5D7IF

Structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
243
structure length
243
Chain Sequence
IAGITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7iF02
4FFVC 3MLUL 1XGTA 1CL7I 1JPGA 4BSVB 5D7LE 5FYLH 5B38A 3CC5A 4QHMB 1X5XA 4XP1L 4OCWL 3MRGA 4IRSA 4J4PA 4P4KB 3O11A 4J4PC 1QFUH 3ARUA 1A9BB 1KJ3H 1DQLH 5I1AB 1F8TL 1OM3H 5CS7A 1OLLA 2MQCA 5DD0H 5DQ9A 5JO5A 3EDFA 3OGCA 3QUKA 4NQSB 5ALBH 1NCWL 3U4AA 1T0NB 2OCFD 4L9DA 4QRPE 3R0MA 4XPGH 2F15A 4PB0L 4KZDL 3IKCA 1LEGA 4PP1D 5DLML 5GGSA 5HXMA 1MHHB 3RGVD 3SDDD 3PWLB 4JGUA 1AE6H 4R4BB 3ARGB 3NFNB 4QRUB 3K4ZA 4YHML 4LFHG 4N8PA 1KNOB 3RU8H 3AU1A 3VCLA 1P53A 2EXWD 2EYRA 3EO0A 3U1SL 1QSEE 3BKCL 5F9WB 2OR9H 2F74B 2E7BA 5D7KD 1RZIB 3EYOA 5FF6A 2P5WD 1TDQA 1P7KA 3PL6B 4PJ8A 3RVUC 3H9SB 1NFKA 1A9EA 1SYVB 5JUEH 4LLWA 4QRRD 2I60L 1VDGA 4HKJA 1A47A 5FKAA 5SWZA 1UJ3C 3FHQA 4OM0H 1KYOK 2NZ9C 4HV8B 2IFGA 5D7JB 3H3PL 2HLAB 3BZFB 3D2UA 4KK9C 1ZLUH 4RWHA 4D3CL 4NZTH 4JRYE 3P9MA 4K94L 3WNLA 1OOAA 5C7XH 4LMQI 1H8OA 1J5OL 4LCCC 1CQKA 4YXLL 4HJ0D 1I3VA 4MQXC 3HCVB 1Y18B 5GGTA 5E8PB 2QR0B 3HPJA 1K4CA 1HHJA 3B9KB 3EDJA 2GJ6E 3TPUA 1MCBA 1CDHA 4JKKA 1MQKH 1NGQH 5JHDE 3MV8A 2C7UA 5CEZE 4LCWB 3CMOH 1E4KA 5ESAA 3UO1H 1E4KC 4MJIA 3WHE1 1T80A 3ARWA 1ZXQA 4PJCB 4Z95H 3RKPA 4IRZL 1URLA 3NZHH 5T1KB 1F4HA 1NPUA 3IFNL 3DXAA 1YMMA 1XGUB 4FQIL 3KDMA 5E2WL 1LO2H 3X3FH 5I1IH 2Z8WC 5FHBL 1TQBC 2JJVA 2NY2D 3FQWA 4IRSD 2VXSL 3MV9D 1T1XA 4ONHA 1I8KB 4DFIA 1T1YB 2YUXA 4XCEB 4PJXE 5HHPB 2AJZA 2JCCB 4N0FB 4OB5H 5EU4A 5EIIA 3D25B 2FL5B 2NR6D 4ZS7L 3QJFA 3ZDYF 4PJAB 3O6LL 5KVDL 3T3PE 2E8ZA 3IDMB 4GG6F 3GMMB 3SGJA 1RZKL 1QRNA 4DKFL 3DLQR 3SGJC 5D70H 4JDTL 5AAWA 2FEDC 1YDPA 3RL2A 2X1OA 3QCTL 4PY7A 3HE6D 5C0GB 1KB9J 3REVA 4LEOA 4X7SL 4ZXBA 4RMUA 3LKNA 5EUOE 2G5BB 3D39A 4JGMA 4JPVL 1DQQA 3OMZA 4K7PX 3QIBB 3PDDA 5JW4Q 4HGWA 4AL8L 1OF2B 3B8YA 4PYHA 4F8TA 1ZSDA 4JHZA 1V5JA 4TVPE 2J8UF 2L0DA 2OQJB 4LSQH 3B3IB 3S4SB 3VXQB 1U8NB 3HS0A 2EO9A 4PJ8D 4XPBL 2WSKA 2CKBH 5IB2B 1RUQH 4HUNB 2PO6C 2VB5A 4K7PL 2VDQL 5BRZE 1DE4B 1QPXA 2WWMD 3V7AG 1Z9OA 4FG6C 1YEKL 4HGMA 1RJZB 1MCPH 3V0WL 4B5EA 4TYUA 5CZKA 4XWOC 3DYMA 4FTVE 4PTTA 1TTGA 2YUWA 3I02A 4WCYL 4HHAB 3TV3H 1UB6A 1T1ZB 2K3TA 3MLYL 2EKSA 2MPAL 1BJ1H 3GMOA 5EZLB 3SKOA 1G7JA 2NXZC 4O4YH 4ODTH 1AFVH 3FAWA 1V7NL 1GZPB 4G8IA 2XG4A 1D6EA 4X5WB 4X99A 1K8DA 4M1GL 4IRJA 1INEH 3ULUH 4JFFE 4RFOL 4IRJC 2O61A 2DTMH 5F1NA 1QLEL 4P4RB 1P6FA 3STLA 5J6GB 2IMMA 2EH8L 3ARBC 4UNUA 2KZWA 3W11D 5EOQL 1T0MA 2HFGL 1VA9A 5I71C 3L3GB 3U36A 5EOCJ 1KB5L 5HI4D 1OCWH 3DX9B 3EIFA 4ZTOL 1XR8A 2DM7A 1S7RB 1WVZA 2KZ1B 4M7LL 4XC3H 1HE7A 1Y6NR 1R0AL 3NVQA 4KC3B 3V0AC 1NEZG 5C0JB 3O4OB 5DK2A 2EYSA 4YHKH 4HIIA 1GGUA 2GY5A 3LKRB 2E7CA 1JK8B 4DQOL 3HLAB 4X7DC 3VXPB 1WZ1L 3P4OB 3I75A 3HPLB 4Z77B 3FTGB 3P0YH 5DD5H 5C07B 5BMFL 4P46B 3LHPH 5GS0D 4WHDA 1B88A 2QADB 3LY6A 5I15H 1R3HA 1OL0A 4HCRL 2DWEA 1WBZB 3OAUH 3L3HB 5CEZL 5IMKB 4QOKA 1R3KA 2YSSA 5FA3A 1X3DA 5KSAD 3VMOA 4ZXBD 5DJ2B 1RQ5A 4U6TA 4YHOH 1HYSC 3MUGA 4FQQB 4YIQA 4AENB 1J0KA 4FS0A 4GLRI 4CVWA 3QWRA 2CRYA 2GK0B 1MEXL 4XI5C 3ULVD 4PJGF 1HKLL 1DUZA 4Z7UE 1J0HA 3RWEA 4OFKA 1HILA 4Q9RL 4X6BB 3VGAB 1G9NL 2E8YA 2VL5A 5I1DB 4H8WC 3HI5L 4PJDF 1CICA 3ROLB 2H41A 4XZUA 5DQJA 1CICC 4LIQH 1Q0XL 3AB0B 4KV5F 3SDDB 1JUFB 4N8VB 1YNLH 1J8HE 2PR4H 4JRXA 5HHQA 3MCLL 5AYUL 5HI3C 1V8HA 4OD1H 2XWJB 1F6FB 4PS4H 2V2WA 3MRHB 4MA1C 4D9RE 3QXAA 1NCAL 1YEHL 3GSQB 4GW5A 2P4AB 4D9LL 2UY7A 4XH2A 1BBJA 5F7DB 4G6KL 4LVOB 3FB8B 5BO1L 3RZCD 4GQ9L 4X6DF 1WBXA 3F6LA 4P3DA 3HNVH 4POUB 5DVMA 2Z8VC 1YMHA 1CD1A 5IKCB 5TDOA 5IP4A 4S0TD 3GHBL 4URTB 2F19H 3SDCA 1EO7A 4NQXA 3G5XB 3SDCC 4G8EA 2CR3A 1KENL 1A6WH 1ACYH 5HHVL 5KJRH 4WTZA 3FT4A 4KK8D 5D7IB 2BK8A 4L9LB 1B4RA 3KYMB 3P73B 1U8MA 3OR7B 4EIGB 3KPPB 2X4RA 5HDQL 1IAIL 5DFWH 4JCLA 3BKMH 4HX1B 4Z9KB 4Q0XL 1H3VA 4HXBH 2VE6A 4MD4A 4ZTPH 4JFYA 4D0CA 5CGYC 1U41A 3OX8B 3MNWB 3CD4A 1DUYB 4H0GA 5EU3B 5CCKH 2OMBA 3BAEL 1P1ZA 3QYCA 1MH5A 4GAYB 4GAJH 3JXAA 4M5ZH 2V9TA 4XBGA 3CFEA 4GRWH 4NQCE 3X12B 1NMAH 5TPWL 3DX7B 1HHGA 4P23B 1MQ8A 1CFVL 2A6JB 4JVUA 3D9AH 4OZFB 5BZWB 3VXSA 3Q3GB 4FNLH 2LFGA 5IWLA 3CFBB 5T3ZE 3CK0L 2MFNA 3S97C 1SHMA 1XGTB 3WSQH 3IFPA 2A83B 2NY2B 3BN3B 3MRGB 3MV9B 4IRSB 1ZLSL 1S7QA 1YEEL 5GS3A 4MJ2A 1MJJB 4XNZC 3HC4L 2Q8BH 2DQDH 4V2BA 5DQ9B 1IAOB 3MRJA 1P7HL 4UNVA 4ZFGL 3OGCB 4U1NA 1T2JA 3W2DH 1AI1L 1FVCA 4XTRD 4LPTA 4X6CF 1ZHKA 4XHJD 1IGIH 2OS7A 2VISA 2JB5L 4OM1L 2X7LA 3IDJB 2Q76A 4PD4J 4WW1B 5IEHA 1NUFA 3P0VL 4WFGE 1K6QH 3HE6B 1GIGL 3IKCB 1LEGB 1FHGA 1P4BL 3ZE0F 3LD8C 5JW4M 4OF7A 1A7QL 1CFBA 4WV1A 3TWCL 3DMMC 5L8KB 4D8PA 3W9DA 4NCC2 1HI6B 1R6VA 4JRXD 4R96A 5DC4B 3EHBC 1O0VA 5DYOB 2IALB 3PGDB 4Y16D 5CEXA 3AU1B 3VCLB 3V4PL 2CSPA 3WLBB 4TULL 5JMRA 2EYRB 2JELH 4I4WA 3PG2A 1YQVL 2E3VA 4JQIL 3LKQB 4BQ9A 5IR1A 2M8XA 5FF6B 1AY1H 1P7KB 5FYJD 4PJ8B 1MWAA 1QKZH 1A9EB 4LLWB 4TPRH 5TGBA 4F7MA 4GKSA 4KK6D 2GEEA 3LS4L 4RFEA 4HKJB 1JPST 5CJOL 3LEYL 1BFSA 1CXFA 1IGJA 5CIPH 5E1AA 3ZHDA 4WW2B 2RBLA 2DKUA 2YD9A 2VLMD 4OLVH 