3OJ2C

Crystal structure of fgf1 complexed with the ectodomain of fgfr2b harboring the a172f pfeiffer syndrome mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
KRAPYWTNTEKMEKRLHAVPAFNTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/signaling protein
molecule keywords Heparin-binding growth factor 1
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 209
sequence length 209
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C01
3ILQC 2BMKA 5IVXE 3WO3B 3NOIA 1ZHKA 3D69B 2IEPA 2VAAB 2Q7NA 2FL5B 5CJ8A 4GBXC 1N59B 4F7TA 3PDOA 3H0TB 4EZMA 5I30L 2GK0B 1A1OA 4O51B 1B2WL 2O26U 4PRID 4HDIB 2PYFB 3TN0B 4HKJB 1TCRB 4HJJL 4MQXD 2LABA 3H42H 4XWOC 5CEYA 1D6EB 3OAZH 2IJ0C 1UCBL 1V8HA 2XTJC 5KVEL 3FN9A 3MLTA 3BIKB 1R3HB 4YXHH 1T04B 2GFBB 2ZZUT 1CFSB 2YPLE 3PWLB 2EYTA 4ONGL 5LGKA 1H15A 1T7WA 4EIZC 4M1GL 4H0GA 4UOW0 1D5IL 5BS0B 1KCUL 1JZ2A 1X44A 3C09C 4P9HH 5KAQG 3DROA 1P6AB 5IBTH 2AQ1A 3MV9A 3TBVB 5CUSL 1IEAB 4KAQH 2I24N 4QNPF 4KQ3L 1MJ7H 5GS2H 3D0LA 4X6CA 3AGVA 5SX5K 3QUYB 2CKNA 2X40A 4AK1A 3O3AA 4YHNB 5FUCE 1II4E 1O5DT 3BZ4A 4LBEB 4LSRH 1DSFH 2BJMH 3GSUA 3QCUL 4LPVA 5BMFL 2QQNH 3RNQB 1K8DB 4G8GB 4HIXH 4JDTL 3EHBD 3MX0A 4E9LA 3L1OH 4D9QD 4MDIA 1CVSC 2DLFH 2R0LH 3AMLA 1MWAL 3FRUB 1AHWB 4XVTH 1ERNA 2I60L 2LAGB 5C0CD 2IBZX 5DD6A 4ELMF 3IF1A 3SGJA 2BNUA 2P7TB 3FJTA 4N0UB 5L8KB 3BP7A 3C5ZB 4P5TC 2PN5A 4K7PY 2MHAB 1DBAL 3C5JB 5ILTL 1IGML 3HZMB 2UWEB 2Z8WC 4FS0A 1RZ8A 1YZZA 4TOYL 2R23B 2V5MA 4KDTC 1C5DA 5D7IF 3GBLA 1ODAA 3OKDB 5DJDA 5D9SB 4Z7VA 1FCCA 2OTUA 2AS5M 4PIRF 4NFDA 1EAJA 2ICES 3D5OF 4N90D 4KV5E 4MXWL 3ZE0F 1YEDB 4ELKA 4Z7UB 3UAJC 1UB5B 5DK3A 3REVB 1PSKH 4KZEL 5GGUB 3MA9L 2D31B 4ZUVB 5TFSH 3MA7B 1A6WH 3N85H 1PKQE 3UJJH 2UY6A 3BGAA 3QWOB 5JR1H 2YS4A 1FIGH 5FOBA 4ENEC 1IAIL 1FRGH 1NGQH 4YHOL 2XQYK 1RQ5A 2ORBH 3IDUA 4PGBA 4UDUA 3RZWA 2R9HC 1X5YA 2QL1A 5B3NA 1UCTA 1X6NA 2BX5A 5E4IA 3VRIA 4NDMB 4JKMA 4NUJB 5KN5B 4BZ2L 3TZVA 2XZAH 3OSKA 2R4SH 3SOBH 5D1XB 1OP3H 5I1DB 5EPMB 4O2FA 4WI5A 4Q58C 4IM8A 3QEQD 1HHKB 5HGBB 1AXIB 3RVTC 5H37H 5EOQH 4WFFE 1S5IH 4LLVA 4P2QE 2YPVH 4TTDC 4JQVA 4X4ME 3DI2B 1XGPB 4JM2A 3S5LA 3QFJD 2L7UA 4BJLA 3HRZA 4WGVB 3QIBB 3RWHB 3MUGB 4K23H 2OMNA 1LO3L 1B0WA 1G6RH 1E6OL 2WBJD 4YDVB 1KB5L 1GSMA 2BSTA 2JKXA 3LH2H 3IVKB 1I9JL 3FZUD 3KYOA 1TCMA 4PR5B 1MCPH 3HNSH 1AO7D 2NY5H 3FRPG 4FA8A 2VQ1A 3V0VB 5GRJH 4GS7B 3S37X 1RVFL 4HULB 4OZGF 4Y19D 3MRBA 3FO1B 1UXSB 2E7LA 1CGVA 1NJ9B 2EDQA 2F5AH 4PV8A 4LCWB 1EV2E 1V7ML 4L9LA 5B8CA 5I6XC 1S7WA 3TIEA 4OZIA 3OPZL 4ELMB 3RZCA 3EKCA 5F6IB 1XF2B 2IQAB 5D6CA 4WEMB 4QGYA 3SQOH 1DUYB 5FKAB 5E00A 3X12A 2DB8A 2VXSL 1L9NA 2ATKA 1IC5L 4HUXB 4LPXA 3UX9B 5ACZA 5GGTH 5D7IB 4NQED 3VXUB 1AKJB 1KXQE 2VLMD 2WWMD 4K94L 4Y4KC 4PRAA 4Z0XA 1G9NH 3OJMB 2NXZD 4PJCA 1MWAA 3T0EB 5JQ6H 4K8RC 2PXYB 3GMOA 2XZCL 5C09B 4DFHA 4MWFB 3ULVF 5BZWA 4G6KH 2IFGA 4JFPB 3S36H 1UWXK 1OQXA 5D2NE 3GK8H 4UILL 3P4OB 4WHYH 4J7RA 1FH5H 2BSSB 1RUQL 2I9TB 3RVXC 2R0ZH 3ULUC 2VXQH 2OJZL 1UVQB 1FL6A 1OB1B 1N5YH 4KMTH 3U9UA 1N0XH 1S9WA 3I02B 4HUUA 1VGEH 3D85A 5HYEA 1Q9KB 4QRQB 4UT6L 1MI5A 2DM3A 4CVZB 5E5MA 3RUGA 4CVWA 1KELL 5JA8B 3RWEB 1NFDF 4PJIE 3PP3K 1XIWA 3CD4A 4TUJB 4J12A 3OKEA 4YHIB 1KLGB 3ZTJG 3WIFB 3OAUL 4Y89A 5BQ7B 2EO1A 5CP7A 1F4YH 4ONFL 5D72L 3NFPA 4Y5YB 4BUHA 4FTVB 2NYYD 1RPQA 3JTTA 3DX7B 5DO2D 4IOIB 3CDYA 3NBNA 3OX8B 1OPGL 4ZNEE 1T89C 2EDEA 3V4VH 4U7SA 1MH5B 1RZJL 4Q9QL 2HFEA 1T1XB 2Q6WA 5HHOE 1J9CT 5T3XH 4I13B 4NO0D 1A6TB 1GIGL 1J0IA 1FVDB 2EIBA 1L7TH 1TVBB 1A6VH 4JHAH 4QKXB 3WSQH 1T0MB 4XPAH 4PJHB 1KJ2B 3NVQA 4M02A 4GRLA 1ZEAL 2FH8A 5CEZE 5MP6L 3GFUA 3P77B 4PGCB 4CADB 4LDEB 5HHMD 3G6DH 3QXAA 3TO2B 5I75C 1T5WA 4KGJA 1SYSB 4NO2A 3UZVB 1XEDA 3GMQB 2NPLX 3IKCB 4R7DB 3DNKA 4Y1AE 4UIMB 4KTDL 2APTA 3EO9L 1YEEH 4NO5A 1EIBA 1LO5A 4EOWH 1ZANL 3AROA 3KYKL 4LGSB 1Z5LA 1PG7X 3IFNH 1VACA 5L2JB 1JZ7A 1JZ3A 4RZCB 1S3KH 3BKML 4S10A 4F7CB 4J3OC 3WNMA 1WZ1L 4Y16D 2D7NA 4XP9L 3FN0L 1I1YB 3H3PL 1KEGH 5B4MC 4L3EA 4XB8A 2F5BH 2GTWB 3F7YB 5C0BA 4L3AA 1LVEA 2VDRL 2B2XL 2B4CH 4AEHL 4KUCD 3T2PA 2IH1B 2AW2A 4ERSH 1EO5A 4HK3N 3IJYB 4WV1A 4F8QA 2APBA 1U2CA 2VDPL 2HKHL 1QTYT 3DV6B 1YEJL 4CJ0A 5IIEB 1MRFH 2ZPKL 2EIZB 3E3QC 4M8QA 1BQUA 1A6UL 1UZ6F 1NFDB 1WV7T 2IALB 2R0WL 4U2ZA 4BZYA 2Y1VA 2YXFA 4GRWB 4ZS7L 4UMGA 1GGIH 5FHAL 4X7SL 1TMCB 4HIHB 1TETL 2XA8L 1QSEE 4OFKA 3VE0B 1K5NB 3VFWB 5GZNC 1RD6A 1BFOB 3G5YA 1X5KA 2VLJD 1ADQL 2Z4QB 4L3ED 1NCAL 3IAPA 1YY9D 5C1MB 2R69H 1JWMA 1JTTA 4KRNA 3QFDA 4C83A 1X9QA 3MNZA 1ONQB 4DKDC 3ZMRA 5C07A 5CZKA 1QFUL 3A6BH 1FZOA 3SDAC 1NBVL 3VXRE 4WWID 1DBML 1CGWA 1P7KB 3JV4A 3PV7A 4PP1D 4MAUH 4KMLB 2E8ZA 1LDSA 1U3ZA 3S34L 1H3XA 3CVHL 3HAEB 1T66C 4NQVA 1KSRA 3X13B 1HEZA 1RZKH 1NDMA 1S9XA 3S98A 3KXFB 4Q2ZA 5HI4C 1EMTL 1QSFA 3K2UL 3OGCB 1E4XL 4DEPC 1YNKH 3U1SL 3UBXI 2LV4A 2NXYC 4CN1A 2DQUH 4OD1H 1IQWH 1FAIH 2DLIA 5I74B 4KK6D 1P2CB 4BUGA 3V6ZB 3CXDH 4J3XA 3GMRA 2W9EH 2WM0A 4P59L 1X6LA 1YQVH 5C3LD 4FQXA 1IGYB 4P4KC 4U1SB 3V5HB 3CK0L 2R56H 1NMBH 1I3RB 5HGGS 4NNPH 4G9FA 4V1DE 3KR3L 5LBSH 3OR6A 3VGEA 3VWKD 