1NGYA 4ZUSB 4A2LA 4BELD 3AMKA 4XAKD 2XV6B 3GK8H 1KACB 1CFQB 1RVFL 2BNUB 3KJ4B 1B9ZA 5AZ2L 1XH3A 1EEYA 5E4IA 3KPRE 3X12B 1BZ7A 4HV8A 3TBSB 3VA2C 3OAYH 25C8H 5IVZB 1GZQA 3QCUH 2HVKA 3B2UD 3QDHA 3U9PL 3VWJC 4XCYB 1G7IA 1MFCL 4DN4H 3QFJD 2GCYA 1P4LA 2AQ2A 5EC2B 2HT3D 2PW1B 2YD3A 4XBPA 3OG6B 5JR1L 4LCWA 1NGXB 3KHQA 4OUUB 4G42B 3PDOA 3RWJB 4FTVE 1CG9A 1SYVA 4P5TC 1FN4B 3BGFC 2IAMB 4UINL 5HYQA 1IAIH 1VB9A 2ADGB 3LKOA 5KVFH 5EPMA 3L9RB 1KBGH 3TZVB 2VIRB 1FVCA 1YEIL 4QRUA 4E5XA 5ICYA 3GM8A 1NSNH 3TGXA 5KSVA 5C0EB 3UTSD 4KK6C 3TYFB 3L7FA 4C56A 5TDPA 5T3XD 1B0GA 2R4SL 1ZANH 2HFEB 3JTTB 3NCMA 4JHZA 5L2JB 1D5ZA 3PGDA 4RIRB 2XI9A 4P9HH 2R0WL 1F6FB 2HJLB 3GKWL 1WWBX 5I1JH 2GK2A 1CLYL 4PJAE 2PTUA 1T03H 3ZMRA 5BVPL 5HGGS 3BRFA 3IU3A 2DN7A 3EOAB 2DI9A 4P2OB 5I73B 2FGWH 1DTUA 1CR9L 2VZVA 5HI4D 2NY3D 5CJXA 1ZA6B 3MLUH 3LIZL 4HKBA 3VXMD 4Z7VA 3U46B 1HWHB 2EDBA 2VLKD 2APWA 2FEDD 4Q2ZB 4DGIH 5EIIB 1J05A 4NKOB 1DQLH 2COQA 3NFSL 3KPTA 4O51B 4H1LG 3PWNA 3EYUH 1I8LC 3M07A 1N6QL 4U6XB 1J9CT 4JKWA 1MRCH 4S1RH 1AD9B 4XWOC 4G9DA 5HBBA 4WU7B 4BQBA 1KTDA 2C3WA 4ZUWA 5H94A 2XTLA 4G8GA 1AQKH 1VPOH 5FV2A 3CCHA 4LF3B 3CFBB 1V7MH 4CVWA 4FFVD 4M61A 3Q6FB 1CXFA 5DHYA 4HPYL 2FD6H 2XY2A 2OL3H 4X5XB 4JLRB 5FO7A 2EXWC 3DV4A 3QCTL 4I8DA 3BW9B 2CDGA 3K0WA 1EMTH 1VFBA 1MVFA 4Y19E 1HYRC 5E8OB 1KIPB 4PJ9A 1BWMA 4TPRL 4U6VL 4F9PC 4C54A 4V1DE 1NGZB 1BVLA 3G5XA 3P4LA 4H8WH 4GW4B 5J7CC 4L4VB 1DEEA 1LP9B 3AXLB 4ZD3H 5E99L 4N90E 3FQRA 3MFFB 5BZDB 3TNMB 3WS3B 4NNXA 3I6LE 3QEQE 3MV11 3F5WB 1J7VR 1N3NA 1FCGA 5DQ9B 4RBPK 5DVOA 4JHAL 1TXKA 2VLRE 2D7QA 2DM4A 4R4NC 4AJ0A 4G3YL 4QRPD 5FAAA 1KB5L 1JFQH 4PG9A 3TWCH 4LSTH 5D7KE 2ICEB 3A67L 4D3CL 2EE6A 3EJZD 2OCFD 1YDPA 4IRJA 1BEYH 1IGYB 2YZ1A 3VWKC 4Z77B 4A6YA 3ECBB 5LCVL 4XPBL 2MJWA 3MV7B 3V6ZB 1S7SA 3EFDL 1XCTA 1KJ2B 4X6DF 4P59H 1MF2L 3GSWB 4HJ0C 1WTLA 3MUJA 3E8UL 3LKPA 4JKMA 4NC1C 4U31A 4XMKH 3RZCC 4R90H 1ACYL 1RJYB 4CVXB 3DO7A 1PQZB 1NGQL 3S5LA 5TH2B 1YEEH 2DQCL 4RAVA 3VH8A 2XWBA 1MCSA 5C0CA 5E7BA 1RMFH 3GNML 4YDKH 3O45B 1AJ7H 4HZAA 3K7UA 4KJQD 4N0UB 3HNSH 2P44B 3ZKMD 3GSRA 2J2ZA 4D0CB 1ZLUK 4L9LC 4HAFA 1KYOJ 4RISL 1W72B 4JANB 3OGCB 2YN5A 4D0DA 5CD3B 3ALXA 4NT6B 5JLZA 5T5NG 4U1NB 4YHKL 3RJDA 2OZ4H 4ODWA 1IC7L 1V7NH 2AK4E 2ZJSH 3D6GA 1TMCB 2F5AH 4XXDA 4K7FB 4MB3A 4KZDH 1MJ8L 5GGTH 3RDTB 1ULVA 1JHLL 2C3VA 3KPLB 1QBLL 1S8DB 1UCBL 3CMOH 3PWJB 4Y5YB 2GTZA 1M6OA 5IQ7L 1IAKA 3HMXL 4WIQA 1DQTA 1B90A 3PNWA 1HHJA 3NGBB 1WITA 4HIXL 2WUBH 3O4OB 4XPGL 