4EN3A

Crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
186
Chain Sequence
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATYDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSVCLFTDFDSQTNVSQSKDVYITDKCVLDMRMDFKSNSAVAWSNKSDACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The Molecular Basis for Recognition of CD1d/alpha-Galactosylceramide by a Human Non-Valpha24 T Cell Receptor Struct. Title
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 186
sequence length 194
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3A02
5ID0B 1IT9H 3QUYC 4Y16B 5HDOA 2HFEA 3GMOA 2E6JA 5E7FA 1GC1L 3EHBC 1HH9B 5EIQA 1VB9A 3TPUA 3WD5H 1N59A 1YEJL 2EIDA 2X4RB 4FHBD 1AQKL 1AGEB 5DD6B 1QYGH 3GSNB 5HHOD 1NL0L 2EDRA 3F5WB 4IMLB 2GK0B 2XKNA 2XXCB 3OX8A 3ZYZA 3ULUF 5DI8B 4KGLA 5L2KB 1JPFB 1IBGL 2QADC 1BIIA 2MMXA 3H7LA 2X89A 1F3DJ 1TJHL 1UJ3B 4UV4L 4HV8A 3OJDA 2AJXL 4N9GA 2GAZB 1JF6A 2VO5A 2E7LA 4R2GC 1N4XL 5FDWB 3BD5A 3PQYB 4JZJC 4PLOB 3MV7B 3GSXB 4HUVA 1ADQH 1YUHA 4HGMA 1ADQA 2QKIA 4LIQE 4H8WC 5I74B 2GITA 4FABH 1QRNA 4B50A 1C12B 2XZQH 4CMMB 4X6DB 3QDMD 2OR7A 1OAYH 3QDGB 1F42A 3MRPB 5DDHA 3CSBA 2VKWA 4CRPA 1LHZA 3H9HA 4NN6C 1IEBA 2UZXB 1MFBH 5D7IA 4U3HA 4Q9QL 4N5ED 4U0RC 2HFGH 1FGVL 5D7SH 4PJFE 1DVFA 2CDGB 2RFXB 3GJFB 1JYNA 3ARYA 4UT7L 1CE1H 5ITBL 3FQNB 2P4AB 3V6OC 1HKLH 3VI3F 5DURD 1ZS8B 4P4RB 4XNQB 2OI9B 2VLKD 1M7XA 3BKYL 3C60D 3MV9D 5BZWA 4N1HB 2YA2A 4XVJL 2WIMA 1CLYL 3QIWC 1MCWW 4OBRA 5MP6H 4TYUA 3DETC 4OCNC 4S1QH 3G5YA 4U2YA 1YEHH 1HINH 1AHWA 4K3JH 3VFUA 2R1YA 4I0PB 1LK3L 2E27L 3U9PH 2CSPA 2DLFH 4JFDA 4ZODA 1JNLH 3MRCA 1H0DB 3ARBD 4J12A 2DQIL 3K8KA 2FSEB 2V5TA 3BW9A 1RZKC 1WZLA 5DFTA 4PRHE 5KAQF 3GIZL 4LSUH 3FQTA 5GSRA 1JHLL 2I27N 4KTDH 5F96L 2ADIA 4N0CC 1JNNH 1VADA 4URTB 1BD2A 3W39A 4LGPB 1G9MC 2IQAA 1P53A 4YO0A 1IZJA 2D7MA 5EU6E 2NY1B 1T22A 3IDMA 3LEYL 1R3KB 2B7DT 3RWEA 4JFFA 4L5FH 3F65A 1HIML 5DTFA 32C2B 4RX4A 1GZQB 1QBLH 1PX3A 5EG6C 3T0ED 5KZCD 1BM3H 2ESVD 2Q1EA 1RIVL 1P4LA 1I3VA 4NO2B 4RMUA 4JO1H 1LK2A 1VSCA 3BQUC 1JHKH 3LQAC 4ZPTA 3SDDC 1YEEH 2P8MA 4ODUA 3PHOB 2XTJB 1C8PA 3OPZH 4Q9RH 5IHBA 4LLYA 4G6AD 3KLHC 3P0YH 4P2RB 1AXTH 4X9FA 5I15L 2VB5A 2X42A 3OJMB 2BY0A 1FL3A 4RQQB 1I8IA 3U7AA 3QP3A 3Q6GH 4LKCB 3LKQA 2PYEA 1A14H 3L95A 3RWFB 4HPYH 4IRSC 3X11B 2IBZX 3IDIA 5E6ID 3MTRA 1HI6B 4RMTA 3WXVL 1LO4H 2BZDA 4H26B 2BVEA 5CINL 1LE5B 1IFHL 1R5WB 2HJLB 3GBMH 1U3HC 3S37L 5JR1H 3QQ9C 3VW3H 5KVGH 3HR5A 3Q48A 4EVNA 3CAFA 3TO4D 2WWKO 3WSQL 1ZHKA 3EOYG 4X4YA 4PP2A 3PDDA 4MJ5A 3RQ3A 2Y7QB 3FTGB 3FB7A 3E1F1 3OXSB 4ONGH 3U4EA 3MLUL 1BQHG 3PP3H 5A2JH 2BRRH 1DLFH 1G7LB 3LN9A 4JKWA 4KVNH 4OIBA 1II4E 3B83A 3KYAA 4NC1C 3WUZA 1EEZA 2F53B 3CIQA 4ZUWA 3U46A 4TPRL 3BRGC 1A0QL 1LP9E 1DP0A 1VFOA 1H5BA 2AK4B 2FJFB 2VE6A 1IC5L 4PJCA 5IB5A 3J7HA 4UQ3B 5C0CE 5CHNA 3FQXB 1U9KA 3P0VH 3PHQA 4XGZA 5CLTA 4ZDHB 5DUML 3TBYB 1F8TL 2FD6L 2ARWA 2XXMB 4MQXD 4KRPC 1V7ML 4WUUB 3LY6A 4QHKJ 2CKBH 1YQVH 2JJVA 4L8SA 2WAHA 2BCKB 4FG6D 5HGHA 1UZ8B 2R9HD 1K2DA 3LEVL 2BVTA 3ARED 5EIIA 3FO2B 4HWEL 1B4JH 2QADB 3GSVA 3O3EA 2IPUG 3GUTB 3MJ9L 5EU3B 4GQPH 1HXYA 2UWEB 4WHTB 5CILL 3T09A 4DVRH 4JFXA 1IKNA 3CH1B 2WLYA 2BOBB 4R2GB 4J23A 4U2ZA 2NNAB 3LV3A 4FXGA 4ODVL 4JZJB 1ZGLA 5DA0B 4OJFL 5EUKB 5EUOB 4Z8FL 3IF1A 1FFOB 4F7EA 4NJAL 1CD1B 5CJOL 2FLRT 4Z7NF 2AJZA 2GJZB 4NPYA 1KPUB 4E41B 1JUFA 2EICA 2GFBB 5ID1B 1OAUL 5F7KC 3L5XH 4PG2C 1A5FL 2ED7A 4P5KB 5GGVL 1D5XB 2VLJB 3WHXA 1ACYH 4NGHH 1HCFX 4QRPD 5KN5A 3UAJD 5I1KH 1EJ6A 3QDHA 5DJ0B 4FFYL 2YUWA 1A22B 3SEPA 4NN6B 3NCJH 3V52H 3NACL 1IEHA 4YEEA 3SOBH 1JFQH 1KIUA 5L2KE 2FHBA 1GC1C 3S4SG 2DMKA 4IRJD 2GJ6E 3K8LA 5MERB 3RVWC 3D6GA 4IIQC 4PRBA 5T3ZD 1A8JH 4KROD 4NHCH 1IC7H 2Z9TA 4GW4A 3PQYE 4M6ML 2XN9D 4XPFL 2Q8BL 4YBQD 4DW2L 1JN6A 1AXSB 3E8UH 5D6CB 3MA9H 4QT5A 3V4VL 3B9VA 1YYLL 2R29L 5EULV 4O5LH 1MRFL 4X4ZA 5TFSL 1G7JA 1U36A 2DQHH 4WCYH 5BQ7B 1KIRA 1QFWL 1Q9OA 4JFZH 2CLZB 3PGFH 4HMCA 1HHKA 4QYOA 4YC2C 1ZHNA 1I1AD 2EIZB 4LPTA 5DS8A 4PIRF 2VN7A 1E4XI 1YJDH 4PTTA 1G84A 3RWCB 2LTQC 3CDFA 4JPVH 4MJIE 1CCZA 2NY3C 1BJ8A 5CGYD 3HFMH 4X6FB 4NQXA 1OGTB 4I18C 3TNMA 3KPOB 4R3SA 5JPMA 3GO1L 3FJTA 3RWJB 1I4FB 5AWNH 1NGQL 2PO6D 3ULUE 3DXAB 5FEBA 2FX8L 2A6DA 2NY7L 4HJ0D 4Z7VF 1S7VA 3N0PB 5C07A 1AD0A 1EEYB 3BQUB 4J7RA 4XVSH 3SDDB 4JAMB 3Q3GA 4PJ5D 5L8KB 1A6VH 4ODSL 1G6RA 3PJSA 3RKDD 3B9KD 5I8EA 1MFAL 5DQ9A 3QEUA 1A3RH 1SEBA 4M4PA 2E5EA 5AYUH 5C6WH 1I8MA 4PD4J 4Y5YA 4NNPL 3LEXA 5HXMA 2RAMA 3S3PA 3L6FB 1G1YA 5IVXF 3OKEA 5IWLA 5DD0L 3ROOA 3RKPA 5FK9B 2Q86A 1CGYA 4P59L 5MENB 4PJ9B 4W68A 4ZFZB 3ARDA 4BSJA 4QHUA 1MCCA 4XP1L 3V5DA 1RURL 1N6QH 5FCSH 4P0DA 4GRWF 5D1QA 2Z31A 2F5AL 4NRZA 2EC9U 4R6UA 1YPZF 1IKFH 4S1RL 4BKLA 2A83A 1KLUA 1UVQA 3HA0A 2K9UA 5JXEC 1UYWL 3DX8B 2AJSH 4X5WB 1CDJA 2ITCA 4YDLC 5TQ2H 1EHLH 5L6YH 4M03A 4AJ0A 2OK0L 5FF6A 1MIEH 4MMXC 2VR5A 1VFMA 3VI3E 1FQ9C 1JGLL 5D6DC 5EOTA 5DC4B 1S7QB 5TGBA 2XTJE 4FQCL 5E9DD 4PB0H 5LVEA 3KYMA 3CPLB 4O2CA 1HEZB 4R4NC 4U1KA 1OGAE 1TPXC 2R4RL 3HE7C 2PW1B 1NGZA 4N8VA 4R9HA 2I5YL 5I1CL 4O00A 2EYRB 3U1SH 4LLDB 2UUDH 