4EN3A

Crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
186
Chain Sequence
b'QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATYDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSVCLFTDFDSQTNVSQSKDVYITDKCVLDMRMDFKSNSAVAWSNKSDACANAFNNSIIPEDTFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The Molecular Basis for Recognition of CD1d/alpha-Galactosylceramide by a Human Non-Valpha24 T Cell Receptor Struct. Title
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A02
5EU6E 4HS6A 1U2HA 1S7QB 4WUUE 2A2QT 4X6BA 2JCCF 5I19L 4NQEA 4OV5B 2NXZC 2KZ1B 4JDZB 2HJLB 3VFOA 3V8CA 3HPJB 3OZ9L 3PP3K 5I8KH 2VQ1B 5DK0B 5GRZA 1ACYL 5KVEL 2P44B 3WEXB 1OCWL 4URTB 4KFZC 1CDIA 5DD0H 2B2XH 1JRHI 1LGVA 4WI9A 1D9KB 5A43C 3WJJA 3RZCC 4W81A 4MSWB 4P9HH 1JWUB 3K4ZA 1I1RA 4CU6A 5INDA 2V2TB 2NY0B 1EX0A 3TBVA 4NIKB 3HMWL 3IAQA 3SE8L 3U46A 8FABB 1C5DA 3UJIL 3WE6A 4CVWA 3IDXL 5J13C 3RVWC 4WFGD 1QFHA 4JZNA 1LDSA 1SM3H 3ZDXE 1QSFB 4C83A 3UTPE 3LV3B 3PQYE 3C2SA 3S5LA 4K2UL 1HQRA 2XZQL 4PJ9A 1OPGH 3BZDA 3MOQA 1OP3K 1RAMA 4U0RC 4HUUB 3QCUL 4KI5D 5HJ3A 1ZLWH 3SKOA 3ROLA 4GBXA 2Y4SA 4R26H 5BXFB 4M48L 3TJEH 1RUQL 2GITB 4KJYA 1R0AH 2APFA 4UTAL 2BOBB 4WW2B 4N8CL 3DXAA 3BT2H 1FVCB 5CSGA 2DIJA 4NPYA 5LXGL 2BFVH 2HJKB 2ENSA 3P2TA 3PL6C 4QNPE 5B39A 5DSCB 5L7XL 1R3KB 4MD5A 4PGDB 4Y4KC 1MPAH 1WLHA 2H3NA 3SE4A 3QHFL 1QFUL 3R06A 4LHUG 5CIPH 5GSRB 3FAWA 1QACA 2FLRT 3GMOA 3UYOD 4EIGB 3EUUA 3HR5B 4M43H 4E42A 3RTQD 2DQFB 1U93B 1SMAA 4U1MB 1IM3B 4HKZB 4MNQB 4Q9QH 4ZNEE 3LS5L 5GRJL 2IC2A 4Q0XH 2GAZB 3PJSA 1E28A 1EO5A 1NCTA 5E4EB 4BSJA 4D9LH 1MFDH 1T89A 4NQDD 3GJEB 2YPVH 3K74B 1BFVH 1UADC 2E9WA 3QO1B 1Y6KR 3C6LC 1UACH 5K59E 5JIPA 3T0EB 4R97B 5J89A 2JB5L 3GUTA 2IAMD 1OL0A 2YRPA 2QADC 1ORQA 2J5LB 4IDJH 3AU1B 1C8PA 3RZWA 3LIZL 5F9WB 2XPGB 1VENA 3LB6C 3MOBH 1J86A 3BGFC 1TPXC 4G8GE 3EOTL 5KSUB 3WFCL 4ZXBB 4PY7A 3JVGA 5BVPH 1BZ9A 3ME0A 3ARQA 1BFSA 1C12B 1AI1H 4CU7A 5F6IC 1BQUA 4OZFA 5IW1A 5FYJL 4Z5RB 2VDKH 1J5OL 4LLVB 4H20L 3CFBB 4NHUB 3NA9H 1P7QB 25C8L 4O9HL 3G6JE 1X5FA 3VD9A 3FFCA 1JE6A 3NIGE 5IMKB 2XZCH 1KJMB 4PY8J 1WSST 3QG7L 1BAFH 3TT3H 1PZ5A 4CUCA 3JV5A 4Y7MA 2HYMA 1T83C 5IP4A 5DO2D 4KKBD 1E4JA 1OT2A 1AGDA 4HUWA 2QJDA 3T09A 1CN4A 3HN3A 3S88L 3O0RH 1LK3L 1KC5H 3OAUL 4HJGA 3D25B 5IGXL 4XAWH 5JPMB 4OZIF 3WKML 3P9LB 1T6VN 5H2BA 5HHME 5E9DE 2G9HA 2YPLA 1NC2D 3TIEB 5DJDA 3U4EB 3MFFB 1AO7E 3MV8E 2HRPL 5IHUL 1CYGA 3BPLB 4G42A 4DGYL 3O2WH 4I48B 3RWIB 1ZEAL 4FQHB 4WFHD 1GJIA 2EZ0C 4K94H 5EH1A 1B88A 1MREL 3HC0B 4X7DC 3M1BA 5FV1L 4YDKH 3E6FB 3ZTJG 2ZNXA 3O8XB 3KYAA 4YXHL 5DFTA 3CMOH 6CGTA 3HCVB 3P40A 1X5KA 1I8LA 4NQCD 2QHRL 4OGAD 3CSYA 4OCYL 1PSKH 3GGWB 1TCRA 2PXYB 3MO1B 2KQNA 3CCHA 4Y5VC 5SWZA 3TVMA 3IVKA 1VFAB 1IGYA 5F96H 2WUBH 4NNPH 4GKZB 4KUZH 1QFOA 3O3BB 3WUZA 3QEUB 3TH2T 3KYOB 3SBWA 4GAGL 5I1LA 3W2DH 5J3HC 3HFMH 5FM4A 4UV4H 4N0YH 43C9A 1R3IL 1QRKA 4NYLA 5JDSA 1F4XL 2YD6A 1J0HA 5CUSL 1TETH 1BLNA 2IFFL 3M8OH 2W59A 5HYSA 3VXSB 2EIDA 5LGJA 5EC1A 3RP1A 4MAYC 2XI9A 1GH7A 4O2EA 4X5XA 1I7RA 5MEPB 1JHLH 2CLVB 1OP5H 1IAIM 4MNGB 5DJZA 5E99H 3GKZA 4PJIE 1NGQH 2NY4B 4MQXC 4QXUL 4FFWC 2R0LL 2C26A 3QDHA 1LP9A 4NKOB 4LLWB 1F58H 1OTUC 3UTOA 1HEZA 1RZKL 3FO1B 1C08A 5GZNC 1P5VA 4JY6B 3STLB 3E6HB 1MJ7L 1TZGH 3EYUL 3RVXD 5DA4A 1LK2A 3NPSB 2FEDC 1Z9MA 4PJ8C 4WIQA 1HHGB 4XZUA 2DJSA 2DKUA 4U05A 3VG9C 4EN3C 2HAZA 3QXVA 3WNPA 5CJBA 1RUAL 5EU6B 1H8SA 2GIYA 2VC2H 4YGVB 4X7SL 1K3ZA 3WFHA 4UILL 3TCLA 3HI1B 3NH7H 1UCTA 5DJAA 2VIRA 2XFXB 5IFJA 4OFYA 5I0DA 3HE6D 1NAMA 1FDLL 1N64H 3T3MF 4ZUSA 3EOYG 2NR6C 3CFJA 3ZLQC 5ITFA 1K4DB 3GBLA 4NUJB 3ZKMD 2A74B 1MOEA 3BKYH 3VWKA 5D2LE 3DSNA 5K9OB 1TZHB 5EUKA 5JQHC 2CK2A 1GGBH 3KHOA 2P8PA 4EBQL 3RNKA 3TA3A 3QXAB 3RJDA 2VDQL 4LNVA 4TUKL 1QFWL 3IDJA 2W0FB 1T7YA 4KJWD 5J56B 1RD6A 3ZKXC 4OCMC 4HG4J 4I1NB 1QBMH 4NZRL 4WDIA 5DQDH 3PQYB 3TBTB 2DWEA 4W4OA 3ZHKA 4NCDA 4E41B 2GQHA 5EUOA 2VSDA 3PWPB 1JF6A 5EBMB 1F11B 1RZFH 3R1GH 1NBYB 1YEEL 4H8WC 2AJVL 4K7PH 4XBPB 2C4FU 2JJSC 4LKCB 4LCIH 1ZWIB 1JFQH 4HLZG 4TSCH 1WT5C 1TTFA 5I18H 5IJVB 1EO8H 4L9LB 5CJ8A 1CL7L 5IKCA 3VGBA 1HIMH 2PKDA 4WY7H 3KHQA 3GDBA 3MUJA 3Q6FA 4XVJL 1OB1B 4UNVA 3EOAB 3CFDB 3ZYJA 1ZHKB 2AK4E 2WNGA 4NWUL 4IMKA 4XWOC 5B8CA 1U8HB 3RAJH 4S1DC 5T1MA 1AD0A 4JPVH 2OS7A 1FORH 2X4RA 1D5BB 1KB5H 2WIIB 1UXWB 1KCRH 4IRJC 4Q58C 4FQ1L 4KTEH 5LGKA 1L6XA 2XRAL 1G7MA 2VL4A 2Y6SC 4XP5H 1TZIA 3MUY1 3GB7A 5HHNA 3RBGA 4FNLH 4BUGA 1NBVL 1FNHA 1KULA 2CJUL 3TIDB 2HT4C 4BQCA 1LO3L 1H3XA 2YBRA 2XN9B 4PLKC 3LN9A 1P9MA 1GGUA 3RGVB 3GJFA 1M71A 5EORL 1XF4A 4X7CC 3ALPA 5EOTA 1HH6B 2GTZA 4YQXL 3FO2A 3QWOB 1G9NC 1FFOB 2XKNA 4M93B 1QLFB 4K3GA 4XCYB 4F3FB 4Z8FL 3PNWB 4K3EH 4QY8B 4WEBL 5E7FA 5INCB 3D39E 5EU7E 5F8QC 3SQOL 2BJML 1MJJB 1S9KC 3P0GB 3IDGB 2G75B 3QCTL 4G6JL 3C8HA 3GSNL 4KKCC 2YEZA 4G8GB 3F58H 4DVBA 3EFFB 5FK9B 3FOMB 1A9BA 5C0JB 2COQA 5C7XL 2OP4H 1UH4A 2CD0A 5KN5B 5FYLH 4Z95H 1I1AB 4RMTA 4U1LA 3DURA 5C0EA 2NTFB 4NZJA 2AAVA 1T4KA 2CLZA 1DSFH 2D9QB 1NCCL 1WIUA 3MMEA 4HV8A 5E6ID 4K9EL 5I76B 5J6GB 4ALAH 1XR8B 3UAJC 1KLUA 1OAUL 