3C8HA 5IW6A 2Y6SC 4EJ1C 2VR4A 4JFZH 2CLRB 4GG6B 3IXAB 1M1SA 4NQXA 2NX5A 3NFNA 4Q9RH 4U0RB 1QLEL 2GT9A 4MA7H 1D6EA 4UB0H 3W9DA 1U41A 5EH1A 3IDMA 1OT1A 5ETUB 3W82A 4F58H 3TVMB 3HFMH 2R23A 4PJXE 2VDML 1NCWH 3GMOA 3BEVB 1T5WB 2DLHA 3SKNA 2YD4A 3CLFH 4PJHB 4K9EH 4ZSOA 2WQ8A 2DB8A 5DYOA 3DXAA 3VA6A 2VC2L 4X7CC 5INCA 4ZPTA 3QWQB 3RBGA 3U0TA 2VDNH 2DI7A 3EDEA 2BDNL 2F53D 2IADA 4X99B 5D1ZA 4YXKH 1AE6L 4PGZA 2BNQD 3G5YA 4HS8H 4R4FH 1MJUL 5D6CB 3S35L 1C5CL 3O3BB 2DICA 2O5YL 4QNPE 4UU9B 1YNKL 3ZSTA 4NFBA 3SDCC 4XRCA 2VXQH 1U8HB 4UZGA 3ARFC 4OZ4B 1JI1A 4DZBB 1U2CA 2EYSB 2D7PA 2DQFB 1YEDB 4EUPH 2X4NA 5F1NA 3VFOA 1AGDA 1F5WA 1MCPL 4OFDA 1Q9OB 1XGRA 3DWTA 2APBA 5ITFB 2H32H 2OI9C 4XAWH 2YPLB 1Y6NR 4POYA 5CP7B 3RVWC 3VFSB 2DQTL 3T08A 1LO0L 3MA9L 4MA8H 4UUJB 3MRGB 5BRZD 4OFYA 3NTCL 5BMFL 3GMPB 5SWZD 2UWEA 4YBQC 4G43A 5FYJL 43CAB 4M7ZC 4L4VE 2BFVH 4GBXA 2MCPH 5DMYA 1NCUA 2HVJB 3QDME 4CVZB 5IJVA 1HKFA 3NCBB 1PKOA 4HXAH 4NO0D 4X83A 1HDMA 3WFBH 1KSRA 4I2XB 2DTMH 4JRYD 3KPSA 4GMSH 4LAQL 4U6YB 4ZQKB 5J1AB 3P0YH 3TN0A 5CCKH 2WWKT 4XI5D 4RFOH 3H3KA 5A2FA 1CDJA 5IBUB 5BQ7A 4MYWB 3FAWA 4U1MB 1MJJA 3K4AA 4C56D 3X13A 1DN0A 4TVPH 4ESKA 1P6FA 3CFJB 5MEPA 3T0EB 5GS0C 2NLJB 5ISZE 3I6GB 4U0QB 5SX4I 2P24B 3BRDA 2ARWA 2VDPL 3DURB 3R06B 1K2DA 4PRPD 4OZHF 3BPCA 4Y4FC 2NZ9C 3HRZA 5CBEA 2PTTB 4GAYB 2A9ML 2H8PB 5CILL 1GXEA 4MAUH 2VOTA 3GSNB 2F5BH 4IJ3B 2NY2C 4GRLA 3IU4L 5HY9A 1TTGA 3C2AL 5I17B 5LG1A 5LKNA 2HH0H 4QHMA 1OTTD 5DJDB 1HIMH 4KROB 4G6MH 1MFEL 3ZKXC 5L8JB 4KHXH 4LASL 4KDWA 4Y16A 5KSAA 3UZEA 4KH2A 4YUEL 1GCFA 4MD4B 1OTUC 1M7DA 2DQHL 3BVNB 5AZEL 2D7OA 5FUZH 2JB6B 4JRXA 1H9VA 4PGDB 3QIWD 3VGAB 1ZTXL 2NTFB 3DECA 3VXQB 3WIHA 1CL7L 5AG9A 3L3HB 1N59B 1N4XL 2KDGA 5IFJB 1FPTH 3MLVL 1CIDA 4K3EH 5GRXG 1A7QL 3DOSA 1WC7A 3ZYZA 4LEOB 3MLYL 1PJ9A 4HS6A 5JHDA 1UWEL 7CGTA 3LKSA 5HI5C 2ED8A 3SE9H 4PJ9D 4EI6A 1EX0A 5IMLB 1BZQK 3HE6C 4E9LA 5DD5L 1NBVL 1U8NB 5HYJD 4MXWH 1NMBL 1CGUA 1U3HA 2H1PL 2R1XA 2V2XB 4OCRH 3R8QA 3P9LA 1SEBA 1GZPB 1L4IA 1PZ5B 5BV7L 3IAQA 3OKDB 3VI4E 4XCFL 2WNGA 4PJHE 5J6GB 3B3IB 4QHLA 2IBGA 1HI6B 4AMKH 1OGAA 4JZNA 1DBKH 1JTTA 2OL3A 4N8CL 5DMKB 3LKRA 1TJIL 5L2KD 5I0DA 1P84J 4GKZB 2XNAA 4NQEE 5E2UL 4F7PB 4E0RB 3O2DL 3SDDB 3FO1A 3GSVB 4F33B 2Z92A 2MQCA 3N9GL 2DQUL 3BKYH 4BM7A 3CSBA 4MAYD 2JB5L 3FT3B 3O6LL 2FIRT 4EDXB 2PNDA 3MREA 2DLFH 4P4KC 1PZUB 2G60H 5AUMB 5C0BB 5IWLA 3JUYA 3ARBC 2B2XL 1SYSB 4HUUA 5SWSD 1BIIB 4WW1A 2YUVA 5D1QD 5DTFA 1SBSH 35C8H 3SKMB 5I8OH 4WHTB 