4EN3A

Crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
186
Chain Sequence
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATYDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSVCLFTDFDSQTNVSQSKDVYITDKCVLDMRMDFKSNSAVAWSNKSDACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis for Recognition of CD1d/alpha-Galactosylceramide by a Human Non-Valpha24 T Cell Receptor Struct. Title
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
total genus 31
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A02
2V5TA 4HPOL 4PGCB 1MCNA 3IFLL 3QB7C 3THML 1QRND 4EBQL 1AIFA 4PG2C 1BVKA 4JB9H 3G6AA 3SQOL 3SKNB 1AO7E 1K4CB 1N8ZB 2F19L 5ERWA 2A9NH 3PHOA 2BCKA 3AXLB 2Z31C 1ACZA 4JRYD 4XMPH 1KELH 4XCCH 4Z7NE 1RMFH 4EI6B 1E6OH 1ZEAL 4OD1L 2GK2A 4JY4B 1N7MH 3QT2A 1HHKB 3BIKB 4GKZB 4HIHB 2JIXD 3CFDA 4GMSH 4M7LL 4M6MH 3ZKMC 4QRSB 2R56L 3BP6A 4XC3L 1JHKL 4R8WH 4R96B 5H2BA 3RVUC 3T08A 2XA8H 3VH8A 2QQNL 3QIBB 1BJMA 4PLJD 5T1KD 3KYNA 4OSUL 3H9SE 3T1WA 4Z0BH 3OKLB 4M03A 3MJ8A 2AK4E 2FL5B 3ZDZE 1RVFH 3HUJB 3SCMC 3MUHL 3EGSA 5EO1A 2XKNB 3KNBA 3MR9A 1XR8B 1CXHA 5ESQA 5EU4B 3ULSA 2AJYH 3E8UL 3EJYD 4FQIH 5JXEC 3C5SB 2GJ6D 2WWKT 3BIBX 3MOQA 3OJMB 4HK3J 5E00A 2I9LA 2JELH 2P5EE 2ZJSL 4KDTA 4K3DH 2HFGL 1JE6A 4X4XB 3SDDA 2Y5EA 2FATH 5B38A 4NZRL 4XVSL 3RVWC 4JFFB 1TNNA 3JV4A 1YEEL 5DQ9A 2Q8AH 5F96L 3S96B 3TN0A 5HHPA 3X3GH 4PV8B 2HRPL 5FDWB 1NFIA 4PJGF 2GCYB 4YHZH 5H94A 1AI1L 4DOHE 3DROA 1KB5B 5E2VL 2WUBH 1M7DA 5JW3L 1AFVL 1GGTA 4OQ1A 3TO4D 5E9DA 6FABH 2EC9T 1YEFL 1WJ3A 3K80A 1JRHL 3EOYG 3W2DH 1Q94A 4AYFA 2OI9B 1Q72H 4OZFB 5D93B 1FZJB 3NCMA 3NFSL 3H9SB 1A4JB 1FQ9C 1Y6MR 4MQXC 4YE4H 3P4NB 4DFIA 5B3NA 4CVZB 3B5GA 1JFQH 2H2SD 4ELME 2WANA 3WLBA 2KBGA 1MEXH 4Q58C 3QUKB 3RZCA 4H5SA 3D85A 1EIBA 2GW5A 3MLXL 2DWEA 4XX1G 2X4RB 3H3PL 3TJHD 3GGWA 5F7EH 3OHXA 3BX7C 3CFKA 3SPVB 4ZNCD 1MHCB 5CEXB 1C1EL 2B2XL 2X4TA 5EO0B 3OZ9H 5F21B 2JJSA 2WBJC 3BSZH 4EUPB 1PYWA 1T5WA 1OAXL 2X40A 1CXLA 5E4IA 3QI9A 4JQVC 4X98A 4HIXL 4P5TA 4JHAL 2CDFA 4WGVB 4R90H 4ODUB 3WNNA 3T65A 4FRWA 1KEML 1CLOL 4OQTA 3IYLW 4U0RB 4BH8B 1OWRM 3JWOH 4X99A 1OHQA 3OXSB 4G9FE 2EO1A 4HWZA 1JPFB 4Q6YA 2G2RA 2J12B 1D6EA 4E5XB 2VQ1B 1NCAH 4PBWD 5FYLD 4M1CC 4BSJA 3BZEB 1IGYA 1X5HA 2YC1A 5I74B 1B0GB 3VXUD 3KXFB 2D03L 1AP2B 1D5BB 2HT2C 4GSDL 4PLKD 2DIJA 5DZNA 2AV7B 5D72H 3I6GA 5E1AA 3QZWG 1C08B 2R0WH 1CZ8H 4DVRH 1RAMA 3L5IA 4NQCA 4G9DA 4NQUA 2AVGA 2AJXL 2FX8L 5FYKE 4UINL 3W5NA 3HAEH 2DKSA 3OKDB 5CP7B 2ITDB 3T77A 4MDJB 4IRZL 3MV01 3EYVB 1AXSB 3QFJD 1YYLH 3ZYZA 1F5WA 5K9JL 2EDNA 4LARL 3ORJA 2MCPL 4LVOB 1G6RA 3KYKH 4JVUA 1RK1A 4XC3H 4G8IB 3MNZA 1CBVH 1XH3B 3BHBB 1BBDH 1SVCP 4J8RA 2JCCA 5J6GB 1TXKA 1YQ2A 2AKRB 3C6LD 4J3SA 4ZPTB 3QWRA 2V7NA 1S5IL 2Q86A 4KK5C 1JPTL 4CN4A 5JXEA 1VFBA 3GMOA 4NUJA 5J6HB 2VKWA 4PRHD 5DUML 2FX9L 4HQQL 2L7UA 2R39A 12E8H 1TVHB 4BUHA 3B9KB 5IVXB 3DYMA 3V7AG 1JN6B 3MRJA 4DCQB 1GGCH 2PN5A 1SY6H 4JFXB 3HA0A 5DMKA 4LSVH 1VEPA 4L3AA 1XF1A 2NW3A 3V8OA 4RSVA 2CLVB 5JOFA 2FD6H 3KJ4C 3ULVD 1IKNA 4I77L 5TE4L 3B5TA 2BRQA 3BEWA 5D4QA 2ITCA 3RVUD 1BZ7A 4OTXH 2EH8H 1GZQA 1NCBL 3BN3B 1FL3B 4Y16C 4NQSB 3VWJB 2CK0L 4TSBH 2K7PA 2DDQL 1Q9OA 4N9GB 2P42B 5DQDL 2FO4A 2HKFL 4G42A 5DJZB 4BM7A 3DV6B 2DQJH 5BQ7B 1EHLH 4Y4KC 4RGOL 2V6HA 1AXTH 5L6YH 3ZYOA 5TDNA 1I9JH 2WBJD 2XKUA 4XP9H 5TF1H 4H0GA 4MA8H 5C09B 1AKJB 4PTUA 4PJCB 1I8KB 5C6PB 3C8KA 2J6EH 1V3MA 4LSSH 4L8BA 4MNHB 5C0EA 3WFBH 2LVCA 3IDMB 4M02A 1J0ZA 2BVQB 2EEBA 1ZLVK 1HIML 2EDJA 2LQRA 1C5DA 3E3QC 5ALBH 5SWQA 3PHQB 4CU6A 3QULA 35C8H 1G7LA 1BP3B 4Z76B 4U6VH 3GO1H 4KTEL 1CIDA 2J3SA 3PWLB 1F3JB 1CXFA 1ZHBB 4KU1A 1SJXA 2VDQL 4LGRB 3IJHA 4R4NC 5IFAH 1AO7A 5LBSL 1CIUA 2QSQA 2X42A 3HRZB 3C2AH 4IDJH 3VDCA 4F3FB 4UOW1 4O2FA 1MLCB 3Q3GA 1YEDA 2R1YA 5DJDA 4P5MA 3HZYA 1FVDB 3SDYH 5E99H 4CN6A 4Z77A 1LNUB 5DJ2B 3IAGC 2KH2B 5L7XH 1M7IB 1NCAL 4KMTL 4MQSB 5CJBA 5D1ZA 5F9WB 4QYOA 5C0DB 4M8QB 4TNWF 1U2CA 1F3DJ 1ULVA 4NJAH 4P3CH 5IVOA 2HRPH 5DS8B 3EYSH 3S6CA 1L0YA 1QA9B 3KHOA 1I1YB 4XPBL 3QPQC 3HUJA 3KHQA 4HEME 4XNUH 4X8JB 5E6IC 2YZ8A 3GSRA 2XZQH 4I48B 5D7JA 3ULVH 2AJUH 5KAQF 5F9WC 2ZKHL 3STZB 4NBXB 2E6PA 4EI5D 5F7DB 1FAIH 2ENYA 3IF1B 1U93A 3LN9A 5GZNC 4ZFZA 3SHSA 5CWSA 1N6QH 1KOAA 1RK0A 5CJ8A 1W2KT 3R06A 2BX5A 3UTZB 4Z7VB 2AK4A 4UIKH 4OFYD 3UAJC 3ZKSD 3U7YL 3CCHB 1KPUB 2Y5TB 3I3EA 4TPRL 5HHPB 3UTSA 4CGTA 2K7QA 3HPJA 3LS4H 4AEFA 4KXZH 1KB5A 5JPMB 4MXWL 4RX4A 1DSFL 1LO0L 4XAKE 4FN0A 3BZ4B 4O5LH 1A0QL 4TSAH 1I8LA 3L5XL 4CL7A 3BKMH 4LAQL 4P2RA 3OR7A 3OX8A 4AG4L 1A6WL 5CUSL 1NGXA 4K8RD 4M1GH 1UQSA 3GBNH 2G75A 4KZDH 5KAQG 4S1DC 3NH7L 3VCLA 4LLDA 4TNWK 1EAJA 1AR2A 5ITFA 1P7QB 2NXYB 1FG9C 3P4NA 5EOCJ 5IMLB 4FQJL 1T1YB 4HFWA 1QYGH 2O93L 3O41A 3QEQE 4XNXL 2Q8BL 5ENWA 4TOYH 2B1AL 4ZFFB 3S98A 4Q74A 5B22A 1LK3H 5JW5B 2A83A 3D85B 3TA3B 1LK2A 5AAWA 1QOKA 3CLFL 1GYAA 5FYLE 1D3CA 3QXDB 1JUFA 1QQDB 3GMMB 3K2UL 3QIWC 2OK0H 3QDGD 3IRZA 1AGBB 4MHHG 3M17A 2WP3O 4WIQA 4EI5B 2VC2L 3ARGD 1WFTA 2GSGA 1QTYT 1NKOA 2X41A 5D71H 1AE6H 3MLSH 4D8PB 4WHCA 5MEOB 2PYFA 2LAGB 3HR6A 5K59E 4G43A 1MFEH 1OQOA 