3OJ2C

Crystal structure of fgf1 complexed with the ectodomain of fgfr2b harboring the a172f pfeiffer syndrome mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
b'KRAPYWTNTEKMEKRLHAVPAFNTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 36
structure length 209
sequence length 209
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oj2C01
3QQ3A 3BRDA 1KCKA 3B8SA 2BY3A 4OI7A 1WZKA 2GTWB 4KRLB 1EEZB 1W72B 3QNZA 1IAIL 1WQVT 3HNVL 5D7IA 3EBAA 4A6YL 3TLRA 1BQHG 5E8DL 3TBSB 4ZQKB 1EHAA 4JKKA 4PJ8A 4QY8B 3QDMD 4PBXA 4HUUB 2DRUA 1AGEB 3BQUC 2IPKB 4GMSH 5FKAB 4X98A 1QSFE 2BSED 5JXAH 2F74A 1NCCH 1GIGH 2D4DA 4FQHB 4RDQG 4NQXB 4QRSA 5HHNB 4X6FA 4Y19B 5CBEA 3VFTB 4UT6L 3KPQA 3FRUB 5CZXD 2E3VA 4DK3A 3KYKH 1YEDB 1O5DT 1TZHA 4WI9A 3IJSA 4HMDA 3T2NL 5INDB 4ETQB 4JAMA 3F62A 3RIFF 3O6FC 3E3QC 5I18L 5I8CA 1EVTC 1ZSDA 4TNVK 2PNDA 3D69A 5KS9F 5A2KH 3WFEL 1JF1B 4WTWA 1N7ML 3ULUD 1QYGH 4RWHA 3HC0A 1T0MB 4MCYA 1ZLVH 4MJIA 4N8VA 3IAQA 2OJZL 5EH1A 5CMAA 5F7EH 3ULUF 5IGXL 4LSRL 4LLDB 5FO7B 3RNQB 2VTFA 1T89A 4YXHH 4ONFH 5CILH 4NN7B 2R56L 1MFEH 2Z8SA 1G9NH 2PKDA 3DUSB 3WNKA 4GMTL 5K9QG 4ELKA 2E6JA 1PVHA 1UH3A 2EDRA 2J4WH 3NTCH 2UV3A 2G5BA 4NNPH 4DGVL 5J1AA 1DLHA 1NAKH 1BP3B 5JMRA 2EZ0D 1MPAL 1C08B 4L8SA 3U0TA 3LEYL 4DWHA 1T03L 1P9MC 1X4XA 7FABH 5DJ2A 2DLEA 3AS0A 5J8OA 4G7YH 4MQTB 4U1SB 3GKZA 4Q2ZA 3X11B 3W9EA 2GUOB 1WWWX 4ODUA 1U93A 2X4TA 4LHQB 4PJEA 5GRVK 2I9LB 5I73C 5DD3H 5I1DB 3DURA 2CXGA 2ZG2A 4WV1A 4FXKB 4X8XA 4C58B 3WFDL 4LEXL 1LDPH 3QHTC 1I75A 4X6DE 2ED9A 3ULVC 3IDXH 2IANB 3ZSTA 3KPNB 5KSAB 1S3KH 5FAAA 3QA3B 1P6AB 1RFDH 2YBRA 2VDRH 1OSPL 2BOBB 3CFBA 3ARDD 1ORQB 4XC1H 2ICEB 2DD8L 3TNNA 3O3BB 5GRJH 5D1ZC 3DSFL 1Q9LB 1PEWA 1G6RB 3O9WD 3DX7B 3OXRB 2BK8A 5ID0B 3U6RB 2E9JA 1F6AB 3EOBA 2WLYA 4S1RH 3RGVD 12E8H 3R0MA 4WY7H 4BH7A 1RUAL 3HG1D 2Z31A 4ODVH 1GHFL 