1MRCH 3H9SA 4P5TC 2AI0L 2DLGA 4Y2DD 5HHME 1JTTA 2RB8A 2VH5L 3MUHL 5T1DH 3SDCC 4AK1A 2R1XB 3MRIA 1PGRB 4G8GA 1JP5A 1EGJH 5SX5H 4YQXL 3OMZA 1OQOA 1EGJA 2CK2A 3MXWL 4UU9B 5FA4A 4NWTH 5IMLB 1K4CB 4CAGA 3MOQA 4MAUL 3RDTA 3GMMA 4Z7WA 4GRWB 4R4FH 4KZEH 1YPZB 2A2QT 1EFXB 3MLYH 3SQOH 1KEGL 1KJ2B 4M6OL 2Z8RA 4OF5A 1JWUB 3OB0H 1I7RB 4MCZA 4NZRL 2QSQA 5DSCB 2F53E 4LHUD 1S7TA 3QCVH 4JLRB 4F3FA 5C6PB 2X10A 4OD2A 2OJZH 4DZBB 4LCUB 4EEEA 3VXME 3T1WA 4FFVC 1ZLSH 1CG9A 2EH7L 3I6KB 1OSPH 2W65A 1ZXQA 1PY4A 4WUUE 3DX6A 5T5NG 1CYGA 3RA7H 3UCRA 1U8MB 3EOAB 4DFHA 4ELKA 5GGVY 2EEDA 2ZPKL 2OJEA 1V7NH 4IOFC 5F7UA 3VH8A 2I9TB 4WENB 3QJFA 4XP4L 4DQOH 4ALAH 4Z6AT 2JLLA 4JPWL 4IIQB 1DQLH 3ULSB 1ZT1B 2O26U 3WUWB 2RCSL 1YNTA 2XACC 2Z4QB 3S34H 3BAEL 1A6TA 4O9HL 1S9KC 2PW2B 3GM0A 3FO9B 3NZHH 1IAIM 2YS4A 4MZ2A 3W2DL 1X5XA 2AW2A 2H26B 4LLVB 3P9LB 3SE9H 3GNML 1HXMA 5I0DA 3VGBA 3V0VA 5EOCJ 3MJ8A 4E41E 3CDYA 1W72L 5DT1H 4JJ5B 3VWKC 1FNAA 5I73C 2YMXL 5EBWB 1S3KL 5ALBH 2MOVA 4NP4L 5JW4M 4NO0B 4KJYA 1AGCB 2OR9L 4YC2B 5F9OL 4JRXA 5ETUA 4I5BB 2DF3A 1N5YH 2VN4A 3A67L 2LTQB 2I24N 4YUEH 4FQXB 4JFQA 2ATKA 3EAKA 1J0HA 2EZ0D 1QEWB 1GGIL 3QXTA 4AQ1B 2H1PH 3TJEL 4D9LH 1EZVY 3V6OE 4Y19D 1NBVL 3I85A 3JVGA 5F7DB 3IVKB 9CGTA 5TDNA 4ACPA 1D9KD 4YX2H 3SDYL 2NR6C 5F1KC 5C08B 2B1HH 2B2XH 3EOTH 4P46A 3D18B 2I60L 1CBVH 1AGDB 2OQJB 3FMGL 2B8OT 4NO3A 1WTLA 1T6VN 5JIKA 1FZMA 2HMID 2B4CL 4LLQA 2D03H 3DRTA 4HJGA 4NDMB 1WBYB 5FO7B 4FXKA 3AROA 3TJHC 1ZEAL 1EBAA 2WMPA 1VGEH 2NY2B 1TZIB 5FHBH 1GZPB 5IFJB 4JDTL 2X6MA 4PPTA 4Z7NE 2HTLC 3B4NA 2F54B 3IRPX 1MY7A 3MRGB 4P2OD 4UTBL 2IH1B 3WIFB 1QFUH 5BO1H 5I66B 4JANA 4O02H 4O2FA 3IXAB 3NCYP 5LQBH 2JCCA 1Z9OA 4J2XA 3PWPA 3EYSH 3U4BL 3MV8D 3QZWG 4CADB 4GMSH 5C7XH 3TH3T 1UM5H 1GSMA 4UQ2B 5GGTA 3VFMA 3IRZA 3J8F7 2BOCA 3LQZA 3DXAE 4G7VL 4LCWD 2P8LB 3TT1H 2IH3B 4IJ3B 3G04B 4PLNC 5DWUH 1FN4B 2AJ3A 3M8OH 3NA9L 3QWQB 1CI5A 1A2YB 4PJEA 1K85A 2VL4A 5E7BA 1Q9LB 1RZGB 1XGTB 4QF1B 4BYHA 3MNVB 3RWDB 1DN0B 3GSRB 1A6ZA 1FG9C 3G9AB 4RMRA 5CBAA 2E8ZA 5GGRA 3IXTA 3HE7B 5DQJA 2GK2A 4NQVA 3H3PL 3RGVC 3HZMA 2FO4B 3KPSA 4Y5VB 3HZKA 2BSSB 3KVQA 5L0QC 1NC4D 2W0FB 5HHQA 4OKVA 4UNUA 4KK9D 4P5TB 4LSTL 5IK3A 1GOHA 5FM8A 5D71L 3OXRB 5MENE 1YEDA 1ZVYA 3I6LD 1ED3A 3SDCB 1ZTXH 4MA1B 1HHJA 4JHAL 5FOBB 3ARUA 3EJZD 1MH5B 1I9JH 5HI4D 2BNQA 5IJKA 4XNZC 2Q76B 2NX5B 3RX8A 4ZO7A 3NFPA 3JSSA 1DVFC 1MRDL 3QSKB 4PJDA 4MNGB 4OTXL 1P7KB 1F00I 1RD6A 3G6DH 4U7MA 1E6OH 4L3ED 4BQ8A 1G6RL 4KKBC 1ZANH 4NQCD 4BUHA 4LAQH 1XF3A 5HYEA 4IOSD 1GIGH 3CLFL 2WBWB 5HDLA 5EZLB 4OCWH 4UINL 4NC1E 3U0TB 2GI7A 1E4JA 1DANT 4OB5L 4Z7VE 5C0GB 5SWSE 1MJ7H 2ZSWB 2IPKB 5IFHH 4L8DA 1Y18B 4XPTH 1AHWC 1VHPA 4KJPD 5DF0A 3ZT6A 3LH2L 4H0GA 5EPMB 5JPNB 1R3LA 5J12B 1S5IH 1TCRA 3JV4B 4PGEB 5DRWB 2PKDA 3GJEA 5IQ9A 4RCAA 2DICA 3MBXH 1DBML 1J8HA 3WLBB 4DVBB 5IVXE 4WWKA 3H2WA 1ZHLB 1G7IA 3MLSH 3CCHA 1JGEB 3QFJD 5CEZD 2EO1A 1NUNB 3ESVF 4XP9H 3VRIB 4OSUH 4U1IB 5TE7H 2Q6WB 1LMKA 1DN2A 5FYJD 4TUKL 1HWGB 2YRPA 5EO0B 5HI5C 5HGBB 3RPKA 1JPGB 1TENA 3QULB 4GRWE 1A1OA 1KPVA 3CUPA 4ZSOB 1YPZE 4IHOB 3TF7C 2Z91B 4ORZC 3MV7D 3CXHK 4BZ1H 4RA3A 4DGVL 1INDH 5JUEH 5I73B 1GOGA 5F3HB 3MRDB 1RJYA 3ZHDA 1E4XH 2XRAL 4AG4L 4OCYL 1U8HA 1V3KA 1CF8L 2B20A 5ILTH 5GS2D 3C5ZC 2AXJA 4DCQA 1OSZA 3QDGD 3B2VH 3IDJB 4XCYA 3MROB 1BBDH 4XBGA 2DTMH 2BXYA 5CUSH 4KKNA 3HI6H 3MUY1 4LSDA 4W6YB 1C5DA 4GRLD 4XC3L 1NAMA 1EUTA 4DAGL 3PNWB 4WU5A 1O5DT 1F6FB 1QSFE 4MCYB 2C3HA 4BSVB 1QUNA 1PKQB 3EYOB 4HDIA 2IQ9L 1MVFA 1B0RB 4QTIH 4YR6B 4NQED 1HHHA 5KSBF 4XMLL 3HS0A 1WTGT 1LO5B 2P5ED 4NUJA 3VFVA 5LGJB 1N7MH 1AP2B 5GZOC 4DOHB 1U6AH 3DJ9A 1LD9A 1OF2A 5GS0D 4WV1A 2XIDA 2XPGB 2DQJL 1WZ1L 3ZO0A 4J1UB 2K7QA 4I0PD 3GK8H 1KUMA 3AMKA 5KVEL 1UEYA 3QEHA 1P5UA 4ZAKD 4ZUSB 1GGYA 3SGEI 2WIIB 4PJAA 1RIHL 5E03A 4FQIH 3UC0L 2M2DA 1H3PL 3T4YA 3HI1A 1YN6B 4PLKD 1OPGH 1PVHA 3GSQA 1JYXA 4I1NB 4R8WH 3T2PA 3T4AB 1F3JA 5F88B 4U6XA 1MJUH 2VISB 2GUOA 5D7IF 1GH7A 4Z95H 5GXBB 1EAPA 1KENL 4XP6H 3DIFB 1M71B 15C8L 2FZ3B 2BVPA 2DTSA 4L8SC 3CFDB 2DL2A 5TF0A 5ISZE 2NY1D 3I9GH 3O2VH 4LNRA 4D0DA 1JWSB 2NXYD 2Q7NA 2E6PA 4MS8D 2AJUH 2NW3B 5M7QA 4JQXC 2EDKA 2P44B 2ZOLB 4OUUA 5KSBB 2HT4D 4GBXA 2YUZA 3FT4A 4JFEA 4TSBL 4G6FD 4Z9KB 4PFEA 1M1SA 1IGIL 5EO1B 1A7NH 5TDOB 4P9MH 5JQ6L 1UM4L 5I1DA 3NTCL 1DQDL 3DGGA 4GG6B 5E8PA 1J10A 2UV3A 4P2RD 3RGVB 1G0YR 4CBPA 4GKNA 3MYJB 1AH1A 2F54E 1RUQL 3V8CA 1B2WL 3LSOB 5L0QB 5B38A 1YMMA 4PLJD 4MNQA 3ARGC 3QRGH 2B4CC 4M02A 5J13C 1FLRL 1XFPA 2R4SL 3S97C 4M7KL 3EYVB 5LG1A 5F7NC 5KVDL 3ALWA 3IGAB 3RPIA 2A77H 2IAMB 2A9MH 5E2UH 3QWRA 4XNZB 3T2NH 4R0LC 4N8PA 2NY6C 1AKJA 4U1NA 2CXKA 3BEWA 2R8SL 3NIFF 5C0BB 1DUYB 1U8IB 1T2QH 3MLRL 1Y6MR 2VSDA 4KMTH 2ATPB 4OCSL 1SJXA 1DQQB 4I3RL 3QIBD 2MSPA 2B1AL 4IOIA 5TPWL 4PV9A 1BWMA 1XGYH 2F9BT 3D25A 5DJYA 5DMIH 3TCXA 3NABH 3GBNH 3RNKB 3U7YH 2AXGB 2XG4A 2JELL 4KMLB 5EZJB 4ZNEE 5T33H 1FNHA 1U92A 4K8RL 3N1MC 2OTUB 2AK4D 1IILE 2A1WH 3UZQA 1MCNA 3DURA 4L4VE 3QQ3A 4XWOC 3N50A 2DYPA 5JO5B 1ODAA 1X9QA 5SWZE 3HMWH 4WEMB 2PTTB 2XZAL 4LBEA 5GGTL 1QD0A 1DUZA 3VFWA 3IT8D 3BEVB 