3OJ2C

Crystal structure of fgf1 complexed with the ectodomain of fgfr2b harboring the a172f pfeiffer syndrome mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
KRAPYWTNTEKMEKRLHAVPAFNTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
molecule keywords Heparin-binding growth factor 1
total genus 36
structure length 209
sequence length 209
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C01
1RK0B 3NCBB 5F97E 4HKXA 1MCKA 1WIUA 5M94B 1QYGL 5DHYB 3VFNB 2H2PD 3N50A 3TCLB 2AXHA 3QPXH 5FOBA 5IQ7L 1T0MA 4OKVB 4QY8B 3TBYB 3MOAL 2FB4H 5JR1L 3HNSL 2AAVA 4RX4A 3MRMA 4JFXB 1IAMA 3THML 3S4SB 4YFEA 3PDOA 3KLDA 5I74B 3S36X 1GGIL 3NVQA 4GMSH 2VKXA 2WP3O 5IBUB 3LOWA 2DWDB 1I3GL 1UCBL 2A1WH 2X4OB 3QCTH 1N6VA 4HK3N 5TPWL 4X8XA 4JFDA 3ARYA 4TULH 2CD0A 3G6JF 4UDUA 5IUSA 2R2EA 3S34L 3VFOA 3QJHB 3LQZB 4R2GD 1VGKA 4RGNC 4ELMF 3PQYE 4G3YH 4GH7B 5F7LB 3BZFA 5EN2B 2P8MB 1DQLL 4JJ5B 1SVCP 3WFZA 4WUKL 3G5XB 4LCUA 3FOMB 5IG7B 5D7LB 3FT2A 5EIIA 2BVOB 2EEDA 2VLLB 4X4MA 1NFDA 3PP4L 5D93C 1FPTL 4C56B 4IRSD 1BPVA 4PJDA 4JHWL 3GMPB 2GFBA 2BC4A 3ZYOA 4NWUL 1DFBL 2G2RA 4U6HB 2DM3A 5D1XA 3C60C 1HQRB 1TQCB 3RZWA 4M7ZC 4QGTA 1BOGA 1MF2H 1PW3A 5E4EC 1OHQA 4R4NC 3U4EA 4HEPG 3O6FB 3CFKA 3JSSA 1A3LL 4E5XB 4V1DD 3VXSE 1XFPA 3REVA 4MJIA 1KCVH 5JO5B 3KG5A 2EO1A 1BD2D 4NFCA 2NXYC 1NFDE 1I7UA 5JHDA 1P84K 2E3VA 5ESVA 4WUUB 5H37G 4MQXC 5ITFB 4PB0L 2IANB 5BS0A 3LRHA 4R4FL 3PP3H 5F6HJ 2P45B 4EIZC 4ZXBA 4U2YA 3ZSSA 3RIAK 1R3HB 3TF7C 1U0QA 4LGPB 3LKSB 7FABH 2XQYK 1NAKH 4EUPA 3VFUA 3T2OA 1X5FA 2RGSA 2ARJQ 1JCKA 4M93C 5KSBA 2A83B 3JTSB 2I9TA 4Y89A 3QG6A 3WFDL 5IESH 5DLMH 4P2OB 2I25N 3QJHA 3T4YA 2YBRA 3K3QA 5DC9B 3SKNA 1J5OH 3WLBB 4ZTPL 3O8XD 3QNYA 4I3GA 4KRPC 5F7HA 2NR6D 3HFML 1PZ5B 4FQLH 4YK4B 2D7PA 5BRZB 4YBLC 5HHVL 3SDAC 1EUTA 1TCRA 1I3RB 2IH1A 3T0EA 2B7DT 4DZ8A 2Y07H 4X6FB 1FBIL 3K81A 1IEAA 3I50L 5HYQB 5KSBE 3QUYC 1T1ZA 3BEWA 5LQBH 2D3VA 3V0WL 2P24B 2DQCH 3V7AG 5F72S 1MIEL 2ZNXA 1U3ZA 4AL8H 4K2UL 4WI9A 4HWBA 4PR5B 3S5LA 3MLXL 2UVEA 2VDKL 5IOPA 4ALAL 1HIMH 3BWAB 1R5VB 2AABH 3O3UN 3UZVB 5IIEA 3WFBH 1MI5E 4G6JL 5JW4Q 3GKZA 5E8PB 3SDCD 4KI5C 2YD2A 3DUUB 2V2WA 1GAFL 1TFHA 3FB6A 5D5MF 5FB8B 1OSPH 5IQ9B 4NN6B 2NMSA 3SO3B 3CX5K 1I4FA 1J18A 5JDSA 3TH3T 4EUPB 1FFRA 1F42A 3CVHA 3GMOA 3U4BH 1EERB 4BZ1L 1WBXA 3EO9L 1JYWA 1IL1B 2MJWA 1I7RA 1BREA 3S3JA 5DLML 1JWSB 3MLPA 1K8DB 5BZDB 1FNGA 4P2OA 3VRIB 4ZFOA 3E3QE 2CLVB 1E6JL 4YJZL 3S96A 4RAVA 3SGJA 2NYYD 4G6AC 4DKAA 3U4AA 3HCVA 4BZ2H 5HVGB 3P4MB 5L2KE 3KPSA 1RUKH 3HZMB 4PJ7A 3HZYB 1H8OA 5AAWA 3DVFA 1RFDH 2NZ9C 3O2VH 3MODH 2B20A 3AY4C 1MI5D 1ZEAL 3WIHA 1R5IA 4OBSA 4LSPH 2EEAA 4UINL 4L4TE 5KSVA 4P2RB 3I75B 4WU5B 4XP4H 5C9JB 4IOIA 1ZVHA 1CI5A 2R69L 2BOCA 4FQCH 3MV9E 5DRWB 4F9PA 2F53A 4IDJL 2X44D 3C6LC 4U7KA 4TTDC 3NAAH 5EORH 4X99A 3BDXA 5K59E 4TSAL 2X9WA 3VXOA 5HHNA 4RAHA 3TVMB 1S78D 3U2SB 5CP3H 4FZEL 3OR7A 1OAQH 4JO1H 5EOTA 5DQJB 3BGMB 4NHUB 2GHWB 5HTSA 1W2KT 2DJSA 1KG0B 3G6DL 1CVRA 3GMRB 5HHPA 1UA6H 3UJIH 1U8JB 1P6AB 1VFAA 1I8MB 3LD8B 4FQPA 3WFHB 1UH3A 3ZKXB 5TGBB 1N59B 4JQXA 3TWCL 4KDVA 5GSVA 5JNYA 4QTIL 3QEUB 3QSKB 4NO0D 4NNXB 3TN0A 3WIIL 5EO1B 3DTXA 4EOWL 1NBYB 2AJZB 2GUOB 1Q9WA 3ZTNL 5KANI 4MA7H 3TP4A 4G42B 1RFDL 4PTUA 4QCIB 2YPVH 1WZLA 1HSBB 5IBTH 1LEKA 1XF2B 1AO7E 2H45A 5JMOC 2VL5A 1J8HA 1FZKB 1H0DB 1LVEA 1NCTA 4QHLB 1UVQB 2EH8H 4LQFL 1UM4L 3ZKQD 3MA7A 5SX5H 2XOTA 2XRAH 3MR9B 1MHHA 1T22B 2RR3A 1INDL 2C4XA 3O6FD 3QUZC 2JCCE 2IPKA 1YPZA 2HFTA 2ADFH 4PRIE 5BMFL 4LPCA 5HGAA 3LAFA 4JRYE 3S37X 4HLJA 4HH8A 3TO4C 4QXGH 1MCSA 3S97C 1OARH 1S7VB 5E2JA 1KULA 2VR4A 2I07A 4N8VA 2ZP0T 3SCMA 1F97A 2ESVE 3LEVL 2FATH 4OF6A 2CLZB 1LEIA 5KG9A 1QACA 2GW5A 1A7RH 5E56A 1IC7L 1P4LB 1MCDA 1U6AL 5L2JB 2COQA 2DF3A 4QTHA 2CXGA 1L9NA 4KJPD 5FYKE 1MRCH 1T7VA 5MEQA 1DVFD 1WITA 2G5RA 2QLVB 4P46C 5EPMA 3AS0A 2X41A 2H2PC 4OTXL 2V5SA 5JOFB 2XZAL 5EBMA 1MLCB 1S3KH 1DDHA 2GUOA 2VXSH 2WLYA 5FUOL 5L2KB 1G9ML 3D3VA 5DJAB 3RWHA 1DQJB 4XWOD 4DFIA 3QDHA 4PTUB 4QCIA 4WTZG 3WD5L 1F3DJ 1EVTC 3FO9A 5JW4M 4ERSH 2YXFA 4QHUA 1FVCA 2LABA 4YHYB 3JXAA 4XI5C 4LBEB 1BVLA 3D6GA 3IU3A 1CTOA 4NYLB 5HI4C 2BHZA 1F4YH 1R3LA 1Z5LB 5CEZE 1H3UA 4ZODA 4JB9L 4PTTA 2PO6B 4I2XB 3F58L 4Z7OE 2Y7QB 4PJIF 2KPNA 3BQUA 4LVNC 3BO8B 3LEXA 5H2BB 1XIWD 3C5JB 2PYEA 1G0XA 3AU1A 4XP5H 4PRPB 3PIQA 5ICXA 2QSCL 4GRWF 3O2DL 4NSKA 3BUYA 4OD1L 4JPWL 1OGAE 4F3FB 1JF5A 1C5DA 2XZCH 5E70A 2Q86B 4LASH 4PRHE 4CMHB 4JY5L 1EUUA 3PQYD 4JPKH 3BIAX 4GRLC 3NFSH 1X6LA 1DLFH 1J86A 1IGJA 1TZIA 3C08L 4IRSB 4BFBD 1NMAL 1Q9LA 1FIGL 3DMMC 2FX9H 4MAUH 3R8BB 3GKWL 3VWJA 1DQDL 1HHGA 3MJ7A 2WW8A 3M17B 1LO3L 2BOBA 3MBEA 2BDNH 1LEGA 4BFIB 4RMTA 3FKUS 1TQBC 3MJ8A 4I5BA 4WV1B 4POUB 3ZO0A 2C9AA 4Z0XA 4N1CA 3DV6A 2QR0A 3Q5YA 5DFVD 3B3IB 5ESAA 4LSPL 1JFQL 2E7LA 2R9HD 4L8CA 5T1KD 1BIIA 3HG1D 4BK4A 4BSVB 1CICC 4L4JA 4NDMB 2P4AB 1N5AB 1YZZA 2VABA 1FLRH 3VXRA 3ECBB 3FQNA 4PP2A 4MAYC 2YRZA 5FHBH 4LF3A 3EYQD 1BVKB 3DURA 1CBVL 2GK2A 4U1GC 1C5BL 1U36A 2FH8A 4I2XE 1JFQH 3FMGH 1F4WL 1YMME 4NRZA 4LCUB 4Y4HB 3MRRB 1MFDH 5IG7A 