3G6JB 4M61A 1GZPB 1MAJA 5D1XA 3VRLE 3GSVA 1F45A 2NZIA 4U1NB 3KYKH 1ND0B 3TJHD 1JK8A 4MD0A 4XCEB 3QI9B 5JW5B 4HIXL 4OUUA 3NFPA 7FABL 3QNZA 4YLQT 4F15C 3DV4A 3OWEA 4PGJA 4UBDC 4UT9H 3O6FC 4DEPB 2CO7B 3W9EB 3FB8A 4FQXD 3B5TA 1B2WH 4J4PD 3V8OA 3ECBB 5A16A 3UZQA 3WS3A 3DARA 2FIKA 4BSWA 4X6CF 2G2RB 1X4XA 3FO0H 1YN7A 4ZUTA 3HNVH 4HK3N 5E9DB 2QR0B 4OTXL 3ZTNL 3TYGH 1BOGB 1AO7B 1S7WB 3MV8B 1PG7W 1QRNA 2B1HH 2Q8AH 2DQUH 2DI7A 5E8NB 5JORB 1EO7A 1P4LB 3BMVA 3TN0B 5FHAL 5CJ5A 2ZG1A 2BY1A 3GMNA 2HFEB 2EIZB 5AAMA 1D9KC 5EZLB 2CGRL 4WO4B 2QQLL 3HTLX 5DRNB 3QT2A 1OSPL 4Z7WE 1VSCA 3VA2C 1KTLA 3MRCA 3PIQB 2NY0C 4K7FA 1MCFA 4U0QB 3RWEA 4PRIE 5HY9A 1WAAA 4PGCA 1H9VA 4GW4B 2FEEI 4NQXB 1TQBB 1OW0C 4KVCL 2NY1B 3U9PL 3RIAK 2Z92B 3V4VL 3VGAB 1J8KA 2FBJH 3P9WB 4P23C 3ARRA 4WU5B 3MJ8A 2CK0L 5I1DB 2DQIH 1AQDA 4GKOA 4A6YL 5TDPB 2XG5A 1PY4A 4L1HA 1Q94A 1UKSA 2DLGA 3S4SG 4MHHI 2RGSA 4JN1L 3FTGA 1UZ8A 2ATPB 4WW2C 5GGVH 2IPTL 1D5ZB 4QXTB 1VADA 4FZEH 3MLWL 1LO2L 5JIHA 1DLFL 4M02A 3GMQA 4PLJC 1J1XL 4MAUH 3NZHH 2FGZA 3DO7A 3EYFA 3FFDB 4YH6A 1YA5A 1T22B 4KDVA 1JZ2A 1MCPL 1QOKA 4PJIB 3TC9A 4NKIH 2E8YA 1CI5A 3VRJB 2Q3ZA 4XPHL 2RFXB 2HKHH 4G8FA 2ZP0T 4PJDE 5IBUG 4P2QD 2HKFL 3KS0J 2DBLH 3F7VB 5GGUA 3JSSA 1BQLH 3AGVA 1BJMA 5DMIH 5ABDE 5I16A 1KPRB 3ALXA 1DBAH 1CLCA 2ITDA 2WUCL 1HXYA 4AEEA 4PJ7E 1G7PA 3T0EC 4R97C 3TP4A 5CMAA 3D1MC 2FBOJ 1ZLUK 1IE5A 4Z7UA 3MXWL 3QUKB 2E7BA 4D0DB 5D7IF 2N7BA 1MCDA 5IM7B 5F9WC 2GJ6E 1F5WA 3RKDD 1SYSB 1F4HA 4O4YL 5F88B 5CSBA 1OD9A 1AR1C 3MV11 4LLAA 5D2LB 3ZE1E 2EDQA 4ZXBC 1FN4B 4JM2A 4EOWL 2YA0A 5CEZH 3B5GA 1RZ8B 4PJHA 1VFUA 4O58H 2HT2D 3NTCH 4DFIA 3SDCA 1B90A 4MXWH 1A14H 1N0XL 3EAKA 3VXNB 1EV2E 3QXUA 4JR9L 5F1NB 4F9LC 5EOQL 4JFPA 1CICB 5HBBA 5H8DA 4H88H 2VB5A 3AAZB 2P5WD 4NC0B 4CVZA 4H5SA 4K23L 1DUYA 3VFWB 4OQ1A 4LSPL 1Q9LB 4XPAH 4EEEA 5AUMB 3WFBL 4F57L 4NKMA 1JI2A 2XTJD 1IAKA 3W39B 5T5NG 4GOSA 5ID0B 3ZDYF 4ONOA 3BD4A 4H0IA 1R5WA 3DBXB 5DD6A 2OM5A 3SDDC 3EYVB 3Q6GL 2DQDL 2VXTL 1FFPA 3KYNA 4HWZA 4W70A 4QHLA 1I8IB 5DD1L 1IKNC 2HVKB 2X7LB 3LEYL 4LHQB 4CNIB 1QKZH 3CX2A 1NMCB 3TEUA 5E5RB 3SDAC 5LCVL 1DE4A 1M4KA 4ONFL 4LCCA 3QIBA 2AJ3B 1YMMA 2MKLC 2CRIA 3BPLC 3HR6A 4RISH 4BH8B 1UC6A 3LZFL 3VXUD 3ZT5A 3ZYZA 5DK2B 4GMSL 1I8MB 5FUOH 1I75A 1XIWB 2DDQH 1YQVL 2YMXH 3MGAA 1IT9H 3QZWG 1JNLH 1II4E 3F5WB 2DJUA 4BZYA 3ULVF 3O8XC 4XTRC 5IR1A 5KS9B 5AG8A 3HRZA 4B50A 3EGSA 3T2NH 4CN1A 5KOVC 3BJ91 4OQTA 4GKSA 2V17L 3FHQA 1LO4H 1NGYB 5I1GL 5LQBL 3RWDA 1N5YH 2B7DT 4S1RH 3UTSD 1FO0L 3OXRA 4R4FH 1HCFX 5HDLA 4KMTL 1JF1B 5JPNB 1FAIH 2HLFD 1WQVT 4Q6IA 1MVUA 1DQLL 1DQJA 3S35X 3JTSB 3RI5K 4LBEA 5IB4B 3PABB 5EU3A 3ZT6A 3D39B 3FONA 2YR3A 2H8PB 2D31B 4P5TC 5E24E 3V7MA 4UT7H 1QFPA 2VWEC 1WWWX 3CFCH 1AXTL 3QIWD 1N5AA 2VE6A 4HWBH 1H15A 1MI5D 5CIPA 5IHLB 4YXLL 2UWEA 1NDMA 3Q0HA 1X5LA 5EIVA 1NFDA 5SV3A 4NRXB 5CWSA 4U7SA 2UUDK 4JFXA 1INQB 2WBWB 3UJTL 4LF3A 3WLWC 2AJZA 4HX1A 2I07B 2NY4C 3B2VH 2V7NB 1CDUA 4LQFL 5D7KE 3MRMB 3NCYS 3U6RA 4DAGH 4AIZB 5DI8A 1N3NA 1DQMH 4JG1L 1W0YT 3LKPA 4WTZA 1YNTB 4DKFL 2AP2A 1A3RH 5CJXC 2DQCH 3MUHL 5ACZB 2EXYC 4ODUA 4OGZA 1MIML 4HIIB 4KV5E 4P4KC 3NPSC 3BT2L 5IBTH 3WSQH 5IROA 1OWWA 1Q9KA 4JQXA 2PYEE 2IH1B 2A6DB 3OKYA 4HPYL 1CFNA 3PP4H 3ZTJH 1J18A 3QUMH 3MRIB 4RCAA 1XGPA 5C3LD 2JE8A 1MVFA 4NZDA 3SCMD 2P46B 1OTSC 3EOBB 2R29H 4QF1B 4ODTH 3DIFB 4LCUA 3DUHA 1ONQA 4TPRH 1H3VA 4RWHA 1KFAH 5I8CA 5I1EL 2Y25A 1ROWA 1EZVY 3LKRA 1BVKB 5E08L 1NAKH 5CBEB 5MI0B 4JJ5A 4DZBB 4APQD 3L7EB 4YE4L 2X89D 2Z4QA 4NUGL 3EW3B 4DZ8A 5DRZB 5L88L 4QRSB 4Z7WB 1YYML 3MJ6A 4JZOB 4KKAC 5GIRB 1HHKB 1HSAB 3UPRA 2J8HA 1T66D 5ILTH 4RNRB 5EO1A 2ADFL 2Z91A 5CBAA 5BZWA 4NQED 4PYHA 3PDGA 2F9BT 2HTLC 5GGSY 4C57C 4MX7A 5I1KL 1VFOA 4KXZH 4Q9RL 2OXGA 32C2B 2C3VB 1E6OH 3JUYA 3MV9A 5EN2B 3O2DH 4ELMB 1DVFA 1RZGB 3UPCA 4S2SA 2X4PB 1VB9A 5F1OB 4E0RA 4PBXA 4KK8D 1EEZB 5E8OB 5DURD 4L3EE 2VDNH 3SE9H 3MSPA 1U42A 1S3KL 3A6BL 3QO0B 1E4WH 4JE4B 3U7WL 4L9LC 2BVOA 1BZ7A 3H7BA 2VZ3A 4P9ML 2NX5A 1HI6A 3BGMB 2LVCA 1JPGA 3O4OC 4HKXB 4JFYA 3PWUA 5CD3B 3LN5A 4WFFD 5KJRH 3MREB 1QSEA 3SJVA 1GC1C 4ZS6D 1JUFB 1I3GH 3NACH 2BCKB 2B5IB 4JRWA 1NEZB 5E5UB 3VFGL 2BVTA 1A1NB 1IEHA 1WCBB 2F5AL 2R2HA 5TDOA 5MEQA 2ADGA 4JFQB 2OR8A 4GBXD 3IJYB 5H35A 5A3ID 2XQYG 3TPUB 4PJXE 4NNXB 3ZE0E 3I6LD 3ULUD 1KCUL 2OL3A 3V0WL 4YAQB 3ZMRA 2X2YA 3PXHA 2E9JA 5HI3C 3Q1SH 2VLKB 3DXAD 3L3KA 4HHAA 5D6CB 3BUYB 3OAZH 3KPPA 4LFHG 5J9PA 2C4FT 2E27H 2BNUA 4TQEH 3RGVC 3DI2B 4HFWB 1AHWC 2C3XA 4KKLC 2C1OB 3OR6A 2L7UA 1JHTB 2V9QA 4HCRL 2ADJB 4PJ7B 3TFKC 1HQ4A 3IXAA 4X9BA 4RSVA 4OGAC 2W92A 3O41B 3BEVB 4OD2B 1E4KC 4IOIA 5HTSA 3FQUA 4WEUD 1WFOA 2GJ6B 4LLDB 1U3HA 4FZ8L 5C0GB 4YPGB 1G9ML 2GK2A 3UJJH 3JZ7A 3JUZA 1PZUB 1ZA6A 1R3HA 3WDIA 3EHBC 1FL5B 2FHCA 1L0XA 5IIEA 4HH9A 3OJVC 1T0PB 2X70B 4RFEB 5ANMA 4WI8A 4HLZH 3PGDA 5DD5H 2N1KA 4YBQC 3ARUA 4UOW0 3BAEH 3SGDI 4XXCA 4KDTA 3IETB 5F96L 4WU7B 1FLRL 3IF1A 3WL9A 1IC4H 1QVOB 1OAQL 1RU9H 4BH7A 2YC1A 2K3TA 4LAQH 2XQBH 4MXVE 4FG6C 3FZUD 5SWZE 1CCZA 2NY6B 3HG1E 4YUEL 3LH2L 1C1EH 3PWVA 3QI9C 4WJ5B 3V5DA 4OIIH 