4PJ5B 6FABL 1IFHH 1U92B 3MPCA 5JXAH 3ARDD 4BUHA 3O6FB 4NN7C 4I48A 3B9EA 1PY4A 4NN6C 1P7KB 3PHQA 4K7PX 4Z5RB 1CS6A 2FO4B 1X6NA 5T33H 1WCBB 4HG4J 4B0MM 5EOQL 1I9IH 3AY4C 4OLYL 4YPGB 2QJDA 1DDHB 1LK3L 2QQLH 4L3CA 4LCUA 4I2XE 4CGTA 1ZT4B 1BOYA 4HH9B 3ROOB 4FQXD 1I4FB 3CH1B 1RVFH 4PS4L 5AZ2H 3V52H 2QQKH 3LQAL 2YUZA 2YHGA 3WJJC 4PRNA 2Q76B 5IF0A 1MHHB 4E41B 1RU9L 4XZUA 5K59E 2W07A 1OP3H 1FAKT 4PJCA 3FOMA 3U6RA 3P4NB 1H8NA 2KQMA 4FZ8L 1EO8L 3D2UA 4R2GC 5DC4B 3EKCA 1OLLA 5T1KB 1RUKH 5E9DA 4D9QD 4WO4C 5D9SA 3TZVC 1CDUA 3OR6B 2EYRB 5KOMC 4Y5VA 2JIXB 5C86A 1CI5A 2F15A 3NVQA 4L8DA 4KQ4L 4DAGL 1TCRB 1D5XA 1YEIH 4HKZB 5F7DA 2OZ4A 3KPNB 1G7LA 2CGRL 2VISB 4YIQB 3GZKA 3MOAL 4UDUA 3S98A 1UEMA 4PJ7E 15C8L 2PUQT 3DXAD 4XNYL 1JGDB 3UBXG 1HXMA 4PRAA 2R0WH 3GJFB 4JM2F 3WIIL 2XKNB 2A77H 3M17A 2NXYB 2PXYC 3BUYB 4TNVK 2YS4A 4AEIL 3MX0A 2XACC 3VXRB 2KUTA 5I73C 5CGYC 3WL9B 1QRNA 5HGAB 1KCRL 3GKZA 3QRGH 3UX9B 4X0KA 1UENA 3LDBB 1UJ3A 3QCVL 4I18B 5E6YA 2XKUA 4BSWA 2YC1B 2ED9A 4KWUA 1FQ9C 5ECJE 3SN6N 4JQVA 1JF1B 1MFAH 3QPQD 4S1SL 2QBWA 4WUUD 3FFCE 3IKCB 3QFDB 4EN3C 5KAQF 3HTLX 1NMCC 1T04A 1D9KC 4HIEB 4LARL 1A4JA 1U8OB 3D0LA 5H2BA 1H3PL 5JW5A 2JCCA 5IVOA 4Y4KD 1N6QH 5CMAB 5ELIA 3TBWA 1FH5H 3ARSA 3D3VE 3LQZA 4MXQD 1AHWB 4HW6A 3HR5B 1Q9LB 3EDFA 3O3EA 4F8TA 3VXSD 3N1MC 3OKOB 1W0WA 3CFIC 3F7YA 1ZAGA 4KPHL 2ARJB 2AEQL 2ZG1A 5DS8B 1T5XA 2V17L 4ZFOL 1RD6A 4M4RA 3PGCA 2R0ZH 4HPYH 3KPSD 1A1OA 3P3YA 4JAMB 3QNZA 2EDYA 5CFHA 2GK0B 2X4OA 3FB6A 2C3GA 4EUPA 5C0JB 1S3KL 1A9BA 2ILLA 3RGVC 3RVUD 2XQYG 3MRQB 1OP5K 1IM3B 2VLJB 4NFDA 3O3DA 1CICD 4BYHA 4DVBB 1FYTB 1J0IA 1UC6A 1BVZA 4MNGA 3EGSA 2H32A 3P4OB 5IB4A 2X1PA 4M00A 4TPRH 4U6VH 2XOTA 4JGUA 3C9NB 4MD5A 5C08A 4AEEA 1D5IL 8FABA 2LQRA 3NH7H 4LSUL 1DQJA 4JZOA 1AY1H 5KS9F 1QR4A 3QEUB 4GG6F 3FQWA 2I60L 4HK0B 4JM2C 3L5XL 3AS2A 3NN8B 1OAKL 1ORQB 4DKDC 2ZUVA 5DURD 4RWYH 4XHJC 5EUKA 3U0WL 4YEFA 1JPSL 1R5WA 5GGUB 4FQHB 5C7XL 3ZDYE 4FQPA 1KB5H 2Y25A 3RY4A 5EOCL 5F3BB 2HLFD 3MGOA 4WHYG 1HKLL 3H9YA 4FFZL 3A67H 4C58B 1UWXK 3CX5J 4JDZB 2IBBA 5GGQL 3BP6A 1HHKA 5LCVH 4Z7VF 5E94A 4Z8FH 4CKVX 3VMPA 4YHYB 2MCG1 2IANA 2C5DC 3EUUA 4NDMB 3S36X 3OKYA 3E2HB 3E8UH 3IFPB 1QSZA 4QHNA 3RVTC 1CFNA 4YXLH 4KTEL 4LDOB 5JHLL 3GO1H 2DWDB 3KYMB 1I85C 1NGQH 3F7VA 3RWDB 4E41E 3L1OH 2HFTA 5DMIL 5JORB 1ACZA 3CSPA 1WV7T 3P30L 1QFUL 2HTKD 2HN7B 4X6CF 5F9OL 5FYKE 5KW9H 1GAFH 2LU4A 4LSDA 1RFDL 1QBML 3HZVB 1EEZB 1K5NB 1T1YA 3V5HB 2Z31D 5D8JH 4EOWL 4R26H 5KAQG 1N5AB 1QP1A 1VFAA 