2UUDK 4BJLA 1AD9B 4N5ED 4EQ2A 2Z91B 3PGFH 3VFSB 3KS0J 4WHYH 3AB0C 3CLFH 2G2RB 3OKLB 3S3PA 1QBLH 4XPFL 4HK3J 5CBEA 3SHSA 4KI5E 1SHMA 1IKFH 2M8XA 4LCWD 3IGAA 5FM8A 2XA8H 3O6FA 1JNLL 1T21A 2Q6WB 1RUQH 1T03H 2HWZL 2JJTA 2VDNL 1A2YB 5AZEH 3QDJA 1F6FB 4UT9H 3RWDB 1WV7T 3P30H 1Y18B 3GBNH 5IFAL 4NUGH 5JW4N 1YA5A 2ICWA 2ICWJ 2NCMA 5JOPD 2OSLA 2D4DA 12E8H 4HK0A 1Q0XH 4DN4H 1Q0YH 1PY4A 3NIGE 3NMEA 4P5MA 4BQBA 1KXQE 2QQKH 1YN7A 3QR2A 3W5MA 4I9WE 1H5BA 1NLDH 1AD0A 1DTUA 4PS4H 4MB5A 4E42B 4G8GD 3VXPA 3FQNB 4HPOL 4PP2B 3RA7L 1RUMH 1CXKA 4FFWD 4FFYL 1YDPB 4KI5D 2ZPKH 3C5ZA 4BA8A 1KJ2H 3O4LB 4XWGH 3ZDXF 5D96B 3LPWA 2QSVA 2YD6A 1LP9E 4N0FB 5DD6A 1LE5B 4MD4B 5GIRB 4KROC 2GJ6B 4WU7A 3VFTA 3F5WA 4KK8D 2BHYA 3VFVB 2HTLD 2O5XH 1AR1D 1S7RB 1U8IA 4FFYH 4GXUM 4XP6H 2P24A 5FA4B 5GS0H 3KS0H 1FG2A 2Y36H 1TNNA 5BW7A 4JFFD 4LPTA 5CJOH 1MI5B 4KTDL 1U91B 4WO4B 3VWKD 4P2YA 3QIUB 4JO3L 3IDYC 1DEEB 2A2QT 5FOBB 4OM1H 4QT5A 2NTFB 5EUOA 1NCBH 3UTTA 5DUMH 5IWLA 2CGRH 2EE6A 2Q7YA 2VXVH 2GJZA 2XXCB 3CLEH 4HEME 1MNUL 3NIFE 3MGTA 2LU4A 4I3RH 5E6IB 1OLZA 5J1AB 1CGSH 2Q8AL 3UYOD 4OFPA 4OCXH 3QEQA 1G1YA 1P2CA 2OR8A 3MGOA 3BISA 3LN5B 3CUPA 3SKJL 2NXZC 1HEZA 1GC1C 1CGVA 1N4XL 1IMHC 2OJZH 1CDCA 2BNQB 2FBOJ 1EZVX 4K23L 3SDXA 3CLEL 1AH1A 3UTZA 4APQD 1GGBL 4M7LL 1H15A 2GITA 5FGCE 3O45B 5K9OA 2I9LA 1INEH 1YEHL 3T4AA 1P7QD 3UJTH 4B7LA 2ARWA 2PR4L 4Y1AD 3DXAB 4OZIE 4GQ9L 3O6ML 4KVNL 3CX2A 3ULUF 4FTVA 5HVHB 3VFWB 1BBJB 2XICA 5BOZG 1LK2A 3WSQL 4M6ML 3MRIB 1XMWA 5MHSD 4X80H 5FYKD 1BVZA 4KHXL 5KOVC 3GMPA 2CKBH 4QRRD 5GRUL 4FFVC 3SKMA 1RZFH 5I1GH 3T2NH 4FQ1L 5DHVB 3W0WA 1RURH 3L3GB 3O9WA 1GYAA 4U6XB 4MNGE 4HWEL 1ZT7B 4XH2B 1RMFH 4OM0H 3HE6A 3QFJA 3K4AA 4J7RA 3BESR 3IU4L 2DM2A 4LLVA 5EU4B 4ODUA 2APVA 4N8PA 5JO5A 2UZYB 1WFOA 4JM2A 5JHDB 2Q7YB 3UZEA 5HJ3A 1FV1B 4NZDA 4WUUA 4W81A 3H3PH 4P9HC 1RIUH 2DQDH 1B90A 4P57B 1HIML 3PWJA 2D03L 2UV3A 4Y1AE 5FK9A 4BH8B 4KPHL 1KENL 2UZIL 1JNLH 1EX0A 3RGVA 1WC7A 5EWIH 1INQA 4OLWL 2C5DC 2HJKB 4KUCF 3I02A 4HC1L 3C60B 1TQCC 3AMKA 1AXSB 3MJGX 3T0VA 5E4EB 2XKNA 2YMXH 5B39G 2I9LB 4K7PX 5ECJE 3MLRL 4NN7C 5EZJB 3SKNB 5SWSD 1UJ3B 1U8HA 2QQKL 3TZVA 5C0AE 4LHJB 3HPLB 1E4KC 1J05A 4ZFZB 3QUMA 3TLRA 4F7PB 4Z76B 5J1SC 1A02N 1YUHB 4NBYB 5FECA 1XH3B 3WHXB 5DGQA 3P4LA 3SY0B 3QQNA 4X4ZA 2WBJD 3ES6B 4MHHG 3ZKND 4HIEB 2JCCB 1KIPB 3I6GB 4Y5XA 1F4HA 2OL3B 1VFMA 4M93B 2PKDA 3A6BH 5BS0E 1F58H 3PWPB 1J8HD 3EKCA 4P2OC 1KIQB 3JV4A 4LRIA 5GGSA 2DJUA 1X5LA 4S2SA 1DANT 1AGBB 2X7LA 5TQ0H 4Z5RB 1XIWB 2CRMA 4B50A 1M4KA 4NUJA 4JO2H 4F33B 4YBLB 3SDAB 3BZDA 3KPLA 4PJFB 5SWSE 3CH1A 2YK1H 2FZ3B 4HX1B 1ZGLB 4JM2F 5AG9A 2DQJL 1NAML 2Q8BL 3L3IB 2NNAA 1LEIB 3M8OL 4JHAH 3QUXA 2VLKB 3RA7H 1N8ZB 1I1AD 2KQNA 3BH9A 3LPFA 1I7ZA 1HYSD 4H25A 1A6VL 4MD0A 4MD5B 3IFPA 1FFOB 3RRQA 5IHBA 1T3FA 4YHPA 4FXKA 4WFGE 4ZQKA 4X4YB 1WWBX 5CWSB 5FYKL 2IPUK 1XGPB 2NY2D 2X5PA 3KYKH 3T0AA 3FB5A 1JRHI 4M43H 1CG9A 5CJBA 3UTOA 3OB0H 3B9KB 3H9ZA 4YQXH 1GGCL 2E8ZA 2Z35B 5I1IL 3D3VE 5DA0B 1R3LB 1JGUL 1Z5LA 4GQ9H 4ONHB 5EZIH 4LSTH 2QHLA 3L5WA 5E7FA 5DZOA 4M02A 1E28B 3MV7D 2J12B 1G9NH 2PYEB 3DYMA 4OD3H 3T09A 1GGUA 4BUGA 1DUZB 4WHCA 4J3UA 5A43C 2FIKB 2VNCA 5ACZA 3CC5A 2XFXB 1VFUA 2P43B 4ELME 1OPGL 2E7HA 1WBZA 3BN3B 1A21A 3ZTJH 5E8DH 3BKCL 4GQPH 1XIWA 2L7JA 1X7QB 5FV1L 4FQHA 3TM6A 2Y1VA 4G7YH 4J3VA 3EOBB 2EKSA 5M95B 1VDGA 1M05A 2VDLL 1NANI 3ARDC 4M1DL 4OB5H 5DFWH 5ANMB 3L7EA 3HTLX 3RDTD 1D6EB 4D0DA 3X3FL 4M62H 4F37K 5C9KA 2JK5A 2VIRA 4IMKA 1MWAL 1A1OA 1A4KA 4KZDL 1MREL 3D1MC 3GI8H 3D3VD 2XQBH 2VZVA 5DJ0A 1DP0A 3ROLB 4HS3B 2C3VA 2J5LC 1MSPA 4XCYA 3DTXB 3GSUA 4RMWA 1Z6JT 2EYSB 5F88A 4RISH 4YWGL 5T1LB 3B5TA 4LDOB 3NZHL 1T5WB 5E99H 1XR8B 4QRRB 1MREH 5L0QC 4P2RE 2AABL 1GIGH 1SY6H 5FO7A 4RMRA 3W81A 4X98A 4F7TA 3CCHB 3LD8C 3FQTA 4NQVB 3CU1A 1JK8B 1A5FL 3QPQD 4XB8A 1RUPL 4YE4H 5JHLL 4RGMC 4TPRL 3QFDA 1QSEE 1T4KB 5IHUH 4PRPD 1DUZA 5FKPB 2FIKA 3GJEA 2FNBA 5E8DL 4BZ1H 4PJGA 1VKXA 4Q58C 5AZ2L 4PJ5D 3K1KC 3UEZA 3GSQA 2HVKB 3O4LD 3LSOB 1RJLB 4YFLF 4JQIL 3OB8A 1UEMA 5HHOE 4KK8C 1QFUH 3EAKA 4G3YL 4KJQC 5SWQA 3IDUA 1KCKA 3SGEH 4HWBL 4YBHA 5C0GA 2P46B 4G43B 3BJ91 3RWJA 4PRBB 1JPSL 2VDKH 4ZUUA 4E41E 3WLBA 5TDPB 3MRKA 4ESKA 3LQAC 4LVEA 2CO6B 3BYYA 3MLSH 5AYUH 4UNTA 3NFPB 5MI0C 3ROLA 3VWKB 4JM2D 4AK1A 1QR1B 5BXFB 1NUDA 5FUZL 4Y5VB 3BPLB 1X5ZA 5HYSG 4XZUA 3UPRA 3TO4B 4O51A 5DJ2B 2PCPB 3WIIH 3DSNA 3EYFB 2YEZA 4J4PA 4JR9H 4JY4A 3OX8B 4OF5A 5GGTA 1QSFB 4MA7L 4MCZB 3OJVC 4OGXH 1Q94A 2FJGA 4GRLA 3UJJL 1FQ9C 4JO1L 5FO7B 4HIIB 2V5YA 2NW3A 4ZFFA 1XZ0B 3BWAA 5IIEB 4HIJB 2MKWA 5DD3L 1QA9A 5JUEL 5TE6L 3SQOH 5AWNH 2YR3A 4L3ED 4FTVD 4UIMB 4UQ2A 1QOKA 5IJKA 3NA9H 5DMKA 5JQHC 2PYEE 43CAA 1ZWIA 4I18B 3MLYH 4JFHD 3RZCB 3TA3D 1QNZL 4KKBD 4KY1L 5DK0A 5F44A 1CFQB 4PGCA 3SDAD 5F6HI 2HVKA 4A2LA 1R3IL 1I7RB 4PJCE 5LCVL 5TE6H 5LWYL 4Y5YB 3P4NB 3RPIA 4M8VA 3MC0A 4MNQB 4WI5A 1G7HA 2H32A 4HUUA 2OL3H 5IK3B 5FGBA 3WNPA 4H5SB 3QULA 3GSVB 1R3KA 2PO6C 3KPNA 1H3WM 1MRDL 4RAVB 1WAAF 1ZMYA 2DIAA 2VXUH 3EO1B 1I1AC 3C5ZC 2PYFB 4PJXE 1A9BA 2W0LA 2NW2A 3P4MA 4PGZA 1OB1A 