4EN3A

Crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
186
Chain Sequence
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATYDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSVCLFTDFDSQTNVSQSKDVYITDKCVLDMRMDFKSNSAVAWSNKSDACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The Molecular Basis for Recognition of CD1d/alpha-Galactosylceramide by a Human Non-Valpha24 T Cell Receptor Struct. Title
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A02
1I1AC 5DJCB 2BNRB 3C5ZB 4HXAL 5E6IB 5ISZE 4YPJA 5HDBE 3SDYL 3QI9A 1CQYA 5BMFL 1CR9H 3MBED 1PYWB 1DFBH 5D6CA 1JZ4A 1D5XB 1W0WB 4NQED 4AJ0A 2XFXA 1HHKA 5FYJD 4XP1H 1VERA 1VFMA 1KC5H 1GC1L 4FQHA 5DJZB 3A67L 4MJIB 4NKMA 4HWNA 2ADGA 3V0WL 1YQVH 4EI6A 4IDJL 4D9LH 1VFBB 2FL5A 2XYCA 1ZS8A 1C12A 3LEVL 3RJDA 3QEHB 1UYWH 4XCEA 1HIMH 5BV7C 4N1EA 5DJCA 2BNRA 1LILA 4X9IA 5E6IA 2APFA 1IGTB 4OKVB 4OFVA 4GRMB 1I9IH 1NFDB 2AJYH 4BQCA 1Z6JT 4H20H 1PYWA 2PW1A 3O9WD 2AJXH 1PQZB 3PV6B 2Q87A 1I8KB 2WWMD 4OM1L 2BVTA 3UBXB 3QFJB 1B4RA 4I13B 3L3KA 2NY4C 4MJIA 1HXMA 1QUNA 2HLAB 4KMQA 1U3YA 1VFBA 2COQA 3ULVL 3FOLB 2QEJA 4S1QH 1T2QH 2GITB 1W72B 3B9VA 3T1FB 1CICD 4U33A 2DLIA 1EEQA 5INDB 1I3VA 3CFJB 4XI5C 3QEHA 4WFFE 1MCQA 4KHTH 1H15B 3L1OH 1A2YB 1UVQA 3GM0A 1IGTA 4YHML 3SY0B 2FGZA 3MLXL 5TPWH 1IFHL 3GSRB 1QBAA 4GRMA 1NFDA 2VR9A 4KGJA 4KI5D 4Y19B 4C4KT 3PV6A 4PBWD 1PQZA 1I8KA 2Y5TB 3UBXA 5CZVH 2DQEH 4HULB 3C8HA 3GSVA 2QQLH 4WW2B 4DGYL 2H1PL 5EU6D 2XQBL 1TJIH 4JO3L 3K4AA 2IH1B 3MX0A 4PJGB 1A4JB 2HLAA 3B9DA 2DN7A 4XP9H 3H0TA 4FFYL 4MNQB 2X4TB 4YGVA 4D9RE 2K3TA 3L3JB 1OGAD 1H0DB 1A2YA 3U36A 1CGWA 3SY0A 5IMLA 2FJFB 1ZLWH 2B1AH 1T03L 2Y5TA 4YDVA 3D6GA 4G6MH 4HIEA 2IGFL 4WW2A 3D3VE 3KLAA 4MZ3A 4LCIH 3QIBA 4NQSB 3RWEB 3X17A 4I3RL 2IH1A 4HS8L 1A3RL 1A4JA 5DHYA 2EXWC 3RVTC 2WW8A 3KYMB 5IK3B 1SHMA 1SJVA 4MNQA 5C0JA 3C8KB 4QTIH 4MJ4A 4Q2ZB 1FFOB 8FABB 4QHKI 2CMRL 4DCQA 3VXOB 1FVEA 3L3JA 1I9JH 3MV01 2UZIL 3CLEL 5IHLB 1I3GL 2FJFA 4KZEH 2VLRD 4NQEB 3Q1SH 3JUZA 2VQTA 1T80A 1Z9MA 4XBGA 3P77A 3WEXB 3OR7B 1QLRB 5DWUH 4Q58C 3KS0H 3QUZC 1BM3L 4PS4H 1QEWB 2P5EB 4J4PD 1QRND 3KYMA 3HMXH 4HJJH 3C8KA 2ZJSL 4Q2ZA 1FFOA 1EEZA 1UWXK 3EYQD 4NZDA 5CEZE 8FABA 3VXOA 4P2OB 3T4YB 2EIZA 4LRNH 3ZDXF 3BD5A 4E0RB 3RU8L 3QDMB 4LCWE 4DKEL 2BDNH 1FZOB 2VDNH 3MBEA 3CLFL 3O9WB 4NQEA 4KJYA 4N8PA 4PTUA 3TC9A 4OZ4B 2FECI 1NCDH 1S7TB 2IH3B 5I17B 4NQCB 4RGOL 1KG0B 3V7AG 4F2MB 2APBA 1ES0B 2XA8L 3BIKB 1IBGL 1SBSL 5IIEB 4LVNC 3WO4C 2BHZA 5IR1B 1MJJA 3T4YA 3NFNB 4E0RA 2VC2L 2NXZD 4K3EH 1S3KH 3O9WA 1V3KA 4DAGH 1D9KC 1QQDB 5H35A 2DD8H 4XCCH 2HVJB 1WCQA 4OZ4A 3S4SG 1S7TA 2Z4QB 5I17A 4JREC 2EDOA 1KG0A 3DGCR 5AUMB 3NCJH 2CLVB 3LKRB 4C58B 2ZNXA 2EEDA 4LSVH 5DTFB 5KW9H 1ES0A 1CICA 1AIFB 3HC4L 3IRPX 3BRFA 1U2CA 2AQ2A 2C1OB 4N9GB 2AEQH 4XMLH 2FD6H 4JVPA 4APQD 2LU7A 4MNGA 2GK0A 2XY1A 5KVDH 3KJ6L 5H37H 1G9MH 3TVMC 2DIAA 1EAPB 3GFUA 3L3GB 3M17B 1F90L 1DBKH 2FX9L 2Z4QA 1T6VN 4XAWH 2APVA 4OQ1A 5DJDB 3BGFB 3D0VA 2CLVA 3LKRA 3JWNC 5GISL 5DTFA 4LFHD 5BVPH 1MOEA 1AIFA 3VW3L 1I4FB 1OARH 2O5XH 3FO0L 3UTSE 1RK0B 4N9GA 2PXYC 3HNTH 4HK0B 1OGAA 3BP6B 3JSSA 3K8MA 4D2NA 3OAZH 1DBMH 3SKMB 3BJ91 1C08A 1D6VL 1KFAH 3IXTB 4W81A 2BNQB 2A1WH 3ARFC 2NY7H 1EAPA 5T3XL 3M17A 2GSGB 2YA0A 3L3GA 5JOEA 5AYQA 5IFAH 1CZ8L 3LSOB 2YXFA 3HI1B 5D7KE 1U8NA 4MHHI 1U95B 1RIUH 5CJ5A 5KVEH 4NM4L 1I4FA 3RWDB 4YEEA 1RK0A 1CLOL 2QR0B 4JM2D 5GRZA 3TN0D 4J1UB 5JW3L 4J7RA 1E4KA 3IAQA 3TWCL 1A47A 5JUEH 2MCG1 4DTGL 3ULVE 5KVGL 1IGCL 4JFQA 2VLRA 1UACH 4LDLB 4JANB 2D7TL 4YDKL 5KSBF 5HHPA 2HT2C 3AB0B 4K07A 3UX9B 2QQNH 5E2WH 4JG1H 2GSGA 3SJVD 4C56D 4LPTA 2VL5B 2FSEB 3GRWH 4M62H 2YA1A 3BPOB 1FAIL 4AY0A 1OCWL 2QSCL 4J4PA 1QRNA 2A77L 3QRGH 4PGBA 3D2UD 4HCRL 1J87A 2JCCF 1YUHB 4NWTL 2QR0A 2A73B 5I8OL 4J1UA 2UWEB 4YHYC 1QA9B 4HWZB 4U1NB 3GSUB 2NXZB 5E8DL 1UC6A 2ADIB 2H41A 1JPTH 1KENH 1G7LB 1NMBL 3LQMA 4JFYA 4WTZG 4ZSOE 3JZ7A 3UC0H 5KSVB 1CE6B 2FBOJ 5DMIL 3PWUA 2FSEA 3HUJF 2W9EL 4KJWC 5EUKB 1CR9L 3KYKH 1OQOA 1DFBL 5JZ7C 1LQSR 3WKNA 1F4HA 4HH9B 4P48A 1YUHA 5HGBB 4APQB 3EIFA 3KPSD 2A73A 3I84A 4XXDB 3TT1L 1YQVL 3MJGX 2UWEA 1QA9A 4U1NA 5DC0A 3GSUA 5E9DE 2ADIA 3DECA 4K94H 4OF0A 3ZTJH 2XZAL 1G7LA 3KAAA 2E7MA 4KK6C 5KSVA 4KI5E 3TBTB 1X5IA 3NCYS 4K7PH 1K8IB 2DQHH 4HSQA 3U7WH 2C3VB 1ND0B 2AJYL 4LSSH 5EU6E 5IHBA 2AJXL 5LAXB 4P4KC 1F4AA 3MZGB 5SV4A 1FZJA 3ALWA 3BKJL 1RY7B 4HH9A 5HGBA 1KBGL 4APQA 2DKMA 2XRAH 3ISWA 1HH9A 3V5HA 5GSRB 5BRZD 4H0GA 3MJ9A 4S1QL 5FGCB 1OGAE 1MCEA 3H2WA 3QSKB 1NKOA 1X5XA 4S2SB 1LP9B 3DRTB 4GKNA 1KB5H 2MSPA 4KHTL 5D7JD 3IDUA 2BY1A 3L1OL 5IJKC 5FECA 2NZ9D 4JQXA 4OCXH 4YHPA 3RRQA 1DBJH 3QPXH 5TPWL 3SO3C 2C3VA 1ND0A 4YX2H 5HI5C 4Z9KB 2OZ4H 1SJEB 2WK2A 1N3NA 4XPGH 5E94B 5D5MB 4ZAKD 3BZDA 5LAXA 2HLFD 1RZIB 1QNZL 2DQEL 2ZCKH 3ZYOA 3TN0B 4FZ8H 4O5LH 4TSCH 3FT3B 2OQJA 2VB5A 1TJIL 3BP5B 1D5MA 5HHMD 1EEYB 2NX5D 5GSRA 3GSQB 5C0AE 1JN6B 3UEZA 4KFZC 2Q8AH 2YD3A 4LOUD 4XP9L 5FFLA 4S2SA 5GS1C 3WLWC 1T1WB 3FQRB 3O8XD 1LP9A 3DRTA 4UINH 3VG9C 5DD0H 1UWXH 4C56B 3TZVC 4PJEF 4JB9H 3CH8A 3U4BH 4XHJD 4BK5A 