5FF6A 2VITB 4ODXA 2KKQA 4NYLB 3MC0A 3C6LA 3KGRA 4LSTL 1HSAA 1CICC 4KHTL 3LZFH 3IRPX 5CSZA 4OGYH 2EO9A 4A2MA 3FRUA 2N1KA 5IFJB 3HE7D 2FLRT 5BO1H 5I1GH 3FQXB 3BAEL 1RY7B 5IMOB 2YD2A 1NANI 3PJSB 3HCVB 4JB9L 3EO1A 3Q6FA 1UWEL 1OP5K 2VDQH 4ZAKB 2MQ0A 4NM4L 2IADA 2YR3A 1VADB 1S7WB 3I3BA 1ES0A 4TVPH 5KVDH 1NC2B 3BGFB 4J6RH 4PV9A 1RZ8A 3EYOA 2A77L 5IB1B 1NFKA 5IGXL 5D6CA 1H8SA 1YEJH 2UV3A 4XPFL 1OGTB 1PLGH 3O4LA 1MNUL 2X4PA 4NGHH 2W91A 2DQCH 1TLKA 4DJMA 1X5ZA 4ZTOH 2CIKA 4KKCC 1RD6A 3UEZA 3RNQB 5JXAH 2ID5A 4KK5D 5DQJB 4YXLH 1UZ6E 5IEKB 1VGEH 4XZUA 4YO0A 3L7FB 5DK2A 4WDIB 1LGVA 1MVUA 3QBTB 4M7ZB 5FAAA 5LKNA 3K0WA 1AHWB 2P24B 4Y1AE 4PGDB 3QHFH 1Y6KR 3HE6B 3MZTA 3A67L 1NAMB 1VA9A 4NZRH 4QNPE 3LQZA 1RIUL 1U8HA 3JSSA 5KVGH 3UPAA 5FXCH 1I1AC 2KUTA 3FFCB 4G5ZH 3HZMB 4X9HA 4P2OC 1J12A 3DVNB 1CE1L 4OIAA 1A3LL 4AT6B 2VXUL 2XFXB 1WQVT 5EDXA 4YX2L 1JHLL 1BBJA 1CVSC 2ZUQB 4PYGA 4JZJB 3WIIL 4DZBA 3L3IA 5ADPH 1G7HA 5IQ9A 1I7ZA 1BZ9A 2Q8BH 4QRTB 5FB8A 4P23C 5DUPL 3D0LB 2NW2B 2FJGB 4PJGA 3WHXA 4JLRB 1QO3A 4HH9B 5I1JL 1PG7L 5T3XD 3E2HC 2IBZY 4NWTH 3NACH 4HUNB 5CLTA 4WO4B 5HYSA 4HWBH 5EO9A 3I50H 4PJCA 2X9XA 1EFQA 1YMMA 2OMNA 1SJVA 3STLB 3VFWA 4EUPH 1D9KC 4G8GE 5F89A 3I3DA 1MWAB 2IMNA 4HF5L 2LU4A 4YK4B 4EBQH 1VKXA 4KQ4H 1DVFA 3ARBB 1QHPA 4K9EL 3OB0H 4MAYD 4MA3B 4G8FB 4UIMA 4OIIL 5C0AB 2NY3B 4UB0L 4PRID 5F1KC 2FRGP 1ZT1A 3QNXB 4MJIB 2HKFH 3U30B 2YSSB 1XZ0A 2BVUA 5IBLC 1ZS8B 1J0JA 4XP6L 2V9TA 3MCG1 2R56H 2X4NA 2BSSA 1K8DB 5D7SH 4KXZI 4XNUL 4L4TB 1PDKA 5SWZB 1UB5B 1FSKC 4NQDB 4HIJB 4U1NA 4X5WA 5EG6C 2F74B 4JQVA 5D1QC 3A6OA 2V17L 4LEOA 3DRTA 3QEQB 3N1GC 3FCTA 4LPWA 4XNMA 1KLFA 4Y4FC 4EDXA 4OCXL 3S7GA 5C0RL 3WS6A 3BP4B 3ZKND 3NVQA 3AU1A 1IGCL 3QO1B 1RI8A 3KXFD 1YY9C 4M5YL 4WFFD 5JOPE 4MLSA 3HE6C 5ALCH 3LDBC 1RUAL 4R0LA 5C0GB 4NHCL 2EIEA 3OKNA 4QCIA 2DBLL 4GO6B 1DL7H 3RWGB 2AEWA 2VMFA 5C2BH 1J5OH 4L4TD 3DV4A 4Y19A 5F9DC 4J4PC 4GUPB 3HC3L 3WFHA 4ZTPH 5LVEA 4RGMB 4F9PC 3BVNB 3CAFA 2PCPB 3VXTB 4JFYA 4NNYB 5D7JB 1WFUA 4CMHC 1P84K 1RZIA 2FLBT 3U7AA 1BBDL 1O5DT 3ZSTA 2XTLA 1TCRA 4Z7NF 1V05A 2Z4QB 4H8WC 4ZSOE 2W0KA 2X4SA 3SCMD 2DQCL 5IQ7L 4XBGB 1HH9B 3IFOB 4PY7B 1A9BA 5EBMA 3OGCA 2F15A 2FX9H 4RGMC 3ZMRA 5I66A 2WLZA 2AGJL 2YD7A 2QQQA 3IKCB 4JPVL 4GAGH 3MLRH 4XPHL 4ODVH 2OK0L 1U8IB 4WU7B 3MNWA 3TZVD 5CJXA 4PR5A 3D87B 5TFSL 4PJDB 4Y2DC 4FNLH 4KROC 3ULVL 2F54E 4KI1A 5C0NC 3FOMA 4KJWC 3VCLB 1RU9H 1JRHI 1VFMA 1MH5A 3TIDA 1PZUB 4GRWH 2XNAB 2NY3C 5I1JH 3GKWH 1T1YA 3B6SB 4GS7B 5HJ3B 2ARJQ 3DI3B 4IMLB 3MV9B 1OM3H 1OF2A 4K7PH 4J3TA 5DA0B 2H2SC 4OTXL 5K33A 1HH6B 5GSRB 1GZPB 1KIQB 15C8H 3EHBD 2ZSWB 3B9EA 3QIWD 1TVBA 5MEQA 1LO3H 1OT2A 3MMEA 2P8MA 4DGYL 2V7HA 5L2KB 5I8OH 2CKBB 5A1AA 1VGKB 1P69B 3HNSL 3LEXB 1XAUA 2F8OA 2PR4L 3ARRA 1JF1A 2G60L 4Y1AB 1I85A 2EIZB 2H6PA 1NCCH 4QXUH 1MHPL 1KC5L 2EKSB 4M7JH 5T1LD 4KWUA 1J8KA 5DD6B 1EBPA 4PGBA 4BSVB 2EEAA 4JRXB 1GPOH 1OP5H 5DD0L 1CCZA 4YHIB 3V79C 2EDEA 4K8RC 5GRVL 1QRNA 3UXFA 4XNZB 1KBGL 4OF5A 3DXAD 1EJOL 1HXMB 5IM7A 1QG3A 5DWUL 5ALBL 5GIRB 4RMSA 2F54B 1F02I 3ARPA 3ZT6A 1FRGL 5CEYA 5EPMA 5ADOL 3U9UB 1DN2A 4LDOB 2E7BA 4S1QH 1YECL 5ACLA 2VLJB 3DBXB 3JV6B 4FXKB 5L8LB 1K4CA 1N8ZA 4IIQB 2YUXA 2GTZB 4J23A 4XP4H 1P7KA 1ZHLB 4G6JL 3BKYH 5GGTH 5L88L 4HKBB 4O2EB 5E70A 4ODTH 4WWID 2Y1VA 1YY8B 1CGYA 2CQVA 5KSVA 4PRIA 3T0EE 5HHXH 1F4WL 2FEDD 2A9NL 1CFQA 2CJUL 3RWCA 2FEEI 3O6FA 4JGMA 4WGWB 2I9TA 3O2WH 3O8XA 4G5ZL 1S7XA 3VXQA 1EEYA 5KSBF 2HJFA 5DTFA 4JN1H 3GSQB 1CG9B 4HGMA 4NT6B 4UOW0 4GOSA 4FQXA 3HFMH 3MJ8B 2ADFH 2AJ3A 4RFNB 3UTTA 1S5HA 2DRUA 5DJ8A 4X7SH 5DJYA 1N64H 4L8SC 1SJEB 2R29H 4XHQA 3BISA 2JJUA 3WHE1 4PJDF 5IHUL 2DD8H 4Z78B 4YQXL 3RKPA 1HNGA 2I9LB 4K94H 1TTFA 5JPNA 4BYHA 1IKFL 2XWTA 2DJUA 4JREC 3RUGF 3DTXB 2X6MA 2GITB 1AQKH 3RAJH 3KS0J 3KYNB 1OW0A 3MLRL 3MYJA 5IVZB 2ICWI 4KRPB 2VDML 2VLJE 5EOCL 2OLDA 3RX8A 1INQA 1KLGA 4A6YB 1XIWA 2Z35A 2BVOB 1FVEA 4Y19D 5AUMA 1QSFD 4P99A 5IB2B 1VENA 1D9KD 3LKNB 4UUJA 5ESQB 5EU4A 4BH7A 2VLRB 4K8RL 4AZ8A 4H20H 2NYYD 5D5MA 5IQ9B 1P7QD 2NXYD 3QIUD 2C3VB 5FYJL 5I2IA 3TWCH 5DD1L 3VFOA 3RA7L 3BH8B 1FZJA 1MCIA 2HG5A 3L7EA 5GGVH 1J0IA 1J9CT 3T1FB 2N4IA 3L9RB 3S96A 4OLYH 1IT9L 4H1LB 4MSWB 4RBPH 4CU8A 4HXAL 3HB3D 4PJ8B 4GRMB 1KCSL 3P40A 3GI8H 3F7QA 1PW3A 1C5BH 2UUDK 3LQAL 4L4VD 2YD8A 1NBQA 2QR0B 2X89A 5CKAA 3PWNB 1ZVSB 1MHCA 4JFDE 4NWUH 5CEXA 2IH1B 3WXVL 2XKSA 1RIHH 2PTTB 2EE9A 5KSAB 1HXYA 1DEEA 3VXMD 5EU7C 2HT3D 4P5TC 1KULA 3NCEB 2BDNL 3T8XA 1K3IA 2XY2A 2HAZA 1QD0A 3RIFF 5ABDE 5INDB 3QNYA 1GC1L 4PYHA 3WNPA 3AB0C 5JO5B 3FT2B 4NKMB 3OF6D 3GNMH 4Y5VA 4YBQC 4HHAA 3FQWB 1YY9D 3RWHB 4JFEA 1CLOH 1T1ZB 1J8HB 4ELMA 1U41A 3WFEL 1FNSL 1MCDA 3SY0B 3VWKB 2BMKB 2C9AA 5F7KC 2X44D 1OP3K 3GI9H 5JW4N 2X09A 1U0QA 5TPWL 2OL3A 4PJ5B 3O2WL 4WCYH 3T0WA 1NAML 3RL2B 5GJSL 4LU5H 1QEWA 5E2UL 3FAXA 4MCYB 1XGRA 4E41A 4Y19E 3QR2A 3LOWA 1DUYA 1FNGB 4RDQF 1MJ7L 4OCLC 1FV1B 1T04A 5FHBH 5J8OA 5DJ0B 4DQOL 3OAYH 3LV3B 3U7YH 1FFPA 3DVIA 3EZJB 4HW6A 1IGIH 1B0RB 4DKDC 4F15C 5ID1B 1YNKL 1RUQH 3UTPD 4LFHG 2QKIA 5HGBA 4HMDA 2IG2L 3K1DA 3NCJH 2WIIB 2EZ0C 