2DJUA 3P9MB 1BP3B 3O2DL 1B0GA 1DN0A 2NY4D 2X4SB 3H3BC 3K4AA 1FIGH 3G6JF 1UKTA 4Y19D 1J1XH 4RGMB 4O9HL 3DUSA 2F53E 1RZJL 3HPJB 1K4CB 4YHYC 1VERA 5IHUH 3BSZH 5J6HB 1NFIB 3G5ZA 3TPUB 1YNTB 1NMCB 5BS0E 2KBGA 1FO0H 2C7UB 2EDRA 2ZG3A 2X4UA 4ZOCA 1H3UA 4HWZB 1SMAA 5A40E 1IGML 3LPGA 2NXYC 4M02A 4WUUA 4O51B 3U9PL 5I6XB 5I9QC 3VXSD 4NFBA 5ECJE 1F2XK 5C0AD 1LD9A 3BP7A 4K7FA 1I8LA 1KCSH 2ZCHH 3ZE2E 1YMMB 1I8LC 1I4FA 2HLFC 5J1TC 3KDMB 3FFCD 3NCMA 1I8MB 4KMLB 3FQWB 4ONHB 5HHOE 2R9HC 2AJZB 5CJ8A 3N9GL 5EU4B 5EIIB 3KPOA 3JSSA 3QJFB 2VXTH 5I8KL 4OV6F 2NW2B 5D7SH 4OCMC 2IGFL 4A6YH 3OHXB 2BVTA 4ONFH 3MZTA 3TO4A 1QRNB 4L8SB 4OTXH 4ODXA 2AP2A 2BJML 3BVNA 3VXUD 1NFDE 4S11A 1WFTA 1L6ZA 2GCYA 4X9HA 5E8EA 2QHRL 4PY7B 5FGBA 3MUZ1 4V1DE 5ERWB 3REVB 2DM3A 4LEOB 4ZXBB 3KYKH 4X4ME 4OZGE 1NGXA 3PJSA 4B7LA 3LKNB 1DQTA 4QTIH 4XGZB 4AT6A 1JHTB 3TGXA 4OIIH 3O0RL 2XZAH 5BW7A 1LQSR 4K9EH 3PWJA 5BW7C 1UM5H 4HGWB 4WO4C 4N1CA 4HGKC 3U46A 1IL1B 3O4LD 3IXTA 2QQNL 4JR9H 1ZSDB 5ENWA 1OAKL 4RMRA 3HS0B 3L5XH 1I75A 2HJFA 5DHXB 1JPTH 1RIVH 4JG0L 4FFYL 3EOBA 2BVUA 1KELH 4K8RC 4ZFOL 5I1JL 1KCUH 1FGNL 1NCNA 4M6AA 4DEPC 1IGFL 1OTTC 3STZA 4TNWK 4DKEL 4OZHA 2QSCL 2IG2L 3M1BA 4PTTB 3I02B 1U3HA 4J23A 2CXGA 1UB6B 5E99L 5DFVD 1T22A 2EKSB 3MO1A 2OI9C 3GMOB 5J1SC 3TIDB 2FSEA 1G7JB 1NCUA 2D03H 5ITFB 3UC0H 1ITCA 1U91B 2H32H 3MLXL 3GJFH 3C5ZA 1QQDB 1D6EB 3C5ZC 3VWJD 4PRIE 1CN4A 2NY0D 4DKDC 3A67L 1K8DB 4AYFA 1IQWH 4YZFE 2F58H 3S98A 4U2YA 1FSKB 4WDIA 3LOWA 5F1NB 4WI3A 4M7KH 1K2DB 3STLB 3T3PF 3UPRA 4G6FD 3CX5K 4WUUD 2HWZL 2KL6A 1PSKL 4HF5H 3L3JA 1LO4L 4FFZL 3HN3A 1PEZA 1T0MB 1VSCA 1EFXD 1N5AB 3TF7C 4JRWA 3U36B 1UWEL 1XR8B 4X83A 4NIKB 2X05A 5EU6A 3S7GA 1U2HA 3IDNA 5JOEA 2XKSA 4Z6AT 5EUOF 1G7LB 4HIIB 4YO0B 1T5XA 2ZOKA 4JG1H 4BYHA 5KANG 2C4FU 3JTTA 1T5WA 3I75B 3L3IA 1CLZL 3VGEA 3GK8H 1IFHH 1TITA 4IOSD 1CGTA 3MBEA 1N7ML 3HMXA 5DDHA 2P47B 5D1ZA 1BFVL 3BKYH 3HG1A 43C9B 5D1ZC 4QWWD 1JF5A 3TO4D 2AGJH 2VITA 2J6EA 3QNYA 5TQ0L 1H3WM 4M6ML 4QOKB 4HK3J 3MCKB 4Q2ZA 3SCMA 1WGOA 4LSTL 3SCMC 3BUTA 2PCPA 4YPGA 5E03A 3UMTA 4IIQB 1MJ8L 4JFQB 5L2KE 4YIQB 1E4XI 3H3KA 3V8CA 4JM4L 5JORA 4OGXL 4TN9A 4CL7A 3ZL4L 4NRZB 3SO3C 3MR9B 3CFCH 3OAYK 4D0DA 1MCJA 3LMJH 2GSIA 1DUZB 3DPBA 5JIPA 3RWEB 1NANI 5H37G 2CDFB 3U4EA 3UAJD 1OW0A 1CFQB 3PQYD 2RIKA 1OW0C 4Y4HA 5FDWB 4FQLH 4Y4HC 4TQEH 4BSWA 2J5LC 4P3CH 1D5BA 5DQJB 3KLDA 3KR3H 2R0KL 1SEBB 4BQBA 4X5XA 3ZDXF 3GSNA 4LASL 5HHMD 5DMGD 4JRXB 5HHQB 3SDXE 2VZSA 4PJEE 3ARED 4Y16B 1U3HD 2V2WB 5I18L 3QXAB 1PJ9A 1CL7H 1DQLL 4GW5B 5IW6A 5DD0L 3NIDF 1MNUH 2HJLA 1BBJB 5E8OA 4UILH 2ESVA 4HXAL 1WBXB 3QEUA 2I25N 1JHLH 1QBML 1YY8A 3TYGH 3OPZH 2B0SL 3LRHA 4NQXB 4O5LH 1LK3L 1TZIA 4G8EB 1X4XA 4I3RL 3HAEG 1F90L 3FT4B 1L7TH 4M4RA 1M7IA 4HS8H 2OJZH 1SY6A 2X9XA 2X4RB 3EUUA 3BMVA 2NY4B 2WAHA 5J9PA 3WJLA 5KZCD 2APVA 5EU6D 3Q6FA 1IM3A 1X5GA 4JM2A 4XVJH 3RU8L 3WJLC 2UVFA 2Y1VA 4JM2C 1ITBB 3BP5A 1QSZA 4JFYB 4D0CB 1QYGH 2VLJA 2W92A 4LQ1A 2NTSP 3ULUE 5IQ9A 3TH4T 1YN6A 2OR9L 2OBGA 1AXTH 2ZZUT 1PDKA 1VGEL 4TTDC 3QG6B 1MJ7L 3BJLA 2EEDA 3MBED 3CFEB 4XBGB 4EZMA 4Z0BH 4ALAH 3BX7C 4MYWB 4F37K 3EAKA 3GSWA 1HHGB 1AJ7L 3IFOA 2VWEE 3I6KA 4OM0L 3UDWA 2FYYA 5FGRA 2AJYH 3VXSB 3C2AH 3D3VD 3UDWC 3G5VB 3ZSSA 3C5JB 5F7LB 3PGCB 5CUSL 4YE4H 2IBGA 2D7NA 4LSPH 4NZTL 2OXGA 1ZLWK 1CU4L 1LO0H 3E6FA 4WU7A 2EDFA 5C3LD 4OCNC 2PTVA 5GGUA 3EZJB 5IFHL 4ZO8A 2YN3A 5JQHC 1CLCA 1A6UH 3MA9H 4D2NA 1U95A 4ZUWB 2OK0L 5FHAL 5E95B 4ZUUA 3EYVB 1WZMA 3QHFH 4ODVL 2R4SL 1FVCB 4DJMA 1C16A 4GW1A 2BC4A 2W60A 1ZHKB 3EYUL 3UO1L 4JVWA 3UTPD 4JY4A 2XNAA 2Q76B 4LKXB 4QXUL 2LTQB 3LDBC 2QEJA 5B22A 35C8L 1QO3A 1EAJA 2NX5A 3T08A 3GMNA 1T03L 4WV1B 4C55A 1GHFH 3SDYL 1IGCL 4D8PB 3W9DB 5C0BA 1JNJA 1P2CA 5JDSB 4KHXL 1OT2A 2R39A 2I9TA 1ZGLA 4R96B 2DWDB 5JPNA 3QZWA 1A6VH 1DVFD 1A14H 3O3AB 3F12B 1S5IL 5CEXB 5DRZB 4IJ3B 3C9NB 4N90D 3O4LB 4OB5L 4Y1AE 4I4WB 3VDAA 4BFIA 2WUBH 5IR1B 5C71A 2EC9U 3T3ME 1MWAB 5J89A 4KK5C 2CQVA 2FJHB 5IB1A 1IC4H 4F7MB 1BVLA 4RFEB 5DS8A 1TJIH 3UTSE 3K1KC 4MD5A 2X89D 5JOPE 5DA0B 1IGJB 3QUYA 4MHHG 5E1AB 3UTQA 5ANMA 1S7WA 1KEGH 3QUYC 2ERJC 4MS8C 5JTWA 4UT6H 3OG4B 4JFEE 1B0GB 1DN0B 3MROA 4L8DA 4JPKL 4ODBD 2QBWA 4CJ0A 4Y0GA 2XFXB 1PY9A 3U7YH 4M9PA 3D85A 3TIEA 1DSFH 1P9MC 3V6OC 2ZPKH 3QFDA 1X7QA 4XC1H 3VWJB 2NY0B 3HUJF 3NOIA 3Q5TA 5EPMB 2CMRH 2XY2A 4O00A 1RUQL 1ORQA 2Z91A 4DKAA 4FQPA 2YD8A 4KUZL 5C0FB 4OV5A 2H3NA 4WUUB 3TPKA 5KVEH 2DIJA 4WI9A 5FO8A 2SEBA 3TT1L 1EFXB 4O2EB 4KPHL 1LD9B 3KXFE 5DMJB 4M5YH 2MSPA 4N8VG 5JLZB 1MFAH 1I4FB 1PYWA 1I7TA 5D1QA 4PJHE 4NWUL 1YECH 3QIWD 4HIXH 5D1QC 4EQ3A 1ZVSA 1U6AH 1LILA 1AFVL 2HTLC 3ORJA 1UADC 4KMTH 4OQ1A 2R8SH 3KPOB 3QRGL 1RI8A 2VZTA 4Z7VB 4EUPH 1INEL 4KJPC 4Q9BA 5EA0H 4GMTL 2J7LA 3TO4B 1F97A 2DTML 4ODXB 2EIZA 3LQZA 3P77B 3BVNB 5D72L 4KKAD 2GCYB 1JL8A 2HFFA 5E8EB 4ONGL 3RVVD 2VOTA 4G7VL 1ZWIA 2WW8A 4ZYKA 3PJSB 2Y5EA 3JWOH 4XC3L 5CP3A 2KUTA 1HDMA 3V7MA 3MOBL 3C60C 3PWJB 4U6VH 5AG8A 3I6GA 4HDIA 2A0LC 3NCYP 1UXWA 5C09E 1N6VA 4OKVA 4WUKH 5GGVH 1MCSA 4X7CC 2XICA 5ENWB 