3EYVB 5GSRB 1N5YL 4X9IA 2JB6B 1VACB 1ACYL 1UACH 4HUKB 1TVDA 1EBAA 1S7WB 1DEDA 4PJ7E 4S1RL 3EJYC 1IQDB 2ZUSA 4Q6IB 3WFEL 1E4WL 1U8NB 1AO7B 5IFJA 3G5ZB 1KN2L 4N90D 3RX7A 3QEQB 3B3IA 1XGTA 1LDSA 4F2MB 4F58H 2AKRB 4XCEA 1U58B 2O5YH 4A6YL 3W2DH 3MRPA 4GT7A 3ZT6A 2XWTB 5ESQA 4CMHC 4ELMB 3FRUB 3EFDH 3BIKB 1J0KA 3GO1L 1DBBL 3RDTA 2FJGB 4GRLB 4LAQH 1RZKL 3JV5A 2Q87A 1J0IA 1Q9OA 4U3HA 4NQEB 2ZCHL 4JJHA 4D0CA 1H8NA 1I85C 3MBXL 4MJIB 4F80A 3OBAA 3PHOB 4JB9H 3DO3A 2E6JA 4MSWA 3OKKB 4DOHB 3CVIH 5DK2B 3MLYL 4M3KB 4OFIA 3HAEH 1B88A 4PJAE 2DQHL 2Z4QA 5DA4A 4PV8B 5ADOL 1A7RL 3AY4A 4R4FH 1ZA3A 3REWB 4JG1H 1DBML 1KYOJ 1ZK9A 3S36H 1ZHBA 2BNQE 1D9KB 5JHLH 4QWWC 1FL6A 5E94B 4FQQB 4XCNB 3O3EA 3ISWA 3H9HB 3MXVH 4O2FB 3L3GA 1CICB 1NL0L 1AY1L 4DWHA 2AJUL 1BECA 3WD5H 1JTTA 4MA3A 4GMTH 2ZSWB 3AREB 1C8PA 1BQLH 3EDKA 4O2EA 4HUNB 5HGBA 1WWWX 4P2QE 1HSAB 3TN0D 4XMKL 1CGXA 4CUCA 4RISL 3VD4A 4ORGA 3HUJE 3F7YB 4QOKA 1NFDF 4P2CG 4XCCH 1GSMA 1G7MB 2ZSVB 3FFDB 2WUCH 4IRZL 2AJSH 1AO7A 1EGJL 4GRWH 3RGVD 1Y6MR 4P5MB 3I84A 4AIOA 4F15B 1U8KB 2E9WA 3PABB 4ZAKC 1K8IB 4ONGL 1DBJH 4AM0B 3LKPA 3VMPA 4D9LL 3MO1B 1M7IA 5IJVA 1BF8A 4JM4L 1F4XL 4NQEA 1NGXB 1M71B 5DJCB 1VGKB 4H8WH 1RJYA 1BJMA 3C8DA 4LOUC 4HIHB 3MRDB 3MOQA 5GGTL 5FV2A 5IW1A 5CIPA 1KEGH 3NCCB 1B6DA 5D7LA 3VXUD 3U0PA 2BVOA 2YUWA 2N1KA 2GJ6A 4WU7B 3T1FA 4CU7A 4XVJH 5DJXB 1F4XH 2QADD 3TZVD 4G9FB 1SBSL 5FCUH 3FT3A 3VG0L 4U6TA 3MLWH 1LO4H 2D9CA 1I3GH 1UCBH 5BQ7A 3ULVF 1QLEL 4LLUB 1Q38A 4H0GA 5I8CA 1AIFA 1I8LA 5EO0A 4XMLL 4XVSL 5DDHA 1QSFE 5D72L 1B4JL 3FZUD 4U1KB 4DGVH 4M48L 3REVB 3QUZD 3N85L 1YC8A 1HQ4B 5D7LE 5GS2D 4O2EB 5H94A 1I9JH 4LIQE 4QRRE 5IMLA 2ORBH 3OKOB 4BZ2L 1G6RL 4LSQL 3MGTB 1BWWA 4WCYL 3KPQA 4HPYH 1EEYB 4Z78A 1OQXA 5ISZA 5EC1B 3FFDA 2DYPA 3OR6B 4O58L 1MRDH 4KROB 3F7QA 1R3HA 4RWHA 3DWTA 1BZ9A 4WW2C 1B0RA 2NNAB 1QSED 2OP4L 4M48H 1WT5C 1KLGA 2QQLH 4Y5XC 5CSZA 4WFFD 3PWLA 3BGFB 1AXIB 2B39A 5IFHL 2FEDD 4RFEA 3EOTL 3A6CL 4IDJH 2E9IA 1I75A 3P3YA 4L3EB 4YDJB 3EFFA 1HWHB 3GDBA 2R1YA 1FE8H 3QXAB 3FB5B 5J13C 4HUWA 1UC6A 1CDJA 4WI8A 5DXWA 2WBJA 3MRLA 5FYJE 2BNRE 1YEGL 5BV7B 2FBJH 1KJ2L 3OL2A 4XWGL 5LCVH 1OP3K 1R24B 4YXHL 3GBLA 3MBXH 1H9VA 1Y0LA 5I30L 1A1NA 3UTSA 1Q9LB 4BFGA 1NJ9B 4LCWA 3GI9H 4UOW0 5JIHA 1DQTA 3CH8A 1E27B 4ZAKD 3HNTH 3V52H 4BSWA 2PO6D 3TT1H 1MJUL 2VYRE 1WFNA 4KVCH 1G9NC 1UH2A 8CGTA 3FQWB 2R8SL 4KZEH 3EOAA 3DX7A 3CXDL 3S36L 3C5SB 4XNQB 1V3KA 4JZOA 4M7JL 1UYWL 1X44A 3NCJH 3RWIB 4PJAA 1KB9J 2XPGA 4EVNA 2EYRA 3MRHA 5T3ZH 1MY7A 1LEKB 1XF2A 3K0WA 5C0IA 1XF4A 2P8PB 2BVYA 4QHLA 2RFXA 4I48B 5DRXB 3HPJA 5JXEC 4RRPG 2XG5A 4LF3B 3DMMA 3GMNB 4OCYH 4DW2H 3L3HA 4X7TB 5INDB 4YR6B 1CE6A 3MBEC 3IKCB 2XXMB 4YXKH 2HVJB 3KYMA 4J3SA 3M8OH 4JHAL 2C3VB 4K7PH 3VDAA 1M1SA 1WAAA 3M1BA 4O2CB 1KLUB 2EXWD 4I0KA 4OLZH 3PWUA 1QRNB 4H88L 4WNQB 1QBBA 1NUNB 4RIRA 4CN6A 25C8L 1YY9D 3MZTA 2C3WA 3ARPA 3RQ3A 3O6MH 4HULB 2D2OA 4LSRH 4HKXB 3SDYL 4GFTB 4WFGD 3JWDH 1UH4A 4QRTB 4X98B 1FC1A 3LRGA 1P4LA 1T1WB 2KQMA 4QTHB 4QRUB 1JHTB 1OTUC 3BUTA 5ALBL 4B53A 1KCSL 5C0JB 1U95B 3BW9B 3GIVA 3GUTA 4RGOH 1WK0A 1UKSA 1CGYA 5DMYA 5HPMB 4OD1H 4Q9RH 3LS5H 1DQJA 1IE5A 1VEOA 1IGYB 4LASL 3IU4H 2O5XL 5DQJA 1G9MH 3GSQB 1QRNE 1GPOL 1MHCA 1EHLL 3U0WL 2YD9A 1JZ8A 1BVLB 1EEQA 2AP2A 3LIZH 5SWZA 4PJGE 3UJTL 4TYUA 1OOAA 2IF7A 3N85H 4DUXA 3HPJB 5B21A 3CZJA 3BQUB 2IMNA 4KKCD 1F3RB 3WFHA 1K2DA 3H9SE 4YXKL 1IC4L 4D8PA 3C5JA 1BIHA 3B9AA 5HYSA 2UWEB 4D0BB 5GSVB 4HC1H 1JP5A 1KTLB 3E6HB 3O2WL 4OD2A 4QRQB 1W8OA 3RGVC 4FQ1H 4Y4FC 1DR9A 4EDXA 5DR5H 4G42A 1T80A 3I6KB 1UWEH 5LBSL 3EYFA 1CG9B 1G7QB 1ROWA 2RBLA 2VSCA 2R0LL 2P7TA 3OKYA 1MWAA 2JIXB 5FYJH 4HXAL 4XTRD 2QADC 5SX4H 5CJXA 3UBXG 4LGRB 1EFXB 4GXUN 3MV8E 4P2QD 1A6TA 2R29H 4WW2A 4XXDA 3W0WD 4QRTA 1CBVH 2O5ZL 5ALBH 3RWFA 2PXYC 5AAMA 4UILH 1AR2A 5JA9A 1MH5A 1UB6B 2E27L 1E28A 1YYLH 1HHHA 1I8KB 4X8JA 2FX7L 3RVWD 4HLZH 3L5JA 3QIBC 5C6WH 2QL1A 4LSQH 5I2IB 4HXAH 3KPTA 4ODXB 1A0QL 1LDPH 3EYOB 1HNFA 2AGJL 5BV7L 1QFPA 5B39B 3RBSA 4PREB 5E08H 5IB1A 4PLNC 5DEFA 1ZT4A 3TYGL 2D4FA 3B9KC 2CSPA 3D5OF 2QQLL 5IQ7H 1KIRA 3HHRB 4GRWB 2VN4A 3MLRH 3QQ4B 2W0FB 4OIBA 4LIQH 1A7PH 4QWWD 4ZTOH 2AK4A 4Z6AT 5AZEL 5DD1L 2C3XA 1NGWB 2LVEA 3CD4A 3VW3L 2VIRB 2P5WB 4NO0B 5EA0H 2H2SC 4HWBH 1S7SA 3P11H 2YA0A 4R7DB 5D2LE 1BBJA 2OX5A 5IB5B 3G08A 3QUMH 1YEGH 1WTGT 2ATPB 2GIYA 4JFOB 3VXME 5IEHB 1IGMH 4ZS6C 5F88B 3VU2A 1D9KD 3PGFL 4L3AA 3O81A 4ZDHB 1C1EH 1XGQA 1MWAB 4PS4L 2BSTA 5HDQL 3DMMD 1S9KC 1LWRA 2D31A 1GGCH 1ND0B 5IOPB 3ARUA 3EYQC 1P4IH 1R5VA 5I1IH 1BM3L 1NFIA 1KB5H 2A74A 3GK8H 5HVWA 3UJJH 3QFDB 4G5ZL 2VAJA 4AH2B 1J0YA 1T0NB 2IPTH 1NAMH 2VZUA 5D7IF 5FB8A 1MCHA 2ICWB 3QNZA 2X4UB 3FO0L 4HZAA 1MHPH 4MVBC 2V6HA 3DHMA 1S7UA 5GPRA 4HV8A 3SPVB 5EOCJ 3NA9L 4HDIB 5D9SB 5JTWA 4M7KH 1KCRH 3QEGH 3U82B 4P2QB 4ZFOL 3HC3H 4G5ZH 2IGFL 3UTSD 3PL6A 5GS2H 1DE4A 1FGVH 3S96B 1CD1B 3A6OA 2MHAA 2G60H 3L9RB 4L9LA 3QWRD 3KNBB 4UQ3B 5GISL 2E8YA 1JRHL 4RGMB 5EOCH 4ZFZA 2BOBB 1CGTA 2ERJC 4JRXE 4ORGB 4LEXL 4QOKB 4JRYA 4RBPH 3C09B 2NY5C 1IGML 4NP4H 4WTXA 1CDYA 1X4YA 