1EHAA 2BNUB 4FQHB 3GSUA 3DUUA 3MLTA 4M00A 5D2LB 2R2HA 4UBDD 3CFCH 2KZ1B 3QO0A 4X5LA 4GRWE 3LQAC 5E4EB 5E08H 3MLZH 2YKLH 3TFKD 1DN0B 2G5BA 4NRXB 2GTWB 4LCCB 4K7FB 4IS6A 1QVOB 3UTTE 1J0HA 4KPHH 4OLXH 1YYML 1T5XB 3N1FC 3HAEB 3B8SA 3VXUA 2HMIC 4YDVB 3VDAA 2P48B 3RWJB 3QIWB 2ADGB 1QBMH 4OCRL 5DD1H 1A7NH 3FOMB 3R1GH 5KSAC 5CEZH 2VDMH 1HINL 1BF8A 4MAUH 1MCJA 1J18A 1TIUA 2FJFB 3H7LA 4MNQB 3OAZH 2M2DA 3RPIA 5GS1A 3PDDA 4HXBL 1NCUA 4N0CC 2PNDA 1F13A 1HH6A 1ZWIB 4KQ3L 3D3VD 3QWOB 5DLML 2NXYC 2D7OA 4OUUA 1PSKL 3L3HB 2F54D 3ZKXC 1YEHH 4LSPH 4NKIL 4D3CL 5DF0A 3B9KD 1T80A 4GBXB 3O11A 3B3IA 2X1WL 2FR4A 1G9NL 3GIZH 5A2LH 3OXRA 4JG1H 4OCYH 3S37H 2KQNA 3M07A 3FB8B 1YN6B 1YPZF 4HGWB 1KJ2H 1TJHH 3SDCD 5KS9B 3NCFB 1EEZB 2X4OA 3FO2A 1BOYA 4LNRA 4RZCB 3UYRL 2CMRL 1JBJA 4HIEB 4PJAE 5F9OL 1UJ3C 3SO3B 1MFBL 4OKVA 3I75B 2WP3T 4JHWL 4PRNA 5L2KD 1FGNL 4U3XA 5C07D 4LVEA 5D1ZD 5ACZB 1UH4A 2I27N 2OJEB 1VACA 3ILQD 4LLAA 1EEQA 3RJQB 4FS0A 3PXJA 5I9QC 4GRWF 4Y16D 1KT2B 5HHOE 3JWOC 2EH7L 4U1SA 3GO1L 1AD9A 3VE0A 4HK3N 5IHBA 4FQLH 5LGHH 3E3QE 1QR1A 4XPFH 1JNHB 2EXYD 1Q0XL 2WWMC 4N5UA 3ARBC 3WUWB 1I4FB 5DC9B 4P5MB 1MCBA 2XICA 2CIIB 5SWQB 4ZYKA 5H37H 4TUJB 3D5OF 4GMSL 2GUOB 4I4WA 4P2QE 1X5LA 3FOLB 4XGZB 2EXWC 3RL1A 4ODHH 3GB7A 1JV5B 4IRSC 3QJHA 3DLQR 1S7RB 4PJEF 5EZOL 3QUXC 2OX5A 4LEXL 1GGBL 4C83B 3RI5F 1O7SA 1FNFA 4NO0B 4EXPX 5A3IC 1MJUH 4LP5A 2J5LB 1MFCL 2APXA 3LKSA 1NDGA 4Y4FB 5F7HA 3PWPE 2I07B 4RMVA 3T2QA 2J1KA 2AJYL 3E8UH 4FQIL 1NCDL 3ALXA 5C07E 5JPNB 3X11B 4E42A 3TIEA 1CLYH 3FO9B 4N0YH 2KPNA 4MX7A 4PJ9D 4CU7A 5AG8A 5ADPL 2AERT 4UNVA 3QZWA 4PG9A 1FBIH 3MJ6A 4MDIB 2BZDA 3LD8B 4DW2L 1CF8H 4GW4B 2X4QB 5I8EA 1V7ML 3FTGA 1VCAA 1MI5D 3R1GL 1FZKA 3ZYJA 1S7TB 5GRJL 3MACL 4HKJB 1I1FA 1S7VA 3PWJB 4YEEA 1E6JH 5J1AA 1CK0L 2YEZB 1KIRA 1UH3A 1S7QB 4UZGA 3HLAB 1FC2D 1S7SA 1UB6B 3D2UA 5IOPA 2Q6WA 3RTQC 3OJDA 4PBVC 1NMAH 4IJ3B 5CS7A 5TF0A 2LAAA 1T2QL 4IDLA 2VQUA 1JZ3A 4MA7H 2ICES 1Z3GH 3O41B 4IRJA 1Z9LA 1X7QA 4GRMA 5D7LA 4FQCL 5IG7A 5GZOC 1D5ZA 2OTUA 3CZFA 4F7EB 3CU7A 5C9KA 1G9ML 4HGKC 1MUJA 3JV0A 3MGAA 4LIQE 3F12A 3IVKA 4Z7UE 1FN4B 5DEGB 3L3JA 4XCYA 1NGPH 4X7EC 3O2VL 1RQ5A 4GRWB 5EIQA 1NC4B 4HLZG 3CVIL 1ERNA 5K9QI 3MXVH 1CDIA 5HYFA 3L3KA 3RKDC 2R8SH 3BPCB 1FDLH 2APWA 1MFBH 1ZE3C 3C60D 4GG6F 5ENWB 5GJSH 4HULB 2UY6A 2EYRA 3VFNB 4HKXA 1J11A 2HJKA 3VFRA 1J1XH 2AJSL 3GMLA 2PXYA 2PYFB 4RAVA 5HPOA 1TZIB 1EUTA 2JJSC 4X6CE 1FORH 3LRSA 4U2ZA 3SEPA 2NNAA 2YN5A 5SV4A 3UTPE 3IS0X 5ALCL 2MKLC 5B3JF 3BZFA 1KJMA 1AGBA 3N9GH 4PD4K 4MNGE 1BGXL 2WZPD 4LVHC 2ATPB 4HIXH 2JCCB 1GOGA 2OL3H 1YQVL 5DEFB 4MNQD 4ZAKD 3UPRB 2BOBA 3FFDB 4PJ5D 3D0VA 1QEWB 4ISVB 1HKLL 4NUJB 2EYTB 4WV1B 3RPKA 1R3KA 5E95B 1F3RB 4N0UE 5C0JB 4PJHE 1NSNH 5KJRL 1JF6A 3IB4A 3P0YL 1JN6A 3LPFA 2X4UB 5F8QC 3BOVA 4XMLH 4G6KL 5DUBB 4GSDH 4ZPVB 3R4DA 2NMSA 4LCYA 4ZO8A 3RX7A 2WUCH 2X1QA 3MLVH 4BQ8A 1NLDH 3RDTB 5CBEB 1D7FA 4QF1B 4LLMB 1JRHH 2F5AL 3ULSB 3MRGA 4WWKB 2A0LC 4ZFOB 4PRAB 1QSZA 3BKCL 3VWJA 2DYPA 1ZANL 4YR6A 4JY6B 4MAYA 3OPZL 2FWOB 3AAZB 2DLTA 4X6EA 4APQA 1QSEA 2H26A 2VE6B 1CDGA 3UTOA 1ZTXL 3QFJA 1GCFA 1I1AA 5BS0D 3EIFA 1J1PH 1T03L 4WHTA 2D4FA 2DLHA 5DT1H 5J4MA 4XMKH 1M7XA 4R2GC 2FJFA 4LCIL 5TE7H 1UM6H 4MXQD 1K5NA 1J86A 5EU7E 4YDLC 3SE9L 1A3LH 1X44A 1BVZA 1PVHA 5D9SA 3ES6A 3X14A 4JREB 1P6FA 1C5DB 2EDHA 3RTQA 5DQ9B 4J2XA 1UYWH 2BY2A 5GGUA 1EVUA 2H32A 3F8UB 3BPOB 1EJ6A 5D7KE 5B38G 4JHBA 2FIRT 3OAYK 2NZ9C 1AGEB 1G0DA 3DO7B 4K7PX 3U36B 3VRIA 3CDGA 3MBEC 4P2QD 3RZCB 1ZLUH 1GIGL 1D9KB 2BSRB 1IFHL 4H1LH 4MCZB 1MRCH 5FM4A 1K85A 4Q0XH 1G7HB 3GGWB 4NWTL 1JWSB 1N5YL 2H41A 3WXVH 1MWAA 5B21A 1PG7H 2OS7A 4JO4L 2IQAA 5GSVA 4AK1A 5I19L 1H15A 3CMOL 1FCCA 4WUUD 3DMMA 1WLHA 2JJWA 1JPST 1WC7B 5HHOD 4CVZA 4GG6A 2OXHA 1ZKAA 2FNBA 4YHKL 5IVXE 5JORB 4L8CA 3BQUD 1GGUA 2AEQH 2KDGA 4H0HB 4P5KB 3EJYC 3VD9A 2AXGA 5J56B 1BFOB 1U3YA 3TLRA 3QQ3A 1BAFL 1CWVA 3NPSC 4M48L 4OI9A 3WFCH 4PJ9A 1SEQH 4BELD 1OOAA 1ZSDB 1UZ8B 5FGCB 1MIML 4PJCF 1TZGL 1LD9B 3MQIA 3GHBL 3CFJB 1PAMA 3WFEH 2VLLB 4JG0H 4HPYL 1EHNA 4MJIA 5J06A 2HVKB 2DQDL 2UZIH 3V6ZB 2C3WA 3BKJL 4KUZH 3HG1B 2B4CL 4AENB 3O4LE 2NY0C 1N7ML 4U6XB 4ELMF 5TQ2H 3VGEA 5T3XL 3NTCL 5CGYC 4Y19B 4ZNEA 5A43C 2R9HD 4XCFL 4XXCC 3U0TB 4WW1B 4LSDA 2RIKA 1K4DB 4POZD 5I1AB 4KVCH 1I3UA 2LV4A 2XZQL 3DIFB 4NBZB 4XCNA 1QFWM 2Y07H 4Z0BL 1CL7L 2NY6B 5DD3L 3X11A 4E42B 6CGTA 4I8DA 5GRZA 2D7QA 3TV3H 1EFXA 3EO9L 3GIVB 4QCIB 3PXHA 1T7VA 3L3OA 4S10A 4LPCA 3ZT7A 1ZT7B 4JRXD 3TGXA 4HFWB 5CGTA 1QBBA 3MLZL 4PRPD 1ND0A 2WSKA 4ELKB 1I8IA 2EDOA 3C60B 2RGSA 2AXJA 1F42A 4F58H 2COQA 5F8RC 1ZVYA 4F2MB 1S7TA 3OB8A 4KUCD 1A6ZA 2V5RA 5C07A 4WU5A 4X7TA 1PGRB 2Q8AL 4F15B 1GGIL 1RIVL 5CJQH 4H1LG 2IFGA 1I7RB 5EA0L 3IDYC 1FPTH 4N0UB 1A6WH 1UEMA 1F58H 2NW3B 1TZHB 3BGMB 3B4NA 1MH5B 1CICD 4JR9L 5EOTA 4JAMB 1O7VA 4KC3B 2PYEB 4JRYA 4XVJL 3OL2A 1VFBB 1HINH 2HKHH 5J11C 1YJDH 1QNZH 3KPTA 1ZVHA 1SJHB 5IG7B 2YUZA 2R1WB 4P3DB 5GRUH 2ZSWA 1DANU 3NFSH 2LE9A 4BK5A 5DLMH 3GKZA 4U1MB 5GS2H 3U6RB 3EJZC 4YWGH 3UCRA 3GMQB 5F3BA 3T0EA 2JF1A 2IPUK 3QG7H 2OQJA 4GKNB 5TH2A 