4PP2A 2VZUA 4NC0B 2HJFB 5F9DC 5I15L 3PQYB 2XTLA 1XGYH 2YS4A 1WZLA 3FQRB 4MVBC 4WFFD 2VQ1A 3UTZB 3EOBB 3PNWA 3OAUL 3UJIL 4BJLA 4OZFG 4ZO6A 2BVOA 4JB9H 5IW1B 3CDFA 5HHMB 4ODHH 3STZB 1Z9SA 4HWUA 2PTTA 2DJ4A 3LEXB 3AREB 3EBAA 1U3HB 1GOGA 1DEDA 2AK4D 3RKDD 4OLUH 1AGEA 4XMPL 3ZE2F 5KN5B 1SJHA 2FSEB 3RAJL 3D85D 1A4JA 4YBQD 3GFUA 5I1CH 4YHZH 1QSVA 3OR6B 3OKMA 4IMKA 3C5ZB 5DUPH 4IMKC 4KI5D 4BK5A 5JW3H 3U2SA 3F8UB 5HYIA 1JRHI 4WDIB 1NCDL 3QIUC 3B4NA 4L8BB 1MFDL 2PYFA 4DAGL 3UPRB 3NPZB 1BAFH 5KOVC 2IH3B 2R29H 3L3JB 1A1NA 1FN4A 1AQDA 4LVNC 5BVPH 3DX8A 1NFDF 2A38A 5GZOD 2FX7H 3NBNA 2PR4L 3BW9A 4NRYA 5DF0A 2AQ3A 1A02N 2Y36L 1YPZE 3LKSA 5FYJL 5KZCB 5EU6B 4OI8A 4OD1L 3BN9C 2RFXA 3QDMA 1U8HA 5ISZE 5MHSE 1ZT4A 4OZGF 4P9HC 1QZ1A 2W38A 2ZOKB 4ZPTB 4XBEH 4J3TA 5GGQL 1MHEB 1T5WB 4XNMA 4XBPA 3L3IB 5LCVL 1BWMA 2FR4A 2UYLA 2B4CH 5GHWH 5TF1H 3MBEB 1ZA6A 2J1KA 5DDHB 1OAXH 3HG1B 5GRYA 1ACYL 2LQRA 1QUNA 3BEVA 2VITB 4F8QA 3KJ4B 4L4TE 2G9HA 3D3VB 1N3NB 3O2WH 4Q2ZB 5EN2A 4OCSL 5EULV 3MA7A 1KF9B 3HZYA 4YPGB 2Q7YA 3W0WA 1FRGL 1E4WL 3BKML 4KDTA 5DD1H 3O3DA 5F8RC 4KDTC 4J3SA 4KXZH 4Z5RA 1CDJA 5T3XH 5INCA 3W82A 3DVNA 2UV3A 1U8PA 3Q1SH 3SJVE 2RGSA 4H26A 4YBLC 4D0DB 2P5EE 2HP4A 7CGTA 4LGRB 4LOUC 1E27A 5HJ3A 4C57C 5GGTH 3RP1A 1CGWA 3WKNA 1ES0A 5DHYA 2IPUK 3T0EC 3U4EB 2E6JA 5DHVA 3VGHA 4MNQE 4R3SB 4YZFF 4BSWB 1D5BB 2AS5M 5LGHH 2VDLH 5I16A 4IOIA 3E2HB 4PJ7B 2P8PB 2YBRA 1KJVA 3BDXA 2EDOA 2Z35B 4U1LA 4E41D 3GSNB 1J0YA 2XZCH 4E5XA 4NJ9H 4U3XA 1DVFB 5ACZB 2X4NB 1T4KA 1CVRA 5LVEA 4YFEA 4AEFA 4UTAH 1KLUA 5IW6B 2DI8A 1CF8H 2DQDL 3KYNA 2HJLB 4CN1A 2X40A 1GCFA 1HHIA 3E6HA 5F88A 5E8OB 4WEMB 3ZT7A 2A9MH 3BKJL 2KQNA 3F7PC 4Z76A 5F1IA 1A1MB 4MLIA 4F2MA 2DQUH 3FB6A 1G0XA 5EWIH 1Q94A 5JQ6H 1IGIL 2ADIB 3CNKA 4GBXD 3KGRA 3VRLF 5C3TA 3O3EA 4JKPL 3FHAA 1N6QH 5I30H 1TZIB 1CTNA 1JHKL 1K6QL 5GS0H 2BHUA 1EEYB 5CJ5A 3EYQD 3KJ6H 1REIA 5DK3A 3TBVA 3D0VA 1DQDH 1CGYA 4NNXA 5ABDE 2ADJB 5J9PB 1I1AA 5AZ2L 4YK4B 3Q6FB 1IM3B 1E0OB 3PP3K 1N4XH 2V5SA 2HAZA 1X5LA 2WQRA 2XG5A 2JELL 5F97E 4LF3A 2VLJB 2F8OA 5H2BA 5IQ9B 2ORBL 3AS1A 3ILQC 5GGSY 5ITBL 2WQ8A 1YN6B 4MXWH 1AY1L 4NHUA 2XRAH 4JDVA 4YDIL 4MCZA 1QKZL 4ODWA 4NRXB 1WWCA 4PIRF 2ITCB 3ULVH 4ETQA 1EMTH 3IFOB 3SE8L 3I6KB 1ONQA 1RK0A 2FYYB 1DQMH 2ADFL 3FFDB 1VFBA 5L9DH 3GMPA 1A3RL 1UYWH 5HVGB 3WUWA 3E6FB 4EN3A 5GGUB 1Z9MA 1YJDC 4EN3C 4I1NB 1EZVY 3OKYA 4FQJL 4KRLB 3BSZL 4PJEF 4RAUA 5FV2A 3O45A 4ZUUB 3QEQE 4I2XA 1LDPH 1S7VB 1C16B 15C8L 4GW1B 2BC4B 4OT1H 2B5IB 4GMSL 2AK1L 2H1PL 3H9SE 4PBWD 1QD0A 3CU1A 1OSZB 2XNAB 4JY4B 3QFJA 1H3PH 4F80A 5CINL 4PGJA 1XH3B 2OTUA 3KLHC 3BGAA 5FOBA 1IAKA 1CLYH 2NX5B 3GMNB 1BGXH 2WWKT 3QO0A 5MI0C 3CZFA 5KTEH 1B0RA 2I9TB 4MQ7A 2JKXA 4W6YB 5JPNB 3QZWB 3R8BB 2W1NA 4AEEA 2ZKHL 4XP6H 4NWTL 4EJ1C 5A16A 2D7TL 4LLMA 2NYYC 3LV3A 5D7SL 2DOCA 3PABB 2V5RA 4YHLH 3HFMH 4LNRB 1Y0LA 4FXGA 5IB1B 4JGJA 3HI6H 4LCWE 3TFKC 5D71H 1AD0B 2CD0A 1B3JA 3I9GH 5DS8B 3REWA 4O02H 4MD5B 1KOAA 3QCUH 3CVHB 3CMGA 2ERJB 4HKXB 3UBXI 3S34H 3T2PA 3FRPA 3LQAL 1A7BA 4L8DB 3MROB 4DOHE 2AK4B 4K9EL 1I1AD 4MCYB 4C56D 1UM4L 4R2GC 4WEBL 4FZ8H 3D85B 3TIEB 3GSOA 2JCCE 4JR9L 4E42B 1XIWA 4ZS6C 4F7TA 3EJYD 1XIWC 4QO1A 3SE3C 3QFDB 1PKQA 2YPLD 4TVSa 4Y5VB 3OKNB 5CILL 1CTOA 3QULB 4WWKA 4Q9CA 4MMZC 3RQ3A 1ORQB 1CGSL 4WWKC 3NGBC 1MAJA 2Z91B 4FXLA 4U3HA 1F4YH 2FO1A 1B2WL 3V4VH 2FB4L 3EYSH 4EVNA 4OV5B 2H3NB 4GKOA 2XA8L 2VDPL 4AEIL 5T1LA 5IJVA 1OGTA 2Q3AA 2BOBA 4P2QA 1K4DB 4JO4L 2OL3A 1PYWB 5EZJA 5M95B 5FGSA 1G6RA 1H15A 3UPAA 4OLWL 4FFWC 2FHCA 4O2FB 4NN5B 1ZVSB 1BD2A 3QWQB 1NAKH 4CGTA 4LLVB 1MCOH 4KGLA 2IF7A 1OTUC 2OXHA 4EXPX 2F58L 5D2NE 4JLRA 3QDJE 4UMGA 2BY2A 2FATH 3L5WB 2VYRE 1T66C 2EIZB 3LQZB 4M7KL 1UKSA 3QWOA 1FG2B 3MRKA 3T3MF 3GBLA 1P4IL 2H2SD 1N5YH 2IJ0C 1BJ8A 4RRPA 2ZUQC 3EFFA 1ZWIB 3P30H 4LHQB 4ZYKB 5LAXA 2E6QA 1SQ2N 5JA8B 1ZE3C 4CN4A 1RIUL 5E9DE 2RCSH 1KJ2A 2HKFL 3WD5L 2Y72A 3I6GB 4G6JL 3O9WA 4HDIB 4F58L 4TOYH 1KACB 1UXWB 4Z7WF 4Z8FL 5F6IC 4KAQL 5KW9H 4CDHA 4Y4KA 1IFHL 3WKMH 4PP2B 4Y4KC 3HI1B 1MLCA 4RA3A 4HUVA 4OF8A 5A2JH 2C1PA 3SKUD 2Y06L 3IS1X 3GGWA 2A1WL 3PNWB 3QDGE 3H9YA 1DBJH 1JPSL 1GZQB 2BVOB 3OAYH 4G3YH 4E41B 2FO4B 1T1WA 1TVHB 4DZ8B 5KSBF 3S5LA 4NQDA 2ZCKH 4NKIH 2PTTB 4OZ4A 5M94B 2H26B 3WEXB 5IHBA 3PF2A 1AGEB 4P57A 4G8FA 5JMOC 4X7FC 1SJHB 5EBLA 2ICWA 2EDEA 3C6SA 4JFPA 3TCLB 1A4JB 4KTEL 3HA0A 2VR4A 4XP5L 2ATKA 4ENEC 4DVRL 3S9DB 4IM8A 5D2LE 1D9KC 1JFQL 4FQLL 5GSRB 3ZKXB 4TQEL 1QBAA 2PYFB 5CBEA 4AQ1B 3FN9A 2EH7L 5EU5A 4U6XB 1EXUB 3KR3L 4LVNB 4M8QA 1A1NB 4S1SH 3DX8B 5T1LD 3LH2L 1PG7L 1S3KH 2R23A 3LKSB 1Z0MA 4KKBC 4Y2DA 2RFXB 2I24N 2DKSA 1ZT4B 4Y2OA 3ETBF 3P9LA 1N0LA 4XNQB 1CL7L 1RHFA 1MNUL 1NL0L 3T8XB 2VC2H 2IQ9H 4HQQH 1YN7A 3SKNA 4KH2A 4XBPB 1T83A 5L6YL 1OT1A 1A7NH 2FR4B 1T83C 5GSVA 4P48A 3O81A 3N1MC 1HIMH 1EVUA 4HKZB 4XAKE 2EE3A 1EO8L 2R2CA 1MWAH 3GJEB 1FFOA 2OJZL 1U8KA 1M7XA 3RWJA 5GJSH 3U0TB 3MA7B 3W0WB 3ARXA 1CD8A 2FEEI 4NC2B 4MXQD 3O3DB 1X5ZA 3S36L 2DF3A 1ZT7A 2MMXA 3WS3A 4M43L 4Z5RB 4OD3H 3B9EA 5IB5A 5GS1A 1FE8H 1IC5L 3WFEH 