1R0AH 3EHBD 2IGFH 4P4KD 1QFOA 1R5IB 3C8HA 4LSRL 3VFVA 2X42A 1RQ5A 1P7KA 4AYFA 3SJVB 3FQRB 1YY8A 2R2CA 1UGNA 3DXAE 1U8IB 2X4PA 5E5MB 3IDXL 4U2ZA 3GSNA 5DRWA 4JFZL 2CDFA 5ELIA 4OI7A 1M7IB 4N8CH 4K3EL 5IJVB 1S7TA 4FFWC 3L3OB 3BSZH 1KN4L 3KPRB 4G7YL 3X3GH 4W4OA 3UTTB 4NCDA 3VG9C 4P3WA 4Y2DD 3V5DA 5KSAB 3LS5L 5ACMA 2FH6A 5GGRY 1HNGA 5T1KA 1C5CH 2O61B 1V3MA 1ZTXL 2W9DL 4OZIF 5DJ8A 4HX1A 4WHTB 1PQZA 4JVPA 4M4RA 2EDNA 2EDWA 3QPXL 4UT7H 2DIBA 3MLXH 3QUYA 1YNLH 4AJ0A 1D5IH 5I1HL 1QLFB 2AI0L 2VJXA 1WBYB 2YXMA 3BSZL 3RUGF 3ULVD 3IJHB 3GGWA 3WE6A 3RPIB 2X05A 3QHFH 1BLNB 4XC1L 4JLRA 3O45A 5F9JA 3T77B 3T4YB 3KPNB 4N5UA 5MEOB 1AGFB 5EU6D 4P3CL 1I85A 5TF1L 4JN1L 1XCQB 1INEL 1O0VA 1YEHH 4EQ3A 4K8RD 4N0UE 2DQDL 2OI9B 4TSCL 1RULL 4PG9B 3RAJL 3C8KB 3L1OL 4LCIH 4X7CC 1WEJL 3P4OB 4WJ5B 4PGEB 1EEUA 4LHUG 1CLOL 3P9MB 3FQRA 1J1XL 1FVDB 3Q6FA 5FGSA 4TPRH 4NM8L 2JELH 1YN7B 3MPCA 4X6DF 3FO2B 3W0WB 4Y5YC 2NPLX 2I24N 4JREB 4Z7UA 3SOBL 4Z7VE 2UWEF 5CKGA 4BUHA 3VH8B 3MODL 3HLAB 3SGJC 2C26A 3BEVB 1DFBH 5EDXA 3C5ZB 3DPBA 4XBGA 4EZMA 4N5EC 4EEEA 5ICYA 1MCNA 3TIEA 3HI6H 3U30C 5DK2A 3FQXA 1HH6A 3U46A 3ZDXE 4LHUA 2ADGB 1WSST 4XMPL 1WJ3A 1RUAL 3H3PL 4Q74A 2PTTB 4BH8A 3IDIB 2EDLA 3U0TB 5IM7A 2HJKA 2PXYD 1OTTD 4JZJA 5J3HC 3QI9B 5HGDA 1NLDL 3LHPL 4UDTA 5HYJD 3S98A 3DO7A 5F1NB 4NBZB 4GG6B 4Y1AB 2FECI 1NGQH 5IJKC 1BLNA 3AC0A 2CH8A 2KDGA 4Z7QF 2YPLB 2EECA 1CLYH 5DK3A 5MEOA 1U8LA 5D1QC 2VZOA 4TSCH 4AEIL 4IOSD 4QT5B 1DLHB 3O3AB 4PJ5E 1JWMB 4NO5A 1P7QA 3KPMA 1CFTB 2A77L 3V4PL 4KI1A 1WCBB 3OAYK 4LPXA 3HNSH 4PG9A 1FH5H 3RGHA 5J1AA 4PJHB 4MNGB 3QDMD 1MJJA 1MAKA 4ETQB 2I60L 2RB8A 5AWNL 3AVEA 3LN5A 1D9KC 1HI6B 3WKNA 4E41D 1OTUD 2R56L 4V1DE 3VXSD 3BKJL 4V2BA 5GRJH 5JW5B 4LSVL 5GHWH 4R4ND 1H15B 2B1HH 4U1SB 5I8KH 3HUJB 1XCTA 2C1PA 1MQKL 4PJDE 2DBLH 1YEFH 4XBGB 3GNML 4ZS6D 2VDQH 1T7WA 5I8OH 2VC2L 4M4PA 4LARH 5E2VL 1RJLA 5CJ5A 4OIIL 2DKMA 1A6WL 1HHKA 4ZMAT 1LILA 4N8CL 3ARBC 2FCBA 2Y5TA 5D7SH 4D9QE 3IYLW 1AGDA 2DAVA 1CU4H 5BVJB 2P5ED 3NPSC 1A6UH 2BVPB 5IKCA 1ZHKA 2HTKC 1JHTA 3MRKB 4ZAKB 2VDPH 5GGUB 3G6JE 1CYGA 3HE6B 1RJCA 3W11C 1MFCH 1VFBB 1NEZA 1MCEA 1GH7A 4HMDA 1MFBL 2XYCA 3DVNA 4LLMB 3T65B 2WINA 3IXAB 1R0AL 5D6DC 35C8H 2YEZB 5DQDL 1EHAA 1Z3GL 4QF1B 3IT8D 9CGTA 5ILTH 2R2BB 1HSBA 3IFLH 5C0BE 2BSRB 4KQ3L 4XMKH 1B4RA 3SO5A 3QFJD 4KHXH 4HKBB 4P4KC 3ILQC 4ACPA 1J8KA 4K2UH 3ARTA 4ONHA 3MA7B 4HJ0D 5DT1L 5FDWA 1CDHA 1EIBA 3MLTA 4HIJA 2EO9A 1QA9B 3BVNA 1FG9C 4GW5B 4OM0L 5EOQH 4OI8A 2NLJB 3MTRA 4XAKD 1F4AA 4LSDA 5JW3L 2NR6C 4I18A 4QNPE 4LLQB 2R69H 2F5AL 4FQLL 4FQHB 4YHIB 4MB4A 4I0PD 3FJTA 3CFCH 3JZ7A 1TJHL 1F6AA 2ED8A 4FRWA 4WW2B 5DHYA 4Q97A 2BMKA 2ZCHH 1CDGA 4RWYH 1RIHH 3EO1A 1A6ZA 1A2YA 3PP3K 2WIMA 1HH9B 1I7TA 5FCUL 4HG4K 1FZOA 2AJSL 1X5AA 5JHDD 2O93L 3D18A 5ADOH 5CZXC 1KCLA 3GSUB 5FM5O 3D3VB 5F89B 3MRQB 4FN0A 4DGVL 5J13B 4PRHA 1JHLL 1JPFA 4UT6H 5F7EL 1E0OB 3LEYL 1N0XL 2FZ3A 5CJXC 1P5UA 1Q9KB 3OAZH 2NY0C 4KXZI 5EZOH 3HRPA 1NMBL 3CSYB 4JFDD 3WUWB 5CD3B 4N68A 3ARWA 5H2BA 4MSWB 1A7QL 1KELL 3IKCA 3O2DH 4OI9A 4PRPA 1JPST 4OCMC 2VXQL 2CR3A 2BNUA 4FQJH 2BZDA 4PJGB 1KGCE 1IC4H 3MLWL 1S5IL 3FQUA 1C5DB 1QEWB 4J3OC 4L5FH 1INDH 4JQVC 1ZHNA 3QWQB 4HH9B 4JO2L 1KJMA 2JIXD 3OMZA 2LVCA 1W0YT 3RDTC 3KJ4B 1YNKL 2AXFB 1CR9H 2YWZA 4M7LT 3TWCH 5E95B 1MHEA 4L4TA 5DJ6A 3IFNL 2R0LH 4QRUA 5J56B 1RZJC 2J7LA 3AAZA 1D5ZA 1WLHA 5TQ2L 5I30H 1JF1A 2XY2A 4XRCB 4ZD3H 1A7NH 2GAZA 1HH9A 5C0JA 1I7TB 1EFQA 3MBEB 2PTVA 3MCG1 4I0CC 3O8XB 4JGJA 4U1IB 4JFDE 3HE7D 1CU4L 2O26U 1JF6A 1HDMA 5KVGL 2V2TB 5J9PB 4XNMA 3WN5A 4TUJA 4M43L 3MLVH 1MUJB 1IGYA 2Q76A 2GY7B 1KT2B 3DUHA 1HEZB 4BSJA 1KTKE 4JY6A 3BD5A 5D7KE 4XVTL 1Q9KA 2CKBA 5BVPL 3RWEA 3L7EB 1QSFD 4R6UA 1UB5A 4N0CC 1YEJL 4MHHI 1KXTB 4DVRH 1QO3B 4PRID 4XBEH 1JHKL 1K4DB 2DL9A 2DI9A 1RY7B 4UQ2B 4KMTL 3TBSA 3QQ3A 2NY2C 2HKHH 2NY3C 4DEPB 3C2AL 3TBVA 2BNRB 2CRIA 4QGYA 1OPGH 5KS9A 3V0VB 5HYJE 2LQRA 1OGTA 2WNGA 4XVUC 3BIBX 4HFUH 3SKMB 1QEWA 1AGCA 1T7ZA 3BEWB 1BFVL 3RZCD 4RMSA 5C0DA 3QO1B 4MXWL 4PLJC 4M1DH 4OB5L 3KPRD 3CVHH 1N64L 3MUHL 3C2SA 1ZHLB 4JAMB 4OZFA 4RGNE 5FYLH 1MHEB 1DN2A 2B1AL 2CRZA 3VXMD 4JM2B 3WKML 1EGJH 4X5WA 2ILLA 3FB8A 1ZA6B 4RRPA 1KBGH 3MA9L 2FJHA 1CQKA 4WEBH 5DZLA 1L7IH 3L3JB 1TJHH 1Q0XL 3QEHA 5DQDH 1RHFA 4XNXH 5SWZE 3Q1SL 5D7JA 5ISZB 2FHFA 4QTIH 4YO0A 5FK9B 5BO1H 4OFYD 5HYEA 3BRGC 4NNYB 1BZ9B 3HZVB 5EBLB 3OG4B 4XI5D 5LJYH 1AJ7H 1KN2H 5CSZB 4F58L 1T04A 5DMIL 3K2UH 1AXSA 2C1OA 3V6OA 5DRZB 3ZL4L 2QADB 1FL3A 4U1MB 4P0DA 2CLVA 1S78C 4PRDA 3KDMA 3LQZA 4L3EA 4RDQG 4AEFA 2PXYB 3STZA 1J7VR 1FFQA 1G7PA 1YMHB 2EH8L 3FCTB 5HDBF 3D48R 1BF2A 5EBGA 1J05B 3BPOC 4A6YB 5DWUL 3VG0H 2WUCL 5JW4R 4OZ4B 3U9PH 3C8KA 5ADPL 4NQSA 3SJVD 2HH0H 1EAJA 1ZLUK 3ES6A 3X12A 2HYMA 3FRPG 2Z93A 3C08H 1QUNA 1NJ9A 4JHZA 2V17L 1V7NL 2OL3A 3VMOA 3H9HA 4P46A 4MQ7A 4PJHF 3VH8G 4JM4H 2ITDB 1HKFA 4Z7UB 2CXKA 1OW0A 5ERWB 3FQWA 4M61A 4KXZH 5DURB 2HT4C 3EGSB 1KBGL 1BJ1H 5D5ME 2NTFA 2EIDA 1MCRA 3VGGA 3W9EA 2BNRD 2IANA 2OTUB 4LHUB 3FHAA 1CIDA 3KPLB 4PJFA 4K3DL 4J3WA 1IJ9A 1DBKL 2B4CL 3EOTH 3IAGC 