3A0OA 4GXUM 2D0HA 4M1DL 3VXRB 5FA3B 4QXWA 2I5YH 5T1LB 1QYGL 1ORSB 3GSWA 3SQOH 4HBCH 3BQUC 4YAQB 3UYRH 4G7YH 3IDMA 1D6VL 2XZZA 3LKPA 1S9YB 2WBJB 3ET9F 1QKZL 2M1KA 1HHGB 4XMLL 1MHEA 4NJAL 1GRWA 1T7ZA 5IFHL 1KJMB 3CLEH 1P2CB 1U8KA 4JFZL 5TDPB 3FFCE 4KY1H 5D7JD 3T3ME 5IEHB 5C09A 1Q1JH 3EZ8A 3TESA 3JV6A 4FXKA 2R23A 3BAEH 1RPQA 2ED8A 2EDBA 4G9FB 4UOJA 4Y4HC 4Y5XC 4P3WA 3KLDA 2GSIA 4QRSA 4KAQL 3WUZA 3D0VB 4ISVA 4OSUH 3TH2T 2VLKA 1FH5H 3DX6A 3O45B 4U3HA 4S1QL 4P4KC 2NYYC 4LVOC 1H3PL 5IB4B 5FYKU 2H3NA 1ETZA 1NAMA 1SEQL 1JPSH 1OAYH 4J6RL 5EBWA 3QEQD 5D2LF 2EIDA 2IPKA 3UPCA 4YZFE 3ALPA 2P5WA 5HHXL 4HUUB 3CVHB 3O2DH 5IKCB 4M3KB 4I2XB 4MJ4A 1RHHB 1ZA3A 4QHLB 1KG0A 3MRGB 4WWKA 1FFOB 2J8UB 3SBWC 1U8QB 4LRNL 1HDMA 4NPYA 3TF7C 3MFFB 3AMLA 1DZBA 5HI4C 3U4EB 1KLUA 1QSFE 2J8HA 4U7SA 5IV2A 5BMFH 4MZ2A 1UACL 5DS8A 2VE6A 4N1HB 4TOYL 3BESR 2ZG3A 2BVOA 5SX4H 2CRYA 2R4RH 3EDDA 4TTDD 1CVRA 3CX5K 3ZHLA 1YMMB 4DUWA 5C8JA 3DVGB 3DX8B 2VDPL 4UUJB 4MLIA 1HE7A 4AH2B 4FABH 3O2DA 2OP4H 4PLNC 4L3EA 4Z95L 4Z78A 1ZLWK 2OBGA 3TO2B 4BSWB 1A3RL 5D9SB 3D25B 4YNYB 1N0XL 3DTXA 4KJQC 4LCWA 4JN2B 1CK0H 4NHUA 3RGVA 1U8OB 4B5EA 4UQ2B 2ZNXA 2CDFB 4ERSL 2W0FB 5SWSE 3W11D 1IAII 5KVGL 1BFSA 2VDRH 4G9FD 4WRLA 1I9EA 4CKVX 3L1OL 1QFUH 5JW5A 3MUGB 3L3DB 4X4ZA 4AIZA 1XGPA 1UB5A 3F7YB 4P23A 2NY2D 3SO5A 4OZHA 5FA4A 4NC1E 3P11L 4OFYA 4JZNA 1TZGH 3WNMA 1F00I 1MCHA 1XF3A 4CNIB 1JP5A 2AJVH 4X98B 2HFEA 4HDIB 3CH8A 3EDKA 3FONB 3QDMB 4ORZC 2Q7YB 5DWUH 1DEEB 3QUML 5AD0B 4NO3A 3D18A 4P4KB 1V5JA 3LEVH 5DRWA 3MA7A 1WCQA 3E1F1 3FMGH 3GK8H 3VXRD 4XCEB 3IDGB 4LLWA 1T22A 3DV4B 3N1MC 4DUVA 4Z7OF 1AGFA 3DJ9A 4WEBL 3STBA 2F53A 4U1HA 2CGRL 3V6FB 4KVCL 1FLRH 3BVNA 1UCBH 1T21B 2PYEE 1MLBA 3W9DB 2VDKH 3PWVA 3INUH 1SYSB 4XP1L 5DHVB 1S9XA 5J1SC 1QKZH 3QH3B 2YPKA 1U8LB 4X6FB 1BVKB 1NC2D 2JIXB 4O9HH 2IANE 4ZPTA 1S3KL 4RNRB 2ZCLL 5E7BA 1J7VR 2PYED 4KROD 5FF6B 3VG0L 1NUFA 4BQ6A 2IADB 4PJBF 2J4WH 3PWUA 5DO2D 3BIKA 4XNQA 4O02H 3I6KA 5KOVC 1IARB 5DJ6B 1J8HA 3VXRE 1QRNE 5DJXB 1Q9KA 1TQCC 4JFOA 1CS6A 3V0VA 3WLWC 5AYUH 2AKRA 4P49A 3ZL4H 4ZUSA 1NGWA 1HEZA 2FZ3B 2E7CA 3CUPA 2C1PA 4JZOA 5CZXD 4JFFE 5BRZD 2JTDA 2IH3A 4FQ1H 3GMOB 3JVGA 4RISH 1B4JH 2UYLB 4UQ3A 5EO1B 4MA1C 4M7ZC 1MCCA 3VI3F 4HJJH 1EHXA 3F7RA 4WTZG 1IBGH 3UYPA 2NZ9D 3VXMB 2XRAL 4F2MA 4DZ8A 4PRDB 3CFCL 1NEUA 2ZOKA 7CGTA 3BJLA 4Z95H 3VFVA 5DI8A 1EGJA 1HQRA 3DOSA 3L6FA 4OLWL 5C0CB 1TJGH 3TN0B 4LOUC 4PTUB 2GFBB 1BWWA 3HZVA 3D85D 2WV3A 2XKNA 3RZCD 1LEIA 4OLXL 2PYEA 4JRYB 4LCCC 4PJ8D 4OV5A 3FRPA 5KZCB 5E00B 5CEZL 2X70B 3ARUA 1SJHA 4N9GA 5EC1A 2Y36L 1MI5E 4QXTA 2R8SL 3KVQA 4IJ3C 3VWKD 3JV4B 4NN7C 3RGVC 3LQZB 4ZDHA 3BXNB 1FO0B 1FL5A 2R9HC 3P73A 3QIWA 4JO3H 4QOKB 1ZHBA 1DQJB 1IC7L 3DVNA 2HLFC 1PX3A 3SDCA 3CC5B 4UMGA 5KZCD 1PSKH 1UFUA 4OD2B 1DBML 3U46B 3NZ8A 4JZJA 4OFDA 5F6IC 2VDRL 4U6VL 1NDMB 1PEZA 4ZSOB 3TN0D 4R3SB 3K2UH 3SPVA 5C0CD 5ICYA 5INCA 4OZFA 3PL6A 4P2CG 1YUHB 4FQQA 3S35L 1VESA 1KB5H 2AJZA 1JGUL 4UV4L 2VC2H 4LLUA 4DUXA 4LLQA 3TEUA 5C0CE 2B8OT 4GH7B 1I85C 1Y0LB 5MP6H 4ODWB 3S4SG 4RA3A 1EMTL 2XOTA 5ID0A 4MXVF 5EO9B 1JMXA 2YSSA 5C71A 5F9OH 4LKXA 2E3VA 1ROWA 5IW6A 3ZTNL 4BFEA 1Q0YH 2DWEB 1MWAH 2ZUVA 3QUZA 4U1SB 2BSSB 4PJGE 1NCCL 3VFWB 1BAFH 3WFCL 4WNQB 2DQEL 1EEZA 2X4OB 3FO2B 2X4TB 3DMMC 2I5YL 1CLZL 3O3DB 3BUYB 4AEEA 4K94C 2CIIA 1NL0H 3AROA 4K55A 2J4WL 5FCUL 3C9NB 3MJ9L 3IAPA 2OJEA 2PO6B 3O9WB 2HFFB 5EBWB 3P9MB 1XZ0B 3PGFH 4G9DB 4TRPH 4QRRA 4ESKA 4PJXE 2HYMA 3RWGA 2BXZA 4NQVA 5CINH 1QR1B 1CE6B 5DJAA 4OQTL 2YBRA 5E6ZA 5JPMA 3IXTA 1IEBB 2IANA 4FG6D 4KVNH 2P4AB 1BIHA 1N0XH 1KG0B 4EDXB 3ZZ1A 2AV7A 3WDHA 1TJIH 1KACB 3QO1A 1A47A 3VFTB 4WI3A 4U33A 4WWKD 5IK3A 3RHWF 5I16A 1GOHA 3LN4B 2P47B 1T1XB 5IB5B 5HHNA 2UUDH 5IP4A 1OAZH 2NY1D 1P4LB 4OZIB 2XPGB 3P0VH 5EBMB 1CBVL 5DFWH 3VXTA 2AI0L 1LK3L 2OI9C 2VZOA 1ZA6B 3Q2CA 3SDAB 2YD6A 2R2CA 5EH1A 5D6DC 2XRAH 4XPGH 4Y2OA 4D0BA 1EV2E 5IMLA 5JOFB 4I18B 4PJXB 4KROB 4PG9B 1ZHNA 5I76B 4PTTA 2NPLX 1QLRA 1GGCL 3KPPB 3U9PL 5DFVC 1U3ZA 4NOFA 1FLRL 3D48R 1SY6A 5FKPA 4PJCE 3EYQC 1AJ7L 1XCTB 2UWEE 1OD7A 3KS0H 4P2OA 5CSZB 4J3OC 2JJTA 3LKRB 2BHZA 4QY8A 4LSUH 3S88L 3DXAB 4HDIA 4PFEA 1OAKL 4R7DA 3PV6B 5DZOA 2A74A 1CD0A 1JGDB 4PJAA 3SKNA 1SYVB 4HG4K 4R4BB 1LDSA 4PRHB 4D8PA 2OL3B 1CXIA 4N5EC 4N90E 3AM8A 4M3JA 3RWIB 2R1XB 3C87A 5T1MA 3ULUD 4JDZB 4MWFA 4K9EH 4JG0L 5FYLL 3EYUH 4LRIC 2JLLA 2P8MB 5HHVL 3QDMD 4XCYB 4Y4HA 3H9YA 1LQSR 3DGCR 1J1XL 4YC2C 4K2UL 3EDFA 3BI9X 4X9FA 3IXAA 4LVHB 4Z7WE 1P4BL 1PKQE 5TDNB 1FFPB 3T2PA 2HT2D 4PLKC 3DYPA 5J7CC 2Z93A 5EN2B 3C6SB 4OCSH 4XP5H 3IGAA 3PHOB 1BJ1J 4HJ0C 3GSNH 2GKIA 1L6XA 1BQSA 2CDEA 4NZTH 4NO5A 4ORGB 2WIIA 4YFDB 1N3NB 1J05A 4W68A 4PJFF 5DEFA 5C0EB 5GS3A 5DVLA 4TRPL 2FH6A 2BJMH 2XXMB 3DETD 4WV1A 3ZE0F 1NBZA 4M61A 1LNUA 4OI8A 4V1DE 5FM8A 5T3ZL 4Q2ZB 3HAEA 1W72A 3WNOA 1ZK9A 4YPGB 3DETC 4F57H 3MJGX 3OAZK 3BP7A 2GTZA 1YMMD 3NIGF 4MD4B 4EN3B 3KNBB 5L0QC 1RUQL 3DROB 2P45B 2HVJA 4JPIB 5BS0A 3WN5C 1MVUB 2CSPA 2OSLB 4JFDD 4U6HA 3M1BA 2FBOJ 4WCYL 5GHWH 3SCMB 1RIUH 5C6TL 2DLFL 4P3CL 1U6AL 4U2YA 3UTQA 5IJVB 4HV8A 5DDHB 