1XIWB 2OXGA 1WFUA 5CIPH 1GJIA 1PYWB 4FZEL 4LKXB 1KIUA 2QR0A 5DUBB 3HI6H 5T1LD 5F21B 1KB5H 1MOEA 1O0VA 4TPRL 3GDBA 4K7FA 5IVXE 4POZC 2Z93B 5AZ2L 3U79A 1MNUL 4LIQL 1VESA 4M6NH 1BEYH 1U8NB 4K3JH 5JZ7D 1S7WB 3HAEB 2C3WA 3PNWA 4H26B 1A3RH 5CJXC 5TFSL 5TE6H 1YC7A 5LWYH 1N64L 4R2GC 3HFML 1NCUA 2JE8A 3GMQB 3HZKA 4RMVA 1FYTA 1MJ8L 3WE6A 2MHAB 4I8DA 2AJUH 1DSFH 4WI3A 4HPOL 3Q6GH 3MRRB 1RIHH 1ZE3C 2WZPD 4G8IA 1IVLA 4HULB 3CLFH 3BSZL 3ME0A 1CXIA 1MVUA 2R23B 4Y4KA 1TVDA 2DQHH 4P23C 1C5CH 4LL9A 3VG9C 3O6KH 1RJLA 4JZJC 1BIIB 4EJ1C 1NANH 2P24B 4ISVA 4TRPH 4DKEL 1EXUA 5B39G 3VD4A 4WTZA 4ZUTB 4ODBD 1UM6H 3PGCB 2ZUSA 1R3LA 5F7YC 3HMXL 2AGJL 4EZMA 4NQDD 4P2QD 3BPCB 1KCSH 1FL5A 4XNXL 4C54A 3LS5H 3RVVC 5DVKA 4TUOA 4OKDA 1G84A 2QHRL 2ESVD 4NYLB 3WXVL 4NT6B 3PWNA 5EOCH 1OTSC 3IRPX 5F9JA 4GUPA 3C5ZB 3L95B 3QDAA 4FQPA 2EIZA 2A9MH 5DYOA 3UTPD 4I48A 1IM9A 5IFAH 1BFTA 4G6KH 5HI3C 1H3TA 4PUBH 4F58L 2GFBA 1EGJH 1FBIL 3PWVA 3MXVH 5BRZA 1RZIA 1CD1A 1NCWL 1RZKC 3LKPA 2GSGB 4ZDHB 3T0XA 4EOWL 4EI5B 4WNQA 1UB6A 1I1CA 5F1KC 5DO2D 2CK0H 2DYPA 4UV7L 4NUGH 4P0DA 3MV8A 3LEXB 5D5MA 5EBMA 3I3DA 3Q6FA 3C6LD 1JGEA 5FGCB 1MHHB 3JV5A 2XICA 2H8PB 1U92A 2NXYB 1N4XL 4N9GB 4JQIL 1G7PA 1M6OB 4Y5VA 4XMPL 4DKFL 1A8JH 5MHSE 1N3NA 5E6IB 1S7XA 4U6YA 4X4ZA 3TJEH 3ZKND 3PQYE 2CKBB 1YEHH 3PDDA 3CVHH 1Q9OB 2Z4QA 5HVHC 4QRUB 5EU3B 4PJIA 2JIXB 4R8WL 4HT1H 4JFDA 1A64A 2AJXH 1D5MA 1C1EH 1I7TB 1OAUH 1RMFH 3MMEA 1OGTA 5FIEA 4P59H 3SGKA 5L9DH 2Y36L 5F1NA 2DQDH 3OZ9H 4OLWH 3SCMD 3V4PH 4X4MA 4MZ3A 1OB1A 4JEGB 1EEYA 3VH8B 4E5XA 4WGWB 4HJJH 1PDKA 4GBXA 4M00A 4DN3H 5GGQH 3EOYG 4PJ5D 4JGUA 1MH5B 5EU6A 2H26B 1NGXA 2VDPL 5F9OL 3PWUB 3CVIH 5GQBA 4MNGE 3HE6D 4ZXBB 2HMID 5HVWA 3ULUL 1QSFB 2VLKA 4LPWA 1JTPA 1K9TA 1PKQE 4BQBA 1MIML 5ADPL 2DQIH 4R0LB 1QBML 1A7QL 5SWQA 4DOHE 1KG0B 3FB5B 5IBTH 4WHTB 2Y5EA 3VI3E 4Y1AA 2YN3A 