3MV9B 1DBJL 4P2QE 4RISH 5I8CA 4YK4B 4MA3B 4CU6A 4ONGL 2R1YB 5IEHA 4AEHL 3GJFK 2WBKA 3IKKA 4NM8L 2EDHA 1BAFH 4FQJH 1KYOK 1X5FA 3O41B 4TQEL 1QBLH 3E1F1 5CIPB 1UCBH 4BZ1H 5JXEA 5FB8A 3NGBC 4DVRL 2GJZB 4U1IA 4LPXA 4UOW1 4HK3N 1N2RA 1R3HA 1HH6B 1X4YA 3D39B 1OGAD 3G04A 3OXRB 2VZTA 1JGEA 3IFNL 4KMTL 3G6JF 4ORGB 3QIBA 2C4XA 1YA5A 1DLHB 3BZFB 1KCSL 1FO0H 1QLEH 1YUHA 2KL6A 4BA8A 5BJTA 3HMWL 4U7KA 1F11A 5J89A 2P5WA 4GAJL 4XBGB 4UTAL 4PJFB 3G9VA 3AREC 3GIVA 4QTHA 2OTUA 1JMXA 4Q6IC 3HZMB 3VDCA 1PVHA 2VDMH 2BOBA 3GSQA 4QXTA 1LDSA 2ZZUT 4JFHE 1QHOA 2DJSA 3NIFF 1K3IA 3IAGC 1KCLA 4NRYB 1EHAA 2CUIA 1KJVA 4RFNB 1IGJB 1W0VA 2ADIB 1MCCA 3CLEL 2H3NA 4GRWF 4YHZL 4NKIH 1FDLH 2MNUA 5B3JE 1KV3A 3BO8B 3TNNA 4J3WA 1C5CH 3D18B 1CXKA 4CRPA 4WV1B 3ULUC 5DK2A 3JWDH 4JZJA 1YNKH 3WN5A 3CFKB 1PD6A 4KY1L 1JP5A 3WUWA 4LSVL 1P5UA 1ADQH 2HYMA 3NCYS 3QO0A 3K3QA 2BCKB 4HC1L 4R4BA 5DJCB 3LB6C 5DJXB 4X7EC 4RWHA 1A1NA 2FWOA 3S97C 3MV8A 5J0BA 4W70A 1FFPA 4Y8DC 1AIFB 4MS8C 4CMMB 5A2KH 3JV4A 1T6VN 4JG0L 3BIBX 1CD8A 1Y18B 4BH7B 4YC2B 5FUOH 3BGAA 5TPWH 1QKZH 2VLJE 1C7TA 2AJ3A 1K8DB 4Z7WF 3FOLB 2DQTH 1FYTE 1LO0H 4MQXC 5FGBC 5IHUH 4G7VH 3MA9H 3EO0B 1OVZA 4G9FA 4PREA 3HHRB 3KYKH 5HVFB 1BVKA 4LOUC 1IBGL 1OSZA 3NTCH 5BMFH 1I9JL 1UM6L 2BY2A 5FYJH 3BQUA 2AKRB 1MCWW 2Y72A 3RVVD 1XGTA 3W0WD 4JFXA 1WTGT 5IEKB 1VEOA 2EKSA 2PKDA 2APXA 4LLWA 3STLA 3FTGB 1FVDA 3VFNB 5LWYL 1WIPA 2Z35A 4LRNH 1DANT 1PDKA 2W60B 1ITBB 3THMH 3T2PA 3PL6B 4I9WE 2O5ZH 4XPHH 3WMSA 4CW1B 4PG2C 2QKIB 3T0EC 5E6IB 4ZFZB 4YX2L 4GAGL 3O0RH 1V05A 1OF2A 4XNQA 3L3KA 1NLBL 1DVFD 5GPRA 3RNQA 2VDPH 5H37H 1EEQA 5GRUL 4BJLA 4Z7UB 5B22A 4PP1D 5L88H 4LHJB 2DRUA 4YPJA 4XPFL 2A9MH 5CILH 2A83A 4AG4L 4IJ3C 2J88L 3KXFD 5E2JA 2BVYA 3MTRA 3UYPA 1V5JA 2ZKHH 1L0QA 1AO7A 2PYED 1EVUA 3L5WB 3TA3D 5I2IA 5E08H 4KROC 1A22B 3IDXH 4Q58C 4PJBB 1PG7L 4PV8B 3UJTL 5MEND 1F58L 4Z76B 4ZMAT 3HA0A 4I0PA 3BP4B 4LASH 5C9JB 2RAMA 2W38A 3MV9E 5TQ0H 1OWWA 2XA3A 1FGNH 1NGPH 4Z0XA 2DQHH 5AZEH 4WTXA 3VGAC 3U7YH 3UTPE 5DUBA 3OHXB 4H0GA 5ICXA 3I2CH 3BE1L 3JZ7A 4TSCL 4IHOB 3UTSB 3NABL 1DQMH 4LP5A 2X42A 4G6FB 1OTSD 1CL7H 4J3VA 2NY7L 3FZUD 4J8RB 1N4XH 2ZP0T 2VXSH 1ONQB 1U3JA 1A7QH 2VH5L 4FXGB 4Q0XH 3D39E 4WFGE 3DMMD 4KQ3L 1AP2A 4XGZA 1WFUA 2BVOB 1DR9A 2XRAL 3VH8G 5HHVL 4RZCB 5FUCC 1CGWA 4NJ9H 4AT6A 3ARVA 2W65B 1NBVH 3QEHB 4GW5A 3H7BA 1NBYB 4PJFE 5C09A 2JLLA 3RIAF 5HDBF 1DSFH 4PGJA 3ILPB 2R0KL 2VLKB 3F12B 5CBAB 2XA8H 3WDJA 4XCFH 4LLYA 4S11A 5FECA 1OD7A 2QSCL 4HIHA 3FAXA 