4NQXA 1HHHA 5IUSA 1YMHB 5EFIA 2DI9A 4YX2H 1R3LA 2A38A 5ISZA 1A02N 3ULUE 3L6FB 5C0CA 5HDOA 2UVFA 1VFOA 5J57B 3QFJB 5F9AC 1RFDL 4AQ1B 2VIRA 4ONHA 2VH5H 4LBEB 3HPJB 4KDTC 4WO4D 3STLA 3V5DB 1K5NB 5F3HA 3STZA 4GW1B 2BSTA 5F7DA 1KJ2A 1NJ9A 3MRDB 1LO0H 1RK0B 3LKOB 4HX1A 4WO4C 2AQ2A 1MELA 1KENL 2WAHA 3D3VB 1L7TL 1DSFH 1YPZB 3C09B 3IDYB 4R2GB 4D2NA 5HYJE 1Q0YL 3TO4B 3RY6C 3EKCA 5DA4A 4N8PA 3IDUA 5FO7A 3QIUC 3WO4B 5DJCB 3ILPB 3RI5K 3L1OH 1FO0L 4PB9L 5DRXA 4N8VA 3FFCD 4KK6D 1TNMA 1WEJL 5GISL 4ZSOA 5JLZB 3QXDA 5D2LE 4HT1H 1YDPB 4C56B 4NCC1 4OZIE 2VYRE 5D1XD 3BP4A 3RUGB 4N8VG 1BQHA 1GIGH 3QWQB 2BHUA 3MBEB 1UG9A 3G9VA 3LEYL 2PXYD 2P5ED 4CDHA 2FHCA 4KAQH 3V6OE 1P6AB 3WIHH 2E27H 4B7IA 1FH5L 5HHME 1OP3H 5SWZA 3ZDXF 3ARZA 4C83A 1MOEA 4P4RB 3UTSD 4E5XA 1D5MA 3QXTA 3T77B 4JRXE 2BVTA 1WWAX 3CD4A 4ZQKB 2ZUSA 2NY6D 3QQ4A 3QQ3B 1KN4L 1A3QA 2VDKL 4K71C 5LGHL 1MCKA 2DQFA 4NNYA 2DMKA 2M8XA 3O3DA 4MNQE 5E99L 2BP3A 2DBLH 2FGWH 3M17B 3MSPA 3D3VE 3JZ7A 3PG2A 5HI3C 3V0WH 3G6DH 5FUZH 1YPZE 5T3ZH 1F4HA 3QNYB 4RAUA 4XBEL 1EZVX 5MEOA 5FECB 3OKDA 3VG0H 1JIBA 5IHZA 1FVCB 3DXAE 3FO0H 4FQXC 3ARGA 3R0MA 1S7WA 3SGKA 2AI0H 3TVMB 2YHGA 4XVSH 5BMFL 1DTUA 4OZGB 1H5BB 4YXKL 1UEYA 3G5VB 4KUZL 2HWZH 4TVPL 4XWOC 3X13A 1JTPA 3FQXA 5DMKB 3DGGA 2RB8A 4U31A 5CP3H 5BV7C 5D72L 4N1EA 2VSCA 4Q9QH 4I1NB 2AGJH 3WS3A 4FQHA 4UIKL 2JELL 3RX5A 4L5FH 3BMVA 5DC4B 2FX8H 3Q5OA 5F9JA 1V7NL 3NFNA 1P4LA 4ZS6D 4OZIA 1I1CA 1AXIB 1MUJB 4N9OB 4TUKH 3LSOB 4ZG1A 5MI0C 2CLRB 2V9QA 3MLWL 5LCVL 2E6QA 1H5BC 5BVJA 5HHOB 3F62A 5T1KB 4YZFF 4I5BB 1N59A 4JFXA 2F5BH 1GHFH 4P9HC 4YXLL 3DX9A 5JUEH 3SE3A 3RIFK 1FFNB 3P4MB 4YHLH 4H0IA 5DHYB 1JWMB 1HHJA 4PP2B 3ETBF 4M8VA 1G0YR 1X5XA 4RFEA 2EIZA 2H6PB 3MRLA 4Z7OE 5I17A 4DKFH 1S7UA 1DCLA 1AR1C 4MNQA 2YA0A 3T0XA 4OM1L 3PGDB 3NCCB 1BECA 1GZPA 4NJ9H 4BQ9A 3P77A 1RFDH 2W9EL 1DE4A 1F4XL 1NLBH 3REVB 4OF3A 4OGXH 1JHLH 1JTOA 4D0DB 3I02B 4X9BA 2A6KA 4HQQH 4M1CD 4U7KA 1JFQL 2ERJB 3QXAB 1J8HD 1IT9H 1I7RA 3PL6C 4UI2A 4EIZC 3OKKA 5D7IB 2XTJB 2DTML 2VLRD 3RY6A 2EC8A 4AT6A 5HVWA 2IQ9L 4YHYB 4HJGA 5HYSB 2FR4B 1V3LA 4NDMA 1PX4A 4OAWB 1MAMH 4Y16A 1P7KB 1ZHLA 3I2CH 1HOCA 1T0MB 4AJ0A 5EU3A 3CZJA 4HH8A 4LOUD 3REWA 5BS0E 3RWIA 5ADOH 3RVXC 3SKMA 4KRPD 4CVXA 3ARXA 5IESH 1KIPA 3QDGB 4NQDE 5FO8A 3G5XA 2E5EA 1EAPA 5FKAB 3RHWK 1HYSD 1ZT1B 4UINH 3DURA 3SOBH 2Z31A 5IEHA 3WLBB 3K81A 3TYFA 3ZE1F 3N9GL 4H5SB 3OGOE 4GXUN 3IGAB 4E41D 1DP0A 3FB5A 2X4NB 4FFWC 4GXVH 1CD8A 2XI9A 5CZXC 1J0KA 2Y25A 4LDEB 5KS9A 1Q1JL 1A1MA 3VXOB 5D7KD 1U8NA 4F7MA 4U1NB 4X5WB 3GSRB 2JJVA 3BD3A 3MRHB 5D1QA 5DSCA 5I1HH 2BC4B 4RZCA 4F8QA 4PPTA 1Z2KA 1BEYH 1CLCA 1J0YA 2MCG1 3QEQA 3THMH 1CLYL 3FO0L 1JHTB 4TUJA 3PDOA 3ZYIA 5TDPA 4LSRH 5FCUH 4LCWE 1RSFA 1KUMA 4X6CF 3MLYH 5I71B 1I8MA 2OCFD 4JKWA 4GFTB 3IETA 5DJ8B 5HD8D 3EBAA 3GBML 1MIEL 2HVJB 4JPIA 5BS0B 1JNHA 4YGAB 2VLJD 3SE8H 1Y18B 1X5KA 4Z7VF 3FCTB 4WI5A 2C3VA 4R26H 3QDJA 5HHMB 4OF7A 5E8NB 1BVLA 1EEUA 2ARJB 2MHAA 4IOFC 4QGYA 2G75B 5EZIH 2AXFA 2VR9A 1T2QH 4X6CB 2Z4QA 4J4PD 4L4VA 1Z9MA 2W1NA 4K8RH 1CFTA 1KTKE 4CW1B 3SKUD 4XBGA 1WBXB 1SBSL 4NP4H 4XRCB 5BRZB 1AXSA 3EOBA 3TA3A 4H8WL 2JCCE 2DQJL 1NDGB 3KPSA 4OCWL 1AH1A 4ENEC 2QR0A 1XGYH 3SDXF 3KLHD 1NGXB 1U8QA 1IC7H 3T0ED 2PTTA 3ALWA 2XWJB 2DLFH 5EU6A 4LCWB 5C0BE 1P7QA 4WY7L 4POZC 2N7AA 5E6YA 1AI1H 3TJEL 3KDMA 4IOIA 3K8MA 4ZFFA 1RUPH 3SDDC 4GW4A 2ICWB 4FFYH 4X6DB 3DX8A 5CZKA 3QJFA 3LS4L 5MP6L 3TO2A 1QQDA 3F12B 4PREA 4XVTH 3SDAC 5F97E 4KJPC 3V5HA 5LGJA 1G7JA 4KJYA 5KSAA 2J8UF 5C3LD 5L2KA 4X0KB 1LO2L 4NHUB 4NN7B 3RGVB 4P57A 2XN9A 1ITCA 2W0FA 5CILH 5IESL 3FO1A 5GJTL 4V1DA 4GRLD 4X6DF 2IPTL 3P4OA 3S36X 2XACC 3IDIA 4KHXH 3UDWA 4F7EA 4EI6A 4HHAB 5L7XL 2GAZB 3CFIC 1KIQA 4NYLA 2YRZA 3GSVB 1DUYB 1FNGA 2QSVA 1XF4B 1JGLL 3TBSB 4QRRE 2CKBA 4FXLA 5E2TH 1K6QH 1ZLUK 2PKDA 1X3DA 2E9BA 3HPLB 5DJ0A 4JFHD 1MHPH 1SYSA 1JHKH 4Y4FD 3MFGB 3D18B 5ERWB 2FJHA 4HT1L 2A6JB 3H2WA 3MA7B 1IQDB 2EZ0D 2F5AH 1KCKA 4U1IB 3GUTA 4OF8A 4UTAH 4J3VA 1A1NA 3ARSA 1ZT4B 2AEQL 4LK4A 5DFVD 2F58H 2V5YA 3V6FA 5IF0A 1S78D 4WFED 1YY8A 5IB1A 2PO6C 4K7FA 1TQCB 4GMTH 2NY4B 1ORQB 1WISA 3PABA 3SGDI 3VXNA 2YKLL 4KHTH 1S3KH 4Z7UF 1LP9E 4EOWL 25C8L 1S7XB 3FN3A 4NNXB 3V52H 4OF6A 1A2YA 2C1PB 5DK2B 2AJ3B 3QDGE 5L9DH 4FA8A 3MLYL 3OTTA 4DN3L 1MRDL 4L29A 1QBML 4OCRH 3F6IA 1YEEH 3BP5A 5LGKA 4HFUL 5D1ZB 4PRIB 5GS0C 1B3JA 1U6AH 1CFQB 4WENB 4LCUB 4JY6A 4MAYB 4PJXF 2C7UB 3O3AB 1GJIA 1E4XL 3U6RA 5L2JA 5H35B 2VLRE 5IVZA 4WJ5A 2BK8A 1OTTC 3A6BH 3MGOB 3ARVA 5EZIL 2XFXA 4WO4A 2C1OB 2YPVH 3AC0A 1HHJB 4PP2A 5AZEL 5CIPH 4YQXH 1FPTL 5CJOL 4F7CA 2G9HB 4YHOL 3TA3C 1Q9WA 4KK9D 1DUZB 3CU1A 2C3GA 4U3CA 3HS0B 5JOPD 3RVWD 1NMBL 4ALAL 3ARQA 3D0LA 4XAKD 3SQBA 4OCYL 1U93B 1CDJA 3HMWL 4KKBC 3ES6B 4NQEA 2GITA 4J1UA 3MOBH 3BPOC 4JG1L 4APQB 4G8EB 3RTQB 1JGEB 1WAAE 4GQ9H 2GJ6A 4JDTL 3QNXA 1H9VA 3BH9A 5DMGC 2AABH 4UT6H 1VDGA 4RMRA 3AUVA 3CC5A 1F58L 3LKNA 3LMJH 2OJZL 5E5MA 3OF6A 5AEAA 4I2XE 4NDMB 3TJEH 5ICXB 3U46A 2BSRA 2G2RB 3PP3H 1QP1A 5HVGB 1KC5H 4M7JL 4ONOA 5I1HL 2IAMB 3FB7B 3VFPB 5DZLA 1FZMB 4ZOBA 4EUPA 1MCFA 3AVEA 