1P4IH 1RUQH 5IUSA 2YPLB 2QADC 5AAMA 3ZE2F 4ZUVB 5FXCH 1SJEA 4PJIB 4MB4A 3L95B 5CBEB 5D5MA 2B1AL 3A6CH 3JTSA 2LFGA 4XB7A 3UTOA 3FL7A 1CXIA 1RZIA 4X6DE 4G6ML 4JM2A 3TN0A 5EIIB 2UYLB 3Q0HA 4LCIL 5DD3H 4XWOC 1QRNE 2WP3T 4HDIB 5FHAH 4PV9A 1EEYA 5J1SC 3WIHA 1EGJH 2JELL 4QTHA 4RBPH 5DD1H 3O3DB 1MQKH 1B4JH 4Z0XB 3Q6GH 4ZO9A 2DM7A 1HHJB 2OR8A 3FQRA 4QTIL 4MXWH 3GK8L 3SJVA 4C56A 1AFVH 3DO7B 2ZZUT 5TE6H 3S37H 4I48B 5EZOL 3VG0H 1C7SA 1I9JL 1PG7H 2YPLA 4ZUVA 4NZUH 4G9FE 1UZ6F 5CBEA 4KZEL 3PG2A 3GIZH 3VGAC 3D2UA 3G6JE 2DWDB 5E6YA 3KPSB 5EIIA 1Y18A 2UYLA 4U1MA 5HVWA 5JR1L 3RUGB 1MEXH 4HDIA 4RFOH 1S8DB 4MLSA 3CMOH 4RMUA 5KOVC 3W81A 3DXAE 4X99B 1CWVA 4G5ZH 4AQOA 4Z0XA 1XF2B 3HMXL 1HHJA 2FX8H 4HJJL 1ORQB 2ICWJ 3UJJH 4I9WD 5C3TA 2ZUSA 2RJMA 2BDNL 3LRHA 4NPYA 3MLTB 2CO6B 5IKCB 5BZDB 2XPGB 3IYLW 3VI3E 4NHUB 4BZYA 2DWDA 1NCDL 3H7LA 3KPSA 5T3XE 3B2UD 3RUGA 2V2WB 4JRYB 3ZT7A 1OLZA 4Z7UF 3OR6A 1QPPA 4X99A 5EZIH 5HYEA 3LEYH 5LBSL 2ICWI 3I2CH 4YFLI 4TTDC 5FCSH 1XF2A 4ZFOL 3L5XH 3O2DH 3RGVC 3PHOB 1LO4H 4PP2A 4EI5C 1I3RA 2GAZB 4XNZC 5C0GB 3R4DA 2DQJH 1T66C 3SDXE 4K3EL 1BBJB 1FFNA 3BE1H 4DAGL 4MSWB 2RR3A 1FL6A 3ZDZF 1FV1A 5IQ7L 2DD8L 4XCCL 3ARGD 3KLSA 4S11A 4G8FB 2D7NA 4TYUA 2NX5B 2R2CA 5CMAB 3NCJL 5BRZA 3MLSL 3N1PC 5TQ2H 1L0XA 5J0BA 4N8VG 4LSVL 1CD1B 4NRZB 3WJLC 4Q6IB 2A6KB 2R4RH 4LLMB 3WL9B 3O8XB 1QYGH 5A3ID 4P3CL 3MRLB 5D7JA 4PYGA 5INCB 2AEQL 2R56H 1DLFL 2FD6L 2IPUK 2ZG1A 3MGTA 5KVDL 1PLGH 2JTDA 3REVB 4UIMB 1BBJA 4ZAKA 3MUHL 3SPVB 3M07A 2W07A 4M8QB 1ZEAL 2OMNA 2FYYA 4X4YB 5J11B 2FRGP 1DBKL 1N6VA 4BH8B 2BRRH 4XAWL 5MEQB 2Z31C 3PL6C 4PREB 2NX5A 3OKNB 4JG0H 4RMQA 1CD1A 3KR3H 5BVPL 1MFEH 1QFWM 1EUTA 4Z8FH 2A6KA 1CE1H 3O8XA 2O5XL 2APTA 4N0CD 3MRLA 4OQTH 4G7YH 4P2QD 4JY4B 5FYKD 1BPVA 3HNTL 5C1MB 2GI7A 5FF6A 4XX1G 3ZKXB 1OD7A 1MAKA 3DO3A 1DBML 3FB8B 2EIEA 4PJBA 3REVA 4UIMA 1CU4H 1U91A 3SJVE 3RTQC 3SPVA 5GGTA 4S1RH 2A1WL 4JFFB 4JDZB 4IHOB 4Y2DB 5ESAA 4CDGC 2NY7L 5EZLA 5JNYB 4X4YA 5D1XD 5IFAL 2G75A 3IAGC 5MEQA 4A2LA 3AS0A 4PREA 3GMLB 2P43B 3OKNA 5ADPH 5DHVB 4OLEA 2EIBA 4XMPH 4MD5A 5HI3C 2OSLB 2CJUL 1BZ7A 4LVHC 4PP1C 4OLUL 4JY4A 1F4XH 3WXWH 5F88B 1H3XA 5JUEL 5C07B 1MPAL 3BHBB 1UXWB 3PWLB 4BM7A 3MRCA 5A2KH 2IJ0C 1FG2B 2IWGA 2OCFD 5SWZE 2QQNL 5JNYA 1T22B 2J2ZA 1G7HB 1ZWIB 3GRWL 1KCVH 4PUBL 1CFNB 1IMHC 4PRPB 4K8RD 2DJUA 1X5YA 2XQYG 4M7LL 1BBDH 1HSBB 1KPRB 3QRGL 4GMSL 3D48R 4PR5B 2OSLA 3NGBB 2G5RA 4ZFFA 4NUJA 3VDAA 2C4FU 5F88A 4I77H 1S9WB 3QNZB 3BHBA 3CAFA 3TJHD 1UXWA 3PWLA 5DK2B 1B3JA 4TQEH 1YMME 3EDKA 2BVOB 1KENL 1FG2A 1O7SA 2EDWA 1RURH 3BUYA 5I1CH 3DTXB 3UC0L 1AQDB 1T22A 4I1NB 2O61B 1GOHA 5GS2D 3VFOA 4WY7L 4U6YB 5D7SL 3CFCH 5HYJD 4RSVA 2VLKE 4R0LA 3KYKL 1FNSL 3PGDA 5JPNB 3NAAH 1Z5LB 5FV2A 5AD0A 4PR5A 3CFEB 5BRZE 1GOGA 2JB6A 2VXQH 2OXHA 5CSGA 4MQ7A 3QB7C 1MJ7H 4OZHA 1JV5B 1X7QB 3QNZA 5DK2A 2VDMH 3ARGA 3DIFA 1K85A 1WUNT 2D7MA 2MPAH 4RNRB 2DQHL 4F57H 3ULSA 3DSNA 1F58H 4U6YA 4X98B 1NCBH 2EH8H 4LSSL 5F3BB 3ZHLA 3WUWA 5JPNA 2A0LC 3G5VB 1X5AA 5HHME 2ITDB 4O02H 3CFEA 3V52H 2DL2A 4OV6F 1R3JB 5F7WC 2XRAL 2GJZA 3UJTH 2ZUYA 4ZOCA 3P30L 3KXFD 3UP1A 4LF3A 1JV5A 1X7QA 2ARJA 1YECL 4UTAH 3B9KD 3NZ8A 4YHOH 4P46D 3EJYD 4PFEA 4PJXF 2EDTA 1CXEA 4ONGH 1HE7A 5D1XB 1CI5A 4GKOA 3KPTA 4RNRA 4OCXL 1KTLB 4HF5H 3QPXL 1BQHA 2DYPB 1U8MB 4X98A 4IS6B 3MXVL 4YX2L 3NACH 5F3BA 4OCSH 2OZ4L 4WFHE 3U1SH 3G5VA 3GHEL 2ZCKL 4P2QA 3BVNA 4FZ8L 4TSCL 3VD9A 4G9DB 4OJFH 1IEAB 3IU4H 5BZWB 1QSZA 4KKLC 4S0SD 3O6KH 2A9MH 3LRSA 2VISB 3O45B 1MCFA 1YEEH 3T2OA 1MVUA 4UINL 3TBVA 3V4VH 3O2WH 2WBWB 5DD0L 1F8TH 2AV7A 4Q97A 5D1XA 4AG4H 4L3ED 4DK6A 4Z78A 1YC7A 4Z77B 1P4IL 1RUQL 2V5SA 4LCCB 4ZUTA 3MACH 4IS6A 5CEXB 3LHPL 2ATKB 3V0VB 4LLUB 3A6CL 2FEDC 1PZ5A 3TYFA 3CD4A 5I15H 3ILQD 4K9EH 5DD3L 1IEAA 3BGAA 5FHAL 1G84A 5I1LB 2FEEI 4KU1A 2YS4A 5SWSD 5DD1L 5IOPA 1ZGLP 4M7ZC 2BVQB 1MQKL 3T0EC 2VISA 3Q6GL 4EUPB 2HKHL 1N8ZB 2QHRH 5I8KL 4BJLA 3GSNH 4MXWL 3BMWA 1MCWM 1AFVL 3O3EB 5EN2B 1K4DB 5CP7A 3S37L 4OI9A 4JRXE 5DMGC 3VG0L 3BN9C 4U0RC 4MA1B 4LCCA 1BEYH 1MCJA 1QSFE 5EOQH 1AXSB 2BSTB 4BQ8A 4FFVD 4NZUL 5CEXA 1SMOA 2ATKA 3V0VA 5I19L 2XZQL 3VFGL 5E00B 3GIZL 3DX9A 4N8CH 4GBXC 3QH3B 4NCC1 5HGGS 3LY6A 3I6KA 1ZHKB 3TPKA 1T4KB 1MEXL 4M7KH 1UG9A 4RFOL 5SWQB 3CMOL 4OSUH 1NBZB 4XBEL 4KAQL 3L3IA 4ZQKA 4M48H 1IZKA 2QJDA 2WZPD 4G5ZL 3HCVB 2BVQA 2Z8WC 4GW1B 3F8UB 3FMGH 4RFEA 4EUPA 4LMQI 2HT3D 2L0DA 4OZHE 1XGRA 3UJJL 3O3EA 2CXGA 2AJ3B 3BPCB 1PX4A 4JZOB 3RA7H 4PTTB 3ZDXE 4HV8A 5HYJA 1KB5A 3HMWL 5J6HB 4E5XB 3QUYC 5CKGA 5IG7B 3UYRL 2IAMC 5E00A 4JGMA 3QH3A 5HHVL 3ZTNH 1Q9LA 4GAFB 4Y5YA 3KXFB 3DHJA 1HEZB 4X8XA 3B9KB 5EZIL 4P46B 1KN4H 3HCVA 4GW1A 3WKML 2R1XB 4JDTL 2KZWA 2O26U 3F7PC 4CU6A 4HG4J 2M8XA 2WUBH 1U8OB 5DUPH 3VD5A 1S9KC 4PJDB 2E7LC 2V9TA 2D0GA 4PTTA 2DQJL 2WWKT 3H3PH 2G2RB 2VXUH 3WS3A 2C4XA 3BE1L 5IG7A 1ZT7A 5TE7H 4QGTA 2XWTA 4PJ9D 2YUXA 4JLRB 3QT2A 4ZPVB 3SCMC 3QQ9D 1R24B 2VZ3A 3KXFA 4U7MA 4OZIB 5TQ2L 1BVZA 1MFCL 1HEZA 3B9KA 4P2QE 4HHAA 1U3JA 2NXYC 4P46A 3OBAA 4XVTL 2R4RL 3KJ4B 1BAFH 2HVKB 1P5UA 3MRMA 4XBPA 3PWVA 1EGJA 2R56L 2DIBA 