3OF6D 2VDNH 1KFAH 3VFUB 4PUBH 1MELA 1QHOA 3R1GH 5BJTB 2VLKA 5HGDB 4X6BB 5T1MB 2A83A 5DEZA 5F1NA 3DGCR 3IKKA 5D72H 3UROR 3MO1A 3O3DB 1EAPA 5D70L 4PLKC 1SJEA 3D0VA 1NCAH 1NGXA 4TNVF 1CLZL 4KTEL 4FP8H 3WXVH 4KU1A 2WIIA 1OP5K 3MCKB 3WSQH 4ZNEE 5GSRA 5LXGH 4K9EL 1X4XA 3HE6D 3B9KA 3GIZH 3P9WB 2NY4D 3U0WH 3QWOA 4JN1H 4HGKC 3MRIA 3FTGB 4DZ8B 5C3TA 3SDDD 2D7OA 4YBQD 4EXPX 1EMTL 5DJXA 2ZG2A 1IKFL 1SYSA 5K93A 3NIDF 3TBWB 3TV3L 3INUH 2CKNA 4OJFH 2HTKD 4PY8J 5DHVA 3FRUA 4OLUH 2CDFB 5I8CB 1DN0B 5D1ZC 4QRPA 5TFSL 4NJ9L 4ODBD 4U1SA 4JANB 5HHXH 3TN0C 3EUUA 4M61B 4PIRF 1ZLWK 2VXTH 4PRIA 4OLEA 4UNUA 4YAQB 5A2IH 3FMGL 5I9QC 3OKKA 3UP1A 1XF5A 1CD8A 4P23C 3VD7A 2ERJB 4QXGL 2YC1B 3S5LG 3C09C 2Z4QB 4S11A 1JV5A 3B8YA 3JVGA 1BHGA 5EWIL 2HRPL 4K55A 4JG0L 4WHTA 5HI4D 1YY9C 4M8QB 3HI6L 1A9EA 2IAMD 5E03A 4IIQA 2WWMC 2PF6A 3FONA 1QLFA 1YEJH 1PX3A 3EFDL 5HYJB 1SQ2N 3EDEA 2X1XR 4WY7L 5DQ9B 4CVWA 1OAKL 1XF1A 3RVTC 4R2GB 2LE9A 3QA3B 4NCC2 1P4BH 2EE2A 5GS1C 3NN8B 2KL6A 5HI5C 4JCLA 4PJCB 3THMH 1FLRL 4JG0H 1BD2E 2EYTA 1UXSB 3OAZK 2D0HA 3IXTB 1AHWC 1S7XB 2X1QA 1QRND 4K7FA 4OZIB 3KPSB 3WEXB 1FE8L 1G0DA 5IVXE 3L95B 3ARFA 4YDLC 4GW4B 4Y8AA 5H37H 5K9KA 4QLRA 5CILH 1GC1H 1JN6B 5CGMA 3VFNA 5GRYA 5CSGA 3A6BL 3I6LD 3ALXA 1Z0NA 2BJML 1MPAL 1Q72L 3RUGE 3RWCA 3IAQA 4I3SH 3ZE1E 4XP1L 4NSKB 5DO2D 1I1AA 5DSCB 4XVUD 3BP4A 5B8CC 4YHOH 1IEBB 3QCVH 5DZNA 5I8EA 5ISZD 3QISA 3BZEA 4U33A 4NO3A 2A6KA 1ADQL 2D7TH 2FL5B 3MUGA 1P1ZB 4G43A 3HG1B 1IGJB 3O9WD 5HHQB 4NPYB 2AK4E 3PWPD 1FCGA 2Y06L 4L8DA 1HHGB 3HN3A 4X0KA 2Z92A 1AKJD 4Y16B 5F3BB 4ZYKB 5IVXF 3DARA 3VXQB 1LEGB 4BFIA 3U6RB 4KHTL 5CEYB 4WV1A 4Y5VA 5TDNB 1FL5B 1NFDB 3AS2A 1A14L 1K6QL 4UU9B 1BGXH 4CVXA 4O51B 2GFBB 4HSQA 3NCMA 3ARXA 4N0UB 3U30B 4I3RL 4GLRI 4ZDHA 3S35L 1A7OH 2ZJSH 2ZUXA 4K3EH 5KTEL 3U1SH 4FFZL 4XHJD 2AJXH 2J4WH 3WFDH 2A0LD 2H3NA 3QI9C 3ARSA 2VL4A 4IOFD 2FO4B 3GJFB 4ZUVB 1T6WA 5IWLC 1RIVH 4KAQH 1NCDL 4UIMA 1T5XA 3AS3A 2D0GA 2IPKB 2XKUA 1O7SA 3HC0A 1DBAH 1I8IA 4MXVF 4RAUB 43CAB 5HPMA 3ARZA 5I6XB 3B2UD 5D1QB 2RAMA 4Q6YA 2BP3A 2EXWC 1S7UB 4HXBL 4N1EA 3TZVC 1CFQA 1Y6NR 4PGCB 2DJ4A 4QOKE 1QSZA 4LCYA 3V0AC 4OLXH 4RX4D 5C09D 5EO9B 4Q9QH 3X14A 2OZ4L 1JGVH 1CD1A 2E27H 5DJ6B 1RURL 3CFEA 3RHWK 3SKJH 5MEQB 4XRCA 3VRJB 1N4XH 1KCUH 4I4WA 3H0TA 3O8XA 4OD2B 4QRQA 1EEZA 2HLFC 3SBWC 4ETYA 4AEEA 1N2RA 4OUOA 4EDXB 5HD8D 4PY7B 1CLYL 4XCEB 3SE9L 3MJ6A 4WUUD 4YBQC 1GIGL 1L6ZA 5CEXB 2ENYA 2AJYH 2GJJA 2ICCA 1EFXA 4HKBA 3I3BA 5DD1H 1CS6A 4OV6F 3HNVH 3NPSB 3FQTB 4NQVA 2CR6A 2H8PA 2XQYG 4K94H 1ZLUH 1PEWA 4M6AA 1IARB 2BXYA 3DETD 4YGAB 3BP6A 3QNXA 5I17A 4MA1C 4NC0B 1L0QA 3AFLA 3GJEB 1BD2A 3QH3B 5GS3A 4KRPD 5E6YA 2H41A 1T6VN 1LDPL 2NTSP 3PWVB 3PWUB 4Z7NE 3SN6N 4GRMB 5I66B 1WBXB 3P0VH 1RZ7H 1RZGA 3LRSB 5DVLA 1UKTA 4LSSH 2Q1EA 3QUYD 5IHLB 1SEQH 4Z0BH 4YHNB 5D2NC 4X5XB 4KUCD 3WXWH 3OAUH 2HJFA 5J6HA 4BKLA 5CCKL 1CFVL 2AXJA 2DOCA 3BKCH 3MV9D 3VWJB 3AREA 3RTQB 3QPQC 1ACZA 4NC1C 5EUOE 3UYPA 1BFTA 1JZ6A 4LKXB 3HZMA 4I4WB 3JUYA 3U48A 4U1JA 1QR1A 4PJXF 5F8QC 4HGMA 7FABL 3KYOB 2YN5A 5IMKB 1WZKA 4WWKC 3UPRB 1K5NB 4D94A 1MWAH 1JPFB 1NDMA 1G9EA 5J11B 2MOVA 5B3JF 5KJRL 4ISVA 3S4SG 2YD7A 1S7QA 5CEXA 1PZUB 35C8L 4G80B 1T89C 5C08E 1CXEA 5J57B 1OAZL 4G9FE 5F21B 4CVUA 3GHBL 5HHNB 3S37L 4LCWE 3HLAA 4DFHA 3WYRA 1ORSB 3PV6A 5F9DC 2ATKA 1AGEB 2VLRA 4NNPL 5F7UA 1QLRA 3FN0L 3O3BA 4UTAL 1S5HA 3NGBB 2ADGA 1KTLA 4XPGL 3H8NA 3DX8B 3QH3A 4ONFL 3NACH 2OJEB 1IEAB 5HYQA 4OCRH 2EE3A 1QFHA 3TESA 2F8OA 1VFAB 4GRMA 5I66A 1G7QA 4U49A 3DVGA 5C0EA 4N0CD 1MFCL 3N1GC 2C7UA 4U3XA 4NKQB 4YHNA 4N8VG 3DRTB 2YRPA 4PR5A 3RHWF 1MVUA 3KPSE 5JXEA 3PQYA 1TTUA 3MRBB 1FAIL 1Q9WB 4XB7A 3H3BC 4UTBL 1HHHB 1WVZA 1RU9H 3NCYP 5E2VH 4EN3B 3N1PC 1NCUA 5IB4B 4Z7VB 4K8RH 2A73A 1EEYA 4OIIH 4Z78B 1NCNA 4HK0B 4ZUWB 3S6CA 1JPSH 4PJBE 3KPPB 5A16A 1UVQA 2D03H 4GSDL 1IFHH 1HI6A 5EOQL 1FYTE 1OVZA 4LAQL 3UAJD 3BAEH 3ILQD 1JPGB 3TBTA 3V0WH 4RFEB 2P49B 1T2JA 2APBA 3QI9D 4HJGB 1KB5A 5IGXH 1J10A 5L9DL 2HFGL 3RVTD 2APWA 5CBAB 3WV0A 4Y88A 3QXAA 5SX4I 1Z2KA 3HPLA 2YA2A 4WW1B 2R1XB 2DLGA 2DQUL 1Z3GH 3WIHH 2GKIA 4OT1L 1UADC 4KI5F 5D7JC 3ZZ1A 4MJIE 2Y5TB 3QFJE 1JPTL 2E7MA 2JJUA 4QRSB 4XNYL 5KSVB 4FQJL 2XY1A 3MXVL 3UTSB 4TUOA 1WBYA 1KIPA 1EH9A 5FA4A 4IMKC 3ESVF 4NT6B 4BQCA 4BSWB 4TULL 4GKNA 5CP3A 3DHJA 5JLZA 1BQLL 2HN7A 3PGCA 1DEEA 2ZSWA 2XTJC 5F7EH 3IXAA 3P0VL 1QBAA 1U8PB 3QIBD 4NJAL 4Z5RA 3D2UA 3DROA 4L8BA 5HGHB 1N0XH 2YPKA 3BFOA 3RVVD 5I1CH 2XZQH 3TFKD 2NY2B 2XG4A 3LZFL 4NQTA 3NZ8A 1DQMH 5TF0A 5FFLA 1CFVH 3ORJA 4HV8B 1JZ5A 1ES0A 1P2CB 5GS0C 3MSPA 4RA0C 2A9ML 2VZSA 1MCPH 1ZSDA 1ZLSH 3OV6A 1D5BB 4RWYL 3DRQA 3SKOA 4WGVB 3BP5A 4GMSL 2W9EL 3OJDA 3LKPB 1CICD 4MD0B 3SE8L 3WLWD 3V6FB 1NANH 3CFJB 3B9EA 2BDNL 5F1OB 4L8SC 3WFEH 3BN9D 2PYED 1M71A 1FRGH 2R0WL 4LPUA 5CBAA 2OK0L 1QVOA 4CDHA 4POYA 2YPVL 1XGPA 4DAGL 4WW1A 1FSKC 2CIIB 2YD3A 1Y6KR 3FQXB 3WEXA 2B0SL 4JPVH 3QIBA 5JORA 3V8OA 1LK2B 4OZHA 5CAYB 1CTNA 3T0EB 4FP8L 4X6FA 3ULVH 4R0LA 4NQSB 4MCYA 3BPNC 2VO5A 4WWKA 1FZKA 1H0DA 5F9WC 5L2KD 3WDHA 1A64A 3UBXB 5E2TL 4QYOA 