5B8CA 2EH7H 3BW9A 1UKQA 5CIPB 4Y2DA 5IMOA 1YMMA 3OXSB 4OCYH 5CWSA 2UVFA 7CGTA 5ID1A 3C87A 3CPLA 4LHUD 2YA1A 3E6FA 3NIDE 2NYYD 1NAMH 3OKLA 2D4FA 3DX9A 4HDIA 5SX4H 1FPTH 4A6YA 4YJZL 2V7HB 1RJYA 2IJ0C 4OB5H 4U3HA 1FVCB 2YKLL 2VLJD 5EUKB 4Y7MA 2EO1A 3TZVD 4PJ9B 3S88L 5IKCA 4R7DA 3VGAB 1L7TH 4NN7C 3MJ9H 1IC7L 1G9MC 1A1OA 4Q9BA 4GAYB 1AGDB 4P5MA 3MLYL 2ZUVA 1FGVH 3VFRB 1U58B 4K23L 4UU9B 3AXLB 4XVJH 4MDJA 2DLIA 3NCFB 4NN6B 4XPAL 1INQB 5IHZB 1WAAF 3O8XA 3W82A 3PHOA 4JCMA 2P45B 2NY1B 3SPVB 1YEEH 3MOQA 3MJ7B 4WO4A 3ECBA 3R06A 4C56A 1BBJA 3PXJA 1EO8L 3GBNH 1F8TL 1F5WA 3WXWH 5J9PA 3KYMB 4PJAF 1S7QA 4JVWA 4AEIL 1YNLH 5C7XH 3OKKA 1MLCA 1CDUA 1GZQB 1Q72L 3BPLB 3VFVA 2VZSA 5ENWA 5EC1B 2FEDC 3Q3GA 4MA8L 5KSAC 1FYTE 1WBXB 1JTTA 3GK8H 4ODSL 4X6DB 4TTDD 5TDOB 2MWCA 2DM7A 3MRPB 3LN4A 3BE1L 5ITFB 4X5WB 3F7YB 2I5YH 5AD0B 1FO0H 3G5VA 1MELA 2WQ8A 4JO2H 4Y16D 4G9FA 1DBKH 1QEWB 2EDNA 2P8MA 1CDGA 5DK2A 3KHOA 1XIWC 4LRNH 2VR4A 2JF1A 1MCDA 5A2FA 4LAQL 2IWGA 4MVBC 3SO3B 5IFHH 1A7OL 2BP3A 5KVMC 3SDCB 1LEIA 2H3NB 5JW4M 3GSNL 5IIEB 1U8QA 3S35L 1PLGL 4HF5L 5IVXB 4NC0B 1BWWA 3VA2C 2ADFH 5BVJB 3FFDB 4W6WB 5DMIH 2FX9H 4PJ7A 4U0QB 4JFHD 4MA1B 1R3IL 1A3QA 5E4EB 3KS0H 2OL3B 3GKWH 4C83A 3UJJH 1T2QH 2AV1B 5HHVL 2WBJA 4PJHA 4KGLA 1G7HB 1MRCL 3GO1H 5CJ5A 1AD9B 4PJBA 5BRZE 1KENH 1KPVB 1OTUD 1RU9H 1RZGB 4WFEE 4YX2L 2BVOA 3CDGA 4MGXA 5FCUH 3ARFD 2X1PA 3LN9A 2D7TH 4S2SA 3M45A 3DXAA 2NZIA 2VKXA 3W39B 3TCLB 1UEYA 4KPHH 3LKQB 3MV8E 1T6WA 4Y4FD 4Z7UA 1A1NB 1T1YB 3RPKA 1DBJH 3MNWA 2Z8RA 2IMMA 1FL6A 1VADA 2VLRB 1KXTB 2YXFA 2APWA 4WGVB 2VDQL 5F7WC 4OUOA 2NW3B 2NX5A 2VDML 1G7IA 3GSVA 1V05A 3O2VL 5C0BA 2BJMH 1EK3A 4ZS6C 2EDOA 4R9HA 4YE4L 3V5HA 2F8OA 5EU4B 1I1FA 3C5ZC 1REIA 4UBDD 3CXHJ 4G5ZL 4JFDE 4M4RA 4G3YL 3ARBD 4XT1C 2DKMA 3QQNA 3EZJB 1CLYH 3FONA 3GGWA 3PGDA 1IBGH 1SBBA 5C07A 1GVIA 5EZLA 4M5YL 