1EHAA 4QRSA 3O9WD 5INCB 5D8JL 5IVZA 4YBLB 1U8PB 4M7JL 2DMBA 2YEZB 1KSRA 4MA7L 1GSMA 1ZLWH 1TVBA 1KFAH 1EO5A 2CUMA 1ES0B 5DHYB 4Z0BL 5ID0A 3LKOA 3KYOA 1J9CT 1JWSA 1WIOA 3BH9A 1EDQA 1FYTE 2AJYL 1WEJH 4OF6A 1EJOL 5I16B 2AXFB 4IOIB 2OZ4A 4ELMA 5C0CD 3TT3L 1KJVB 4LSPL 3KLSA 4X5LA 1T7ZA 3QH3B 4U1KB 4NUGH 2VZ1A 1LO0L 4E5XB 4F3FA 5I74B 4DUXA 2XPGA 1IGTB 4GG8B 4CJ1A 3TM6A 1T4KB 2AAVA 4JPWH 1FG9C 1KLUB 5C08A 5B4MD 1HHIB 3E6HB 3ME0A 5F88B 3NA4A 4Z76B 2I27N 4GSDH 1PVHA 4F2MB 1IC7L 4JQXC 1Z2KA 5TJWK 3FB6B 1A8JH 2YPVL 3A6CL 2HA1A 3RJQB 1NCBL 3AS2A 1A4KA 1R5VB 5KG9A 2VDOH 2YXFA 4GS7C 1SEQH 1XCQB 3FONA 4LHUD 3SGEI 4F9LC 1HSAA 3BDYH 2AEQH 3F7VB 2X42A 5A2KH 1IM9A 2CIKB 1OY3B 2HFEA 1I7RA 4Z7VF 1I1AB 2O5ZL 1A6VL 5J56B 1A14L 5GRJH 4Y5XA 4C56B 1MUJA 5F44A 2BNRD 4Y5XC 5J7CC 4KDVA 4LAQL 4LF3B 4APQD 1FC2D 5H2BB 4W70A 3A6OA 2BMKA 2EXYD 4WFHE 2YPLB 4UQ2A 4NHUB 3CIQA 4MCZB 2A2QT 4MAUH 4ODWB 4HUWA 1MJUH 2FH8A 4CMMA 4R90H 1G9ML 5C0DA 2QQKH 4MX7A 2FZ3B 4HMCA 4BK4A 1RK0B 3WIIH 2NZIA 2I9LA 3OB0K 5GJTL 3V4UH 1VFBB 1A6AA 3GMPB 4K8RH 4FQ2H 3ZDZE 3BRFA 3WUWB 5MEQA 4GKZA 4MMXC 4EN3B 4EOWL 3U7YL 4X4YB 3GMRA 3IRZA 4PRHA 1Y6KR 4RAUB 2VIRA 3RHWF 4LHJB 3MREA 2IH1A 3L7FB 4DN4H 2VXUH 4ZFFA 4FQCH 3OJDB 3DHMA 5EO9A 1T6WA 1A3LH 3QFJB 5C86A 4QHKI 5SWZE 2OTUB 4M6NL 5JW5A 4H20H 5FOBB 2WBJA 5I8CA 5T3XE 1RUKL 5F21B 3QO0B 3RWDA 3CZFB 4RDQF 4K71C 3KS0J 1B0RB 2YA2A 4GH7B 4MQ7B 2BSSB 1NJ9A 4S1RH 1S78D 2MHAA 3VU2A 1SBSH 3CZJA 3WNNA 4RGND 4PJFB 4M9OA 5A16B 3O6ML 2NXYD 1Q9OA 2GITA 3LV3B 3MRQA 4H88L 3MV8E 2P48B 3INUL 2LVEA 1KGCE 1C5CH 3R1GL 1Y0LB 4FXGB 2WLZA 4TRPH 4X9FA 1YEIH 1A2YA 3B2UD 1U3ZA 4NKDA 3X14A 2BDNL 4JPIB 4MJIE 4XCNA 5L0QC 3BD3A 4YUEH 1NMBH 5IBTL 1JZ3A 4NM8L 4X7EC 1AIFA 2FJGA 4KKCD 2QQQA 5TH2A 1EFQA 3DXAE 3FQNA 3JWOL 1YMME 2J6EH 2GUOA 4KVCL 5EFIA 4EDWH 3ZKMD 1ORSB 1MCWW 2BOCB 5HYQB 2R0LL 4AQOA 3PWVB 1FGVL 2VDKH 3MLTA 4WUKL 5FKPA 5BV7L 5T5NG 1INQA 1ZHLB 1PKQB 5AWNH 3C09C 5CP7A 1D5XA 1XGYL 3NGBB 4YGAB 1QRNE 1UKQA 2EDDA 3T0XA 4M62L 4R4FL 2E27H 1JP5A 2HT4C 1QR1B 4NGHL 4WO4D 1RUAL 1BEYL 1MIMH 5T1LB 5EZOL 3CXHJ 5AAMA 1OGTB 3D39E 4IDLA 4P2QB 2AXGA 5LBSH 2OL3B 2XOTA 4DGYL 5EZJB 3FL7A 3LN9A 5J3HD 3SQBA 3ZKND 1MFEH 4GXVL 5JOFB 5DEGB 3GSNH 3RUGF 4PRHD 5L88H 2IQAA 2YUVA 1OTSD 4HUUB 4LVHB 4BFGA 3L5JA 5JW3L 2Q86A 4ODSH 4JLRB 3VXMA 3VDBA 5EOCH 3MOAL 1V3MA 3TH3T 3MRKB 4RWYL 4LBEA 2ZUQB 3K3QA 4N9OB 5BVPL 2FX7L 2DLFL 1XF4A 2J8UA 5TFSH 2WBJD 4DWHA 1Z3GH 4P2OA 4J1UA 4PTUB 1I9RL 1TTUA 1JZ6A 1SY6H 4JANA 5CZVH 3S3JA 5IQ7L 2LV4A 3QJHB 3O9WB 4WRLA 4I9WE 5T1DL 6FABL 3BGFB 1PG7W 4HUXB 1QBLH 4OI9A 4OCRH 5AEAA 3RDTD 2YZ8A 4F33A 4MZ3A 2CKBA 3SDAC 5TF1L 4HBCH 4TNVK 2QQLH 4HUVB 4MQSB 1JBJA 4BELD 5I19L 3O8XD 5C0CB 2VNCA 1T1WB 2VH5L 4N8CH 4UIMA 3S5LB 4NQDB 1RURL 3TBSA 5HYJD 3AUVA 3IJYA 4CVXA 1F4AA 3O6KH 1TJGL 1RULH 4O58H 4P2CG 2AEPH 4G8FB 4YWGL 1U8QB 2ICWB 1OLZA 3IGAA 3IXAB 3C6SB 1NCCH 4CVZA 1HHHA 1IMHC 1X5HA 2ATKB 4LDLB 4F7EA 3L3DA 1EUUA 1WAAF 3ULUC 5CFHA 4MJ5B 4H1LG 4W6XB 4M6OH 1W0VA 3GNMH 5KBNC 3MRIA 5CBEB 4UT7L 5KVFH 3NH7H 5CSZA 1UZ6E 3OKKA 4LHUB 1NSNL 1J88A 4QOKE 4PJ5A 1GGIH 3C6LA 4M8QB 4Z0XA 1GGBL 3C6LC 1OARL 2BNQA 4QKXB 4KJWC 3U30B 3KYAA 3VRIB 3PWPA 1OGAA 3I3BA 5E8NA 4NJ9L 2CJUH 4F57H 2R23B 4JREC 3NPSB 1UCBH 4Y2DB 4ZNCD 1IAMA 3MMEA 4ZO7A 2BNRB 5CBAB 3QZWG 3SGKA 5HYFA 3K80A 4ORZC 4UTAL 5E2TL 3RJDA 1FNGA 5DD3H 4H0IA 4APQB 1NEZA 3SGDI 1RJLA 3H8NA 4LARH 1NGPH 3N50A 1VFMA 1KCRH 3WFDH 5GSVB 4PV8A 1FVDA 5HVWA 2IFFH 1BECA 2WBWB 4OSUH 3PP3H 4AIOA 2C3VB 3FZUD 1FFOB 4HEPG 4QNPE 1U8KB 4DGVH 4XPTL 4QHKJ 3GIVA 4CADA 5K9JL 4JRXE 5AUMA 4HUMB 3V6ZB 3TZVD 4P2OD 4KGJA 1JYWA 2WINA 4AMKL 1AO7A 1KXTB 1ZT7B 1BQLH 1ED3A 1TENA 1UC6A 4FMKA 5GS1B 3NFPA 1CFSA 1DBAH 4L3ED 1R3JB 1NLDH 4OI7A 4MXWL 3BIAX 1MRFH 3BH8B 3WXVL 4XNYH 5EH1A 3T1WA 5ID0B 5D93C 3KPRA 2BY0A 3KYOB 3LKOB 1EMTL 3BH9B 4D0BA 4KTYA 4ZO9A 5D2LF 5BXFA 1DQML 2AQ1A 2VDNL 4ELMB 5IVXF 2VLME 2YHGA 1CFNA 4X6DA 3QNZA 4XP9H 4C83A 1NGYA 3O6FD 5KAQG 5CMAA 5T1MA 1G6VK 4RGNB 5E08H 3WO4B 4HS6A 2HRPL 4QRQA 1MF2L 3KHOA 5DA4A 2APWA 3B6SA 1GC1H 4YDKL 3TBWA 5J11B 2C3WA 4JO1H 1GGCL 5FUZH 5ID1A 5ICYA 1H3PL 3EOTL 5D9SB 1LNUB 1A4KB 5ICZB 2VDMH 3EFDL 3FONB 4FXKA 1CLYL 5F7KC 2C1OA 1BLNA 5HGAB 1IM9B 5HPMB 4Y5YB 4YX2H 2H2PC 3EW3B 4NKOA 1JZ5A 3SHSA 4M93B 4MGXA 1NGWA 4G5ZH 1OD9A 1F6AA 1WSST 1BVKA 2P8LB 6CGTA 2VLRA 3ARPA 3MRCA 5CP3H 2BMKB 4G8GA 1WCBA 1JNHB 3P0GB 3WNMA 4UQ2B 4RNRA 2NY5H 3HZVA 5BOZG 3HFML 5DO2D 3EOAA 1KUMA 4CMMB 5C0DB 1ZLUK 4GO6B 3U0WL 3T77A 3I9GL 1MY5A 2O5YL 1BQHG 4XHQA 2HRLA 1NC4A 1HYRC 3BP6B 3WFCH 2A73A 4PLJC 3VD5A 3MRRA 3RIFK 5DJYB 3P11H 1RY7B 4HT1L 1W0WB 5MEQB 3T0BA 4M1DH 4PGBB 5F7NC 3C5SA 3T2OA 5BVJA 4FZ8L 1L0XA 2AJVH 3GMRB 4PJBF 2Q87A 4PRHB 1NGZA 2Z9TA 1FZOA 5LGJB 4WFEE 3HB3C 2WUCH 4JZNA 3IJSA 3MREB 1AHWC 4UOW0 4JN1H 4RZCB 2BVQA 3QEHA 4ZFFB 4FQ1H 4JAMA 3KPRD 5EO9B 1F4YL 5E2VL 5GZND 5IOPA 1F4XL 4K3DH 1JWMA 2QL1A 3N85H 4KQ3H 4L4VA 5M7QA 4W68A 2XXCB 4Z7QE 3DO7A 2ZJSH 4R8WH 4H8WL 2WBJB 4Q74A 4JFHE 3JV4A 4I5BA 1A5FH 3RWDB 4P59L 