5IJVB 4LEOB 2QLVB 3HC4H 4BSVA 4JPIA 4X80H 1I7ZB 2CRYA 1MIML 5C0GA 1QSFD 3ROLA 1FFPA 4X6EB 3TO4A 2HLAB 4BELD 3VFTA 4QXUL 5E2TH 4I3SL 5E6YA 2ICWB 4LNVA 4QYOA 1QR4A 1MIEL 1UXWA 2EC9T 4U6YB 4MA3A 3REWB 2FZ3A 2OJEA 3RKPA 4JLRA 4BZ1H 5DYOA 2MQCA 2XTJE 4RMVA 5HYJE 2LQRA 4G6AC 3BAEH 2HVJB 1G6RB 3KPRE 1KCLA 4G9FD 3HG1B 1T03H 1MF2H 5EO1A 8FABB 2X4SA 2AP2A 5DMIH 3W9DB 5CJQL 3MRJA 2Q8BL 1YEKL 1U3YA 3DHJA 1P6FA 5F1NB 1OP5K 3NZ8A 4GUPB 4H20H 4QRPD 3D3VE 3HAEG 2IANB 2OZ4L 3BQUC 5I73B 3DJ9A 5HHQB 3ZSTA 2OLDA 4WU7B 1GOGA 4WW1A 1RIUH 3MJ8A 1JNHB 4JFHE 4Z77B 4L9DA 3VCLA 5KSUA 4K55A 4PYGA 3VI3F 3LD8B 4ZD3H 1FYTA 5HI5C 4GLRH 3GJFB 1MREH 3O45A 2AEQH 3QHZH 3P0YH 4LLMB 2CUHA 4U2YA 1RHHA 4JO3L 7FABH 4PY8J 3TPKA 3C60C 4W6XB 4A6YH 3ZKMC 1AGFB 1J8HE 4XC3L 2FJHA 4Z95L 3RVWD 4FMKA 4PP2B 4G9DB 2XN9A 5KSBB 5HGDA 1DL7H 5K9QI 1AGEB 3GSNL 5TDNB 3BP4A 5I71B 2X05A 4MAYB 4OLUL 4FZEH 3O11A 1XAUA 5E8DL 3QCTL 3V52L 4JFEB 1B3JA 1ZHNB 2AV1A 5HXMA 1NGZA 3QJHA 3GBMH 5IVXA 3GSVA 2A9ML 1AR1D 1FQ9C 4Q6IB 5TF1L 3MGAA 1I7TA 1DBJL 1JV5B 1Q0XL 4GQPH 1HHGA 2MPAH 4M7KH 3VA2C 4D3CH 4R90L 5I16B 2X4OA 1AY1L 4LAQL 3MV7E 4GMTH 4PUBH 3HE7B 5CILL 1NUFA 2Y5EA 3QXUA 3PUCA 2P5EB 4WWKC 5FO9A 3CC5B 1MNUL 1JPFA 3QG6A 3U0PA 1T7ZA 3L95A 4ODTH 3CH8A 1DQLL 4Q74A 4XP1H 2J88L 5AWNH 3RWJA 4P3CH 1IRAY 4S1SL 1JGDA 1BREA 1LWRA 3QEGH 1NUNB 2FX7H 2XN9D 3PWNA 5IMKB 5TPWH 1HNGA 1HSAB 2Z0BA 3SO3B 5JW4R 1KC5L 2YPLA 3C6LB 2H2SC 1V05A 1RSFA 3ARDD 3RVUD 1NBQA 1VDGA 3GIZH 5EU6D 3KPLB 1U9KA 3KPSE 4HAFA 5M94B 1T6WA 3HNTH 2QADD 1AC6A 4LCCA 1KIPB 3BPLC 4FQHB 2ICCA 4CW1A 3PQYD 1RU9L 4OJFH 5JMOC 3BT2L 3CJJA 2NY0B 1HH9B 2MNUA 4LCUB 1T21B 4UINH 2YN5A 1VFUA 4M6OH 3AM8C 3SDCA 5BJTA 1U6AL 2Y9RT 4LRNL 4HWUA 3VXMB 3DXAD 3P2TA 3ZTNL 5D7SH 1U92A 5LWYL 5I1AA 4OF8A 3U4EA 5GS3A 3BD4A 3GB7B 3MZTA 5C0AA 1OTTD 4S2SB 5DJ2A 4S1QH 3CSYB 1X5ZA 3F5WB 1FSKC 2WV3A 4S1RH 4I0PB 4PJFE 5KSAC 2HH0L 4UU9A 1FE8H 5HDLA 3MNVA 3IT8D 3DLQR 1EEUA 3QPXL 2PYEB 4NHCH 4NQDB 4PGEA 2K7PA 2ZJSH 3ULSA 4F37K 1NGYB 3KG5A 2AEPH 4HAGA 3JWDH 2AJ3B 4MJ5A 5AUMB 5FM8A 5L0QC 4KVNL 5MERA 4WFHE 2RIKA 4KQ4H 4CDGC 1MEXL 2FEEL 4YXKL 4YBLC 1IGJB 2XA3A 2VNCA 1QKZL 4JHZA 2M2DA 1OY3B 1XGTA 4O9HL 4K3GA 1QRNB 3N9GL 2OZ4A 1X4ZA 4N68A 1FCGA 4G7VL 4GG8A 3KLAB 1JF5A 1OW0C 3IXAB 4R97C 5C0AD 1P9MC 3DX6B 5ISZA 3A6CL 3TBWA 3O3DB 4FQ2L 12E8L 4MD5B 4UI2A 5DJCA 4EDWL 4EKXA 4RBPK 2CR3A 5CHNB 1U8QA 2O5XH 4XXDA 1XZ0A 1PKQA 1KT2B 3CH1B 3GMNB 2CMRL 3I6KB 2P43B 3IFLH 3QEHA 4IIQA 4PGDB 1AFVL 5EOCJ 5IBUB 1DTUA 4H88H 4PLNC 1YJDH 3IJHA 3VMPA 4C56E 3PNWA 2CJUH 1B6DA 4XP5H 4JFXA 4KROB 5FYLD 1UH4A 1L6XA 3WJJC 4OI9A 3B3IB 4R4FH 1ORQA 2VLRD 2QQLH 5GZOD 1OM3H 3F6IA 2EE9A 1MCNA 3O41B 2BRRL 3P9LB 3PF2A 1AJ7H 2DBLH 3GI9H 3IS0X 4XPFH 1WISA 3U79A 2VOTA 4KZDL 5ISZD 1PX4A 3NIFF 3WFHA 3ULUE 3AC0A 5J11B 2W38A 4Q97A 4HT1L 1BD2D 3AS2A 3CVIL 4JR9H 2AJVL 3WFCH 1GGTA 1CL7H 4P2QA 4ZUTB 2VR5A 4RFEB 5LCVH 4X4MA 1YPZF 2W0KA 5C0RL 4LOUC 3MCKA 3H9ZA 5E2WL 4NQCD 2M26A 4NBZB 4I0KA 4N9OB 1IQDB 1V7NL 1UADC 1FJ1B 1QPPA 4XMPL 4P48A 2F8VA 3D18A 5E8EA 4PBXA 3RRQA 2DYPB 2G75A 4OFPA 3TBYB 4CMMB 1T4KA 4R96A 4FABH 5E8NA 1A3LH 5B3JF 1YYMH 4FQCH 2A0LC 1RHFA 4UDTB 2X4PB 1NH6A 3SKNA 5J56B 3QIUA 1DQDH 3MRCA 4GKSA 1N5AA 3DRTA 3UTTD 4ALAH 1L0XA 4B41A 5C8JB 5E2UH 1RI8A 1YMME 2R15A 5SWZD 4CNIA 3MR9A 1HHJB 3TVMB 3W82A 3FT3A 2HVKA 3TFKD 1TJIL 4OZ4A 3HI5H 2XIDA 1CIUA 3ES6A 2VDLL 4NUGH 4A2LA 3QDAA 5EU5A 1M6OB 4KTYA 3W2DH 3S88H 1HQRA 4K9EH 2J8UF 3ZKXC 4ZQKB 5DRWA 4MCZA 4OZHE 1RMFL 4P3WA 5D1QD 5IBUG 1UQSB 1OAYH 1CF8L 3Q6FA 5DEZA 3QJFB 1C08B 4W6YB 1A6PA 4WCYH 4PJ5B 4N9GB 4NKDB 1JUFB 2SEBB 4POYA 3O6KH 5IFAL 1F2QA 5AYUL 1ZVSB 5D2NA 3I75A 3DVGA 1NCUA 3KPQB 1SEQH 3JWOH 3BSZL 2MSPA 3SKMA 4LP4A 2VC2L 5L2KB 1KUMA 5LXGL 2C4FT 2DJ4A 2C3XA 5IBLD 1WFNA 3MRHB 3BZFB 4XCCL 4M9PA 3UO1L 1QLEH 4WTZA 3HB3C 3NABL 2GSIA 2GTZB 1E4WL 5DUPH 4PJEE 1ZS8A 1TLKA 4GXUN 4QY8B 1URLA 4F80A 4PJIA 5F9OL 3G04B 3DETD 5C08D 4QCIA 3U46A 4MQTB 3QPQC 5KVMC 1KIQB 5FA4B 3SCMC 1KG0B 2YD3A 4NSKB 5T5NG 3QIWB 1YPZB 3TH4T 3SQBA 3O0RH 5T3ZH 3E3QE 2VLKE 4HKXB 1ZA3A 5FUZH 4HS3A 1A7PH 5FM4A 1TTUA 1AD0A 3U82B 2ITDB 4M48H 2NX5B 2VABB 6FABH 5I2IA 1IVLA 3MBED 2FYYB 4ZOAA 2BXZA 3BEVA 3BO8A 1IGCH 4U33A 5I8OL 3DUHA 1A1NA 1EUTA 4H1LH 2IAMB 4QHKJ 5I1KH 5HHOA 3F8UB 4ZXBA 3DTXA 3RY4A 4X9IA 1TPXC 3EDFA 2BNRE 3EOYG 3BYTA 4D0DA 4L8SA 4UV4H 3SDDC 3O9WA 1TQCC 4XCFH 5F3HA 4M1CD 3STLB 4A6YB 4LARH 4LF3A 3MOQA 4Y88A 1NMCC 2YEZB 3UJTH 1J8KA 4JFOB 1NFIA 2A38A 4HUWA 1JN6A 2UZIL 3KPPA 3EOAA 3O8XC 5HHXH 1I75A 5BOZG 1D5XB 4DQOL 3PWUA 2RJMA 4ZFOB 3VRLF 3RNKB 3T77A 3LKNB 1ZLVH 1D9KD 5C0NC 4GKNA 4Y1AA 1I1AA 5E94B 2Z8SA 5E1AB 2J8UB 4R26H 2A6IA 5EBWB 4OLXL 1JGLH 4DGIL 3DBXB 1AR2A 4RAHA 2DLGA 5DURD 3FO9B 4X8XA 1EAPA 1S9KC 3BVNA 3RGVB 1IL1A 4JDZA 5FO8A 3GSQA 4PJXE 1Q9LA 3LS4L 5CMAA 4AM0B 1BQHB 1ND0B 4UTAL 3O9WD 2DQEL 1XF1A 1JF1B 4Q6YA 4KHTH 3QUZC 5LAXB 3OB8A 2I5YH 1DLFH 3D39E 5CP3A 1MCRA 2P42B 3MYZA 4KGLA 4EXKA 3M45A 1CD1A 4GAGH 4YX2L 4HPOH 3FQTA 4WI2A 5K9JL 2C7UA 5IB3B 3D6GA 4KXZH 1HDMA 4CVXA 5FUOH 5A3ID 3TCLA 