3QQ3B 5ILTH 4P9ML 2WINB 3V5DA 4XHJC 3CX5J 4P46D 3VDCA 4XCCL 3IDNA 3KLHC 4K94C 1KBGH 2DMKA 3QNZB 3T1FB 4KUZL 3BYYA 4I18A 2YUXA 5EU6E 4EI5C 5DEFA 1JHLL 4PJ8B 4V1DA 3ZL4L 4LEOA 5JOFB 2F58L 4FTVD 8CGTA 3HMXA 2FGZA 3MRJA 2MPAH 1RULL 4X98B 2VLKE 4X6EA 4X6BA 2F74B 5IEKA 1MQKH 2NXYC 1B0WA 3GSRA 4QRSB 1U3HA 1F02I 5JQ6H 4JR9L 4X6FB 4OFPA 4U1IB 4M1CD 3KPMA 4NQEA 4ESKA 1MIEH 3VWKA 2E9WA 2YRZA 3KPQB 4TSCL 4Y1AE 5E6IC 3QHZH 1AKJB 4YDJA 2OR7A 1TZHB 1KACB 3IJSB 4Z0XA 3D0LB 1C16A 2P5WA 3PQYB 4JAMB 1B4JH 5AYUH 3NCJH 1Z9MA 2IH1A 4CVXA 2EECA 1CE1L 4TULL 5K9JH 1OAQL 2J8UA 3DETC 5I8CB 2N7BA 2CDEB 3D69B 3SDXF 1AY1H 3DWTA 1JI2A 5DR5H 3N9GL 3TCXA 3BN9D 2R69L 3HC0B 2QJDA 5I0ZA 5HYEA 1AXTH 3TN0A 3ZYZA 4MNHA 5CMAB 2XTLA 3U4EA 5D6DA 1V5JA 4FP8H 4JB9L 1F2QA 4YHPA 1IAII 3SE4A 2DQGH 1QG3A 5I76A 2F19H 5GGVY 1OAYH 5LGKA 1RUKL 3V79C 4IRSD 4CJ1A 1A6ZA 4PJFF 5E2WH 5I15H 4ZXBC 1W0WB 1KN2L 2BSTA 3FQXA 2VN4A 4XBGA 1BZ9A 5GGRA 3VGGA 3VMNA 3QDMA 4F7MA 4R0LC 5FFLA 4ELKB 1BLNA 4MLSA 4C56E 4PLKC 1SEQH 2CKNA 2VNCA 1X5YA 1OCWH 2G5BB 2IBGA 5D70H 4MQSB 4QHKJ 2CIIA 4DOHB 4L8SB 3L3KA 3U0TB 4FHBD 4G8FA 4I2XE 1R0AH 1BX2A 1T83C 3C08L 5DJ2B 4XC3L 4EUPH 2D7OA 4Q2ZB 2A6DB 3D1MC 2H1PL 4ZFOA 3W9EB 4ODUB 5I1JL 1U93B 2X4TB 3GRWL 2VL5A 3DTXA 4PS4L 4AG4H 5ESVA 3ARED 2QQKL 3DURB 2WBWB 4GW1A 4Q9QH 5E95B 4WV1B 4YHML 5KS9A 1W0VA 4XAWL 4J3SA 1I9RH 4JDTL 3WIHL 3UEZA 1IC5L 2HFFA 2P49B 3NPSB 3STLA 4PJ9C 3CFBB 1S7SB 4KI1A 4PR5A 3T3ME 3VGAC 3FO1A 4KJQD 1E4XH 3TNNB 4K71B 2UY6A 1JGUH 1IGIL 2DQFA 4KROD 3MFFB 2YD4A 1HQ4A 4G9FE 4NQSB 4U4BA 5JHLH 2R0ZL 4ODHH 1XF4A 3EOBB 1IEBB 4NN6C 2OMNA 1PKOA 3UTSD 4BH7B 4OJFH 2A9NL 3IVKA 1DFBL 1DR9A 2RIKA 5FA3A 2Z31B 3VE0A 1RI8A 1F6LL 5T5NG 4J3OC 2NY1C 1WFTA 3NIGF 1YY8B 4PJCA 2QR0B 1U91A 2O5YH 4AENA 4YIQA 5EZIH 4K7FB 4JG0H 3B4NA 2XG5A 3T09A 4PJ7E 4JHWL 5C0GA 2WIMA 5D72H 1PFCA 3Q1SH 