5B4MC 4QHKJ 4NNPH 3DX6B 3O45A 4G8FA 3A6CH 4DTGH 3U0WH 1F4XH 1NLBL 5K93A 1KCSH 1W0WB 2IWGA 3BKJH 3RUGE 4LLUB 1XCQA 3SKJL 3QISA 1C08A 4I3RH 5IWLA 1MFEL 5B8CA 5JW4Q 5JMOC 4GAYB 4M62H 5ID0B 1IAKB 3MRCA 3O6LH 2ZUXA 4L8CB 3KLAA 3VGGA 1NCWH 5GGRY 2VUOA 4FFVD 3WIFA 2HH0H 2DICA 3FQTA 2BDNH 4NKMA 5FUOH 1T3FB 3LPWA 3KYAA 5T5NF 4KHXL 3WFHB 4PJBB 5E94B 3K8KA 4Q6IA 3T0VA 3FQWA 5D1QB 5TGBB 3LRHA 2AJXH 3ARFA 1KNOB 1WC7A 5BW7C 1I75A 5D1ZC 3PIQA 4NM4H 1R6VA 1DBBL 3KR3H 3RNKB 3ESUF 3VWKC 3U1SH 1FGVL 1RZKC 2MCPH 2QBWA 4DN4H 5JO5A 4OJFL 2EDWA 1R0AH 1CDCA 2B1HH 3T3MF 4L4JA 4Y4FA 5A2JH 3U0TA 4BQBA 1R3HB 2Q87A 1UXSB 2J2ZA 3UBXB 4WY7H 4DVBB 1U95B 2P49B 1CE1H 3BEVB 4IOSD 4HC1A 3V6ZA 1MFDL 4QRRB 1W0VA 4CVUA 3D9AH 4MB4A 1UKTA 1YN7A 5K9KB 2R69L 4EN3C 2ICEA 1PZ5A 2QADC 4XC1H 3QHFL 1NMAL 4NKDA 4N5ED 1NC2A 2EKJA 2R0ZL 5GS2D 1XGPB 4P23B 2VABB 3MNWB 3EOAB 3VA6A 3SKOB 3CIQA 4RMWA 5D6CB 5C70A 1G7PA 4ODSL 3EFDH 3KJ6H 3D2UB 2CIKB 1VFUA 2Q7YA 3P4LA 1RUML 5FGSA 4ACPA 3BEWB 1RJCA 1I8KA 3KPRA 3BGMA 4JO3L 1XGUB 5D2LA 3RQ3A 4IMLA 3QCUH 1IAOA 1D5ZB 5DURD 4NQSA 3HMXA 5DVMA 5I15L 3O9WD 2F53E 3MV7D 5ESVB 1A6ZB 2HTKC 2AP2A 5DEGA 3AREA 1QRNB 2YMXH 4WI7A 3ULUF 1X5FA 1OARH 5GGSB 3EHBC 4ZO6A 5I1LA 1BJ1H 2FBJL 1IEAB 5D2NA 3U83A 1FORL 3LEXA 3QIUB 5EZJA 5DHVA 3HZMA 1AJ7H 3ECBB 2B1AH 1QLFB 5A16A 4LQFH 1Z0NA 3AY4C 3IS1X 4GKNA 5FFLA 1FE8L 2V17H 3BQUB 1QSFB 4MJ6A 1JNLH 2BRRL 5FYJD 5IFAL 4JO4H 1BZ9B 1ORSA 4U0RC 1G1CA 4XI5D 1KIUA 4NKOA 3LKPB 1M7IA 15C8L 1QPXA 1G7LB 5GIRA 3BPNB 4HIEA 1YMME 3C6LC 5EPMB 2XTJC 3P9LB 3HPLA 3MRIA 4QKXB 5IWLC 1A4KA 5GRWA 1VACB 4LCYB 4LPUA 4FG6C 1UM4H 1N6UA 4QHMA 4NO5B 1B4RA 1NGZB 5F1OB 1G7QB 4O58L 4M7LH 4U1IA 3GUTB 1I7TA 2K1MA 2PETA 4R9HA 3WSQH 5FOBB 2X2YA 3T4YB 3PP4H 4PRAA 4S0SD 3ISWA 2L4OA 3VA2C 4ETQA 1UGNA 4EJ1C 1FFQA 4O02L 3HR5B 5ACZA 2VAJA 4I4WB 4DQOH 1CGSH 1W72B 3UTZA 5C2BL 1J5OL 5I1IL 3DRQB 1KLGB 4A6YA 3O6ML 4MB3A 4N0FA 4LHUG 3D39E 1KPUA 4K3HA 4WHTB 1EUUA 4HMCA 3Q6GL 2DB8A 3PV7A 5E56A 4I48A 4I2XA 4LEOB 3B9VA 3OG4B 4LHUB 3C8HA 1LEGA 3CSBA 2QTEA 4QWWD 2H3NB 1BQUA 2Z0BA 3BH8A 1YYLL 3GMPB 4X6BA 4OKDA 5DR5H 1MFCH 5HYQB 1FO0A 2Z35B 4OV6F 4PJBE 1FIGH 2NR6D 1A0QH 1AGEA 1CR9H 3MGOA 5A2IH 4MD4A 4EN3A 4H26B 4ZUTB 4Y5YA 4PJ8A 1WIUA 2YS4A 4XB8A 2O61A 1T83A 1R5IA 2YN3A 5J11B 1RHHA 1BJ8A 2D3VA 2F9BT 3MRQB 2P7TA 5CMAB 2X7LB 2LU7A 1B4JL 3CFEA 2D7TL 2HLFD 3IDNB 5D1XC 2NLJA 1IFHH 4FQJH 1LILA 3S4SB 5I73C 2NXZC 1TCRB 2J6EA 4JHZA 4LPVA 5B39B 1QFOA 1SQ2N 1AQKL 3V4VL 4A6YL 1N5YH 3T0EC 1IC4L 2E9JA 1V3KA 5FO7B 3FTGB 3FT2A 5DJCA 1WZ1L 2EDXA 4X8XA 2DM3A 5D71L 4WNQA 1ZVSA 1S7VB 1N2RA 5E5RB 3JTSB 2YUWA 4JKLA 3E6FA 1FZMA 3SOBL 1VEOA 1CQYA 4PY8I 1VPOH 2OR9L 3HLAA 1XGQA 3TZVB 3X12B 4UQ2A 5ETUA 1DBBH 1FNAA 3KR3L 3SDCC 4Q9BA 1YPZA 4OZ4B 2NY2C 2VXTH 5DRWB 1KEMH 1QFWH 1F90H 3O2VH 4OCSL 4KV5F 3WD5H 4XVUC 2MTPA 4LQFL 1B9ZA 5MENE 2P8LB 1XR9A 1U8MB 2PXYB 1D6VH 1FNLA 4YGVA 3NMEA 3RWHA 1E4WL 1TVBB 5SX4I 5MEQB 4G7VL 1EO8H 3WIHL 1FV1A 4R7NB 4LIQH 5IFJA 2K3TA 3C5ZA 2BSED 3LAFA 3ULUC 4JRYE 4P4KA 4JANB 4Y1AA 3HCVA 3UDWC 5HPMA 3TT1L 3VWJD 4P46B 4TQEL 1IQWL 1M05B 4XCFH 2DL9A 3U0WL 1DVFC 4K3JL 4LKCB 5AWNH 4KKCD 3QUXD 2P46B 3CFDB 1G6RH 1AGFB 1PLGL 2CUHA 4QOKE 5LJYH 2LABA 1I8IB 1OD9A 4PV9B 4GRLC 3IFNL 7FABH 1AHWA 2LTQC 5I1AA 4HCRH 3ZE1E 3SDXA 4KK8D 1ZA6A 4Z7QE 4B0MM 3EAKA 1U9KA 1G1YA 3N85H 4HS6A 2HN7A 2JK5B 1G7IA 1VB9A 2C5DC 4ZPVA 3ARDB 2ADGA 3JV5A 3BEVA 2VNCA 5BJTA 2ZNWA 4NQDD 4MA1B 3RVXD 3L3IB 4QF1A 3MBXL 4JJ5A 2NY4C 4MJID 4ZUWB 4DN4L 3BDYL 5DUMH 2NY3D 4R8WL 4PRIE 2FBJH 3RWEB 3RWCB 4Z7WB 4DZ8B 4PJGB 5BV7B 1JZ4A 1OGAA 2R2BA 1IGTB 2AXHA 3LY6A 1KJVB 5DHYA 1R3IH 3OKMB 4G3YL 1ZGLP 4F9PA 2YPLA 4I9WD 3NA9L 4HC1L 3JUZA 2DJ4A 1QR4A 2WM0A 1FYTB 2NY5L 2ZCHL 1S5HB 1C5BL 4XPGL 5I30H 3ZE2E 3NCJL 3BFOA 3V4VH 2DMCA 3IJSA 1I7ZB 5I73B 5IJKC 1HWGB 3GSWB 4QRTA 3LSOA 3KWWB 5T1MB 1DE4B 1VKXB 1IMHC 3U9PH 1S9YA 5ESVA 5T33L 3GSOA 1B0WA 4X9GA 2D7TH 2VTFA 5GGSA 1XF2A 1KF9B 3MV7A 3OKEA 4Y89A 1GC1H 5KSUA 1NGQL 3R8QA 1FVEB 5FYKH 3IJYB 3QQNA 4TVPD 5A16B 3OXRB 4N8CH 1Q8MA 3FQNA 5C0BA 3FN9A 4ORGA 3CDGB 4MMZC 3B9DA 3GM0A 2XQYK 2GSIB 1DVFB 2PTVA 1RZJC 4R3SA 4Z7QF 2JJTC 3A6CL 1MCPH 2IQAB 3SKMB 4WW2B 2N7BA 4UIMB 5IB4A 5IW1B 5F1IB 3QDGA 3EOTL 1RURL 4K2UH 2HJLB 3ZKNC 1KV3A 4ODWA 5CFHA 4ZFGL 4QRPE 5FGCE 1JVKA 2NY1C 5JORA 2P5WB 1KPRB 3PP3K 2C3HA 4HUUA 4LKXB 5C92A 2BVPB 3BJ91 5T3XE 4KVNL 5J12C 5F7UA 3LKQA 1DQMH 3HG1E 4F7MB 4C4KT 1T0NA 4UU9B 1PG7X 1KIPB 4FFZL 1UA6H 3EFFB 5B8CC 5F1NB 2EXYC 3VMOA 5FHAL 3S9DB 5J9PB 1M6OA 4B7LA 3KYOA 1NAMH 4MX7B 4NN6B 2APTA 5KSBB 3JWDL 4B50A 4KRMB 4W81A 2H9GB 1LE9A 1OCWH 4PD4J 3ILQC 4X7FC 4GUPA 5EORL 1CICB 1CFSA 1JTTA 4NRZB 5FHBL 1OL0A 5IBUG 1FZKB 4AH2A 1WFOA 5BW7A 5I75C 3ZSSA 3QUYB 1KSRA 2C4XA 3Q5YA 3PWJA 3A6BL 4IMKC 2FD6L 1RJZA 1FAKT 4S2SB 3QDHA 4BZ2L 4FABL 2ARJA 2MHAB 2EXWD 3I9GH 4OFPA 2Z9TA 4QRPB 4W6WB 1EK3A 2YD3A 1I8MB 1NMCC 3L3OB 1IKNC 1HH9A 3IFOA 1U3HB 4R4ND 1CL7H 3OMZA 1PKQB 2O5XL 3IXTB 5GXBB 1G0XA 2FYYA 4S1RL 4N8VB 2ZUQC 4P59L 3D25A 4YNYA 3VXME 4G6AC 5ITBH 2R0LH 3DECA 2IGFH 1RZKH 5ID1A 4NFBA 3TBVA 