3OJ2C

Crystal structure of fgf1 complexed with the ectodomain of fgfr2b harboring the a172f pfeiffer syndrome mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
KRAPYWTNTEKMEKRLHAVPAFNTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 36
structure length 209
sequence length 209
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C01
1A5FL 4KQ4H 4LHUA 4WI6A 2HVKB 4Y19D 1JNNH 4ZQKA 3QEUB 4FQIL 3HC3L 2ICEA 3BXNA 5T1DH 4FQLL 3DARA 5EU5B 3FO1B 4DW2H 3I6LD 3UTQB 4GRWB 3QCTL 3KLAA 1Y18B 1S9KC 4NC0B 1KPVB 2Q3ZA 4IRJA 3OXSA 3RBSA 1QLRB 3HZVA 1MHHB 3U9PL 5DMGD 4NHCH 3QUZD 1NL0H 1A14L 1UT9A 3NN8A 3MXWH 4JFPB 5B21A 3S7GA 3CAFA 4DTGH 4OSUH 2IH1B 2CR3A 1MCSA 4G9DB 3P9LB 3V0AC 3PHQB 3BP5B 1I9RH 1SEBB 5DJXB 2D31B 3NFNB 3ORJA 1SJXA 4DFIA 2Q87A 1CG9A 3GUTB 1N6QL 1FVEA 1KACB 3KDMB 2CJUH 4P4KA 1OAUH 5C0DA 2R2EA 3HE7C 3MRJA 4PG9B 2OLDA 2VAAB 3MOQA 5TE7H 3VFGL 3DXAA 3D1MC 3P73B 3SGKC 4PRIA 1FRGL 4RWYH 5D1ZB 3HAEB 4JRYB 2Z92A 1OPGL 3K0WA 2ZOKB 3TYGL 1ODAA 1VFAB 5D8JH 1WFOA 3QZWB 2BDNL 4OLVL 1AO7D 1UC6A 1EXUA 4HX1A 5GS0D 2NY7H 3OAYK 4LP5A 1S9VB 3DURB 4HKXA 3T0WA 4H5SA 4JZOA 2VITA 3FT3A 2OR9L 3IDIB 3KXFA 4NZRL 2XXMB 4ZO6A 4YWGH 5ESVA 2XG5A 3D9AH 2PYEE 3UMTA 2CR6A 4HK3N 5EO0A 4EI5A 4GKSA 1NGYA 2DF3A 3ZYOA 3MLVL 5D2LF 3WXVH 4AZ8A 3MGAA 3D6GA 5KVDL 1H3PL 4GFTB 4CJ1A 4PGEA 3P40A 2XZZA 3BJLA 3DBXB 4QRTA 1NDMA 3FCTB 2XWTB 4FP8H 1AGEA 2FJHA 2IFFL 5L7XL 1IAIL 4LPUA 2NTFA 1F45A 1E6JH 1RURL 2FD6L 3C8HA 1EEUA 4OM1L 4PJCE 4NWTL 4J3VA 1OVZA 5ANMA 25C8H 4XTRC 4G80A 1LK2A 3GSVB 4TSBH 4JY5H 4DAGL 3P4NA 1A6VH 3SGJC 3S5LB 4OFPA 4JPWL 4CL7A 3S35X 5BJTB 1TJGH 2J8UE 4BSVA 2IFGA 3EFDH 3M8OH 1HILA 4UQ2B 2F8XC 3IFLH 4UINL 1U2CA 2BSED 4P4RA 2NY2D 1Z2KA 1CICD 2D7TL 3H7BB 3WFCH 1ZTXL 3GIZH 4HDIA 1BZ7A 3GSQA 4JHWH 1YY8A 2XZAH 1I9EA 5IVXB 5K59E 1PG7L 2XY2A 4TSAH 3AB0B 1HHGA 4ODVL 2C3VA 1AFVH 3O3AB 5E9DB 1UH3A 3WNMA 5C1MB 2FATH 1A3LL 1R3KA 4MXVE 4JHBA 4TSCH 3BGFB 3RWCB 5INDA 2CDEB 1TQBB 2A9NH 4CU7A 2X40A 2Q8AH 3PL6B 3BQUD 2LV4A 2YOCA 3L3JA 3FZUD 2R4RH 3MRCB 4Y16D 1EFXB 5C0JA 1BFTA 4KQ4L 1CFNA 2DL2A 4WGVB 3SE4A 4YAQA 1JNNL 4X6CA 3PG2A 5TH2B 3H3BC 1G9EA 3CX5J 3O3EB 3H9HB 4ODXB 1Q9LB 1NGPH 2W0PA 3S36H 4DW2L 2X4OB 1N2RB 3K80A 1JK8B 3AREA 5KS9B 3VGAB 2GY5A 3RIAF 2HLFD 3MRNA 4JM2B 3MV8A 4EJ1C 4P2QD 3S96A 1XGUA 3B9EA 3X3GH 1NL0L 4MNGA 3C5ZC 3MXWL 3UCRA 5C0BB 4DTGL 4OSUL 2UWEA 3L3KB 4H25A 3RQ3A 4C59B 2W9DL 1I9RL 2X4PB 2YPKA 3L3OB 5LWYH 1K85A 3JV4A 4HPOL 3MJ8B 4LLYB 2CJUL 1OAUL 1YN7A 1AXTH 2BJMH 5TE7L 2VDQH 3L3HA 5F1KC 4U05A 4BKLB 2FLRT 5K9QI 4PPTA 3L5HA 2R1YB 1DLFH 1BGXH 3PP3K 4J3TA 4RWYL 1HE7A 4PJ9A 4KMQA 4PJHA 3SGJA 4Q7DA 1JPTL 1A6ZB 1KJMB 2DLTA 4LHUB 1QKZH 1A7OH 4EN3A 5D8JL 4ZQKB 3BRFA 3LB6D 1R3JA 2ICEB 3MGTA 3BXNB 1HHIA 2FBJL 4FOMA 2R69H 3GM0A 3BPNC 2YWYA 4H0GA 3KLAB 2E7LA 4Y4HC 3BT2H 3D9AL 3QFJA 4IRJB 4KI5F 4JKKA 3OXSB 1MJUH 1MVUA 5A16A 1FZMA 3HZVB 1Y6NR 5KSBA 3WXVL 1DN2A 4OAWA 3NN8B 3WIIH 3Q3GA 5B3NA 3RWGA 3D2UA 1LDPH 1UFUA 3WL9A 4NCC2 1CG9B 4PLKD 4FP8L 2XZQH 4FQJL 1FVEB 3IVKA 2I27N 4P4KB 3WFBH 2R2EB 3MRJB 5C0DB 1E6JL 5HY9A 5JLZA 4HIJA 4WU7A 1UM6H 1MFDH 3DXAB 3LZFH 3WNKA 4PRIB 1YEHH 1TJIH 1KJ3L 2JCCE 25C8L 3GRWH 5GJSH 3MV7D 4OZFH 2R9HC 4JY5L 4TSBL 2D7PA 4ZFGH 5F9DC 2VDRH 5F9OH 2Z92B 5L8JB 4JRXA 4M1DH 2JF1A 5EOTA 3LDBC 3SE9H 3KHQA 3KLHC 3EFDL 3M8OL 4O02H 4OLZL 1GGTA 1QVOA 4XAWH 3IFLL 1EXUB 4HX1B 2GTZA 4G3YH 4LVOB 4I4WA 1IM9A 2DQTH 3HN3A 3ZKSD 3TP4A 4H5SB 4JHWL 1B0GA 4JZOB 2VITB 3FT3B 3I02A 1T0MA 2XZAL 3KXFB 5E2TL 5FGBC 3DO7A 4HCRL 5FCUL 5FUOH 4ELMA 1ADQH 3QNXA 4ODBD 1AFVL 5ESVB 2WZPD 3UTPE 1NGWA 5EO0B 4XWGH 4EI5B 3PHSA 2FATL 4GKSB 4JFEA 1MCOL 1NGYB 3H0TA 3T3PF 4MJ5A 1NEZA 4BQBA 2LVEA 2A9NL 5A43C 1CYGA 4P2OD 2Q8AL 2DKMA 3GSOA 4S1QL 3QWRA 3RIFK 4PGEB 5C09E 3C6LC 4QRTB 1NDMB 4LLAA 5C2UB 1AGEB 5TPWH 2FJHB 3H9SE 1HH6A 3ULUL 5IW3A 4MA1C 2NTFB 1LHZA 4UIKH 5DMJB 4G6JH 2KUTA 4OLXH 1NGPL 5ANMB 2HRPH 4G80B 1LK2B 3S36L 2NXYD 5KJRH 5FA3A 3P4NB 3QCVH 4HIHB 4A2MA 3ILQC 5B4MD 3MMEA 1BWMA 4BSVB 3VDBA 4Y4FD 1HILB 3FHQA 3QHZH 5B8CC 4P4RB 5FV2A 4MAUH 4HDIB 1BZ7B 3DMMD 3GSQB 1EVUA 4LSUH 1YY8B 5LWYL 7CGTA 1HHGB 2C3VB 5A2KH 1AXTL 1DUZA 2BJML 1W8OA 3KG5A 3R8BB 1R3KB 3O3DA 5INDB 1DLFL 1BGXL 5C0AA 2OJZL 3L3JB 4Y0GA 4D2NA 5JXEC 1IZJA 4X4XA 4Z7WA 5C0JB 4XI5C 1RD6A 3N1GC 1CFNB 4HUVA 4NQCA 4YAQB 4X6CB 5HVWA 3UJJH 4KXZH 4GRWF 4D94A 1U8QA 4ISVA 1JHTA 4YBLC 4Y8AA 3UEZA 1NDGA 3UZQA 5I66A 1BFVH 3AREB 2PYED 3TO4A 3BT2L 5C07A 2CIIA 3MLXL 3MRNB 3MV8B 4K7FA 2QSQA 3S96B 1XGUB 1SVCP 1NMBH 4MNGB 4H20H 2AJXH 3OKNA 3WIIL 2UWEB 4UBDC 2AQ2A 2A74A 4H25B 2OSLA 1LDPL 2YPKB 4YHKH 3JV4B 3SDAA 2XZQL 3OJVC 5EBMA 3WFBL 3A0OA 1YN7B 3L3HB 4K3GA 2QQLH 4O5LH 1T22A 2CIKA 4RMVA 4Z9KB 1RZJH 1I3VA 1QA9A 2IPKA 3MBXH 1YEHL 3GRWL 4M9PA 5TDPA 5LCVL 2YZ8A 3QUMH 4PJ9B 4PJHB 1AKJD 1EBPA 2VDRL 1NC4D 2XTJB 5JIIA 4PV8A 4H1LG 4EN3B 5HHNA 3SE9L 4KI1A 4M7LT 2VLKE 5EU6E 1H3TA 4O02L 4GAGH 4X6BA 3U4EA 1R3JB 1EGJA 5B8CA 3MGTB 4G3YL 1HHIB 3O45A 3MOBH 5GRVK 1CFQA 4G8FA 5IESH 4CGTA 1KIUA 3SBWC 4WEBH 1MI5E 1ADQL 4XGZA 