3N85L 1F58L 4L4JA 4I2XE 4V1DD 3DRQA 3HPLA 4G5ZL 1Z3GH 4BQBA 3LKRA 1MCEA 1KLGB 1ZSDA 5M95B 4MGXA 3MRJB 4B41A 2F8VA 4JDZB 2HJFA 1M7DB 4GFTB 4QXUL 5DJXB 4ZTOH 2NX5E 2IQAB 4YXKH 4YPGB 1MCDA 1KJMB 2V7NB 1KNOA 4XX1E 1M6OB 1L6ZA 3FT3B 4G7YH 3FKUS 5EBGA 2QHLA 4X6CA 4HBQA 5HVHC 4WI5A 3UJTH 5MEOA 4P3DB 3V5KA 4JGMA 3QWOB 3U79A 4WW1A 5DEFA 1I1YB 4PJCF 1FG2A 4AIZB 3ZTNH 1ZA3A 3WLWD 1ZMYA 4KUZL 3WHE1 5KSAA 1EMTH 3C5ZB 3ZYJA 4LLYB 2VLJD 2XYCA 3SE3A 3QEGL 5HI3D 3SDAD 2APXA 1K5NB 4JZOA 1HN1A 3D85B 5LBSH 5FCUH 4M3KB 2ICCA 5BVPL 4NUGH 2NZ9C 5CFHA 4MDIA 1R3JA 3C08L 1PSKL 1BLNB 2LABA 4HFWA 5IWLC 2ZCLH 3G08A 2QTEA 4TSAH 5JTWA 1QLEH 4RGOL 4ZO6A 3RVUC 5BS0D 3S4SB 3ARDC 3O4OC 3QUZB 4LCCB 4XNYL 4QHLB 3HR5B 4PRDB 1A6PA 5D1QC 4PREA 2Z31C 4LPUA 2YPKA 4Q0XH 4ZSOE 4JFYB 5DUPH 1BOGB 1I7TB 3QUKA 4XP5L 1IM9A 3ZDZF 3DUUB 2OL3H 1X5KA 2OL3A 2I26N 1D6VL 4AIOA 1DQJB 2WUCL 1FO0H 1CU4L 3LD8C 4PP1C 2VXUH 1R24B 2WBKA 1CGXA 2V2WA 3I02A 3IDGB 2HVKA 1RUPH 5H37G 4X4ME 1JGUL 3U46B 5C70A 1U2CA 1RJZA 4PJCB 5GRXG 1OQXA 1A3LL 1LDSA 5CEYB 2YD4A 1DEEA 4JEGB 5E4IA 1CR9H 4YDKL 1WWWX 1WQVT 5C0IB 3P40A 4RAHA 1W72B 5BZDB 5GGQH 5JNYA 1JNHA 2GW5A 3JTSA 4KHTH 3ZKMC 2WBJC 4OLVH 1ES0A 3G6AB 3HB3C 4L8SB 1Z6JT 3DX9A 1VACA 3G5ZA 3MGOA 3IJSA 4QRQA 4J3XA 5ENWA 1OP5H 1J8KA 2AS5M 3GHBH 3MCKA 2BHZA 1QTYT 4Y4HD 4BQCA 3DVNB 2BC4A 1U3ZA 2FO1A 5LKNA 4NJ9L 4JGUA 2YK1L 3KPLB 4XAWL 3FQUA 4YHYB 3HC0A 4GW5B 4ZQKA 3UTSE 2UVFA 4XVUC 4KTYA 3LV3B 4P3CH 2R0ZL 5FUOL 5GPRA 3BRFA 2BSTB 3AVEA 4JVPA 1ZWIA 1Q9WA 3UJJH 3H6JA 1NKRA 2AK1L 4RFOL 2OSLA 2A38A 4U1HB 1AO7B 3QQ4A 2FWOA 3QDAA 1S7UA 3LMJH 1WLHA 3DYMA 1NAML 2BX5A 2CIIA 4YHZH 4AH2B 1RHHB 3LKPA 1KCRL 5CGMA 1FBIH 1TXKA 4UDUB 4HKJA 3ARGB 1A7QL 1T5WB 2QQLH 5JORB 4JR9H 4CGTA 5J13B 2EXWD 2NY0D 2W0PA 5EU4A 1X7QB 3MUGB 4PGZA 1RY7B 5MI0C 2FATH 5HGAA 3KS0H 4PJ9D 2L4OA 4XI5C 5F21B 1WK0A 2DN7A 1U8LB 4HWBL 3VFSA 4XH2A 5GSVA 3WIIL 4F15B 1JRHL 4R0LB 2VLKA 3V0WL 1A6AB 2FL5A 3VFNB 2NY6B 5D2LF 4PY8J 5CWSA 2A0LC 1P7QD 3SE8L 4NFDA 1N8ZB 3VXQB 2A6IA 3BZFA 5ELIA 5A43C 5KSBE 1BZ7A 7FABL 4DWHA 1U93B 4GW4B 4G6KH 1DLHB 4NO5B 4LASL 3BI9X 3X3FH 3MRLA 1LGVA 1MFEH 3KPQB 4HGWB 4QT5B 3RGHA 1QPPA 3LN4A 4N0YH 4DKEH 4Q97A 4H5SA 3BRDA 2WP3O 4EI6A 4K3DH 3ARBA 3KG5A 2DKUA 4JREC 2IANA 2C1PB 1IGTA 1C7TA 3FB6A 1KELL 2CGRL 5T5NF 4Q2ZB 1J9CT 3O45A 3MGAA 1CE6A 3PWVA 1QLRA 1CGSL 3R1GL 5A16B 2CDFA 2CKNA 5DJZA 2MWCA 3C5SA 1KTLB 3WJLA 1RUAL 4HGKC 2R1WB 3QFDA 3LN5B 4PTTB 5IMMA 3O11B 1QBBA 2P49B 5D7IE 1MCLA 3ROLA 5MHSE 1KT2A 1IL1B 2ZCKH 2ESVA 2SEBB 2H8PB 5HDBF 4MDJB 2W60B 3GKWL 3JVGC 1ORSA 3V95A 3KAAA 1MJJA 1MY5A 5BRZB 4U3CA 3O0RH 5D2LB 3BKCH 1IE5A 4RFEA 4TUOB 5HVHB 2QQKL 4WFGE 4A6YH 2GT9B 3L3DA 5B3JF 4HLZH 4QRRD 4P46C 4MNHA 3UTQA 1OT1A 4AL8L 1QSED 4YDVA 1MLCB 3G6JF 3E2HB 1RUKL 3UYRL 1TTUA 4Q6IB 3VFTB 5E6IA 3HMXH 1NMAH 3IU3A 3WYRA 4JZNA 3O3DB 1IEAB 4M62H 3OZ9H 4UIMA 1LEKA 3U6RB 4KK6D 2Z35B 4XVTL 1TLKA 3UTZB 4RSVA 3B3IA 3EO0B 1NUGA 2FECI 4FQLL 1ZHBB 3PG2A 3LPWA 1INEL 4KUCF 3QNZA 3ROOB 4OQTH 4K8RC 4XMPL 3TO4A 1UG9A 3JWDH 4OQTA 1F3RB 2VDLH 3QPXL 4NOFA 1QVOB 4OLXL 2XICA 1BD2E 2OS7A 2QBWA 3RVVD 1IM3A 1S7XB 4M8QB 4TVPD 4LSPH 1CLZL 3RTQA 4F9PA 4Z7WF 2Z31B 3PWJA 3BESR 4MD5A 4PR5B 1KJVA 3WV0A 3O4LA 3ILPA 2ITCB 3SGEH 5E8OA 5GRJH 5DMKA 3NIFE 1SJEA 2CDEA 1NAKL 3ARQA 3FAXA 2O5YL 2R0KH 5IBTL 3LD8B 1DFBH 4GAFB 5DVLA 1JV5A 1FAIL 1CD9B 1RIUL 3PWNA 3BJ91 3EO9H 4EXPX 4TNWF 5TGBB 1SM3H 2W1NA 4JY5L 4XXCA 1A6WL 4G6ML 4O2CB 4NO0D 5F89B 2O5XL 3G6JB 4YHOL 4FQJL 4KPHH 2BNUB 3ARRA 3KPPA 4HUUB 1G1CA 4NM8L 4N8VB 3AREA 4J3TA 2PYEE 4OLWH 3DUSB 3FRUA 3MA7A 1U95B 2DBLH 2WBJB 4FQXD 1U8OB 5IVZA 2NW2A 4HS6B 5FHAH 1QQDB 4BM7A 5EB9A 1OHQA 3RWIB 5DJAA 5HYIA 1J1OH 3LKSA 3FB8A 3RY5A 3W9EA 3DVGB 3B2UC 3MRIB 4OFDA 2ZWLT 2D31B 3O8XD 1SBSL 2N4IA 4JN2B 3WL9B 2ZSVA 4QRUA 5TDPB 5JHDB 5IJKC 1XAUA 5AAMA 1CL7I 5C08D 5HJ3B 1RMFH 4JM2A 1NJ9A 3QAZC 4GH7B 3L3OA 5DVOA 3MLTA 3CSPA 4MB3A 1JHTB 3S9DB 5JW4Q 2HT2C 2CIKB 2VDPL 5FYKD 3QDJA 2YWZA 4QRPA 4M7JH 3VFPB 1CIDA 5EN2A 4OF8A 2HT3D 2NY2D 3I84A 4MSWA 3Q2CA 4PD4K 5CZXC 1N2RB 1BVLB 5EA0L 5DLML 4PJCE 1YN7B 5IB1A 2HLFC 3THML 2A9NL 3PABB 4PTUA 1ZT4A 1KTRL 1RFDH 2YD1A 3F7QA 1DBKH 5E2WH 1NCWL 5J6HA 2V6HA 3RVTD 2XFXA 4RBPK 5KOVC 4ETQA 4IRJA 2Q3ZA 4XCEB 5K9JH 4WI6A 2HAZA 4KJWD 3FN0L 2JIXD 2MQ3A 3IDNA 5J1AA 1XCQB 2XN9A 5L88H 4KQ3H 4HKZB 3S96B 1CDHA 1RVFL 5IJVB 1NCUA 3DI3B 4UDTA 4AM0A 4BK5A 1FZOB 1XF4A 3O81A 3GMRB 5CIPA 2AAVA 3DBXB 1NMCC 4OD3H 5EZIL 4NN7C 1PQZA 3TIEA 2YPVH 1Z5LA 5E95B 1A7RH 4K7FA 5TF1H 3VMNA 4M48H 2GCYB 3AAZB 5ERWB 3T0BA 3T1FB 4JREB 3MJ8B 3ZDZE 3UEZA 4ORGA 4XHJD 1I1AA 5CCKH 4DZ8A 4F80A 5DQDL 1KBGL 4M00A 1TJIL 4FTVD 4PRID 3B9AA 1U58A 2Z93B 1NEUA 2IGFL 1V3MA 2G75B 1E27A 2NCMA 2PO6A 4UUJB 2VOTA 4K23H 2H2PC 5KSVB 3P4NA 4MD4B 3MRHA 3GMLB 5DJ6B 4CDGC 2WW8A 2ZUWA 4G9FA 4PJ7B 1YMHB 2C7UA 4BFIA 4PJ5A 3D39B 4KY1L 1FE8H 3U0WH 2X4TB 4NOBA 3ULVD 4ODTL 5D8JH 3UBXB 3B9KA 3WNMA 4P46B 1OTTD 2AJVH 4ODWA 3BJLA 3CFEB 1U8KB 4YDIH 2QR0A 4QCIB 5FFLA 4PYHA 1TJGL 4NFBA 3FONB 5HHNA 3VXSA 5A3IC 4GAYB 3GMPA 3DTXA 2H2SD 4LSQL 4ZFOA 