4GG8A 3O9WA 4N1EA 4OIAA 3G08B 1MH5A 5FO7B 5IW3A 5DXWA 1X7QA 4GG6A 3VD3A 2CDGB 3CXHK 3QEHA 3ZKQD 4DEPC 4LRNH 4ZOBA 1TJGH 4HS3B 4Q2ZB 4BFIB 1F4AA 5IUSA 4GRLC 4R7NA 3FHAA 4Y4FD 2M8XA 2X6MA 4LQ1A 4G5ZL 3RWGB 3FO9B 4LLUA 5BS0B 5E99L 2F8OA 3L3JA 4XBGB 4XPGH 1YEHL 5B21A 1NGQL 3BJLA 3IU3B 2GFBB 3L3DA 3V52L 4NN7B 4RAUB 4NT6B 3DVNB 3GRWA 3MACH 3FFCD 4BKLB 2FZ3A 2O5XL 3HAEA 3I2CH 1QUNA 4JKKA 3WNLA 4ELKA 4PJCF 1MAMH 5CP7A 3ZE2E 3BD5A 3TN0C 1J87A 3MRQB 3UC0H 3LOWA 2R2BA 2ICWJ 4WO4C 2IPKB 1IRAY 3MYJA 3IS1X 5DFWH 2W9EH 4NWTH 2IBBA 4NQSB 4XVTL 2DS4A 3PG2A 4F2MB 3NCBB 5ESAA 5D7JB 1T5WA 2VC2L 1TQBC 2O5ZH 4WTXA 2NY1C 4Z7OE 2C9AA 4CKVX 1AJ7L 1W72A 2IBZY 3GIZL 2YPLD 2LE9A 2WINA 3QWRA 4X6FA 4YIQA 4R4ND 1C16B 5JO5A 2Y06H 2Y7QB 3KVQA 2DQEH 4P3DA 4WENB 1NL0H 2G60H 3BW9A 3NCFB 5CJQL 1D5MB 4F8TA 3BKYL 1OWRM 3WD5H 1U8OB 5GS0D 2J2ZA 4D3CH 1MHCB 4QRRE 4BYHA 3EDEA 1EXUA 3V6ZA 4JAMB 1CTOA 1NC4A 4UDTB 4PREA 2B1AL 4M6ML 3MOAH 1NEUA 1AD9A 1F4YH 4ZUUA 2FR4B 4NRZA 1XF2A 1QBML 3TVMD 1MEXH 1ZANL 3BZ4B 1NKRA 2PR4L 4PRBA 4JCLA 3FMGL 2MJWA 2UY6A 3R1GL 3VH8G 1ZGLB 4X6DA 4QKXB 4M9OA 1C5CH 5IQ9B 3LQAC 1T1YB 2GSGA 1EO8L 4Y1AE 3VGDA 5TFSH 5C8JB 3VXME 4JO2H 1CFTB 1W0WA 4OZGF 1S9WA 2PYFA 4KK9C 1V7NH 3K8MA 2VKWA 3IB4A 2V2XA 5F7HA 4PJFF 2PYEB 4AENB 4C56B 2OJEA 1I4FA 1VGKB 4PJAF 2H9GA 3SKJH 1UM5L 4Z7NE 1RJLB 3MROB 2WM0A 1D5XA 1FORL 2CDFB 4JFOB 2EC8A 4L3CA 4M8QB 1FJ1A 2HRLA 4EDWL 4JB9H 4NRYA 4G9FB 3MLTA 3LS4H 3RZCA 5HGAB 4XP5L 3U4BL 3SGKC 4CJ1A 3G9VA 1UEYA 2D4DA 2IANE 3V6BR 2R4RH 1WF5A 1CVSC 1YMHA 4HJJH 3BZEA 1T3FB 3QA3B 4JRXB 1BJ1H 1WEJL 4HIEB 3L5HA 2YUXA 4HC1H 4LVEA 1A7RH 1HHHB 1DBJH 5C0CE 1AE6H 1M7IA 1ZMYA 3N0PB 5FF6B 2IG2H 3LD8B 5GSVB 3D85B 1LWRA 2AXFA 1JNHA 1HHIB 4ZFZA 4HZLB 2IQAB 1CICC 3VFSB 5DC0A 4OFYD 2CPCA 5F7EL 2X05A 4U1GB 3MR9B 4QWWC 1P1ZA 4IOFD 3QQ9D 2GYSA 2WWMC 1FVDB 1XF5A 5EFIA 2IH3B 3VWKD 1JMXA 2WQRA 3F58L 3MV7E 4AG4H 4CVXA 4L3EB 1ADQH 2DM4A 3TBWA 1H3UA 4UIKH 1NGWA 4ZFGH 4LPCA 5D7LA 3VFNA 3PL6A 4YHLH 5T5NF 1WZ1L 4JO1L 2LV4A 1KG0B 4OBSA 3TA3D 1A6PA 2YUWA 4U6YB 4Y4KA 5TE6L 2DM3A 1IAIL 3IDYB 5F89A 1M1SA 1R6VA 1YECH 4PYGA 3TO2B 4ZD3H 5ICZA 3BH9A 2BNRE 2QSTA 2FSEB 3BDYH 5CFHA 3REVB 1H3PH 4WUKL 1Y18A 3MLUL 3EO9L 3MA9L 3MRGA 1ETZB 4CADB 4QXGL 1JTOA 5SX5H 4YX2H 7CGTA 2NY5C 2VOTA 5SV4A 1BVLA 1X9QA 4O5LL 4TNWK 3I9GL 4PJXB 4UT9L 4MZ3A 1OTTD 2D7PA 5HHVH 2EH8L 5I0ZA 3AMKA 4JM4L 5DFVD 4PPTA 3C6LA 4KAQH 1MRFH 1DEEA 5T1DH 1QP1A 4HAFA 4M1DL 2RHEA 4YHIA 1U3ZA 2X4TB 3EO0B 2R0ZH 2R56L 4TSBL 4XNYH 5DRWA 3L5IA 5DVOA 3WCYA 2BVPB 1MUJB 1QSZA 1NQBA 1R3LB 2VDOL 4ISVA 3FT2A 4MA7L 4B41A 5EU7C 4M7ZB 3DVGB 5IV2A 1JF5A 1FNSH 1B6UA 1JNJA 1ZA3B 2WZPD 3G5XB 4Y16B 1V3KA 2ZUTA 4RDQF 4PLNC 3B83A 5C0IA 1AP2A 5FECB 2JJVA 3B3IA 5F93C 4I2XA 3B8SA 1BOYA 2EDYA 4BUHA 3G6AA 4HK0A 4H25B 2VLLB 3VFPA 4C58B 1WAAE 3DGGA 3HS0A 2R2EB 4WNQB 1IQWL 1KN2L 5C0BA 1JGUH 1A6UH 5EU5B 1YDPA 4UB0H 4DCQA 1T83A 1D5IH 4OCSL 3BZFA 1CXLA 4YHNB 4D8PB 3HG1B 4GW5B 3OL2A 1YJDC 1I7TA 5JMRA 2R8SH 3L3HB 4P2RE 3BO8A 3P30H 4Z9KB 2KDGA 4MYWB 5E5MA 4Y0GA 1LEKA 3LN4A 4J8RB 3RL2A 5I8OH 8CGTA 1YQ2A 2N7AA 1RJCA 3VW3H 5H94B 4GQ9H 4M5YL 2HLAA 2HTKC 5DGRA 1FZMB 2LU3A 1S7VA 1QSVA 1CZ8L 1GL4B 5GS0L 1V3JA 1S7XB 3GJFK 5D1XD 2VRAA 4N90D 3GMPB 2OQJA 3OKOB 1GC1H 5FIEA 1UA6H 4LPXA 4X5LA 4KMQA 5ALBH 1W0VA 3NGBC 2YUVA 3UBXI 4L8CB 5HYJA 1SY6L 5KSAB 5MI0C 1A8JH 4OAWB 1PYWA 4Y5YC 3OJDA 1DFBH 5TQ0H 3W0WE 1BJ8A 3Q48A 1RUMH 4M03A 3KPOB 3PWJB 4JVWA 2PO6B 3MCKB 1U8NA 3IGAA 4Y5VA 4DUXA 3QWQB 5MENE 1JGLH 5DHVH 4N5ED 5F7UA 2IMMA 2R1WA 3LMJH 1MFCH 1QRND 3BIKB 4ODWA 1EHNA 5L2JB 5E2WH 4I3RH 1DN0A 5DJ2B 3U4AA 2AK1L 1F00I 1YEJH 1HYSC 3GM8A 1J0ZA 4GAYA 2FJHB 4QRRB 4MAYA 3B4NA 3KAAA 2O61B 4QTHB 2HG5B 2QQNL 3PGFL 2R0WH 2V2WA 5D5ME 1KBGH 2VLMD 2Q1EA 4ODVH 4X6DF 4K7PY 1E4XI 4MXWL 4PRHA 2XY2A 3HNTL 4G6AC 1AGCB 2H26B 4L5FH 1NFIB 3S36X 3VI4E 1P4IH 1CU4L 3BWAB 2DLFH 4Z0XB 2JB6A 2C3GA 3UTTE 4GXUM 3DSFH 4PJBA 3O11B 2VO5A 2CO6B 5IVOA 4LSSH 5CGTA 4WHTB 1GHFL 5TF1H 1R24B 3VFRB 4WFEE 1FGVH 3HI6H 4PJ8A 5FB8A 5I9QC 2FX9H 3KXFA 5MERB 4EN3A 3VXMB 4CVUA 4KROD 5EBLB 3S37H 4PJ5A 3X14A 2J6EH 4HT1H 4KPHL 1J7VR 3CIQA 1TITA 4RMUA 3QSKB 3MLXH 2YD5A 2BVYA 2NCMA 2GTWB 4MJ6A 3LKQB 4NBXB 1GIGH 4LCWA 1NAML 5IB5B 3L7FA 2APBA 4IIQA 1KTDA 5JHLL 3WXWL 4RISL 2L7JA 3TF7C 3RVTC 1URLA 4HH8A 5BVJA 2F74A 4NO0A 3GSNB 2YS4A 1S5IL 3IU4H 1VGEH 1JNLL 4KHTH 2VXQH 5LAXB 1ZSDB 2H6PA 2WSKA 2ORBH 3RX8A 3PUCA 4OCLC 1QLEH 3DGCR 4QOKE 1NC2B 4ZDHB 2OTPA 1VA9A 4DN3L 3T1FA 2ITCB 2Y07H 4OI9A 1ZT7A 1FL3A 1HINL 4OZHF 5T1KB 5C0CB 3RL1B 5IFHL 4XCNB 4JKMA 3O3EB 4ZTPH 5JHDE 1LD9B 4R4FL 2J7LA 1G6RH 4OCRH 2YOCA 3UDWC 4H26B 1S78D 3SDYL 5JR1L 2F53E 3VFVB 4EZMA 2JJSA 4JFHD 2BY2A 5DJ8B 3BH8A 3P9MA 4ESKA 3QUMA 1WT5A 2NY6C 1CE1H 1KT2A 1NMBL 4HBQA 4NQCB 3WIFA 1ED3A 3R4DA 3LRSA 1CLOH 4HWBL 4YR6B 3MV7B 2J4WL 3HZVB 4JM2D 5IVXA 2EE2A 3ES6A 1ZTXL 3GSXA 3HHRB 3SO3B 5C08A 5E8DL 1R3JB 2BVUA 4YHOH 1U8JB 1DEDA 3LSOA 4LSVH 2JCCE 5IMMA 3VFMB 3QXDA 2EEBA 1A6AA 5DJ6A 3SDCD 3V4UH 1XF1A 4C55A 1NCAH 2VQUA 2Y5EA 4IRJA 2BNRB 1IZKA 1A6ZB 1BBJB 4U6VH 4HUVA 