4M5ZH 3MOAH 3QIWD 5CJQL 3VGFA 4YFDB 3HC3L 4U6XA 2E6QA 4LLUA 5F1SA 4XAKE 4MWFB 3QRGH 1BQSA 1GGIH 3ROOA 3KR3L 3BI9X 2KH2B 4LLVB 5EU4A 4KQ3H 3DX9B 1BZ7A 2M2DA 4KV5E 2VC2H 4NCC1 1DLHA 3O3AA 5B4MD 1J1OL 5HYIA 1JRHH 3KAAA 3ARGC 1V3LA 1W72H 5JPNB 4KKBC 3WKMH 4U7SA 2P1YA 1OM3H 3NZ8B 4XPHL 3PWNB 4J6RL 2CDEA 4BYHA 1MJUH 5MEPB 1BFOA 1DVFB 1VERA 4GMTL 4W6WB 1LP9B 1NUGA 3V6ZB 3DRQB 1FO0B 4L4VE 1U3HD 4GG8A 4OFDA 5FGCB 2Z92B 1K8DA 3V6FA 4CGTA 1JYNA 2EDBA 4XBPB 5BS0D 4U0QB 3T77A 5F9JB 5KVDH 4LKCA 3V4VL 4FNLL 3CFCL 5EH1A 1UJ3A 3KLAB 3FQUB 3U9UA 2DQTH 3MCKA 3GNMH 4PJ8C 1SJVA 2VAAB 4OD3L 1OSPL 4PBXA 4X9BA 3QWOB 4G8EA 4Y19E 1X6NA 2H26A 4KQ4H 1L7TL 3IGAB 5FKAB 1IAIL 3LVEA 1I3VA 1VA9A 4KMQA 1ZVYA 5I1JH 4OZFH 3VCLB 8FABA 1SY6L 1TVBB 3LEXB 1ZVSB 5CD5C 1EHNA 5A2FA 3RWDA 1DN0A 3WL9B 3ROOB 2OSLB 2F5AH 1W72L 3RKDD 3C5SA 1HDMB 4KQ4L 1OCWH 2VXSL 4R3SA 4YEFA 1RUKL 1YEIH 2ZKHH 4DZBB 1WIPA 4EN3D 4JRYD 1H5BB 1C16A 3CH1B 4FG6C 3QUXD 1FZJB 3HI1A 4IEFB 5IM7B 2Z8WC 3OB0K 4UDUB 2LFGA 3V6ZA 2D9QB 1W0WA 3ARED 5EULV 1Q1JH 4UV4L 4EI6B 3E6FA 2FATL 1LP9F 5EORL 3EO9H 1QHPA 3GRWH 1FBIH 3TBSB 1ADQA 5D1ZB 3H0TB 4QHMB 3W11D 2OXHA 3AROA 1S8DB 4OT1H 1UCTA 3LH2H 1S9WB 5FO8A 4OQTA 3WN5C 5IEHA 3ZE1F 1KPRA 2P5EB 4XPAH 5I9QB 3TNMA 4QXUH 5DJ2A 1NAMA 4Y2DA 4OF3A 3NCEB 1W0VB 4P23B 4IRJB 4MCZA 1REIA 2DN7A 5C0DB 4F9LA 4WTZA 1QSEA 3ZL4H 1ZKAA 4ALAH 5EZOL 4NZTH 4NQEE 1QLEH 2AQ2A 5DEGB 5DTFA 1X9QA 1XR9A 2EC9U 1A3RL 2OTPA 1ND0A 3DV4B 3C87A 3S35H 4ZFFB 1WT5A 1UWXH 1IT9H 2NY6B 3FFCA 2J6EL 4LOUD 1KXVC 4LEOB 1CE1H 2FBJL 4JDTH 3BP6B 5GGRA 5I17B 4L8SA 3TYFB 4PGDB 4LLDB 3VGAB 5D7JD 3HE7B 5I1CL 1OD7A 3UTPE 5K9QG 1QFWI 4HJJL 4YXLH 3VFSA 4G9FD 4G8FA 5E2UL 1LO0H 4E41A 5C09B 1MCPL 1YYLL 2EKSB 3B8SA 5AYQA 3RTQD 4XXCC 4X5XA 1RUQL 3VXRD 5LWYH 3TJEH 3QULB 4AT6A 3OPZH 1D6EA 2FEDC 1CT8A 3CK0L 4Y4KB 3KJ6H 3L9RA 1G7PB 1UA6L 1MLBA 1JL8A 4Z7UE 1C7TA 1NKOA 4ODSL 4O02L 2V7NA 4Q9QL 1X5IA 3T0XA 2FSEB 3VXNA 3ZYZA 3E6HA 3QBTB 3HMWH 1DDHB 4Q6IA 4WI4A 4MNHB 2Y25A 5AUMB 1FVCB 2NY5L 1SJXA 2YD5A 1FDLH 3RUGA 3P73A 2Z31D 1YNTB 4JFEE 3OJ2C 3V52L 4D9RE 4KJYB 1N7MH 4N0YL 3TH4T 3FT4A 1U2HA 2J8UF 3FFCB 5H8DA 3ZTJG 1D5ZB 4APQC 1IBGH 1I8KA 4YHKL 4NBXB 4X8JB 3F7RA 4AIXA 1CF8L 3WCYA 4OKVA 1QLRB 3AU1B 1AE6L 4Y16C 5GGRB 2XRAL 4Y7MA 3ALWA 4WEUD 3HE7A 5D1QA 1EO7A 1WGOA 5JPMA 5K9JH 4LVHC 1TVHB 2YKLH 4ZO9A 1EA9C 5GJSH 1KCSH 1SY6A 2AEIT 4MZ3A 2ORBL 1IBGL 3O3EB 2FJFA 2JCCF 4JO3H 3X14B 3ZTNH 4XVTH 3EBAA 1C08A 1FNSH 3QDAA 3RWJB 2AK4B 2I27N 3L6FA 5F7DB 5LAXA 3CFEB 2F54B 3T0BA 3QQ9D 1IC7H 4JFED 4GG6F 2EDDA 1FZOB 5BO1L 1VHPA 2VDRL 3WNNA 3MJ8B 4M1CC 1XH3A 4IBLT 5DRNA 5DJYA 1G9MC 1FC2D 3UYRH 3SY0A 2H1PH 4POZC 5DMGC 4KGJA 4P2RA 1IGFH 2NX5A 3OX8A 5I71B 3H7BA 5D2NE 4AG4H 2DKUA 2PW2B 3H6JA 3F6LA 3VE0B 2DQIL 1DCLA 4PV9A 4YXHH 1NDGA 5CSBA 4DW2L 3MBED 5GGSB 1OF2B 4ELKB 3CZFA 4HHAA 5A1AA 1LE9B 5DWUH 4Z7WF 5EOTB 5F96H 3BGMA 4NHUA 4HIHA 4NZJA 3ULUL 3NIGF 2QSTA 3U46B 1KJVB 4I0PC 3SDAA 1BD2B 2FX8L 5GGTH 5C08D 4PJBB 2AEQH 3TA3A 3WUZA 1GHFL 2IBZY 2R8SH 3K74B 2RCSL 4K07A 4CW1A 4NHCL 1JHLH 4IIQB 5KVFH 2X4SA 1MCWM 3QUXB 5E00B 1CE1L 3VDBA 1N8ZA 1KJMB 4NGHH 1X5KA 3MX0A 4PRNB 5DQ9A 6FABH 1I7ZB 1ETZA 4WI7A 1DL7L 3QO0A 4JKWA 2BERA 5JZ7D 3UDWA 3CDFA 4P4KA 4CVZB 3SDCA 5F71A 4UNVA 1U3JA 3GRWA 5EO1A 1A6AA 3NFSL 4QHNB 3SGEI 1MFAH 4NQCA 5E8OB 1EZVY 5T3XH 4NHCH 4H1LB 4NP4L 1MEXL 3QUKB 2VQ1B 2ZUUA 3TT3L 5E7BA 4LPWA 4U1HB 4KK9D 1LQSR 5I76B 1DQQA 1QBML 5C0AA 4PJHA 3RWGA 4TUKL 3OR6A 1J87A 2VL5B 3JBG7 4KUZH 1S5IH 3Q5TA 5E9DA 4XNMB 1WC7B 4OZFG 2CDGB 3RU8L 1NCDH 4F7EA 1JGEB 1P69B 4PGBB 2W60A 5HDOA 4UILL 4FZEH 4GKZB 3BKMH 1CK0L 4GSDH 3GJFH 5HYFA 4EI5B 1I1FB 5CINL 5C07B 1YQVL 3AMLA 2C1PB 3VWJC 2VN7A 1PG7X 1AHWA 2EC9T 1C1EL 2EDRA 3KLHD 4C4KT 3RI5K 1T1YB 2WBJB 5FAAA 1YUHA 1KJ3H 4OZHB 1LE5A 4L4VD 3MZGB 1JZ2A 1ZA3B 1PAMA 5JDSB 1FJ1A 4WWKB 4JKKA 1BAFH 3UTTE 5BVJA 4YHKH 2X4NB 1VFOA 4FABH 4PJBF 5J11C 2NY1B 4QYOB 3I6LE 2XN9E 2Y6SD 3GGWB 3WE6B 4LK4A 1J88A 5EFIB 4OFVA 3GI9L 1QBLL 5F3BA 3O3DA 3MUZ1 2CKBL 3LIZL 3IS1X 2ZCLH 1J9CT 1JHKH 5KW9L 3DVNB 5D6CB 1ITBB 5B38B 3J7HA 2WM0A 1FNLA 1TENA 1K4CA 2X7LB 3MMEA 4FTVE 1HSAA 1FHGA 4YHLH 2FB4L 3ZSTA 3F7YA 3S7GA 2HRPH 4P4RA 1UYWH 3Q2CA 5E6IA 3SCMC 1XF4B 4JKPH 2DTML 4R0LC 4YO0B 4PGEA 4ZPTB 4J2XA 4NJAH 3AM8A 5MEPA 1BFOB 1DVFA 4PG2C 2CK0L 3ULUD 4WY7H 5EOCL 3CU7A 2VLRE 5INDA 3BH9B 3BZ4A 3T0DA 1K8IA 2ZCKL 3UTZB 3P0GB 15C8L 4ZQKB 4WEMB 4BK5A 2F15A 5CZKA 1RZ7L 5FIEA 1YMHA 2IQ9H 4AG4L 1BQUA 4X4ME 3NH7L 4A6YA 2IBGA 2YOCA 3VFWA 4YZFE 1I9IL 4EN3C 4XNXL 5D2LA 1JV5B 1TXKA 5ACLA 3IDIA 3Q6GL 2H26B 3KLSA 4PJEB 5C0CD 2NX5E 4PB9H 5K59F 4QRSA 2BSSB 4JFPB 4LMQE 3RIFK 4BQ8A 3HI5H 4HAGA 4YX2H 2VLJD 4UDTB 1S9XB 1ORQB 3JV6A 4P5KB 2APFA 1B0WA 4U6VH 3ZE2E 5DDHB 2NY4B 2NXYD 1EXUA 3GFUA 5AEAA 3PGCB 3QQ9C 5KVFL 4KRNA 2MSPA 1FNAA 5H94B 5IV2A 4MDJB 4PFEA 3MMEB 5ESAB 4EUPG 3QT2A 3O6KL 4P4RB 1NC4D 1HHIA 1ZT1B 2DYPB 2AJVL 3ARBA 3EHBC 4PJIA 3F7VB 3RL1B 4M62L 1Z0MA 2DQIH 4LFHG 2B2XH 4MMXC 2K3TA 2GCYB 4X6BA 4DVBA 2FGZA 5DC0A 3L1OH 1UENA 4HGWA 3EZJB 1PGRB 2X4TB 3G6JB 