1C1EL 2G9HB 1AY1H 3BDBA 1I3RB 4RZCA 4GAGL 5JDSA 2QSVA 5DD3H 3LB6D 1T0NB 1BQSA 1T1YB 5K9QI 4HUKB 4JANB 2JJWA 1KV3A 3VXUB 5DRZA 4C4KT 4X5LA 3L5WA 1Q38A 4PJDF 2GSGB 2B0SH 4CVXA 5FA3A 3MOBH 4ERSL 2J8UB 1TZHB 1VFAB 3MLXL 5BRZE 12E8L 5D2LE 5CD5D 1NEZA 3PXJA 1F2QA 1A64A 3QNYA 4JHWH 4HKXB 1KC5H 4LEXH 5FV1L 5IEKB 4GBXC 3VD5A 4TOYH 3PWUB 2YD9A 3ZMRA 1DBAL 1P1ZA 1MPAL 1CK0L 5F6HJ 1YEGH 3GSWB 4XBEH 3W11C 4PJIB 2Y5TA 3B9DA 1U3JA 4WUKL 4DN4H 1MHCB 5F7WC 3DSNA 3GSUB 1MHHA 4L8CA 1X4YA 4I48B 3IAGC 2Z0BA 5HHQB 1PY9A 3BH9B 5I1GL 1L7TL 1ZLVK 1XGUA 3OKLB 5ABDE 5KVFL 4HT1L 1PZ5A 5JOFB 3FFCB 5E8EB 2KL6A 4OZIA 2XZCH 3K2UH 1KXVC 3L3IA 5C0DA 1PX4A 3OQ3B 3U9UA 3V4PH 1MCPH 2J1KA 3ZL4L 4C56D 3MODL 3FO0H 4Y4KC 2VXSH 4LIQH 2BMKA 1F11B 4YAQB 3BWAA 1T5XA 1DBBL 5HDBE 1Q0XH 2C5DC 1D5IL 3V4UL 3PGDB 3BN9C 4XCCH 3BX7C 4YXLH 3WE6A 4GQ9L 3HG1B 1YC8A 4U6VL 1DEDA 5B3JE 1SMAA 1QBML 3HRZA 3MPCA 4OCRL 3QHZH 1NGXB 3ALXA 5IBLC 1FRGH 3WNOA 3G6JE 5HYSG 4NC2B 3DV6A 2VXTL 1CFSB 3QHFH 4YZFF 5CJBA 4RIRA 1HHIA 3GMNB 5KW9H 1FFNA 1FNSH 3KR3H 1CGTA 2GKIA 4LDLB 3ZHKA 1IQDA 2XKSA 3VXTA 4PRNA 5I17A 4G8GE 4NBZB 1J7VR 3UDWC 4IS6B 3P77A 5GJTH 4JFOA 3GI9L 4YXHH 3AM8C 4Y4FB 1NMCB 4OGYH 5GS1A 4NN7B 4XZUB 4Z7WE 3LKOB 3I2CH 1GVIA 4LQFL 4UIKL 2VZVA 4YPJA 3ARVA 4HIIB 1K6QL 1NBYB 1FLTX 4PJAF 4TSCL 5FECA 1DE4A 1UACH 1ZA6B 5E2TL 5IMOA 3WO3B 5IESL 3KXFB 4MJ4A 4ISVB 2J3SA 3ILQC 1RU9L 4NKDA 3PP4H 3ES6A 4PRHA 1HYSD 2JTDA 5LJYH 4JFHD 5FV2A 3RAJH 2DRUA 2VC2H 4H0HB 3F7VB 4EXKA 5KSAC 5E0QA 4X6BA 1C16B 3IJYA 1K8DB 5B4MC 3SE3C 2APVA 5F70A 1BGXH 4Y19A 1RAMA 3JV0A 1KXQE 4GSDL 4BH8A 8FABA 5EU6A 5A2LH 1CFTB 4C58B 2IAMD 1D9KA 4C83A 3O6KL 2DQEH 1TVHB 4G6JL 1P2CB 4HC1H 4JQVA 4HC1A 3DO7A 1AJ7H 5C0BD 4LOUC 5MEQB 4RWYH 3ISWA 1U8JA 4XPHH 3BHBA 3CVHH 4R26L 1S7RB 4UOW0 3CVHA 4LLMB 3QI9C 4UB0L 3EZJB 1OF2B 2R2BA 2APBA 5ANMB 3D9AH 1ZT7A 2QQNL 2NYYD 3VH8G 2D2OA 4ZOEA 3RL1A 1T21B 3PV6B 3WN5B 4G42A 4UBDD 3STLA 4LFHG 1N64H 3TYGL 3WS3A 5TQ0H 1T7YA 4G8EB 1UH2A 3HAEA 5T3ZL 1S7SB 5FO9B 3PE9A 1A4KB 4WFHE 2Y6SD 3P9MA 4K7PH 3RRQA 4PB9L 5D72L 2VDNH 3MO1B 4U1SA 1R3IL 4M7ZB 3X13A 2WNGA 4LCWA 4WTZG 3F7RA 4HQQL 3VRJA 3HNTL 3CNKA 2J88L 2ARJQ 3NH7L 4NQSA 3CK0L 1S9VB 1UM6L 4QRTB 1S9WA 1Q0YH 4HUXB 4R7NB 4HIHA 4JVUA 2DJSA 4YHPB 5CLWA 3B6SB 4XPBH 2ENYA 1X6NA 3HUJF 1FORH 4NKMB 5I1IL 4HCRA 3QQNA 3IFLL 3S35H 1OT2A 4TQEL 1YDPA 3TN0A 1FFPA 1Z2KA 1HOCB 5JHLL 3C6SB 1LP9A 1FZKB 2XQYK 2ZUSA 4ZD3H 3E6HA 5DFWH 5E00B 1XGRB 5C0CA 5DMGC 2AXFB 4KTEH 2VLRB 1NC4A 5ESAB 3PWLB 3S5LA 1EH9A 4YNYA 3T77A 3OKNA 2VAAA 2FR4A 2VMFA 2HH0L 4X99A 3SKNA 4ESKA 3W9DB 1N5AA 2ORBH 2VUOA 3MCLH 1OM3H 4R90H 3WJJA 1IC4H 3ARTA 4N5EC 4PJHA 1KFAL 3MV11 2C1OB 2DQDL 3VXUE 5CJQH 3PWPE 1CL7H 2VXVL 3FB5B 5IF0B 1X5FA 2VDOL 4G8IA 1QPXA 3QUZD 1JE6A 4NFCA 3MACH 3LS5L 3WO4C 1J1PL 4Y4KB 4X6CF 1C5BL 3C60C 3IFOA 5FUZH 2Q7YB 3G5XA 3MFFA 1RZJH 4LVHC 4FNLH 1LO0L 2CRMA 4PJEE 5ID0A 1IGMH 3HUJB 1P5VA 4D9QE 3MRMB 3EYUH 3VGEA 4ZFOL 3K80A 3O6ML 4M6NL 1HH9A 3MLVL 5DC0A 2DJUA 1FDLL 4IRZL 2VZ3A 4D8PB 1HQ4B 4GW1B 2X4RA 1AGEA 1JWMB 3VXOB 5DD6A 3GSNH 3ARBC 3GSNA 1KCUL 1HNGA 3F5WA 3KPSE 2GK0A 3NAAL 25C8L 5C0RH 5CAYB 5F6IB 2PUQT 5DI8A 4WW2C 5L2KA 1JPFA 4LBEB 3HN3A 5E8DL 2V5RA 3CFCL 4GXUM 1ERNA 1UJ3A 2EDOA 1MHPH 3FFCE 5B3NA 4P99A 3WJLC 5AYQA 3O6FB 2GAZA 3SGJA 2LAGB 5ACLA 5EWIL 5FDWA 5ACMA 5CJXA 3PQYA 2BNQE 4GOSA 1CVSC 1FH5H 3MV7A 3T0EC 3GSXA 4PJDE 1KB5H 4EDWH 4KAQL 1KSRA 3BVNB 4I9WE 3BDXA 4M7LH 1DQML 1MCKA 3HCVB 1C12A 1XZ0B 1MJ8L 4J3OC 3EW3B 1AO7D 2CMRL 4X6DA 4RRPA 3QCTL 4G6AC 3ZYIA 4OGXH 3QDGA 3MRPA 5JIIA 4JY4A 3VE0B 1FG2B 5ACZB 4HBCH 4X6EB 1UT9A 5ADPL 3OAYH 1IARB 4KZDH 4JY6B 4WIQA 5DVKA 1HKFA 1T89C 5E6IC 4XCNB 2K3TA 3GJFH 5IB3B 3GJFA 5I8CB 7CGTA 4OI9A 3FQNA 1MCSA 2FX9L 3WXWL 4G80B 1ZS8A 1J8HE 2FH8A 2P5EA 4P4RA 3ULUH 4XNQA 3ZKQD 2MPAL 4H1LG 3BPOC 2BJMH 1ZK9A 4XNMB 1LNUB 2MTPA 4YDJB 3TO4C 3VG0L 3TBWB 2NTFB 3NFSH 3OHXB 3D0LB 1AXIB 2AGJL 1NKOA 1A4JB 3BKML 4NWUH 4F9PC 4I0PA 4DQOL 4K9EH 3MRRA 3QI9B 2P5WB 4WFFD 5EDXA 4H20H 1H0DA 4HH9B 3V9FA 1UWEL 2FSEA 3EYQD 5EC1B 3L1OH 3I02B 4F57L 4MYWB 1M7IB 5BOZG 4XBPB 4MQXC 1RULL 2DDQH 3P11L 1D5MB 4XXCC 3EDJA 3GIVB 1KLFA 4POZD 5HHOB 4FG6C 4N9OB 3IU4L 1DDHB 2JB5H 2R9HC 5ADOL 1R3KA 5F72S 1TMCB 4YZFE 4YHMH 3WS6A 32C2A 4XNXL 3OAZK 4XRCB 2EDYA 4UT9H 2GSIB 2HFTA 4EIGB 3GFUA 3F6LA 4NO2A 5IIEB 2EE2A 5J4MA 1NANI 4FA8A 2J5LC 4GXVL 1I85A 3PHOA 4HK3N 1T1XB 2ICWB 4K71C 5HHMD 4E0RB 4P2RA 5ANME 4RQQA 4Y1AD 2YR3A 4DGIL 4X7SL 5GRUH 3OGOE 4CKVX 2FBJH 4MA3B 4LKCA 1RZ7H 1WIPA 5D1XD 5HGDB 4U1GB 5DUBB 4PRPB 1T3FB 3RWFA 1KG0B 3QDMB 3X11A 4WW2F 4PJAE 1HI6A 3UAJC 1KOAA 4H26A 4PJBF 1LE5A 4KC3B 3QO0B 1SYSB 2YN3A 5H94A 2A73B 2HJLA 1R5WA 2F19H 3D2UB 2G60H 4JPKL 3H42L 5F7LB 4JDVB 4GAJH 1AE6L 2IADB 1WZMA 4RGMC 1X5GA 4M5YH 3ECBA 5EOCL 4H0IA 5EOQH 2Y7QA 3ARWA 2Y72A 4IRJC 4NC0B 3DECA 3C2SA 3VFSB 1U41A 2X4QB 2YA1A 3FTGA 4XH2B 3OXSA 5GSVB 3AS3A 4KROC 3C60B 1G7LA 3MV9B 1QZ1A 4MXWL 4YWGL 4LVHB 4YBQC 2BXZA 5L7XH 3BXNB 2Y5EA 2H41A 5IMKB 1ORQB 3FFDA 2AK4A 2FJFA 4UQ3A 5I18L 5F7MC 2FX7H 3FQXA 4ZDHA 1ZLUK 3IDYB 2VLRE 4HXAH 