3RIAK 3PNWB 4D9RD 3BPLC 5FO8B 2DM4A 2LVEA 4KVNL 1KFAL 3TBVA 5GS2H 2FRGP 5JW4N 4B7LA 3EFFB 4PJHE 3HZKB 5HGHA 1TCRA 1WTGT 5E03A 5EORL 1IGFL 1IC4L 2FB4L 4LLQB 4FFVD 4ZUVA 3IB4A 5IHUH 1FYTB 1HNGA 3WE6B 1JGVH 2VO5A 1N6QL 2NW2A 4BQCA 3O2DA 3LH2L 1BM3L 1A0QL 3GIVA 3TP4A 5E9DE 5DURB 1FL3A 4G8IB 1A6PA 4OZGF 1HH6B 4LSPH 3ARDA 5J6GA 5M95B 1MVUB 3C9NA 1ERNA 3D39D 4FQ1H 1UH2A 1NL0H 3P77A 4YDKH 5DXWA 4Z7UE 5BVPL 2XN9D 5F3HA 4A2MA 5FB8A 3O9WA 3SO3C 4K8RD 4HQQL 4LIQE 1UYWH 5D2LF 1X5JA 3JUYA 3TV3L 3RGVA 4NHUA 3RX8A 3Q48A 4ISVB 1EXUB 3HG1A 4UAOB 1R3LB 2AABH 4CW1A 4CGTA 2VDKL 1L9MA 5C0BE 4PGEA 2B8OT 4YPJA 5T1LA 1V3KA 4MA1C 3U9PH 5E4EC 2MMXA 1K6QH 2GYSA 3PWNB 3FB8A 3PIQA 4N5EC 5GSVB 5F9JB 4GUPB 4FQXD 2ARJA 2ORBL 1KCRH 1L6ZA 4LAJH 4EN3D 5C07E 1AR2A 2EIZB 3EDDA 1F2XK 4NKOA 2X4SA 5IESL 5T1KD 1L7IH 2M2DA 4M62L 4P2OD 1YUHA 1VB9A 5C0ND 4OLZL 3SE8L 2DL2A 3GM0A 5GJTL 3PWVB 2FZ3A 4BK5A 5BRZB 4HS3A 2OMBA 1MRDH 2AJVH 1YN7A 1YMHA 4KDTC 4V1DE 1KJ2L 3LKPB 1NUDA 5C0CE 3GI8H 3S96B 3MV9D 4XWGH 5BQ7A 3GSNA 4FZ8L 4WNQB 3ZT5A 2BDNL 3K4DA 3HMWH 3VGEA 4OCSH 3MLUL 3MV8B 1E0OB 2VXSL 1D6EA 1FRGL 2XG4A 5EBMB 3HC4H 5KAQG 3Q6FB 3QG7H 1JGEB 4QTHA 4PLNC 5HPMA 5DRXA 3V6ZA 5I1IH 5C2UB 2JJWA 4NQEE 1JGLL 2ZSWA 1U92B 2GAZB 4LCWD 4M6AA 1G7PB 1TTGA 1Z9OA 4Y5VB 5I71B 3AS3A 1N3NB 1NCBL 4TVSa 5IJKA 2LABA 1ZVYA 2YD9A 3RRQA 3DMMB 1NLDH 4P2QA 5HXMA 2Z4QB 2IPUG 1G7LA 5EO9B 4PJIB 5TJWK 4JFDB 1PX3A 5J3HD 2ESVA 2L7UA 4H0GA 3CU1A 5A3IC 1SM3H 2ZJSH 3MMEB 4NZTH 1OGTB 3MNVA 4FFWC 4JM4H 1CLZH 5F1NB 4NWUL 5CJOH 1Q0YL 2HKFL 1BOGA 4EIZC 5E6YA 1NGPL 2SEBA 1OB1B 4HIIA 4E5XB 5J7CC 3W11D 4U1HA 4PJ8C 4GBXB 1HCFX 1BVZA 4U1KA 3WNLA 4FFZH 5EU6B 4QHKI 2EDKA 3R8QA 5HYFA 3IFNL 3IDGA 2CLZA 3FQUA 1L0XA 4MNQA 5T33H 1CYGA 1RHFA 3HFMH 4I0CC 4NOBA 5D2NE 5D6CA 2VLKB 3C8KA 4PRDA 5I1KH 3EJJX 1JUFB 1ZS8A 2BMKA 3WLWC 3C6LA 4PYHA 2C4FU 