4ZFFA 1C1EH 3QFJB 4XWGL 3SDCD 1MVUB 4FQQA 4CMHB 4XWOD 5A16B 1FZMB 1JZ4A 4AG4H 2I60L 1BIIA 2HKHH 2AV1A 4R26H 5KSBB 4HBCH 1N4XL 4JREC 4L8SC 2X4TA 4OAWB 5DEFA 4UOJA 3Q3GB 2VLJA 3RWGB 2OK0L 4NFDA 3D2UB 3VMPA 3WL9B 1XEDA 2J5LB 3RY6A 3IVKB 5TPWL 2MMXA 2V17L 2A1WH 4DOHE 2NYYD 2EDQA 5HY9B 5JLZB 3VMNA 5KZCD 4HIJB 4UAOC 4WU7B 5CGYC 4XP9H 5KOMC 4G6JL 4OLXL 2VLRE 2HRPL 3QDMA 4JFZH 5KJRL 4UZGA 3LQZA 5HI3C 1J87A 3QDJA 4F80A 4LEOA 2B20A 2CPCA 2WBJC 4JRXB 4XX1E 5EOTB 4XPGH 4V2BA 4XPHL 1QVOB 5IVXF 3QHZL 2VN7A 2GTZB 3ARXA 3BN9D 1E4WH 3B8YA 4I4WB 4GG6A 1IM9B 2D4FA 4MAUL 3RVTC 3JBG7 4DK6A 4H88H 1B0GB 3DO7B 3I02B 4LDOB 1T0MB 3QO0A 3F58H 3KPPA 4ELMB 3UDWC 3B3IA 3QNXB 2C3HA 4GW1A 4KJPC 1DCLA 4OZFA 1NGWB 5ESQA 4LVEA 4JFEB 3WEXA 2EE9A 3MJ6A 3H0TB 4MJ5B 2V5MA 1NEZB 1NBVL 2VC2H 1TZIA 4BQ8A 2K1MA 3GSOB 3GSXA 2HT4D 4TNVF 5FB8A 4WFHE 4P9HH 3UTTA 1OF2A 3GKZA 3WFDH 1F4XH 3MCKA 1HH6B 3GDBA 3QIBD 1ADQA 3L1OH 3UJJL 5AAMA 3L7EA 4HUMB 5EU3A 1UWGH 1FE8L 5KS9F 4D9LH 3G9AB 4IM8A 3SBWA 5E6IA 3EBAA 3BPNB 1QFOA 4JM2F 1NCTA 3C8DA 2WIMA 1EZVX 1MCDA 1BFVL 1IGIH 5FA3B 4WTZA 5E94A 4M8QA 4NQDE 1CVSC 5TQ2H 3MMEB 4QKXB 1C5BH 1RZKC 5H94A 4Z0BL 1RZIA 1CDHA 1NANH 4L8SA 1NMBL 4H20L 2AJXL 4JFHE 2HJFA 2PETA 2ZUYA 4WW2F 4XNYH 1BM3H 1WBYA 3LKSA 1G7PA 4YHKL 3PUCA 3CFDA 2IAMD 4MMZC 3TBVA 3DJ9A 1JF1A 1DUZB 2Z31C 3AMLA 1EH9A 3QQ3A 3RWDA 1RZFH 1D9KC 1E6OL 1BZQK 1R3HA 1IAKA 3O3DB 1RZJL 3MBXL 1AR1C 4LPXA 5HDOA 5C0AB 3B5GA 1B88A 4X4XB 5IQ9A 4MAYA 1G7JA 4Z7WB 4MB5A 4HUVB 3ZDYE 5SX5K 4R97C 4NQCB 4JO4L 4OF5A 3VI3E 3CUPA 4GAGL 3NZ8A 1T5XA 5I73C 4Z0XA 4ODSH 1YNTA 1XIWA 4QOKA 1U8QB 5T1LA 4UUJA 4ISVB 5IESL 1JHTB 2ZCHH 3S3PA 1EA9C 1NDGB 4LHQB 4KRPC 2PO6A 1UKSA 2JJTA 2FB4H 3U79A 3EYVA 3UTPD 5I66B 4R7NA 1WUNT 4PGBA 5C07B 3TO4B 3CH1A 2UVFA 2CIIB 4ONHA 4AG4L 2H8PA 2J6EA 2HKHL 2CK0H 4R26L 2O93L 1R3LA 5CIPA 3X3FH 4KZEH 2HH0H 3OKNB 3O4OB 4Y4KC 4ACPA 5CWSA 2EZ0C 4OFIA 2A74B 5C09D 2OSLB 3ESUF 4PLOB 3SDAB 2DQUH 3H9SD 1JN6A 5EBMB 4MA1B 4ODWA 5FOJA 3IB4A 2HVJA 4QHLA 3GNMH 4XP9L 1DQMH 1T22B 2CIKB 1VFBA 2IPKB 1S9YA 1T2XA 3S34H 5E2VL 4POYA 5TDPB 2NXZB 4JFZL 4RMTA 4U1IA 4KK9D 4OFYD 3RVWD 2CDFA 2P8LA 1P5UA 3R8QA 4PV8B 4GLRI 1JCKA 5HHNB 3E3QC 1FO0L 4PP1C 3IRPX 4X6BB 3U4EB 1Q0YH 5B8CB 1GJIA 3V4UH 3QBTB 2BC4A 3O45B 4Y7MA 1CFQB 3QIUC 4G8FB 1EMTH 3AGVA 1TCMA 4X7CC 4LEXH 1K2DA 3QFDA 4XGZB 4ZFFB 1MCNA 2XTLA 4FQPA 3QUMA 1JYVA 4IMLA 4FQQB 1K4DA 1BIIB 4Q2ZA 2AV1B 1RUPH 3DUHA 3F62A 4XP1H 1DR9A 2X4TB 5DEFB 3S37X 2VLJB 2YS4A 4KJQC 5DZOA 1F5WA 1EVTC 1ZXQA 4IJ3C 3RZCD 1S7TA 1AC0A 4P9HL 1T7ZA 3WFDL 1F4XL 3BVNA 4HWBL 4OZGA 3PDGA 4RSVA 3WCYA 1G0DA 2PR4H 4PBXA 4WUKH 4M00A 2NY4B 2J8OA 1QNZH 4D9LL 3QDMB 1N0XH 3AUVA 1VFUA 3LQZB 4GKZA 3QDJB 1IGIL 1OOAA 4LEOB 3BIBX 4GW4A 2DICA 3MX0A 1K9TA 1FYTA 1P69B 4JO1H 4GG6B 1A7BA 1JFQL 4MA3A 4XNYL 3ARZA 1BM3L 5J6GA 3CDYA 1RJZA 3QO0B 1A64A 3KPPB 3B3IB 4PJBE 4GW1B 3TEUA 1ZVSA 5DJ6A 4B0MM 4OZFB 1KC5H 5ESQB 2R0LH 1RZFL 3WEXB 1KELL 4IDLA 1TZIB 1EZVY 5IOPA 1A6TA 3MO1A 4QWWC 4X6CF 4M03A 3GSXB 4N8CH 1DVFA 3TVMA 2ATKA 3QCUH 3MYJA 5FHAL 2PYFA 5FB8B 5FO8A 3UTTB 2VLKD 2H32A 1OF2B 1WC7A 1OB1B 1X4YA 3MCKB 6FABL 2EC8A 1RJCA 3UTSA 4ODSL 1DANU 3L7EB 1CWVA 3P4LA 5BOPA 4K8RD 4XCCH 5A2JH 4HGMA 2HMID 2FHFA 2Q6WA 3WDJA 1MI5D 4QEGA 5E6IB 2ZCHL 1FFOA 1J1OH 3QI9A 2F53A 5E94B 4M8QB 1U8IA 4G8GE 4KTDL 4AH2A 2UWEF 3TNMA 2Q76A 4QLRA 5F71A 2X1WL 4W4OC 5H94B 3KPTA 1RZIB 1EHNA 3W82A 2CK0L 2N1KA 4JREB 4L8SB 4PD4K 1CIUA 3X3FL 4KZEL 5D1XC 1LO4L 2HJFB 4UOW1 5A40E 1WBYB 3LKSB 4RFEA 1G7PB 4QT5A 3V0VA 4HJ0D 3CFDB 2DQUL 2DTMH 3TBVB 1JF1B 1GGUA 2I9TA 3H3PH 3RWDB 3OX8A 3QQ3B 4Y19A 3PE9A 4U3XA 3GNML 4PJHF 1YYLL 3P4OA 1DQML 1R3HB 5DA4A 1IAKB 2VLRD 4KKCC 4MQXC 3V6OA 3S34L 1DJSA 3VG9B 5GSVA 4JG1H 4PLJD 5IQ9B 1CGSH 4MAYB 1G7JB 4EIZC 4QRPE 2XKUA 3TCLA 2WBJB 4U7KA 15C8H 4TRPH 3EYUH 4PJ7E 3CUPB 1I1FA 3NZ8B 1T5XB 4Z0XB 5LJYH 1AQDA 1YNTB 1XIWB 4QOKB 3V4UL 5T1LB 3KPLA 4UUJB 3T2OA 3QUZA 3MCG1 1UWXK 5GIRA 4BFEA 3P30H 3STZA 2B4CH 1H0DB 3MFGB 2PO6B 4Q58C 4YHPA 5KSBF 1BQSA 4RA3A 3MJ9H 3EYVB 1IM3A 4R7NB 1MIEH 4PGBB 3C08H 3CH1B 4TOYH 5D6CA 4Y2DC 4XXDA 5IJKA 4ONHB 5M94B 2H8PB 5FCSH 1OHQA 5I74C 1R3LB 1RUPL 5CIPB 4XP1L 3CVHH 1N59A 4K9EC 2WINA 1JMZA 5CWSB 3OHXA 4WFHD 4GSDH 1OW0C 1JN6B 2DWDA 3HFMH 3VGDA 4ODWB 2E9BA 3TYFA 2PR4L 3NMEA 3JWDL 2HVJB 4QHLB 1Q0XH 4WUKL 2HFFA 3C2SA 1VFBB 4Q0XH 1QNZL 1UADC 1JHLH 1D7FA 3WIFA 1S9YB 4MLSA 2Y07H 2BOCA 1N0XL 2JE8A 4U1IB 2EEBA 2CDFB 4KKLD 4NQDD 2P8LB 1T66C 1LO2H 2Y9RT 3ECBA 5ID1A 2DQCL 3R0MA 2W9EH 4ZO7A 5JIHA 5C0CE 5DEZA 4OCWH 4JFHD 4ELMF 4P2CG 2ZG1A 2BC4B 1XAUA 5HJ3A 3PV6A 3TA3C 3DVGA 3AY4C 2APTA 1K2DB 3QFDB 4DKAA 4AYFA 4X6FA 3CLEH 1I1AC 2FEEL 1MOEA 1OTUD 3ZHKA 5ENWA 4JJHA 1CGTA 3D5OF 1IGCH 3QUMB 1KC5L 1P1ZA 3FOMA 4O2CA 2R0LL 4IMLB 1KNOA 1MCPH 1AP2A 1K4DB 1S7WA 4Q2ZB 3S35H 5CCKL 2W60A 3QZWG 1RUKL 1TTUA 5JQ6H 4NN5B 5IHUH 1SYSA 4N8CL 2D0GA 3QCUL 5F89A 3R0NA 1S7TB 1IC1A 2W1NA 1RUAL 2X7LA 4EKXA 1FAKT 3BVNB 4OZGB 1FVDA 5I73B 2ESVA 3VGBA 5SX4I 3BGMA 4XCCL 2PXYD 3B43A 3MJ7A 4TVPE 1CICA 1CGUA 4RZCA 4LRNH 