3TBYA 2NY5L 4IDJL 1TNNA 5FGSA 3RIFF 4TUJB 4K94L 4M1CD 5IM7B 1TQBB 3ARBB 3E0GA 2VAJA 2YXFA 2R56H 2BCKA 2C3GA 3BH8B 1UZ8A 1I1AC 4B5EA 5SV3A 2GJJA 3LZFL 3RUGF 3PWVB 1YMME 4JB9H 3FO2A 3HC3H 3PUCA 3QEQD 4MNQE 4WFED 1RJLB 4WI2A 4WW2B 3UTPD 4ODHH 5I9QC 3GUTA 2X1PA 4LARH 5EU3A 4PJBB 2UWEA 4WHTA 5CGYC 5D70L 3VWJB 5JMRA 1EFQA 2YC1B 4PUBL 1AC6A 3BSZL 3CH1A 2BOBA 1R5IA 2VXQH 4HCRL 3IFNH 2X4SB 1J5OH 5BMFL 1H3XA 4ELMB 2NNAA 3C5JB 3FCTB 1CDYA 3K0WA 3PDOB 4JZJA 4HZAA 2PO6C 5EUKA 1HH6B 3T0EB 4NKIH 2YHGA 5EUOA 4G3YL 5KZCB 1MFDH 1CD1A 4H8WH 5JHDD 5C0EB 4HJ0C 4D0CB 5C1MB 1L6XA 2GJZA 2CLVB 4E41A 1KPUA 3MREB 2GFBA 4QHNB 5ID1A 3IS1X 4HFUL 3HUJE 4P5KA 3T0DA 1MSPA 4B7IA 2ZG2A 1D5XA 4WEBH 1CDGA 2VLJA 4GT7A 1RZIB 5DHXB 3RKDC 3B9KC 3OG4B 4M43L 4HS8H 4QOKD 5DJ0A 4OF0A 1NGPH 1BWWA 1IQWH 3D69B 1C08A 2DQFB 4G8FB 4UIMB 2QL1A 1FHGA 1JZ4A 4X7DC 3I75B 4MB5A 1KB9J 3CLEH 5MERA 3GDBA 3BPOB 1KPRB 2D4DA 1MFNA 1QFWM 3A6CL 3RUGB 1CTNA 3AFLA 5IW6B 3IETB 3PL6D 2RQ8A 5GS3A 1B0GB 1KJ3H 1H3UA 2QEJA 2X5PA 1YEKH 1AXSA 4WEUD 4P4KD 3MBED 5D6CA 5F1IB 1CT8B 2R0WH 2DLHA 3DLQR 5C0AD 2DD8H 1TTGA 2XTLA 4OGZA 4UAOC 4UI2A 1T6WA 3U36B 3OAUH 3F58H 5BQ7A 1K8IB 4X6CE 2CKBB 5DMKB 4YK4B 1QO3B 2X1QA 3CU7A 2Z8WC 3P30H 4JG0H 3BPCB 1RZKH 2CLZA 3NCFB 1NGYB 4YIQB 3RBGA 5CEZL 3QIUD 1KGCE 5BOPA 5DMJB 2EIZA 4DKFL 3RWCA 2KQNA 2I07B 1DL7L 5FYJL 1WUNT 1G9MH 3BE1L 3GSOB 4X6FA 2EKSB 3VDBA 1Q9KB 5J3HD 1OGTA 4Y2DC 2F58H 3KPOA 1LDPH 2PR4L 4YBLB 1I4FA 5HY9B 4N1EA 3DXAA 3LOWA 4NHUB 4E5XA 3MV01 1RI8A 2FGWH 3QXDB 2XKUA 1OB1B 4WO4D 3K7UA 4HZLB 1EEYA 3LQAH 3TA3D 3BQUA 4JM4H 1CXIA 4JAMA 3SDDA 2HP4A 1PW3A 3D39D 4R97C 1AFVL 2IG2L 2ZSVB 1RUML 2DQGH 4OIIH 2FEDD 1JYWA 2X1OA 5T3XD 1F02I 4OLZH 2R69L 3QR2A 4Z0BL 2X9XA 1NBQA 1RSFA 5CKAA 4XNUH 5JW4N 1I7UB 2XQBL 2QHRH 4N0FB 3EGSA 4BZ2L 3L6FA 5T5FL 4JJHA 1JNJA 5FO8B 1U8QB 4JG1L 4WGWB 5FK9A 3RFZC 1A1MB 5MENA 4PJ9A 2VDQH 5HHOE 5EORL 3ZTJH 4ONFL 1XF2B 4YE4L 4F7TB 3UZVB 2MFNA 4RGMB 3EFDH 4F37F 5GS0L 1P7QA 1FL5B 4LCIL 3DX8A 4X5WA 3V7AG 1UA6L 1PFCA 1BFVL 1QFWI 4OF7A 3EOBB 4YFDB 4BK4A 2ZCHH 4N0UB 4P2QD 1EJOH 4LNVA 3RI5K 4CNIB 4KROB 2EKJA 2HG5B 3JUZA 1T7ZA 1CS6A 5DO2D 6CGTA 2CD0A 3VG9C 2OP4H 4GS7C 1S7QA 3CPLA 3GGWB 3I9GL 4I3SL 1PG7L 4JO4H 4M5ZH 4O58H 5FGRA 3RWGB 1M4KA 1DBJH 5CIPB 1HEZA 3U7WH 4OZGB 5GS1C 5AAWA 1GGUA 3MLWH 2YD2A 2PW1A 4NCC1 2FIKB 4K7FB 3IDXH 3QDME 2EYRA 2DMCA 4S11A 4LLDA 1CWVA 4TTDD 2GEEA 1FJ1B 5ICYB 1PDKA 1Q1JH 2E7MA 2R1XA 2VDML 5I9QB 4OCMC 2LU7A 3LPFA 2QSCH 4MAYD 1BF8A 2BY2A 1TQCB 2EZ0C 4AEFA 4WI9A 5CMAB 5EC2B 5IMLA 4GRWH 1T7WA 2PO6B 3VXPB 2ZUVA 2VLKE 3L3HB 1D9KC 4ONOA 1XT5A 1YPZA 2FGZA 2W9DH 4UT6H 1UWGL 1EFXA 3MV9E 1KJ2H 5JIHA 1KJ2A 1JWUA 1XH3B 1I7RA 4JQVC 5DSCA 3Q1SH 3U82B 5FIEA 4PG2A 1EXUB 1QSEA 2AXHA 1JPTH 4JLRA 2HMIC 2BY3A 5T1MB 4XXDB 3DROB 4EN3B 4DZBA 1AI1L 4LCUA 1UENA 3I6KA 4ODWB 4KI5D 3FO1B 5BV7L 3T0VA 4PGCB 4LPVA 5JW3L 3EOAA 1MF2H 3SDXF 5KJRH 3BWUC 3S7GA 4LGSB 4P2OC 3BOVA 5HYSB 1T03L 5C8JB 2Y1VA 5DYOB 1J0ZA 1GC1H 2I9TA 3BD4A 2R0LL 4ZFOB 1MI5B 3D48R 4PJBE 1KULA 4OZIF 2CXGA 4KRNA 4IIQA 1ND0B 1NFIB 1YEJH 1ZT1A 5ESQB 3ULSA 3WUWA 4DN3L 2NY5C 1LO2L 3VGFA 1AQKH 2Z4QA 4K94C 43C9B 2RHEA 2PW2A 3B5GA 1NL0H 3FO9A 1G7HB 4L4TD 3OKKB 5E94B 3T0EE 4EI5D 2ESVE 2J6EA 2H26A 4LLVA 3P9LA 1VFUA 1IBGH 2J8HA 2UZIL 4K2UL 4Y4FD 1EBPA 3L7EA 4UV4H 1TJHH 4U6YA 4XWGL 4JJ5A 3ZE2F 2AJXH 2WWKT 1QHOA 3KGRA 5EBWA 1N4XH 1ZGLM 5E9DB 4RMQA 4PS4L 1EEUA 3WNLA 1JGDB 4FFWD 3H3BC 4NO0A 2H32B 3KXFD 4HPOL 2DQUL 3K8MA 1TVBA 4I5BA 2DQTL 4DUVA 1MIML 2BDNL 3MX0A 4FQXA 4JKPL 1I3GL 1T1ZB 3WFBL 1QEWA 4KK9C 5ITFB 1T7VA 2MQ0A 1VCAA 4Y2DB 4HIEB 5DJCB 4XCFL 1FNGB 4P9HL 3QUML 5FM5O 4L9DA 5F7DA 3SDXB 3IVKA 2A74B 5MEPB 3EJZC 3UPAA 3RUGE 1NLBL 1RK1B 5HI4C 4HLZG 3WJJC 5T1LD 5SWQB 2VITB 5C08A 4Q9QH 1E4WL 3D18A 5I76B 1AGDA 2OQJA 2F74B 1FGVH 4D9RE 1V5JA 4JCMA 4R97B 4UT7H 2Q87A 3TYFB 5ITBH 1WCQA 5J1SC 4P3WA 5E08L 4NDMA 1WBYA 5D7KD 5HVFB 5FO7A 4LVEA 4B7LA 1DQTA 3FZUD 5F8RC 5I8OL 3BKYH 1TZIA 1GZPA 4EOWL 2F5BL 4LHUB 5IFJA 4K7PX 4XVJH 4KK5D 1CIUA 1CLYH 5I2IB 5EH1A 2F54A 4KJPC 3GRWA 3MRGA 3QXVA 43CAB 1LK3H 2E27H 4HMEA 2IH1A 3WIFA 5C2UB 3QHTC 5I66A 1QRKA 3IXAA 3HZYB 4OZ4B 1UJTA 4CADA 3VGGA 1CLOL 4JRYD 3BUTA 2JIXA 4UQ2A 3S35X 2EYTB 2DQIH 3I3BA 3GIZH 4RIRB 5JXEA 2IF7A 1BQLL 1FFNB 2BRQA 1JBJA 2JJUA 3G04A 1JHLH 3S6CA 4OD1L 2X4NB 1FN4A 1JTOA 1MWAL 5F96H 2CQVA 3H3KA 4LAJH 5AZ2L 1A2YA 5ICZB 3VG9B 2HYMA 1RZGA 1T1WB 4CN1A 1XGTA 1SBBA 4QF1A 1HDMB 2H3NA 3LEYH 3MNVA 1LO3L 1IAIL 5IHLB 1BF2A 3RWDA 1DN0A 3GSRA 1HIMH 2CK0L 4ZNEA 5C71A 5GS1B 3F62A 1RIVH 4DTGL 3HE7A 5I74C 3VXRB 4G43B 2FO4A 4Y5VA 2BSSA 3JUYA 1KN2L 3RZCB 4QRPE 3T3MF 2X1XR 4YGAB 2W0FA 4I77L 2Z8VC 4JPIB 5E8NB 3OXRA 5AZEL 5B39G 3NA4A 3P9WB 3CVIL 3IYLW 4HG4J 3DPBA 3SDCA 5I15H 3QXUA 4GRLC 1IAKB 5I19L 5FOBA 4ZUVB 1MH5A 5DHYB 2DM3A 4J3UA 1CXKA 2B5IB 1FYTD 2Q76A 2NX5A 4CUCA 2VABB 1U0QA 3NVQA 2W59A 2X4UB 5D2NC 3WXVH 5C09B 4MNGA 5CINH 1LE9B 1P7KA 4KFZC 4N0UE 1IFHH 5T3ZE 3S37H 5FM5M 1KF9B 1I75A 4N0RA 2XN9E 5EZLA 3C6LD 4KQ4L 3U0TA 5IQ7L 4PJ8B 4CU8A 3WSQH 2X41A 3TFKD 5C0GA 1OARL 4L3CB 4QTHB 