3QI9D 1BOGB 4WEUD 4YXHL 4NNPH 2GHWB 1YY9C 1MFCH 2HH0H 1RMFH 1WITA 1RZKC 4YHNA 3MJ9L 4HEME 3CVIL 3KPTA 3MLSL 3RDTB 3MRQB 1W72B 1N2RB 1VENA 2JB6B 2WIIB 4KQ4L 2FECI 2BNUB 2OMNA 5E2UL 3L1OH 2IBZY 2YD3A 3L7EA 4PLKD 4NKDB 3X14B 2IANA 4RAVA 3G6JA 4JFDD 4WUUE 4NN7B 2PW1B 3E0GA 4LLYB 4PYGA 1HNFA 1FC1A 3PGFH 1KT2A 3TJHC 3QPQC 2FBOJ 5HYJB 2FJGB 5TH2B 1LO3H 3BPCB 1M6OA 1FFPA 2GUOB 3I85A 2B7DT 1WBYB 5EFIB 3WE6A 5JIHA 5I75C 1EUTA 4MA8L 3GSVA 4TOYL 4CMHC 4QXGL 1H5BA 4BH8A 2YRPA 1H5BC 1TNNA 4JO3H 2E9IA 3FQTB 5KW9L 4P2RD 2GAZB 1INQB 3X11B 2XA3A 5MEND 3CSBA 3WL9A 3OF6D 5EZIH 1D5XB 1HXMA 4M1CD 5HYEA 2HG5A 1GVIA 3TNMA 2DD8H 4LSSL 1EHNA 1TZHB 4OJFL 4U1GC 3TO2B 3RA7L 3HC0B 3QQ4A 2FD6H 1IJ9A 4UDTA 1FQ9C 5DMIL 5TE4H 4G9FA 4R4NC 2ZCKL 1QFWM 5SX5K 1ZANL 5DHVH 2AXGB 1JTOA 3OKOA 4DCQA 3K2UL 5DWUH 4GG6B 3VI4F 5A43C 1XF2B 1KBGH 1J05A 2QSQA 1E4XL 5CD5C 4R7NB 3M17A 1GRWA 4JVPA 5TF0A 2FJFB 2F54D 4AIXA 1MRDL 3GZKA 4XP4H 1PQZA 3ISWA 2A6IB 2AABH 1F3JB 1IARB 4LBEB 2JJSA 2V7HA 2VXVL 3BI9X 3K8KA 3DUUA 2JJSC 5HHME 3KPSA 2J8UB 1YNKH 3TZVB 4P2OB 4J1UB 3OXRB 4OZHE 1CZ8L 3MFFA 5MEOA 4LKCA 5SX4H 1DBBL 2VABB 4M7ZC 5JNYA 3BIKA 4JANB 1KLFA 2L4OA 2VLKA 4HCRA 4L3EB 1XF3A 1XCTA 3HRZB 3VD7A 1RZGA 1E28B 4R26L 2X1XR 5CJXA 5HVHB 3MYZA 3GKWH 4KTDL 3LIZH 2DBLL 3RWIA 1QA9A 5IK3B 2W9EH 2W0LA 5IESL 1ZLVK 2YXMA 3K46A 4Q7DA 3VXRA 3AY4A 3PDOA 3GSXA 3AY4C 3ET9F 4UBDC 4UIMB 5D7LD 1BZ7A 4JFXB 1KC5L 1KCVL 3TBSB 4KRPC 4WI7A 4CVXB 1C12B 3O6FB 3WUWG 2X4QA 3MV7A 1FE8L 4MNHA 4BSVA 4CBPA 5TE6L 1MCFA 4NQTA 3IGAB 5DT1H 1G9NC 3NAAH 4DTGL 3TN0A 4CVZB 1HHHB 4P4KC 2V7NA 2XKNB 1YJDH 3V6BR 2HFTA 3L3DB 2AJXH 4MSWB 5FYKE 3ZTNH 3OXSB 4V2CB 4ESKA 3HG1E 3GHEL 3VFGH 2HT3C 3WLWC 1N8ZA 5JXAL 3MRIB 1L7IH 2E7MA 5CSZB 4K2UL 3OKKB 4PR5B 1K85A 2XQYG 4PJ5B 3C6LB 4Z0XB 1BFTA 2ZOLA 2J4WH 4NUGL 1RZ8B 5E8NB 1OGAB 1HHKB 2NY7H 4K3GA 1FAKT 1U0QA 1I9JL 3V5DB 2G5RA 1UFUA 4DFHA 3GI9H 5SWQB 1XEDA 4OQTA 1QSED 3RX5A 5CKAA 2XQBH 3NFNA 4O2CB 1RZ7H 3ARGC 1CR9H 1NEZB 1KNOA 3R06A 1RJLB 4ZSOB 5E8DL 1QPPA 2AJSH 4JHAH 5DEZA 3ZHLA 1FVDB 4OFDA 3DV6B 5F9WC 2FX9L 2X10A 1A7OH 1RZIA 3QG7H 3S88L 4G7YL 5DJ0A 1SYVA 2R4RL 2DQJH 5MP6H 3RNQA 2VZOA 1WUNT 2YKLL 4JRYD 4PJFF 4W4OA 3DI2B 3GIVB 2FGZA 1KEMH 3MLVL 4HK3N 3DBXB 4PJGB 5D7JA 1BX2A 3SGEH 5D7JC 3LAFA 5B3JE 3BZFA 4HPYL 2YD1A 2FNBA 1ED3B 2APXA 12E8H 1C08A 2VXQL 4W6WB 4ERSH 4LU5L 5JHDD 4NM4H 1VKXA 1A7RL 1Y18A 4EI5A 4PJDB 5CEZD 2ESVE 1B4JH 3B9KA 4X8XA 5GPRA 1MVFA 3B9KC 1OSPH 1MJUL 3A6BL 4ODUB 4R90L 3KPRB 1J1OH 2X4OA 2QQKL 1T6VN 1FNFA 3IDYB 5HDBF 5SWSA 1Q72L 1ADQH 3MODH 1PKOA 5HSFA 3WNPA 2G60H 1MCKA 2CDGA 1C1EH 1F4WH 4KROD 4PJCA 4K8RL 1CFNB 4X6DB 1OAQH 3S37L 1D5IL 3QI9B 4U6HB 5T1KA 1NGYB 2DLIA 1G0YR 3ARQA 3OAZK 5CMAB 2VLJE 5B39G 1L4IA 4HS6B 2E7LA 2OL3H 1BJ1J 1I8KA 3F58L 1T1YA 2E7LC 1G6RH 3QQ9C 3TBWB 3TN0D 5HHPA 4N0FA 3QUML 1QVOB 3D25A 2OYPA 4YQXH 2FL5A 4KVNH 5ID1B 2WWKO 4PJAA 2Z31D 3AC0A 3UEZA 1QSFE 4JFDB 3IDMA 1WFOA 3MBXL 2APFA 4UINL 1KXVC 1BJMA 1KN2H 1M4KA 1C5BL 3FCTA 1OAYH 4N0CC 1J11A 1LP9F 3DX6B 3HAEA 4X80H 4FXKB 1JGVL 4L5FL 2C1OB 1BLNB 2BSED 5AZEH 5C0GA 2XTJD 5JHLL 1A7PH 2N7AA 1RUMH 2O5XH 4QNPF 1L0YA 4NKOB 3RVWD 1R5WB 2WIMA 2G5BA 2H8PA 3RWFA 2LE9A 4TVPD 1NGWB 5E1HB 1F6AB 1KIQA 3AM8A 3NCFB 2RHEA 3QIBA 4P2RB 3QIBC 1J18A 3MRCB 4G8GB 1WCBB 2J8HA 1MHPH 1KJ2H 4P5MB 3HZVB 4JFZH 5BRZD 1YEIL 2DICA 3O2DA 1S9KC 2ENYA 5I76B 5HHXH 3CXDH 5FYKL 5IB2A 1J8HA 3HMXL 4WI2A 1FL6B 2YMXL 4X9IA 1QP1A 4M48H 4FTVD 1CGVA 1VEOA 1YQ2A 1X6LA 2DQHL 1LWRA 2NX5E 2A73B 3RWCA 2J6EL 3MRRB 3WHE0 1RJZA 5C0BE 3LN4B 4X6CB 4OZIF 2FBJH 4K3HA 2DQEL 2BY3A 3C5SB 2CGRH 2GJJA 5BVJB 4FABL 4HHAA 3QA3B 1NGZB 1T1ZA 2CDEB 3UYRL 3D69A 4EI5D 3GI8H 3IJSB 5AWNL 4JFFD 3RX8A 1JGLL 5HD8C 1RV6X 5TQ2L 4BZYA 2BERA 2BVQB 3QEHB 2P8MB 4JAMB 3MRDA 1FNSL 4TSAL 5IOPB 3FRUA 4POZD 3MJ6A 1QLRB 5FM5M 1JWMB 3K0WA 2AJUL 4U6YA 3DO7B 4LHUG 5KVGH 5ANME 4HH9A 1H3TA 5ICXB 1IKFL 3ULSA 3HNSL 3IDIB 4LSVH 3V2AR 3DX9A 5I2IB 1MY7A 2WK2A 3JWDL 4F7PA 4HD9A 1MAKA 4YHNB 1FLRL 3AFLA 4QY8B 5C0JA 4B41A 5A1AA 3MXVH 3WDJA 2GKIA 3O4OC 4NQCA 4WNQB 5IGXL 1CE6A 3W9EB 3HLAA 3HMWH 5I1GL 3QSKB 4OLEA 3VXPA 3HPLA 4U31A 3U82B 1GOHA 3L7EB 1JNLL 2IPTH 2IANB 4P46C 5IFJA 4JQVA 2QADC 1JRHL 4R9HA 4FFWD 3FO0H 4OFVA 2BSRB 5LXGH 7FABL 1WBZA 4UIKL 2W0KA 1T7WA 1KT2B 5D7LB 3UTTA 3L3HA 3RVXD 4XB7A 3TJEH 4XCFL 5IMKA 3LSOA 1M6OB 1FFPB 3HUJA 1HZHH 4KJQD 3V9FA 2BFVH 3X3GL 5DJ2A 3CPLB 1FPTH 2G75B 4NCDA 3C08H 1H5BB 5CWSB 2FLBT 4GAFB 1X44A 1G7MB 5I1KL 4ZFOA 4OCXH 3G6DH 4KRNA 1WZKA 4HBCL 1KULA 2J8OA 2QQLL 2DKMA 5C0IB 1GPOL 1CG9B 1HXMB 2HG5B 5FO9B 3TNMB 3TP4A 1H9VA 4N5ED 4TSBL 1AP2A 4HJJH 1U9KA 4I0CC 5EC2A 2R0WL 3QQ4B 1EGJL 2DL2A 4HIJA 4UDTB 1J8HD 4GW4B 4EDXB 3H6JA 3VGAC 1CIDA 2YK1L 4I77L 5GIRA 4ZAKD 5EO1B 2J88H 3O6KL 4PP1C 3RGVA 3OKOB 4D9RD 4F37F 1FORH 4N8VA 3SDDC 4PFEA 1QSEB 2OZ4H 3MYJA 3F65A 1YYLL 4G6MH 2EDQA 1J05B 2XWJA 3MRHA 4N0YH 1FV1A 3M17B 3V5KA 4WTWA 2EXWC 3AXLB 2M1KA 3B2VH 4XMLH 5JIKA 5F7DA 1O5DT 3UJJL 5KANI 3L3KA 1KB5B 4LVOC 3UCRA 1S7SB 1G0DA 4M6OL 5ESQA 2P5WA 