1TQCC 2R4SH 5DMJB 4M6MH 4PJDA 5JO5A 3G9VA 1FNEB 5EO1B 3N85H 4OIIL 3LKQB 4PJAF 4IRJB 1PLGL 1WWWX 2CDFB 2G2RA 4HS3B 1Z2KA 3OV6A 4UQ3B 1QFUH 5DEGB 1G6RL 1JGDB 4Z7NF 3I6LD 2K7PA 3RVVC 3QI9C 3N1QC 1VACB 4JLRA 4MAYD 4ZPVA 1JGVL 3PWPD 1S5HB 4OZIA 1YYMH 2VKWA 4JG0L 3QXVA 3T2NH 3KR3L 3QPQD 4QHLB 4X8JA 1R3LB 4Z8FL 4OZFH 1CE1L 4M1GH 1WICA 4LBEB 4G7YL 5F9DC 2E9WA 4L3EA 5DFVC 4PG2A 3SEPA 3LPFA 4DEPC 5EO1A 4N0FB 3LKQA 1EXUB 2I5YH 5E6IC 4HS3A 4XCNB 1CU4L 2BVYA 5EBWB 3STZB 1JGDA 5B4MC 3THMH 1Q9KA 1UGNA 1GRWA 5CP3H 5I75C 5JOPD 3L5IA 1WT5A 1VACA 3ILPA 2AABH 4MMZC 3T3MF 2BHYA 1KT2B 2UVFA 5A2JH 4WI5A 5JDSB 4C83B 2Z93B 3TCXA 4QHLA 1R3LA 2J5LC 4EKXA 4Z18A 2DAVA 2DMBA 4WDIB 1J0ZA 3SDAB 1WIPA 5BS0B 2ADJA 4LLYB 1F4XL 4XPAH 4L8SA 4N5UA 3WXWL 1U6AH 5DYOB 4N0FA 4ESKA 5KS9A 2ENYA 3O2DA 5C6PB 1JK8B 1QHPA 4XCNA 3J8F7 1WC7A 5IQ9B 5EBWA 1G7JB 1U8PA 4OCWH 4MAUH 3BD4A 1I7UB 5ESQB 1KXQE 1MQ8A 4ODUB 4NBZB 1CIDA 2O5YL 1KCVL 5EO0A 1KT2A 5HYIA 3KPLB 4ALAL 2HTLC 5JDSA 2Z93A 1BBDL 2MHAB 2VOTA 3TIDB 2JCCE 4QKXB 1PG7X 4YHKH 4LLYA 4X80L 2X10A 1MJ8H 5L2JB 3P9MB 3SDCD 4NM8H 3VRIA 1ED3B 5B39B 4TQEL 5HDOA 3U30C 5IQ9A 1F3JB 5I8CB 3WNPA 1G7JA 1G7PB 1RURL 4PJ9B 2MOVA 5I1CL 5KAQG 3TA3D 2AS5M 4ODUA 4GAYB 4JKLA 3HUJE 4WW2C 3ELAT 3LZFH 3LPWA 3KPLA 3WFHB 2ZKHH 5F96L 2XWJA 5KZCD 2DLGA 1CK0H 1TZIA 3TIDA 2Y25A 2VXQL 5DQJB 5GRVK 3KPRD 3PWNA 5CCKH 1AH1A 4KJQC 3FB7B 2LVEA 2AK4E 3FO2B 4OQTA 2Y1VA 1ED3A 5B39A 2CRMA 1F3JA 5I8CA 1G7PA 2VDML 3R06B 4H25A 2XI9A 4C59B 4PJ9A 3H7BB 4HGMA 5FGSA 5IV2B 1LHZA 3OJDB 5IB3B 4MAYB 5HJ3A 2MPAL 2ICCA 4F57L 1F58L 1SJXA 2EH8L 1OW0A 3WFHA 2E9BA 5IW1A 3X14B 4F15B 3ES6B 5I0ZA 4O02L 1K3IA 3BKCL 1TENA 1LO3H 1EIBA 5DQJA 3UJTL 4Y4FD 1EZVY 4NQTA 3BO8A 4Y1AE 4EIGB 3FB7A 1U8IA 2OI9B 4ODXB 5ANMA 4UTAL 4YHOL 4ZOEA 4I3GA 4WU5B 3MBEC 4XPHH 3GBNH 1H8OA 3H7BA 2EE9A 4ONGL 1A64A 4MAYA 3PWPA 4OV5B 4LP5A 3MBXH 2VO5A 1IGJB 1A3LH 1FGNH 4WWID 3UTSB 3NACL 1JZ8A 5GRUH 2BK8A 2ID5A 3ES6A 4POUB 1TPXB 1KPVB 5SWSE 1ULVA 1PD6A 4OJFL 4W6XB 3IU4L 3Q3GB 3QNXB 3O6KL 5TDNB 4ODXA 2A9ML 4R90H 1UB6A 1R5IA 1YEEL 2G5BA 1OF2B 3E6FB 3R0MA 5HTSA 3O9WC 1CFTA 5B3JE 5CJQH 3W9EA 4AG4L 2WWMC 4YHZH 4PJEE 3QZWB 5HHXH 2FGWH 3BH9B 4FQ1H 3MACL 1OWRM 3ZE2E 3VFMB 1A6PA 3IFLL 2GJ6D 2NLJB 1G9NC 3A6OA 1R6VA 1X3DA 3OKEB 3P0VH 5I15L 1J86A 4K9EL 1KPVA 5D7IB 1X4XA 1UJ3A 4P4RA 4HBCH 3Q3GA 3QNXA 1P7KB 4NQDD 4HBQA 5TDNA 4NNXB 4CW1B 1G0DA 4TPRH 2NY5C 3S3JA 1A9BB 2F54E 2GFBB 2QHRL 1OF2A 1YEDB 3TA3B 1AE6H 2YD7A 1DQLH 4HZLA 3EW3B 4Z7VF 1MUJA 4M03A 3K3QA 5IM7B 4LEXH 1BEYL 1BZQK 5C0ND 1D6EB 1FC2D 4JY6B 1UQSB 5ABDE 1UZ6E 1JP5A 2NLJA 3K1KC 3CSYB 5KZCB 3MOBL 4B7LA 3OKEA 3ZO0A 3U0WH 4R7DB 4ZUSB 4N8CL 4HUVB 3GJFB 1F6LL 3QFDA 4Z7WE 5D7IA 1YEFH 3C5SA 5D9SA 3QP3A 4M7KL 2JE8A 1P7KA 3SDCA 4OSUL 4ZSOB 4NNXA 4CW1A 3FMGL 5KVMC 5HVFB 1BP3B 1YEDA 3TA3A 3IJYA 5GGUA 3QYCA 4WEMB 4FNLH 3UTPD 1KCRH 4Y4HD 3EYVB 5J1AA 4R3SA 5T3ZH 4LAQH 1BVLB 1D6EA 4XPFH 3STLA 3JWOH 2UZXB 3BGFC 3EYSH 3WD5H 3CSYA 5I1GH 5T5NG 3O4OC 4DUVA 3IVKB 4R7DA 2HH0L 4HUVA 3GJFA 2E8YA 3KPRA 4Q9CA 1MCOH 1UH3A 5IB1A 5F6IB 3KPOB 3V5KA 3QIUD 4Z7UE 1MCSA 4Q0XH 1E4KC 3HNSL 3W11C 5ADOH 4LDOB 1P1ZB 2FO4B 4NRXA 4M9PA 2IF7A 5ANME 1GGBH 3H3PL 5F6HJ 2EC9U 3EYVA 2VXUL 4P2YA 5C09E 4XPTH 4FFWD 4OFDA 2QQKH 3ZDZE 1TJGL 3IS0X 5L9DH 2Y72A 3ARVA 4U1LB 4FXGB 4J4PC 5DD6A 2NY0B 5BV7H 4ENED 4Y4FA 1T7VA 2IPTH 4WU7A 1IARB 4LHUD 3EYQC 4YJZL 4HK3J 5F9WB 3LS5L 5EFIB 2ICWA 3RPIB 4HKZB 2K9UA 1IGML 1BAFL 4Y88A 1ORSA 5DO2D 4YR6A 2Z8VC 2FO4A 1AD9B 4LGPB 2R4SL 4PRBA 5F6HI 1PVHA 4ELKB 2C4FT 5EU3B 4JN1H 1TMCB 1IT9L 3AB0C 3FRUB 4TVSa 1T21B 3NIGF 5C0DB 3GSNA 1BECA 2OR9H 2GJ6B 1J05B 1K6QL 1QFUL 2BY0A 3I9GH 4NRYB 5B38G 5HYSG 3L7EB 4U1LA 4J8RB 4CVZB 4FXGA 2E9IA 1LD9B 3D39E 2AJUL 1YYML 2KPNA 1EMTL 1A1OB 3T2NL 1JPFA 4PGCA 2NXZC 4M1GL 4UQ2B 1J10A 3W2DH 4LCUB 5IT2L 1AD9A 5DRWB 3TF7C 3ARYA 2Q6WA 3VGHA 1OHQA 4O2CB 1T21A 2I5YL 1BREA 3PNWB 3ZSSA 2UY6A 3VFUB 2GJ6A 3AXLB 1J05A 3RVXD 4P9HC 4NRYA 2LU3A 2OL3H 3THML 4L4JA 5I1DB 4HPOH 3KYAA 2AABL 1LD9A 2HN7B 4EDXA 4UB0L 4NQDA 1NCCH 5IW6B 3ZMRA 4APQC 1GJIA 4EVNB 3I02B 5KTEL 4QLRA 3S5LG 4S1SH 3DSFH 4UQ2A 5CFHA 4ZTOH 4LCUA 5LXGH 5IESH 1FL3B 3ARUA 1YMHB 1B9ZA 3MTRA 1U6AL 3T65B 1VFAA 1NC2B 4FQXD 4Y4HB 3LKPB 3RWCB 3G6JB 3PNWA 4JQXC 4ZNCD 4YZFF 3AXLA 4KK8D 5D2NE 4MAUL 1NGYB 1LEGA 5EZJA 2NW2B 3WNMA 3EOTL 5I1DA 3DXAB 1YY9C 2HN7A 3O81A 3DOSA 3QIUB 4U0QB 1BQSA 4GRLD 2P4AB 4EVNA 4RAVB 3I02A 1YPZF 2PTTB 1MCWW 3KPRE 3HHRB 3OXRB 1JF1A 1SEBA 4YHKL 2X6MA 1FL3A 4KRPD 1YMHA 2IPKB 4LSDA 4N90D 4Y4HA 3LEXA 4NM8L 4U1KB 2Z91B 2E5EA 3QDGD 3JV6A 1WLHA 3GMQA 1G6VK 5BQ7B 3OJVC 5LCVH 1PZUB 2RAMA 3GIVB 3VFRB 1QBLH 1NUNB 4Z5RA 1LDPH 5AG9A 5DRXB 3QIUA 4RISL 3TN0C 1DN0A 3LZFL 4K7PY 1T6WA 4MDJB 3FTGB 2VDKH 2CIIB 4BZ2H 1X5ZA 1WIOA 12E8L 5D2LF 5FYLH 3WBDA 2EDEA 3OXRA 1P7QD 3SDXB 4CNIB 2IPKA 5CCKL 1ZSDB 4U1KA 5CS7A 1W0VA 2DBJA 1R5VB 1IEBA 2CDEB 4XTRC 3GIVA 1S9VA 4V1DE 1IVLA 4LHUA 2LAAA 3H42L 3NH7H 4MA7H 1ZGLB 4PLKC 3ZL4L 1F2XK 4M8VA 3FTGA 2FEEL 2CIIA 4PJ8D 2QSVA 5F8RC 3RDTB 4GXUN 5D7LE 4M6OL 3BWAA 3QEQE 3LQAC 