1J1OL 1EO5A 4GKZB 3GBLA 1GGYA 4QF1A 3SDXE 4GW4B 4YEFA 4OTXH 4I0KA 1OAQH 3WV0A 2VE6A 1FYTB 4U1HA 5J13C 2YPLE 3GKWH 4MA3B 4AEEA 4O9HH 4LLMA 1RJZB 5J6GB 1U3HC 4NZDA 5AZEH 5T1MA 4Y16A 4K55A 2XI9A 1INQA 1J9CT 1ZVSB 2DTML 4MVBC 3D69A 5DJ6B 2YXMA 2WV3A 1KENH 3B9KD 2BK8A 3H3PL 4YHMH 5BZWA 4Z7WF 2COQA 3OSKA 4TQEH 3V5KA 5C2BH 4FZEH 5IOPB 2PUQT 4FFVC 1A6TB 4XMPH 3MO1B 2D3VA 4DKEL 4LP4A 3TVMB 1DVFB 1CGSL 2ATKB 1CFVH 3MYJB 1L0QA 1UCTA 2PYFB 4HMEA 3TCXA 5FO8B 2H32B 1WC7B 15C8L 5IKCA 1K3ZA 3MRIA 4TRPL 3UROR 4TNWK 3EYUL 4LKCA 3UTSB 4MB4A 4P2QA 3IYLW 3TA3A 1AGDA 2Q6WB 1N64H 3P30L 3AY4A 4KKAD 1FFOB 2JTDA 3QI9B 1YY9D 2F53B 1I1AA 3MJ9L 3PQYA 4JPVH 1MIEL 1U8IB 3ZKMC 4AH2B 3TNMB 5C8JA 2Q76B 1T2JA 4QXTA 4KK8C 1U0QA 3CVHL 4DFHA 4G7YH 3RHWK 3HI6H 4LPVA 2QLVB 3JV5A 4NO0D 4RFEB 4GSDL 4QT5B 3GBMH 2HG5A 2R2CA 3V0VB 1P9MA 5F44A 4DN4H 2I9TB 3TJHC 3OX8B 4Y19B 3G9VA 2RCSH 4KI5E 1Q0XL 3P4OB 4Q9QL 4Q0XL 1JHLL 2LU7A 3OJDA 2A9ML 1PLGH 1NPUA 3IDUA 5LXGH 3TH2T 3L3GA 5GSVB 4LIQL 4IOIA 4PGCA 2R29L 3B9VA 3C2AH 1LO2L 3TCLB 2KQMA 2YRLA 4PP2A 3ET9F 2O26U 3W39A 2OI9C 1I1FB 3L95A 5TE6L 4OCWL 1AQDB 4YGVA 1S9XA 3KPLB 4ZFOL 3QUZB 5AYUH 3ALPA 5GIRB 1CBVH 3RI5K 3STZB 1VFOA 4YHPB 4GXVH 4NQXA 1IM3B 1A3RH 3F7RA 1U8PA 5D6CB 2FO4A 4XXDB 4U1KA 2GQHA 1MCPL 4JFOA 4PJXE 1P4BH 3QXTA 3S35L 1N59B 5JQ6L 1II4E 2WINB 4FQ1H 3X12A 3P4MA 4N0FA 5IHUL 4LAJH 1N5AA 2SEBA 4M7LH 5ABDE 3OHXB 2VZTA 3MV7A 5D72H 7FABH 3TC9A 1I75A 5MENE 1IEBA 3P0YH 4L4VA 4GAJH 2NY0C 2DWDB 4M6OL 2EYRA 5I8KH 4HIXH 5LBSH 2LTQC 4ZOEA 3TYFB 4ETQA 2HFFB 2NMSA 3VFSA 3WIFB 1J1XH 4A6YH 4WY7H 3WLWC 2BOCB 4YXLH 4FFYH 5IB1A 4LU5L 3LRGA 5CUSL 3CX2A 4I3SH 4G8GD 2XACC 5I1LA 4GG6F 5ID1B 3ECBB 4IOFC 4N5ED 4JPKH 4OTXL 4W68A 1OAQL 4POUB 3OB0H 5GZNC 4UDUA 1QLEH 3AFLA 4KJWC 5HJ3B 3GKWL 1UACH 3PV6B 4W4NA 4BJLA 2BY3A 2AW2A 3VRLF 4O9HL 3LN9A 4P2OA 3DVGB 1IT9H 5AZEL 4RFNB 4X6FB 4J6RL 5ENWB 2VDLL 3Q2CA 4NUJA 1P1ZB 3FOMB 3IS1X 4O2CB 4YHML 2J1KA 1I85A 1KNOB 3SO3C 1WLHA 1YQ2A 1A4JA 1AP2B 4XNQA 2PKDA 3U36A 1S7WB 1XMWA 4TQEL 5C2BL 2W60B 2R1WA 4FZEL 4XMPL 3H42H 1RMFH 2YD3A 1SYSB 5L8KB 4QRPD 4WI7A 3WSQH 3EIFA 1CFVL 4JPIA 4PJIE 5F89B 2X7LB 5T5FH 1XCQA 4EQ3A 3W11D 1FVDB 1QBAA 2ESVB 4Y4FA 2YWZA 3BGMB 1JZ3A 3MJ7B 2UY7A 1N64L 1CICB 4RZCB 1T7VA 3RY4A 1GYAA 3DMMA 4YO0A 4JPVL 1RJLA 4QF1B 5BMFH 1QP1A 3IDMA 3SE3A 2VDOH 3K8KA 1CDYA 3FFCD 5E99H 5I1GH 2GHWB 4YFDB 3EJYD 4G7YL 2VE6B 2QSVA 4U1HB 1X44A 1NCBH 5DRWA 2Q7YA 3OR6A 4LLMB 5GRWA 3GBML 4GRLD 5T1MB 3IFPA 4Y16B 3T0DA 3K8LA 2GAZA 1H3VA 1INQB 5CKAA 3D69B 3TLRA 5BZWB 3CFKA 2RCSL 2FHCA 4UU9A 3C5JA 4XXCC 3EDDA 3V5KB 4FABH 1PLGL 1HQRA 2QHRL 4JQXC 4QGYA 3F8UB 2FZ3A 4UIMA 5B39A 4KUZH 2AEPH 5LXGL 3V9FA 4ODHH 3C2AL 4M1CC 1KJ2H 2PYEA 5IBLD 1WBZA 3NCYS 5C0CD 3MRIB 2ICCA 2FWOA 2DM7A 2KH2B 1MJ8H 4LKCB 3JZ7A 1QFWH 3B9DA 4P2QB 1S7SA 5T3ZE 5KSVA 4EEEA 5L6YH 3I9GL 1KPRA 4JRYE 5AYUL 3TA3B 1AGDB 3NGBC 2LABA 4EDXA 1GAFH 4PJ5E 3RX8A 1I3GH 3VI4F 4GXVL 1I1AB 3MUZ1 3LQAH 3PQYB 1A3RL 5E4IA 4NQTA 4ONOA 3MRDA 5C8JB 4AY0A 4QXTB 3V7AG 1P4BL 5DHYA 4RISH 2EDOA 4PG2C 3ZZ1A 2VB5A 2W38A 4HMDA 3O9WC 4BH8A 4M7LL 2G5BA 2G5RA 3ZYIA 4JQIH 1WIUA 7FABL 3UAJC 2HG5B 1TLKA 1KB5A 1HHHA 3O4LE 4GAJL 2VQUA 1IVLA 3OKMA 3BKYH 4HIXL 5LBSL 4JM4H 3TJEH 2JJWA 1NGQH 3ZTNH 4OJFH 4S0TD 2YUXA 3WFEH 2W91A 4TVPD 1N26A 3ARSA 1J1XL 3OJDB 4A6YL 4WY7L 4PRBA 3B2UD 4YXLL 3HC0A 5C9KA 4FFYL 3L3GB 4IOIB 4PGCB 3H7LA 4I3SL 5IUSA 5BOZG 1T7XA 2ZPKL 2AQ1A 1CT8A 4PP2B 3TN0C 1J88A 4PRDA 5F70A 3W39B 1LE5A 3L95B 4LNRA 3IF1A 4M43H 4YGVB 2YPLD 2C3WA 1S9XB 3GJFA 3PGDA 5DSCA 1UACL 2DLHA 2Q3AA 3BFOA 5E95B 1HKLH 5E4EB 3VCLA 2YUZA 4NQXB 3F7VA 1A1NA 3D0LA 5JHDE 3JVGC 5T1KA 2XIDA 1U8PB 5IBUG 2FO4B 4YHNA 4U1KB 4HH8A 3PIQA 2EO1A 4JFOB 4XXCA 1BQHG 4YR6A 4JQXA 1LEIA 4MXQC 3X12B 4YHOH 3H42L 3P4MB 1RMFL 2VWEE 1MJ7H 3MGOA 4N0FB 4OZGF 4OKDA 3ULUC 3TZVC 1N5AB 2SEBB 3ULVC 3WSQL 3MV7B 1NBQA 5TQ0H 5AWNH 2QQQA 3GI9L 1IEBB 4L4VB 1FZOA 3S98A 1C8PA 1P84K 2PW2A 2EYRB 1AD9A 3F7QA 3RL1A 5HHOA 2DLFH 5CSBA 5GS1C 4ETQB 2FCBA 4U1NA 4N0YH 4EDWL 4CKVX 3S3SA 3VFSB 5F96H 4HXBH 2NY1C 4K7PX 5DJDA 3ABZA 5IB1B 1FDLH 5FYKD 1NFKA 4XVJH 2W9LA 3RAJH 5BMFL 5I1LB 3U48A 2VDOL 4K8RH 5E99L 5I1GL 5JNYA 4PG2A 2Y06H 4MZ3A 4UDUB 2PTTA 1JTTA 5ACZA 4V1DE 5HBBA 4P2OB 1E0OB 3IGAA 4YDIL 2V6HA 4KI5D 4NUJB 5IHZA 1CZ8L 3WO4C 5DS8A 5C0BE 1CXEA 5CEYA 1A4JB 4XNQB 4P5TD 3U36B 3QIBA 3WJLA 4XCYA 4KQ3H 2R1WB 4OLUH 2E8ZA 1VEOA 3C60D 5TDNA 2QV2A 2AEPL 2GSGA 2AJUL 2O5YH 1O7SA 4ODHL 4JPIB 2EE6A 1DN0A 1KJ2L 1XCQB 1G9ML 1MJ8L 1K5NA 1QFWL 5D70L 4FTVD 4Y4FB 1U42A 3WDHA 5L6YL 4M5ZH 3SCMC 4WO4C 1T83C 5SWZA 5EWIH 4I0PC 1GAFL 5HPMA 1I3GL 3DMMB 4YO0B 4QXGL 4WU5A 3JVGA 2YD8A 1RJLB 4PTTA 2QJDA 1INEH 3FB5A 3LPFA 2X5PA 3IDMB 5J1AA 5MEPA 1KYOK 3A6BL 2M2DA 2OCFD 5D1QD 2JCCA 1WT5A 5DRWB 2Q7YB 3OR6B 5MEND 4JQIL 2Y5TA 3IFPB 3V95A 2GAZB 5L88L 3CXDH 4KHTL 3BKYL 2DKSA 2LTQB 4JM4L 3TJEL 2AVGA 3CFKB 2G2RA 2QEJA 4UU9B 3C5JB 3PP4H 3ZTNL 4OJFL 5LAXA 3WFEL 1CS6A 5K9KA 3BH8A 4LMQI 1X5KA 1HQRB 1NSNH 5C3TA 4LCCA 2FZ3B 4UIMB 4GKOA 3RZWA 5B39B 2X41A 4HKJA 3MC0A 