5FYLD 5GS0C 2ZSWA 1YEFL 2IPKA 4AYFA 1Y18A 1G7QB 4I0KA 5GISL 4NYLB 3MLUH 4CU7A 5EPMA 5JPNA 4ZAKC 1DZBA 1FNEB 3ETBF 3JV4A 5DRWA 5GZND 4PLKC 3C2AL 1I7ZB 4P2OB 4TPRH 1Y6NR 3G5VB 1A0QH 1A6UL 1NCCL 3WLBA 4DVBA 1IC5H 1ZHLA 4LP5A 1MNUL 1JGEA 3K3QA 4PJHF 3NCMA 3VRIA 5HPMA 5DUMH 4HIXL 1F8TH 2FD6H 3MV8B 5IEHB 1DANU 4U1IA 1KEML 1V7MH 2Q6WA 5EO0A 4U1SB 2L0DA 3O6FD 1MHEB 3QULA 2NXYC 3LEVH 4IHOA 4PBWD 4NQSB 5D1ZB 4HWEH 4MS8C 3DHJA 5K59F 3MJ9H 3UTTD 5CILH 2E9BA 2HT4C 4PJ5E 3UPRB 4ZO9A 3MNWB 5F3HA 3MRDA 4S1SL 1MCOL 4ODVH 5E1HB 3TWCL 3BDYL 3EKCA 3MRBB 3HC4L 2D3VA 3N9GL 4FRWA 5DJ8B 4PRAB 3KPRD 4OJFH 5JDJA 3D0VB 4H88L 3JWOL 1VKXB 2PXYD 4Z8FH 4NJAH 5CJOH 4M4RA 3IDJA 5AG9A 4X80L 1OAUH 3S5LB 1A5FH 3OKOB 4PLJC 4BSVA 2XA3A 5GGVH 4KHXL 3WDIA 2IALB 1PKQA 3T77B 2P1YA 2VAAB 3WKNA 1AQDB 4YR6A 4LPCA 3UTOA 1EX0A 1LO5A 2P24A 4FFYH 4LRNL 4LMQI 4FOMA 5D7LB 4H1LB 5BV7C 1AP2A 5I75B 4OCLC 2EYSB 2WQRA 3NACH 3S88L 4EQ3A 1S78D 4M3JA 4M8VA 4L3EB 2XPGA 5AEAA 4NQCB 4J1UA 3QIBC 1DTUA 4O2EB 2FCBA 1JF5A 4ZUSA 2LAAA 1FIGL 3DVFA 4X6DF 2WIIA 5E9DE 2P5WD 4M6MH 2AEQL 3JXAA 4XPFH 1W0YT 2Q8BH 3VJ6B 4DW2H 1YN6A 3GEWB 4EUPG 4LF3B 3V4VH 2ZG1A 3T4AA 4OZFG 4RAUB 1YYLH 3HKFA 5F88A 2R29H 1MRFH 2VISA 5TFSH 4NCC2 3GZKA 4TVPL 2DOCA 2W0KA 1L0XA 3DIFA 4GUPB 1M71A 1QFWH 2FZ3A 3CFDA 1NEZG 3FOMB 2YXMA 1MFCL 3SDXE 3W81A 3QFJB 3MRNB 2J6EL 3BGFB 1JWSA 3EFFB 3Q6FB 4KVCL 4OM1L 4F33A 1ZLWK 3SGKC 2NW3A 3EDDA 3QPQD 2FB4L 2ZOLA 4OZIE 1UCBL 1NUFA 5J9PB 2VZOA 5KSBA 1QRND 1KN4L 3BZ4B 3D87B 4LU5L 1IGFL 3GO1H 4P9HC 5EO1A 1NGQH 3C8HA 5TDOA 5FOJA 2FX8H 4GG6A 5JOPD 2FJGB 2NY7H 5HDQL 2O5ZL 2GTWB 2I9LB 4POUB 2CUIA 3RGVA 5DMGD 1I9IL 3MYJA 1OAQL 3WFCL 3ZE2E 4GMTL 3S36L 3WLWC 3LSOA 1CQYA 2FJHB 4PRPD 5I1EL 1NLDL 5E5RB 5DGQA 4ODSH 2YOCA 3AU1B 4JY4B 3SDAC 5HI3C 2RIKA 3WFZA 1MFAH 1Y6KR 3EYVA 2Z92B 3IGAA 4GRLB 3D2UD 2AQ1A 2IAMA 3LVEA 2C3VB 4HAGA 4NNPH 3UX9B 1CICB 4P23B 4Z76B 2P48B 4XPGL 5D2NB 4NQEB 5DD0H 3ELAT 5C0BA 1DUYA 2ADJB 5FYKL 2OTPA 1U8IA 2EH8L 4P5MA 4P59H 2ATPA 2P5EB 2X44D 1X5AA 1VPOL 1DQQA 1CGWA 2AEPL 4XP1H 1RURH 4F9LC 3TZVB 4JFDD 2BNRB 2F5AH 1JGVL 3SKMB 1UC6A 3LQMA 3RNKA 4S1RH 2AXGA 3NN8B 4MXQD 2NY4D 1UYWH 3OAYK 2IPTL 3GRWL 5EZJA 4NRYB 4AIXA 4J3SA 4W6XB 2OK0H 4F7PB 2OTUA 4FFZL 3MRRB 2D9QB 4ZAKB 3REWB 2A6JB 3D3VB 2ZUXA 1JGLH 2NXZB 5JO5A 3R0NA 4JQIL 5C6TL 3CDGB 4FQCH 2PTTA 4APQD 2YPLB 3MXVL 3BEVA 4JFFD 3H7BB 1L9MA 4AEHL 4RDQG 1KLGA 3MLZL 2R4RH 3MRJA 4JDZA 2I5YH 4ONHB 4NQUA 1M7DA 5IFAL 3QG7L 4OF6A 1B0WA 4K3GA 5DJXA 3SBWC 2M1KA 5I1CH 2D7QA 2VQUA 3VWJD 4Y19E 3AC0A 5I1JL 4OF3A 3NCBB 3L9RA 1EV2E 2AI0H 4YPGA 1KJMA 1T83C 2NXYB 5HYJB 2V7NA 2VH5H 4Y4HC 1M6OA 3FT3A 1KTDA 4J4PD 5IT2L 3SKJL 4P3DA 1S8DB 4YQXH 3QWOA 5B8CC 3FN3A 3MRQB 1I1YA 4LCYB 3MXWH 4G6FB 4AIZA 4MAUH 1G0DA 4NNXB 3EBAA 4MXVF 3UBXI 2AQ3A 1A3QA 3DNKA 2MCPL 3C5ZA 1Q94B 3JV6B 3OL2A 3ARFB 5E4EC 35C8L 1NSNL 5C9JB 1CDCA 1VFBB 3M45A 1KEGH 4M6OH 1EERB 1I3UA 1K5NA 4HAFA 3D85A 2YD3A 4NZRH 5F71A 3OKYA 5IHZB 2WLZA 3CFKA 1F4WL 1BLNA 3UP1A 2EXWC 2NY0C 3DMMB 2UWEF 4DKAA 2EH7H 5H94B 4AQOA 3MV8E 4PJ9C 3S4SA 3ULVL 3QUZA 4LCCA 3I6GB 4QHLA 4PRDA 5BV7B 1J18A 4LCWE 3ECBB 5EUOF 4JFYA 2ZPKH 4PGJA 1BOGA 1I7TA 2EDWA 2UYLB 1I8KB 3DUUA 4XP4H 3BZEB 4M61B 4X9IA 3QIBB 4JPWH 1DQJA 4I0CC 2RCSH 1R24A 5F9DC 4WY7L 3BAEH 4O9HH 5INCB 4X83A 3IDGA 4PJXF 1J0IA 5JZ7D 1P84J 4OUOA 3W2DH 3FFDB 3GNMH 3NZ8B 5CEYA 1EK3A 1R3HB 1W72H 2LQRA 2GYSA 5C0IA 5KS9B 1W72A 5BZDA 2YMXH 2EXYD 5IGXL 1S3KH 3G6AA 4WI7A 5F1NB 1RZFL 4NP4H 3I6LE 4V1DB 2VQ1B 5L9DL 3T04D 2OR9H 3JWOC 5F9OH 3ZDYF 1JTPA 4TN9A 3NFNB 3DVNA 3A67H 4PJHE 4JQXA 2WANA 3KPLA 1E4KA 3RIAK 1R5IB 4GW5A 1GGIH 3HNSL 3TJEH 3KJ6L 2E8YA 4L3EE 2BSTA 1NBVH 4NQCE 1NCDL 1JF1B 3QUMB 3OSKA 5BVJB 2DWEB 4U1HA 1AO7A 3SDYH 1G7MB 5GJSL 5JW4R 1EO8L 1HCVA 2DM2A 3HNVL 1E0OB 2I60H 4AH2A 3FMGH 1RHHA 3KYOB 4KU1A 4F58L 2UZYB 3IDUA 4UDUA 2J8OA 3ARGA 2V7HB 2B4CH 1T5WA 5JORA 1H15B 2E9JA 2AV1B 3SY0B 4PJXB 3SDAB 1X7QA 1AGFB 3MUGA 3CJJA 4LSSL 4PGBB 2WZPD 1ZEAH 1BJ1H 4KK6C 5GRVK 1FGNL 1KCVL 4FQQB 4JDTH 1C08B 1U8LA 5JXAL 3A6BL 4R0LA 3QFJE 5CEZE 1A6AA 3UO1L 2YRZA 3VFNA 2V2TB 2DB8A 1A9EB 4UTBH 2HKFL 5BS0B 2DIAA 3BP6A 1N8ZA 3VXQA 3FQRB 5FYJE 1FO0B 3RVVC 5DEGB 4HF5L 3U4BH 1U93A 5A2KH 1DLHA 4NO5A 2IBBA 3MV7E 3ARSA 2EE9A 3KPQA 2EDLA 4G7VH 4HGWA 3UJIL 4HX1A 1W8OA 1GAFL 1JZ3A 4CU6A 3NA9H 1VEMA 4FZ8L 5E2VL 2C1PA 1MWAB 4YHLL 4Q2ZA 5HGGS 1N0XL 1EVUA 3C8KB 1FYHB 4X6DE 3MMEB 1XGQB 2W9EL 5A16A 5IW3A 3QDGE 5D7JB 3DSFL 5IKCB 4D2NA 4DGYL 5CBEB 1KTLA 1LILA 1WFTA 5F9WC 2R1WA 3LN5A 5IVOA 3O11A 3H3PH 5DJDB 3PIQB 4FQXC 1EDQA 5IV2B 5C07D 1IL1A 5D2NE 4M1DL 4ZO8A 3N1FC 3EJJX 4NQEE 2XWJB 5I0ZA 2NMSA 2SEBA 1VEPA 2YD6A 4U49A 2H8PA 4LSTH 1UH4A 4ZTPL 4FZEL 4EDXB 4MDJA 2W60A 4TULL 4NZTL 5D71H 4Y4HB 3CX2A 2P5EE 4RRPG 5BRZA 3O8XC 5D2LA 4E5XB 1P6FA 2OZ4L 4JHAH 4NQDB 4TUOA 2XG5A 1E28B 2F8OA 1TCMA 2GT9A 5B8CB 2Q8AL 1NDMB 4U1MB 4B0MM 5F3BB 4C54A 4Z18A 3T8XB 4OM0L 1MRDH 2VIRB 3VD4A 1FVDB 4OTXH 1N0LA 1DSFL 1MLCA 1T2XA 1JRHI 2GIYA 2NQCA 4EN3D 1G6RH 4Q6IA 3VFTA 5E4EB 4P49A 4MWFB 2PCPA 3CLFH 3O3DA 1IEAA 3U6RA 2HT3C 2NY2C 4UINH 