3CDGA 3K74B 4OD2A 5JMOC 2BERA 1TZGL 2ATPA 2YSSB 4N8CH 3QJHA 3AU1A 3L6FB 1NCAL 1Q1JH 5DMGC 1MJ7L 3KLHD 5E2UH 3I02B 4DK3A 1IM9D 1V3LA 4LSPL 1KPVA 4JFDD 2H2SD 3L7EB 1CDCA 3I9GL 2BVEA 2DQUH 2V5SA 3N9GH 2FX9H 3NAAH 3OB8A 1S7XA 5E4EC 1JZ4A 1TPXB 4M7LL 4WJ5A 3D87B 3X14B 4PJ8D 5DVLA 2EXYD 5I1HL 2ADFH 5C0GB 3V0VA 4NNYA 1N26A 1MREH 2CRIA 4YBLC 3ZL4H 1KPRB 1SM3H 2B2XH 4LFHD 1B88A 5DD6A 1QFPA 4I3RH 2IQ9L 1TJGH 5FO9B 3MRKA 1V8HA 4DKEH 2BSED 3VMNA 5F7HA 1IT9H 6FABH 1KTRL 2E9JA 3O6FC 3V8OA 1HH9B 3ARPA 1B2WL 3MRMB 2ESVA 2GY7B 4M3JA 1JWMB 3OB0H 1OCWH 4Y2DC 3HC3L 1L9NA 2MQ3A 3WSQH 5CJ8A 2AGJL 3CZFA 4YDVA 2BOCA 1G1CA 2GSGB 4HUXA 3MUY1 1KB5A 1NCBL 1T21A 3WHXA 1FNFA 1EAPA 3ET9F 5MP6L 3TM6A 1JPFA 4FFWC 4RGND 2V5TA 5EOQH 5L9DL 3TO4A 1LK3H 5IJKC 5EOTA 3NOIA 5DD3H 5T3ZD 3MUGA 4YAQB 5IMMA 2FJHB 2DJUA 2NYYC 4HG4K 3VFVA 2VDKL 1I1AA 5IG7A 1WEJL 2V2TA 2CK0L 4QRPB 1VCAA 1B6DA 2ZPKH 1RU9H 1R3KB 2R39A 3WNLA 3GSXA 5IW1B 2CKNA 1FHGA 2NW3B 4DN3L 2XXCB 3FT4A 4P23D 3MRRB 3HE7C 3PWLA 3WS6C 3MO1B 3OXSA 5TFSH 4FZ8H 2GFBA 2EZ0D 5KN5B 5IT2L 2X09A 5AEAA 4Z7UE 5IHLB 5D93B 5IM7A 1KLGB 3QIBD 5CEZH 1KIRB 5E0QA 1M05B 3FO2B 2MSPA 3MNZB 5KTEH 4PRIE 5IFAL 4KQ4H 4DAGH 4MJ6A 1JWUB 3QQ3B 1YY8B 4O5LL 4PRHE 1OGTB 3QDJB 3V4PL 3ULVC 5GGSY 1FL5A 1A3RL 1NCDH 4ZAKB 3W81A 2N4IA 3MXWL 5E56A 1XGQB 2NXYC 3HMXA 1WZMA 4ODTH 1IQWH 1N8ZB 3WIIH 1GRWA 3M1BB 2N1KA 4AEIH 2G75B 4HKXB 4O2EA 1YNTA 2F54A 1LEGA 2HFFA 1KCRH 4I18C 2A6IA 4JQXC 4G6KL 4M93B 3DVGB 3D85D 3SCMA 3HC0B 3BP7B 3ROLB 3VXTB 3A6CL 1A2YB 3BFOA 3GI9H 5TGBA 3RL2A 5KZCD 1DE4B 2BMKB 4MJIA 4S1SH 2EO1A 5I19H 1T7XA 4FQQA 4U7SA 4EKXA 1RUQL 3Q3GA 1K8IB 4LLVB 2JJTC 2XZZA 5D1XA 3WKML 3RWCB 2BK8A 3ZT6A 1H5BA 3AFLA 3MGAA 1H3PH 3TBTA 1I1RA 4I3SH 5J57B 3VFPB 5DHVB 2EICA 4PLJD 1S9YA 5M7QA 1ZSDB 1GGBL 1J10A 1MWAL 3O2VL 5DFWH 3GMLB 5TQ2L 3S4SA 4BQ6A 5FKPA 3BH8B 4HLZH 4HX1B 4KPHH 3P0VL 4XMLH 2X1QA 2V17H 2G5BB 3HPJA 2AV7B 4PTTA 3UP1A 3D5OF 4PY8J 2Z4QA 2LV4A 2F53B 4ZO7A 4UAOB 2BNQB 1LE5A 4Y8AA 5CEXB 3S88L 5HHMB 1CFVL 2WUCH 4AIOA 5M95B 3Q2CA 4L3EE 3ARRA 3SDXF 2ZNWA 1UB6B 3TESA 3MBXL 5GS2H 1IRAY 4FQIL 3H9SD 2XZAL 5IFHL 3L5IA 1RURL 1YN7A 1JPGB 1QO3B 3VJ6A 4RMUA 5BXFA 3WLWC 5J8OA 4WU5B 2XN9A 5ENWA 5SWQB 1GSMA 1NGYB 3IF1B 4LHUA 5DR5L 3R8BB 2H41A 4MQSB 3O8XA 5ACZB 4UIKH 5KSUA 4G5ZH 3PHOA 2I60H 1D5BA 1KJMA 1XH3B 1YECH 1EEYB 1N6UA 5GGSA 4JFPA 4LDEB 3NCJL 4X6BB 2YA2A 3GMNB 5JZ7D 3TLRA 1E4WL 1JPSH 3MBED 5FKAB 4ZXBA 1AO7D 5C92A 5E8EA 5C7XH 1A47A 2Y4SA 3WFCL 2R4RH 5BRZB 