1ZS8A 2F5AH 2PYEB 1WBZB 1WWAX 3MPCA 2FWOB 3MCLH 5B38A 1OWWA 4M43L 5EU4A 1S7SB 5KSVB 2NY5H 5HYEA 4PJEE 5BVJA 1KPRB 1RU9H 2IH3A 4EDXB 1HKLL 3GSWA 1Q1JH 5C09A 1H8OA 3CK0H 2AXHA 2VR4A 1PQZA 3MRDB 1U36A 2GITA 4WRLA 4E42A 5DHYB 1KJ2A 3VXNA 4NWUH 2FX9H 3KXFE 3FT4A 1QSVA 1TTGA 1MJ7L 4NNYA 4OGAC 4BH8B 3QP3A 1JWMA 1ORQA 5DFWH 2G5BB 3EHBC 3D25A 5GZOC 5KVFH 3RTQD 1KB5B 4OFYA 1HHHB 3IDYB 4I18A 1JPST 3D48R 5L9DH 3OKMB 3SDDD 1F00I 4HC1H 1JGLH 2MOVA 3EAKA 3WFHA 4N0YL 2FL5A 1HCFX 5F96L 4HXBL 32C2A 4WO4A 1CDJA 1QUNA 4PRBB 1SMOA 4I0PA 3HC0B 4PS4H 5JPNA 4XPAL 3S37H 3UYRL 4XVJL 4KGLA 3ZE2F 3MJGX 5DZLA 3RAJL 5HDQH 5I1AA 1CT8B 4K8RL 4PRDB 3SN6N 1LE5B 5DGQA 3SHSA 1UZ8A 3RUGE 1DE4A 4LNRB 4L8CA 5K93A 3IF1B 1F4WH 3RY5A 1ZT4A 2Y06L 4NOFA 3GJFB 2GCYA 4M02A 3PGDB 4D0CA 5DSCB 2HT2D 3LN4A 1B3JA 2EH7L 1MSPA 3VCLB 4PJ8C 3F7VB 1A1NB 3D0LB 1IC4H 5T1KB 3RZCA 4O2FA 3HRZA 4R2GC 2P8MA 4YHNB 4K7PY 3VWKC 5CGMA 2J12B 3PIQB 3BMVA 2XXCB 2EDEA 5GJTH 4KQ3L 1S3KH 1KCLA 1IC5H 4YR6B 1LEIB 1N0LA 1WWWX 2ZKHH 3MGOB 1FFPA 5IVNA 2DJUA 2HFEA 2O5YL 1TETH 5IHLB 1FZOB 1DQTA 4U6XA 2PW2B 4BSJA 3BUYA 1AD9B 3RL1B 3MLWH 5HHOB 3T0EC 4U1NB 3HMWH 2EEAA 2H2PD 4NFCA 4PJ5D 5DJDB 1ZA3A 4GQ9H 5EWIL 4ZSOE 1NCWH 1VADA 2DD8H 4TUOA 2KQNA 1INEL 2OM5A 3NFSL 1P53A 5JNYB 2V7HA 3QUYC 1REIA 4K3EH 1PZ5A 4OGXL 2PTTB 1RPQA 1UVQA 5ACZB 3PJSA 4KAQH 3T3MF 1CXFA 2A6DA 3L5JA 2CDGA 1GC1L 3O4LD 1ZT7A 2QSTA 3CDGA 3IGAB 3U0WH 3CXDL 4DUXA 2OBGA 4XP5H 1A6WL 4MNGE 5IHZB 5DS8B 5CEYB 1G0YR 3PP4L 3QIBB 3O41A 1DANT 1B4JH 4XCYB 5FO7A 1J05A 1NSNL 4AEHH 3IAGC 2BVPA 5TDNB 4LRIA 1MI5A 2GSGB 2RR3A 1F58H 5M95B 1DN0B 3MFFA 5DD6A 4ZUWA 5EIVA 4IIQC 2HN7A 1INDH 4EOWH 2NY3D 3MCLL 3ZKXC 2Y72A 4H8WH 1K5NB 3NA9L 2J3SA 2NY5L 2UZYB 1RU9L 5C7XH 1TDQA 5SWZB 2PCPA 4K07A 5GGVY 1F42A 1T20A 5HPMB 1MQKH 1Q1JL 3BDBA 5JHDD 3NIDF 4NJ9L 4WU5B 4PTTB 5KTEL 3DETC 1OTTD 3VXQA 3FB5B 5MEPB 5J1AB 3I3EA 4NWUL 5F3BA 3VFVA 5E5MA 2JCCB 5J12C 3VXUA 5DJYA 2FGZA 2Y5TB 5KVFL 5ERWA 4WHDA 5FFLA 3AAZA 2Y25A 4HJGA 4JCMA 3D18A 2ARJQ 5L9DL 4HC1L 2XA8L 1DQLL 2G2RB 2HFTA 4D3CL 4YFLF 5LAXB 4XP4H 4Y89A 2NY1B 1F2XK 3BH8B 5K9KB 3BW9A 2VR9A 2UV3A 4YBQD 4LCCB 1UKTA 5GGQL 3THML 4DWHA 4APQC 5ELIA 4PS4L 1XF2A 3S37L 4HKJB 2RGSA 1ZS8B 3KYMA 3EZ8A 4ZOBA 5HDQL 1A0QH 5IVOA 4L8BA 1LNUA 5B38B 1F4WL 5EU4B 3AM8C 3HB3D 4V1DD 4X83A 5BVJB 1DBJL 2IH3B 4KV5E 3GSWB 4JM2D 5D71L 5C09B 4Q6IA 4TTGA 4N9OB 1IC4L 4NCDA 5C0BD 1PQZB 1TJHH 3O6MH 1KYOJ 3JWOL 1T6WA 2GITB 1YYMH 4E42B 5GJTL 5T33H 3NCBB 1KJ2B 3VXNB 5EUOE 3GSRA 1S3KL 1IC5L 4P9HC 2DIJA 4IRSC 4PGZA 2ZKHL 4Z7NE 4NNYB 3RVXC 1JWMB 1ORQB 3D25B 2NR6D 4NQDA 2YD6A 2X89D 4P9MH 4I18B 1OP5H 3RL2A 2GUOA 1IKNC 3I6GA 2VDKL 3NOIA 3MLWL 2IEPA 3MLSL 4K3DH 2VDNH 1CXIA 3WFHB 1F3JA 2FL5B 3GMPA 3LV3A 32C2B 4WO4B 2F9BT 2YMXH 4P2YA 4GQ9L 4I0PB 1KBGH 2G60H 5FOBA 2AJVL 5JPNB 1MFAL 4WHYG 2APBA 4XC1L 5JOFA 2DD8L 1KTRL 5I1AB 5FF6A 1ZMYA 2BFVH 1UZ8B 2OTWA 1DE4B 4L8CB 5FKAA 4LGPB 1ZT4B 2ZP0T 3QA3A 2H9GA 4K3EL 2GCYB 3MZGB 4D0CB 5J11B 4D0BA 2DYPD 1XCTB 3LN4B 4KAQL 1QG3A 2X6MA 4ENED 3U0WL 4NC1C 3VRJA 3HS0A 3RZCB 4O2FB 3HRZB 4XP5L 5IW1A 2P8MB 3LRSA 3CLFL 3QULA 1BHGA 4L8DA 1G9NH 4AEHL 4YXHH 3E6FA 5E70A 1NAMH 1FFPB 2HFEB 5CZXC 3DLQR 4PREA 1RAMA 2Y23A 5BW7A 3M45A 4I48A 5J3HD 4U6XB 4JLRA 5FM4A 3BUYB 5F6HI 1KLUA 4LCUA 4EOWL 2Q8BH 4H8WL 1DQDH 5TF0A 3AM8A 2BY2A 4X9HA 3BDYH 4WI3A 1CF8H 1X5ZA 2ZJSH 4S10A 2XRAH 2IMMA 2OJEA 3RVVC 1ZA3B 1FJ1A 1E27A 4Z6AT 3NCCB 3DI2B 3SKOA 1VADB 3TWCL 4BQCA 4TUOB 2OTPA 5F9WC 4I0CC 3ARDC 3B9KA 5JO5A 3KXFD 4OCYH 2V7HB 4Y88A 1U8HA 1U93A 1PZ5B 5L0QC 1UVQB 4U1GB 4WNQA 2QQNL 4NCC1 2A6DB 2CDGB 3DX9A 1JHKH 4PY8I 1ZT7B 1L7TL 3RKDC 3CDGB 5MP6H 4NZTH 3ROLA 2XICA 2WQ8A 4ZAKC 3O41B 5FO7B 1J05B 1VESA 43CAA 3QEGH 3KJ6L 4K71B 2P42B 1U92A 2BVPB 4XBEL 4FQ2H 3UBXG 1MI5B 2KZ1B 5FYLD 3B5HA 3TFKC 3VA2C 1YEJL 1PY4A 3GEWB 4X7SH 3MFFB 5DD6B 4ZUWB 4F9PA 5ALCH 1R6VA 2CKNA 1A0QL 2HN7B 3TT3L 4TVPH 1FLRH 2ILLA 2X2YA 3D85D 4G42A 1UCBH 1X5FA 3VA6A 1CXHA 2E9JA 3A67L 4RBPH 4CAGA 2MCPL 5HYSA 4DZBA 2PCPB 1T20B 1IGML 5F7MC 2EDDA 4R2GB 4HF5H 4JJ5A 2AJYL 3VXQB 4DOHB 1TJHL 3O6ML 3QISA 1UA6L 5C0NC 5T33L 2AK4E 5CJXC 1RFDL 5F3BB 5GGSA 3VFVB 3O11A 2OR7A 3HE7D 4HUKB 4XPBH 3VXUB 5DJYB 3JWDC 5IB4A 5ERWB 4M1GH 3AAZB 4HJGB 4P9ML 5GHWH 2DJ4A 1B2WH 2ZUQC 3D18B 2H1PH 3FO9A 2CGRL 4OCXH 2P45B 4K3DL 4OI8A 2VDNL 1IAII 3KAAA 3WJJA 3BW9B 1FNSL 3GMMA 2YMXL 4OUUA 4DK3A 3NTCH 5I15H 1T0PB 1KBGL 1XF2B 1ZGLM 1MFNA 4MXVF 3LEYL 2WUCH 5AYQA 3KYMB 4HFUH 1PEWA 3ARDA 2HFGH 3EFFA 5I0DA 4L8BB 1LNUB 3VXRA 3F6IA 2VJXA 4HWUA 1ZSDA 3RU8H 1E4JA 1BQLH 1VFMA 3V8OA 3SJVE 3MRLA 3G5VA 2X1QA 4WV1A 5IFJA 4Q6IB 4UMGA 1ACYH 3EYSH 4GG6E 4DGIH 1AGFA 1V7MH 3GSRB 3LKQA 1G9NL 4YXHL 5AD0A 1NAML 5EFIA 4JAMA 5LVEA 2QADC 4NQDB 4G8GA 1BJ8A 1X4XA 3BZ4A 2GUOB 1L7IH 3CZFA 3RL2B 5ICZA 1NFIA 3I6GB 4XTRD 3N1MC 2Q8BL 1DQDL 1Z9LA 3SKUD 1QRKA 5MI0C 1F3JB 3GMPB 3BDYL 5L2KA 1CF8L 1J8HA 2ZJSL 3LV3B 4P46C 2XRAL 3PWPA 3KPSE 3O6KH 4KMTH 4ZG1A 5FOBB 1W0WA 1LDSA 1IEHA 4JKWA 2CMRH 5JOFB 4NC2B 2LQRA 1OAXH 4GT7A 1FPTL 5FF6B 5FUZH 1FAIH 1AC6A 