3U82B 5SWSD 4XPTH 1DBKL 2CLVA 2PUQT 1LO3L 1QBAA 4GBXC 3UO1H 5I8CB 5T33H 2XA3A 5IK3B 4D0BB 4PJIB 1DQQA 5F93C 1GH7A 3MTRA 2ZP0T 3W2DL 2EYRB 2EKSA 1E28B 4WFHD 1R3IL 4G3YH 1UVQB 1V3JA 2XPGA 4BSVA 2H2PD 2ICWA 4AIZB 4DW2H 3V0AC 2OR7A 3WDJA 4F8TA 4IS6B 3RA7H 4TNVF 1DQDH 5FKPB 3NPZB 2F53B 4U1HB 2DI7A 3L3JB 1CGTA 4KRNA 1WF5A 1IVLA 2X10A 3C08L 3U79A 5J12B 2MQCA 2F8VA 1GPOL 3E6FB 4P2OB 3SE4C 3K46A 4HAFA 4Z18A 1E6JL 4N0UA 4HXAH 4RBPK 2PW1A 3TZVA 3X12A 5D70H 1TTGA 3MYZA 3JWDC 2A6IB 1PY4A 3QDAA 2IAMC 4HS3B 1SBBA 3JUYA 1UXWB 4R97B 3B9AA 4RAVB 2E8ZA 1YECH 2QJDA 4NCC2 4JRWA 3WEXA 3ZLQC 1HI6A 1UT9A 2XQBH 1FRGH 2EYTA 5JDJA 4HWEL 1R5VA 1ZHKA 1WAAF 1SM3H 3QFJE 5FV2A 3BKYL 4OIBA 5CILL 2MPAH 4Z76A 5IROC 5BO1L 1FCGA 4PG2A 3HI1A 2APBA 4LVNC 4LQ1A 4ODTL 3N85L 1VFAB 3PWLA 4LNVA 4XP4L 3U1SL 5HBBA 3DXAA 3FQUA 4PS4L 2BFVL 4WHDA 1A6AA 3BE1H 1HCVA 1L0XA 4G80A 4PRBB 4YUEH 2OQJB 3QQ9C 4S11A 2JIXA 3C6SA 5DTFB 1U42A 4LSRL 1U3JA 4O4YL 4ZUSB 4WI6A 2ORBH 2A6JA 3LPGA 3H8NA 3KPOB 3T3PF 1TITA 4KI5F 1F2XK 5E2JA 5AYUL 3QFDA 1FAIL 3ZL4L 1FVDA 2VDNH 3PQYA 3I6KB 4KUCF 1UKSA 5D7JC 2P8PA 2WQ8A 1Q9KB 4JFOB 4HJ0D 4NGHL 4PRDA 3IXAB 1WBYA 5D7IE 2IALB 1YEJL 1KB9K 3TPKA 3QAZC 5CD3B 1R5WA 2W60B 1HQRB 5LQBH 4E9LA 1JK8B 2IPKB 4NM8L 5L0QB 1IQDA 3EJJX 1JWMA 2DQTH 1IAIH 5AUMB 5JIKA 1N3NA 4RGNE 4YDIL 2OL3L 2Q76B 4XAWL 1OPGL 3MUY1 4M5YH 5EWIH 3GMNA 1S7UB 25C8H 3F5WA 4D9RE 2BNRB 5F7YC 3W0WD 3MRKB 3QXWA 1ZA3B 4KKBD 4N90D 4QHLA 3ROLA 1KN2L 3CDFA 4CN1A 1CDHA 5EOQL 2RFXB 3L5WB 1EA9C 1R3JB 3G5YB 2GUOA 1HDMB 5HGDA 3R06B 4M6OL 1AC0A 1CD1A 4QRQA 3L7EB 3T1FA 3RL1B 4HLZH 4RGND 4OLUL 5L2JB 4MA7L 5J13C 2AEPH 3QSKB 4TULL 4BZ2H 5I0DA 3P0VL 3CVHA 3L95B 5BV7L 1FYTA 3NZ8B 2OSLA 2VIRB 1RUPL 4ONHB 5IIEA 1HOCB 1T0MA 2W0LA 2BVYA 2IF7A 3CPLA 1JMZA 1Q9WB 2DIBA 4POUB 3MA9L 4K3EH 5KSBE 1YNLL 2AAVA 4AEHH 4YHOH 4NQXB 1NPUA 4ZDHB 4ZXBD 4D9QE 4EVNA 4DGIL 4ETYA 4F9LA 4YXHH 4MA8L 2YPVL 5AZEH 3HAEG 1YEGL 5IW3A 4ENED 4CADB 3LEYH 1JZ5A 1T83C 1HILA 1N6QL 4ZFGH 5IMKA 3P3YA 2YPLE 1M71A 3T3PE 5JUEL 3S35H 1QSVA 4MDIA 3QQ9D 5INDA 1INDH 2ZG1A 3GZKA 1SVZA 3MX0A 1HYSC 1OTUC 3S34H 1LK2B 4K3GA 1EX0A 1EHLL 2O5YL 4QO1A 4PLOB 2WNGA 3KPNB 4Y5VB 2QSTA 5FUCE 4UT9L 5TE7L 4S1SH 2ESVD 3AM8C 1EMTH 3MNVB 1KIRB 4K7PL 1H3VA 1QPPA 3C5JB 1MAKA 2Q3ZA 2HTLC 3GRWA 5DVNA 3PDGA 4JO2H 2FO1A 4LLQB 3GBLA 5F44A 3ARFD 3LMJL 3VXSA 5K9OA 1F45A 1CLZH 1WCBB 4W4OA 5IB3A 1BX2A 1DLHB 3P9MA 4NNPL 3J7HA 3T2OA 3M8OH 4P5KA 3RVVD 4AENA 1IAKA 3MRCB 5E2WH 1KPRA 3SDYL 4D9LH 1DQLL 3BZDA 4HKZA 2F19H 3F7YA 4O4YH 1ADQA 1MAML 5FA4B 3C6LB 2VN4A 4N8CL 5F71A 4OF0A 1NAKL 5HDBF 4GW5A 1HHIB 4YH6A 3MO1B 1MREH 2MWCA 5FYJU 5A40E 1UC6A 3O4LD 2XG5A 5M95B 1AQDB 3ESVF 3BPNC 3P0GB 1W0WA 5TE6H 1BM3L 4BQCA 1BOGB 1MCWM 2VXVH 4G6FD 4O2CA 2NY2B 1MQKL 4EOWH 1IM9D 1EFXB 5DRNA 2DLEA 2BNUA 3MV9D 3INUL 3TT3L 4BKLA 1AE6L 3MLSL 3TBTB 4NFDA 3QO0B 3IFNH 1I1AD 1NBVH 4NM8H 3UJTH 3C60A 1INEH 3PWUB 4BFGA 2XIDA 1IGML 5GGTL 3HNVL 3LV3A 3PWVB 3ARFB 3EUUA 4X7TB 4YDJA 1UXSA 2XZCL 1Q9LA 3VXUB 3WLWD 4OGYL 3PIQB 1XMWA 1NUGA 1KGCE 3ULUL 2I26N 2DQDH 1JPGB 3FKUS 4IOIB 2A73A 2DOCA 4PTTB 1YYMH 3MBXH 3I6LD 5LAXA 4DGVH 2PTUA 2WWKO 3U2SB 1LE5B 3KYMB 2DJSA 3GBNL 1MPAL 3VGDA 2XG4A 3NOIA 5IT2H 1ZOXA 1YC8A 1IC4H 3MA9H 3V0VB 2ZOLA 1GGYA 4U6YB 3WN5A 1SMOA 1TTUA 4QTIL 1A9EA 4FTVD 1OAUH 3EO0B 3O3BA 5FYKD 4YE4L 1XGUA 4ZUVB 5T5NG 5D93C 5T1LA 1MCSA 1CGUA 2GAZA 3EDJA 2NW2A 2QHRH 4Z9KB 4F58L 5F7EL 3CNKA 4U1MA 1G7PB 3BYYA 4OCWH 3NAAL 5F3BB 1LO4L 3MRNB 2V2TA 1BD2A 1ZV5A 2X89D 4O00A 5FYJH 2L7JA 3DX7B 4TTDC 1SYVA 4PGJA 1MRCL 1CD9B 3AB0B 4HUXB 3AY4A 1P4BH 2BXYA 4HUWA 3O0RH 3CDYA 3IKKA 3UO1L 4Y16B 1UXWA 1OTUD 4U05A 3F58L 2BERA 1T7WA 3QEHA 1A1NB 4YHYC 4LLVB 4YC2B 2X70A 1L9MA 3TBYA 1I3RA 4G6AD 4MGXA 5ICYB 5C0AD 3ZDZF 4D9LL 3PL6B 4WUKL 5CZVH 5EU5A 2CO6B 4NHCH 3QXAA 3HHRB 4JFFD 5EZLA 3NGBB 3WS6C 5BRZE 3RBSA 3QIUA 2NZIA 3HMXH 4NUGL 3B2VH 3HNTL 1FG2B 1A6AB 3SDCB 1BFVL 4JVWA 4RQQA 3QEGH 4G6JH 5KVEH 5C08D 3D69B 3TYFB 1S7RA 1AD9B 1D9KA 1BM3H 4L9LA 3VE0B 1IC5L 5IW6B 4P9HH 1J1OH 3LZFL 1J87A 3SE8L 1JGUH 4UDUB 3REWB 5HY9A 4U6HB 3SCMA 2HFGH 1LO5B 2VLKB 5EOQH 5INCB 4PJ5E 2DBJA 1ETZB 3LCYA 3QIBD 4X6DE 2IMMA 4HWEH 1A6TA 2B4CH 4K23L 4NRYA 4OIIH 5H35A 4NFCA 2ZZUT 3HNVH 3ZE2F 5TQ2L 3DARA 5E8DH 5ISZB 2ZUUA 3BP7B 1G6VK 3OKLA 3BPLB 4OD3L 4IM8A 1AD0B 2ZUWA 3WKNA 2C1OA 4GAGL 4PJAF 4ODVL 3GJEB 3CGTA 4NQVB 3C60C 3OG6B 3PQYE 3W39B 2YK1H 3ULVC 1UWXH 3TPUB 1AO7D 2QEJA 4YXKH 3AS0A 3H0TA 4LAJH 3WMSA 3VFMB 4M7KL 3VGBA 2NXZD 4NPYB 1ONQA 2SEBB 1YMHA 5EFIB 3HE6D 3C9NA 4JFFA 4HS8H 4N68A 1GL4B 1P1ZB 5GRJH 3KYKL 1AR1D 3WUWG 1U58B 2B0SL 5F88B 1OM3L 4JGJA 3B8YA 4BK4A 4KZEH 4U6XA 4ONFH 3DVGA 4OZFG 1IL1A 3BT2L 4LHUA 3F6LA 5CMAA 2UY7A 3FB7A 5BZWB 5BOPA 4ZFOL 1KJ2B 5A2FA 2YEZA 1OAZL 2NLJB 5GGVY 4EVNB 2ZUYA 4X6CA 2O26U 4Q9RL 5DQDH 3V7AE 5IT2L 1RUKH 3CK0L 3H42L 5C7XH 1U3HC 2UWEB 5CIPB 5LWYH 3VWJC 2DLGA 43C9A 1U36A 3MRBB 3VFNA 1JWUB 2CKBL 4ELKA 5DUPH 1AGDB 1FDLL 4XCEA 5HYIA 1TQBC 1P5UA 3L5JA 5DK0A 2JB5H 3VFUB 3EDEA 5JLZA 1K6QL 4AY0A 2D9QB 1ED3A 3HE7B 3S4SA 5FEBA 1H3WM 1U92A 3WFBL 1ZLSL 