3ARED 1K3ZA 3GBLA 1UZ8A 4Z7OF 2EDLA 3MJ7B 3OF6D 4UV7H 5C86A 5CLWA 3BIBX 4GG6A 3MYZA 1QFOA 5E4EC 4U05A 3CX5J 4PJXE 3WO3B 4XPHL 4YXKH 3GBNL 2ATPB 1JGLH 3DX6B 5HHQB 4WV1B 3MBXL 2H3NA 5H37G 1R0AL 1ZGLA 5GRUL 4HKXB 5SX5K 1R3IL 4HCRA 4GQ9H 4PJFF 2ZUQB 4M61B 3TBSA 3K81A 1ZVSA 3CZJA 5DFWH 3MA9H 4FQXB 4AL8L 5GJTH 3EYFB 2CPCA 1RHHB 3NPSB 5DVNA 2W9DH 4QOKD 1OP5K 5DJXB 1UH2A 5BVJB 5EA0H 3C6SB 3RL2A 3MJ7A 4HIHB 2R23A 4R90L 2CH8A 2QTEA 4TULH 3ULUD 2ATPA 5CZKA 2F5AH 3RHWK 3GJEB 4UILH 5HHXL 3FQNB 4KRMB 4GRLB 4K2UH 3BT2H 1U2HA 3UTTE 4ZNEA 2EXYC 3WUWG 1JZ2A 3EUUA 2H8PA 4FZEH 3BKYH 2OP4H 4KRPB 5T3ZD 1QBBA 5EULV 4FQXA 4K55A 4OGXH 5D7JC 3EYFA 3W0WE 2NZ9C 1V3LA 3CVHB 3QDGB 5SWZB 3MRPB 4LLVB 4CVXB 3OB8A 3DVIA 1AE6L 4LSPH 1DQLL 4ZAKC 3V95A 1S7SB 5E7FA 1WSST 2PUQT 3GJEA 3TV3L 1XCQB 1VKXB 3FQNA 4GRLA 4YO0B 2GEEA 1BQHG 4KMLB 4Q9QH 3U0WL 2FZ3B 1UWGL 1OPGL 5DJ2B 1AO7E 3O8XC 4LHQB 1YMMB 1CYGA 4YXHH 4TUJB 5CZXC 3VD3A 3CVHA 4L3CB 3QDGA 4XHJC 3TEUA 3MRPA 4LLVA 4CVXA 4NN5B 3OX8A 5GRJL 2BNUB 1OP9A 5FUCE 2XKNA 1KCRL 4DN3H 5J11C 2H9GB 1KCSL 4LAQL 3EYSL 3JWOL 4PJ8B 3WD5L 5I1GL 1VFOA 2FZ3A 1P7QA 4FABH 5DJ2A 3JVGA 3D9AH 4MYWB 2MNUA 1MCOL 2WQ8A 4XI5D 4TUJA 4Q0XL 1WITA 4L3CA 2QSTA 1NGXB 1AGFB 2B8OT 3C6LD 2VLJD 1EBAA 4Z76B 2AW2A 2JJUA 5DDHA 2BNUA 2K7QA 2ED7A 2EDNA 2LABA 5J57B 3MNWB 1BOYA 3EO0A 1AHWB 3FOMA 3ZTJG 4R97C 3MRGA 2H9GA 1X5LA 1WAAF 1NCAH 4XPTL 3X3GH 3DUSA 4PJ8A 4O9HH 5L9DL 5CSBA 3HAEH 1NCTA 2HG5B 1Q8MA 2C3WA 4DJMA 2IPTL 3ARDB 1KJ3H 3MRHB 4QOKB 1FFRA 1RUKL 3OF6A 1J0YA 4O00A 3GM8A 4RA3A 3TJEH 3QUXD 3I75B 4MD0A 1AGFA 3O6LH 1F5WA 4TRPH 1C8PA 1PSKL 1DQDH 4XNQB 2VXVH 4G7VH 1RI8A 5F9OH 3MNWA 5DR5L 1CXFA 1AHWA 4PJAE 3FQUA 5DK0B 4CBPA 3BESR 3B2UC 1G9MC 3H9ZA 3U9PL 1DLHB 3RIAK 3I9GL 1BZ9A 4UNUA 2OTWA 3MV9D 4R0LC 3UROR 4JFDB 4OBSA 3UMTA 4HWUA 2HG5A 1DQMH 1OB1B 4DW2L 2IBBA 2DS4A 4FQLH 3NGBC 4Y5XB 4ZNEE 4LU5L 4QOKA 1NSNH 4GRWF 4ZFOB 3BDYH 3FCTB 3I75A 4NFCA 3QAZC 4WTXA 2RGSA 4XNQA 1CN4A 4A6YL 3ET9F 3U82B 1KOAA 3VFTB 3VMOA 2GT9B 1J8HD 5B8CB 1LEIB 3RWIB 3WNNA 2FLRT 5EH1A 4I18A 5DMYA 3LMJL 4CKVX 3TIEB 5JHDB 4XWGH 2OL3L 3BOVA 1YEIL 1XF3A 3VDCA 4RGNB 3T3ME 5JW4M 1F3DJ 3RHWF 5C9JB 1N26A 1O5DT 1BFOA 1FIEA 4KUZH 5E8PA 4KTDH 5FM5M 1CCZA 5F93C 1K8DB 3O3BB 5C0EB 4M5ZH 4S1SL 4JRXB 3DSFL 3T77A 2V9RA 4ZTOL 5IESL 4O4YL 3R1GL 5GRVL 2KKQA 4R4BB 15C8L 4EJ1C 1U58B 5B21A 5I66B 4ZG1A 5B8CA 1BGXH 3RWIA 4HAFA 3UTZB 3WFZA 3TIEA 4E9LA 4CJ0A 3B5HA 4OIAA 4HAGA 3BX7C 5F9AC 4N0CC 4QYOB 2BSRA 5FM8A 4J3OC 4MVBC 1A3QA 2N1KA 3VE0B 1NC4D 1K8DA 4ONHB 3NCYP 2E9JA 1ZA6A 4U4BA 1R5WB 4YC2B 4LMQE 1FFPA 4QO1A 1U58A 1VGEL 4HFWA 4JN2B 1PX3A 1M05A 5D1XC 1TLKA 1XR8A 1SY6H 5EWIL 1AR1D 1S7XB 4L4TD 3SDDB 5IVZB 5GHWH 4GUPB 5LCVL 2H26B 3WYRA 1YC8A 1LDPL 4JPIB 3K1DA 4QYOA 1CGXA 4CMMB 5JMOC 5GZND 1QO3B 3VE0A 3QUXB 4FA8A 2X9YA 3C6LA 5SX5H 1S9XB 2VLJA 2VDKL 2X4SB 2XZCH 1IE5A 4PGEB 3NIDF 4BZ2L 2AKRB 3TCLB 1QSVA 5FYLL 3TBYB 2FLBT 5L2KD 1MCNA 4Y8DC 2ZOKB 4HFUH 3VWKD 4JN2A 1XF5A 3MRFB 3NA9H 4K94C 3RL1B 3I6GB 3SKNA 1NGWB 3VFNB 4K8RC 4G8IA 1KCKA 4LCCC 3SDDA 4HX1B 3MOAL 5HGHB 3IFNL 3HZMB 4ZO8A 4JPIA 5JXEC 4AMKL 1AKJD 4MHHG 1I7RA 4CMMA 1BIHA 4NOFA 2ZG2A 3EO1B 3QUXA 4WW1A 5F21B 1S9XA 2X4SA 4PGEA 2AKRA 3TCLA 2X1OA 1WBZA 3TBYA 3SOBH 4V2CB 1Z9LA 5HYQB 1G7MA 1T7XA 1S78D 2IFFH 1IAOB 1JWMB 3MRFA 1KF9B 4PJ5E 3RL1A 4YGAB 3HR5A 4OF8A 4UV7L 1MLBA 4MA1C 5DGQA 3MV9A 2R2HB 4WHCA 5HHNB 4CMHB 1OLLA 1ZANL 2NR6D 4LEOB 5HGHA 5GGRA 2CLZA 3BH8A 1D5BB 3C09B 1OM3H 3VH8B 5FKPB 1M7IA 1UM4H 1X4ZA 2VLLB 3EO1A 4HKBB 4J3VA 4Y5YC 5T3ZE 2HWZH 4L9LB 3RIFK 1BJ8A 4JAMB 4NDMB 1U8QA 2DMKA 3S8WA 4X7SL 4RMVA 2ICEB 3IDGA 1F6AB 4P9MH 3F5WB 3U0PA 1JMZA 1J8HA 3LKSA 5EOTB 5GJTL 2W9DL 2ZP0T 3TP4A 1CGSL 5EA0L 3F12B 5J6GB 4TULL 1X4YA 2R2HA 2EICA 2F5AL 1NJ9B 4UILL 4DUXA 5IMOA 1KCLA 3VH8A 2I9LA 5FKPA 1NC4B 1L7TL 1VB9A 3PDDA 4ZYKB 2VZ1A 4K2UL 4HPYH 2RHEA 2FJHA 3ESVF 1X5KA 4L9LA 1DP0A 2V2XA 4JAMA 4NDMA 3B9KC 4LIQL 4P46C 3BKYL 2OP4L 4OLXH 3EJYC 4N0UB 1F6AA 3OB0K 1PGRB 2VDQL 4OGXL 5EOTA 1LE9B 3OMZA 3LN4A 5KSBB 4HLJA 1ITBB 2ZG3A 3RX5A 5DVLA 3F12A 5IB5B 3QA3B 1DVFB 4WCYH 2I60L 4LSPL 4JR9H 1NJ9A 5H2BB 2BCKB 2PR4L 4JZJB 4P57B 1NC4A 4ZYKA 2P8PB 5LKNA 1CLCA 1J5OH 4Q9QL 4JFHE 4N0UA 2GTWB 3E6HB 2H32A 3KJ4C 5TDPB 3EJJX 4R7NA 1LE9A 2DL9A 1C5CH 4PG2C 3OWEA 4JE4B 1RZ7H 1EVTC 3AAZB 4PRDB 4L4TA 5IB5A 3QA3A 1DVFA 3F62A 4IRJC 2YK1L 1YY8B 3HUJB 3IF1B 1FSKB 3WFCL 1AGDA 3WFDL 1XGPB 1QFWH 3ILQC 5H2BA 5GZOD 1AKJB 2BCKA 4CJ1A 4NO3B 2M2DA 1KJVB 4KMTH 4P57A 2P8PA 4V2BA 3K2MC 3MV7E 4IJ3C 1YYLH 5GGSB 5L2KA 4LQFH 5M94B 2KZ1B 3D9AL 3E6HA 3VWKA 2QQQA 5TDPA 4X6FA 5HDBF 3CDYA 4L8SC 1IC4L 4ZS7H 4GJTB 4HC1H 4KRNA 4B0MM 3AAZA 4QRRD 5BCAA 3FO1B 2FIKB 2PW2B 1GVIA 3ZDYF 3DX8B 1XGPA 3ZE1F 2VR4A 1S5IH 1AKJA 4ISVB 4ETQB 4UT6L 3RY5A 3MR9B 5GS3A 3X3GL 1ETZA 2XNAA 3NTCH 1OAYH 4ONOA 4O9HL 3MLZL 4HKJB 2B0SH 1KJ2H 4Y1AB 5GGSA 1MY5A 2HT3C 4O2EB 4Y89A 1FO0H 2CKBB 3BWUC 5GGVH 1GL4B 1GGCH 1YZZA 3TJEL 3TZVD 3O6LL 3QG7H 1DQDL 1J8HE 5DJYA 2FIKA 4G7VL 3UBXI 5F44A 1ITCA 1MNUH 3DV6A 5F9OL 1JNNL 1F3DH 1LO2H 4X9BA 4ISVA 4ETQA 