3G08A 2OTWB 5FKAB 3QA3B 2H9GB 3JV6A 1VKXA 4D0BB 3QRFM 4K94C 4A2LA 1RIHH 1V3MA 1JHKL 3X13A 4HH9A 3VRJB 3HS0B 4HS6A 5MP6L 5FDWA 4NZTL 5IW1B 3LRSB 4PJ7A 2EDKA 2GW5A 3QULB 1LGVA 1J5OH 4L8DB 4LL9A 3QEGL 3E6FB 2AV7A 4FQ2L 3NIGE 3OV6A 4UTAH 3LIZH 2JLLA 3E8UH 5C92A 4IBLT 4PREB 4X7SL 2VABA 3OAZH 4RMSA 1HDMA 4I48B 3IXAA 1LWRA 3QO1A 5ALCL 4F3FA 4JLRB 1DTUA 1KLUB 4LCUB 4TVPL 1FLRL 3FFCA 4QXWA 4UDTA 2AXGA 2OJEB 1EO7A 2IPUG 1FJ1B 1E27B 3SPVA 3SKOB 4N1CA 4JRWA 4GRLA 4R3SA 1CTNA 1NAMA 2HRLA 3C5ZD 1YUHA 2JCCF 3KLSA 4KWUA 1TXKA 3SE8H 1CGWA 4JGUA 3ULVF 3B9KB 3V7MA 5JO5B 4GMTH 1EEYA 2RAMA 2ZCKH 1SM3H 2BCKA 3V6FA 1U8HB 5DXWA 3HLAA 3QXUA 1U93B 2P1YA 4WNQB 4WTXA 4PRPE 1U3JA 4LNVA 3VFRA 5E8OA 3DX9B 1P7KA 1G1YA 3ZL4H 3PHOA 5CJBA 3S6CA 3VXSE 5GHWL 3DWTA 5H35A 2H1PL 1IE5A 3DYOA 2YD7A 4S1DC 3ROLB 3L9RA 2HA1A 3MODH 3QWRD 4QO1A 1T1ZA 4L9LA 43CAB 4R8WH 5DDHA 3NTCL 1U92B 3PWVA 5I15L 4F33A 1F8TH 2J8HA 3KJ4C 2WUCL 3S4SA 4M93C 5I16A 4HFUL 3GSNA 3V6BR 4WUUE 4MJ4A 1R5WA 3JTSA 3PWNA 1FG9C 4HIEA 4LGSB 2UUDH 4OCMC 4RA0C 5DZNA 4YX2H 5MERA 1X5YA 4G42B 4IRZH 4Y4HD 4PBVC 1ZAGA 4FFWC 1BQLL 3ZDZE 5HYSB 4DZBB 4POZC 4BSWA 5EZOH 5JDJA 4JJ5B 1ACYL 1J18A 3EYSL 4JN1H 4DGIL 1RUML 2R2BA 3HNSH 4OI7A 4P5TC 1JRHH 4MXWH 5GGSB 3GO1H 1EBAA 3O11B 5EBLA 5CD5C 3QT2A 2VR5A 5IB4B 1S5HA 4J7RA 4NKIH 1L7IL 4OQTA 3TBSA 4ZXBC 3SDXA 3FO9B 1UM5L 4M6ML 4K2UH 4RGMC 2R9HD 3BE1L 2E27H 1LD9A 4WHCA 2YPLA 4P2RA 3GMMB 4OUUB 3O6KL 4KMTL 3KLHD 4S1RH 4OZGE 2WWMC 3FAWA 2CMRL 1CDUA 1OAXL 3FB6A 2V9RA 5T3ZH 2X9WA 3HAEH 4GBXC 1AHWA 1FAIL 3ARDB 3P9MA 1FL5A 3BESR 4IS6A 3EFFB 3QWOA 3VXRB 1VGKA 5L0QB 4WI2A 1ZSDB 2ZWLT 5C0IA 1UGNA 2E9IA 5ECJE 1RIHL 1W0VA 5HGBA 3MRLB 4OFDA 3G5VB 4WV1B 4K7PH 5IFJB 2EH8H 3O2VL 1ZOXA 3SKJH 1AGFB 3MOAH 5AZ2H 2X4SA 4HGKC 3C6LD 4WJ5A 3LKQB 4XCNA 4Y5VC 1SEQH 3KPMA 5AD0B 5EFIB 4LK4A 4UTAL 4JAMB 1QBML 3E8UL 1C08A 4NPYA 4ALAH 4HGWA 4G8GB 3BZ4B 3CZFB 5ICZB 1NFIB 3MBEC 1YEGL 1IGFL 1NMCC 3NVQA 5EOCH 5J7CC 4XBPA 1GOFA 5L2KB 3IDGA 3ILQD 1J8HB 5DVKA 3KS0J 3PWPB 4QHUA 3E3QE 4NN6C 1W0WB 1QSZA 2MQ0A 4N0UE 1KOAA 3VH8G 1T03H 1D3CA 2A38A 3SE8L 1BBDH 4KDTA 2X09A 5F7KC 4GMTL 3T1FA 3G08B 2ZCKL 2AK4D 2B8OT 4P5TA 3SGEI 1HI6A 3JV6B 1VKXB 1N6VA 5I8CA 2MHAA 2F53E 3C60A 3CDCA 1FC2D 2MQ3A 5CJOL 2F5BH 2R0KH 5LGJA 3V2AR 3ZL4L 3X13B 3MRQA 1QSFE 4HH9B 2HT3C 2Z93A 3BJ91 2ZUQB 3K4DA 4HS6B 5FDWB 3MA9H 3MODL 4PJ7B 5F7WC 5JXED 5EC1A 5F1OB 3VD9A 5EN2A 4XI5D 4RDQF 2YC1A 4FTVA 3LKNA 5BV7L 5E7FA 2AV7B 1F8TL 4Z7OF 4YEEA 1MAMH 4XNZB 2VABB 2R39A 3GMNA 1HDMB 1WTGT 3IXAB 1FH5H 2C9AA 3QO1B 2V9TA 4F3FB 2C4XA 1YNKH 3A6CH 4PJXA 2CD0A 2WBWB 2CLZA 4R4NC 4YX2L 1MH5A 3FFCB 3VD4A 1DUYA 5GGVH 4UDTB 2E5EA 2AXGB 2EDBA 3SJVD 1HEZA 3KYOA 1FV1A 1D5IH 1LMKA 3SPVB 1JVKA 5MENA 1NFDE 1WWCA 4GRLB 4R3SB 2ARJA 1NAMB 1J7VR 3MLRH 5EZOL 1YUHB 5HD8C 4TTDC 4UBDD 3JSSA 1EEYB 3HNSL 4ONFH 2BCKB 1MCFA 3V6FB 3WXWH 3HLAB 1JRHL 3QXAA 4MXWL 5HI4C 3GO1L 3VFRB 5E8OB 1KN4H 1X6NA 1P7KB 3PHOB 2QADB 2Q20A 4NKIL 5H35B 1BLNA 3N9GH 2VXSH 3O2WL 3ZE0E 4G9FE 3L9RB 3ETBF 4K2UL 3W9EA 1HINL 3MRPA 3BP6A 1T2QL 1T1ZB 3S97C 4L9LB 3KPSD 3TNNA 4CBPA 2EDWA 5DDHB 3PWVB 3VGFA 2X05A 2BVTA 4S1RL 4F33B 1RUQH 5IJVA 5C0RH 3S4SB 3ILPA 1QBBA 5I16B 3GSNB 5T3ZL 1TVBA 5L2JA 1R5WB 3JTSB 3PWNB 5MERB 1PSKH 4HIEB 4TUKH 1H5BA 1P2CA 2L4OA 4KDVA 1AJ7L 1G7MA 2R1XA 5F7EH 3T8XA 1JPSL 3UP1A 5I8OL 1IKFH 5EUKA 4PJIA 4MWFA 4K7PL 2EH8L 5B39G 4FQXC 1QZ1A 4BSWB 3RTQA 4JDZA 3T0VA 2P44B 2AI0H 2DMCA 4OM0H 3SKJL 2R23A 4O4YH 3SDDA 3MOAL 2R2BB 4F58H 3KS0H 4MLIA 1SEQL 2H41A 4J23A 5EBLB 5CGYD 3NIFF 4IMKA 4FRWA 1UXWA 5DI8A 4ALAL 3IKKA 1SJVA 1S5HB 1FCGA 2B5IB 3TBSB 5IIEA 3SDXB 5JW3H 5HI3D 1LD9B 3LH2H 4KXZI 4AM0A 2KBGA 4BH7A 2WBJD 2YPLB 4P2RB 4EIGB 3DYMA 1NBYA 5EPMA 4M6NH 1QTYT 3WN5C 5DWUH 3DVFA 5FGCE 1L9NA 4P23C 2ESVE 1V05A 3FB6B 1BPVA 5DUBA 3RVTD 1S8DA 5EULV 1AHWB 3P9MB 1BBDL 1FL5B 3ALWA 4IS6B 2CKBH 3QWOB 1PZUB 1KIPA 1SJHA 1VGKB 1ZLWH 5L8LB 3ZDYF 1CR9L 3LD8C 1HN1A 4R4FH 4XH2A 4KJPD 4PRPD 5C0IB 1NJ9A 3VI3F 3BWUC 5EZJA 2F5BL 2R0KL 1W0VB 5HGBB 3VXSD 2IGFH 1XGTA 3D39E 5CZKA 4I1NB 3IFNH 5DUPH 3T0XA 3MA9L 4IOSD 2XYCA 1D5XA 2X4SB 2VXUH 4B50A 4WJ5B 4XCNB 1G9MC 3KPMB 4PJ5A 1C08B 1MAML 4GH7B 1ZVHA 4M93B 3T3ME 4NPYB 4ETYA 4HGWB 4WUUD 1FH5L 2QBWA 5B3JF 1YNKL 3A6CL 4C56E 5TF1H 1J86A 3GHBH 4I77H 4RMUA 2A77L 3GHEH 4AMKH 4XBPB 5GGVL 3E6HA 3IDGB 5DK2A 3KLDA 4QHUB 2LE9A 1D5IL 1S5IH 3RRQA 3BRDA 4FQXA 3O4LA 3P11H 3MLRL 2BP3A 3MLYH 4P2QE 1F4YH 3BMWA 4EVNA 1RK1A 4N90E 3RWEA 2DKUA 4G6ML 5HXMA 3T1FB 4ONFL 3WXWL 4P5TB 3GB7A 1E4KC 4LSDA 2OX5A 1HI6B 5ID0A 1PG7W 5I8CB 2MHAB 3PQYE 5KVEH 4F8TA 5D7IA 2Z31D 3C60B 1ZEAH 3IRZA 1CFSA 4FMKA 1UB5A 1D9KD 1KN4L 1VB9A 1XFPA 5LGJB 2XWBA 1KTDA 3MRQB 2Z93B 2VXSL 1JPFA 1UQSA 1AR1D 3CX5K 5FXCH 5EC1B 1TIUA 5DD3L 5EN2B 1CQKA 2PNDA 2H6PA 2YC1B 4FTVB 3LKNB 3QPXL 3WN5A 4LPCA 1RUQL 5C0RL 5JHDA 4KVNL 3GMNB 3UC0H 3I3DA 1HHJA 4PJXB 4KRPD 1PSKL 4TUKL 1GPOH 1TNNA 1MH5B 4Z5RA 3TO2A 1X5LA 1DUYB 1F90H 5F7EL 1HEZB 3KYOB 1FV1B 3PV7A 5FK9A 1HIMH 5DQ9A 2L0DA 5MENB 2ARJB 4Y4KD 2MKLC 4NM8H 5TDOA 1CFTA 