1CD8A 2Z35A 4XMKL 1N6UA 3UTZA 1BQUA 3EGSB 4OB5H 3T0AA 3EO0A 1ZHBA 4QWWD 1B88A 5CKGA 2NY0B 3KDMB 4MA7L 5FKPB 3LH2H 2OLDA 4NN5C 6FABL 1KB9K 2LVEA 5KANG 1F97A 3L5JA 3RVTC 1QVOA 1MI5D 1G0XA 1YNLL 1ZOXA 1SJHB 1S7XA 4M8QA 4KJWC 1DBMH 4PR5A 4X98B 1P7QB 1CZ8L 1GPOL 1NMBH 3VXNB 3DV4B 4GLRI 3O2DL 4IJ3C 1CN4A 4YHIB 3U30C 2DLTA 3TBVB 3ZSSA 4WVRA 5K9QG 1FSKC 4TUKH 1E6JL 5E1AA 3H9SD 1JK8B 4P2RE 3FT2B 2PTVA 3QCUL 5F89A 2CJUL 1R0AL 3T0WA 4YH6A 1FVEB 4DGVH 3G6JA 4FXLA 4GJTB 4F7MB 4XHJC 2BNUA 4HUUA 1T20B 4OI8A 2AABL 2ZP0T 4JVWA 3DUSA 4Y5VC 1U95A 4F7CB 2WBJA 1B6UA 1U8OA 4HS6A 3BIAX 1QQDA 2XRAH 4AG4H 3KNBB 4OCYH 3RWIA 4N8CL 3RDTD 1CF8H 4KDWA 4GKOA 1YNKL 1FC2D 4EKXA 1TETL 3MOAL 3P73B 3DVGA 4WWID 1U3YA 4MA1C 2D31A 1J05B 1MAML 3ET9F 4JN2A 3WL9A 4NM4L 2LFGA 3NGBB 4HSQA 4XC3H 5DD5L 1NQBA 5T1KB 4DAGH 5TDPA 1X4XA 5JHDA 2KDGA 4QY8B 5LCVL 5HJ3A 2IQ9H 3NBNA 1LWRA 2DQCL 2C4FT 1JHTA 1OL0A 4OT1L 2BSRB 4XMLH 2CIKA 1RZ8B 4BSWB 3ULVC 3VFPA 5KAQG 4QRRB 1OTTC 5CSZB 4KKLD 1R6VA 1WWAX 2AEIT 1N2RA 1QSEB 4D0BB 1BVLA 4LVNB 2AK4E 5DVNA 3WEXB 4KXZI 1YN7A 3TH4T 3PABA 2DQJH 1TDQA 3CMOL 1P6AB 1WZ1H 5KTEH 4MXVE 3BGMB 1CFQB 5IG7B 5KVEH 1MREL 4LFHD 2FBOJ 3QNXB 4MX7B 1KCSL 5J12C 3TEUA 4Y89A 1FVCA 1NCAL 1RIHH 2H2SC 3UC0H 2R2EB 1H3PH 4V1DE 4XCEA 4UTAL 3B43A 4GRMB 4OCXL 4MMZC 3RI5F 3LB6C 1XCQA 1HZHL 1BEYL 5IROA 2ZNXA 2UWEE 4HKZA 3S96A 2JB6B 5IJVA 4ZOBA 1CFBA 1KENH 5C0AA 1FZOA 15C8H 2G5BB 3GMRA 3DBXA 4OFPA 3M17B 3OR7B 2VLMD 5EUOE 5CGTA 5CD5C 1AD9B 4WNQB 5DFVD 2GCYA 3AAZA 4JRXD 5ERWA 3SPVB 3BPLC 3T1FA 1SQ2N 3INUL 2QQQA 3L7EB 4S2SB 3P4OB 4U6YB 3KPNB 1IGJB 3EDFA 4BQ9A 3JTTB 3VXRD 1B4RA 3BO8B 4FQPA 4PV8B 4TSBH 3RZCD 2VLJE 1IGIH 2BVQB 2W92A 1PEWA 5I6XB 3O41B 1JPSL 2CRIA 5CSGA 5JQ6H 4PJXE 1UM4H 4L29A 5D96B 2Z93A 4BFBD 3NTCH 5EIVA 1TVBB 5F9WB 1DQDH 3S37X 4BJLA 5B39B 4J6RL 2G75A 3ME0A 2EDQA 4UUJA 3MRFB 1RUQH 1B2WH 5KSVA 2AJYL 4MD4A 2HJKB 3GMLA 5DJ6A 5BS0E 1FLRH 2BP3A 2R4SH 5DXWA 4AENB 5C09D 4PJ7A 1YMHA 3FQWB 4M7KH 3O8XB 3D39A 1I9RL 3ZDYE 5KVDH 2BVOB 3QXAB 3S3JA 2X4TA 2ZOKB 3UBXA 4PJ8D 5FB8B 3B5TA 1U8KA 3CFEA 4XPAL 2R8SH 3CXDL 4FQ2L 2GHWB 2OM5A 3MLRH 1QLFB 1XR8B 4QCIA 4OCSH 1YY9D 3HPJB 3LHPL 4I3RH 3FONA 1BHGA 2DWDA 2B1AH 5TPWH 4GAYA 2YBRB 2UVEA 1R5VB 3GB7A 4UMGA 2X70B 4GKSA 3O3AB 2ZKHL 2G9HA 1I3RA 2JELH 2VLLB 5C0FB 4K8RH 2YSSB 1OTSD 2AKRA 4NN5B 3ZLQC 1T0NA 1T1YA 5IVNA 3VXUA 3TESA 5IBUG 3VD7A 3O2WL 2GSGA 5C0JB 3WKML 2XZAH 5GGTH 2JIXB 3V0AC 1QFHA 2J8UA 1QHPA 5EBLB 3N85H 1XF1A 1F58H 1TZHA 1VFAA 2YN5A 3ULVF 4G5ZH 1HK6A 3OR6B 4KKCD 3U30B 5D1ZD 4LLWB 1WC7B 4HKXA 4QXUH 1K3IA 1NFDA 1FSKB 4CDHA 1GGBL 1P4IL 5IEKA 2H3NB 2XWTB 3PWUA 3UMTA 2HLAB 2ICWI 3GSWA 1TFHA 3BP4B 1L7IL 1MAJA 4I3GA 4PJIA 1RPQA 1IAOB 2VR9A 1HYSC 1JPST 1MHCA 2JJSA 3GSUA 1HNFA 3SJVB 4FTVB 4I48A 4PRIB 3BH9A 5AUMB 1G9NL 4KUZH 5F7EL 3TP4A 3OKLA 4Q74A 2WP3T 1UXSA 3L5HA 1C5CL 5JOFA 3FFCA 5E8EA 4ZUTB 2MKLC 3QEGH 1F4AA 4Z0XB 2IAMC 5HPOA 1FZJB 4HS3B 5BVPH 5D7LD 3C08H 1PSKH 2EE3A 2MKWA 1YYML 4OLYL 1MCJA 1F11A 2BVYA 2KQMA 3DYOA 4YAQA 1MCRA 2D7TL 2ZNWA 4I4WB 3B9EA 2HVJB 1F4YL 4RGOH 3RHWK 2VZSA 3PGDA 5D93C 5HHPB 4XNYH 4UILL 3Q5TA 1YECL 3HG1A 4HK0B 2NPLX 3ZTJG 2EIEA 1EZVX 4WWKD 4XP5H 1NGXA 5H35B 2NYYC 4EUPB 2VYRE 3NCCB 5CJ8A 1D6VH 4OZFB 4UBDC 1CFSA 2WUCH 2OX5A 1CU4H 3GMQB 3N06B 1J0KA 4X7FC 2WV3A 3WMSA 2ARJB 1J1XL 3GMNA 5TE4L 3UROR 1NCNA 4R4BB 3JWNC 3TCLB 1JGUH 1IGYB 1YEIL 2DIBA 2Y6SC 2Y36L 1CDUA 1AIFB 3VMOA 1A3LH 4W70A 1SY6L 1CDBA 3RBSA 5TE6L 2X2YA 4YDKH 5HPMB 1KIQB 4UOJA 4IS6A 4YHKL 3RY6C 4KDTA 3S98A 5GRZA 3CFBA 1V3LA 2APTA 3K1KC 2BSED 3L3GB 3L3KB 4Y4FA 5EBMB 3QUXD 1BX2B 4XZUA 3TVMC 3LKOA 2ADFL 2IC2A 5AD0B 3ARPA 4HWZB 4KV5F 4HIIA 1NBYA 3V2AR 1XF5B 3BPLB 4FP8L 1ZA6A 4ZYKB 3L7FB 4QRRE 4NJ9H 5DR5L 2YK1H 3KXFA 4ISVA 4XAWH 1QSEE 5BXFB 2P47B 2EDEA 2R0ZH 5FUOH 1OAXL 1FP5A 3BPNC 1IGCL 3F7VA 4ZMAT 5FKAB 2AK1H 4RFOH 1C16A 1K8DA 4WJ5B 5E99L 3TBTB 4HG4K 2BFVL 3EJYD 3MQIA 2R2HB 2X7LB 5L2JB 1CFTA 1NAMH 3C9NB 2D7PA 4TNVF 4QNPF 1KCRH 4GXUN 1SEQL 4X4XB 1CICD 4P23D 1A7QH 1TVHA 2OR8A 1P2CA 4NCDA 5I30L 4LSRL 5MEQA 4LKXB 1F5WA 2P24B 3Q5YA 3QUZC 4LCCC 2I25N 4C56B 3MZTA 4HWBH 5CD3B 2APWA 1A1NB 4HWBA 3WIIH 1JRHH 1S7RA 4GG8B 3TZVD 5KSUB 3V0WH 2BNRD 4LLMA 3S3SA 4GG6F 3SE8H 2Y06L 3WCYA 5ANMA 4H25A 2Z8SA 1CFVL 5BJTB 1Z9SA 1T21A 3PV6A 4XHQA 3WN5A 7FABH 4PJFB 1X6LA 4RISL 1NCBL 3D3VD 2NXZD 4G8EA 4LASH 1WV7T 2IBGA 5CP3H 1S7SA 5FO9A 5CP3A 5LWYL 1GXEA 1A4KA 5GGUB 4PJGF 2IEPA 2YPLD 3FHAA 4XAKD 3WIHL 2QLVB 3MO1A 1KELH 2CGRH 4N5UA 4U1LB 1UKQA 3U0PB 1CGUA 4GLRH 3EO1B 1S9VA 4AEIL 1CGSH 3R1GH 4JFED 4QRTA 3P4LA 4HUXA 4R7NA 1Y0LB 4YHPA 2G2RB 1RUAH 3B6SA 5HYJD 4OV5B 4F33B 4NKMA 2KUTA 5C08E 1HOCA 3V79C 1E4KC 4YHYC 3C6SA 2IFFL 3IKKA 1FZKA 2XWBB 1PD6A 4ODXB 5LGHL 5E00A 3GKWH 1XGRA 2V17L 5KG9B 2AXFA 5HD8D 2VLRA 5ESAA 3PWLA 3ARFD 2QQKH 1UFUA 5DJ2B 3I50L 2HRPL 5H2BB 1OD9A 4TRPL 4HIJB 3L3JB 3WDHA 3FRPG 4AL8H 2DMBA 3W9DA 1MEXL 1RUKH 3UYRH 5EFIB 4MA8L 4QHKI 1NBZB 2IMMA 3DMMD 2C1OA 5I8KL 3WNPA 4AT6B 4PJGB 4X9GA 3FB5A 5IF0A 4XVTH 5T3XL 5ICXA 4F15C 4FQLH 1PYWA 4Y4KA 1S5HA 1INEH 5HBBA 2Y07L 1URLA 