5E6YA 4WIQA 5JPMA 2EYTB 3VFMB 2C5DC 5T5FL 4QRRA 2YZ1A 5F7FA 1QBBA 5A3ID 2UVEA 2BP3A 2V7HB 4JRYB 2NPLX 3RX7A 5KS9F 2V2XA 5D7IA 3L5IA 2L7UA 2CJUL 3HR5A 3G6AB 1UCBL 1NLBH 3VMNA 3KYMA 3MFFB 3P73A 5MEOB 3WFBL 4L9LC 1CLOL 4K07A 1ETZA 5JNYB 4JJHA 2DQCH 4RIRB 3THML 8FABB 5JHDB 4HX1A 1XF3B 3F7QA 4HJ0C 1XCTB 2KKQA 5LKNA 8CGTA 1NGPL 1QLFA 1RZGB 3RL1A 1BFOB 5L7XL 1P84K 1YEJH 4OF3A 2B2XH 3TA3A 2Q20A 4NQCD 4ZUVA 1SVCP 1DUYA 3DSFL 5JR1L 3SGDH 1DTUA 3H42L 4M4PA 3LN5A 5FCUH 3KNBA 4Z7NE 4XXCA 1F6LL 1QA9B 4OUUA 4XXCC 1JZ8A 3DTXA 2VAAA 3X12A 4XNUL 5GRWA 3D5OF 4KROB 3BZEA 3VXRB 2A6JA 3GSXB 2Q8AL 4OZFA 2LAAA 3T2QA 3UTTD 1BZ7B 3VMPA 5IFAH 2B1HH 2EE2A 4UI2A 3EJZD 3M8OL 4ZODA 3CFBA 5IV2B 3TESA 2D7MA 2HTKD 4AIZA 3QDME 4JKMA 1CE1H 3MV7B 3HE7D 4YC2B 2DQIL 4MNHB 1AGFB 1DBAL 2A83A 1KN4L 2Y7QB 1NLDL 3MV9A 3TEUA 2NY2C 4IRSC 3AAZA 4UTBH 3TN0B 2V7NB 4LSUL 1RU9H 4XNYL 1MJJA 4RFNB 1EAPB 4L3AA 1NFDA 1IAOA 2F5BH 1ZVHA 2A9NH 2NR6C 4WFGD 2Z31B 3WV0A 5BJTB 4V1DA 3MNZA 4R7DA 5D6DA 5GRUH 3DOSA 4L3CA 5D6DC 1N8ZB 1R3IL 3LS5L 4NFDA 5EUOB 4OLZL 2IBZX 3IDJA 4ZPVA 4WW1A 3WYRA 2W9DH 2FIRT 5DURD 2P49B 3HE6A 3BEWA 2ZOLB 2XTJB 3L9RA 4XX1G 3HE6C 1K8IA 1T2XA 1MRCL 3W0WE 4AEHH 1VPOL 4RMWA 5FUOH 1F3DH 3HZKA 2EDBA 1IRAY 1HI6A 3EO9L 4OZHF 4IHOB 1VFUA 4PUBH 5DYOA 2IALA 3PGDA 3R06B 3WLBA 2B4CC 1JMXA 5DJ8A 4LP5A 1FLTX 1U92B 2BHYA 1N6UA 5BRZB 3T0EE 3QXWA 5FUZL 3LKQA 4PGEA 5FM5O 5C2BL 1CXKA 1YUHA 4PJ8C 4PG2A 5DJ0B 3L3OA 1F00I 2VDML 4PG2C 3RNQB 2XN9A 4NHCH 3IDXL 1UM6H 5A2IH 1PEWA 1PD6A 3QEGL 3PP4L 2F53D 1BX2B 4WW2A 1ERNA 4WW2C 3ARDD 3MLZH 2X70B 2ATPA 3LZFL 1C08B 2X4SA 3VG9B 1J7VR 5BS0D 4PRIA 4YHIA 1VKXB 2NY1D 4RGMC 5TE7H 4EI5B 5IUSA 1N26A 3TA3D 3WNKA 5EO0A 1NFIA 4HLZG 5J6HA 3MJ8A 1YNTA 4XRCA 5J1AA 5DMYA 2X4OB 1NMCC 4MAYD 5SWSB 1ZVYA 4HLZH 4HWZA 4M3JA 5B8CB 5E4IA 2CDGB 1TZGH 1DLFL 1AQKL 5F89B 5GRZA 4O51A 3OG6B 3GSRA 5I6XC 4XAWL 3RTQD 3W11C 3QUZA 4RMQA 1W8NA 1HQRB 2I5YH 5HI4C 1P7QD 1V05A 1I8MA 3CSPA 3ZE1F 5LQBL 3ARFA 3NABL 1YEGH 3U7WH 1IQDB 2R56H 1E6JH 4JN1L 2XZQL 5H8DA 43CAA 4XWGL 1MI5E 2FHBA 4X7TB 2NW2A 3SQOL 5T33L 4K3DL 9CGTA 3MGTA 2JJTA 4V1DD 5GS0C 3V52H 3OHXA 3RY4A 4HPOH 4L8SA 3W5NA 4DK3A 3FCTB 4L8SC 3HAEB 3MQIA 5GRXG 5DR5L 1A5FL 1K3IA 3QHZH 4G80B 4KY1H 5ERWA 5KSAA 4WGVB 3MLWL 4KUCD 5KSAC 3ELAT 4ZXBC 4ISVB 4XGZA 2H8PB 3RWFB 1MELA 1JHTA 4UUJA 1KIQB 4UNTA 5B3JF 2AEWA 4FQXD 3ZKSD 2DIBA 4P9HL 4I2XE 1IL1A 3VFTB 2MCPH 4HAGA 2DYPA 1KG0A 5DGRA 3ULVC 1TQCB 3ILPB 4N0UE 4UDUA 3QFJE 1VCAA 2R0ZH 4XNXH 1J8HB 4PJ9D 1Q9KB 3GIZL 2XN9D 1NAML 3MRFB 5C0ND 4ZAKB 1EJ6A 1OQXA 3VD3A 3KPNB 1LO3L 3OJVC 3RWCB 1I8IA 1RAMA 3VGBA 1RFDL 3QR2A 4NZRH 3PWNA 3W5MA 4LLQB 4XVTH 1Z6JT 4PG9A 4PRAB 4Y7MA 4GAGH 4M3KB 4LRNL 4PRID 2K7PA 4JM2F 2YRLA 1NBVH 3MXWH 1Q8MA 2D4DA 3D69B 3TIDA 5IBUG 5ITFA 1KJMA 5SX5H 2HKHH 1U91A 1BM3H 3RZCA 5EZIL 1Z5LA 4QHLB 3RZCC 4AG4L 4LQFH 4FZEH 3MRDB 1QQDA 3FOMB 5DJDA 1AC0A 3FRUB 3SKJH 3E3QC 1FSKC 4U6YB 3VFUA 5FUCC 1K2DA 1HINL 2IPKB 3O3UN 3UJTH 4HH9B 4KK8C 3FQUB 1AH1A 3B43A 3ULSB 3T04D 3LEVL 1SM3H 1N5AA 2PNDA 4XVSL 3QUZD 4OLYH 4GXUM 4F7PB 1I3GH 2H9GB 3ARFD 5DEFA 3QP3A 4DW2L 1G7LA 1F58L 4NQCB 4YO0A 1CE6B 1IZKA 1PKQE 1LHZA 4IEFB 5HBBA 1JWUA 2NLJA 3WS6A 5HGDB 4QT5B 2HVJA 2OP4L 2PUQT 4AZ8A 1EH9A 5IFJB 4RMSA 43C9A 3DECA 2P43B 1CQYA 3UTTB 4LSDA 3IFLL 3LSOB 1N59B 4P2QE 3MCKA 3FMGH 3HUJB 3CDCA 3HRPA 3CLFL 5ADOH 3HE7B 1FAIL 4YDVA 4HFUL 1CK0H 1BD2E 4IIQA 1ZLVH 4JFQA 4IIQC 1BF2A 4QXTA 4P2YA 3DGCR 4ZFOB 1JGUL 4S1QH 1KYOJ 4LAJH 4NRZA 1C7TA 3IU4H 4HC1A 3MR9A 1OAZL 3UX9B 2DYPD 3GKWL 5I17B 5IMOA 3O2VH 3RWHB 4XTRC 5C6TH 1AP2B 2CDFA 4XHJC 3BRGC 1CFQA 5EC2B 4HIJB 5FDWA 2C9AA 1IAIM 3TBYA 5DURB 3MLUH 2Y23A 5GIRB 5F96H 3IU3A 3H0TA 4XP1H 4OCWH 2B1AL 3RGVB 1SEBA 1EHLH 5D1XD 1N0XL 1F8TH 3QNXA 3FKUS 4UOJA 1B6UA 3MYJB 2FEEL 2X2YA 2GJZB 4PPTA 4Y16A 5HI5D 3NAAL 4Y16C 5IM7A 1FV1B 3V5KB 2VR9A 4LL9A 4FP8L 3ZTNL 4IDJH 3NCEB 3L3KB 4KZDH 5ESQB 5JPMB 2P5WB 3VG0L 4GRMA 2DM4A 1G1CA 3VJ6B 3K7UA 3BXNA 5DLMH 4YDLC 1L7IL 1AR1C 4PB9H 2EIBA 4QRRB 4TVPL 4XVUD 4KK6C 3U9UB 2AJ3B 4NQEA 4ZDHB 4Z7WA 4NP4L 2V2XB 4L1DA 2VR5A 4NQDE 4YHMH 2F53B 4HWBA 3HR5B 2D7PA 3ARDB 4KXZI 1U8OB 5E00A 3GI9L 1ETZB 1SBBA 2DL9A 3CGTA 4WY7L 3U1SH 3ULUD 3BKCH 3VXOA 2NY4C 1VGKB 4Y19A 4OBRA 1QLFB 3RL1B 4Z7OE 4WGWB 1RK1B 3TA3B 4OAWA 4ZUVB 1JI2A 2VO5A 5KSBA 4J3UA 4N9GA 3LN5B 1A7OL 3KNBB 4MAYB 5CGMA 2D0FA 3GRWL 5D5ME 4OUUB 3QG6A 2GQHA 3DTXB 4RX4D 3H3PH 5MP6L 2VAAB 1CCZA 4BM7A 1IKNA 3BZEB 4D3CH 1IKNC 4K94H 1U42A 4N5UA 4LPWA 3PV7A 2CPCA 4YXLH 3G5VA 3RTQB 2ZSVA 3C5JA 3Q6GH 5C0AA 3PGCA 5IWLC 4AIZB 3FFCA 3GO1L 4NM4L 2BRRL 3GBNH 1T2QL 3AAZB 4CRPA 4FRWA 4BKLB 2UZIL 4ZUWA 3QXTA 2HT2C 3EYVA 3OKLB 1NFDB 2IADA 1J1OL 3OAZH 4V1DB 3MNZB 3MODL 4IRZH 3WUZA 4R7DB 5ILTL 4L3CB 4OZGB 4Z78B 2UWEE 5KVMC 1C1EL 3I50L 3VXUA 5DUBA 3IFNH 4ZPVB 1JZ2A 4LKXA 4FQIH 2R1XA 3GBMH 5E2WH 5CLWA 3BEWB 2LTQC 3L9RB 3RVTD 5CZXD 1IT9L 1K8IB 2VXSH 1V7ML 2VDRL 3HZKB 4LCIL 4WV1C 5JDSA 4EBQL 2DWDA 1UACL 4FQXB 4BZ2L 3O3AA 3F12A 3U6RA 3O6LH 5DRZA 3ALWA 5KVDH 1G6RL 3C9NA 2XXMB 3O4LA 