1I1AD 4N8VG 3IU3B 2D7QA 3LV3A 3P11L 1KULA 4MMXC 1A2YB 2GQHA 3VFPB 4H25B 1A47A 3R4DA 1F4WL 4PJBA 4QHKI 2X10A 3NCYS 5ICZA 1NLDL 5GRWA 3I3BA 1U58A 1U8MA 1OHQA 1T2XA 2DQDL 3KPNA 5SV4A 2YSSA 5CGMA 1Q94B 1QSEA 4KK9C 4M5ZL 5DMYA 1OVZA 4FFYH 4JO4H 5D2LE 5E8OB 3AUVA 4PD4K 2CO6B 1B4JH 1FORL 3D87B 4YHKL 1N3NB 4KKBD 3HUJA 3ALXA 1A64A 1DDHA 3OQ3B 3F12B 4LFHD 1SM3L 3MRQB 2VQUA 2V7NA 4PTUB 4XVJH 1GC1C 3PE9A 1N7MH 1NMAL 2NY4C 3VXRA 4AY0A 5FECA 4LEXH 1BPVA 1A14H 2Z8VC 1JGUL 1MVUA 4JQIH 3WCYA 2HA1A 1FVCB 2JB6B 2V7HA 3KLDA 3QUKB 3ARED 4X7EC 4XNMA 1F4HA 1BGXL 1MQKH 1ORSA 2I07B 4X7TB 4NC1C 3PGCB 1MHPH 1WICA 1AQDA 3BGFB 1MRDH 3I85A 4GAYB 4U1NA 4XP6H 5I18L 3ZT5A 4OIIH 3AVEA 4ZODA 1A7BA 1U3HB 4U3CA 3WFEL 1BJMA 2H26B 2BVOA 4RAVB 4XPHL 1BVKB 4LKCB 1OSPH 3CX5K 4NZTH 5IEHA 4PB9H 5F9AC 1A9EA 1X5IA 2DRUA 3QUML 1NC2B 4JFYB 3OKYA 1S7TA 1XF4B 3QQ3A 4YBHA 3O6FA 2VQTA 4IRSA 4JREC 3VGFA 1K8IA 1J10A 2EH8H 1JFQL 2WLZA 4V1DA 1N6QL 1INDL 2OL3B 1QA9B 1ROWA 5D7LE 3U6RB 4M7LL 2X89A 4BSWA 3RPIA 4BQ9A 5A2FA 4P23B 1HOCB 5MI0B 3L5WA 3EUUA 4GMSH 4KJPC 4M6ML 4JKPH 4OZFB 1RUKH 3WEXB 1UH3A 2PO6D 1YN6B 2FIKB 1XT5A 3EO0B 5IOPA 1UG9A 1MPAH 2HWZH 3RDTD 4ZYKA 4DKAA 2H1PH 1MCCA 1C7TA 1AE6L 5I66B 4AG4H 4I2XB 1CXLA 2V9QA 5CGYC 4X4YB 5ITFA 1QACA 5CBEB 3SDXB 1GHFH 3C2SA 1C5BH 1DQJB 4H8WH 1GZQB 3CFEA 4HUVA 3KPRA 4L8CA 3AAZA 3GHEL 4YFLF 3B9AA 2GAZA 3P0VL 4K3EL 2Q86B 3SY0B 3P0GB 3ARBD 5FA3A 3KJ6L 3HS0B 1TDQA 4HCRA 1Q0YH 4OGYL 1GZPB 1ZLSL 4Y4HD 3K46A 1B90A 3D3VA 2DBJA 3FO2A 3LN4B 2W0PA 3PHQA 3NGBB 2LTQB 3VFVA 1KEMH 1BQSA 1J5OL 3HMXH 5GS1B 5KS9E 4DWHA 4ETQA 4UQ2A 2ZP0T 1R24B 4JJHA 1WGOA 2F53D 5GJTH 3DRQB 2BSRB 3GMMB 5DMGC 2QJDA 3AXLA 2XTJD 1N2RB 3MXVH 4GQ9H 1FN4A 4DN3L 4BH7B 4D0BA 1RK0A 3PXHA 4NO3B 5DK2A 5I30H 2HT4C 1WBZA 3GJFK 5D1ZC 5HGAA 1J8HA 3VJ6A 4MHHI 1B2WH 4K8RL 5ITBL 3HPJB 1FO0H 4H26B 4X5XB 1DQML 5HHNA 3V8CA 4HJJH 1JPSH 3D3VD 4KJQD 3X17A 5FYJD 3K0WA 3BMVA 1UCBH 2NZ9D 3R06B 2IQ9L 5KVEH 2X4NB 2A74A 3KYMB 4OZFG 1TZIB 3ULUL 1EGJL 4M1GH 2YKLL 4KDTA 1K85A 1E4JA 3LKSA 3GJEB 4TTGA 4DGVL 3MV7A 1KCUH 5I76A 1T20A 4QHMB 4XCEA 3V2AR 2DDQL 2IPTL 3BPOC 3L6FA 3UTQB 3G6AA 2DL2A 3QNYA 1F45A 2HT3C 5CUSH 1FC2D 5IB4B 4KRLB 1AC0A 1NC4A 5CKAA 4KQ3H 4QRSB 3MOBL 1HZHL 1ZA6B 3NCYP 3MJGX 4U0RB 4JFDB 4Y5XB 3LHPL 2E27L 4HEPG 3TA3B 3KPSA 2JCCF 4PJDB 3QCUH 1ES0A 5BMFH 2EKSA 1FZKA 4MJIA 2WWKO 5ICYA 4JDTH 2K1MA 3V9FA 3G5XA 4WI9A 4X7DC 2GT9B 2R2BA 3QDGD 3FB7A 5E9DB 3HE6B 4F57L 3ARGD 4ZFZB 3L3HA 4LASL 3MV8E 5F7FA 3RL1B 3I6LE 5DF0A 1IM9A 2FWOB 1L0QA 2HJLA 3ZT7A 3MRPB 3QUYC 4W81A 5GRXG 5DD5L 1KIRB 4FOMA 5DQ9A 2VJXA 4N5ED 1DBBL 3OKLB 4NQXB 2R2HB 4JFQB 3LS5L 2F54B 4JFZL 3WNLA 1ZGLB 4NN7C 1RAMA 4MZ2A 5ILTH 5I19H 4WJ5A 4PJFA 4F7EB 4TOYH 1DUZB 1VFMA 4Q9BA 3ISWA 3HRPA 2XWTB 1WIPA 4Y2DB 1W0WA 1HHHB 1S7VA 5F88B 4MJID 3MRNA 4MXWH 3X3FL 4QRRB 1AHWC 3L5XL 1FFNB 3QWRA 4KZEH 4TSCH 3C6SA 3G6JE 4TNVK 2EYSA 3MA9H 2AKRB 3DYMA 2VZTA 5T1DL 1AP2A 3GGWA 4RIRA 3CGTA 4PRNA 1DVFA 4OUOA 1WBXA 1IAIH 3EO1B 4LPCA 3IJSA 4YHOH 3RVTD 1LNUB 2P8MA 2FIRT 5F7DB 3ZE1E 1JZ8A 1T22B 1EO8L 5JUEL 3SE3C 3WDJA 2W0FA 2H9GA 4IEFB 3H9SE 3D0VB 2M8XA 3Q5OA 1IC7L 3OJDA 4OFYA 2G2RB 4BZ2H 5T1LB 1S8DB 3SJVE 3TN0D 2EZ0D 3E2HB 4HK0B 4L8BA 4PGZA 3ZDXE 1JPTL 1Z9OA 4Y4KA 4CN6A 1NEZB 1H0DB 5TDOB 3QWRD 4MXQC 3O81A 4AIXA 4WEBH 4FFWC 3PV6B 4C56A 2DWEA 2VZUA 3N0PB 3QNZA 4WFHD 4YNYB 1SY6L 4JY6A 1DVFD 5DK0A 5BS0D 4XH2A 4KUZL 3TBTB 2H3NA 1LO3H 1E6OH 4CVUA 4Q9RH 2Z35B 2GCYB 1KB5H 1I9JH 5J6GB 4Z6AT 3QRFM 2YPKB 1JHTB 3EJYD 4M4PA 4HX1B 1C5CL 1EGJA 3FAWA 3TIDA 2BMKB 4OFYD 1Q9OA 1ZHKB 1QLRB 3MBXH 1RVFH 4DZBB 4F7TB 1I8IB 3DO7A 3TJEL 5SX4H 4TQEH 1LO0L 1V7MH 4O2EA 3U36A 3T08A 2BNQE 3QIBC 3FFCE 3PJSB 5BRZE 4MVBD 5CSZA 4C56D 4K8RD 4XTRD 5EBMA 3EYUH 2FECI 2A9NL 1R5VA 1J0ZA 1UA6L 2WSKA 5CEYB 2ERJB 4KKAC 3VFRA 3VXPA 4R9HA 3MLTB 3WE6A 2VXSH 5FGSA 3N1MC 5JQHC 1IC5H 4JHBA 1S7UA 2EYTB 1H15B 1U2HA 3FKUS 4WHDA 5A43C 5EO0A 4YDKH 2BRQA 1EJ6A 1BVLA 3MODL 4K94H 1PDKA 1T89A 3WXVL 1OAZH 2ZCHL 3C5ZD 3DROB 1YMMA 5HPMA 4NC2B 3MV9B 4ODHL 2XZCH 4KDWA 5DMJB 4DN4L 3MLXL 5JLZA 3TLRA 3MROA 4OCMC 4L8DA 3D0LB 4JZNA 1JGEB 4X6CB 4NZUL 4UILH 4ZFFA 4KVCL 4NKOB 3O3AB 4QTIL 4ETYA 3BI9X 3BZ4B 1RUQH 4LCIH 3GSUB 2C1OA 4OZHA 4QOKE 2X9WA 1RIVH 4O4YL 1CGXA 2OJZH 3SKOA 4E5XA 3TPUA 4EQ3A 2V5RA 1Z0MA 1KJ2L 3OXSA 4NP4L 4ORGA 3H3BC 1XCQB 4MDIB 1K2DA 5EUKA 4UT6H 4L5FL 2AEIT 1F11B 4ODVL 1KELH 3HCVA 1DQTA 4B7LA 1FGNL 2R39A 2MTPA 2J6EH 1NANH 5DD6B 1NL0L 1FP5A 3IF1B 1AGBA 3ZE2F 1CXKA 2AK4D 3OAUH 4RFNC 5CZXD 2GITA 3BP7B 5C0JA 4ONFH 5D72H 3V6OC 4LDOB 4N8CL 4XBGA 1BIIA 3MV11 2FR4A 4LMQI 1C5DB 2X4UA 2YRLA 2YHGA 3JV6A 5DJDB 4Z7VB 1OPGH 2OTUB 3SGDH 4TNWK 1Z9SA 1RZJH 4Q9QH 2XT1B 5EOTB 3ZKQD 1RZGA 4G8EA 1GIGH 4AEFA 5INCA 3QB7C 1U0QA 3WKMH 5DGQA 2VLKA 5IB5A 3GIVB 4MB4A 5F96L 2JIXA 5DEGA 4PGBB 2WBJB 1ZEAH 1JNJA 2NY2C 1JPST 4PD4J 4OF6A 2KL6A 5MP6H 2Z31C 3MCLL 5FYJU 2DKSA 3V4PL 1V3JA 4LVOB 3WHE0 3MGOA 2X9XA 1FVEA 3Q0HA 2IH3A 4FRWA 2AXGA 1INQA 4PRHE 5F6HJ 2I26N 1HSBA 3OKNA 3P9MA 4MMZC 4KTDH 5JDSA 1JHKH 2BNRA 3GM8A 3E6HA 2PR4L 1W72L 