3NIGE 3KYOB 3MUGA 4C55A 2B2XH 4UAOB 1IM9D 2V17H 2X4OB 3G5XB 1TZGH 1H3WM 1VHPA 4HKJA 4PD4J 2AI0H 3B83A 3T0VA 5JW4Q 1DQML 2E27H 3RWGB 2F5BH 1EEUA 4O2EA 2G9HB 2CKBA 3VXRE 3JV4B 5E8OB 2HRPH 1NSNL 3RKDC 5LWYH 3BDYL 5IP4A 3QWOB 4PJEB 2CRZA 5F97E 3RIFF 4JHBA 4PD4K 5FYLE 3BW9B 3CZFB 2E3VA 3HRZB 4KKAD 4PJ9C 5DZOA 1Q9WB 4PPTA 4OM0H 3QQ9C 3PDOB 3EO9L 5C3LD 2BMKB 1MI5B 4XWGL 5GJSH 3G5XA 1JTPA 5FA4A 1OW0C 4D9QD 2JJTA 4PJ7E 1NDMA 1TNNA 4OCRH 2G9HA 1ZLUK 5DLMH 2YD4A 2F54B 4KUZL 4KTDL 3QWOA 5I1IH 3FT4A 1UEYA 3CPLA 4KDTA 3SKJH 3HR6A 4CAGA 3CZFA 4ODBD 4L4TE 5JORA 1BGXL 3CK0L 4MAYC 1IAMA 3HPLB 1G6RB 1Q9WA 2V5YA 1JIBA 1QKZH 3QJHB 4YZFE 3MRNA 2BMKA 2FHBA 3B8SA 3V6FB 4JJ5A 3QPQC 1JHLH 4WTWA 2VSDA 1IL1B 1NH6A 4F15C 4ODHH 4I2XB 4GAJH 3S35X 4Y5VB 5KSUB 2P8LB 4PB9H 1QACA 2P24B 4TTDD 4FP8H 3RGVD 4HWBA 3V79C 1YPZE 2X4NB 2H2PC 4YHIB 2YPVH 2OI9C 5TH2A 2XIDA 4OZGA 5FO9B 3S36L 2NTSP 2P5WD 3ZYIA 1LE5A 5FKAA 5TQ0H 3HPLA 1G6RA 2BVUA 2MQ0A 3QJHA 4H1LB 1SY6L 1JWUA 4MNHB 3S96B 1GGUA 3V6FA 2LAGB 5GHWL 5C0CE 1A6AA 1IL1A 1CF8H 1OAKH 4I2XA 3BSZH 3O11A 4Y5VA 1RUPH 2EH7L 3G5YA 3U6RB 2P8LA 2C1PB 2X4NA 1ZXQA 3L5WA 4YHIA 4DVBB 4D0BA 4QRRA 4Y4KB 4YPGB 4WO4B 5D2LE 4DN4H 2PYEE 1X6LA 4N68A 1FNHA 5FO9A 43C9B 4HFUL 4H26B 5C09B 3VFWB 3BIAX 4KQ4H 5KANI 3NA9L 2NNAB 1AQKL 4MNHA 3O3AB 4OD2B 4QHMA 4E41D 3PL6D 5TF1L 1NDGB 3PF2A 4WFGE 2WINB 3RVWD 3GNML 2BJMH 5K9JH 4GH7B 3U6RA 4IMLB 3HG1D 4QF1B 3NCFB 1OAZH 3AY4C 4FTVD 5DURD 2CSPA 1ODAA 1KTRL 3TZVA 1H9VA 4YHNA 4R4FL 3SDCC 1NGZB 4WO4A 4F3FB 1PKQA 1MFNA 3ZHKA 4X4XB 4G8GD 1T0PB 2WBJD 1RK1B 3OB0H 1T1XB 43C9A 4H26A 3VFWA 2FNBA 5L8KB 4MJ2A 3RTQD 3TA3C 3EFDL 1TTFA 4Z7OE 5C0IB 2NNAA 1GXEA 2NY6B 4OGYH 4Q9RH 1IM9A 2CKNA 2MKWA 4OD2A 1T0MB 4YLQT 2XXCB 1BOGB 3SGKC 3K7UA 1SYVA 3WHE1 3GI8H 3HE7D 3PGFH 1OTUD 1FG9C 3MRJB 1UM4L 1OTTD 2HWZL 5HHOD 1FCGA 4PJFE 4JM4L 2Y07L 1NGZA 3DRQB 4ZOAA 4F3FA 1MCLA 4X4XA 4AIXA 4P9ML 1TIUA 3HTLX 2IALA 3MRDA 1A7QL 5C0IA 3HI5H 3IJHA 4OZFG 1HI6A 3VRLF 5MHSD 2VDPL 1DBAL 3V6ZB 2LVCA 1T89A 4FQIH 1U92B 2R8SL 3PXJA 4MDIA 1PEWA 4LHUG 2DRUA 4OGAD 5CHNB 3B2VH 5I1AB 4HPYL 1KTKE 1BX2B 3ESUF 3DRQA 2J6EA 5EOCJ 1H5BB 3S34H 1HINL 3WNKA 3P9WB 1OSZA 2OJZH 1Q94B 5J56B 2MQ3A 5JPMB 5HGDA 3DGGB 1DUYB 1U92A 2VLMD 4KKBD 4X9GA 2BXYA 3K74B 2J8UA 1I75A 1MF2H 3LVEA 2NY0C 1T04B 1IKFH 3PQYE 5DEZA 3RGVA 1KGCD 5CHNA 4M93C 3ULVF 5I1AA 1CBVH 2CIKA 1BX2A 1J5OL 2V7NB 5F9WC 4DOHB 1MHEB 2R0WH 2FHFA 3LH2H 2X2YA 4I3SH 2P5WA 1DTUA 3CVIH 2N7BA 2Z8RA 2P44B 1Q94A 5I30H 1C5CL 4ZXBD 1RZ7L 5JPMA 3TH4T 3GMPA 3I3EA 1DUYA 3HZKA 4RIRB 4WEUD 3DYOA 1CVSC 5IVXE 1GH7A 3DROA 3HG1B 4FTVB 1D3CA 2A0LD 2OTPA 1T04A 4KMTL 5DA4A 1FORL 3DMMD 4ZODA 3CNKA 1K5NB 4J2XA 4QRPD 4DKAA 4KTYA 2V7NA 1MHEA 1YYLL 3V6BR 2WBJB 3QQNA 1AGBB 5I1JH 4HQQH 1PKQE 4NKIH 3SKOB 3HPJB 1G7IA 5EC1B 4LVOC 4E41A 5E95B 3MMEB 4U1SB 5HPMB 2AJVH 3HE7B 2DLFH 1HKFA 1KYOJ 3A6BH 5ETUB 2WIIA 2WLYA 1S5IL 4HXBH 2YD9A 3HG1A 4FTVA 1F4WL 3F7QA 5KG9B 1WAAE 4HS6B 3SQOH 5HHOB 3NTCL 1OAYL 3SBWC 5D7LB 1TVBB 5AYUH 2B0SL 1KJ2L 3CMGA 2JK5B 4G8GA 4KI5F 3ZE0F 5CBAB 2WBJA 3EDDA 1MIEH 1AGBA 1N2RB 2Z92B 3RTQA 2EDBA 4LCYB 1ZLUH 4HEME 1QFHA 4PJXB 2X1XR 3E2HC 4M02A 2C5DC 5GGVL 2ERJC 1NANI 2D7PA 3SKOA 5EC1A 4Y4HC 2R39A 3VFPB 3QG7L 2HJFA 2VSCA 4MQSB 1K2DB 3HNVH 1JE6A 4U1SA 5HPMA 5JIPA 3HE7A 4OB5H 4CDHA 1MNUL 5ETUA 3IKKA 4XPBH 4KV5E 1JUFB 1LO2L 3B9AA 1ACYH 5C08B 4OUOA 4D9QE 5KG9A 2EKSB 4MJ6A 4AIOA 4HS6A 4X6CE 3S6CA 2EYTA 5HHOA 3QIUC 1TZGL 4P2RE 2AI0L 5CBAA 5DXWA 2E27L 3DURA 1N2RA 2F5BL 5FYJH 3RY4A 4LCYA 2HRPL 4OCYH 5LWYL 5A1AA 3IDYB 1L0QA 1YEGH 4LVEA 1K2DA 4LLDB 5DMGD 1CGTA 4KKNA 2ESVD 4LGRB 5FOBA 5FUZL 3UTTB 4ENEC 3LKNA 4OM0L 1FQ9C 4N0YH 3QO1B 1CLZH 4EDWH 3U0TB 3WFBL 5GJSL 5GGRY 1OSPH 1VEPA 3RWFB 3W0WB 1HQRB 1D5ZB 2OM5A 3MZTA 1A1MA 1QZ1A 4OCRL 2R2EB 4YE4H 2VIRB 5DO2C 5K9KA 4NIKB 5DLML 2OBGA 1KEGH 35C8H 3MCG1 5CUSH 5E5MA 4ZXBB 2YN5A 5DC4B 2C3HA 4GMTL 5I1IL 2IAND 3X12B 3TLRA 4X4ME 1G9NH 3KDMA 5IROA 3BZFB 3IU3B 4X6DF 4K3DL 4LLDA 5J9PB 4OT1L 3VXSE 3SKJL 1D7FA 3F6LA 4HC1A 1F11A 3MLWH 1WZ1L 1KNOB 2CR3A 3DMMB 1A5FH 3QO1A 4DZBB 3U0TA 4NN6B 1X5FA 3VRJB 2NY5H 3RWFA 4EOWL 4DZ8B 4JY5L 4IBLT 4TUOA 4RZCB 4ODHL 3VCLB 1OGTB 1KB9K 4GAJL 3F58H 4IIQB 32C2B 5JLZB 3RDTC 4FP8L 2CGRL 4ZXBA 3I50H 5CSZA 5KSAD 2UV3A 1MRDL 3IDXH 5L6YL 2VN7A 4TN9A 5FUOL 2YPVL 4MXVF 1FO0A 3B9EA 3IU3A 3OG6B 5MENE 3RVXC 3P9LA 2X4UA 4M5YH 2AV1B 5HDLA 1AGCB 3HB3D 5TQ0L 1KNOA 2CUIA 3DMMA 1YN6A 3ZT5A 3FFCD 4QRPA 3VRJA 4PRAB 4ZTPH 3WHE0 3N50A 4B5EA 1CF8L 1OAKL 4I0PD 3OXSA 3VCLA 1OGTA 3BSZL 4LARH 2ZUQC 2X9WA 3ZKND 1IQWH 1RUPL 32C2A 3PP4L 4IIQA 3IRZA 4UTBL 4QY8B 4AH2A 5T1KB 3MREA 1CD9B 4G8GE 4FQXC 1H3PH 3NIDE 3NPSC 2FBJH 3MV8D 3MSPA 4DN4L 4KK8C 2P7TB 1U3HB 4Z7QF 2BSSA 4PGJA 1WBYA 4ZO6A 5C7XH 4KQ4L 4JDVA 1AC6A 4NZRL 2EDKA 3RVVD 2O93L 2IADB 3JUYA 5DVOA 2DQTH 2WUCH 5FGBA 5TGBB 4QWWD 1YDPB 1E6JL 4GRLC 1KLFA 4NO0D 8CGTA 3BZEB 3BYTA 3H9HB 3QUKB 5C70A 1YJDL 2Y6SC 4KRPC 1YNKL 4QY8A 2F53E 1ZT4B 1JVKA 3L6FB 1A6WL 2RCSH 3KVQA 3OGCA 5I76A 2X7LB 7FABH 2ESVB 3UYPA 3NA4A 3C5ZD 2FWOA 2P7TA 5CWSB 2YC1B 1MFDH 