4IJ3C 1BQSA 1KPRA 2OM5A 3LB6D 5DJ8B 1RZKH 4DKFH 5FIEA 4KVNL 4JDTH 3CDGB 1DL7L 3UTSD 3QCTH 4PGEB 3DETC 1NUDA 5JOPD 3PHSA 1YUHB 4X7SH 2FJHA 4PJ9B 3L3OB 4Z7NF 2XN9B 3BGMB 1ZTXH 4JPVH 3LQMA 4JFED 4NQED 4ELME 1JIBA 1A6TB 3IETA 4KZEL 2A74B 4H5SA 5EIQA 1I9IL 4JFOA 2ATPB 3RY6A 1MCIA 5C08E 4CU8A 3RY6C 4PRIB 1FDLL 4YHIB 3IVKB 1J12A 2XKUA 5DFVC 3JUYA 2IAMD 2XFXA 1NKOA 4DGIL 4UAOB 1KJ2L 3RIAK 2D3VA 5EO0B 1XR9B 4QLRA 5IMLB 3MJ8B 4XRCB 5J1AB 3VWJA 3MGAA 2ARWA 3VWJC 5EPMA 5HHXL 1YEKH 2NY0C 3V0WH 5I1HL 3KXFD 4N68A 1KPUB 1AGCA 1MFBH 3D6GA 3EZ8A 5C0FA 2Q1EA 5DVOA 4WCYH 2NY3D 3GSRB 1EFXA 4O2EA 2Y4SA 1XGQA 3QUZB 4Q58C 1BIIA 5JLZA 2CGRL 2KQMA 3B83A 1F13A 3ARFB 5I73B 1B6DA 1DANU 4PBXA 4M1GH 2QHLA 1GAFH 1FBIL 4FHBD 4RFOH 4LPCA 43CAB 3NACL 4L4TA 5E24E 4G6AD 1RZFL 4Z7VA 2EH8H 5GRVL 5CJBA 3MGTB 4P3WA 2HFGH 3P77A 5KVGL 3HR6A 4QWWC 3TO4C 4ZTOH 2PYEA 4XCCL 4M7LH 2P1YA 5CHNB 5FYLE 5B21A 4LSVL 1R0AH 5KSAB 5FGBC 2OLDA 1EK3A 1YEFL 1CI5A 2VZVA 1PX4A 4DQOH 5C09D 3BFOA 3TVMD 5HGBA 2AQ2A 1DQJB 4UUJB 3QQNA 5T3ZL 5BMFH 3MXVL 1S9VB 4Y89A 2EICA 3OGOE 3IDGA 3VW3H 2XY1A 4LEXL 1RIHL 2DYPB 1KG0B 4HCRH 3TLRA 3QPXL 4MNQA 3NTCL 3R0NA 4UDUB 5CEZH 2DB8A 3JV5A 3PQYA 3UAJC 3FQRA 2JF1A 3LRGA 5LXGL 4YXKL 3UTZA 1KTDB 4PJEB 4XMKL 1CDCA 1I8IB 1MCDA 5ALCL 3RPIA 1HZHL 5IW1A 3FQXB 2BFVL 3D48R 3JBG7 3PXHA 5I1EL 5DMGC 3PWNB 3LEXA 3C08L 3AREA 1MEXH 3AREC 4GKNA 5L8LB 4HIHA 4PG9B 1S5HB 1HN1A 1U3HC 3E8UL 4UT9H 4HLJA 5C6WH 2FRGP 3MRPA 4WI5A 5KN5A 1H8NA 4Q9RH 3VWKD 1KJMB 2OR8A 2X9YA 1P69B 1W8OA 3RZCB 1Z5LB 1G9NH 3OR6A 1YZZA 1R5IA 5C0RL 3QHTC 3HI5H 1UH4A 2A6DB 4WU5B 5DJDB 3MLRH 4PJXF 5ESVB 3WN5B 5F3HB 3VFWA 4R97B 1Q38A 1Q0XH 1RHHB 2FIKB 4L8BA 1WV7T 3LKPB 3VFUB 3MCLH 2A77H 2DM2A 5AYUH 1QFPA 1DR9A 2IH3A 2J88L 3I84A 5MHSD 4PRPA 1DBMH 4K3JH 1NCAH 3BT2L 3OB8A 1YEHH 5IW3A 3SN6N 4D9LH 4IOFD 4Y8DC 4G6KH 4U1SB 3ARZA 2EIDA 4GQ9H 1FIEA 5E7FA 5DC9B 5I8OL 3BPNC 2YRZA 5DEFB 1FZMB 3GHBH 5F8QC 4ZPTA 1RJYA 4OQTH 3NA9L 1MHEA 1JWUB 1KENH 2NLJB 5HHVH 4L4TD 4Q9QH 2HVJB 2L7JA 3MBEC 4BZ1L 1VB9A 4P5TD 4MDJA 3BQUA 1IAIH 2PYED 3D3VA 3KJ4C 4Q0XH 5EU7C 1N3NA 1OAUL 5CLTA 2YPKA 1NLBL 2UUDK 3ZDYE 1ZEAL 1OD7A 3V6FA 4YDVB 4AM0B 4P49A 2X5PA 4E9LA 1DN2A 3SJVD 3BAEH 1X5FA 3OKEB 2P5ED 3NFSL 4NUJB 3HZMB 4BA8A 4ETYA 4HG4K 4QXTB 1T21A 1L9MA 3GB7A 1NBQA 4XPHL 3VRJA 2BSTA 5FCUL 1IEAA 1CFVH 1OP9A 1QEWB 3VXME 4MNQD 5IMOB 1ZK9A 5E70A 3ZHKA 1UA6L 4OD2A 4GXUN 2NW3A 3S3PA 3CK0H 3KAAA 3TBYB 4TSCL 2DI7A 4ACPA 3RUGA 3CCHA 3K81A 2EZ0D 4R3SA 3IU3B 3H0TB 4D9QE 5C8JA 5H37H 2J8UE 1FNEB 1ZLSH 2F5AH 1AKJD 1U3YA 2P8PA 2ZUWA 4JZOA 4PJ7A 2Z35A 3BHBB 4X6EB 5SV3A 1X4YA 1CDYA 3E2HC 1CE1L 3QNXB 5FYLL 4ZFGH 1DVFA 1LO5B 3MNVA 5ACZA 1AI1H 2X4NA 1DVFC 3UYPA 1QFUL 2Z93B 5IM7B 1KJ3L 3LRSB 1RU9L 4PJIE 1OM3L 1FYHB 4LP4A 2Z92B 1I3RA 4MJ6B 2JB5H 4AH2B 4OM1H 4I13B 4UBDD 2D2OA 1A1MA 4KI1A 5DUMH 5ALBL 4GRMB 2WNGA 3QUXD 4YDLB 3T2NH 3BESR 1AGBA 2CUHA 1X5YA 2ADIA 3BXNB 5FYJU 2EDLA 2MNUA 4XPGL 1A7QH 3TWCH 4JFEB 4NQEB 2X89A 4Z7WB 2APTA 4MB5A 1ZV5A 1EEYA 4PRPD 3V4PH 5FUOL 4TUJB 4TULH 1AE6L 3HAEH 5E00B 4C59B 4KKLD 1YQVH 4I8DA 3VXOB 4JQIH 2ADJA 3F6IA 2R2EB 4CVUA 1MCNA 4Y19B 5JXED 1AD9B 2IAMB 4YK4C 2Y6SD 2X9WA 4FQHA 2Z4QB 5F72S 4OAWB 1TLKA 3T4YA 3WXWH 5KSBB 4N9GB 3LS4H 1LK2B 5CJOH 3WHXA 1J8KA 4NO0D 4NRXA 2ITCA 3N1QC 5EC1B 5JUEL 2DN7A 3PIQA 1UVQB 4D94A 4Z7UF 2V6HA 4PJ5E 1UM6L 3O2DH 3BQUD 2NY3B 4GRLA 4PJHB 3PXJA 4BH7B 2BNQE 3PWPE 1OGAE 2C26A 2ZSVB 1CD0A 4O9HH 5C0AB 3FFDA 1MHCA 4FN0A 1WAAA 3EOYG 3FFCB 3QEQD 2DRUA 5C7XL 2MKWA 3QIWA 1HCVA 3G04A 4P5KA 3QIWC 3PL6D 5F9JA 1TETH 3JWNC 5KSUB 5J0BA 1MQKL 1NGQL 2IADB 1S7VA 2Q6WB 4ELKB 3U9PH 4HK0B 3MLPA 1P6AB 4H1LA 4QEGA 3Q48A 3CMOL 2B5IC 3T65B 2G2RB 3M45A 3VXUB 5DUBB 1OSZA 5L8JB 2R1XB 1SJVA 4KKAC 1XH3A 4Z95L 3SE9H 1S9YA 1I85A 5E9DA 4I48A 4MWFA 3NZHL 1I85C 3RVVC 4L29A 1UZ8A 5C09B 1AGDA 1AO7E 3TVMB 1OWWA 5HVFB 3N9GH 1LO2L 3X3FL 4I0PD 5I1IL 3GDBA 5ADPH 3U7WL 5I8KH 1NUNB 4MD0A 3U6RB 2IGFH 4ZOBA 1KPRB 4RCAA 4KV5E 2BJMH 1X5KA 3PABA 2D7OA 4JJ5A 2QHRH 5H35B 3V52L 4Q6IB 4LNRA 4LIQE 5D70L 1AD0A 5D5MF 4I0KA 1G9EA 3QHZL 3SE4A 2VUOA 3CVHA 4X6DE 3IETB 3JUZA 3ARSA 4KHTH 3DHJA 3SE4C 2ID5A 2CRZA 3JZ7A 4HKXA 4R0LA 4H5SB 4R0LC 2QQNH 1M71A 1BBDH 1F02I 4JFOB 4BUHA 1M1SA 3ROOB 2AK4A 1OAKH 3RKDC 4Y88A 4MCYA 5D2LA 5EOTB 3VWKB 2O26U 4JG0H 4E42A 1YC8A 5IVXA 4FFYH 4YBQC 4LSQL 2X1QA 2Q3ZA 1TCRA 4Y5VA 3OKNA 3OTTA 4KI5C 3BP4A 3GMLB 3QULA 1LE9A 2FECL 4Y5VC 1SJEA 3RHWK 2CKBL 1FGNH 5I1JH 2R0ZL 1IGFH 1AGCB 5HDOA 4EKXA 2FDBP 4G6FB 2QSCH 2IG2H 5I8EB 1Z0NA 4GRLD 4LCYB 2UWEF 1MCPL 5KOMC 3IYLW 1XGQB 3NZ8A 5GZOC 4NZRL 4X4ZA 3T0AA 1BIIB 2JIXD 1K4DA 3TV3L 2PXYA 4XVTL 5C1MB 4MB3A 4O2FA 2LAGB 1GC1C 2VLRE 3IAQA 3F7RA 4LLVA 3A67H 4NN5C 4G8GE 4O4YL 4ODTL 3QDJD 4GRWE 4LCUA 2XIDA 2CIIB 4L4TB 4FZEL 4QYOA 2D31A 3VFOA 1PSKH 4GUPA 4LDEB 1LO4H 3CH1B 4FFZH 4S1DD 3ULUL 3U0PA 4P5TB 1T89A 3DRTA 3L5WA 3IKKA 1BF8A 2PYEB 1UWEH 1FG2A 1FJ1A 3IJHB 1CFTA 1FNHA 3D0LA 3F7YB 3FO9B 2HJKB 5E9DD 2X1PA 3F5WB 3NCYS 1OCWL 4OLYL 3SJVB 3VE0A 1KB9K 5HGBB 2P5EB 4PGZA 