2OI9B 4O2FB 5JMRA 1DP0A 5FM5M 1SBBA 5IMMA 1ZANH 5HYQA 3KYKH 2R1YA 4LLVB 4HK3J 1DN2A 3OHXA 3OKKA 4HW6A 4JG1L 4JM2B 3SDAA 1WWAX 1KJMA 3VXUD 2VLKD 3BKMH 5F1IA 4WHTB 2VKWA 1WZ1H 2FBOJ 4XP9H 5I8CA 3FN0H 3H3PH 2Y6SD 3M17A 3T0ED 5IHUL 2BSTB 1RV6X 4NC1E 4NQEB 2PXYD 1XH3B 4CL7A 2VDRH 5DRZA 2B2XH 4AEHH 1HYSD 2VQ1B 1Y18A 3L7FA 5EZLA 3MRBB 5D5MF 3CX5J 4PJXA 3MLZH 1I9RL 2VDPH 2HKHH 5IQ7L 5DMKA 1MFDH 1YEJH 4PV8B 2YBRA 3QSKB 2ZPKH 4L9LB 4XBPA 2FHFA 3ULVC 1A6UH 1QSVA 4YXLL 5F7EL 3K7UA 5B8CB 1S7WB 4OZIB 3D39A 4JDVA 2R0WH 4WHCA 4PJGE 1IAKA 3ZYZA 3BKCL 5D6CB 4ZS7H 2DWDA 4KUCF 5FHAH 4X7SH 5E00B 1YA5A 1TETH 3UBXA 3X12B 3IDGA 2ATKB 4Y0GA 2LVEA 1ADQH 1NCAH 1EJOL 2Z91B 3WNPA 5ACZB 2EDJA 1B9ZA 1CFQA 4P9HC 3WMSA 4PRAB 4Z0XB 4IRZH 4OV5A 1MWAB 1WUNT 4L4TA 3WHXA 3GMOB 1BBJB 4FTVD 4K3DL 5FB8A 1QFUH 3U7YL 3MACL 4GJTB 2ICWJ 1NBVH 3VD7A 1R3KB 5BZWB 4ZDHA 1DBMH 1VPOL 2FSEA 2UV3A 5D2LA 2R1WA 2Y36L 3QDMD 3S34H 5IMOB 3CVHH 2AEWA 2N1KA 1FL6B 1J87A 4U7KA 3EBAA 4GW5A 4OFDA 3K2UH 4E41E 1E4XH 1S9WB 3F7VB 3S5LG 3D85B 3FQWA 1CDGA 1MI5B 3RTQD 1P5VA 3U1SH 2P44B 5BXFA 4GG6E 4HWNA 5E5MB 3V5KA 1WCQA 4UZGA 2EYRA 3RUGB 3U83A 1PBYA 2G9HA 4XZUA 1XIWB 4L4TD 3BQUA 1W8OA 2ZUTA 1Q9WA 3OKEB 3X3GL 4I18C 4NGHH 4P59H 3SE4C 3MRKA 5HHMB 4JPKL 1YN7A 1Z9MA 4R4BA 5CP7B 2YWYA 1KCVH 1IGTA 3CK0H 3NFPB 3V5DA 3VDCA 3ZYJA 3JTTB 1HKFA 4HHAA 2X44D 3KR3H 1RZ7H 3CDFA 2A6KA 2ZG3A 4G6AD 1UJ3C 5T5FL 3FQXA 1OL0A 2YC1A 4MXVF 1CI5A 3LKOA 1SQ2N 5FV2A 5HJ3A 1MIMH 3C60A 4UNUA 3T2OA 2IGFL 2HFEB 3IFOA 5EZOH 4DZ8B 4NQUA 1TTGA 3WUWA 1H8OA 4U3HA 1W72A 2DTSA 1MCEA 2HLFC 2NW3A 5D5MB 1VB9A 1W0VA 4OM0L 4QXUH 5JXAL 4I3SH 5E6ID 5AZEL 2UVFA 4PJ8C 1MIEH 2CH8A 5FYKD 1BF8A 3CMOL 4HEME 2QHLA 2ICWI 5GQBA 4DOHB 3QXAB 1T5WB 1T80A 1KB5B 3ARRA 4NO2B 3CNKA 4EDXB 2ZKHL 5HI5D 4WWKA 2HJFA 5D7JC 5FGCE 5FYLH 5C0IA 5CJQH 1LE9B 2Q8BH 1YEKH 1OLLA 5CD5C 4NO5B 1LO5B 5CCKL 5J12C 4GXUM 4APQA 3WDHA 2OZ4H 4WUUE 1JYXA 1PZUB 5L8JB 1NGXB 1MFEL 5JPMB 5IW6A 4NOFA 2WINA 5DR5H 3KHOA 2VR9A 1OSZA 4LLWA 4I77L 4KY1H 1HHIB 4L3EB 3LRSA 2NY5C 4IMLA 1F6AA 9CGTA 4F33A 4JO3H 4HWEL 2J8OA 1PYWA 3U0TA 1F13A 1S9YA 4Z95H 5C0EA 5I73C 4WV1B 5TE7L 4U1IA 3QO0A 5J57B 3AM8A 3GSNH 1MFAL 1KNOA 4PTTB 5KS9A 4OLUH 1EFXA 3LQAL 4M8QB 3QCTH 3L3OA 4APQD 1E4KC 3BPNB 2OK0L 3IYLW 5ID1A 1LE5B 2A9MH 4G8GE 5TF1H 1DBJH 1Q0XH 1T6VN 4P46C 1PJ9A 1CICA 2EDXA 4JQXC 1AY1H 4LAQH 4CKVX 2I9LA 3Q2CA 4G6JL 5DZLA 2NR6D 3BUYB 1MNUH 3T4YA 3RL2A 1G9NC 5J3HC 1DQLH 4LHUA 1WIUA 3O3EA 3QFDB 1I85C 2J88H 4MAYC 2DQTL 4C83B 3MNZB 2DIAA 4ODXA 3EYVA 4FXGA 1T5XA 2H6PB 1KC5H 2P4AB 4AMKL 2C3VA 2XG5A 1G7LB 2EXYD 3QULB 1Q38A 4EBQL 4XC1L 1P84K 1U8PA 4FXKA 4Q6IC 2UWEE 4OGAC 4PJ7E 3NIDE 3OAYH 4EN3D 4X7FC 4QHLB 1OW0A 3JVGC 2NNAA 1A6ZA 5TDPA 3JV4B 2W59A 3JUYA 2HP4A 1P9MA 1LK2A 2N4IA 1S7SA 5I1LA 1WITA 4XAWL 3ROOB 1KXVC 3MRRA 4NQVB 4R8WL 5E8PA 3W5MA 1RU9H 3P73A 1HEZB 3BT2H 1CICD 2KZ1B 5D96B 1NPUA 3TP4A 2ADGA 4Q2ZB 1QSFB 5FHBL 3CZFA 1U6AH 1CDUA 2HTKC 4EUPA 3UTSA 3SO3C 2PW1B 3C6LC 3DVNA 4LHUD 5GGSA 1H9VA 1P7QA 5EZIL 3ZTNH 5LWYH 4YIQB 3DIFA 1KJ3L 3WFBH 5EO9A 1TITA 1D5ZA 4JRXD 2VITA 1HCFX 4PRDA 3WJLA 4QTHA 3MV8A 4U1LA 3S4SA 1T0NA 4G9FB 2MQ0A 2FGWL 1BZQK 3OR6B 3QPXH 4RDQF 4O02L 5IHLB 5IG7A 4JPIB 1SJHB 3QH3A 1D7FA 3WLBA 1QYGL 4JFFE 1ZLUK 4KVNH 5C0GB 3ROLB 5DI8A 1FFPB 1MEXH 32C2A 4YXKH 5E1HB 5FDWA 3BE1H 4OLZH 3UTSD 1QKZH 1JCKA 1VADA 2J12B 4O9HH 3N9GH 2JJSC 3S97C 4QYOB 4G7VH 3BHBA 4MA3B 2MFNA 1DLHB 3VXSA 3MQIA 2FZ3B 5D7KE 1S78C 4NRZA 1A7QL 4JLRB 12E8H 4XVUC 5DYOB 5M7QA 1NBZA 4NJAL 3FT2A 1UGNA 3B5TA 4MA1B 4HG4K 3G6JA 5GSVB 1HK6A 5GGRA 1NBYB 2BVYA 2X42A 3PL6D 5ALBL 2CMRH 2VB5A 4Y5VC 1AFVH 5AG8A 4JFED 3H9HA 5EO1B 2X4SB 3NA4A 4BQCA 1NAML 3VMOA 2APFA 3NZ8B 3H9SA 3FCTA 4ELME 1TQBB 1CK0L 5KVDH 1UYWL 5EOCH 1UWXH 1F3JB 3HE7D 2BRRH 4WW1B 3SDYL 5IMLA 3MJ8B 2FEDC 1HN1A 3ARSA 3VCLB 3KLHC 4AQOA 1OGAD 5ERWA 4TVPL 3VXSD 1WBYA 1FYTB 1Z6JT 5D7IE 1U8NB 4IHOA 2KQMA 2VISA 3WNNA 4TRPL 3O45B 4WENB 4HT1H 3CVIH 2A0LD 2ZSWB 1RHHB 1EEZA 5L88L 2AJVH 4HZLA 2DQIL 5C0RH 2MWCA 2FJHB 5E2WH 5C09E 2AJUL 3DMMC 2XN9B 4ZSOB 1CD8A 1V7NH 3LB6D 1DJSA 3BP4B 3PP3H 4XMPH 2R4RL 3ARDB 4MDJB 5ESVA 3O11B 5EU6B 2FX8L 5GRVL 3EIFA 2AV1B 3QJHB 3BP5A 1IC1A 2ARJA 3R1GL 3V6OE 3B4NA 5J11C 4MX7A 3EOTL 4OLYL 4C57C 1B0GA 1Q1JL 4AL8L 5EU3A 2AXHA 4GKZA 2X4OB 4CDHA 4M61A 5FO9B 4TUOA 5EIVA 2BNQA 3QG6B 5SWSE 3U0PB 4UB0L 5BW7C 3L95B 2ZUQB 3FFCA 5BRZA 1F97A 4P3DA 5IQ9A 2HTLD 3NN8A 4CMHC 3OF6D 3RWJB 2JJUA 4I0PD 1TJIH 3I9GH 1JGDB 2BP3A 1HWHB 3GBNH 4F58L 2B8OT 4TVSa 4POZC 3PWNB 4LMQE 3UTZA 1MJ8L 4HJ0C 4YHZL 2VDLH 1CGSL 2GJZB 3K81A 1ED3A 4X4XA 1KBGL 4TSAL 3MPCA 2IADA 4HIJA 4MCYA 4NQDD 5FYKU 2DQGL 1GRWA 5IUSA 4S0SD 2YR3A 3GI8L 2CXKA 1FGVL 4LCCB 1CF8H 1RZKC 1EFQA 4CW1B 1GGCL 2QSVA 4O2CA 1QRND 4QRTB 3UXFA 4OZGE 3EYFB 5JO5A 5IFAH 3UTPE 4NHUA 2EDRA 5AYUH 3SDDA 4PJAF 3SDCB 5BJTB 4X8JA 2FNBA 2JB5H 1CE1L 4LIQE 4EI6A 1REIA 1IE5A 1U92B 4QOKA 3U4EB 5C0AB 1RUPL 2VC2H 3O8XA 4K7FA 5MEOA 5LXGH 5DJ2B 1CBVL 5IWLC 5EC2A 1QFPA 3I2CL 4XCCH 3UO1H 4DW2L 5ADPH 5EA0L 1U8KB 35C8L 4GW4A 4UU9B 3GSRA 3NABH 