4WRLA 1FYHB 2Q7NA 4OGYL 4Q9RL 5DFTA 4XCFL 1YDPA 4JPKL 4CVWA 3BZEA 1IC7H 3H9HA 5EOCH 5LGJB 3KWWB 4P2CG 4PG9B 1LP9F 3JVGC 3GKWH 4XH2B 1ZT4A 2XN9D 4L4VD 2IANB 1BIIB 1ZTXL 1J1OH 3L6FA 2X7LA 2XZZA 2ESVA 3MLUL 4J3TA 4UT7H 1T7YA 4NN5C 1JF5A 3WDHA 5D5MF 5GXBB 1JTTA 1Q38A 5E2UH 1FVDB 4G6KH 1R3KA 4JM2F 3SN6N 3HI5L 3OKMB 1OL0A 4AZ8A 3STBA 1NEZA 5GPRA 3HFMH 3NFPB 3QFJD 4FQIL 1Q1JL 4K71B 4AEEA 4PJ8C 1DSFH 3FQXB 3KWWA 4N9OB 2J88H 3LS4L 4Q7DA 4G42B 5EUOE 4WFED 2IANA 1BIIA 3I3BA 1J0JA 1N7MH 4P9HH 3O0RH 4JO4H 1Z0MA 5C0BE 3MRIA 3VGGA 4RRPA 1FVDA 4Y19D 2QSQA 3OKMA 4BQ9A 1AHWC 4QRSB 4NC0B 2DQDH 3NFPA 1QP1A 5L0QB 4QHNA 3D18A 4QRPE 3C08H 2Z8SA 1MF2L 4PJHA 3KGRA 5IB4A 4G42A 1IKFL 2ZCHH 1B6DA 5KSAA 3ARDC 3MJ8B 3MNVB 5DA0B 1C5DB 3VD4A 3MV8B 1NANH 3HLAA 1WK0A 2R0WL 4KJQD 1J0HA 4I3SL 3ULUC 3CVIL 5DJ6A 2DI9A 4RGMB 3B4NA 4XHQA 3FFDA 4NQXB 3BI9X 3FFCA 1ZLVK 1F97A 4HUNB 2D31B 1UCBH 3RUGF 4H8WC 4I18C 2PO6D 1GGIH 4I0PA 3QDJE 5TFSL 3EZ8A 1GGYA 4PBXA 4DFHA 2HFFA 1WFTA 3T08A 3MJ8A 4M6NL 2HJLB 1CXLA 3MV8A 3Q6FB 4ELMA 5I6XB 3X11B 5MP6H 4F9LC 2XWBB 4KVCL 3L3OB 4P3DA 2P49B 5FV1L 4NQXA 4PJCE 5L7XH 4G6JH 2AEPL 5B8CC 2D31A 4Q6YA 2Q3ZA 4NO0A 3WIHH 3ZDYE 2AJVL 2DLFL 3DX7B 3ZE1E 5DSCB 5IEHA 2VDRL 3OKDB 4HXBL 5E24E 4RGNC 2XN9B 5TE4L 4L4VB 1FRGH 5CIPB 2DWEA 4PRNA 1EJ6A 3CDFA 2P5ED 1V7NL 3OAUH 3T8XA 1DEEB 1QSED 1VADB 3Q6FA 4XNUL 5AYUL 3T0EE 3VXME 4TUKH 5ICYB 5AAWA 3V5DB 3X11A 2V2TB 1MCDA 3C5ZA 3IXAB 3QUMB 4PJ5B 4P2OD 1MIEL 4F37K 2VN4A 2XWBA 3PHQB 4OI7A 2J8HA 3QDMD 3CXHJ 2XT1B 3HC3H 2RFXB 5D4QA 4L1HA 1T5WB 2YD8A 1D5XA 1W0WA 3HNVL 5F3HB 1O0VA 3RI5K 3VMNA 5DJZA 4NQCD 5DSCA 1UWEH 1ROWA 3SGDI 3LQAH 3CXHK 2XN9A 4L4VA 4YIQB 4RWYH 5AZ2H 3AC0A 3RAJL 1HWGB 1I1AB 1UADC 1VADA 3P3YA 4F9PC 2DLEA 5ICYA 3V5DA 5LGHH 3C6LC 1NAMB 2DQGH 4GAGH 5TDOB 2V2TA 3QJFB 3VU2A 3IXAA 4PJBF 3QUMA 5C0FB 4O51B 5FYJL 3V4PH 4OKVA 1TETH 4EN3D 4OLYH 3EJZD 1P84J 2RFXA 4YC2C 1T5WA 1MLCB 2F58H 4CU8A 2F19L 1UKSA 3QFJA 4HIXH 5F3HA 3S88H 2R1WB 5K59F 3C8DA 2H45A 2EDDA 3SDDC 1XGQB 2OMBA 3FOLA 1NLDL 1VCAA 1HILB 4XCYB 3F7VB 4WVRA 1CLZL 4YIQA 2GITA 4EDWL 1W72A 1INEH 3T1FA 5INDA 2P1YA 3Q5TA 3CFJA 3L5JA 1KELL 2VNCA 3QUXC 5ITFB 5IHZB 2EDJA 3IDMB 4KHXH 1NAMA 5TDOA 3MCLH 1H15A 3QJFA 5DUBB 4YE4L 3MXWH 3UPAA 4O51A 1JZ6A 5EPMB 4WUUE 3GSRA 35C8L 4MS8D 1K9TA 4Y19A 3D69B 4Z7VB 5I18H 3PXHA 1G9NL 1A4KB 4GW5B 2PO6B 3G9AB 4K23H 3MLWL 1T3FB 4PJGA 1GZQB 1UENA 3S9DB 3VGFA 1HILA 4PV8B 3F7VA 1OTSD 3NOIA 3KPMB 5EIQA 2NY5L 4KI1A 4MZ2A 3GBML 2X4TA 4X6BB 2D0HA 5DUBA 1H0DA 1E28B 5EBGA 3W11D 4HUWB 5EPMA 2X1QA 1DQTA 4M1DH 1CDJA 4ELME 1GAFL 1FBIH 3I50L 3D69A 4A6YB 4D3CH 2BNQD 2CXKA 3IDXL 5GS0D 2YA2A 4ZUUB 4QNPF 1T1YB 2PO6A 3AS1A 3QISA 1OY3B 4M5YL 4NQSA 3RWEA 3CSPA 2V5MA 3AS3A 1T3FA 1GZQA 5E99H 1NFIB 3MV7B 1Q9OB 2OL3B 3WLBB 3QHZH 1P4BH 3C09C 4GKZB 1QSEB 3D85B 5IK3A 4NSKB 3KPMA 4YWGH 3R8QA 4JFZH 4OZHF 2B39A 4X6BA 4L9LC 5IEKB 1Y6KR 5GGTH 1E28A 3MUZ1 5I1HH 1IQWL 4L5FH 1FLRH 5CEYB 1DQQB 4Q9BA 2HRLA 2BNRE 5ALBH 1H3PL 2FBJL 5F7DB 4CGTA 5JQ6H 1T1YA 3WEXA 3OR7A 1IGIH 1TQBC 1QLRA 4KROB 3H3KA 2VUOA 5H94B 4AENB 4RBPK 4D0DB 1OAUH 3WLBA 2DQTL 1QEWA 2P5EA 4MJIE 1QSEA 2RBLA 1DL7H 4WIQA 3VGBA 4P2OA 4QHUB 3QDMA 1L4IA 4EN3B 1FZOA 5CEYA 3EYUH 1DQQA 3BEWB 3HAEG 4OLZH 1MCBA 1RIHH 5F7DA 7FABL 3T04D 1NFDE 4M7JH 5DHVH 1OD9A 2IH3A 1AR1C 1DVFC 2P42B 4NQCA 1IKNA 4F37F 4QXWA 2JJVA 4GG8B 4F2MA 3QHFH 4ZOBA 3OZ9L 3BIKA 5F7EH 2P8MB 5GZNC 5E5RB 2DQUH 5IIEA 2I26N 3VXRB 5IR1A 1IC7L 3RI5F 3KPPB 3NFNA 4KRLB 3TH2T 4G6AD 1MRCL 4NJ9H 4EN3A 1JNHB 3BKML 3ZKMC 1RZJH 1CDGA 3VWKC 3OKKB 1YNLH 2EYRB 2H6PB 1J1OL 1FCCA 1QQDA 2HVJA 4NO2B 3VWJB 5E70A 4EEEA 4UT7L 3TGXA 3O41B 5CKAA 4PIRF 4LKCB 4TVPD 5AUMA 3IT8D 5E2UL 5F1KC 1EFQA 3MLVH 4U3XA 3I3DA 3VRLE 1ZLVH 2P8MA 1C1EH 1QD0A 1YY9D 3TYGH 4LLAA 1HHGB 1JYVA 2ITCB 2C1OA 3T2PA 3DWTA 2EDYA 3CIQA 2J3SA 3UPRB 2J88L 5C0RH 3K8KA 4MNQE 3O4LD 1JNHA 2C7UB 5ALCH 1D9KB 3OKKA 2Y23A 1S78C 2EYRA 2H6PA 5AEAA 1N7ML 4P59H 3O0RL 1GCFA 1NBVH 2AEIT 4NUGH 3N0PB 5E8EB 4XC3H 4OFIA 1CFVH 5GSVB 2Y36H 3O41A 5DJDA 2NR6C 3AVEA 4LKCA 1N4XH 4JO2L 4H88L 2I24N 5M7QA 1AXTH 2DI7A 5J13B 1Z9SA 1HXYB 1FYTD 2OLDA 2DQDL 1LWRA 2ITCA 3MJ9L 1CL7I 3HE6B 1XGUB 2W60B 4HK0A 3BP6A 1YPZB 1DANU 2EEBA 2YUVA 3C08L 1QHOA 2NY2D 3SKMA 2AXFB 3IXTA 3TVMB 2BNQA 2YRZA 5F70A 2X05A 3IDNB 2D9CA 3NMEA 4KH2A 3LIZH 1QTYT 5E8EA 5F1IB 3LSOA 4NQEE 5ACMA 4ZFZB 3HI1A 5FYJE 1U95A 5FYKH 2VKXA 3QO0B 2VZTA 2YPLD 5C0CB 3MLYH 3SGDH 4XTRD 1R3HB 3C2SA 2PXYB 3RWDA 4U1HB 2W60A 4UAOC 5IVNA 4PLKD 3SKUD 2P5EE 4ODTH 2JJTC 3WE6B 5I71B 2M1KA 3ZZ1A 5LQBL 4YH6A 1AI1H 2Q8BH 4JANA 4UIKH 3IDNA 1CD0A 4KQ3H 3RKPA 5MP6L 1UA6H 2VL5A 1IC5H 4YDIH 2VZUA 2VH5H 4KDTC 5F1IA 1BVKB 4ZFZA 5I74B 1OAQH 1S7UB 4PRID 2M26A 4FQCH 3ABZA 5L7XL 4G6JL 1XF4B 5GGVY 4XP1L 3WIHL 1KC5L 4RMSA 3H9SD 4YNYB 4ERSH 4F8QA 1RQ5A 4I4WB 1VPOH 1BWMA 1XCTB 4D9LL 3KPNB 4HWZA 2YD5A 3WE6A 1FRGL 4AT6B 4FFZH 4LAJH 4PJDF 4K8RH 3OAUL 4MNGE 2X70B 4KVNH 4TUKL 1UYWL 1HIML 3WDIA 1CE6A 5DZNA 3ZE0E 1NGQH 3CC5B 1BVKA 3AU1B 1QBMH 4GKSB 4TSBH 5B3NA 1I9IL 3HC3L 5EUKA 4H20L 5GZOC 1U3ZA 