1ZLVK 2ICES 5EOCH 3SPVB 1CD1A 2GCYB 4HXBL 1P4LB 4F7MA 5SWZB 1HKLH 4P3DA 4XBPB 4C59B 2P49B 2XG5A 4JHBA 1EK3A 4NO0B 3PDOB 1CG9B 5GGQH 5HYQB 4JRYB 4CDHA 3E2HC 2IALA 1FVCB 4QRUB 2X10A 4E5XB 5ICYB 3MJ6A 1KN4L 4YZFE 1YMHA 2W0FA 2HLAA 2VLME 3L7FB 4Z95L 5FOJA 4C56B 2A1WL 1B0GB 1FNEA 2Z8SA 3QYCA 3QNXA 5FYLL 1RUPL 1D5ZB 1QFUH 3PGDB 3L3OA 2BZDA 3QUYA 5ID0A 2NW2A 2A9NL 2VR9A 3O3UN 1M7IA 1RFDH 4M5YL 4PFEA 5D7LA 2W91A 2K9UA 4JY5H 4HQQH 3IU3B 1UVQA 5I16A 4YK4C 4XTRC 1DBJH 2EO9A 2EDNA 5IUSA 2G2RB 5EU7E 4ONGH 2VXVL 4H88H 4AEHH 2ITCB 4PGCA 4WUKL 5DF0A 4HKBB 4NZUL 3QDJE 2AJVH 5EWIL 4V1DA 2BNRA 5JOFB 5EUOA 5BZWA 1DUZB 3PIQA 4UV4H 3PWNB 1QFWL 2BSRA 3U9UB 4G7YL 5I74B 3SKJL 4KKLC 2BVPA 4KMTH 4R7DB 4U1KA 2J4WL 1OAYL 3V5KA 4G9DB 4ONFL 2OK0L 4N5EC 1QVOA 4ZUWB 5B4MD 5ALBL 5ICZA 4GAJH 4M9OA 2OJZL 3FN0L 3QIWB 4NO3A 3MCLL 5H94B 4G8GB 1XGUA 3KYOA 5IOPA 1Q9KB 3G6AA 3L3GA 4K3DL 4WFED 4M61B 1I9EA 3DIFA 2WWMC 4JFOA 5DHYB 3C5ZA 5EU6A 4NPYB 1FVEA 1QSEA 4PJDB 3HNTL 1KEGL 2DL2A 2IPUG 4JQVC 5FO7B 3DV4B 3CLEH 4N9OB 4YHZH 5CHNA 2CDGB 1VFBB 1RI8A 4J6RH 4PJ9B 1CFTA 1UZ6F 2CLVB 5ID1A 5C0RH 4K9EC 3ME0A 1BVLB 1FGVL 5FA4B 1A9EB 3UAJC 2P7TA 1R5IA 3OKLB 2Z91B 2MPAL 4KY1H 1TZHA 3TO4D 1ZHNB 3V9FA 1LO2H 4HC1H 3FQRB 4X7SL 4NNXB 1CLOL 2DKSA 4LPUA 2HT2C 1T80A 4P46A 1NLDL 1N3NB 1DCLA 3PWVB 4XP6L 4MZ2A 1T4KA 3F7QA 4TN9A 1JNNL 4P48A 4U3HA 1TVBB 2YD7A 3WE6B 4Y1AA 5IESH 5HHME 1F8TH 3PDGA 4ELKB 1ZT1A 3WXWL 3LD8C 4MAYB 3T3ME 3DHJA 1JNHA 2J8HA 4ZPVA 2ZSWA 4MJ5A 3QHZL 4MSWA 1MUJA 1DBML 2WBJA 3EOTL 2R2HB 1UM6H 1WZ1L 2EDOA 4OM1L 4JY4A 4KXZI 1PSKL 2VXTL 3U4EA 3TPKA 1S7SB 1XCTB 4Y4HC 5D1QB 4NC0B 5DJYB 5FM5O 5F96L 4NQVA 3V6OA 3LKPB 4IMKC 4HHAA 5LWYH 1GGIL 1NL0H 3DO7B 3KWWB 1NBQA 4S10A 3S5LB 3RVXD 3VH8B 4RAVB 3JV6A 2XWBB 4PJIA 5JIKA 2EEDA 5JDSA 1KENH 1NJ9B 1NUGA 3TC9A 4FQ2H 4YX2H 5T1DL 2VUOA 3SEPA 4OBSA 4L8SC 4K3GA 4LGRB 3TIEA 2DMCA 3VFWA 4EUPG 1Q94A 4D9LL 3B9DA 4LCWE 4WHCA 4X7FC 1F4AA 3O9WD 5CSGA 3VXNB 3C6LA 4HFUL 4D0DB 2HG5B 5JLZB 1OAUL 4K8RH 4FQXB 4YHML 5J6HA 4PJGF 3FRUA 4XXDB 4LQFL 4AG4H 1T1ZA 2J88H 3B2UC 2HFGL 1G6RB 1AGEA 2Z8VC 2GTZB 1M6OB 1RIVL 4LHQB 1IAKB 1RUMH 3WJLA 1HHHA 3PNWB 2HT3C 3V2AR 4H0HB 5DLMH 2FIKB 1PG7H 3UJTH 4TUJA 2NY1C 3AAZA 1QR1A 3LN4B 5DD1L 3MLWL 4NQXB 2NX5B 4N5UA 3LSOB 3EJYD 1ZHBA 3W9DB 3KPRD 3KNBB 1ERNA 4WTWA 4YQXL 1FZMA 4HUKB 2CLZA 5FDWB 2R23B 4TSCH 2IJ0C 4Z7VE 3NABH 3GMOB 4OCWH 3MCKA 4NQCA 1IQDA 2NY7H 4ZSOB 1TVHB 5HSFA 5DYOB 5D7JA 2R29H 3DROB 3DXAB 1K6QL 4ZPTB 5C07A 3U0TB 