1CLZH 1NCTA 2NQCA 4YHKL 4RISH 2BVPA 2ZP0T 3IF1B 3IDGB 2NY5C 1BFVH 3ZE0E 3QDHA 1ZGLP 1FYTA 3QDGD 2QV2A 3P0YL 5DD5L 4MNQB 2OJEB 1VFAA 3LHPL 3I6LD 4M6MH 3L95A 3HI1A 1ZA3A 4Y4FD 4LSTH 4L4VE 5BQ7B 4PJBA 2KH2B 4OGAD 1MJ8H 2YC1A 2UY6A 1BQHA 1G7IB 1GZQA 1IBGH 1EBPA 3RPIB 4HMEA 4E41A 2FO4A 1TVHA 4JM4H 4DZ8A 2X4TB 4OGXH 3ZL4H 1KPVB 4OZFH 4YHOL 1BZ9B 3WBDA 2EE9A 4GKNB 3TC9A 4HIHB 1I1YA 2H26A 3WEXA 1H0DB 1PX3A 3MRPB 3SY0A 4B7IA 3TCLA 3BPLB 2W91A 1R5IB 2YD6A 1B90A 3QUXB 1CD9B 2EDJA 2WP3T 4GBXA 3VFWB 2IANE 3DYPA 3DI3B 3G6JE 3H2WA 2NY6D 5E6ID 3X17A 2R0KH 3MRNA 5GSRA 1K9TA 4LASH 2H32B 3ZKXC 3EYFA 5F96L 2Z0BA 4AK1A 3GJFB 3MJ7A 5CKGA 4LIQL 4U6XA 1EXUA 4PRPB 3QO1B 5I18H 1EHLL 2E9WA 1YNLL 3EYQC 1W2KT 4HXAH 3BPNB 4PS4L 2PXYD 1XAUA 5JZ7D 4XNQA 4JKWA 1QBMH 2PTUA 4Q6YA 3T8XA 2B0SH 3NN8A 4LLDA 1RJYB 5J12B 1LK3H 4IDJL 4XAKD 2X41A 4I3RH 4JDZA 3HNVL 4KUCF 1F90H 2C4FT 3TCXA 4NO0B 1K3ZA 1ACZA 2F19L 1ROWA 4PB9L 1NBZB 1A6WL 4HKZA 4G9FE 4MDJB 1FCGA 5KJRL 1XF1A 3BQUB 3B5GA 1MVUB 3GJEA 4U1HB 2YPKB 5IIEA 3U0TA 4XCYA 3QEQB 3V6FB 4CNIB 3W81A 1E6OH 4HXBL 1U8JB 2K9UA 4NT6A 4ZTPL 3KVQA 2RAMA 1VGEH 1MJ7H 1T21B 5EBMA 5CCKL 3GB7B 4CN6A 3VRJB 2BSTB 1AJ7H 1UJ3A 5IB3B 2YEZA 1IEAB 5ACMA 1FYTD 4PREA 2JJUA 4GAJL 4OD2B 4M5ZL 4HWEH 3FT3B 2NW3B 5GGVY 1NMAL 5CUSH 1H3GA 3D9AL 3VDCA 3AMLA 1CU4H 5EUKB 4LCCA 3RUGB 1CWVA 3CCHB 1WFNA 5C8JB 3KPSE 4FNLL 3Q6GL 4PV9B 5IFHH 2AXFA 2W59A 2V2TB 4JZOB 1QNZH 2OK0H 3QH3A 4U1KA 2EDWA 5FHAH 3WSQL 2ZWLT 4I0PB 3RY5A 5IBLD 2VLKE 3ZYZA 1IGTA 4ODVH 2HMID 4GG8A 1V3JA 2R4SH 3GBNL 3MNVB 4QRTA 5DJZB 5I74C 2GT9A 3EYUH 1VESA 2Q8BL 1Q1JH 3RIFF 1I3RB 1EBAA 4P23D 1O7SA 2EEAA 1EA9C 4QXUH 3W2DL 2CLRB 1AGBB 35C8H 4NYLA 3K4DA 1C7SA 2C4XA 1S8DB 1VFOA 4FFVD 1T03H 3VXRE 1ZT1A 3GBML 3SDYH 1IGCH 1R5VA 4HIEB 4DOHB 4KHXH 2RQ8A 1XCQA 4J4PD 1S5IH 3KHQA 3WIHA 2ED9A 1YC7A 5F3BB 3F7VA 2ZUXA 2P42B 5DSCB 2CIKA 3MV7E 3ABZA 4WFHD 2EKJA 3JTSB 1DDHA 1I1AC 4C56A 1JPFA 4NBXB 4P9MH 4PGDA 4FQHB 3VFPB 1WJ3A 3T4YB 1JVKA 2OTPA 2J12B 3EJYC 2YPLA 3FOLA 3WHXB 4XT1C 4TPRL 4EXKA 2GTZB 3PIQB 1ZTXL 2FZ3A 3SPVB 2M2DA 4GRLB 4JPKH 3ARVA 2XTJE 5C0EB 1LE5A 1MHCB 1J10A 4OLVL 2JIXB 3K8LA 1FIGL 3QIWB 1J1XL 1PBYA 3G04B 5IHLB 4P5KB 4X98A 2KPNA 4OF5A 5F9JB 3RVUD 2PO6A 5D2NB 4X4YA 4NDMA 3SDXF 3QDJB 5IHUL 4YJZL 1FFNA 4P0DA 1UB5A 4K3EH 4KUZH 4LNVA 3C8KB 1FO0L 2NZ9D 3KPLB 4PJIF 5SWZD 25C8H 3L7FA 1RUPH 3VGFA 4H1LB 3TT1H 3OJDA 4HFWA 4KK9D 5CEYB 4KPHH 1MFBL 4GJTB 3D2UD 5T3XD 5EBWA 2H2SC 5ETUA 3QAZC 2OSLB 1S9YB 4NWUH 5E9DB 4MQXD 4I48B 4MWFB 4PD4K 2X4PA 4L29B 1KCSL 2BZDA 3WO3B 1UZ8B 2ZCHL 1AGDB 1QTYT 4JHWH 3FO1A 2DQGH 2BSSA 4G42B 3QRGH 4NO2B 3MV8D 4MD0B 1GAFL 3GUTB 1KGCD 2QKIA 1ZHBB 4GMTH 3JV6A 4PJFA 3KPQA 1G1YA 3QDGB 3BPOB 5D72H 4MJID 2YWZA 1QACA 2VXTL 3ZDXE 3ARBA 3JV0A 4JJ5B 1WISA 4Y4FB 5SWSE 4A6YL 3ULUF 4ONGH 1IGYB 2VTFA 4ONFL 4G7VH 4OTXL 2EC9T 2YD5A 4LPXA 1LEKB 3B5HA 2C3GA 4ZQKA 4JPIA 3DXAD 5AD0A 1YMMD 3NIDE 1E4JA 2GK2A 1PZ5A 4PJCE 1P4LB 1INDH 3DGGA 4X4XB 3MOBH 3T0VA 1IVLA 2XWBB 2GSGA 3KYKL 5DVNA 3OZ9H 4QTIL 4R0LB 3MV11 1TMCB 2ZNXA 4MDIB 4OIIL 1M71B 5D96C 1HOCA 2XZAL 1U93B 3MRBA 1ORSA 4HZLB 1UM5L 2BOCA 5HYQA 3BE1H 5D2LB 3VW3L 4TUOB 3PWVA 1GXEA 1QRND 3BOVA 5C70A 2FEDD 5IVXB 4WTXA 3D18A 3CFJA 1ADQA 1ZHLA 3UJIH 3L5XL 1TCRB 1MFNA 1MCWM 4PJAE 3BP4B 1LE9B 5E6IB 2NY6B 1SJEB 1JPTL 1RIVL 4HC1H 1CGXA 3D39D 1KELL 4JN2B 1KCUL 3SOBH 1QR1A 3CSYA 3ZLQC 4XMPH 2YR3A 3NZ8B 3RAJH 5HYSG 1EEZA 2PXYB 3TBTA 4UV7H 4UT9L 2UZYB 2RJMA 1DCLA 5JOFA 4I3SH 3PE9A 2PO6D 2D03L 4MQTB 1LP9A 5DEGA 3UC0L 5B39A 4LCUB 5C9JA 4F15C 1NCDH 5LG1A 4NN6B 4ZNEE 1MFDH 1MIEH 5E5MA 4QYOB 4FG6D 4HUUA 4DAGH 3MLRL 2D31B 3VFOB 1JJUA 3BUYA 3BZ4B 4LVHC 4GUPB 2YA0A 3D1MC 1IQWL 4YGVA 1JF1A 3U0PB 3DRTB 4XWOD 3V5HA 4NO5A 2A77L 3MJ9A 2Y36H 1DBKH 1FJ1B 5FYJH 4QGTA 1CFTB 3D0LB 4HF5L 5FAAA 1DBML 4K3JL 5F1OB 4C54A 4EUPB 2NXZD 4I9WD 1WFUA 4PTUA 3VE0B 5GGQH 1T7YA 3LCYA 5LCVH 4MXQC 4HWBH 2DMCA 4GQPH 5E5RB 2BVPB 3QJHA 4JG1L 4IRJD 1BMGA 4NOBA 1XZ0A 3EO1B 3O9WC 4OQTL 3VI3E 4G43B 4HUXA 3BD5A 3BGFC 1FYTB 2UUDH 4NJAH 4Q9QL 1XF5A 3GK8L 1VFAB 1TTFA 3ARBD 3L95B 5J57B 1ZA3B 1GGYA 5IVOA 4OZIA 3BKYL 1FL3B 4OCSH 4BSJA 3EGSA 2AGJL 4PJBB 1SYSB 1FRGH 1E4WH 2YC1B 1WT5A 4U1IA 5BV7B 1BQHB 1D5MB 5GGRA 1WT5C 5CJQH 5C0CA 1TCMA 1F45A 5F7MC 1J0JA 3Q0HA 3MV01 2EE6A 1I1YB 2VERN 1Y6MR 3SY0B 1U8QA 2R1WA 3TNNA 3IXAA 3CFCL 4PJHF 5B4MC 1CS6A 4RBPK 2CH8A 3LMJL 4KJYA 4QF1B 3QCVH 5C07E 2WM0A 4GRWF 4QOKD 4GBXB 5IT2H 4J12A 2GW5A 4MJ5A 5TDNA 1UH3A 3MRNB 3BD4A 4EI6A 3FN3A 1JPGB 1HYSD 3EYFB 4Y8AA 5B38B 3CC5B 3UTTE 4P3CL 4OIBA 1OP3K 3MJ7B 4LHUA 2F5AL 3O11B 1I1CA 3H9HA 5LWYH 5SX4I 4X8JA 3HUJE 3UPCA 4F9PA 3VRIA 5JO5B 4XI5D 3U30C 4F9PC 3QWRD 4WENB 1BWWA 5K9KA 3BKJH 3QUKB 4IMLA 2GIYA 2CLZA 2OX5A 2BNRA 3NPSC 4Y2DC 5CBAA 1LDSA 1RSFA 2Z8SA 5GQBA 1U58A 4APQA 3ZSTA 3NN8B 4LLDB 4JKPH 4APQC 4UILL 2MOVA 4JDZB 5DUML 2EXYC 1JHKH 1NQBA 4QXWA 1FVEA 1WLHA 3T2NL 4ZD3H 1CICD 1JHLL 3TYGL 5GGSB 3OPZL 3DMMA 4O5LL 1X5JA 5HI3D 2JLLA 2C3VA 1L7TL 3KG5A 5AZ2H 4HS8L 2F8VA 5IIEB 3EO0B 1A6ZA 4XCYB 2ORB