4XMPH 4LDOB 1L4IA 2Q7YA 5HVWA 4XC1L 4P5MB 3QPXH 3SE4A 1K3ZA 4OLXH 5D93B 4RNRB 4ZOCA 4ZS7L 3F7PC 1BVKB 3T0XA 4Y0GA 1BQHB 2GQHA 3HUJA 1CLZH 1WBXB 3H0TB 3MRMA 4UV7L 2P8PB 4OAWB 1GGCL 4D8PA 1A7PL 1HQ4A 4GW1A 1VDGA 4MQ7B 1JWMA 3AGVA 3VXOA 4NKQB 1NAKH 2O5YH 3W5NA 5IBTH 1LEIB 3EYQC 3LRSB 1GYAA 2X9WA 1FAIH 1LEGB 2MHAB 4FTVE 1RIUH 4PRIE 4AEEA 1BIHA 1UKSA 5HHXL 3LIZL 4JY5H 4YHNB 4POZC 1A6WH 4G6MH 5GHWL 5CJ5A 3O6FA 2O5XH 4YHOH 4FQJH 4K3EL 3UDWA 4NM8H 1JZ8A 1A9BB 1A47A 2VNCA 1VGKB 1D6EB 1OCWL 1JVKA 3AM8A 5IOPB 5C92A 3TVMB 4MNGE 1PLGL 3L9RB 4MHHI 4WHDA 1OAKL 1G9NC 3BVNA 3T65B 1I1RA 3O6LL 5E5MB 3SN6N 3HCVA 4OIAA 3ULVE 1XZ0A 1KTDB 3LKNB 4ZS6D 1SBSH 2XI9A 3AUVA 1FC1A 3VE0A 1VA9A 2M8XA 5ACZA 4X6EA 2G5RA 3BPNB 3E2HC 5D1XC 2ILLA 5I71C 5DGRA 4JY6A 1PJ9A 3BUYB 2ZUTA 4Q6IC 2VDPH 4U6HB 4XCNA 2VRAA 4XX1G 5IB3A 3O9WB 5I8CA 1D5ZB 1MCIA 2HKHL 5ALCL 1ROWA 5LXGL 1BBJB 3KHQA 3CFKB 3UYPA 3VD9A 3QJHB 4G80A 5EA0H 5DLMH 1GOFA 5DD1L 3THMH 1P9MC 2A9NH 5DRXB 4LHJB 1WCBB 3STBA 4XNMA 4CVWA 1LNUA 4YDJA 3V6FB 3TBWA 2NTFA 1NCWH 4HKBA 3OHXA 3D0LA 2CO7B 2KBGA 2ED9A 4D3CL 1A4JA 1SVZA 4ZUUB 1WBZB 3KYNB 4IDLA 4FQ1L 4L8BB 4QEGA 3FN0H 3QI9A 4BH7B 2P5WA 1INQB 5LGKA 5FGBC 4NT6B 4NZUL 3ABZA 1T66D 1RVFH 2YKLL 4HH9A 4JO3L 2H9GA 5EC1A 5EZIH 2GJ6B 3KS0J 5HHVL 1M7IA 4XBPA 4BELD 4M1CC 4HJJL 1D5MA 3GIVA 1OTUD 2PYFB 3CMGA 4QXGL 5D7JD 5HHOA 3ALPA 3IJHB 2IBZY 2YUVA 3NIGF 3OKMB 1DDHA 1F4XL 4JFPB 4OLUL 4OV6F 3TNNB 3WFDL 3IFPB 1J12A 2ZJSL 1KB5B 4LQ1A 5IB2A 3PP3K 5DQDH 1F6LL 1PKQE 4XRCA 1KBGH 1TJIH 2GSIA 5EZOL 4Z78B 5IIEA 1A02N 4BA8A 4K55A 2IGFH 4C56E 2FNBA 4DOHE 1BFSA 4RA0C 5CZVL 4NQDD 1QKZL 1GHFL 1T1XA 1WT5A 2ICWA 1AR1D 4E0RA 3TT3L 3CSYA 1BP3B 4MJIB 4MA3A 4AMKL 5HGDA 5DUBA 3BT2H 1T3FA 4KV5E 4KY1H 4PRPA 5C2BL 5I1HL 1KG0A 3QDMA 1WEJL 4NRXB 3KYKL 4ODTH 2GTZB 4RWHA 4YBHA 3QO0A 1SYSA 2A73A 3D2UA 5F7FA 4WHYH 4M1GL 4JDVA 4Z7QF 1NDGB 2HN7B 1S7WB 2IADA 1TJGH 3Q5OA 1S9XB 4CN6A 1FFQA 1F3DH 2XA8L 2JE8A 2X4QA 4LSQH 1HHGB 2MCG1 1C1EH 2ADGB 4QNPE 1WVZA 2ED8A 3C60A 3MV9A 3PL6C 4GAGH 1H8SA 3GHEL 4HULB 2EDNA 2AP2A 5IROC 1NC2B 3BP6B 3BXNA 2IAND 4P4KC 3MBEC 4GKZB 1BJMA 5IMKA 1ORQA 1XIWB 3TBSB 3WFEL 5GIRB 4ERSH 1V3JA 2DBJA 1MQKL 3MLXH 5D5MF 1P84K 4HX1B 12E8H 4O4YL 4TUJA 4GG6E 5IM7A 4LDEB 4APQA 4OFYD 3HI5L 3MJ6A 2BVUA 2OMNA 3BH8A 3QIUC 1B6DA 4S0TD 4JFHE 2VDKL 1EO5A 4WW2A 1RJLA 3MJ7A 3WFHB 4X8JB 1DBAH 4PJBA 5C86A 5FGCB 3VWJA 1OAZL 1MPAH 1CK0H 1QNZL 4HXBL 5IHUL 2YC1A 4HW6A 3RL2B 5J3HC 4PJGE 1A7OL 3K4DA 2X4SA 3RIAF 4ELMA 3TM6A 3C5JA 3FCTA 3PDOA 4WUKH 1WWCA 1XCTB 1T0MB 1HH6A 3T0EA 4J4PA 1UWXH 5T1KD 1G9EA 5C0EA 1OGAB 4WRLA 5I1GH 2H45A 1L7TH 3RU8L 5C0BE 4D0CA 1T7XA 2CLVA 2ITDB 5KVFH 4WO4C 4HT1H 3MREA 1TZGL 3TA3C 4BQ6A 3M07A 1JJUA 4QHNA 3ZT7A 2VDRL 2J4WL 4LSVL 4WTWA 4ZFFB 3GI8L 2FEDC 5JLZB 3SCMB 5HHMB 2VJXA 2WUBL 3MYZA 1RZIA 1XGPB 3ZL4H 3MODH 1AC0A 3BGAA 4EBQL 4Y1AB 1U8PB 5D1XB 5I71B 1DBBH 3D69A 1D5IH 3V4UH 2DQFA 1T89A 4G8FA 2PCPB 5D5MB 5D9SB 1UCTA 3LS4L 4GQ9H 1KCKA 4D9RD 3I75A 3OGCB 4U6VH 3RTQD 1QBMH 4Z5RB 5GRWA 4OCRH 4WU7B 1KPRA 3RUGA 3O4LD 1CXFA 1LVEA 5IW6A 3TV3L 2FEEL 3IETA 4J3WA 4U0QB 5FYLL 5HYQB 2VXTH 1B0GA 5E6ZA 3QUYB 4E9LA 3EYFB 1EO7A 5F1IA 1CT8A 3VXMB 1XR9B 1MLBB 2HWZL 4ZFGL 5J11C 5J89A 5DO2C 3U36A 4JE4B 1K8IA 2JK5B 2CKBA 1Q72L 5CEXB 1X5HA 5H8DA 1QO3A 1PZUB 1OWWA 3BPCA 1YA5A 1FPTL 1NGYA 4YIQA 4EJ1C 3VFGL 3GI9H 2O93L 5E1AB 1SHMA 4DK6A 1K4DB 4LQFH 4UIKH 2I07A 3CGTA 4LEOB 1K6QH 3NCYS 1JL8A 4TSCH 5E2TH 3GSOA 2EKSA 1Q9KA 3A0OA 5IESH 4TTDC 1BAFL 1RU9H 3QEQB 2HTKD 3WNKA 2JJSC 2HA1A 5HY9A 4NHUA 4MAYC 5E2JA 4JM2D 5A2IH 2BHYA 3QXDA 1OB1A 4HZLA 3QDJD 4GSDH 3CX5J 2AV7B 3BKJL 5DK2B 1AR2A 3U2SB 4QGYA 3O6KH 1FCGA 3P4MB 1Z0NA 4G6JH 4JN1L 4U0RB 1I7UA 4RGND 4F2MB 4N0FA 2UUDK 2VL5B 3X3GL 1V8HA 3REVB 4OZHF 5FO8A 1U8QA 1P4BL 4R26H 4QOKB 1A1MA 5KBNC 4UB0H 4KI5C 5K9OB 5SX5K 4BFEA 1F90L 1B3JA 3QIWB 1XF2A 4F7TA 2QQNH 2Y23A 1JZ2A 1IT9L 1FL5A 1FVCB 3TYGH 1HQRB 2ERJC 5IBUB 3EOBA 2WINB 4KDVA 3QZWB 4PJ7F 4N0UA 5T3ZH 4CNIA 3WD5L 3OB0K 4JCLA 3PL6B 2HG5A 3CFJA 4PB9H 1B90A 1QYGL 1OW0C 5D72H 1G7PB 1R3IH 4V2BA 2HFFB 3VDAA 4J3VA 4P4KB 3F7YB 3MBEB 4EI5C 4TNWK 4J8RB 4KDTC 2VWEC 3GGWA 3RWGA 4HQQH 3HNTH 5C0AB 5CIPH 2J88H 4C59B 3NH7H 3CK0H 4Y4FC 4OZGA 3RWHB 1UM6H 4U31A 2FIKA 2R39A 1AO7E 5DK3A 4FQHB 5I1IH 4FFWC 2KH2B 3ZE1F 3IFLH 1MUJB 4NKOB 4QGTA 4TQEH 4HUWB 3QIUB 5JHLH 2X09A 1FJ1A 1ADQL 4XT1C 5ICYA 5SX4I 4S0SD 1T4KB 4DK3A 4OZHB 3SJVD 1VENA 4FABL 2F8XC 3W0WD 3QH3B 4X7TB 4ZPVB 1UB6B 2AERT 4G9FD 4L29B 3V5HB 5CSBA 5CMAA 1U8NB 2XZQL 5EC2A 1HILB 3CZJA 5DZNA 2E9WA 1OAYL 2J8UF 3NIGE 4QXTB 3VXPA 2HH0H 1YC7A 3C09C 3L3HA 2DJ4A 2FYYB 1FFRA 4JHZA 5IB4B 1UXWB 3NOIA 4KRLB 1XEDA 4WO4B 1XH3A 1F13A 1MFBL 1KFAH 2EECA 3TA3B 1NFDF 2DQDH 4IRSB 2HFGL 1QBAA 5FYJU 1EXUA 5D7SL 2XNAB 2VXVH 2VDOH 5T1MA 1CE1L 3AXLB 2IWGA 3DROA 4XXDA 4EN3A 3VXSD 4RAVB 2X4PB 1HKLL 2XOTA 2A6KB 1U3HB 3FZUC 3LS5H 3BP5B 1J1PH 4QKXB 4WFFE 2QJDA 1C5BH 4KK5C 4PJIF 3O3BB 3FO1A 3MRKB 4PGCA 2YWYA 5MP6L 1LO0H 4S1QL 4KKAD 1YEHL 3WN5C 2DWDB 5HYSA 5C8JA 1HINL 2DM7A 4K3JL 5DYOA 4W4NA 5IUSA 3R06B 3GB7B 3O6M