3SGKA 2IADB 5LGHL 3NPZB 4FTVD 4CJ1A 5GZOC 4KQ3H 1RZ8A 4X6CE 1CD9B 4JB9H 5HI4C 2NY3C 5T1LA 1A5FL 1F4YL 5E2TL 4DTGL 4XRCB 1S7RA 4G8GE 2FEDC 1NC2A 4OBRA 4DZ8A 4LHUD 5IMKA 1U95A 5BOZG 2A6KA 3LQMA 2X4NB 3UO1L 1FNLA 1NFDB 1XF3B 1E4JA 1YMMA 3ZSSA 4ZFOA 1XGRB 4Y4KB 3IFLL 4OQ1A 1TZGH 4PB9H 4UQ2A 2B20A 4JM4L 1NCAH 4CU8A 1TPXC 4QCIB 3QIUD 3I9GH 3LEYH 2WW8A 4M7LH 3ISWA 3FQXB 4KK8D 2UWEB 5GZNC 4FP8L 5I1HH 2UZIL 2F58L 2DIAA 4FFVC 2NY6C 4GBXB 2EH8L 1KCVL 3T4YA 4GFTB 4R97B 5IJVB 5IGXH 4FZEH 5IQ9B 1HDMB 1QLFA 4LNVA 2GUOA 4JPVL 3KPSB 1RJCA 3WEXB 3RUGA 5LQBL 2IQ9H 2R2EA 2F19L 2FLRT 5DJ8A 4UQ3A 1J0KA 3MZTA 1MJJB 1CICB 3X13B 2YPKB 3NIFE 3HC3H 2BJML 2AGJH 1UM4L 2YKLL 4QLRA 5IK3A 2Z0BA 3ARWA 4FOMA 4XVTH 4ENEC 3BUTA 3DTXB 5MP6H 2CKBL 1JGVH 2HJKA 3S37X 5L9DH 3BPCB 3MACL 4M43H 5F6IC 4AENB 4JCMA 5CBEB 4EIGB 3MJ7A 4PGEB 3DSFL 3PV6A 5DURB 2JTDA 5E8NA 2VDKH 4Y19D 2D7TL 3P4MA 3WUWG 4WNQB 5EZJB 4JO3H 2VXUL 5C0CE 2CK0H 3Q0HA 3SKOA 4V1DD 3GHEL 1Z6JT 3EJZC 1C08A 4QHMB 1XGPA 4Y2OA 4JGMA 1WBYB 4RRPG 3RIFF 4OKVA 1FORL 4RMSA 3T77B 4XP1H 5IKCB 5T5FH 5I6XC 5D93C 4Y16B 4NRXA 4N90D 1OAQL 4OLZL 1J87A 4DFHA 3I6LD 3K2UH 3ARGC 1T7ZA 3QEQD 4JG1L 2HJFA 5J11C 3D0VB 2VLRD 3DX9A 2CPCA 3E3QC 4JRXB 5L0QC 4B41A 5IFAH 5D7KD 3RWHB 1T0PB 4KJQC 4OLEA 5GRJL 4HBCL 1HHGA 5FUCE 3MXWH 3ZKMC 4OT1L 1X4ZA 1IL1A 1VEMA 1QNZL 3QUZC 4Q9CA 4HGWA 4OZGF 5FO8B 2Z31B 1HCFX 1G7HA 3MOBL 4JR9L 1RZGA 2NX5E 2VNCA 4QRRA 4PGBB 4M93C 1LEIA 2JK5A 1I3RA 2AK1L 4N0FA 3DUHA 1U3HB 2D03H 4G6KH 2C1PA 4I0PC 2BC4A 5J06A 4CMHC 3P9LB 1SEBB 2VLLA 4GT7A 3C60D 1ODAA 3ARYA 2DTSA 3PWPA 3PXJA 3GSUA 3KG5A 3BD3A 4ZSOE 5I1IL 3K1KC 4QHLB 5F9JB 3DXAE 5FYJU 3IDIA 3Q5OA 2B1HL 2FGZA 1UB5A 1A3LH 1TIUA 1OGAB 4YXHH 2OL3B 1S78D 3RGHA 1Q0XL 1IKNC 2IAMD 4EI5D 2ERJC 3BIKA 2Z92B 2AK4D 3EO9H 3DHMA 4XP9L 2DD8H 3WKNA 4P0DA 1X7QA 2VZ1A 4J12A 4KI5F 4OLWL 1MWAH 3LKQA 4I13B 5TQ2H 2WBJD 4MCYB 2B1AL 3UTZB 4C83B 2VE6A 5D2NA 2OQJA 3P0VH 3QUXA 1N0LA 4WW1B 3ZDXF 3KJ6L 4HUMB 2IBZY 4AL8L 3HLAA 4RCAA 3ZO0A 4HC1A 2R9HD 3WO4B 1FFOA 3PQYA 2FECI 1IAII 4P2OD 3CFCL 4I48B 3TCXA 1CFVH 5DQJA 1S5HB 4WI2A 1WUNT 3MBXH 3TYGL 4FQIH 1A6AB 2UWEE 5EBMA 2XZAH 3ZTNL 1A7OH 1VACA 1XIWD 4KRLB 5IFHH 5JDJA 5MEOB 1IC1A 2JE8A 4KUZL 1RURH 4UV7L 2IG2L 2GJ6A 1IARB 5FM8A 3A0OA 1UWGH 3C09C 1KXQE 3OAYK 5DR5H 5E03A 4L3CB 4LCUB 3CUPB 2NY0D 1I8MB 1JYWA 2AXGB 4J4PA 1YYML 2HTLC 4GG8B 4PV9B 4ZUUA 2VITA 3FONA 2VABA 4PRNB 4FHBD 4WGWB 5FF6A 5IF0B 5EIQA 5JW3L 4XZUB 4R3SA 1E4WH 2DF3A 2LTQC 1GL4B 2ZUSA 3REVA 