4DAGL 4OLZH 1T2JA 4BFEA 4LLYA 3D3VA 3KWWB 3BKJH 3MTRA 1N7MH 3MRHA 4Y19E 4F9PC 1XEDA 2CIKA 2DQCL 4N8VB 3ZL4H 4MA8H 5FO9B 3BXNB 5C09E 1CWVA 5JXAL 1HKLL 2PN5A 3ULVL 3QFJA 4NM8L 1X5GA 3EJZD 4K8RH 1EEYA 3T04D 5D7JC 1PAMA 4LGRB 3OR7B 1YEIH 4JZJB 3I75B 1AY1H 3U0WH 5DEFB 3MRLA 1YY9C 5D6DA 2X42A 3QIBD 4D9QD 1YMMD 3DV6B 4ONGL 4X4MA 4AMKH 3E0GA 1OARH 2J88L 4FTVE 1IQDB 4G8IA 1QNZH 2OBGA 1RMFL 4GMTL 3RWHA 3MRJB 5MHSD 1RPQA 5GQBA 1DL7H 5KS9F 1ACZA 1S5HB 5C07A 3C09B 2EYSB 3F6LA 3QPXH 4YHZH 3HE6B 3WBDA 4PP2B 2NYYD 3UYRL 1DJSA 2EO9A 4OGXH 1EVUA 4XNMB 4QRPA 4TVPD 3T2QA 1X3DA 2HVJB 4MDJB 1E27A 4I9WD 4TNVK 1PW3A 5GGVY 3G04A 1XCQA 2E9IA 1C5BL 1X5IA 3QUXB 4GW1A 5C6WH 1I1YB 4RGND 1IBGH 3CDCA 3WUWB 4M62L 1P4BL 2HT3D 3O6FA 5JQ6L 1K6QH 5JDJA 4X98B 2FO4B 4PJ9C 3V7AE 2VITA 3MQIA 1XH3B 4P2RB 4X8XA 3PF2A 1IL1B 1I3VA 4O02L 3DO3A 4OV5A 4JDZA 3RWJB 3HPJA 4PRNB 2VQ1A 2CH8A 5DK0A 1OAZL 2DI8A 1Z9LA 4S10A 2NX5E 3FRUB 1ZLWK 1F6LL 3WEXA 2EDRA 2R1YB 1T03H 5C0ND 1MRCH 1YPZB 2F54E 3RWCB 5KSVB 1D9KA 4Q7DA 3RGHA 2OTWB 4MSWA 1JWUA 5JW4Q 3ALWA 2BK8A 4UZGA 3T0VA 1B4JL 1U8KA 3SO5A 5C6PB 5GXBB 1ODAA 3W0WB 3HUJA 1UM6L 5C9KA 2NY5H 2G5BB 1JGEB 3UXFA 1QSFA 1RQ5A 2VDLL 4XP4H 3BQUB 2D7NA 1AFVH 4MQSB 3LD8C 5MENB 3MNVB 1ZLSH 5JZ7D 1G7LB 1YYLL 3KPNB 5DQ9B 4HUUA 3FCTB 5C0FB 1CFQB 4YHPB 5BXFA 1K8IB 3HC3L 2GITA 1UFUA 4GRMB 3TYFB 4NJ9H 3VXPB 1RIHH 4DN4L 2WBJC 1SEBB 3G5YA 2AGJH 2I60L 3V2AR 4L9DA 4WW2A 5D93B 5FKPB 1A6TB 1EFQA 4YZFF 1FVCA 2FHFA 5DR5L 4M00A 2VLRE 1WV7T 2YHGA 1RVFH 3RU8H 4OZIE 2HJKA 4M1GL 5DZNA 5FXCH 4HGMA 4NN5B 1PG7L 1R3KA 1J1OL 1ITBB 2GCYA 1Q0YH 3BAEL 4O51B 2AXGB 3IDYC 5C2BL 4MVBC 4HXAH 4QRTB 1T2XA 3L3IB 4XCCL 5ANME 5GSRA 5HHOE 5B22A 4KZEH 1UM4H 4OJFH 1IGTB 4JGJA 3MV9D 4KRMB 3QPQD 3RPKA 3WIHA 4M6NH 4P2OB 1DVFD 3HR5A 3UTTB 3U79A 1ES0B 5KVFL 1C1EL 4AEHL 4PR5B 4ERSH 2DQFA 1T6WA 3GBNL 4CAGA 4U1MA 2O5YL 1IM3A 2AXJA 4HKZA 3H3BC 2OZ4A 1F6FB 2DOCA 4F58L 2P4AB 3GHEH 1IFHH 2GAZA 1G9EA 1J88A 3BP4A 3GJEA 4Y4HB 1RURH 5E6IB 5B4MC 3ARYA 4Z7VB 2FD6H 3IAPA 3DVFA 5I75C 5JOPE 2DYPB 3T0EA 5T3XH 4L8DB 4JPKH 1YJDH 3RX5A 1DTUA 3H9SE 3RVVD 5EU4B 5DJYA 1QSED 3SJVD 3EYSL 2DM2A 2Z35B 5IMOB 2R9HC 1T7XA 4WI7A 1Q8MA 4WV1B 2VXVH 5HGHB 5CZVL 3CFIC 1N4XH 3ETBF 4XP9L 5HGDA 1QEWB 1I9IL 5KSUA 4ZXBA 4M7ZC 1RFDL 3NIFE 2N56A 1PLGH 4KRPC 5EZJB 5HHPB 5D70H 3L5XL 1MLCB 1C12A 4Y16C 1MJUL 2W9EL 4RAVB 3OKMA 4C59B 1Z5LB 4Z5RA 3W82A 4HPOH 3KG5A 4LLVA 4QOKB 3D0LA 5EO0B 3CFBA 3QRFM 3QEGH 4NHUA 2IGFH 1P7QA 1IC7H 4F9LA 1Z0NA 1I7ZB 5GRUL 1MNUL 3GI9H 3QRGL 1G7QB 2QQQA 4N0CD 5JHDB 4NBYB 4XH2A 4J3SA 2EE9A 3BSZH 4OT1L 5IVXF 4BA8A 3VD4A 2F53B 3CK0L 4W4NA 2D4FA 3HE7B 3GFUA 3VXTB 1KSRA 1U3HD 2KUTA 3QHTC 1EZVX 3D25A 5JPMA 2KL6A 3G6DL 4HJ0D 3P9LA 3SDDA 1L4IA 1UQSB 3F7PC 3BPNB 3GBML 3PGCB 1IKNA 4KK6D 3TIEA 3U4EA 3MFFA 3SDAA 2J12B 5TF0A 2ZJSL 3SGEH 3VI3F 2JCCB 5GRYA 1A7NH 2OCFD 1F3JA 4QRUB 3B9DA 5DT1L 1RK0B 4H1LB 2EEAA 5IB1A 4I48A 4Z0BL 3RWIA 3CZJA 4FQHA 4LPWA 3NFSL 1W2KT 4JO4H 1FSKB 3WS6C 3D5OF 2CDEB 3VXRE 3E6FA 3BUTA 1GGCL 3GSQB 4YBHA 3O8XA 3W11D 3JWOH 3RPIB 4Y19B 3O9WD 5KSAC 5I30L 3KPSA 3H2WA 3HCVA 2IEPA 3FQNB 3DI3B 1BPVA 5C09B 1HILB 3GGWA 3MO1A 4TVPL 1OP5K 3HMXH 4WW1B 2PO6C 2UVEA 3FOLB 1VFAA 4GKZA 4M7KH 3O3BA 3QEUA 3KYOA 4HS8H 3SDXA 4P5TA 2IQ9L 3J7HA 1F4WH 4KJQC 2FDBP 2BHYA 4FTVB 3W81A 3NVQA 5DMGC 3IFOB 4HBCH 3VXSA 3MCG1 5FYLE 3CFEB 2EEDA 3ILPB 3WO4B 5ERWB 4G9DB 1Q9OB 5IG7B 2CLVA 3GHBL 4MNGA 4F33B 1IVLA 1P7KB 1FNEB 1ZAGA 1HZHL 3HZMB 1INDH 4OFIA 4UIMB 3QWRD 1T0MB 15C8H 2ZOKB 2YWZA 3F12B 1EBPA 4LLWA 1Q38A 2AJXL 1AXSB 2FYYB 3FO1A 2VN4A 3MA7B 3QIUD 3MV01 2DTML 4JY6A 1CTNA 5CJXA 3BN9C 1U3YA 3STLA 3E6HA 4JHWL 5EIIB 3NMEA 1A4JB 1JGVL 2NY2C 1BQHG 4P4KA 1PJ9A 2EH7L 1HHGA 1E6JL 4XXDB 1FPTH 2O26U 4GT7A 4MXQD 5EU6A 5A2JH 3NABH 1MHEB 3EJYC 4WUUA 1NC4D 3RNQB 3GO1H 1Q9WB 5F7MC 2HWZH 4LIQH 2OSLB 2P5WB 4ZD3L 3L6FB 4R0LB 1DCLA 1JGDB 1OTTC 1IGCL 4WHCA 5DFVC 3LKSB 2ZG2A 1JHKL 5I19H 4F7TB 5GGQL 5BZDB 2F5BL 1K4DA 4NUJA 2A74A 3HI5L 2F54B 3HUJF 5B8CC 1BREA 3OZ9H 4JFZL 1U8LB 2WW8A 4G7YL 4R2GD 4A2LA 5CZKA 5K9OA 3T65A 1ACYH 1TZHA 2D0HA 3EIFA 3WUWG 1X5XA 4DOHE 4Q9BA 4PRAB 3QXAA 1D6VL 4QGTA 4NKDA 3QQ3B 5CGYC 1MRFL 5F9AC 3KPMB 2NXZD 4M7JL 2W0FA 5FO8B 5DMJB 2ICWB 1DUZA 1PKQE 4EXPX 2V5SA 1FZOB 1NUDA 3CC5B 3TBTA 3PQYA 5F9JB 1MIEL 3HMWH 4E41A 3SE8H 2ZKHL 2IADB 4XWGL 4U6XB 3UJIH 3IDIA 4TRPL 3FQWB 1F11A 1K2DB 1NBYA 3IDXH 4XBPA 1FV1B 1ZWIA 5KVDL 2EDTA 3B8YA 5FYLD 3RZCD 1NFKA 4K2UH 4OUOA 4P46C 5IJVA 2YK1L 2JJWA 5AWNL 4L9LA 2XZQH 3IJHA 3P73B 2B4CL 3L9RB 2NXYB 1KIRB 3QDGD 1N6VA 3QCUH 5AZ2L 3CFDA 1ZHKA 3UTSB 4PJEF 2VLRB 4YNYB 1P5UA 1RUQH 1U8HA 3SO3C 3RVWD 1RHHB 4OZIB 5BMFL 1GAFL 4UNUA 4X6CE 3HPLA 4UTAH 4YJZL 4N8CH 1B6DA 3QH3B 4M3KB 1D5BA 1IEAB 2WIIA 1UXWA 5LXGH 1TXKA 1K4CB 2IBZX 5HHOB 4UB0L 1NGZB 4M1CC 5F21B 1D5IL 3MXVL 3ESVF 5T33L 5F71A 5L7XH 2YA1A 4IM8A 2Q6WB 2WWKO 3QHFH 5C0BE 4F80A 1I85C 1JV5B 3TIDA 1QFUH 1IZJA 2NPLX 1S9VB 4ZNEA 4QYOA 1QPXA 4J3XA 4XMLL 3O3DB 3J8F7 3CJJA 5D7LD 3PL6D 4F7PB 3RGVA 4GRWB 4Y88A 1AHWA 3SGJC 5I66B 1NCWL 4TOYL 4Y4KD 4X4XB 1HH6A 