2BVPB 1XF4A 2FIRT 4OZIF 3DVNB 4YNYA 5CGYD 4XXDA 4EUPH 4I4WA 3EFFB 2L7JA 1L9NA 1UWEL 4JRYD 3O4LB 2EXYD 1B6UA 4AT6A 1T2QL 5GS2H 4Y5VC 1YEKH 4UOJA 3L3HB 1B88A 1Y6MR 1A7BA 2X70A 1FPTH 2NW3B 3PGCB 2R1YB 3GHBH 2DQGL 4GAGL 3TBTA 3DLQR 1J1PH 1K8IA 2PN5A 3CC5A 1CT8B 3V4PL 5FO8B 3PJSB 1TETL 4N5ED 3DJ9A 4Q74A 5IBUG 5C71A 1JI1A 2Q20A 2BFVH 3WIFB 1FYTB 1DBBH 2F58L 1S7QB 5CZVL 1RUMH 4KXZI 2QQLL 4HIXL 5MERB 3S88L 3MLRH 2EZ0D 3U46B 2IEPA 2NY2B 5E6ZA 3O4LA 4HGWB 1ZA3B 1KIRB 2WBKA 2AEWA 1INEL 1T5XB 4U6XB 1A02N 5I1EH 5KS9F 2NW3A 3S4SB 1IGFH 3PGCA 2R1YA 2V6HA 5B3JF 4KHXL 3MCLL 2AGJH 2Z35B 4BFIB 3G5ZB 1QVOB 2AJSH 2VLRE 5CZXD 2R0LH 4WEBH 2V7HB 4WO4C 4JKMA 1JPGB 4P4KB 5E94A 1FYTA 4P5TD 5I18L 3V8OA 4OD1H 3FT3A 2ORBH 3PQYB 3U46A 1U8JB 5J89A 3BP5A 4HIJB 4X5XB 4HGWA 1ZA3A 4GW4B 3GSQA 1JN6A 1KIRA 5E2VH 4JQVA 1T5XA 1T1WA 4U6XA 1LGVA 5E08H 3K8LA 3ROOB 5GGQH 1U8KB 2Z35A 3C87A 1QVOA 2V7HA 5HDQH 4PRIB 4M1DL 1J12A 1IM3B 1A6VH 3D0LB 3GJFK 4KKAC 2BXZA 3HKFA 4PJIA 3L95A 1P2CB 3Q1SL 2JJSA 4MXVE 4JFFD 5C2BH 4Y2DD 3H9SB 4Z7WF 1S7RB 5F72S 5DWUL 1T89C 4HIJA 1JZ5A 4PS4L 5E99L 4GW4A 1P4BL 3O3DA 3D1MC 3VG9B 3WN5B 3DUUB 3ARZA 4YWGL 1N5AB 2UWEE 4QXGH 1CGUA 3ROOA 1A22B 2YPKB 1U8KA 5D8JH 1VA9A 3DO7A 1UXSB 4LRNL 1A7PH 1X6NA 5GGTL 4I48A 4TOYH 5I1HL 4TNVK 1FP5A 2BX5A 4P3WA 4PRIA 5C07D 2VDNL 3LQZB 3VJ6B 4R2GB 1IM3A 1KJMB 5ALBL 1P2CA 4LPYA 4HWEH 2ZOLB 1WCBB 5IBTH 5CINH 3H9SA 2QV2A 3DHMA 3BJLA 1FNGB 5I8EB 4Z7QE 5D70H 1S8DA 4RA0C 3K4ZA 4PRPD 2DQIH 1T20B 1IGYB 3WN5A 3DUUA 3IDJB 1WZMA 1VGKB 4JKPH 3DV4B 1ORQA 4FXLA 2YPKA 3QXDB 1CTOA 4X7CC 4NZJA 1BQUA 2V5RA 3VMPA 4OAWB 3BXNB 3LQZA 3VJ6A 1S3KL 1KJMA 3MLTA 5IKCA 5BZDA 2XPGA 1WCBA 4NHUA 2B5IB 4XNXH 4M7JL 2ENSA 5E2JA 1HYSC 3HS0B 4PLNC 1FNGA 2V2WA 4JRYA 1CL7H 4OCMC 4ODSH 4P2RB 5EC2B 3GSXB 5KW9L 5T5FH 2YXMA 3GO1H 5KVFH 1VFUA 5F7EL 1FDLH 1GSMA 3IDJA 2KDGA 3WXVH 3FONB 2DQUL 3PHOA 4XMLL 2WNGA 1II4E 4GRWB 2GAZA 5FGCE 4Y7MA 5C0GA 4C4KO 4NJ9L 2VTFA 3OAYK 1LP9E 3BXNA 1FL5B 1G9ML 4P5TB 4R96B 4MSWA 1BWWA 2W0KA 4G8FA 4M43H 4WNQB 1U8HB 1HZHH 1I1CA 3U4EB 5D5ME 2VQ1B 3ARTA 5CMAA 1V7MH 2ADFH 3RVWC 4NRZA 3GSXA 4Q6IA 1OARL 4LLMA 4WTZA 1NUFA 4NZTH 1CFBA 1ZHLB 3WL9A 2HYMA 3TYGL 4P5MB 2YZ8A 2XOTA 5INCA 4AK1A 1S7VB 4MVBD 1LO0H 3QRFM 1D5IH 3MODH 5T1DH 5C0RL 5ALCL 1HHIB 2WBJC 3VXPB 1KFAL 4MCYB 4C56E 4BZ1H 4P5TA 4R96A 2ILLA 1CXHA 3C5JB 3EKCA 4P59L 4YK4B 4M8QA 1NBVL 4NUGL 2YPLE 3VXUD 1F13A 4WNQA 4BH8A 3QWQB 1CFVL 4PLOB 3FQWB 1F4YH 2Y36L 4DWHA 1N4XL 2DYPD 1AXTL 4JRWA 5JDJA 3HE7C 2IQ9H 1RIUL 2NY3D 1OTUC 5KVEL 1BD2B 5EORH 2KQMA 3G08B 1ZHLA 2DM3A 3EBAA 5AG8A 4P5MA 1OTTC 1A1NB 5A43C 4HUKB 1IEHA 2WLZA 4KK5C 4TNWK 2GCYB 3SE4A 4RMRA 3FB8A 1HHIA 4HEPG 3VXPA 1UACL 2WQRA 4GXUM 1MWAB 3C5JA 4JFFA 4JDZA 4IHOA 4Y2DA 5E2WL 4WI8A 4JG1L 1T2JA 3MC0A 1IAII 2JB5H 4M62L 1J0KA 2L7UA 3FQWA 3GMLA 5FYKL 3U79A 5DHVA 3MLYL 1AC0A 3KPSE 1BD2A 3RUGE 5B22A 4OGAC 1F00I 1P69B 3S36X 4LDEB 5JXED 4I5BB 1QFPA 2YHGA 4BSWB 5C07A 2XTJD 5JXAH 5D1QD 5JIHA 3SDYH 5ICZB 1AI1L 2Q8BL 1JPTL 4ZFGH 1UKTA 1MWAA 2Y4SA 4UIKL 4KQ3L 2PNDA 2VMFA 4HJGB 3TH3T 3K46A 3BPNB 4OFKA 1G7HA 1IC5L 1MFAH 1ZWIA 3ARRA 1PJ9A 2VH5L 4KXZH 5IROC 4LQ1A 1CFNA 3A67H 4PRPA 1DEDA 4TNVF 1GZPB 4KKBC 1HOCB 5F9JB 1OAQL 4QXTB 4FQCL 1HSBA 1P53A 2YBRB 5E8NB 1KPRA 1JL8A 1EA9C 3BMVA 1XAUA 3A0OA 4JRYE 3LEVH 2Y9RT 2J8OA 4WJ5B 4ERSL 4JFEB 1XZ0B 1T2XA 4YFLF 3VXTB 1VPOL 1K4CB 4BSWA 1S9WA 4K94L 2BVOA 5ICZA 1IZJA 4K8RL 5ISZD 3DTXA 4KVNL 1AQDA 4ZXBC 4OM1H 4HJGA 1EHXA 3OJMB 4PRHB 3AM8A 4H0HB 5DJ0B 4K7PL 1MVFA 2O61A 3U7WL 3BP7B 1QBML 5T1MB 1A0QH 4TSBL 1HOCA 1CIUA 4QXTA 5DMKB 2YBRA 1IQDB 1UB5B 5JTWA 1Z5LA 1I8LC 2NX5E 3DMMC 2R9HD 4UU9B 4WJ5A 2FH8A 4K7FB 1RJZB 4JFEA 4NN6C 1K4CA 2SEBB 5EB9A 1IFHH 4R9HA 1YEKL 1UFUA 4IIQC 1T0NB 2H2SC 4XZUB 1KB5L 3VXUB 3GHBL 4PRHA 4PJBE 5DJ0A 1LDSA 2H1PH 1DBJL 3BP7A 4JO3H 2NY3B 4GT7A 3GJFH 4OLVH 4UOW1 4XPGL 5DMKA 1U93B 2IG2H 1DBBL 1IQDA 1UB5A 3WNLA 2ITDA 4FFYH 1UM6H 1R3JA 4O5LL 4YBHA 2DJSA 4UU9A 5FGBC 5K59E 4MJ5B 3H9YA 5ID0B 2SEBA 1EERB 2Q8AL 2OJEB 4WFFD 4JPWH 2L4OA 3RY6A 1T0NA 3DVGB 5I1EL 3GMMB 4XZUA 3EZJB 3VXUA 4XVJH 2AGJL 1P4LB 4JB9L 2FECL 3U4BL 4WEBL 2HAZA 5E2TH 5HVHB 1KTLA 2DYPA 1U8MA 4N8VB 4I3RH 4IRJD 1MCHA 5KOMC 2YSSB 1CLYH 4NC2B 3FAXA 4F58H 4M1CC 1N6UA 2QHLA 4G9DA 5DF0A 5BZWA 2XTJB 4G43B 5D1QB 1KCUH 2X5PA 5ID0A 1EGJL 1FH5H 4DK3A 4I9WE 5C92A 2OJEA 5E2VL 1B4JL 3O45A 1I8MB 1NUGA 5E08L 5GGQL 3GMMA 4L9DA 3TM6A 4JQIH 2NYYD 4R26H 5TE6L 3NCCB 1P4LA 2Z0BA 4Z77A 1PG7L 4HJ0D 3CFKB 4TNWF 5HDQL 1WV7T 4N8VA 3HI6H 1A6VL 2GK2A 1MH5B 1BM3H 3D3VD 3BDXA 2HFGH 4LLUA 2HFEB 2YSSA 3V6OA 5C2BL 4QNPE 4PRPE 4NN7B 5JXEA 5E56A 3UBXG 4MMXC 3MYJB 2ZJSH 4P0DA 4G43A 5D1QA 5I1LA 4DKEH 2YRPA 4KUCD 5ISZB 1N8ZA 2FX8L 4HUUB 3SDAD 5D8JL 5EN2A 5BS0D 1K4DA 3BPLC 2EC8A 4TOYL 5FDWB 3OAYH 4JHWH 1AXSA 2BSTA 4UI2A 1MH5A 3FT2B 5JW4N 3VA2C 1W8NA 2MJWA 2XA8H 1FC1A 1SBSH 1ZHKA 5E1AB 2E8ZA 3CCHB 1T4KA 5SWQA 1X9QA 4I8DA 4JGJA 3KS0J 4M7ZB 1NBZA 3RBGA 5I2IB 1YEHH 3T0EB 3GI9H 3LEYL 4G3YH 1EAJA 5CEZD 3I2CL 5ISZA 3L5XL 3O2DL 3OKOB 4URTB 4HUUA 5KSAC 1LO4L 1XR9B 4LCWD 