4ZUTB 3Q3GA 2G9HB 3DUSB 3T8XA 5KSBF 1KTDB 4S1RH 5I74C 5I75C 1ULVA 3RI5F 5DK0B 3OTTA 1GHFH 2WIIB 4HT1L 2ZZUT 3GBMH 2E7LC 4RGOL 1CK0H 2SEBB 5JORB 1QP1A 3MRCA 5CMAB 1VPOH 4QHKJ 2Q3ZA 1QG3A 1B6UA 3JWNC 2IPTL 3CDGA 2JB5H 4MCYB 1VENA 5GJTL 3VXSB 4KTYA 4MAYA 1KCUL 2W0KA 2HFFB 1T2XA 3I2CL 5DTFB 1R3KB 2CGRL 3G5YB 5HY9A 4UUJA 5LGKA 4RGNB 1BJ8A 1X5YA 1NC2A 4WFFE 2BRRL 2FGWH 3GBML 4JVUA 1L7TH 2Q8AH 4W6XB 1MEXH 4BELD 5J06A 3RY6A 4HXBH 1I1YA 5I1AB 3FFCE 2LTQC 4Y16D 1NEZG 3HMXL 4YAQA 2Y9RT 2YUZA 3L3DB 4OLXL 1A0QH 4XPTL 5CHNB 4PYHA 3RIAF 1U58A 2OMBA 3UPCA 3MNVB 2DWDA 2YD8A 3OGCA 3QDGB 4JY6B 4M7ZB 4NZUH 1N6UA 2NZ9D 3QQ4A 1OCWL 3BPNB 3U4BL 2DIJA 2DDQH 4FQIH 5F9WB 1SEBB 3O6FC 5L8KB 4PRBA 2DM4A 3VI4F 1C12A 2YD1A 1M6OB 3PHOA 2MQCA 3VA6A 3DI2B 2P5WA 4OCSH 1OT2A 4L1HA 2NXYB 4NO0A 5EN2A 1PDKA 4P46D 4JJ5A 4X80L 3VWJD 3VWKA 2MMXA 1AC0A 1UWXK 4FHBD 2BNRA 1KJ3L 4MD4A 4UV4H 1GGTA 5C07D 5IW6A 4NRXB 4DKEH 3O4OB 4F3FA 5CZVL 3DLQR 3LDBC 1RVFH 1FRGL 1KN4H 4KKLC 4PBVC 5C0EB 1ZGLM 1T89A 3G04A 1A7QH 1KELH 4LCCA 3AM8C 3MACL 3MGAA 1DVFC 4PG2A 2LAGB 3KVQA 3RIFF 5FUCC 3PQYB 4LL9A 1YYMH 5DD0L 2IADA 2F54D 2HT3D 2HFGH 1IGCH 2A74B 3GM8A 3QCTL 3MJ7B 4GAFB 3FZUC 4PGJA 4FQXB 5INCA 4R26H 4W4NA 2CJUH 5D7SL 4Z7VA 5MERA 5ACZB 2H9GB 2V9TA 1MCBA 1D7FA 2X4UA 1KJ2B 3MV7E 2PTUA 4JKPL 4Z0XB 3GEWB 4JDZA 3DV6B 3MYJB 5DJDB 4PY7A 3CUPB 3T08A 1TDQA 4P5TB 1MHCB 4JQVA 1FFNA 1OLLA 1MQ8A 4F9PC 3ULUC 1X5XA 3C6LA 1DZBA 2BSED 4U1MA 5F9AC 5J8OA 1T83C 1HYSC 1KB5B 3GSVA 2KZ1B 4LSTL 4F7MB 1BVKA 4D0DB 3WLWC 4L9LB 5KVGH 2MNUA 1A4KB 3O6KH 3MXWH 1PKQA 3EW3B 3CXHJ 4ZOCA 1AI1H 1RZJH 1IGIL 4J8RB 1KC5L 1NCCL 4HUXA 5DJ0B 1LNUB 2XZQL 4NN6C 1MIMH 1MRFL 3WFCL 1ED3B 1KCVL 4KV5F 3ALPA 5HSFA 1FVEB 2XN9D 3HAEB 4NRXA 3VXRE 1KPRB 3TNMB 4P99A 2A77H 4IS6A 1FYTD 2X4PB 1EVUA 1JE6A 5ESQB 2F53D 1JI2A 3DECA 2VDPL 2QJDA 5MP6H 4XXDB 4U05A 4NM4H 4JFZH 4N9GA 1IM9D 3O2DA 2CMRL 4LHQB 1QQDB 5FHAH 3VMNA 1VPOL 3U7YH 1JGDA 3V7AE 5C2UB 4X6DB 5ILTL 1NQBA 4ODXA 1ACYH 3DYPA 3QAZC 5I8OL 5IMKA 5KANG 3WN5B 1WWAX 4PJ9B 5GISH 1TPXB 1KNOB 2B1AH 3QXVA 3B4NA 1LO2H 1B2WL 1CFSA 5DT1H 2PR4H 3O9WC 4DCQB 1UWGL 2EDTA 2K7PA 4ZPVA 3C6LB 4X9HA 4DUWA 4OUUA 3OKEB 4M3JA 1QO3A 1NGWA 5TDPA 2HJLA 3VRJA 2DLFL 4J3XA 4LSUH 3DIFB 3MRLB 3TBVB 3GMQB 3HE7C 4XHJC 4I77H 1U8MA 1ED3A 1AQKH 2JF1A 5LGHH 2VLJE 2BRQA 4D9QD 1CL7I 2YZ8A 4DGIH 2CDGA 4OCSL 2P5EE 1AGCB 4HIEA 1TZHA 2ZG3A 3HS0B 4O5LL 1GJIA 3TNNA 5DYOB 1P5VA 1YNTA 3D85B 4AM0A 1MI5A 3OKMA 3BRFA 1AY1H 4GW1A 1CDUA 3U2SA 2FEEL 3IJSA 4PRIB 1T1XA 4CL7A 3VXUB 1RHHA 3E0GA 3WIHL 1CFNB 2YN3A 2EKJA 4LVOC 2QEJA 4DN3L 4JHBA 3LQMA 4JRXD 2F19L 3SE3C 5C08B 1CXFA 3TPUA 5I1DA 5DD5L 3T1FB 4KJQD 5HHPB 1FAKT 2GY5A 5TQ2H 5T3XE 3CVIL 4NKOA 1KEML 4G9FA 1RZGB 4YR6A 3WNMA 3CFBA 1NEUA 2FJFB 5BQ7B 4RA3A 3DO7B 3QUZB 4WFEE 1RSFA 1N59A 2GSGA 1A3QA 4FS0A 1A47A 4UINH 2X4RA 4BKLB 3T4AB 4Q9CA 4NNXA 4LKCB 1PYWB 3T3ME 2GJ6D 4O2CA 5ALCL 4PJCA 5FYKU 3NTCL 5EU7E 1PJ9A 4APQB 1LO5B 1K4CB 1KGCD 3U9PL 4RIRB 4M9PA 1P7QB 5BZWA 1U93B 3TH2T 4TSBH 4U1JB 3EOYG 2CIKA 1HYRC 1I3RA 1F3JB 3ARBD 5DJYB 2W65B 4N9OB 4DVRL 1NGZA 1IAIM 4KK5D 1FO0H 4ETQA 5C2BH 1B0RB 3MCLH 4XCFH 4YE4L 4JZJC 4NQDE 3KR3H 3LN4B 1IGIH 2FHCA 3SE8H 1FNHA 1Q1JL 1UZ8A 4LQFH 2R0KL 5J6GA 4YUEL 1SEQL 2X89A 5JXED 2OCFD 4XH2A 3NIDE 3BX7C 3BW9A 3WXWL 5JW5A 3GUTB 1FDLL 3WL9A 2AV1B 5F70A 5FUCE 4KJWD 3V9FA 2R1YB 5HXMA 1NGPH 4OGYL 1CFNA 1IEBA 3OWEA 3U7WL 4LU5L 2X09A 3LV3A 4YK4C 5IQ9A 3QXUA 1MY5A 1RPQA 4NKMA 3SBWA 4WCYH 1R24A 2D7QA 2LU7A 2HMID 3REWA 4HWUA 4M6OH 1IGTA 3I9GH 3QUYB 5E8NA 4XPFH 5I16A 1IL1A 1ZHKB 2J6EA 4LVNB 3FRPA 5MENE 3IJHA 4Z7QE 1U3HB 4EI6A 4P5KA 1PBYA 1A6UL 3BJLA 1A22B 2WAHA 3W0WE 5GGUA 5EC2B 2MPAH 3WO4C 5JOEA 4JLRB 1AC6A 5D1ZA 1EXUB 3K2MC 5L8JB 1Z9LA 4GBXA 1LO4L 3B5GA 3EJZD 1NLBL 1XCQA 1U8OA 4NQCB 3BP7A 3K8KA 5T3ZL 1DUYB 1J8HE 2YUXA 4PJ7B 4J6RH 4BQ9A 4HBQA 4P59L 4I0PB 2B4CC 2J1KA 5C0IB 5F7MC 2BVTA 2CUMA 3VGHA 4FQ2L 2BY2A 1U2CA 5CUSH 2L0DA 4PTTB 3B83A 4MA8H 5FYLE 4RGND 4KFZC 3QUXC 3DMMB 4M6NL 3GMMA 5DMJB 3H2WA 5BVPH 2ARJB 2F53B 2RQ8A 5DUBB 4O02H 5FHAL 5HHMD 3W39A 1TQBB 1NBZB 1HOCA 3X17A 2GEEA 3CMOH 2DLEA 2Y4SA 3BEVA 1KTDA 4S2SB 3ZDZE 5IB3B 2NY3D 4FOMA 4P48A 3SCMD 5ID1A 3KGRA 1RZIB 3TIEB 2AQ3A 3DSFH 3LV3B 4U4BA 1AJ7L 4K8RL 1CXLA 4WDIB 5CP7A 1MJ8L 1W72A 4NKDB 3L3IA 2XQBL 4MAYB 5E8NB 1BFVH 5FYJD 4MJ6A 3FONB 4UB0H 3QWRA 4WO4D 1DANU 1NC2B 2EDKA 1U3HA 5C07E 1LK3L 2IWGA 5GZND 4GG6A 2DBJA 3M17A 4QXUL 4MAUL 4Y8DC 1F4YL 1A4JA 5E6ID 4P2OD 2WWKT 2YPLA 4K9EC 2FWOB 3TVMC 1U8LB 2ESVD 3UCRA 3K8LA 5D6CA 4A6YH 3UPAA 2OTWB 4OBRA 1U8PA 4K7FB 3L3DA 3AB0B 1YJDL 1HKLL 5B22A 3L95A 5E5RB 4QXTB 4YPGA 1QSFA 2WBJC 3PDDA 5C6TH 3OGCB 3QDGA 1LK3H 2BSTB 1D5MB 4LNRA 1NCAL 4OTXH 2HT2D 3MV01 4HIIA 2MWCA 5I1LB 1ZSDB 4Y19B 3ULUH 4ZS7H 4PJXA 3PWLB 3SKOB 3BE1H 1SJHB 3I3EA 3GIZL 3RVUC 2HT4D 3HUJF 1T0NA 3PF2A 3WS6A 1ZEAH 5IR1A 4CU8A 4JG1L 4TVPH 4Y4HA 2VDRH 4YNYB 5KTEH 2EXYC 4NZRH 1EHXA 2QV2A 3K80A 2FYYA 1G7JB 1NBVH 2P5WD 2B4CH 1JJUA 4HDIA 4XP9H 4CMMA 3IF1A 2IALA 4BM7A 2ZKHL 1W72B 3CLFL 4Y5YA 1FN4A 2FL5A 3ARVA 