2AI0L 4LBEA 2EZ0D 4JR9H 4O4YL 3GMOA 2F58H 5A2FA 2NW3A 2IMNA 2ICWJ 3QXAB 2NZ9C 3OL2A 3ARVA 3F7PC 2OL3H 2OS7A 2GIYA 3HMXH 4HK0A 2VSCA 4GG8A 3OQ3B 5A2LH 1BLNB 5C0GA 2ENYA 3WFZA 5JW3L 1NMCB 3W9EB 3MRPB 3BP6B 3BPLC 3JWNC 1A7PH 3OAUH 2G75A 4KMLB 3TNNB 1A9EA 3MV7E 5E08H 4V1DA 4L4VE 4M6NL 5HHVH 4PP1D 5DWUL 5IJVB 4KY1H 4MD5A 3ILPB 1XH3A 3J7HA 1SBSH 3QIUD 1HZHH 1CK0L 3HNVH 5TJWK 4QRRA 1TVBB 5HVHC 5L2JB 3QG6A 3L3KA 4HWEH 1E4KA 2F53D 1NANI 1H5BB 2YD2A 1P2CB 4R4FL 1OWRM 1XT5A 4PFEA 4MNQE 2AKRA 5JTWA 2R1XB 1G7MB 2X42A 3T8XB 1QSFD 5EUKB 4WW2A 4PJIB 4MWFB 2IGFL 3F6LA 3WUWG 3RTQB 4JDZB 3IFNL 5DUPL 2X89A 4KJQD 5LQBH 2R23B 3O0RH 3SDDB 1XGPA 3RGVC 2VXUL 1BOYA 3RPKA 1HYRC 2NY6C 4HAGA 2FJGA 4HFWA 5EG6C 4HS8H 2KZWA 3HZYA 1ZVYA 2DTSA 1F4AA 1UXWB 5DI8B 5EA0H 5IMKA 5IIEB 4G8EA 4NRYA 5TF1L 4I77L 3GHEL 5DA0B 4AMKL 4AM0B 4BH7B 1NBYB 4N0CC 5EPMB 5A3IC 4RGNC 4XNUH 2DYPA 1ES0A 1S5IL 2CLRA 3V7AE 1EAJA 2IPTH 3P11L 4R9HA 1CVRA 1MCIA 1ULVA 3MLYL 2KKQA 3MXVL 5DUBB 1F4YL 1S8DB 4HLZG 5KSAC 4QTHA 5D6DC 4F15B 1GC1C 2OTUA 1KIPB 1SJHB 4BZ2H 1G7HA 4KROC 4XH2B 5KVEL 1NJ9B 4OBSA 5EZJB 4PJ7F 2EDHA 4NNXA 3S8WA 1KCKA 1XGTB 1W8NA 4E5XA 1NCDL 5F21B 5BCAA 4X5LA 4G9FD 3Q6GH 4XB8A 4QWWD 5I71C 1K8IA 1CCZA 1D5XB 2DIBA 4G43A 3RIFF 3SY0A 1MCCA 4PJEA 3AS1A 2CKBA 2XFXA 1I7UA 3OG4B 1JV5A 5HI5C 4NRXA 4PJ5B 3BAEL 4KKBC 3F65A 3UC0L 2FGWL 2ZUSA 4ZNEE 3H6JA 1GPOL 5JUEH 3E6HB 1F90L 3ZSTA 5DK2B 1OM3H 3BO8A 1HIML 4M7ZC 5J4MA 4FQXB 3O4LB 4BFGA 5D1XD 5BO1H 2MJWA 1LO0H 4JR9L 4ZOAA 4EVNB 1RK1B 3RWEB 3RGVA 3WLBA 4AT6A 4ZS6C 3GB7B 5ID0B 4J3UA 4Z7QF 3T2NL 3QQ9C 3VMOA 5ACLA 1GGBH 5D7IB 1ZGLA 1IBGH 4HZLA 1CFSB 2ITCA 1UB5B 4YZFF 3HMXL 2J88H 1KTDB 2XWBB 4KKCD 4MQXD 1F11A 3O3BA 1JPFB 1UQSB 4O58H 1U8JA 3RUGA 1AGBA 1FIGH 2NY3B 1QFHA 1A7PL 3OAUL 2EXWC 3D85A 5IROC 3GI8H 4KVCL 3UPCA 2H6PB 4JFQA 2APVA 5E08L 4HIHA 4U1LA 5HVFB 5HHVL 3WN5B 2WNGA 1S7RA 2ESVD 1B6UA 4KY1L 5D96B 5JHDB 1CGXA 2CSPA 1SBSL 5IMOA 4HJJH 5GRUH 1HZHL 3HNVL 1XR8A 3QJHA 1HHJB 3G6DH 3Q5OA 4LQFL 5KSAA 1FNEA 2WLZA 1OD9A 4HWEL 2B1HH 2BVYA 2ITDA 4FS0A 3TO2B 4Z5RB 3LS4H 4MQ7A 4XT1C 1F6LL 4Y2DD 5E6YA 1QLFA 3JWOC 1A4KA 3HE7A 3D39D 5FK9B 4M4PA 2QQKH 5DQ9B 1AGCA 1F3DJ 4JANA 3G5YA 5TDOB 1CFTB 4LBEB 2DL9A 2FEEI 2R15A 3SGKA 4RDQG 2CO6B 2EIZA 3GMOB 2EICA 1MHEA 2NW3B 5IT2H 2ADFH 1TQCC 2V5TA 4CVWA 4HS8L 2CH8A 3SDXF 4XCEA 4ZSOA 3TIEA 4D8PA 4UNUA 2HKFH 5IBTH 4Z76A 4HK0B 3WNNA 4JDTH 1CXKA 1N7MH 4GG8B 1X5AA 5EA0L 3KVQA 5F72S 5C0GB 5T1DL 4XVUC 4C56D 4JO3H 1T66D 2G75B 1A9EB 5BZDA 2V2TA 4V1DB 4XNUL 5HHXH 5E5UB 2IPTL 3CMOH 4MD5B 3RDTC 5HHOE 1XH3B 4NHCL 4N90D 5DRZA 3TA3D 4QRRB 4YDLB 2OL3A 3HMXA 5CEZE 3QG6B 1NBZA 3QXDA 1I1AD 3PQYD 5KANG 1A6AA 4YFLI 2AKRB 1EGJH 2M26A 3DVNA 5EIQA 2XA3A 3W0WA 4WW2B 4RMRA 1ZLUH 4PJDE 2R2HA 4G6AC 4CN4A 1TVDA 1CDGA 1XGPB 2R0WH 4Z18A 3FB7A 3TT1H 1HSBA 2IBZY 2FJGB 4HFWB 4N8VA 1BVKA 3HZYB 5I1HH 1MCWW 3PNWA 3FHAA 4Q74A 2NY7L 1K6QH 5IMKB 5KAQG 4KC3B 4G8EB 1A7RH 4NRYB 1B0RA 4WFFE 1DBMH 3DV6A 5JUEL 1GGCH 3RJQB 4NOBA 3ZE1E 4KK5C 4KTEH 1OM3L 4YWGL 1J0IA 2DYPB 1ES0B 1AR2A 3LN5A 2CLRB 4QTIH 3SGEH 1RHFA 2VXTH 3KYNA 2IPUK 5BO1L 1D6VH 1LO0L 1RZGA 4UV7H 4QTHB 1U3HD 1H8SA 1XF4A 5HVGB 2OTUB 5SWZE 3DX6A 1G7HB 4MVBD 4CUCA 1CTOA 1GGBL 5I17A 3U30B 1IBGL 4NNXB 3VWJC 1I3UA 2J88L 4Y5XC 4E5XB 4FFVD 2EO9A 4X8XA 5F7YC 4BUHA 5LG1A 3TV3H 1EEZA 3DECA 4O58L 3N1QC 1K8IB 1FIGL 2DQDH 3ULUE 4G43B 2BY0A 3ULVE 3PGFH 5SV3A 1PKQE 3GI8L 3SY0B 4L4VD 4PJEB 1A6VL 1FZKA 2CKBB 2DI7A 2XFXB 5D2NC 1I7UB 5FGSA 1JV5B 4PYHA 3MLUH 1F3DH 4PJXF 1TJGL 4NRXB 4U6TA 4E9LA 3RDTA 3QDGE 1ZE3C 4HJJL 5GRUL 3C5ZA 3G6DL 4YHZH 3WFCL 3GIZL 1XGRA 3H8NA 4XNXH 2B1HL 5EUOA 4NN7C 2X70A 4MNQD 4NQVA 2A6IA 4TSAL 2GY7B 3ZKMD 2JB5H 3N85H 3LHPH 3JXAA 3BO8B 2QQKL 4KK8D 3FMGH 3ALXA 2FR4A 2CO7B 3MLZH 4TSCL 5CGTA 4H26B 2P4AB 3MR9A 3MUHL 3RGVB 3WLBB 5IT2L 4JKPH 4DVRH 4AT6B 2ADFL 2R4RL 1DLHA 4XBGA 2ICWA 2ZUUA 1OP3H 3DVIA 3NCJH 3GGWA 1ZGLB 3TJHD 4HZLB 4B7LA 2ITCB 5IBTL 5IV2A 1N7ML 1F11B 3O3BB 1A8JH 4JO3L 3QIWC 1U8JB 3RUGB 1AGBB 3IAPA 2JELH 2E6PA 3D85B 4RNRA 4JFQB 1T04A 4U1LB 4RGNB 4Y4HA 3V79C 1S7RB 1HWGB 3CMOL 4HK3J 4NUGH 4DKDC 3LCYA 2Z91A 3X3GL 2P46B 2EYSA 5IMOB 3BPOC 1XR8B 4M3KB 3QJHB 2BRRH 3IETA 5KSAB 3NCYP 1FNEB 1ROWA 4PJIF 2ITDB 1OGTA 1DQJA 4MQ7B 1FFNA 4H1LA 3QQ4A 3CCHA 1A7NH 1PDKA 1EGJL 1F4HA 1QLFB 1QSEA 1A4KB 3HE7B 2BSTA 3I2CH 4KTYA 4Z78A 4Y5XA 1YMME 3VRIA 1AGCB 2VDQL 3GJEA 1YEFH 4JANB 3G5YB 1KXQE 5I71B 4CRPA 2EIZB 4F9LC 4KKNA 5DT1H 5DJAA 1MHEB 2K7PA 3QAZC 5FO9A 5I76A 43C9A 1MAKA 3IS0X 3TT1L 2NY0D 5D2NA 2J6EH 1QKZL 1A7OL 5CIPH 4XCEB 4ZSOB 3TIEB 5I1HL 4D8PB 1M1SA 4Z76B 1IFHH 3HKFA 3W5NA 2Y6SC 3WLWD 3CC5A 3HUJA 1T7WA 3EO9H 1KLGA 2N7BA 1A7RL 2R69L 1DBML 4I13B 1GGCL 2XT1B 3G04A 1G6RA 5FGBA 5JMRA 5I1KH 3NZHH 5BZDB 3IDNA 2V2TB 4GKNA 4IOFD 4KTEL 1L4IA 1MRFH 4KRMB 4YDVA 3KPOA 4M7ZB 4QTIL 1MJUL 4L9DA 4LASH 5GZND 4LAQH 5HYJE 4FMFA 4KJWD 2VXTL 5E03A 2XKNA 5DRZB 1D6VL 1UENA 2OL3B 1G7LA 1TVHA 4UV7L 5D7JC 3LEXA 5EBWA 1RZKH 5GGUA 1NBZB 3QXDB 4LLUA 3C6LA 1A6AB 2ZSWA 4G8IA 3DVNB 3E2HC 3QRGH 4X5WA 4R4BA 