2H41A 2AJZA 3MNVB 1E4WH 4HMEA 4LLQA 4KROD 1I1RA 4BK5A 5F9OH 4PGEB 4NYLA 4WNQA 4Z5RA 1NFKA 4KRMB 5EZJA 3ULSB 2YD1A 1ZE3C 4MJ5B 1KGCD 2X4QA 4NM8H 5MERB 3ZKNC 1S9VA 2CIIA 2VLRB 2NLJA 1NAMA 3W11C 3ULVE 1XGTB 3QUZA 4JRWA 1CXHA 1D5MA 4GG8B 4OQTL 3EDKA 3QXTA 1UEMA 5ISZB 1RURL 3TBWB 3VW3L 2NY1B 4RA3A 5DJCB 5I8OH 1BD2B 1X4YA 4QF1B 2ZUXA 3UYRL 3VH8A 1XZ0B 1PKQB 2IWGA 5EG6C 5DQDL 1LEGB 4NRYA 3QEHB 1L7IL 3QP3A 3QIWC 3QZWG 4IIQB 4NQCB 2OYPA 1GCFA 3MTRA 1D6VL 2DYPD 4QWWD 4GLRI 5SWQA 1MFBL 3IJHB 3VXQA 1NFDE 3PNWB 2UZIH 3ARVA 4X9BA 5JNYA 1BWWA 1ORQB 5HI3D 4DQOH 2PKDA 5C92A 2P5WD 5HVHC 4PRHA 2B5IB 5FEBA 5EWIH 1L6ZA 2W0LA 1XGYL 3TVMD 1JYVA 3WFHB 3UTTB 4TVPD 3V6FA 5GGQH 2NQCA 2APXA 3AU1A 4P2QB 3LS4H 1XR9A 4QXTB 2CLVB 3RKDC 3HI1A 2BVPA 1VEOA 3MCKB 1GYAA 4UTAH 5ESAA 1PG7L 3ECBA 2DQEH 1G84A 1IAOA 3SEPA 1PZ5A 2CIKB 2J2ZA 2C1PA 3D18B 2BOCB 3B2VL 5E8EB 43C9A 4YX2H 2Z92A 4PJ5D 5D1QB 1NCWL 2KQNA 3WKNA 4X6BB 1UT9A 1T4KB 3EOBA 4L4VD 4C59B 3NZHL 5K9JH 3FHQA 2HKFL 3KXFE 4J4PD 5JZ7D 3RGVC 2BDNL 5F9DC 3MXWL 1INEL 2YN3A 5K9OA 2DQJL 2X1XR 3IDJA 3P11H 5FYJH 3MRCB 4GKSB 1M1SA 3DRTB 1F4WH 2YUVA 1K4CA 4J3UA 4OAWA 3RVVD 4CNIB 4AEIL 3MR9B 5HYSA 4JCLA 3FT3B 2HVKB 5EUOA 2A1WL 3J8F7 3KNBA 4ZUUA 2DQDH 2BFVH 3OR7A 1Y6KR 4YGVA 4U1KA 1G1YA 3ES6B 4M5ZH 4OV6F 4PY7A 5EU5B 3PIQA 2AERT 2PCPA 1HQRB 4K7PX 4Z8FL 5DRWB 2CPCA 2HYMA 4MCZB 5MENE 1FORH 3THML 4YHKH 3WN5B 1FG2A 4R4ND 2VUOA 5EFIA 1PW3A 2EE2A 3Q6FB 2VIRB 1E28B 2VRAA 3WIIL 4UTBL 2M1KA 1R3IL 1SM3H 1R3LA 3T09A 5DRXA 1NMAH 2JJTC 2NX5D 1JGUH 1ZAGA 4OT1L 1NLBL 5D2NB 3I75B 3DVGB 5JORB 5BOPA 3O6ML 3MLRL 1UZ6E 2A83A 2IAMD 3DX8A 3SKMB 2UUDH 1UEYA 4RAUA 4G6ML 4JN1L 2NY6C 4OQTA 3RIAF 2OR9L 1DEEA 1KTLB 3R0MA 4OLWL 5DHVA 1TVDA 4XI5C 5I18H 2HFGL 4GG6A 4X6DF 1YEFH 4NM4H 2GSIB 3WFEH 3X14A 25C8L 1KF9B 1ZS8B 3EZ8A 4PJBF 4XPHH 1G7MA 3BD3A 2EXWC 3TBSA 3DECA 3JWDC 1BQLL 4QCIB 3U46B 2DJUA 2IANE 3TEUA 3L9RB 5C0FA 1HXMA 3QUMH 5JW4Q 1QLFA 5KTEL 3G9VA 4JANA 3EDDA 4FFVC 1ZA3B 4PJ9C 5KJRL 4KFZC 5FM5O 4HS3B 4DUVA 3BIAX 4F2MA 1AD0B 1N6QH 1JFQH 1HKLL 2E9WA 1NUDA 5I2IB 1INDH 2UZXB 3LDBB 1U3HC 4K3HA 3HUJF 3BEVB 3BO8B 1FNHA 2WP3O 4KI5E 4M7LH 1FL5A 5DURB 4M6MH 5D1ZA 3HMWL 5JHLL 3QI9D 4MB3A 5HHOB 4P2OC 4XRCA 3GRWL 3DTXB 1FNFA 4D0DB 4PLJC 3EJJX 3O9WB 5F3HB 3K4DA 4WI7A 1AGCA 1P84J 1YJDC 2GY7B 1W8NA 4RRPA 4LF3B 1FNGA 2Y07L 1UKSA 1NFIB 3EJZC 4HUWB 1JN6B 3STZA 3KPPB 1CL7I 3EOAB 2IC2A 5FGBC 2DI8A 3MRLA 3PWUB 3S96A 4N1CA 1QBML 3GHEH 2WUCL 3T77B 5C9JA 5AAMA 5MI0C 3P0VH 2WWKT 4K3EH 5DMGD 1MFCL 2BY1A 1WC7A 4Y1AB 1I1AB 1JTOA 4DKEL 2VXTL 3LZFL 2P5EE 4OCLC 3CU7A 4RQQB 2A6IB 3KJ6H 1SHMA 4HXAL 4NQSA 4OGYH 1TCRA 1EAPB 3G5ZB 4WUUA 1BOGB 3BH8A 3N06B 4CN4A 1IL1B 4JDZB 5FO8B 3GSQB 1YYLH 2AJSH 2XY2A 3MMEA 1D6EA 1Q9LB 5CMAB 3Q6GL 1R3HA 1CFNA 1U8IA 2GFBA 4RGND 3PWLA 4YH6A 2HRPH 4UT9L 1CU4L 3L3GA 3LRGA 1CD1B 4GRMA 4DN3H 2PTVA 1H3PL 1OAKH 2XTLA 3LEYH 2FDBP 1MCBA 2X4RB 5LGHL 1CD0A 2R2EA 1Y6NR 4OLVL 2EECA 5DDHA 4TPRL 3QA3A 1HDMB 4CVXB 4K8RH 3GO1L 5I1CH 3TCLB 5EBLA 2VTFA 5CBAA 2BVTA 4MSWA 4R3SA 1U93A 3LV3B 1A8JH 4NCC2 1KCSL 3NGBC 2XFXA 3QUYA 1DQMH 2LTQC 2IPKA 4OB5L 3RU8L 5GS1C 3VXME 4WFGD 4PJBB 5ICZB 5DC9B 4B50A 1J7VR 2IQ9H 3X11A 1U58B 1U8MB 4FFZL 5IW3A 5TE6L 3RNQA 3KPNB 4G8GA 2YSSB 2EC8A 4H0IA 4D8PA 1EGJH 4HG4J 4AH2B 1QSEB 5ANME 4DGVH 4K9EC 4NOBA 3TT3L 5E2VL 2E7BA 3FMGL 4ZTOL 2DDQH 3VI3E 2IPTH 4UOW1 1AHWA 2VDML 2VSDA 2PYEE 4J3TA 3HUJB 4LHJB 3B8SA 4WW2A 3TV3H 4MD0A 1ZWIA 1DDHB 2Y7QA 3F7RA 1DE4A 1I9IL 2FD6L 1CCZA 4FHBD 3MOBH 3ZZ1A 1HZHH 1CG9A 3MO1A 1H3UA 3Q1SL 5FECB 1RJCA 1MVUB 2UWEA 4PJ7A 3LHPH 3SE3A 2E27H 3T0WA 3JWOC 4P23D 4MLIA 4XNMB 3OKDA 4DKFL 1WEJL 1JMZA 2IBBA 1ORSB 5AD0B 4XWGL 1F4XL 4J3SA 1G1CA 4KK8D 1LO4L 1AQDB 5F1KC 1YNLL 2EE3A 4D9LL 5GGUA 2X09A 4F57H 4LASH 4ZUVA 5GS0D 5C9KA 3OB0K 4N0FA 4I1NB 4LRIC 5DD5H 4YFLI 2QHRL 4OCRL 4U0RC 3ZLQC 1DBBH 3G08A 5IEHB 4NNXB 4W70A 3LS5H 2QEJA 4JFZH 1Y6MR 1A9EB 4NDMA 4MZ3A 1ZKAA 1GPOL 4WEUD 2QV2A 3WL9A 1S7TB 1IT9L 3MRMA 3QQ3B 3O6FB 4IRSB 2ARWA 1K8IB 5KAQF 1ZVHA 4J8RB 3QUXC 1MQ8A 4V1DB 3O3UN 5HDQL 3X3FH 4AENA 3MLSL 3L5XH 3ARBB 1M4KA 2Y23A 1ZVYA 4XPBL 3RPIB 4BSWB 4JFFA 3L5WB 3MJ9H 4NZRL 1NCBL 5T1DH 3ALWA 3OGOE 2AV7B 1XGPA 3ZTJH 1CLYL 3EYOA 2PF6A 4KJWC 3BDYL 3RWHA 1KTRL 4RMSA 1EO8H 3IKKA 5JUEH 5I8EB 4ZYKB 1YNTA 1HE7A 4Z7NF 3MUHL 1NKRA 3J7HA 4IJ3C 4WRLA 1LO2L 4Y2DC 1IC7H 3KDMA 2XTJB 4D2NA 1IGFL 3ALPA 3IRZA 4BFBD 3CFEB 2LFGA 4L8CB 3AAZB 3FO1A 1JNNL 2GAZB 1NJ9A 1JPTH 5DHXB 3MJ7B 3O6LL 3C09B 1FBIL 4X9GA 5JHDE 1Q72H 5FA3B 2UYLA 3U30B 3H6JA 4JFFD 3ULVL 5DWUL 3D3VB 2YMXH 2OM5A 3H42L 1SY6H 4KXZI 2IQAA 3VA6A 3FO2B 2H2PC 4RMTA 3PHQB 3VFVB 3MOAL 4OCXL 1FNSL 4ETQB 4HMCA 4UQ2B 5D7KD 3VFMB 5D6DC 5D7IA 3H3KA 1GAFL 3E2HC 5BCAA 5I1GL 3AXLB 4G5ZL 1C5CH 4LHQB 5ACMA 2DS4A 2V2XB 1FN4B 15C8L 2QKIA 3ILPA 4D0BB 1I9EA 1RK0B 4HV8A 1CDJA 4AZ8A 1PLGL 5DK2B 4P2RE 1WBZB 3FB8A 1KENL 3TJEH 5KZCB 4JFDD 1LO0H 4KAQL 5HGAB 3VJ6B 1BFSA 4JY5H 4XAKE 4M00A 5DVMA 4JFPA 1A7OH 3P4OA 5HHNB 2A9NH 3PXJA 4M6NL 5J1AA 4RGOL 1UA6H 3QQ9D 5E9DD 4DVBB 4TSBH 5KBNC 3PG2A 3V6OA 5L2KE 