2X5PA 2ED8A 2VZTA 3QWOA 1FFOA 2AEQL 2CIIB 1VFMA 1QLFA 3LS5H 4HFUL 1JP5A 3H9SB 4JZJC 3IKCB 3PNWA 4QY8A 4XCYA 5GRJH 3GMLA 5INCA 2X4OB 1E4KA 1I9JL 1MJJA 5KZCD 3PHOB 3IDGA 2G75A 2JB5H 2Q3AA 2WBKA 4G8GA 1CGTA 5ALBL 3OB8A 1KPUB 5JA8B 5HPMB 3MRNA 5CEZE 1EGJA 2QSQA 3EFFA 3S6CA 5FK9A 4RZCB 1DFBL 3FOMA 1QHPA 4N0FB 5C0JA 4B7LA 3HA0A 1RJZA 5KN5A 1YNKL 1XGRB 2VZSA 3C6LD 5HYJE 1G0YR 2NTFA 2FJFB 3EOTH 3K3QA 1ITCA 3C09C 1JGLL 1FFNB 4CGTA 1ZVYA 3L3OB 1LO5B 2QADD 4AT6B 5I76A 5J6GA 1JPTL 2UZIL 3MLSL 1O5DT 3LEVL 1Z9OA 4G80B 4X6EB 1XR8A 3G6JA 4ZFOL 5FYJH 1GZPA 2AKRB 1FC2D 1WJ3A 4APQB 1J5OH 1G7IB 3LB6D 4U1NA 1ND0A 3M45A 4H20H 4IS6B 2RCSL 3P4NB 2J6EA 4B53A 1H3GA 1KIPA 4XCEA 3QI9A 2A6JB 2A38A 3QUXC 25C8H 4O9HH 2D0GA 1YEJL 4MS8C 3W9DB 4KH2A 3PWNB 4IRZL 3W9EA 1T04B 2AJYL 4CN4A 5C0RL 4M5ZL 2V6HA 5EWIL 4HD9A 4U2YA 3ECBA 2A9NL 4FOMA 1IEBA 3U36A 4GRLA 2W0KA 5I1AA 3QDME 3EYQC 4ODVL 1BWMA 4OD3L 4YDIL 5E9DA 2QR0A 4NOFA 3GRWL 4ZS7H 3S88H 4MB4A 1LK3H 3OAUH 3CPLB 1AO7A 1S7WA 1UJTA 3MV8A 4L5FL 2LAGB 2HFFB 3WKMH 1KB5B 2DLFL 5E8NA 1P4LA 3TN0A 2PF6A 4QHKJ 5D7IE 3EDKA 4UT6L 2HFEA 2EIZA 1O7SA 5EZLA 3TBVB 4WO4A 5DRNA 1U6AL 2HRPH 5IHUH 4HMCA 3VXRB 4NCC2 3K1DA 1ZT4B 3MCLL 3PIQA 4DGYH 1HSBB 2QQKL 1XZ0B 4JANB 1MCBA 4FMKA 1ZEAH 5AD0B 4PIRF 4GW4A 3QXWA 4NQXA 1MREH 4HT1L 3S5LB 1W72L 3MUGB 1ULVA 2Z92A 3NN8B 3PP3H 1Z3GL 3FAXA 3GK8L 2FO1A 4WU5A 2BVEA 3BQUC 5J6HB 4YXHH 5I1DA 4NNYB 4GBXB 4WWKB 5DS8B 4PJ5E 3B2UC 4KI5F 5DDHB 2QL1A 2QHRH 4OF8A 4OCYH 5T3ZL 2EZ0D 4H1LG 5TE4L 5TH2B 3VCLB 1JPSL 2E7CA 1ZLVK 4KHTL 5DLML 3WNOA 1KLFA 2RB8A 1UB5B 2V9RA 5HYJD 5D93C 4KK5C 4GAGH 1D5ZA 4QXTA 4I18B 4MD5B 1MF2L 4ZOEA 2VLJE 1FRGL 2IPUG 4JO3L 1BZQK 4P2YA 2XKSA 1R3IH 3FFDA 4ZTPL 4XNQB 1F4XH 2D7OA 1T22A 5CUSH 2IFFH 2BP3A 3ZO0A 5C0AE 1S9XB 4OF5A 4PJIA 3VMOA 3VRJA 5J3HD 2BNQE 5CSZB 2RFXA 2IJ0C 4JPWL 4P2OC 2A0LC 4L4TE 3VMNA 5ICYB 1E28B 3C60B 3F7VA 3K2UL 5B38G 4QXUH 2R0LH 1A7PH 3ULVE 4M6AA 4XP1L 1K9TA 3OJMB 3FL7A 1KPRA 4MAYD 3D0VB 2APTA 4Y4HC 1RZKH 2Z93B 1MJ7H 3EYUH 4YXKL 4QLRA 4PRHD 4MQXD 3T4AB 5K9JL 5KBNC 1CD0A 3QUKA 4D0DA 4FFWD 4HUNB 4DQOL 2WLYA 1RUAH 5C9JB 5IM7A 1NH6A 3KPLB 5CS7A 3SGKA 3OX8B 4X7SH 1OTUD 4UILH 4FXLA 5GZND 4W6XB 3GKWH 2MWCA 4NZUL 5D2LA 1WICA 4P9HC 1KUMA 3O3UN 4OZFB 1FN4A 2VZUA 2FEDD 4QXWA 4PJ8D 3ROOB 2W9DL 1OGTB 1A7BA 1CBVL 4RFOH 3KXFD 1FDLH 4Y4FB 4EN3D 1JCKA 1RZ8A 4ONHA 4PV8B 2X9XA 3OKLB 4X8JB 3T8XB 1U8IB 4K8RL 2EECA 2DI9A 5JW3L 5JOFB 1WBYA 3FFCB 4HZAA 3VXNA 1KEGL 2HA1A 5F1NA 4LCWD 4EBQH 1AY1L 1CICA 1PKQB 3ZHLA 3QFJE 2JJTC 3AAZA 2NW2B 2AS5M 1CDCA 2VDQH 3EFDL 4TUKH 1U8QB 1QFWH 5B3NA 2NR6D 2CRZA 3GSRB 4F8QA 1Q9LA 1L7TH 2BDNL 4ZUWB 4HJGB 4NO0D 1JWSB 5IBLC 3KPQB 4NZRH 5HD8C 3HE7C 3EJJX 5ID0A 2VABB 2BSTB 1GGTA 4OLXH 4UTBL 1YEEH 3EYVA 4K55A 1TVHB 1DL7L 1VHPA 1IAMA 4OLEA 3BEWB 1G6VK 1CGXA 1I8IA 1BP3B 2EDNA 3BPNC 2X7LA 5D4QA 3X12B 1CGSL 4HUKB 2FL5B 4RX4A 1CL7H 1Y0LB 2DQJH 4OGXL 2GUOB 1V5JA 4XVJH 1NBZB 2AJ3A 3MRBB 4BH8A 2YD8A 3RUGF 3DUUB 4NWUH 5DRXB 5DK2A 4JRYE 3D6GA 1I8MA 1GRWA 4XAKE 2DLTA 4R90L 3F5WA 3CDFA 2UZXB 4LPYA 5DEGB 5GS3A 3CSYB 2OJZL 5BOPA 1A5FL 5E94B 3CCHB 1KJ2L 4FQ1H 4TUOB 2XRAH 2V7HB 1NGYA 3IVKB 4XWOD 1X5YA 1A7OH 2NY7L 3RDTB 5C08D 2H2PC 4S1DD 1BM3L 1FE8H 2P43B 5JPNA 2CJUH 1LO3H 3JTSA 5IT2H 5EC2B 4IRJD 5IB4A 3PABA 4K7PX 1DQDL 3D39A 1ORSB 2E6JA 2H8PA 2D31A 2PCPB 4XB8A 2Y6SD 3C9NB 5IQ7L 5EORH 3D3VD 5CJOL 4ZO9A 1U8PB 4YWGH 5HYSB 4YQXH 1GGIL 3TT1H 4Z8FH 4WEBH 2HT4D 1GVIA 4O2EB 4BQ9A 3SQOH 4G8EB 4EI5B 4GH7B 4PLKD 4JFEE 2CKBL 3NIGF 3BYYA 3ARGC 2XXMB 1P84J 3QDJD 4I5BB 4LDLB 4NRXA 3QCTH 4G6JH 4YEEA 3GSNH 3WO4C 1INQA 4D9RD 3QFJD 3G5ZB 2YZ8A 2FWOA 3QEQE 5T1LA 3U9UB 2I07A 1U58B 5C7XH 2V7NA 2UZYB 3MRMA 1IGIL 5DVNA 4AIZA 4FQIL 3MJ9A 4UV7L 1YNTA 2W0PA 2YKLL 5DF0A 2XT1B 4KKCD 1XGUA 5ACZA 3AVEA 2JTDA 4K9EH 2AGJL 4LHUB 4HXBL 2F58L 5ALCL 4HIIA 1OAUH 4KDWA 3K80A 1K85A 4AJ0A 2PW1A 4L4VE 4MWFB 2IH1A 2A6DA 2VKXA 1PQZB 3MRIA 5CZXC 5DJAB 1JYWA 4HIXH 4FXKB 1WBXA 4JREB 3BPCB 5C07D 5E70A 7FABH 3EOBA 1FHGA 2Y72A 1NAMB 1YC7A 3MYZA 3QDMB 4G7VL 4J3UA 4LOUC 5JW4R 4HXAL 3DIFA 3CFJB 3UAJD 2X4UB 4QRPD 1NGXB 3DX7B 4OJFL 3VWKB 4G6FD 1IJ9A 4U1KB 4M6NL 4HF5L 2CUIA 4TSAL 2BXZA 2I27N 2PNDA 3KJ4B 5EUKB 2HMIC 5D7IB 4DZBA 3ZTNH 3BOVA 3N1FC 4GO6B 4UBDD 5DRZA 3O6FD 4QRSA 4Z7WA 4JZOA 3T0BA 5GIRA 1HHKA 1HSAA 2PTUA 4PRIA 4RNRA 1TJHL 1KIUA 4JKWA 4MNQE 2DQTH 2DWEB 1NCBL 1UWXH 1ZV5A 1OSPH 32C2A 2C3VA 5E95B 5A2KH 3BP7B 5EN2A 4HWEH 1RZGA 5SX4H 2X4PA 3QULB 1P2CB 4KVCH 3RKPA 3TO4B 3U9PH 4JFDE 3V4VH 3KS0H 5IKCB 5C2UB 1D9KD 1EEZA 1YPZF 5FYKD 2Q76A 1PLGL 5MEOB 1J0JA 5KTEL 5DD3L 2CK0H 2ZCLL 3QO0A 4A6YH 2XZAL 2NY0D 3IDMB 5FUZL 2NXYC 3QUYB 3BGMA 4HKXA 3AC0A 1NKOA 3T08A 5CD3A 3S5LG 2VLJB 3C2AL 1UWEL 1QSFD 4JN1H 5F8RC 1JUFA 2BCKA 1MCHA 1NEZA 3VDAA 3WFDH 1A3LL 3NIDF 3QHZL 4H0GA 1A1NA 2A77L 3FT3B 1WCBA 3MLWH 1LO2H 4LU5L 5C0AB 3F62A 1J1XH 3BSZL 4JFQA 2Q8BL 3HMXA 3IJYA 2BNQB 3AXLA 4JY4B 2UY7A 3TPUA 4P59H 1WIOA 3I6KB 2R69L 4NNXA 1FNLA 2HJFA 4L4TB 4YAQA 1MCPH 3OKDB 1RZJH 2MMXA 2C3HA 1BMGA 1T1WB 5D6CA 3BUYA 1M71B 3P11L 1CXEA 4XPHH 5B39G 