3HNSH 3BAEL 4Y1AB 5B8CB 2EICA 3BW9B 1KXQE 4Y2DB 2XQYK 2KDGA 3JSSA 1FG2B 5F88B 3WJJC 4MB4A 1RD6A 2ADIA 2YXMA 5ID1B 3CPLB 3RVTC 2B4CL 3L5XH 1KELL 4ZPTB 3MRHB 3E6FB 5DJAA 2VLME 5KS9E 3OKLB 3DX9B 5I66A 2AV7A 5DMGD 5T3XD 5HDLA 4A6YB 1UJ3A 5FHBH 5GS1A 4M6OL 1SEBA 3RWGA 1JZ5A 2I27N 3BPNB 2EH8L 3M8OH 3SKOA 2ZG1A 4QXTA 1H3XA 3ULUE 4NKMA 1T89C 1KIQA 4H5SA 1CDCA 5IKCB 4DAGH 4OLVH 1DQJB 3B5HA 4P5MB 3MBED 2PXYD 3SDAD 1CTOA 3P30L 4YLQT 4MDJB 3WKNA 4TSBH 3BVNA 2X9XA 4TOYL 1FNEB 5GGUA 2DM3A 4XTRC 2R0LL 3V7MA 1RK1A 1LP9A 4H1LG 2FLBT 3CDYA 4HV8B 2EKSA 2M26A 5TE4L 2QKIA 2Y72A 1TENA 4WO4B 2NQCA 1I1RA 1NMBL 3CXDH 3ECBB 3R06B 3EJZC 4I3GA 3HE6A 1FBIH 1BBJB 4L8SC 4C56B 4RMSA 4IRZH 1WEJH 4JRXD 2Y1VA 1FIGL 3MODL 1S7QB 4YXLH 3BH8A 5LCVH 3RVXD 3OKKB 1MLCB 2JJVA 4D94A 4R4BA 2OQJA 4ERSL 5KVDH 2XTJE 1M05B 4YHLL 4WV1C 3FMGH 5ENWB 3U36A 4ZOCA 1JK8A 3RDTD 1QRND 3Q3GB 1GAFH 4HCRL 4OGXL 1OAXL 2GHWB 4LHUA 1ONQA 3EO1B 1H8NA 3WIFB 3UC0H 3IF1A 4H20H 4K71C 3LN4B 1QLFA 5FUCE 4HBQA 5HGAA 2B0SL 2YPLE 4JFXA 4TN9A 3DI3B 2C1OB 5FYJD 1UM5L 4IBLT 1KJMA 5FM5M 2VLJA 4G9FB 1JNNH 4LVNB 4AEHH 3TZVA 2P8MB 4K3EH 2Z31C 5DK2B 4HMEA 4M48L 2AP2A 4BELD 2EDHA 4FQLL 2QLVB 1T7VA 3GMNA 1RUML 1MJUL 1WAAA 5AZEL 3EYSH 4YGVA 3CAFA 4BKLA 4OCXH 1U8QB 4RFOL 3V4UH 5CZVL 4PJAA 5CCKH 2CR6A 1NSNL 5FM5O 3GBML 4KDWA 4PJ7B 4K8RL 3L7FA 3WIHA 2W9DH 4MA7L 3AROA 1JPTH 1YEFH 5IW3A 1J10A 1I3UA 4GRLB 1UWXH 2EIBA 5J1TC 3VXQA 4U7SA 3TWCL 3INUL 3DO3A 3DBXA 2PW2A 3D0VA 1LO4L 4GW4A 4PJHB 1O7VA 5ADPH 4PJBB 5EU5A 5KZCD 1I4FA 3EO0A 1HKLL 3BX7C 2NY6D 2VXVL 3DV6A 2BVOB 3CDGB 2ZCLH 1R3JB 1AO7A 3O2WL 4KV5F 3UBXA 4S2SB 5E9DB 4PY7A 4C55A 1S5IL 3G04A 2XZAH 4Z7UB 4PGBB 4Y16A 2DQCL 3MNWB 1SY6H 4UAOC 3F7VB 1FL6B 4YFDB 1VADB 1RZJH 1Q9WA 4C57C 3O3DA 5DJZA 1P69B 2ZSVA 4JKLA 4D9QD 3KPPA 5T1MA 2BNRD 1G7IB 3GHBL 3GSVB 4KQ3H 5F9DC 4WFFD 2CRZA 5C0BB 