3JWNC 4LGSB 4NO5A 2EDKA 1I8IB 4PJCB 3MODL 1NANH 4TUKH 5IBTL 1JPST 3ULUL 3GDBA 4QYOA 1OLZA 4MCZA 2VDOL 1T0MA 4Y5VB 3CXDH 4JFQB 4DCQB 1D5XB 3FB5A 3HUJF 5BS0A 5HD8D 1G7LB 2FYYA 4PBXA 5GSRA 2AEWA 4Z95H 3BYYA 5GJSH 4KI5C 1U8MA 2CQVA 2AERT 1TQBB 1HXMB 3D1MC 5FYLH 1RUPH 4P5KA 1DVFB 1I1AC 3QDMD 4PRAB 2KPNA 3K1DA 4ZOCA 4TTDD 3M17B 1T1WA 4M6ML 3IDNB 3U4BL 3NFPA 1JNLL 1DL7L 4X7TB 5CZVH 4D0BA 5HHOA 1BBDL 4X0KB 4JRXE 1UJ3B 2J8UF 5KVEH 2E9IA 3KXFB 5F6HJ 1J1XL 5ESVA 1HXYA 4OB5L 1G7QA 3NPSC 4NZUH 1FFNB 1MCWM 2PYEB 2V7HA 2WWKO 3JTSA 5ISZD 4R0LB 3TA3B 2OJEB 5GGVL 1T04B 4HJJL 1U6AH 5K9KB 3MLXL 3D0LB 5H2BB 4N8VA 5JW5B 2JCCB 4NHUA 5GS0H 4ZYKA 5JHDE 4G7YH 5EZLA 2EDJA 3SKJH 2FX7L 3VWJA 2J7LA 3C6SB 3LQZB 5MEQA 3VGHA 1S7QB 1OAYH 3T65A 4W68A 4ONFH 4WCYL 2OK0H 3VXOB 1NAMH 3QIWC 3O3EB 3BKML 1J1PL 1RZJH 4Z6AT 2Y5TA 2VQ1A 3GSNL 4QRSB 3FN0H 3F7YB 3MCLH 4F7CA 2EDQA 4B5EA 4LVHB 4P5TA 1U0QA 1T5XB 4A6YL 4OV6F 5FCUL 3HI5L 4NRZA 1VKXB 1HHIB 3EDJA 2APTA 3OKNA 1A1OB 2UVEA 3V4UL 3QNZB 4UDTA 1EV2E 1OGAE 3QXAA 3SCMC 5ILTH 2X4OB 3CVHH 3DMMB 4EUPB 2IQAA 1A9BB 3CK0L 1J12A 1CF8L 2WBWB 2Q6WA 3VGEA 5D2LB 3GIZH 4IOIA 2VN4A 3EGSB 4WY7L 5FA3B 2FX8L 5DK0A 3RDTD 4WWKA 3LRSA 5JUEL 3S3JA 8FABB 2WANA 1SY6H 4YBHA 3D69B 4NZTH 4JZOB 3MR9A 4KU1A 1HSAA 1L0XA 3FQWB 1WQVT 5GSVA 1EO5A 3QG7L 5ITBH 4X7SH 1CLOH 1FAIL 4ELMA 1Q9WA 1MFNA 4P2QA 5EUKB 3JWDC 5GGRA 1MVUA 4I0KA 1R5WB 1NBZB 3TFKC 1IM9B 4MAYC 4JFDB 3BHBA 2D31A 4NP4H 1U8JA 4R7NB 3T4AA 4K94H 5C70A 4DGYL 1E4XL 1JGLH 3OAZK 3QHZH 4HWBH 3WNMA 1IC4H 2ATKB 3KAAA 5DFVC 3BKJL 1DBMH 1WZ1H 1CGSH 2UYLA 2Q7YA 3U1SH 1EH9A 2A6DA 1T7VA 2WIIA 3S3SA 2IANB 4HBQA 4AQ1B 4NQED 3ARDC 4TOYL 1G0YR 1SJEA 3C5JA 4M48L 4QHNB 1CZ8H 1FC1A 1CFNB 3S4SG 1UADC 2YRPA 3F7VB 1OM3L 1SMOA 2OTWA 4QRTA 1P9MC 1O7VA 4WW2B 5EG6C 3ZKNC 2GITA 1KC5L 4JDVA 5CJQH 2J6EH 1EUTA 1H15B 4PJCE 1A7NL 1HQ4A 1BX2B 1T1YB 4RGNB 5EB9A 4OTXL 4D9LH 3SDXE 4F37K 4AH2A 4F9PA 5E9DE 4FQXC 5I8CB 2K7QA 4LVOB 5I1DA 4MQ7A 4WFHE 5IEHB 1NCTA 4UT6L 4YHMH 3QA3B 1F6AB 1NFKA 1ZS8A 3FB8B 1CLZH 1S7VB 3AS0A 3RTQD 2HFGH 3MRFB 1FIGL 3NA4A 2YBRA 3EDDA 3QZWB 3FB7A 3LMJH 4X4XA 1S9XA 2ZUXA 4P23B 1R3HB 2MWCA 2DM3A 1TNNA 5INDB 3SO3B 3O6ML 4LPYA 3CU7A 4RBPH 4YHLL 3BXNA 1LMKA 1LHZA 3QIBB 4NBXB 3MRIA 3ZT7A 3SJVA 1SJHA 3FQTA 3T3PF 1QRNE 1Z3GL 2ITDA 1N0XL 1YUHB 4X4MA 4ZDHA 4GKNA 1NEZB 2A74B 1C12A 3VWKA 3EFFA 1EHXA 4YQXH 2XPGA 3HS0A 2AS5M 2ADJA 2OTUB 2XTJC 2A0LC 4JFFA 4OLXL 2AAVA 4Y89A 4QXTB 5H37G 2PYFB 2D4DA 4YDLB 2QADC 1G0DA 3RZCA