4PLJD 5EOTB 2DWDB 1BQSA 5E8EB 4HFWA 1DDHB 5LVEA 2HKFH 1KPVB 1OY3B 2C1OA 2EYRB 1JHTA 1HE7A 2P45B 4AEFA 2ADJA 4PJ7A 4WCYL 3E3QE 2L4OA 1N2RA 5E00A 5EA0L 4XVUC 3O41A 2YEZB 3BEVA 2GT9A 5DC9B 2AV1A 4MCYB 4XP6L 5IB2A 2GJ6A 4LLDA 1K3IA 2P5EE 5F6HI 3BVNB 4GFTB 4WI4A 1A9BB 4I4WB 4YPGA 2GJZA 2OYPA 4XVSL 4X7EC 3IFLL 2ICEA 4OD1L 3L3GB 1FL5A 3S97C 4DK6A 1SJEB 3DURB 2X70A 1YEKH 5C0EB 4RFEA 2VDPL 1UB6B 3M17B 1UEMA 2OLDA 5FEBA 4NJAL 3I3BA 4O4YH 2R39A 5TQ2H 3IETA 3T0ED 4WU7A 3EDFA 4M7KL 4H8WL 3UDWA 4EOWH 2J8UF 1QVOA 3DROB 3ULSB 1KJ3L 4MD4B 4KXZI 2ZUUA 1OSZB 2Z31B 3NFPB 1RIVH 3Q3GB 3B43A 3FB6A 1N0XH 4WJ5A 2WQ8A 2R15A 4JR9H 4KTYA 4XNZB 3G08A 1AR1D 1LE9A 5FO7A 4J1UB 3OPZL 5EOQH 4ZXBD 5A16B 3RIAF 2A1WL 2P8LB 1Q72L 4OZFG 12E8L 2CDGA 1AGFB 1Z6JT 1T7ZA 4ZMAT 4HS3A 5C0DA 4K23H 4Q2ZA 4X5WB 4OZGE 3NCJL 35C8L 4ACPA 1A6WL 3DVIA 4BFIA 4LSPH 1IGML 4QHUB 2VH5L 2DBJA 5F7WC 4MJIE 3K4DA 3OB0H 4PJFE 1QRNB 3FO9A 3RWGA 5BS0A 2V5MA 2W91A 1WBZA 4JKLA 1P7QD 4PJAE 4XBGA 3IU3A 2GFBA 3V6FA 1DBBH 4RAUA 4NT6A 2YUZA 3DVNA 3Q6GH 1TVBB 1JN6B 2VXTH 3H9HB 1FC1A 4PD4K 3D69B 3MRQA 4JRYB 3LEYH 4F9PA 1KTLB 5BRZE 4NGHH 4K7FB 2YD7A 4BZ2L 2QHLA 2IPKA 4ONFH 3N1MC 3LZFH 3HZKB 4NQSA 4RFNB 5GGTH 4GMSH 3SDDD 4F2MA 5D7JA 1G9NL 1RV6X 3O6LL 1WVZA 1CGYA 1WTGT 2NY3B 4RIRB 1KTRL 4KY1L 5EOCL 5JXEA 3QNYA 1AGBB 3SDAD 4Y8DC 2DMCA 3V5KA 1C16A 4WWKC 2V17H 2Y7QA 4M9PA 1MFEL 5I1GH 3DYMA 2NQCA 3S96B 4R7DB 5LQBH 4I0PC 4YFLF 1EHXA 5HDQL 4LRIC 1FO0H 1U8OA 4HMEA 4KMTH 1MHCA 1CLYL 3O8XD 4XTRD 1S7RA 4DTGL 1DQLH 2VNCA 3KPSD 4JAMA 4UDTA 4CW1A 3OMZA 4I18C 4ZAKB 1QR1B 4JFEB 3VRIB 1DQQB 2FR4A 1AXTH 2H32B 4ZYKB 2ID5A 3BFOA 1EERB 3QEQB 4AK1A 3BZ4A 4ZNCD 5HYIA 4YXLH 2H1PL 4HLJA 1P6FA 2DJ4A 1ZGLA 4P5TD 3UJTH 3A6CL 3IDUA 5GISL 4YK4B 5IQ9A 5CKGA 3MRDB 4E41E 1T1YA 5IEHA 4FFVC 1JI1A 3K81A 3PWPE 5EOCJ 4Z77B 5HYSG 4OF0A 1CFTA 3C60C 5I16B 2R4SL 5IHZA 1B0RB 4KTDH 4LQFH 4AH2A 1EFXA 3VXSD 1XFPA 4JG1H 4NP4H 3ARXA 2MCPH 4L4VB 4DKFH 2PYEA 3FB5B 4AENA 4UU9B 1JRHL 4C56A 4Z7UB 4EDXB 1VFBB 3WLWD 1MIMH 3SKNB 3O6MH 1RJLA 3MROA 5F7DA 2CDFA 3JWDL 4JFOA 5GZOC 1V3LA 2NY4D 4M8QA 4EI6B 5FYKL 5JA9A 4HPYH 4MB3A 1KB9K 1A3QA 3FB7B 5HGAA 1LDPL 1D7FA 1X6NA 4JM2B 2R23B 3HZYA 5CEXB 2EXYD 4V1DD 1VPOL 4X83A 1T3FA 5FKAB 5D96B 5DUBB 4P4KD 2BOCB 1T5XB 1WK0A 4HIEA 4H1LH 4DVRL 5FM8A 5I1EH 2EIBA 1HHHA 3CFKB 5EU6D 5E08H 2YA2A 5FF6A 1A6VL 4WUUD 4YE4H 3D85A 1OTSD 5HYQA 4TYUA 4NUGH 4OZ4B 4Y5XB 3U2SB 2XN9E 5L88H 2LVEA 1YYMH 4HZLA 4U1JB 3VFSA 4S1QL 2EDLA 1N6QL 3MR9A 5SX5K 1IM9B 1TIUA 2ADFH 2Q7NA 1FVDA 2WBJA 1L7IL 3TM6A 1KJVB 1F3RB 2IH3A 5I1KH 4Q9RH 4JFDB 2BSSB 2V5YA 4L3EA 1EHAA 5ISZE 4D2NA 5IJKC 4KKAD 4OLWL 1KG0A 4U6YA 2AI0L 5AG9A 1S9YB 2EDOA 3JV4B 1J8HB 3CDGB 3TO2A 5TPWH 2HTLD 1YMMB 2VAAB 1S3KH 3A6BH 3C87A 2FSEA 3U7WH 2I26N 1X6LA 3TNMA 3CVHL 3UTPD 1F02I 4PJDF 3PQYD 2ZNWA 3WIHL 4P9MH 1NCDL 5D9SB 2IALB 1ETZA 2OZ4L 4U7MA 4L8SC 1M05B 3BN3B 4MA3B 4N9GB 1FVEB 1NCNA 4PJCB 4GKSB 4PJXA 3VFGH 1Q0XH 3LHPH 2F5AH 3PDOB 3F7YB 2ADIB 5I17B 3OXRB 3RDTC 3TH4T 3SE3C 3VD7A 4QTIL 1TENA 1KCUH 3V0WH 4ZS7L 2X4TA 3EO0A 2VDRL 4RGOL 3VJ6B 4V2BA 5T3ZE 5KSBF 4LEXL 4MLIA 2BVPA 4RMSA 2XWTA 5D1ZB 3DVGA 4OFKA 4NQUA 1ZA3A 4UDUB 1F13A 3KLHC 2P5EB 3G5XA 4HCRH 4Y16A 5FECA 4RWYL 3IXTB 4LSTL 4NDMB 5HI3D 5J1TC 2FX7L 1BHGA 1UZ6F 2ICES 3S4SB 4EI5C 1MCSA 4R3SB 4EXKA 3OHXB 4PJGF 1PBYA 3RGVD 4FZ8H 4KKNA 4KKLD 3Q2CA 2OTUB 4H25A 2X4NB 2VLLA 1G9MH 3DX6B 5ID1B 2E5EA 2VYRE 4GRWF 2R2EA 4FP8L 4JGMA 3TFKD 4WNQA 5FGCE 5EU5A 1ZGLM 3TH3T 4F7CB 3P0YL 3ARPA 3ILQC 3D87B 4PD4J 2WK2A 4PGBA 4LASH 1F3DJ 3HG1A 4GW5A 4YC2B 4JHAL 1FLRH 4PG2C 4G8GD 3L3HA 5GJSH 1OAQH 3EHBD 3C8KB 3NAAH 1XGPB 2ESVE 4RQQB 1H8NA 2CR3A 3FT4B 4UMGA 4ZQKB 5FYJU 5IBUB 4J8RA 2X4SA 4YUEH 3LH2H 4YBQD 2ZCHL 1DN2A 1CXHA 1KTKE 4OZGB 5FCUL 2QKIA 3LY6A 4JREC 5LBSL 4MJIB 5I8CB 1FZMA 5K9KB 4PJFB 1S7TB 4WI6A 1BFOB 2LQRA 4PJAB 3TZVB 3P4OB 3UBXA 1JYVA 1FP5A 1S7XA 4FG6D 3WS6A 3U30B 4LK4A 5HYEA 3OKOA 3QI9D 4G5ZH 3KJ4C 1MQKH 4L8CA 1S7SB 5KSAA 1YEHH 5BRZB 4KC3B 4OAWA 3V52H 3VD5A 1QZ1A 1A7PL 2O5XH 1B0GB 1T21B 5AEAA 4OCWL 2RIKA 2VZVA 4G6ML 2K9UA 1KLGB 2PO6A 3MCKA 1RI8A 2I25N 5J1AB 4GRLD 2HH0L 4N9OB 4MJ5B 5HHMD 1PVHA 5BQ7B 3HB3C 1B9ZA 4OZHE 5E9DD 4S2SB 4HIJB 1AO7D 3MV8D 4HGWB 1K8DA 4XVTH 4LSRL 4KQ3L 4GRWH 3WN5B 2WLZA 2UV3A 3TN0D 2FX8L 3OG4B 3TO4C 5E2TL 1JYXA 3C5SB 5AYQA 3GKWL 5L2JA 1AJ7H 3GIZH 5DJ2A 1SYVA 3LPFA 4Y2DC 4WO4D 4XRCB 1IMHC 1JPGB 4IIQC 2FJHA 4RFOL 4QRRA 5CLWA 1NDGB 2O61A 4GUPA 4QTHA 2HG5A 4NO2A 4JN2B 3QUYC 5CJQH 5DUPL 4M7LL 2ERJB 3UP1A 2NY1D 2DD8H 1AGCA 2H26A 3BKCL 1NFIA 3OV6A 5TDOB 3BWAA 4Z0XA 4YFEA 5IOPB 3I6GB 3O11A 2B1AH 3QUZC 4M6MH 1KN4L 2W65A 4WHTA 1L7TL 1R24A 3VFRA 5KAQG 3ULUF 3P0VL 5MERA 4NSKB 1ZANH 4Y1AA 2PR4H 3VXMA 3FMGH 2K1MA 5EBLA 5IB3B 4OLXL 1RUPH 4U1SA 3QZWB 3ULVC 4XMPL 4P0DA 1CDGA 5HHQB 1FIGL 1HKFA 2GTWA 3LKQA 5DYOB 3S3PA 5IB5A 3MNWB 1YEGH 2DQJL 1IC1A 5ICXB 4LSUL 2XWJB 2VISB 4K07A 1JPFB 2R1XB 5SWSE 1XCTB 3BWUC 3JV0A 4AEIL 5E2JA 4Y8AA 3DRQB 1UM5H 4DUWA 1ZSDA 3EDJA 2IANA 3K8KA 4UQ2B 4DKDC 4ZPVA 3DRTA 4ZDHA 4EDWH 5BO1L 4KK9D 4P57B 5D71L 3T77B 