5KSVB 3CSBA 2DM4A 5LGJA 1DCLA 3QDGB 3LSOB 4NWTL 4CBPA 3SPVB 3I02A 3K80A 2Q7YA 3MV7B 5I76B 5FO7A 3MODH 4XCEB 3KS0H 4U6HA 4WFED 3FFDB 5SWSA 2ZCHH 3L3IA 3NIFE 4P99A 3RWEA 2F54D 1G7IA 2ED9A 3QNYB 4ODHH 4DN4H 1HWGB 3IU4H 3MLXH 1CGYA 4MNQE 1NC4B 1I7UA 5ACLA 4F37F 2P47B 2ERJC 4HH9A 1YPZE 4NZUH 2AI0L 4YEFA 4KVCH 3CU1A 5DFTA 3BW9A 2ESVE 3EHBC 4IOIA 2Z31A 3KPSB 5TQ0L 1QD0A 4O4YH 3ZT6A 1ES0B 1FZKB 5I0ZA 4MJIB 4R2GD 1KJ2H 4NP4H 3G5XB 4OM1L 4YBQD 1L9MA 2R2BB 4E42A 3FB7B 5C0DB 5JXEC 1MY5A 1PSKL 5B3JE 1J0HA 2F8XC 1PFCA 3L3HB 4Q0XL 4OZGA 4L5FH 1WZKA 4ODVH 1BZ7A 5F9WC 3V7MA 5DFWH 2HJLB 1FGNH 1TVBA 3BN9D 3PWPD 4Z7UF 1ZSDB 1NGQL 1U41A 5DQ9B 5T1LD 4M5YL 2X9YA 1QO3B 4PGCA 1A1MB 3VFNA 2AJXL 4LSTH 4N8CH 1XR8A 4WJ5B 4PJFB 2XZAL 4P2CG 1LK3L 3LCYA 5LQBL 1W0WB 2J8UE 4KPHL 3MRNB 3C6SB 4FNLH 5FYKH 2Z8RA 1S5IL 5L2JA 4XNYL 2YPVL 1AP2B 3GGWB 4QEGA 4RIRB 1DVFB 1KPUA 1WBXB 2VWEC 3BD5A 5F96H 3NA9L 3KGRA 4F7CA 2P8MB 5F97E 1BWMA 2W0FB 2H9GB 3MCLH 5EIIA 3T04D 2DMBA 3LH2L 3CFCL 5DGRA 4H8WC 5T1MA 3OJDB 3IDMA 1OD7A 1T7XA 4V2BA 3SE8L 1AD9B 1FHGA 4RMWA 5T33L 5E70A 4EQ2A 4GRWH 2PR4H 1W72H 4Y4KB 1UB6A 1X5AA 2EIZA 4IMKC 4C56B 1NFDA 2IALA 2CRMA 5D70L 2DWEB 2WBJC 2DD8L 1RK1B 3QNZB 3WLWD 4JG1H 1RUMH 2YZ8A 4HXBL 3FZUC 4JY6B 4LVOC 4WGWB 1VCAA 5DK0B 3ULVD 4XH2B 5IFJB 3CPLB 3GM0A 2H3NB 3VE0A 3U48A 2DKUA 1BFOA 1XF5B 2H32A 5IHUH 3ARTA 4BQ6A 4NN5C 3MV9D 5GGTL 3VG0L 4HF5L 2NY3D 1YY8A 3TIDB 4LLYB 2YRZA 2B7DT 4HLJA 4I0CC 1D3CA 1Q9OB 1IEHA 2B0SH 3HAEH 3NPSC 4ZUWA 1BZ9A 5JQ6L 4BQBA 1UWEL 4JQVC 3SGKC 3BDXA 3UZQA 1M7DA 3U36B 4CUCA 4YXLH 5F7EH 2R8SL 3ARFA 3V4UL 5CSZB 5JW5B 3DARA 5I9QC 5DHYA 4I9WD 5EBMB 4OF5A 4I18A 1R5VB 3SE4A 3BKCH 3MYJB 3EYQD 3VFRB 3VXPB 2WWMC 3X13A 3WE6B 5DA4A 3VGAC 1YUHB 4N0CD 5DQJB 1AXTL 1S7UB 1V3MA 4LAJH 2NXZC 3VRLE 5EO0B 3T0BA 3OAYK 1BVLB 2O5YL 1UJ3A 3BH9A 1J0KA 3MSPA 2P49B 3V6ZA 5HPMB 5C2BL 4K3DH 2C5DC 1CGUA 5JLZB 3U7YH 1LEKA 2AK4B 1NCCL 4L8DB 4JZNB 5EC1A 4JJ5A 4PJ8A 1F4YL 1KACB 1VPOH 3ARFD 3S6CA 3K3QA 4ZFFB 4FP8L 3JWNC 1SJEA 2Y36H 3CSPA 4NFBA 1QBLL 4R0LB 2C1OB 4OZHB 5MENA 2ENYA 4IOSD 3TYFA 4YC2C 3SKOB 3TPUB 2PETA 4ORGB 3OXSB 3WBDA 2BOBA 4X6EA 1K2DB 5EUKB 2MJWA 1BJ8A 2FGZA 5D7JA 4HS8H 3B43A 1EVTC 2ICWA 3HCVB 2YK1L 4K3JL 4OGXL 3UROR 4JHAL 1T83A 1UM5L 2NYYC 4I2XE 3X3GH 1AGBB 4YDLB 3TZVD 3GDBA 2JK5A 5DO2C 1XGQA 1VESA 4JPKH 1CVRA 2GITB 3G6DL 4MS8D 3TH2T 4JHWL 4XBGB 3EYSL 2FR4B 2X4UB 4LKXB 4PJHF 5IJKC 4GXVL 5DJ0A 2XZQL 3JV6B 8FABA 5T5FH 4YZFF 3EDJA 3W9DA 2H8PA 5C71A 1JZ5A 4YHLL 4JM2D 1N64L 2IGFH 4EOWL 3GJFH 3KYNA 2IANA 2R0KL 1RZGB 2F58L 4NBYB 4OM0H 3IFNL 1YC7A 1AH1A 5INCB 5D7JD 2ICEA 4JAMA 5AZEH 2EIEA 1BM3L 4Z77A 5IK3B 1CXEA 4JO1L 2VLKB 5F1SA 5IB5B 5FV1L 1MHEA 1S3KL 1E4KA 5K93A 2DOCA 3TF7C 1FG9C 2D7OA 4P46A 3FB6A 2IH3B 2AXGB 4JQXA 1INQB 1HCVA 2ZKHH 2KPNA 5GGTA 1M7XA 1MLCA 2XKUA 3DX9A 1HSBB 3FQRB 3OKNB 3GSXA 3P9MB 4G9DA 5BO1L 3RWGA 3ZL4H 5JDSB 1LP9E 2BNRB 3E6HB 3RZCD 3BRFA 1GVIA 2E9IA 3FB5A 1MRFL 1I85A 4MAYA 3T2QA 5CCKH 5IMMB 2D0GA 2XKNA 1ZTXL 5HYQB 2R1YB 3I6GA 4Y16C 1SEBA 1MJUL 3B9KA 3OHXB 1J12A 5DS8A 3SDAB 1MFEH 5SX4I 1U8HA 1KJMB 3L3JA 4O00A 4Q6IA 5F1IB 3JVGA 4Z9KB 5I8CB 1I4FA 1KXTB 3IETB 4W4NA 4ZUSA 3M17B 1JRHL 1YMHA 2P5EA 4KI5D 1BJ1J 4P46D 2R69L 5DRZB 1HINH 4HWEH 3O4LE 1MLBA 4GRWF 5ICXB 4LCYA 2CLRA 1Y18B 1PEWA 3L7FB 1VGKA 5IW1A 5EZLB 3TWCL 4PJXB 2EDTA 4BFEA 4DEPB 4QHUB 5DMKB 1HSAA 1MFAH 2ZSVA 2YBRB 3LQAH 4XBPB 1PEZA 1W0YT 4JY4A 2A6JA 2OTPA 4KTEH 4M43L 5TJWK 4JDVB 3QDMB 4HBCL 2OK0H 4CGTA 3B9KD 1MSPA 1EXUA 3D85D 1YY9C 3LN9A 2CLZA 1MI5D 5HTSA 4PLOB 4OGAD 4LSUH 4B7IA 4YQXL 3IDGB 1HH9A 4G6JH 1T0PB 1T21A 4B0MM 5CJXC 1EZVY 4FQLL 1XIWD 4K94C 3RTQB 1CFQB 5MHSD 1A7RL 3RIAK 5D93C 5INDA 3VXMA 1MCIA 2DQTH 2N7AA 3DVIA 4OV5B 2CRZA 4L4TB 3GKZA 3WHXB 3OBAA 4PP1C 2W9EL 5H8DA 5FB8B 4AMKH 1YQVL 4PRPE 4EBQH 3CIQA 2OBGA 4WVRA 4XC1H 5A2IH 4RA0C 2VDKL 2BVQA 1U95B 4HJGA 5ANMA 5D2LB 1WCBA 2R1WB 5IKCB 5IVOA 5J1SC 3K8MA 1VEPA 3UPCA 4XAWH 5HVWA 1NANI 4R8WH 1IILE 2PYEA 1CT8A 1X5XA 2BY0A 5FFLA 4GW5B 3NFSL 3HFMH 2Y25A 4Y5VA 5FHBH 3FQWB 3M1BA 3FO0L 5BXFB 2D0FA 1WK0A 2PTTB 1G7PA 1QBAA 4GRLD 2Q20A 2EYRB 5E6IB 3V5KB 3ZDYF 2G9HB 3RP1A 2CDFA 5EZIH 2V2TA 3KJ4B 4U6VL 3SGDI 1IGIL 1TNMA 2CK0H 1Q9WB 3IXAA 4BZ1L 2B20A 1KJ3H 3MRKB 4YDJA 4YPJA 3VWKC 1C1EL 4R4BB 3A67L 4U6XB 3ELAT 1IGTB 5CHNA 1PY9A 5D96C 4PFEA 4WY7L 3QXDA 2NZIA 4HHAB 4RFOL 2FGWH 4XVUD 3I6KA 1ZMYA 2A6KB 4O02H 1P4LA 3LN5A 1T03L 3MLWL 2CUIA 5IESL 4PRIE 3FQXB 1RZJC 1KB9K 2YC1B 3CSGA 2I25N 5I8KL 3LKOB 1QYGH 5HJ3B 3C60B 1G7JA 1QFWM 2ZUVA 2A73A 3WUWB 4U1GB 1W72B 4QHNA 3DMMA 4KKLD 2NW3B 4MA7L 3B3IA 3UBXG 1A9BA 3PWJA 1ACZA 3O2VL 3P9LA 2R2CA 1RIUL 2XICA 2EDHA 3FOMB 3QR2A 5C0BD 5C6TH 5D4QA 1A7QH 1L0YA 2ZCKL 4KHXL 4CRPA 1H8NA 2JCCE 1EK3A 4I5BB 5BZDB 3TNMA 3MCG1 3OKOA 3KLHD 2AABL 1R0AH 1QRKA 2B39A 5JA9A 3A0OA 5CFHA 4G6FD 5ALBH 4D9RD 2DQFA 3UDWA 3PABA 2AGJL 2HJFB 5EORH 3NACL 4IOFD 5C0IB 5BW7A 1FL3B 4NIKB 1IQDA 4WU5A 4MNGE 1A21A 1NAMH 2RCSL 2ZOLA 3ET9F 4APQB 4JCMA 5CJOL 1CK0H 3DMMD 1UYWH 1LDPL 2ITCA 3SDYH 5KSBF 4ZO9A 1OGTB 2CSPA 4MA1C 4L3CA 