1T5WB 1QACA 1QHOA 1A7RH 4P57B 1TZHA 2IQ9H 2XTJE 5L88H 1NGYA 1A7PL 2A74B 3RIAK 1U8LA 4X6FA 3T65B 1JGDA 4PJAB 1BX2B 1DLHA 2CXGA 1OT1A 2HJKB 5AAMA 3VFRB 4JRXA 1NBVL 4LLWB 1I3GL 3KPQB 3S36H 3FFDA 3UAJD 4WTZA 5FHAH 3SE4A 3S88H 1N2RB 2ZCKH 2XY1A 2Z31D 2EICA 3TZVC 1OAYL 5LGJB 4QLRA 1DJSA 4HPOH 5CD5D 5JHDB 4HUMB 5I1DB 4S1SL 5JQHC 5CCKH 1EO8L 3EYUL 5EBGA 1WIOA 4OZ4A 5D2NE 1N64L 3MJ9H 4U6TA 3S5LA 4RAUB 2VLKD 4YUEL 3TA3D 5IR1A 4G7VH 4DGVL 4MJ5B 4P2QB 5CBEA 3RDTA 5EUKB 1R24A 3PWPA 4M6ML 3TVMA 4L8DB 2UYLA 4UQ3B 5CP7A 1T6WA 1MJ7H 4G6KH 1TENA 3Q6GH 5DRZA 4OB5H 4WV1C 3HTLX 1KXTB 4BUGA 2ADIB 5BCAA 2X4UA 4HPYH 2NX5E 4TTGA 4I5BA 1CXEA 3VD4A 4LLYB 5DUBA 5KVFL 1RK1B 3VRLF 3GHEL 4GJTB 4G8IA 2VZTA 3DGGB 1QSEB 2H26B 2X9WA 1HEZB 2FZ3A 4HS6B 1G7IB 1EDQA 4NNXA 4ZAKC 3RIAF 3KPRE 3VXPA 3NTCH 3MLWH 5LCVH 3MRLB 1P7HL 5MI0B 2EE2A 5HHQB 4HMEA 1RZFL 1LEIB 1CR9L 1IAOB 5C6WH 3PGDA 1IGFL 4QRUA 5TFSH 1Z0MA 3FN0L 4QT5B 3K74B 3KYMA 3REVA 2FH8A 3PABB 1B2WH 4LCIH 3V6OC 3SDXB 3VXSD 5GQBA 2BNQE 1NMCB 4XMKL 3ROOA 4CAGA 3V95A 4AM0A 2AABL 1N4XL 5D2NB 3D39D 3GKWL 2W9DH 4HD9A 2R2BB 3MGTB 4RFEB 3WKMH 3WJLA 3LS5H 1T7YA 4JN1L 3MZGB 3S3SA 4N0YL 4Z7UA 5JQ6L 5E2VH 1DUZA 4ONFL 1B90A 4JCMA 2LVEA 5DYOA 4HJJL 3UTQB 3VFOB 1B88A 3BT2H 1D5XA 5CJQL 2VH5L 1H15B 1TCMA 1KLUB 2VUYA 5HI4D 3OQ3B 4JFED 1BD2B 5LXGH 4RRPA 4OD2A 3BUTA 2YPLB 3QG6B 5EIIB 3U30C 3UZQA 3VGHA 1MQ8A 4C56E 4F7CB 4RMUA 2EECA 4LBEA 5M94B 1INDL 1A7QL 1NCNA 3QUZB 3UTTD 2VKXA 4FQ2H 4PRPA 4NQCD 3KWWA 4Z5RB 4CUCA 1WFNA 1YUHA 2BSTB 1VSCA 3T4AB 5EUOE 4KKAD 1A7OH 5GGTA 1DANT 2BNQB 1HXYB 5IBTH 4Y4KA 1UWXK 1U8OA 5MEPB 3CFJA 4QHKI 4O9HL 5J1TC 1BQHB 5ANMA 4M4RA 5KSUB 1E6OL 4YEFA 1OY3B 1C7SA 3W0WA 1FG2A 1LO4H 1JL8A 3IU3A 1P53A 2R4SH 4N0FB 1I9JL 4JFQB 4XPAL 4JPKL 2D31A 3U0PB 1D5MB 4WHYH 1AKJD 3GI8L 2J5LC 3HZYB 3O0RL 3QQ4B 1NAKH 3QI9D 1LD9A 5BOZG 3K8LA 3QDMA 5IW1A 4QYOB 2PO6A 5C0DA 1XCQB 4OFIA 1BLNA 1WAAA 1A6TB 1CTOA 1EO5A 5TE6L 5GZND 3W9EB 5E08L 3DUSB 5I8KH 4CBPA 4LEXH 5EB9A 4HK0A 3JBG7 3IETB 3KLAB 4NKQB 5FECA 1CE6A 5DJAB 2A0LD 2E8YA 4KK6C 2PW2A 3O6MH 1TPXC 3HZKA 3QPXL 4X8JA 4UNUA 2P7TB 2Y23A 3TPUA 1CTNA 5TGBA 3KJ6L 4HZAA 5E8NA 3QUYA 4YHNB 3T2NH 3PP4L 1RJYB 4Q9RH 4GLRH 3EJZD 4A2LA 3TM6A 5C0FB 3UBXA 1LP9B 4WUUA 3TC9A 3VXUE 2XZCH 4ZFZB 1T4KA 3KPMB 4X5XA 5FM5M 4WTWA 1QFPA 2ATKB 1AFVH 3BWAB 2P44B 1S5IH 5F88A 4I18A 4PJXA 2QADB 1DQTA 5E8PB 3PGFL 2WINA 5TPWH 3RVVC 5JHDE 3EOBB 1GGIH 1TPXB 2GTWA 3O3UN 3EYSL 5CD5C 1KCUL 1JYXA 4XPBH 3O8XD 3V6OA 4AEIL 3CMGA 2FYYB 1XCTA 1H5BA 1QUNA 4IEFB 2JB6B 2VLME 5I1CL 1IGFH 2AQ3A 3SJVB 3LIZL 1G9NH 3GIZL 4YK4C 1UQSB 4I13B 1N6VA 1XF5A 1FP5A 4APQC 3Q1SH 4NCDA 4KKLD 1FHGA 3RVTC 3QCVL 2FSEB 3WS3B 3RZCC 4LL9A 1YN7B 4XBPA 1OP9A 1PKQA 3H3KA 2EH8L 1KTLA 1MF2H 2L0DA 1J1PL 3B9KC 3P77B 5ICZA 1I8LC 2Y4SA 3DO3A 3U7WL 3T0DA 4POYA 1F8TL 2EIBA 1DFBH 3S37X 2WBJA 1G7JB 4KJYB 4XH2A 2FHBA 5L6YL 2Y7QB 2GJZA 2GI7A 3AS3A 3GMMA 3VFVB 2X1OA 3JWOL 2ZSVB 3MXVL 5I1LB 3NCBB 4DK6A 4UT6L 4F7PB 4XWGH 3GJFA 1KCLA 1MCOL 3ECBA 1PG7W 3RY4A 5IMMA 4KTDL 1M05A 1IZKA 5I17B 1Q0XH 3CLEL 4JFZH 1I9RH 2CD0A 3NBNA 4ZS7L 3L5HA 2VZUA 1X6LA 3WEXB 2VB5A 4L9LC 2A77H 4J7RA 1A7QH 1SHMA 4Y4HB 4ONGL 3HUJF 2DL2A 1NBZB 4M61B 4C59B 4K71B 5ESAA 4HF5H 3SJVE 1ORQA 2EE6A 3BXNA 1DBJH 4WUKH 5CZVL 5KN5B 4I0PB 4P2RD 2Z93B 5EN2A 4KDVA 4QOKA 3RRQA 1T66D 4HWUA 5CAYB 2HN7B 1QFWI 5JIPA 2CDEB 4HS3A 4YFEA 5TQ0L 1IGJA 2R23B 3EO1B 4FXGB 5FGBC 2W9LA 3IFLH 3KPOA 3BE1L 1FYHB 1YQVH 5IKCA 4GBXD 3FN0H 2AK4D 1ES0B 1UJ3A 3NCYS 5FOBA 3NZHL 4PLJC 3H9SD 3FHAA 4KJPD 4EZMA 4XX1E 4OD1H 1P9MA 3U4EA 4PGCA 4HWBA 2W9DL 1X5IA 1A22B 1EAPB 2P43B 1KELL 1R3LB 4XCCL 5FKAA 5IVNA 2W38A 2Z31B 3QJHB 4HCRL 5E2UH 2WIMA 3CFBA 4B53A 4JFPB 3OKMA 1JK8A 3GHBH 2Y06L 12E8L 5I1GL 3VXPB 2WUCL 2NY6C 1QZ1A 1DDHB 2G9HA 4GRLA 4CMHB 2MJWA 4OGAC 4TNVK 2NY7L 3GMNB 4K3JH 3MRHA 3F7PC 5DSCB 3MPCA 4HZLA 4TSCH 4X80L 2J8UA 1IAIL 2UVEA 4YDLB 4OCNC 4HV8B 5DDHA 1OW0C 4XAWH 2H45A 4LCUA 1BIIB 4S0TD 5MENB 3O3AA 1Y6NR 1CGXA 1WBYB 1RVFL 1OQXA 3NIDF 4XPHH 2DYPD 3ROOB 4I0CC 1ZLWH 4JKPL 4PJHA 4R26L 4I18C 4GKSA 4RFNC 4F7TA 1ZTXH 3UBXI 1NMBH 4PV8A 1ODAA 2NTSP 4CW1A 4IRJC 4GQPH 4M9OA 5C0BB 1NFDA 1WBXA 3F5WB 5HDLA 5ICXA 4RFOH 3L3DA 3NAAH 4YFLF 5IIEB 3N50A 5GZOD 1VGEL 4OUOA 4ODSH 4WFEE 4BSWA 4XTRD 4PGEA 4JZNB 4LSUL 3FL7A 1MF2L 1UKQA 2OTWA 2DQHH 3U7WH 3TO4C 5HI5C 1F4YH 2CR6A 4WI2A 3G5ZA 5I16B 1RUKL 4P23D 1DLFH 5FDWA 2OYPA 2DTMH 4K3EL 4JPKH 1LWRA 4HUKB 3WXWL 2MOVA 1R5IB 1MI5A 2A9MH 4JQXC 3O6KH 5C9JB 1P4IL 2VL5A 4I3RL 3QUMA 2YMXL 1T20B 3VFPA 4KTEH 5JQ6H 1AGCA 4OCXH 4D3CH 3SDAA 2APFA 3G9AB 4WI8A 1I7UA 1C5CL 4IHOB 5MEND 5LBSH 5F1NA 4JY5H 4MVBC 4G8GA 4CRPA 5HGAB 4UT9H 2QHLA 4AMKH 1KYOJ 2RCSL 3JXAA 2EDYA 3OZ9L 3P4OB 8FABB 2DN7A 5I1EH 1TZIA 3PWPD 2H9GA 1S9VB 3O3EB 1HN1A 3P0YH 4WFGD 2P8LA 4OZGF 3ARGB 5GJTH 3ABZA 4NQDA 3MXWL 3GSVA 5E0QA 1E0OB 1JYWA 2JCCF 1FNEB 3TVMC 5KSAD 3ZHDA 5DD0H 4UILL 4JM4L 3T09A 1JYNA 1MFNA 1XGQB 2ZCLH 1KFAL 1S8DA 1GSMA 4P5TB 3ZKMD 5KW9H 3VGAB 4JDVA 1EXUA 3MRRB 5D1QD 3SDDD 5IBTL 4PRHA 4K9EC 1EO7A 5IHZB 1JYVA 4JM2B 3MRMA 4LKCA 3TBWB