4FQJL 1UYWL 1O7VA 3DX8B 3U4BH 2ITCA 1A7OL 2AQ3A 2UYLA 5T1KA 5C0CA 3RL1A 5KS9E 1HH9A 4XCNA 3O3EA 4GAJL 1FE8L 5DHVB 5DJCB 1LD9A 4WGVB 1KXQE 1WEJH 3CSPA 4OI8A 3NCMA 1EA9C 3QYCA 4ZFOB 5IT2L 3VFVA 3FQRB 3LKOA 1ZHLA 4X7TB 4P46A 2Z31C 1MH5B 3RFZC 4PRPE 4GG6B 4YWGL 3P77A 3TT1L 4YR6A 5DEZA 3MV7A 4JHBA 3ZT7A 3HZVA 5F7EH 2DTSA 5D6DC 4BSVB 5ISZB 1R5IB 1R3JA 1T80A 4BK4A 3THML 3L3JB 1FL6A 3FQXB 3VFMA 2EICA 3L5JA 5JLZB 2FZ3B 2MSPA 4FXGB 2H41A 2BNRA 4JVUA 1A6ZA 1BBJA 1JWMA 5CP7B 1CICD 1WZ1H 4JO1H 3ZE0F 2DLIA 4QWWD 4ZTOL 1MWAL 3KWWA 5TE6H 2E7LC 5IVNA 1IAIH 2FECI 3F65A 1QQDB 2WWMD 3RQ3A 3DTXB 5AZEL 1I1FB 1I85A 2SEBB 4N8VA 3OSKA 4WUKH 4K71B 5FO9A 3BXNA 1U2CA 3C6SB 5FGBC 3MLUH 3EO9H 3MA9H 1MCNA 4LVHB 5T3XE 4RFNC 3SGJA 4QXGH 4X6FB 3WHE1 5IHBA 2AK4D 1EAPB 4LPTA 3QB7C 1G0DA 5JO5B 4O5LH 1HHJA 2NY3C 4JZJA 3I9GH 4RX4D 4P3DB 1RULL 2EH8H 3QIUB 4NZTL 5DEFA 4GXUN 4JM4H 1MELA 3DV6A 3S9DB 2V5TA 3GMMB 2KH2B 1VKXB 3L95B 5GGSA 3SHSA 1RK1B 4DKAA 1IQDA 1EGJL 4M1DH 5E2UL 4FRWA 4PGEB 3OKNB 2MFNA 2R56H 4TSBH 4BFGA 3MRJA 4YZFE 2VDOH 1AD9B 4ZUUB 4MA7H 2GEEA 1S5HA 4JQIL 4NRZB 2EYSA 1ZS8A 3HE6A 2DQTL 4PP2A 4ZAKC 5J12B 4OZFH 3STZB 2ZUQB 1G6RB 4XNMA 3AREB 5K9QG 3KR3L 2HVJA 2E7HA 4MDJA 2YRLA 3REWB 4X6DB 4HWEL 4XX1G 1I3RB 5FGCB 2NZ9C 3QUXA 3D39D 5HYFA 1S7UB 3SY0B 1UT9A 5E2VL 5HVHB 4YK4C 4HKBB 1OAXH 1S9WB 4X98A 2MQ0A 4ELME 3QQ4B 2FO4A 43CAA 4EIZC 1IQWH 1KN2H 1WWCA 3KLDA 1XH3A 4TULL 4P2RA 1IL1A 4OCSH 2ESVB 3RWJA 5F7LB 4PRNA 1OP9A 4D0CA 1CFVL 1BGXL 3ZE2F 4HDIB 1FFQA 3C5JB 3FRUA 3TV3L 3KDMB 4QRQB 5T1LD 3WFDL 2R1YA 2YRZA 3BDXA 3S34H 3RZCB 5GRVK 2JK5B 4WTZG 5KSVA 1M7DB 2FEEL 1LP9F 3QDGB 4PUBL 1NCUA 3WJLC 2OTWA 4F37K 4FS0A 5D8JL 4M5YH 2GJJA 3UROR 4P59L 2IF7A 4CDGC 3MJGX 4A2MA 1WFNA 1RZJL 2VR4A 1PEWA 1CZ8H 3NA4A 5D96C 4U3HA 1Y6MR 3T4YB 1CLZL 5GS0H 4RRPA 1TQCB 4G6KH 3W0WA 2G5BA 5GS1B 1JGEA 3MRFB 1MHHB 2AXFB 4U0RB 1JL8A 3BQUA 1SY6H 4ZFZB 2V5RA 3SKUD 5MENA 3MNVA 2VLKE 1MCWW 3FN0L 2HTKD 5HVFB 1RZIB 2DRUA 1G7LA 1OAYL 3KPNA 4Y5XC 4OZHB 5DQ9A 4U1IB 3BRGC 5C0FA 4HIHA 4YHPA 5E4EC 4TNWF 3P4MA 3QP3A 4GRMA 3TYFA 3VXPA 1UKQA 5TJWK 1SEBA 1NGWB 4KQ4L 5DVLA 5FKPA 1FG2B 3VFNB 3B9AA 4P5KB 4LEOB 4PTUA 4E9LA 5E6YA 2J5LC 4OLUL 1A6TA 1JYNA 1DBML 4D0BB 4Y4KB 1YEKL 1GCFA 5ICZB 4YBLB 3D2UA 5J11B 2P24A 5TQ2L 4PRID 5D5MA 4O51A 2AK1H 1GOHA 1XT5A 3U7YL 2RQ8A 5KZCB 3TPKA 3VI3E 4FQLH 1JZ4A 3L5WB 4G43B 3SQBA 2QQNH 3PGFH 3LPGA 4X4YB 5EUOF 4NN6B 3LQAL 3H6JA 1HWHB 4P2OA 1RIVL 3UTTA 1GGYA 3SEPA 1ES0A 1EEUA 4PR5A 4DGIL 3HNTH 5HI4C 2GSIA 1HYSD 1CU4H 4XI5C 1DEEB 5HVGB 1I8KB 5DK3A 1H8OA 3B6SA 3H9YA 1KJ2B 4Y4HA 4LIQE 1XGQB 2XNAB 2Y36L 2VSCA 2DYPA 4NFDA 1CT8A 1GHFH 4L8DA 1QG3A 5EU4A 3MJ7B 4G6AD 5DZLA 4CL7A 1DBBL 2Z35A 5IMOA 3FT2B 3QXTA 5DQJB 4XCFH 5ESQA 4KPHH 5HGHA 3E3QC 5BS0E 1QEWA 2PTVA 5SWSB 5EULV 2Q20A 5F6IB 4NGHL 5D1ZC 1NAMH 1AP2B 1KCSL 5EZJA 1CDBA 3I3DA 3IFNL 5DJXB 4OM1L 2HN7B 4I2XB 5J57B 5JHLH 1FYTE 3WXWH 4RAVA 4JQVC 5J8OA 1Z5LA 3X3GH 4QOKA 4UNTA 3MODL 5EPMB 2CKBB 1NUNB 5GGTL 4HK0B 5IK3B 5EO0A 1S5IH 3NZ8B 1P69B 5ITBL 1FYHB 4NC1E 2QSCL 5L2KE 1I7ZA 1G7QA 2DB8A 2JJTA 5DWUL 5JHDA 4XC3L 3RVTD 4DJMA 4DN3H 2F53A 1OGAE 1HINH 2PXYC 5IFHH 1HCVA 3HE7A 2GJ6D 3BIBX 3VXTA 5F3HA 1J0IA 2A6IB 4PRPB 4YC2C 1CD9B 3T2OA 2Z9TA 3VH8B 5JR1H 1FBIL 3SDYH 3OAYK 2OK0L 3S37X 5F97E 1CDJA 3H7LA 5GS2D 1UQSA 3PGCA 2CUHA 2WWKT 3AS3A 1YNLL 1NMBH 1B3JA 3ELAT 1CF8L 1BD2B 4RDQG 4LVOB 3ESUF 3KPRE 2JCCA 1CIDA 3ZYOA 4QRUA 1QO3B 1RK0A 2J4WH 5ELIA 4H1LA 1ZTXH 1UCBH 3BGAA 1VDGA 2OQJB 1V7ML 5E8DH 3TZVC 1FG9C 4X0KB 4X9IA 3T0AA 4GSDL 2CDEA 2BSRB 1PYWB 2B20A 2NY6D 3GSQA 3O4LE 4Y19A 3RPIA 4FQQB 4KTDL 3FQNA 4U31A 3ZKNC 5C09A 4NP4L 1HILA 2XWBB 2MCPL 4WW1A 1U91B 3FOLA 1X5HA 2WP3O 3O6ML 2Z8RA 5BS0D 3HAEG 5JXAH 1HKLH 4ZO8A 2AABH 4C56E 3ULVH 4NM8H 1DN0B 1CQYA 1FGNH 4JJHA 3WN5C 4FTVA 4N5UA 3WFEL 3ZSTA 3OXSA 3IFOA 1LMKA 5TE7L 4G9FE 1FZKB 1MHPL 2AV7B 3HKFA 2EKSB 4ONGH 2V9TA 3ARGA 3A6OA 3ILPA 1WAAF 2E8ZA 2J88H 4PRHB 1BF2A 3RA7L 5ERWA 4G9DA 4PJEE 5D7JD 1Q9OA 5IG7A 4JRXE 5I71B 1LEIB 2X10A 2ERJC 1RMFH 4F33A 4CU8A 4GMTH 1P7KA 1FNEA 5FYJE 3HZMA 2X4QB 4UIMA 5JXED 1A0QL 4FHBD 3MJ9L 1YY9D 2Z8VC 4P3CL 3F12A 4YFDB 1NJ9B 4RMVA 1LE5B 1AXSA 2FYYA 3VMPA 3KXFB 3VG9B 4MNHB 3UYRH 5LGHL 2X09A 4NO5B 1A4JA 3GSOA 2XA8L 5HHXL 5KAQF 4XXDA 1HXMB 3BESR 4RMQA 4U3XA 1TCMA 2L0DA 3RNQA 1C5BH 4EVNB 2ED9A 3N85L 1F90L 1Q9WA 2OSLA 4AYFA 4M62H 1P4BH 3L6FA 5TPWL 1XF3B 3H3PL 3UO1L 5JQ6H 4HCRA 4AY0A 3B9KB 5E4IA 4XPFH 3RVUC 3LKSA 4JFFE 9CGTA 3MLZH 3SGEI 4O02H 5A40E 1INEH 2H6PB 2F54A 4JKPL 1U8LA 3PWLB 5D7KD 3NBNA 1OAZH 1BEYL 2FJGB 5FUCE 3MPCA 4PJ9D 2K7QA 3T1FB 1Q0XL 5BV7H 4PRAA 3LHPL 2WV3A 2NLJB 4ODHL 3QQ3A 1EFXD 3HC4L 3KPMA 4OF7A 3LDBB 5FO8A 3MLYL 2PYED 1CD1A 4C56D 1KXTB 4NHCL 5F1KC 1FZOA 4B5EA 2JIXB 5F9JA 1B4JH 2DF3A 2H2SC 2AEIT 2ZUSA 4U6XA 3P9MB 4Z7UF 3FQWA 4I77L 2C1PB 1UM6H 1KT2B 4RBPH 1PDKA 2YXFA 3FRPA 4I3SL 3SPVA 1FV1A 5FGRA 1MCOL 1ED3B 1SMOA 2VDLH 5EZIL 2EDWA 1J0KA 5C3TA 2YD4A 1U92A 2ARJB 1EBAA 5AYUH 5IVXB 2EDXA 1T0NB 1KIRA 1YYLH 4M93C 3PHQB 1CQKA 1KNOA 1TTGA 4JM2F 1CGWA 1P6AB 5D1QB 1LNUA 