5IW6B 2WINB 3JTSB 4GW1B 2MPAL 3DHMA 4TVPH 4D9QE 4LLWB 4D3CL 5F72S 1KCRL 3LRSB 3BWAA 4TRPH 3RVWC 1SBSL 5JHDA 3IRPX 5C07D 1MCWW 1F6AB 1P53A 4F33B 5L88H 5C0CE 3VFUA 2DQIH 4P4RA 1PYWB 1S9YB 3S35X 1RY7B 5C0EB 1TJGL 1TQBC 4U1IB 3QO0B 5B22A 2OS7A 2YUZA 5TPWL 4HBQA 1KNOB 2R4RH 5KS9B 1EFXB 1AR1C 1O7SA 4EN3B 3WXWH 3L3OB 3GIZL 2FX8H 4OIAA 4L29A 2FX9H 2XWJB 1R5WB 3R1GH 5ID1B 1FSKB 4HUNB 4N90E 5IWLA 3OG4B 2XRAL 3EOTH 4OLYH 5HD8D 1Q1JH 4LSSL 3WUWG 2X4TA 1CICB 4AL8H 5EN2B 4P2RA 1T3FB 4KWUA 3LVEA 3KAAA 5B38A 2I9LB 4NZDA 4PB0L 2E9JA 1T2JA 3S37H 1QFOA 5GGVL 4EJ1C 1YDPA 3PDGA 3T4YB 4M6OL 1T7YA 1VKXA 3G9AB 5E4EC 3UMTA 3BFOA 4LHUB 3O3EB 3KPQA 3ARDC 3BKYL 4FQXD 3RVUC 2BHUA 5L0QB 1JVKA 1IM3A 3VFOA 4F58H 3FQNA 5DD3L 1FZMA 3FTGA 4ODXB 3EYVB 1E4XI 1MJ8H 4FXGB 1T5XB 4YHZH 1J05A 1CGSH 2C3VB 2IF7A 2QADC 2VWEE 2KUTA 2VLLA 1KBGH 4TSAH 1U8PB 4JRXB 2P8LA 1EDQA 3ZKSD 1F90L 2DQGH 3RWIB 1U42A 2NNAB 3QDJA 4G7YL 1A6ZB 5TDPB 5CZVL 4LNRA 1E6JL 3WS3A 3GI8H 4UQ3B 1LK2B 2GTZA 1MCOL 1FGVH 1S7SB 5I1LB 3TO4D 1HILA 4GSDL 2VSCA 1RZIA 3MRRB 3QEQE 4QY8A 5E8PB 2E6QA 2ZUQC 3P73B 1ZT4A 2UUDK 1KFAL 4HFWB 4UIKL 1XGRA 2AEPL 4MNQA 1JBJA 3IS1X 2GJ6A 4TNVF 2HAZA 3TGXA 3CZFB 1FPTL 4JRYE 3HN3A 4KI1A 5KANI 1YPZA 3QFJE 4X5WA 1OTTC 1TVHA 3UTSB 4EUPB 4QO1A 3DVNB 4H0HB 1JK8A 2ESVA 1QQDB 1CE1H 5GGSB 1MHCA 1P7QB 2XWBB 4NQTA 3QHFL 2VABA 4U1MA 2YA0A 2VZVA 2EH7H 1CBVH 1AO7E 4HWBL 1WIOA 5F71A 3DIFB 2CDEA 5GIRB 1BP3B 2EC9U 3P30L 5EO9B 1D5ZB 3DPBA 3I2CH 2VITB 1ZK9A 4PRDB 4HS6A 3NFNA 5EA0H 35C8H 4QTHB 4Y19E 3QDJD 4LVEA 3BISA 3MV8B 4U1LB 5CLWA 3V7AE 3PL6B 1T0NB 2OMBA 4WDIA 3V6BR 4Z7QF 1CQYA 3N1QC 4Y4FA 3FN3A 2Q87A 1RFDH 3BXNA 3HI6L 4N8PA 2GJ6D 4DCQA 32C2B 3AY4A 5FDWB 4YFEA 1FYTD 1D5XA 2QQLL 3QEUA 3UCRA 1VADB 1YECL 2IG2L 3LKNA 4YK4B 4OQTH 4IRJA 1K6QL 5F89A 5HSFA 1OGAB 5JIHA 1C12A 3VXSB 3OJVC 2XNAA 5FDYA 4LVHB 4NRZB 4NQEE 3ARWA 1HQ4A 3VW3H 1F6FB 1A4JB 4LHUG 5EBWA 2VLME 1NBZB 1K3ZA 1TFHA 3DBXA 3BN3B 1X7QA 3G6JB 4Z7OF 3OXRA 1A7NL 3RGVA 5GGRB 3UYRH 1QG3A 3QZWA 1KJVA 5DQDH 1BQHA 4AM0A 2IBGA 1WZLA 1L7IH 3HC3L 4ZAKC 3N1GC 4KKCD 3H9HB 1D6VH 5GZOC 2DJSA 2VDQL 5IB1A 1MFBH 3T3PF 4Y4FD 3C8HA 1HNFA 4BH8A 2YA1A 4YHYC 3H9SB 3FCTB 4PG2A 3UPAA 3S3PA 3ZE2E 3T0DA 1ITBB 1MCWM 3R0NA 5IMLB 4BFGA 1IC4L 5IB3A 3ARQA 4IRJD 4POUB 5ERWB 1DFBL 2GHWB 4HUKB 4PY8I 3ZKXB 1WBYB 4EUPG 3U7AA 1XGYH 3IU3A 1FZJA 4IHOB 2J3SA 1FFQA 2VISB 4IIQC 3P4LA 4HLZH 4XHJD 2AXJA 5DEFA 1EEZB 4NKMA 2YPLD 4HZLB 5T5NF 2GI7A 2DI9A 2JJTA 1PG7H 3L3DB 4PYHA 1WTGT 5DTFA 4B53A 5JOFA 3E8UL 3S4SG 5ESVB 4AJ0A 3B2VH 1QPXA 1AXSA 2X2YA 5E2JA 5F7LB 1OF2B 4WI6A 1NCWH 3LMJL 3BGMB 3BP5B 4KRPD 5DRNB 1P1ZA 3NZHH 2ARJB 1N3NA 5DSCA 2HKFH 2EDLA 4MX7B 3SDCD 3DI3B 3VU2A 1HI6A 2BDNH 1F3RB 3F12A 3MXWH 4HQQL 4XMKL 2WP3T 1INEH 4GKZB 2APVA 2DQJH 2CKBL 4M61B 3TFKC 2FATL 2P24A 1I3GL 5F7YC 4TUOB 5HPOA 2BNQB 5TE4L 3FFCB 5BRZB 3QUKA 4P3DB 3O3BA 3NN8B 4AEIH 2A1WH 4K07A 3DGGB 5HHME 4HIEA 3UTZB 4M6AA 5D1QC 1XF3A 4PJ9A 1ED3B 2YD2A 2ADFL 3AB0C 4X4XB 4GAYA 1CDBA 4HIJB 2IADB 3JSSA 4HKBA 4HWBA 4Z8FH 5GJSL 4AT6A 3INUL 3THMH 1U3HA 2E5EA 2H26A 3KPOB 5J8OA 1BHGA 1BVKA 5J89A 3WIIH 4UTBH 1OT1A 1QEWB 2OL3H 4P2OA 1UC6A 4TNWF 3DUUA 5HVFB 1JTPA 3RGHA 5D5ME 1TPXB 5KW9L 2NMSA 3LPFA 4NHUB 3IGAA 1ZXQA 4OT1H 3SDDB 1NLBH 3PWVB 4JFYA 4OZFH 2EXWD 2ZOKA 3O6MH 2NY1D 3MLRH 4V2CB 5IBLC 1UWGL 5IVZA 4EI6B 3JUZA 5CINL 1Z0NA 3MFFA 6FABL 5GS0H 4LK4A 1QA9A 4G6MH 4JN1H 3O8XB 5FGBA 4FMFA 5DJ8A 4DOHE 5MEOB 3WN5C 2OR9H 2W65B 1MAML 4OLWH 4FG6D 4DUWA 5CEZL 3PGFL 1X5JA 3WEXA 3S9DB 4PGJA 4GW4B 3EO0A 3GSRB 1KLUA 4JN2B 2WW8A 1H5BA 25C8H 4LLQB 3WS6C 3D2UA 4XCFL 4LU5L 4NYLB 4WNQB 4Z5RB 4M1DL 1BQLH 5EZJB 2HG5A 4P2OD 4PPTA 4LARL 5EUOF 4X4YA 5CJ5A 4ZFGL 4EVNA 3FHAA 1S9VB 3MBEC 2CIIB 3CDCA 1GZQA 1NAMB 2B1AL 4ZPVA 1QFWI 2L4OA 5KJRH 3QUZB 4PBWD 2P5WB 3L3KA 3TT1L 1D5MB 3D9AL 1HKLH 3SO5A 2VLJE 1G9ML 3K8LA 4M62L 4ZS6D 4WFFD 4P2QD 4ODUB 1AI1L 2EDBA 4HFUL 1CFTA 4LPWA 1TJHL 4R26L 1OTUD 4YLQT 2CUMA 2WQ8A 4M1CC 3HMWH 5JHLH 1JGVL 3GRWH 4NRYB 4XVSH 5E08H 1FNAA 3UC0L 5ETUA 5BVJA 5IGXL 5SWQB 2Y07H 1D9KC 3DRQA 3GMMA 3RIFF 5DUBA 5HGHB 1N2RA 3LDBC 3QIUD 3QAZB 1S5HA 4L4VB 1QBMH 2WUCH 4BK4A 1KN4L 4NO3A 2LE9A 4NT6A 5BV7L 2P46B 1MFCH 4DKEH 2VXTH 1CZ8L 3LZFH 3V8OA 3ZYIA 1LP9A 3E6FB 4I4WA 4ISVB 1F8TH 4X5XA 4HXAH 3WFZA 4F3FA 2W07A 1S7XA 4MXVE 2CKBA 3AU1B 4W4OA 2EE6A 3R06A 4NJ9L 3HI1B 3Q6GH 2BVPB 2NY4B 2X4NA 5ESAB 3ECBB 3T3MF 2VL4A 3CFBA 2D2OA 1IAOB 4RMQA 4UT9H 1CU4H 2QQQA 1PZ5B 2C1PB 43C9B 1IEBA 1ETZA 5A3IC 1I1AC 1QVOA 2VZ1A 2Z92B 1H3PH 5ID0A 4UUJA 1DN0A 1B4JL 3JZ7A 3O4LA 3EOBB 3ZDZF 1KB9J 4OLVH 1WFTA 3QQ4A 4TPRH 2CD0A 1IMHC 4N8VB 4FQJH 1PVHA 1LMKA 1J86A 2J4WL 5K9OB 3OKMA 3IDJB 1KCSH 3B2UD 4OB5H 1GGUA 3CUPA 5TGBA 3SKJL 3H8NA 3W39A 4MJ4A 4ZNEA 3PHSA 1ZLUH 1F42A 2BC4B 1K4CB 4OAWB 4JO2L 2HMID 1U8OA 5HYSB 5F44A 5EUOB 3KNBB 4ZUUB 3OR7B 1NGPH 3VWJA 4IBLT 4YGVB 4U1KB 2ATPA 4KKBC 3O4OB 4JREB 3VH8G 4PY7B 3PIQB 3TT3H 2PCPB 3HZVB 5E2VH 4A2MA 3FMGH 3QUXA 4MB5A 2OXHA 5A2KH 4G9FE 1K4DB 2VDMH 3GMLB 2O5ZL 1PGRB 2COQA 4H1LA 3UTOA 5EFIB 4RWYL 3VG9B 2AXFA 4X98B 