3PUCA 2Q20A 1Y0LB 1DE4B 2BSSA 3DI3B 2BFVL 1S9VA 4JFYA 3AAZB 4OZHF 4KTEH 3TGXA 2JB5L 5D96C 4IRZH 4MWFA 2K7QA 4L1DA 1BGXL 2X4QB 2FWOA 4ODWB 2X1WL 3OSKA 4HJJH 3EYOA 2FR4A 1XGUB 1BX2A 2IMMA 1U41A 3T3MF 2OS7A 5C1MB 3BD3A 2E6PA 2ZCLL 5T3ZD 2AKRA 3H7BB 5IB2A 1FIGH 4WI3A 3QXTA 2MPAL 3MROB 3JVGC 2IAMA 3VE0A 2JE8A 1WAAE 5GZOD 3EYSH 2F74B 4NYLA 3BGAA 5J0BA 4MS8C 4PLKD 3O4LE 3CCHA 3MV9A 4KKAC 5E2TH 4KAQL 4Y19A 4C59B 3FFCD 3H9YA 2BY1A 1YDPA 4HIXL 5I1GL 1LE9A 1AGEA 2VLRB 1YNKH 3TO2B 4R7DA 4XBPA 2NY6D 4LU5H 1KJVA 4MLSA 4LLDA 2NY4C 5CLTA 5E6IC 2BX5A 3PIQB 5ICXB 2J8UB 3T8XB 2VWEC 4JFEB 5GIRA 3TA3B 3BUYB 4XP9L 2FYYB 1MCWW 3IJYB 4P49A 3NCJL 2NY5H 2NXZB 2Q86A 4U6HA 1K3IA 4FQQA 4XCNA 4PRNA 3B9DA 2C7UB 3MNWA 1OAKH 1N5YH 1EPFA 1PLGL 5T33H 3KYNB 4CVZA 2HT2C 3TV3H 3LB6D 4N9GB 3CVHL 1AGFA 3MJ9L 4YIQA 4MA3B 5KVMC 3X11B 5T1DH 4JGUA 2VR9A 5DUPL 3QG7L 2DICA 1ZA6A 2A38A 4M5YH 1FZMA 4LLYB 3MYZA 2VQ1A 43C9B 3NFPA 1JGDB 2IG2H 2IQAA 4NO2A 2CLRB 4FNLH 4P23D 5F1IA 4IRJD 3B2UC 5I76A 4ZUWA 5C0BA 1MCQA 3GHEL 4NNYA 5B8CA 3PE9A 4FFVD 3MGOB 1MRCL 4JY4B 3SDXF 3WXVL 3MJ9H 3QDMB 4DQOH 5A3ID 3C2AH 4S1QH 2AEWA 3CMGA 3TBTB 1TCMA 5F96L 1NGQL 2EDJA 3OHXB 4I1NB 1HN1A 5LKNA 1UM5L 4HFUL 1YEKL 5SWSA 4H1LH 4RZCB 5C07A 3RY5A 1K2DB 2GYSA 1OQOA 1Q0YL 2C4FT 3KNBA 4UQ3A 1A7OL 3DGGB 2ESVA 1ZLWH 2R1XA 1N3NB 5ISZE 2DWEB 3V5KA 2BNUB 2IBZX 5SX5K 3TPKA 4WV1C 3LPGA 4WENB 1IGFL 3PL6D 1DL7H 1U92B 2L7UA 3LEVH 5DO2C 3TO4D 1RZJL 3ULUE 3IDXH 4WEBL 1ZHNB 4HH9A 5C0BD 2JIXA 3QDME 3V6OC 3WNOA 5JQ6H 5E8EA 3PWPE 4G6FD 4MQ7B 5CCKH 2X70A 3BH8B 2AERT 4S1SH 1RZ8A 3IVKA 4N90E 3D69A 3GZKA 3BOVA 4HWEH 3DV4A 4NQDB 1T1XB 1JNNH 3RTQA 1T0MB 4KJPC 1YEFL 2R23A 4NQXA 4HBCL 3M45A 1FZMB 2JKXA 4LLYA 5GZNC 3KPMB 4U1IA 1ZV5A 1CFBA 4OLVL 4JGMA 3MRJA 4GUPB 4YHOL 5FEBA 5IFJB 1EBPA 4TUJB 3OF6A 3O4OC 1NKRA 1OAYL 1NDMB 3ARDD 3LDBB 5TH2A 4L4VB 3LMJL 4ELMA 2GK0A 1VB9A 2PW2A 2VUYA 2EIZA 4OCLC 2EDQA 5T1MA 4HFWB 4U1LA 3QEQD 2I5YH 4MNQD 1I8LC 3BPCB 4J12A 3OHXA 2R29L 4RBPK 4IHOA 2CQVA 1UB5B 5TDOA 3R06A 3RY6C 1ERNA 1MLBB 5L8LB 1XIWC 2HA1A 4XAWL 2HKFH 4Z76A 3VXNB 4QOKD 2XZCL 4FABL 3CPLB 4OCRL 5IB5A 5D4QA 4PJBA 5MEND 3A67L 3ARDA 2AGJH 5BV7H 3WHXA 2W9DH 4GRWE 3QHTC 1AGDB 4IS6B 2Y72A 1OTTC 5IF0A 4G8IB 4MDIA 4IOIB 3NFNA 3SGDI 2BVQA 5CGTA 2DI7A 4NFDA 3CIQA 4U3CA 4ZOBA 3RUGB 3QXDB 5DJZA 2X70B 3BH8A 4K3GA 4OJFL 1G6VK 5EUKB 4NGHL 6FABL 4JFQB 4KJYA 5CINH 1MAJA 3CDCA 1KIQA 2QHRH 3JV4B 3QHFL 5CKAA 2EXYD 1RV6X 3L5XH 4NQDA 1AGBA 2R23B 4NQXB 3QUKA 2OR9L 3RWIA 4GKOA 4Q2ZA 3U7AA 1FNFA 2YC1A 4L29B 5D70H 2BSRA 1E4XI 5F9OH 4MJ4A 1H3PL 4TQEH 3IAPA 5E9DD 2RJMA 2CJUL 5KBNC 4I48A 5DRXA 5C0AD 1WIOA 2B5IC 3ET9F 3L5XL 4CKVX 1HCFX 5D7IA 3VXUE 2MKLC 2DQEH 5KS9F 5DRZA 4GG8B 3WIFA 2ZJSL 3RBGA 4WO4C 5T5NG 3WS3B 1XF3B 1YNLL 3QIUC 3QEUA 2NY0D 2QQNL 3Q5OA 4KKAD 5F7DA 3IDYB 5C0RH 1G84A 2HLFD 3IXTA 4OLWH 1QRNA 5E24E 5TE7L 4M6MH 5IW1B 4NKIH 2VAAA 4YHIA 5FUZH 1K85A 1F8TH 4KWUA 5C71A 2R0ZL 3ARDB 5DD0H 3RKPA 2VTFA 4Z0BL 3IDGB 1TPXC 3IB4A 1T1ZB 4TUOB 2VDMH 3OKNB 1ZVSA 3O9WB 1VGEH 4MXQC 5GRXG 4TVPD 3D85A 4J23A 1L9MA 1FO0L 2FDBP 3QDJD 1U3YA 3DXAD 3QFJB 1YPZB 5E1AA 1NMCB 3VXTA 4NM8H 2J5LB 2OMNA 4X4XA 1PEZA 1PVHA 1HQ4A 1EDQA 4FQCL 4PLOB 4ZG1A 1IQWH 3DUUA 3BP4B 2A1WL 1X7QA 5CHNA 3H42L 1G7IB 2VDOH 5HVHC 4Q2ZB 3FB6B 4LQ1A 4X9GA 4ZUSA 4CJ1A 4ZPTA 3QHZL 4X6DE 3T0EE 3JUZA 3CGTA 4MQSB 4MQTB 5EA0L 1OAZH 3U7WH 5HHQA 4Z7VF 1RK1A 5H35B 4KJWC 1FCCA 4KDTA 4TNWF 4X0KB 3KPRE 3OJDB 3QJFA 3DX6B 3SE4C 3E3QC 1ZOXA 4ZFOB 4Z7OF 1P53A 1HCVA 3LN9A 3EJYD 1OT1A 4NWUH 2Z8RA 3AUVA 1S8DA 4H1LG 4XNZC 4GXVH 2ZUQB 4HUWB 1UKQA 1IAOB 3BT2H 3QUMB 5BZWB 4LVOB 4F7PA 5I1EL 4QF1A 1XGRB 3MRGA 4JPIA 2DQGH 5J3HD 2AV7B 3EO0B 1AXTL 4GRLD 1A6WH 1BM3H 2A6DA 4KMLB 2HTLC 5CJQH 5KSUB 3I75A 4ZSOA 3UBXA 2XWBA 1JTOA 2VOTA 3UXFA 2LAAA 1RZKH 4PLJD 4JQXC 1MHPL 2I26N 3L5IA 4KKCC 3VXOB 1A5FH 3VWKC 4GAYB 4JANA 5MERB 4NN7B 1MIEH 3KXFB 4Y5VC 5E0QA 1IM3A 4OV5A 3MNZB 1LO2L 4MQXD 4LLQA 4OQ1A 1UJ3C 1G7JA 5GGVH 1CD9B 1EO5A 5JPNA 2VZTA 5I1JL 4GKSA 2WMPA 1MCLA 1U8QA 1RMFL 5C09A 3GSRA 3CMOL 3NACL 1HHIB 3FB7A 1ZT1A 1O5DT 2F53E 1OD9A 4S1DC 4E0RA 1MQKH 5I15L 3U0TA 3BMVA 5F8RC 1OW0C 1IGTB 5GRZA 1JGLH 4F7MA 2PETA 4JZJB 2NXZD 1RK1B 2CMRH 5H35A 1MJ8H 1JGVL 1EO8L 1HXYB 2P8MA 3QJFB 3IFPB 3SOBH 4Y1AA 5CZVH 5A2KH 1YMMA 1KPUA 5CJ8A 2WQRA 5EIVA 1UFUA 1E4XH 2FEEI 3O6LH 4GS7C 3SE3A 4U6YB 5EZLB 1EJOH 3A67H 4KK9C 3MLUH 3BP7B 5L7XH 3EDJA 4ZXBD 2V7HA 3HMXA 4CJ0A 2ADIA 4I0PA 1S9YB 3LKRA 1VADA 4Z7WB 5MENB 1MJJB 5EZIL 2EDYA 1HHJA 1F2XK 2XWBB 3MV9B 1P9MA 3VCLA 1DBMH 1CLOH 1TVBA 4ONGH 4D9LH 3NBNA 1U3HC 3MCLL 3OKDB 3PXJA 4XCFL 5DUBA 4YDVB 1WZMA 3PV7A 2NZIA 3WO4B 5DMKB 1BP3B 5BS0B 5DI8A 3D87B 2UVFA 1SMAA 2KZWA 1A1MB 5ID0A 1AQKL 3F6IA 3C9NA 3V95A 5ID1B 3SPVA 3OKLA 1GRWA 5D2LB 1FORH 4P2QA 4WDIA 5CP7B 3VW3H 4DCQA 5KSBB 4UBDD 4F9LC 1TTGA 4X9FA 4Z77A 3VDCA 4GAGL 3OZ9H 4HUUB 5IK3A 3C60D 1BBDH 2V5RA 2C3GA 4H5SA 1RD6A 5E4IA 1IGCL 3KDMB 3UX9B 4TNWK 5L2JA 3V79C 2HLAA 3CJJA 1HXYA 2Z8SA 4JFFB 5KN5A 1F90L 1J1XH 2WBWB 4JN2A 1U8MB 5DRNB 3T65A 4OGAC 4PBWD 1L4IA 1P7K