5KN5A 3W0WB 4LSVH 1O0VA 4UNTA 2BXZA 1UM6L 1MFDL 2R2HB 3CFJA 3TV3L 3LZFL 1KCSH 1TJIL 2DQDL 5GJSL 1JWUA 2FECI 1IAIM 3PGFL 3FB7B 4ZFGL 2WUBH 5F9OL 5FYKU 1HSBB 2IANE 3BI9X 4PR5A 4N8VB 1BVKB 4M1DL 2ERJC 3NH7H 3LOWA 4BQ6A 3PNWB 3P77A 1A47A 2A6KA 4XAWL 1DBBH 4FQCH 2AERT 4YHZL 1WIPA 2DQTL 4LLQA 1B0RB 3ZTJH 3DV6B 1EAPA 2AK4A 3I6KA 1C16A 5FUOL 3FN0H 2RB8A 1ZANH 2JB5L 3LHPL 3EO1A 3QPQC 2PF6A 2N56A 1X4ZA 3LS5H 4FG6C 3LN5B 3FMGL 4Z7OE 3MLZL 3MRKA 1ND0A 3KYNB 3NPSC 4KPHH 5DFVC 1RZGB 3HR5A 5D7IF 4F9LA 1XF4B 5JXEA 4JKPL 2KL6A 4DVRL 3DX6B 3EYQC 5SV4A 5EU7C 5T1KD 3V52H 1PD6A 2M1KA 5I17B 1DFBH 1NUNB 3AS0A 4KHXH 1FIEA 4UIKL 4QHMA 4S2SA 1ZLSH 1EEZB 1M7IA 1QRNE 2OP4H 4DEPC 2DM3A 3VXUE 3HZKA 2JELL 4OQ1A 5TGBA 2VISA 4M1CD 4WVRA 1FZKB 3QCVL 1Q9WA 1LEGA 4U0RC 3SJVA 1T4KA 3WMSA 5HHOD 3RDTB 4NUGL 5DR5H 3T0EE 5BS0E 2CRYA 3ROOA 4ZTOH 4JCLA 3C5ZB 5CEZD 2BRRL 4ZUTA 1YQVH 1XGRB 2BXYA 2H32H 5EUOB 5HYIA 4LSUL 1IEAA 2X70B 1KV3A 1NUFA 4NQVB 2A6IB 4BZ1H 3I2CL 8FABA 2YRPA 1O7VA 1OSPH 1MWAA 2FR4B 3MZTA 1A21A 2AJ3A 4LDLB 3WIHA 3MNZA 3O9WD 3MR9B 5J57B 2FEDC 2LVCA 4LOUC 4KFZC 3UAJD 2ID5A 2VQ1A 2F54E 1DLHB 1EV2E 4XBGB 2ICWB 2J6EL 3KPSA 3GGWB 2APXA 2X9XA 1OB1A 4PV9A 1IFHL 5IV2B 5HGDA 2H45A 4X9FA 4YK4C 2A0LC 1WIOA 4WFFD 5IFHH 5IB2A 1X7QA 2VH5H 2XNAA 1FNGA 4RNRB 2GYSA 1T04B 3NFPA 4Y4HB 1MRFL 3TN0D 2VMFA 1YN6A 5CSZA 2EE3A 4X7EC 2D03H 4LASL 3NIFE 2Z91B 2EYSB 2K3TA 4R7DA 2AJZA 3IETB 5SWZD 5IMMA 5KVGH 1OGTB 4LF3A 1DQJB 1FFNB 4H1LB 3QQ4B 3W9DA 3CCHB 4OT1H 3HG1E 1QSEB 4YUEH 3QRGL 2BSTB 2C3XA 3LPWA 4LSVL 4Z78B 4Y5XB 3VRIB 5HYFA 2QQLL 3GJEB 4GOSA 4GXUM 2YD1A 4O5LL 4MXQD 1MRDH 3TBYA 5I9QC 3ULUD 3TZVD 1XZ0A 1KCSL 2MQCA 3ULVD 1A22B 1T80A 3BWAA 5DJAB 3QUML 5FO9B 5I76B 43C9B 3HHRB 1NCCH 5D2NB 4KUCD 2WBJA 3NABH 3UJTH 4I9WE 4LVHC 3LDBB 2D0FA 3QDGD 1Z3GH 4LARH 3B83A 1RIUH 2NY1D 1DBBL 4FQCL 3CC5B 3HUJB 3O8XC 3MOBL 1KLGB 5GS3A 1IL1A 3H3KA 5GSRA 4B5EA 4YGAB 4WEBL 1FFQA 1H0DA 1G6RB 3G04B 1QBLH 3UDWA 1QFWI 1ZANL 1PFCA 2ZUWA 4FQHA 3GMLA 3IDNB 4GKNB 2EDLA 4DUVA 4PRPA 1C1EL 2DQIH 4YDVB 3KPOB 5GS0H 3OF6D 5HHMB 3VXSA 2I26N 2CUHA 4HBCL 1NLBH 1O5DT 1GIGH 2XKNB 4U7SA 4P57A 4UNVA 1G7LB 1TVHB 5B3JE 4GS7C 3LEXB 1TMCB 5EBWB 1UJTA 5GGUB 4LLUB 3QUXC 3C6LB 2XWJA 1HHKA 2ZSWB 4G8IB 1IAOA 2A1WL 2QTEA 4X5WB 4R4BB 5KN5B 4MD4A 4KHXL 5FM8A 2EEDA 3CFJB 4PJEF 4TPRH 5D5MA 5BV7C 1ZLSL 4WUUA 3K81A 4F7MA 2OP4L 4ZOCA 1B90A 5M7QA 3RX7A 1JWUB 5DF0A 2Z8SA 4XAKE 4PR5B 3TPKA 4NO2A 4JB9H 4XPGL 3ARUA 4JFYA 5LGHH 5DR5L 3P77B 4I5BA 2R0ZH 2A6KB 4ZTOL 1RV6X 3SCMD 2DAVA 4WO4D 1E4WL 4OF6A 1LVEA 3ZO0A 3IXTA 4I0PD 1YQVL 1ZHKA 4LLQB 4H88L 1EAPB 2AK4B 3I6KB 1C16B 2UVEA 3F58L 4BZ1L 1NKRA 3EDKA 3EO1B 5JW4M 3T1WA 1WQVT 1P7QA 1YMMD 2Z31A 3AS2A 3UPAA 1D5ZA 2UY6A 1OSPL 4CVUA 1D9KA 4X7DC 1X5XA 3MRKB 1ND0B 2VC2L 1MEXH 3HR5B 2LU4A 4YPGA 3OB0K 2AJSH 1CU4H 1Z0MA 4Y5YC 1N3NA 4NC1E 4K9EH 5I1JH 3RUGF 3L1OL 2IWGA 4HKZA 4QHMB 1UWGL 5MEOA 4S2SB 4WI5A 1UEYA 1ED3A 1M7IB 5IFHL 2ARWA 3QG7H 1WAAA 4WWKC 4YBLB 4HXAH 1GH7A 2WM0A 5I1CH 3HZKB 5TGBB 2VISB 3WS6C 5D1ZC 2D9CA 1Q9WB 1B0WA 1LEGB 2WMPA 4GUPA 2EIBA 5TQ2L 2FYYA 3SJVB 4YIQA 1C5BL 1T4KB 2LFGA 4TNWF 2XPGA 1DDHA 2D03L 5HYJD 4L5FH 4GW5A 4WIQA 3ROOB 1U8KA 4Y4KA 2VZOA 1HQ4A 4ZUTB 1V3LA 5KVGL 3U82B 1IEAB 2WK2A 1A7QH 4OT1L 3VXOA 4JGMA 4YUEL 8FABB 3D3VD 3EOAA 2BHUA 1MWAB 1C5CH 2AS5M 1J0KA 4YQXH 3VXRE 2AJ3B 1MRDL 3MNZB 4XP6H 1QHOA 4NQSA 3RHWF 4OGAD 3EHBD 3IJHA 5GZOD 3CFBA 1J11A 1OTSC 2QL1A 2IAND 2VQ1B 5FDYA 1NCCL 3KPSB 3NABL 2JK5A 1R24A 3UJTL 3OTTA 1H3UA 4PV9B 1RIUL 2PTUA 5HGDB 4M61A 5SWQA 4YHIA 4N0UA 1GSMA 5C70A 4K3HA 3U7AA 1MFEH 3QIUA 5T3XE 1KEMH 3CPLA 5IB2B 5JW4N 4XB7A 1X7QB 5HYQA 2XNAB 1FNGB 1QBLL 1OGAA 1WITA 2FB4L 5DLMH 3NFPB 4GO6B 1YN6B 1VERA 1FNHA 5CSZB 4X98A 4X9BA 5GS0L 3VGEA 1QSFA 3PWJA 2D7QA 2GEEA 5TE4H 1NLBL 5KANI 3NPSB 3SEPA 1GIGL 5L2KE 2HH0L 4R7DB 2AJZB 1J8HE 1NCAH 3PWPE 3RI5F 5IMMB 4PJ8D 1AQKH 4Y5YA 5DK0A 4LF3B 3T0BA 1LP9E 4R2GD 2EIEA 2ZSVA 3W9DB 3FB8A 3VWKD 2Y5EA 3AB0C 1I9IH 4L3EE 4YHLH 4MD0A 6CGTA 4UAOB 1UKQA 3HI5H 4TPRL 1QRND 3TBYB 4KRLB 4NM4H 3BGFC 3VXUD 1XZ0B 3BKMH 4WWKA 1J8KA 3Q0HA 3BWAB 1MCWM 3PL6C 3WS6A 3F7YA 4JB9L 1BAFH 3HCVA 3T0ED 5BS0D 5LGHL 1NFDA 1Q0YL 1Q94A 3FJTA 3PF2A 1IL1B 5GSRB 1EMTL 4LEXL 1JTPA 3G6JE 3SKNA 4FQHB 3GMLB 4PRPB 1DEEA 3C87A 3VFWA 3QUYD 3VGAC 1JZ5A 1HOCA 2VKWA 4L29A 3VXSB 1NQBA 3K7UA 4U6VH 3U9PH 3FFCE 4JFDE 1MEXL 4G9FA 4NFBA 2LAAA 4P57B 3K4ZA 2C1OA 2F54D 1CU4L 3HE6C 3MACH 2XWJB 1HHKB 4K9EL 5ADOH 4JZNA 1IAOB 5I1JL 4H0HB 4MD4B 3RWHA 3VXME 1MHCA 5D5MB 3EO0A 3ARBC 4WUUB 1I8MA 4F7MB 1U8NA 1JYWA 3QG7L 1EK3A 4KV5F 1AD0A 2YHGA 2HTLC 4HXAL 1DEDA 5I1CL 3VD7A 1OT2A 4MHHG 2E3VA 1V3JA 4Z7QE 1YECH 1OPGH 3WYRA 4NO2B 1OSZA 4HUNB 3LKPA 4JFYB 4W4OA 4L5FL 5EUOF 2EC9U 4I5BB 1CL7H 4YZFE 4MQTB 4TUJA 5D1XA 4Z7NF 4JO1L 3IXTB 4OKVA 1ZHKB 2VL5A 4ZODA 2L7UA 3VGGA 5IQ7H 4GMSH 3HG1D 2BY1A 3DETD 1FGVH 3IU3A 3FQNA 3HAEG 1P7QB 2Z31B 3BD3A 4XPTH 4IRJC 1D5ZB 1NC2D 1D9KB 1C5CL 4YQXL 5C71A 3DO3A 2DIAA 4XP6L 1GXEA 5DVNA 4OBRA 1BJMA 5KVDH 4YPGB 3OBAA 1SY6A 1UJ3C 1N3NB 4I9WD 4BFBD 