3MLVL 1QBLL 2VLRA 3HC3H 4YNYA 3QXDB 5FYJD 4QGYA 4NQTA 4PJHF 2EDBA 4JDTH 1RHHA 4OZIA 5M94B 4DN4H 1MSPA 4FFYL 3MBEB 2I60H 3VWJB 1IKFH 2D7MA 3D85D 5GGRB 3QH3A 4I0CC 5DR5H 3QJHA 2PW2B 3D3VB 2YD2A 5I2IB 4JVPA 1ZHBB 5F9DC 1K4CA 4P2CG 4DW2L 5HHOA 4M1GH 2QLVB 3LKNB 4IRSB 1PG7H 1I1AC 1J1OH 4LASL 2MHAA 5C2BH 2H32H 2Q6WA 2WBJD 4WRLA 2DLHA 1R5VB 4XCCH 3QDJB 1JV5A 5GJSL 4GKNB 3ARFB 5I1JL 1S9VA 4L3ED 1EEYB 1A1OB 3NAAL 4F7PA 4LVHC 5KVFH 4AEHH 4X80H 1XGYL 4TNVF 5I66A 2D7TL 4WFGE 2P49B 1MLBB 3GBNH 1WC7B 2O5YH 1MJ8L 4X4XA 4ZG1A 1XR9B 4S0TD 4F58H 3CH1B 4MVBD 2CIIA 4PV9B 4BZ1L 3H9SA 3IKCA 2X4OA 4G8IB 2EYTA 4KI5E 3T1WA 3PHOA 5FDWB 5KANG 4AL8L 1H0DB 1ZHNB 4RA0C 1MQKL 1KPUA 1I7UB 1TJIL 1UWGL 2XYCA 5HPMA 2AEPL 4OLYL 3EYSH 4Z78B 3ARDB 1A1MB 4RZCA 5HI5C 4N0FA 4HAGA 3CX5K 3OTTA 3GSWB 1FYTB 5CZVH 5B4MD 1L0YA 4XP9H 3NFNB 5B3JE 5I1CH 1I9IH 2FJFA 1FFNA 1RFDH 2KKQA 4OLVL 3L3OA 2A6KB 1A21A 4AT6A 2ZOLB 3L5XH 4G6FB 1CS6A 2CLRB 4G80A 4YEFA 5J12C 4X6EA 1MJUH 2ZUQC 1S8DB 1XCQB 3DMMB 3AREC 3X11B 5CILH 2R9HD 5L2KB 4EKXA 2AKRA 1G7IA 1YN6B 4P5MB 4HQQL 4IS6A 3P4NA 1BX2B 1VEPA 2A6JA 4B7IA 5CEYB 5C6TL 4LPUA 2ARWA 3VGAC 1OGAB 2VITB 5IF0B 4KRPD 5GRUH 3K7UA 1MNUH 3W9DA 5HVHC 3QRGH 5L6YL 2VXUL 3PWNA 4KZDL 1T04A 3MNZB 5ADPH 4Y16D 3V0VB 2BSED 2XTLA 4HKJB 4OT1H 2D03H 2UWEF 3CK0H 4NQDE 4QHNB 4YDJB 1NFDF 3OGCA 5F1IA 2DD8L 3RWFB 1KCVL 3CPLA 3IS0X 3G6DH 2HFFA 3EYOB 3KPRB 1KB5A 2D7QA 4NO3A 2YPKB 2EC9U 2HFTA 3BIAX 3GBMH 3O3AB 5D2NE 5FHBL 4HUXB 4QEGA 1U8KB 2ZJSH 5CAYB 5DVMA 5SWZD 3VXRA 3HG1D 1ZT4A 4PB9L 4WHDA 3HUJB 5DT1H 3PE9A 1HSBA 1XZ0A 4JANA 3O4LB 4P23B 4Z0BH 5AD0A 1G0XA 2R0KH 1OOAA 1PX3A 3NFSH 1RUPL 1TQCC 3MUGA 1SEQL 3NN8A 1GGCH 4JHZA 4K8RC 5GS1C 2DICA 3S8WA 1YEGL 4OQTH 5I1HL 5J6HA 4ENEC 5I30H 4NNYA 4WWKA 5DS8A 1EHLL 4LSDA 2D3VA 5DDHA 2ATKB 4I0PA 5TH2A 3VCLA 4TVPH 2BMKA 1LEGB 3G5YB 4LRIA 4PY8I 3DJ9A 5IESH 4LDEB 1UB5A 1QLRB 4R8WL 5KSAD 4POZC 5JNYA 2PTTB 4I18A 1HWGB 2GCYB 2IQ9H 3B5HA 5FAAA 1AKJA 2VUYA 4HG4K 4YBLC 2PO6D 5J11C 4IEFB 3D9AL 4XNQA 2NW3B 4PJEB 3EBAA 3RIFK 3MUZ1 3CVHB 4KRLB 1S9XA 4K3JH 4J7RA 5JOEA 2KPNA 3FQTB 4PBVC 4EUPB 5CSZA 4O2CB 4NN6C 3RUGE 1QYGH 4WFHE 2Q86B 4KJQD 2VXSL 3AB0B 3GHBH 2YD1A 5ICYA 4X99B 3MBXH 2LABA 4LPVA 3T3PE 3C60A 1HZHH 3BP4B 5DMGD 4ODXB 4U1HB 4XBEL 4YHYB 4O2FB 4OCXL 4QRRD 1A4KB 3ULUL 3D0VA 2AJXH 4NQCE 2DTMH 3O6KL 5DJYB 5EDXA 2Z93A 4JHWH 2Z8SA 2ZZUT 4LKXA 1IAOB 1JGVH 3S36L 3SKMB 2EH7H 3ARBB 3T4AA 1E6JH 1FH5L 4HMDA 2FCBA 3HNSL 1KEML 3AY4C 4K3DL 4LLMA 5HGDB 1NLDL 5C9JA 1U95B 3QDAA 3KPLA 4ETQA 3OX8A 4JFFB 4JLRB 3ZYIA 3OJ2C 4L29B 3BN9D 3C5ZB 5BW7C 3OKMB 1NMCC 2NY2D 1MCRA 1IGCH 3ROOA 1OGTA 4NOBA 3D0LB 1OQOA 4Y4FA 2EDDA 4BQBA 2MOVA 4Y1AD 1FZJB 1JHKH 5GGQH 4N0UE 4PV8A 2F5BH 3VXMD 3OKLA 4X8JA 3T8XA 1U8IA 3HI5H 4JGUA 4YHKL 3EJYD 4JFZH 1G7JB 1WZMA 4G7YH 5JOFA 1XIWC 2JF1A 3U48A 1RIUL 5E1HB 4XH2B 2XY1A 1PKQA 3MFGB 2VZOA 4QO1A 4YHML 1ZT1B 2NW2A 1TDQA 1CDHA 5TGBB 1D6VH 1U8QA 1NLBL 3GSRA 4M7JH 4ZUWA 5HGBA 1JWSA 3KPQA 4DKEL 3SDDB 1C7TA 1MIEH 4MLSA 3GMRB 5IJKA 2ZKHH 3P4LA 4XWGH 2VABA 2IAND 2BSTA 4UQ3B 5HGGS 4TRPH 1TVHA 3SDAB 4P49A 5CGYD 2VAJA 2BZDA 5I1IL 2ILLA 5KVDH 3BEWA 4PRDA 3CLEL 1F3JB 3U1SL 3X12A 2YK1H 2FL5A 5AWNH 1Y0LA 5T1KD 5C0CD 4PG9A 4X6CA 2B4CH 2GUOA 4LVOC 5IB1B 1F8TL 1NBZA 2AJUH 3MRBA 5AZ2H 3CXHJ 2W60B 5CD5C 4LP4A 3DUUA 1BBDL 5DRXA 4HGKC 4J23A 4L8SA 3S3JA 5BMFH 1GAFH 1SVCP 4U33A 4U4BA 3GSUB 3KPSB 4P46D 1SY6A 4G3YH 2BRQA 1OAXL 2OR9L 5DEGA 2YD9A 4CMHB 3VFUB 3HLAB 4DGVL 2VL5A 2LTQB 3CX5J 5E94A 4GG6F 3MV7D 4TUOA 4YDVB 2GK0B 2EKJA 1Q1JL 2V7HA 3MXVH 1AIFA 5T33H 3UX9B 3RDTA 2OL3H 3SE3A 2ZPKL 3GNML 1WITA 4CMMB 4XNXL 3SDXB 1Y6NR 1MY7A 4P5TB 3NIFF 2JELL 3S34L 3UTZB 5EC2A 1KXVC 4J12A 4XMLH 2BNRD 3I02A 3C08L 1DLHB 1ORSA 4M1CD 2PCPA 3C9NA 3OKEA 1NCWH 4TOYH 2P8MA 1U8PA 1VERA 2AEQH 1YPZE 4HFUH 4U6TA 3BP5B 2CMRL 3IJSB 5CHNB 3O2VL 4TUJA 3LEXA 4G8EA 1I9JH 4EI5A 5KVGL 4G6KL 4ZPTB 3JWNC 2LAAA 4I5BA 1MCEA 3BE1L 4GLRH 3QBTB 3G5ZA 4UAOB 4M3JA 3BX7C 4FQ2L 5I71C 3DETC 3U9UA 1DANU 1U58A 4ZODA 1KF9B 3NIDE 3AS1A 4GAFB 1H5BB 1CFSB 1YNKH 4V1DB 4WI2A 1RY7B 4O00A 4P4KB 1T2QL 1YZZA 2HFGL 3VE0B 2Q87A 4PG2A 1JPTH 2UZIH 3MLSH 4LHUA 1QFWI 3LEVH 4OB5L 3BRDA 3RTQB 3LCYA 3TCXA 4WUUB 4MWFA 4MCZB 1PD6A 2RCSH 2NNAB 1PQZA 1I9RL 1IC5H 3IKKA 3RHWF 1UWXK 5DVKA 4QT5B 1A2YB 1DZBA 4FXKA 1CG9B 3BPCA 4NQDB 1GPOL 2F15A 3F7RA 3QDMA 3BDBA 3GI8L 4IRZH 2AJYH 5C0RH 3B9KC 4FQLL 4M5ZH 2FB4L 5EWIH 4NQVB 2IAMB 2X4UA 4FQCL 1NGXA 1WZLA 2A9NH 3DX7A 4JG0L 1CL7I 4U1KA 1YC8A 3T65B 1D6EB 4ZO6A 4OD3H 4YDIH 5D7IA 3UPAA 3QUXD 5D2NB 3GRWH 3HAEH 4MS8D 4LDOB 5E8PB 3JWOC 1IGFL 2B5IC 3INUL 4NKDB 4W68A 5F9OL 4JY5H 5L9DL 3N1GC 1AC6A 4TVSa 4UT6H 1DUZB 4P2RD 1XGTB 3KGRA 3EYQD 1U6AH 3LDBC 2GY5A 3IDIB 3MCLH 1NMAL 2QQKH 3BP7A 5CGMA 4J3WA 4Z7VE 3T0WA 4XCFL 2J8UE 1FNGA 3QULA 1P2CA 1W72H 3TO4A 3IJHB 3Q5TA 1Z3GH 3GK8H 3WKNA 4Y2DA 2VDML 2MCG1 4XPTL 2DQGH 1AQKL 5MEOA 1PGRB 2VERN 5J4MA 1E4XL 3O4OB 1WIPA 5E1AB 5CCKH 4HWBA 3IDMA 3VDCA 4GXVL 2BHZA 3QUYA 3X3GL 5T3ZH 1YUHB 5TE4H 3HPLB 5D1QC 5LJYH 1JPSH 3W0WD 4U2ZA 3TWCL 4NFCA 2VLJA 5DLMH 1LO0L