5IWLA 2NY1D 2AJ3A 3BPCA 4U0RB 3RKDD 3QQ4B 4JZOA 4GG6F 1DANT 4NQVB 2KBGA 3KG5A 3JTTB 5DD5H 3G6AB 3V2AR 5J6HA 4E5XA 3FT2A 3HB3C 3QXWA 3ARBD 2X9XA 3HC4H 5AZEH 5I73B 4HG4K 3CCHA 4WWKB 4MXQD 1CL7L 4H5SB 4MB3A 3EGSB 3X13B 4J6RH 5I2IA 4I0PC 5FYKE 3ZKNC 5KVFL 3C60D 1QYGL 2R1XA 5C6TH 1WWAX 3RP1A 4BQ6A 1U8OA 1OP3K 1ZKAA 2HP4A 4FQQB 5DI8B 4NQVA 3VFSB 2DQFB 1IAIH 3JTTA 3G6AA 4RGMC 2WV3A 4ORGB 3N9GH 4QWWC 3FO0H 3GMRB 2BRRL 4HIIB 1R24A 4EQ3A 1V7ML 1SVCP 4X6EB 1MFEL 3Q2CA 1D6VH 4UNTA 2EO1A 4MQTB 3D87B 4NZTL 2HVKA 4OQTL 4EXPX 1JHTB 2VUYA 1LO0L 2D3VA 5DI8A 1FNEA 3MODL 2H2PD 4IMKA 5T1DL 5I6XC 3VFSA 2DQFA 4IRJA 2CDFA 2F74B 3C5ZC 5J4MA 4BZ1L 2KL6A 3D3VB 4UQ3A 2VDOH 5DEGA 1ADQA 1G1CA 4S1RL 2C26A 3MNZB 3MV11 4NCC2 3SCMB 3LD8B 2D4DA 4ORGA 2WP3O 3TBWB 1GOFA 3F7YB 4HIIA 1F4YL 1S5HA 3GSWB 5JW3H 2JIXB 5KANG 3LPGA 5BO1H 2IQ9L 3TNNB 5ADPL 3UTSD 1JRHI 5EORL 4XMPL 5DUMH 1TQCB 4LSQH 4LBEA 4L8CB 1TVDA 4FOMA 5H8DA 1SQ2N 1WFOA 1EXUA 2F74A 2C9AA 3STZA 3D3VA 3T0XA 1EHNA 1OCWH 3MNZA 5D6CB 2A77H 5HYJE 5D7KD 3P40A 3F7YA 4HCRH 4MX7B 4IRZH 3GSWA 5I8OH 2BHUA 2ADGB 5SV3A 4EI6B 1RU9H 2CD0A 4J23A 3TNNA 4C83A 4Y16B 5E8DH 3G6DH 2FL5B 4WDIA 1C12B 4LCWB 3SDAA 1NMBH 2VITB 2XXMB 3ZT6A 2NY1B 5BS0A 4DEPB 2ZWLT 2NCMA 5CD3B 1C16B 5DYOA 3WNOA 3DI3B 3ULVD 4KTEH 4I77L 5DMIH 4RWHA 4RDQF 5JXAL 1JK8A 2W9EH 4ZFGL 5I75B 3ARBB 3PUCA 2PW1B 1I7UA 5ESQA 1RJCA 3L3KB 1MFAL 4CU7A 4MX7A 1MHCB 1HXMB 3CFCL 3TT1H 2J5LB 4UOW0 5AWNH 2MHAA 3C60B 4Y16A 4NYLB 1JFQH 3NAAL 3KXFE 2XZAH 3HA0A 4LCWA 2VITA 3B6SB 3VI4E 5CD3A 1C16A 1MJ7L 1JPSH 5L2JA 1UVQB 3P9MA 4NP4H 2VZSA 5FM5O 1KIQB 3UCRA 3UXFA 3ZKQD 1EO8H 3AROA 4S1DC 4J3SA 4PJDE 3ARBA 3CX2A 4BELD 3I85A 1ZK9A 2EDHA 2VQUA 3GSVB 4GAYA 1NPUA 3FB5B 3BKJH 3KPQB 1KBGH 1MHCA 2A6IB 1EUUA 2PO6C 1A0QL 1NCBL 3ARPA 4BSVB 3C60A 1KN2H 3F7RA 4NYLA 3H0TB 4OFYD 4OZIE 4PGZA 1JJUA 3D5OF 4X0KB 3V52L 5FAAA 4X83A 3CVHH 3B6SA 5E9DD 4KDVA 4YGVB 4F80A 3U36B 3ULUF 4F33B 3U30B 3FO2A 1MFBH 2MWCA 1KIQA 4L3EE 2GTZB 5IMLB 4OUUB 3R06A 1XIWD 5IV2A 3RZCD 3OJDA 5IB3A 4YDVB 1J1XH 1QNZH 5DGRA 3CFIC 4HIEB 3FB5A 3KPQA 3KLAB 4MB5A 1QR1B 3QIBB 4HF5L 2A6IA 2Q1EA 4OCSL 4OLVL 2DM2A 5DHYB 3FB6B 4BSVA 3OSKA 2IG2L 3X14A 3U1SL 1M7DB 3VFVB 2LQRA 1J0IA 2GY5A 1B90A 4X0KA 1UM6L 3RVUD 5C0JB 2NY0D 3BISA 3LV3B 1ZVYA 4H0IA 4DCQB 1FVEB 4QHKJ 4F33A 4P2OC 2YUWA 4G80B 2GTZA 4JPWL 2AAVA 2LE9A 4OUUA 4WU5A 4WHTB 3V4VL 5KS9E 3O2WL 1F8TL 2ZNWA 4XVJL 2JF1A 4OV5A 4XBGB 3P77B 5E2TL 1QR1A 3TO2B 1IGJA 3UTQB 3N1GC 4KJPC 3UTSA 4KROC 3M8OH 9CGTA 1VDGA 1IKNC 3FB6A 3JBG7 2JELH 4Y0GA 1M7DA 3VFVA 1CLYL 1M1SA 1Z3GH 2GQHA 4IDLA 4F58L 4QRTB 3MRBB 4Y8AA 1G9EA 1EEZB 3GK8H 3LV3A 5C0AD 4BA8A 1N0XH 2B4CC 2EIZB 1NCNA 1FNFA 1KCUL 5EZOH 1FH5L 1FN4B 5BS0E 1DE4B 3MBEB 4G80A 5ACLA 3U48A 1IAKB 1RHFA 4HMCA 4EN3C 3EJZC 4WHTA 3GSNL 3E6FA 3KYNB 4KJYB 4JQIL 4PTUB 3O2VH 4R26L 1JNJA 2W59A 3QZWA 3BH9A 3TO2A 5JR1H 3B3IB 3UTQA 5EOQL 3HI6L 3VFMA 5MI0B 2HFGL 4LFHG 5IMKB 4M4RA 4HMEA 4FXKB 3AY4A 4QRTA 3MRBA 3TFKD 1MJJB 3ULUH 4ODVH 4M48L 5DQDH 5F8QC 1FN4A 1DE4A 1IAKA 3MROB 4MS8C 1NAKH 1A9BA 2GFBA 3KYNA 5H35B 4H8WH 1OP3H 5IM7A 5FCUH 3RA7L 4G9FD 3VWJC 1NC2D 3B3IA 4OBRA 4JHWL 4JY6A 1JGEB 3SGKA 3MUJA 1UQSA 1A8JH 5CGMA 5LBSH 1CICB 4L8BB 5IMKA 4ZUSA 1OTSC 5FK9B 2OK0H 5E9DB 3SE8H 1BF2A 4FXKA 3ZTNL 3DXAD 3N1MC 4UV4H 3LDBB 1INDH 5C9KA 4MNGB 1E0OB 4ZSOA 1YEHL 2GK0B 3GI9L 4G3YL 4W6WB 1KN4L 3MROA 1XIWB 1RVFH 3RZCB 5IQ7H 2WUBL 4PY7B 5DUPL 5K33A 5GS0C 2J4WH 5EU6B 1WIUA 3FN9A 3I6LE 1NQBA 4X9HA 5DD5L 3UZVB 4OF3A 1BVLA 3MLSH 1JGEA 3D0VB 3PWPE 5T3XD 1HDMB 4OFYA 1LK3H 3NVQA 5TE7L 5J13C 1JRHH 5F7NC 4L8BA 3IVKA 5AZEL 3AMLA 2W9LA 5FK9A 5E9DA 4P3CH 4M00A 4J3UA 1DLFH 1OGAB 3KPOA 4J6RL 1W0YT 3HE6C 1KXTB 4L8DB 5IB2B 4WGWB 1Y0LB 1C08B 1P7HL 1XIWA 5C6TL 4OGZA 3RZCA 1P1ZA 4D8PB 4PY7A 1ZEAH 4M6ML 1TCRB 3MFGB 5EU6A 4GLRI 3N85L 5JOPE 4NCDA 1IAIL 1U8NB 3O4OB 3B43A 5IVOA 5ID1B 1HDMA 3BPOC 3UDWA 3MRQB 3N9GL 2HT4C 2WMPA 5C0AB 5IFHH 3KLDA 4P23D 5EFIA 4L8DA 5IB2A 1HQ4B 3RPIA 1Y0LA 2LTQB 2R2BB 4HKZA 4JFQB 2VLRB 5I71C 3FKUS 5DJ8B 5HHPB 5CD5D 1TCMA 4D8PA 1B0WA 1URLA 3RDTD 2DF3A 2C3GA 4ELKA 1MJUH 5EU3A 1TCRA 3FRUA 3M45A 4KC3B 5C0DA 4X6DB 4XMKH 2NZIA 4WHYH 2VDOL 5ID1A 5I74C 1QRNB 4PJ7F 3L7EA 6FABH 3MRQA 4J8RA 4JO1H 4CVZA 4PGBB 4NBYB 2CJUH 5C0AA 4OLUH 1EJOH 5BW7A 5BO1L 2LV4A 4XP6H 1A1OA 2GSIB 1HQ4A 4G6AC 5D7IE 1MPAH 2R2BA 5DUML 4LSQL 4JFYB 5DJ8A 4XNMB 4OI8A 4XPAL 5DRWA 3K0WA 4G9FB 2X40A 4CRPA 3PWUB 4O2CA 4PUBH 4U6TA 4X6DA 3VFUA 4XAKD 4M7LH 4OCWL 3V4UH 4BQBA 4GMSH 2OTUB 2D03H 2D7QA 4IRZL 1VEOA 3SBWA 5IW6A 1RU9L 4KPHH 1XGTB 2GSIA 4AIZB 3AS2A 3G6DL 4NOBA 1ZOXA 2Y6SD 4A2MA 4XNMA 2YKLH 1OAXH 1PDKA 3T65A 5GIRB 4G9FA 1MJ8L 4KTEL 1NC2A 2F15A 3LKPA 3RWCA 4WY7H 5CJ8A 5D7SH 3G6JA 1T7ZA 5SWZD 2W0LA 3GMOB 1FNSH 1NGYA 2B7DT 2NW2A 2OTUA 1FZJB 2Q3AA 4NNPH 3DXAA 2VDLH 1NBQA 3QNYB 3V5HB 1HH9B 3ALXA 5AWNL 2ZKHL 4RAVA 1XGTA 2PTTA 4AIZA 2NY2C 2IBZX 1H3UA 1JFQL 1CK0L 1PY9A 2WWKO 4JQVC 4UUJB 4GKNB 3J7HA 1CD8A 4S10A 1CDCA 2X1PA 3P0YH 5GIRA 1YMMD 1JPSL 5FECB 4NP4L 4YHPB 1EO5A 2Z91A 1EO8L 1WVZA 1MSPA 4UBDD 5IMMB 2I9TB