3AREC 1EA9C 3K4ZA 4QRPE 2FD6H 1R3LB 3B9EA 5DRXB 4PRPA 1I1FA 3D25A 4PRBA 5IV2B 2C4XA 2L7JA 4DKFH 4YHPA 1WEJH 1X5LA 4L4JA 2A83B 4OF3A 3MRFB 1G9EA 1JWUA 3B6SB 3DX8B 3RY5A 4XWGH 5J7CC 5HHOD 4YHML 4ZXBD 4JEGB 3S36X 1LO4H 4RAUB 3VWJD 5CEXA 4S1DD 1YNLH 4OFIA 4D9LH 3GMPA 5KOMC 1DEEB 3EFDL 4GMSL 4EI5C 3QI9B 4GG6B 4UOJA 1WAAE 3X14B 3QCVL 3TYGL 5CEZD 4YWGH 1LNUA 2QHRH 4OCRH 2YD8A 1OT2A 2WIIB 4BFIA 1G7MB 3TBSB 2OCFD 2RHEA 3VXOA 4ZG1A 1WT5C 3N1PC 1EHNA 4H5SB 5C0FB 1HXMB 4HCRL 5FAAA 4Y1AD 1CLCA 1QLFB 1P69B 1GPOH 4JPVH 4JANB 1IT9H 5KVFH 2F9BT 4H8WL 1O7VA 4F2MB 1U8LA 5D6DA 5HDQH 2A6DA 2PO6C 1U36A 5E24E 4YR6B 3SDXF 4PRIA 4WW2F 1TNNA 4XPBH 5HYSG 3RDTC 1BAFL 4NZRH 5D1ZB 4WO4A 2OQJB 2VDOL 4XRCB 2X70A 1I8LC 3BDYH 4ZSOE 3U2SB 5F7KC 4RGNB 3TBTA 5CKGA 2OSLA 1JPGA 4C54A 5EU6E 1FNGB 5J6GA 1LO2H 2YPKA 5GJTL 2Q8AH 5A2JH 4UBDC 2JCCA 3STZB 3N50A 3MXVL 4GQ9L 1IGFH 3V0WL 3ARBC 1N4XL 3LKPA 1WWCA 3MRLB 1QLRA 3S96B 3PQYE 4DZBA 5C9JB 1JNNH 1I8IA 4I48A 4Y4HC 1WC7B 3O6LH 2P8PA 1BLNA 1FBIH 2ENSA 5DT1H 3IDXH 5KG9A 4XCNA 3BPOB 5FGCB 1BBDL 1FO0L 4YDIL 3PJSA 4MNGA 4NQSB 3ULVH 5DC4B 4ZO6A 5DWUH 4WO4D 3DXAE 4WUUB 1JPSL 3BH8B 4J1UA 4JM4H 1OTSD 1QSED 3MMEB 4PLKD 2FLBT 5AYQA 5IM7A 4GFTB 3NCFB 1ZGLP 1CFNB 1CTOA 1U8IB 2APWA 2FO4A 3MOAH 3QWQB 4OCXH 1FNSH 2BXYA 3CX2A 1NDGB 4C58B 5GHWH 4KJYB 4TULH 1GAFH 5I1GH 4G5ZH 3EZJB 1PX3A 4JB9L 3L3GB 15C8H 4GRMB 1UFUA 2QR0B 3DOSA 5DFVD 1PLGH 3U0WL 3HHRB 3U30C 5C0CA 2Y72A 3VXRD 5JXEA 2R2EB 1KENH 5DDHB 2HT2D 3QA3B 2ZUSA 4KJQC 5EBLB 3T65A 2NZ9C 1JGEA 2X7LA 5CBAB 1PD6A 2D7MA 4MSWB 5F7WC 4R3SB 1U93B 4Z7WF 2XFXB 3AS0A 5E5RB 3RWDA 2IPKB 4M6NH 2W60A 4NKOA 4AQ1B 4KK5D 3BP6A 4RGOH 3W0WE 1AIFB 2ARJQ 4GBXA 1CLZL 5K9KA 1T1WA 2H32H 2F8OA 5C0AE 4N0RA 3X11B 2VN4A 4NN7B 1G0DA 4DK6A 4PS4L 1LD9A 4D8PB 4NWTH 1XCQA 3BJ91 2VDNH 4HLZG 3MREA 1F11A 5DLML 4PJDF 4U1JA 4RRPG 1I3UA 2DQCH 5HYJA 2DL9A 5JXED 4WW2B 4F7PA 3GSWA 2JTDA 4JPWL 4MD0B 1ZWIB 2Y7QB 5E95B 5F3BA 2YZ1A 1DE4B 3O6FD 4IRSD 4MHHG 5FYLE 1SYVA 1CG9B 1T1YA 2AI0H 3BESR 2VLRE 3MO1B 4O58L 4JZJC 4P5MA 4V1DD 3CAFA 4OCWL 4ZTPL 3ILQD 4PJ7B 5I19L 1ACYL 2JELL 4XPGL 1KV3A 1CDHA 2X89D 5TQ0H 4GBXD 3T0XA 2V5SA 3ARGC 4XXCC 5ISZE 4OM1H 3QEQA 4I3RL 1F58L 1BD2E 5EOTA 2WQRA 4TSCL 4Q0XH 4N5EC 3RY6C 3H7LA 1S7RA 4JRYA 2V2WA 3QFJA 4N0FB 4XWOD 1WLHA 4NQCE 4XBEL 1MHHA 1CD9B 4QXWA 3GIVA 2PW2A 5HYJD 4IMKA 3BZEA 5JDJA 4N1EA 2WBJA 4M5YH 5GSRA 2PUQT 3G08B 1WWWX 3KPRD 2AJXH 1AO7A 5I1IL 1EO7A 3HMXA 4Q9CA 1VSCA 1Z3GL 3VFSA 3WL9B 3MRMB 3K74B 4Y19A 1LK3H 1VHPA 5LQBH 3VMNA 5DZNA 2DI7A 1EHXA 3LKRB 4KPHH 3PGDB 4LGPB 4AENB 4OD2A 4F7MA 2X1QA 2UVEA 3UTTE 3CZJA 4HGWA 4P5TA 3GNML 3CDGA 2BHYA 4WEBL 4JFHD 4JFFB 5CWSB 1ZT7B 5SWZE 4ONGH 4XNYH 3CCHA 3SGKA 1FO0A 1CDCA 2E6PA 4JRYD 1MCFA 5EU7C 3EYOB 1D5IH 1LEIA 3NA9H 3IDNA 4WHTA 4PJAE 4DGYL 4Z7WB 1YNTB 2NW2A 4Q9RL 3TN0C 3CFCH 2EZ0C 4NQEA 1XH3A 3KDMB 4R7NB 4XNXL 2YXMA 5KZCD 1J8HD 1OCWL 5HDBF 3WHE1 2EKJA 3SE8H 2BZDA 1MUJB 5T33H 3MBXL 4YEEA 1MCDA 2J7LA 3MV01 5EIQA 4TQEL 4X9FA 4K2UL 1DVFC 2UYLB 2HN7A 4P5TD 3NCEB 5AZ2L 5F8QC 1EX0A 5D70H 2DD8H 3EYUL 5I1EL 4HXBH 4K71B 4HPYL 2A2QT 3CFKA 3MV7D 1MWAH 3EJYC 3A6OA 4ORZC 5JIIA 1PAMA 1EH9A 3I3DA 2I60H 1CDYA 3CMGA 5E6ZA 3FT4A 3K1DA 3UAJD 2Z91A 5CD3A 4CJ1A 4QRUB 4YDKL 3VG0H 5ALCL 4NNYA 2A77L 4HF5H 1NC4D 3G5VB 2QKIB 3ILPB 4HV8B 4ENED 1OAZL 2RGSA 3T4AA 4MVBC 1DBAH 4YUEL 5C08E 1VFBB 4XTRC 1IGMH 1BBJA 3FB8B 1UWEH 3LRHA 3B9VA 4XCYA 3KPSD 1R3KA 2R9HD 2V6HA 4I8DA 2R8SH 5A40E 3V4UH 3MGTA 1JF6A 3TC9A 5LVEA 5J1AB 3U4AA 1OARL 5IMOA 4RFNB 4LCIL 5J9PA 1NCTA 3FOLA 4R2GB 1RIVL 1N6VA 3B83A 3RHWF 4X6CF 1IM9D 1AXTH 5LGJB 3PDDA 5FOJA 3C5ZC 4LSQL 1M71A 3UP1A 3F7VA 1UM4L 2Q7YB 2NTSP 5IJKA 5F21B 5DJAA 5I15L 5FO7B 4NO0A 2O5YH 1Z9LA 2LVCA 4G8IA 4TTDD 4U6HB 2NTFA 5SWSB 4W68A 4N1HB 3L3IB 3IAGC 1G7IB 5HBBA 3PWPB 5C2BH 2J6EL 3T0VA 4IDJL 1I7UB 1NCCH 2O93L 4HH9B 1Y0LB 4FP8H 2AAVA 3RPKA 3BW9B 4RSVA 3UEZA 4OKVB 1NSNL 2WZPD 2NY2B 1QBLH 2Z31B 5MEPA 3F65A 2P1YA 4YFDB 4K7PL 3T0AA 4E42B 1VA9A 4DZ8A 3DWTA 4OZGB 5D5MA 3MLUL 4OIBA 1FNEA 1X4XA 4KU1A 4P57A 3M8OL 4Z7VF 5D1XC 5CZXC 1BZ7B 1J0YA 2DN7A 4OCNC 2YK1H 4K3JH 3WKML 4OGXH 1UM5H 2VL5A 3DSNA 4AIOA 1I8MA 4Y16A 4R0LC 3PDOB 3VFNB 2QSTA 1A1OB 2J1KA 4UV7L 4JHWH 4Y4KD 3LEXA 1KB5A 1XR8B 2VYRE 4MYWB 3EYSH 4EDXA 2YD7A 1A3RL 4GXVH 4D0CA 4YAQA 2XZQH 3OPZH 1JHKL 1LE9A 1RJYA 4YHLH 1N64H 5E99L 1JHLL 5IROC 2XPGA 1GGBL 4MA8L 4EIGB 3KS0J 2R0KH 2F58H 4XNQA 1A4KA 3OG6B 4YDLC 4GS7C 1BM3H 1KPUB 1NGXA 4JO1H 3RVXD 5JPMA 2EEDA 5CIPA 3ULUD 4OFVA 2XY1A 2MOVA 1B88A 2VLJA 1HHIA 5EIIB 2YOCA 1SJXA 4JM2F 2NY3B 2EDYA 1GXEA 1H3VA 5T1MB 2GSGA 3IDMB 5F6IC 4JKKA 2PTUA 1J1PL 1MCHA 3H7BA 5TF0A 5CJXA 3TJHC 1F6LL 5BO1H 5F9JA 2Q76A 3MLZL 3QG7L 1LHZA 1MFDL 1IJ9A 3NIGF 4WTXA 2G5BA 4X6DE 4PTTA 1UB6B 3B9DA 1ZTXH 2DTML 4PJBE 2KZWA 2R29L 4QXGL 1MCKA 3ARZA 2Y6SC 1MJUH 1EEQA 2XQBL 3T0EC 3HLAA 1LE5A 2PXYC 5J6HA 2BHZA 5IFHL 4DK3A 1HYSC 1I8KA 2EDFA 2H32B 4OZIF 1JRHH 1YMMD 2YD6A 5DUML 3BUYA 1NEUA 5TQ2L 5IEKA 5MEQA 5GRVK 1YY8B 4OBRA 2BNUB 3HUJE 3RA7L 5GRYA 4IRZL 4FQQA 3TWCH 4IS6A 2F15A 4ZUWB