4R97B 4WWID 2B1AH 4P4KC 3C5SA 3PWLA 4HS3A 5L7XH 1B6DA 2YRZA 2BVEA 4HKZB 1URLA 5MEOB 1MFEL 1ED3B 4APQD 4X7FC 3IAQA 3V5HA 2C7UA 3Q5TA 2WQRA 4KRPB 4PB9H 5E2UH 2DRUA 2VNCA 4X8JA 4OFKA 4DAGH 4EZMA 4GUPB 4Y2DA 2FYYB 4YIQB 2XPGB 1DDHB 3D39A 5C86A 4GW5B 2PW1A 5TE4L 1U8KB 2Q7NA 4AENA 4Y4KB 4UINH 3ARFC 1IC7H 1HQ4B 4P2RE 4LVOC 1NCAL 2D7TH 4M3JA 3HE6A 1AQKL 2DS4A 1B4RA 1KT2A 5DO2C 5HGGS 1OW0A 3VXOB 1I9IL 4YHLL 3DYPA 3KWWA 3S5LG 3EOAB 2EDNA 4EI5C 3ME0A 4IRSD 1OLZA 3ARBA 1HSAA 4LQ1A 2OQJA 3REWA 2IQ9H 4NM4L 1R5IA 4NQSB 4C56A 3RVXD 3IJHB 3CFBB 4JG1L 4XAKD 3EYFA 3U1SH 3UYOD 1GRWA 3WHXA 2BSSA 2EDJA 3HUJF 3U83A 2JK5B 1R24B 3CNKA 5F1IA 1F02I 1BAFL 4N9GA 5E0QA 5GPRA 2V7NA 3N0PB 4LIQE 4M61B 5SWQB 4YHIB 4N0UB 4U7MA 5ESAA 5GGSY 1KB5H 3QIUB 3S9DB 5JZ7C 3CPLB 1L0XA 3CFCH 2B4CL 5HYQB 4EUPH 2EDXA 1OGAB 5JOPE 2D2OA 2RJMA 5FYKE 3C08L 4TOYL 4X98B 3N1PC 1J0ZA 1QSFB 3PWJB 1EHAA 3KGRA 4U6VL 1RIVH 1OQOA 3LPGA 5GGTA 1LE9A 3KPQA 1UJ3A 1J0HA 1PX3A 3GZKA 4Y5YB 5DK0B 3MACL 4IJ3B 2W9DH 2ZSVB 4ORZC 1ONQA 5E24E 5ADOL 3FB8B 4KDWA 3HFML 4HPOH 3GJFH 4MD0B 4X9GA 3MRMA 3DHJA 4XHJC 4WWKB 2Y07L 5CZXD 5CILH 2ED7A 4F57H 1RZ8A 3F7YB 1JPTH 1YECL 1Z9SA 3FRPA 4U6YA 4MQSB 2W9EL 3HCVB 3SE4C 1NFDB 1CL7L 1Q94B 3RVVD 3ARFA 4MCYA 4U6HA 4FTVE 2FBJH 2DWEA 2Y36H 5JQHC 1OT1A 4HG4J 5IQ7L 1U3HA 4GMSL 3SKNB 1U3YA 3CLEL 1FGVL 4N1EA 2ENSA 3ARDD 1DEEB 3AREC 1IGCL 4QY8A 2LAGB 3VFWB 4XPTL 4LHUG 3VXRD 4ZO9A 5CEZH 1HOCB 4L29B 2ADJA 3L7FA 4FFZH 4G9FB 4JN2A 4LLVB 5BRZE 2C1OB 3RKDD 4MX7A 4QYOA 3CJJA 3R4DA 1KF9B 5E8NA 2A73A 4JHAH 4JZNB 2WWKT 3O6FC 4FQJH 3PDOA 1FFRA 2B1AL 4ZAKD 3CMGA 3RWHB 3AS3A 1MHCB 5ISZE 5T3XD 3EO0B 4C55A 1I8MB 1U8NB 5LGKA 1UWEH 1AD0B 1T0NA 3BZDA 3DTXA 4NNPH 3TFKD 1KJ3H 4LRNL 4PB9L 3BZFA 2ZOLB 5E2UL 2IBBA 4PJ9C 4OUOA 4MNQA 4RWHA 5GGRB 2XTJC 2MWCA 4XCFH 1OSZB 3LKPB 4EN3C 2OXHA 3CXHJ 3CDFA 1AIFA 5L2KD 4OLZH 1J8HD 4TUJB 4WEUD 5D1XB 3PWPD 1IC7L 4OKVB 2VL5B 1S9WA 3T65A 5E2TH 4HCRH 5FCUH 3IU3B 3MV9E 4L3ED 3FQNB 1G6VK 1ZHBA 5BXFA 5E7BA 4AL8H 5C0ND 1KENL 2E7LC 1NCUA 2YXFA 1PX4A 1MCOH 4CMHC 1MPAH 5SWSA 2FBOJ 2IQ9L 3FAXA 2NLJA 1VGEH 3QUKA 4N5UA 4UQ3A 2DQHH 2EIDA 2N4IA 4S1QH 3U1SL 4J4PC 4AEFA 2J5LC 5FGCB 5JDSA 3C5SB 3PWLB 4HS3B 3U2SA 3ULUH 3ULVH 2BZDA 2V5SA 4Y1AE 4LCIH 1BP3B 1KB5L 4WFEE 2P7TA 2GK0A 3CFCL 3V5HB 3C8KA 5J1SC 2C7UB 1P6FA 4NKOA 3MQIA 1F6AA 4X8JB 1RI8A 2P24A 4Y2DB 2DLIA 2VDMH 5FYJE 4KK6C 3D39B 1NUDA 2PW1B 4JFDD 5I74B 3QH3A 1RIVL 4AENB 3NIGF 3HI6L 3HE6B 1YEKH 5C3LD 1KT2B 2W65A 3BD5A 1BFOA 3O6FA 3VXMD 4DN4L 5DFTA 3KWWB 3X17A 2FECL 1KPUA 4MJIA 4P3DA 2BNRA 4I3GA 2G9HA 4P3WA 3N1FC 4YJZL 2CXKA 3ARBB 1HSAB 3Q1SH 2OQJB 3REWB 5J06A 4ZNEA 1R5IB 1KB9J 3VDCA 4C56B 3ZKNC 5DRNA 1OP9A 5CILL 3EYFB 2OJZH 4F57L 2QADD 1G84A 1WF5A 3WHXB 2BSSB 3D0VA 5ICXA 5F1IB 4N9GB 2V7NB 5E00A 1BQHA 5IB3A 1I8KA 4P46D 1S78C 3WO3B 5E2JA 2DI9A 5ESAB 2Y36L 1CBVL 1KUMA 1CIDA 3HPJA 3FL7A 2FX7H 5JIKA 4MCZA 2NZIA 1F13A 5CEZL 1UB6A 1VEPA 3MLXH 2IF7A 4TYUA 1MUJA 4FFZL 1LE9B 4FQ1L 3KPQB 3KYAA 1LO3H 1UJ3B 2ZUVA 3T4YA 4J4PA 5D72L 1ONQB 2NNAA 3P0YL 5D5MF 4JHAL 2P48B 4ERSH 2NCMA 4EUPA 5I8KL 2RHEA 4NZJA 1JYXA 3MRMB 1BD2A 4XVSH 1U41A 5BVPH 1RULH 1NGZA 2BVOA 3ZDZF 1UWEL 5E8DH 1BMGA 1JUFA 4NNPL 5D7IE 5IEKA 1FC1A 2HAZA 3OG6B 5LCVH 1RZ8B 5FEBA 5KSUA 3VW3H 1QEWA 3KYKH 4XCFL 1LEKA 4U6YB 4KZDH 5ALBH 4MGXA 4JPKL 1WCQA 1BZ9A 1PBYA 1OP5K 1MNUH 1XF3A 4P2RD 3ARFB 1QLEL 5J13B 4MCYB 4U6HB 3KPRE 4HKXB 2DWEB 2X1XR 1IT9L 1U3HB 4U0QB 1RK0A 2EXYC 4NRZA 4AL8L 4QY8B 3TO4C 4N8VG 2E8YA 1MPAL 2I60H 2ADJB 5T5NF 1N4XH 3L7FB 1VGEL 4JN2B 5MHSE 2EDRA 4OLYH 3O4OC 4OGYH 2DQHL 2AEWA 4MX7B 1NAKH 4QYOB 2OK0H 4S1DD 1NH6A 5T5FL 5E8NB 2A73B 3SDAC 3BKJH 3PDOB 1WAAF 2V17H 3ULVL 5K9OA 4LCIL 1EJ6A 3SGDH 1S7VA 1T0NB 4W6YB 3DTXB 1GZPA 3L3DA 3BZFB 4F2MA 5JOPD 1U91A 4RX4D 2NXZC 4MNQB 2N7AA 1M71A 4PRHA 2VDML 3FQRA 1QACA 3QJFA 4PJDA 1AIFB 4XPHH 5DK3A 4FFWD 3DOSA 3O9WA 1OL0A 1NCBL 1S9WB 1Z9MA 1YEKL 1C5DA 4POZD 3T65B 3FN9A 2YUVA 4NQEE 3ISWA 1ZHBB 5BXFB 1WVZA 2XN9E 3IKCA 4QRRE 5DHVH 1DSFH 4X6EA 3Q1SL 5SWSB 4FABL 4LCWA 1NBVH 5CD5D 2NLJB 4W70A 4P0DA 3QUKB 2VUYA 4UQ3B 4KUZL 4EXKA 3DI3B 2P5WE 1E4XH 4ZMAT 1KULA 3E0GA 1MLBA 4ZXBD 4ZYKA 3TN0A 2GK2A 3RY6C 2OI9B 5JDSB 4HCRA 3U2SB 4WHYH 2DLGA 3ZYJA 1YPZA 5FIEA 1J12A 3ARGC 4EI6A 2NY4C 5E1AA 1FE8H 4DZ8A 1NEZG 2P7TB 2GK0B 3C8KB 2WWMD 3BP4A 4C83A 4NKOB 2X10A 1CD9B 1F6AB 3DRQA 4MDIA 1FNAA 3LQAL 2FX7L 2P24B 4GBXD 3CVIH 1JZ8A 4OV6F 4Z0BH 3TBTA 2Q1EA 3QH3B 4RISL 4LFHG 1TCRA 4PJAA 4DJMA 1KCUH 5BRZD 3TZVA 1LO3L 1U6AH 1PKQA 4Z77A 1ZV5A 2W65B 4RBPK 3OPZH 5AG9A 1GVIA 2NY0B 1BFOB 4ERSL 3O6FB 4J8RA 4F7TA 3HA0A 2VUOA 5I1DA 3QDGA 4MJIB 1KPUB 4P3DB 5GS1A 5ISZD 2BNRB 4XVSL 3VE0A 2G9HB 2H3NA 1NGQL 5BVPL 2GJZA 1RULL 5FGRA 1E6OH 2EECA 2FNBA 2XQYG 5DYOA 5E8DL 4HQQH 5DRNB 4OLEA 1NFDF 2LU3A 3WNLA 1Y6MR 5DQDH 2JIXA 3D0VB 5IBUB 5JPMA 3VW3L 1VACA 4KZDL 3KYKL 4YC2C 5ICXB 4JG0H 3U0TA 3MBED 5ALBL 3RIAK 5E00B 4JO4H 3OF6A 1BQHB 4NO3A 1YZZA 2O5XH 1I8KB 1MNUL 5IB3B 4PJGE 3LKOA 2BNQE 1MJJA 1UXSA 1UYWH 3HPJB 5E6IC 3MV9D 1EJOH 1FGNH 3DGGA 3TH4T 3ZE0F