1NJ9A 2H32H 3EOTL 2AK4D 4NQDE 5BV7H 1CXEA 2DBLH 4P2QE 2XXCB 3V5HB 3FT3A 3QRGL 1CDYA 2HA1A 3MLTB 1W8OA 1NQBA 2ESVE 3SE9H 5MENE 1F3JB 1JWSB 3FONB 3SDDA 2EC9U 3PGDB 3WUWG 5C07B 3BQUD 4E0RA 1J5OH 4CBPA 1CK0H 2AXJA 3UTPE 1FNLA 2JJUA 5IWLA 1F8TH 5LBSL 5E8NB 2FIKA 4XCEA 4I18B 1MCEA 2R2HA 5DEFB 4UTBH 4HFUL 5H35B 4V1DB 4MXWL 2DIJA 4F7CB 3B9DA 3FT2A 1KTLA 3ARFA 4NJ9L 1CGVA 5F7NC 4K7PL 3QXDA 4X6EB 2FR4B 2V5RA 5IEKB 2AJYL 4X6CF 3GSRB 4JM2D 4Y4FA 4Y5VC 1U3HB 3DX6A 6FABL 5I71C 3KPMB 4NQEB 4ZTPL 3VWKB 1DCLA 4UQ2B 4YDJB 4JM2F 2VZOA 1U8MA 3DMMC 4Z0XB 2HLFD 3N06B 1C16B 5E08L 3WJLA 4IOIA 1DZBA 1WT5A 4IMLA 2W0PA 3RKDC 2IH1B 3WO3B 1E6JH 2YMXH 4KKBC 3RTQD 5IVOA 2GJ6D 2J8UB 1LE9A 3P9LA 1KJ2A 3BP6A 3ARBA 4M8QA 1OWWA 4M43L 2NY7L 1MFAL 2D9CA 1AJ7H 4U1JB 4DTGH 4X7CC 4Z18A 1YNKH 3IJHA 1J11A 4GBXC 2R4RH 4UB0L 1I85A 3TN0B 1M7IA 5EA0H 2E9BA 2AK1H 3HR6A 4J1UA 4P46A 3HE7D 1AQKL 4QGYA 5GJSL 3SOBH 5I76B 3TF7C 1WCQA 5GZNC 2HT2C 3UTQA 1A6ZB 4PJ5E 1HSAB 1A6UL 2ATKB 2ZKHL 3FQXB 4XBGB 1BZ9B 3MA9L 5GGRB 2BNUA 2X4QB 3QDMB 3T4YA 3VFGH 3F58H 4FTVA 3MUY1 1BLNB 2A77H 5D2NB 1J0YA 1TXKA 4XP9L 3RVUD 2GTZA 5DUMH 5TE7L 1F90H 4OQTH 1G7JA 3AU1A 5B8CC 3MLWH 2CIIB 1HHGA 4Y2DC 3LKNA 4D3CL 4XNUL 2H2SC 5ALCL 4DQOH 3L3KB 4G8FB 1BX2B 4DVBA 4DUVA 5HHOD 1MQ8A 1WV7T 1HWGB 5CGYC 2C7UB 2EKJA 1ZEAH 3DRQA 5L8JB 1CN4A 1VPOH 2DOCA 2VJXA 5I8OL 4X5LA 3DTXB 4TNVF 3WFBL 5ESVB 1OF2A 2A0LD 4NCC1 5J56B 4GW1B 4X7SL 3BPNC 3SDXA 3AMLA 4KTEL 5BZWA 5KS9B 1W0VB 1ADQL 4Z7WF 1JPSH 2V7NA 4ODTH 1OSZA 2VDQH 4QKXB 2HFFB 1KPUA 3NA4A 1ZMYA 5DK0A 1SYVA 3FO1B 2DQFB 1XGUA 2LV4A 3O41A 4FG6D 5E99L 5JW4Q 1JYNA 3LKSA 1HQ4B 1RIVH 1L4IA 4EQ2A 3WMSA 4M1DH 1IFHH 3D85D 2N4IA 3HPLA 4NC2B 3NPZB 3LPWA 3AVEA 2J6EL 5FA3B 3VE0B 4JPWH 3ZHKA 4WVRA 1GOHA 3CSBA 1FAIH 1IAOA 5FYKU 3VXUD 1KT2A 5ICXB 4IRSA 4WO4C 1FN4A 1U91B 3MGOA 4AENB 4YIQB 4N0FA 3S5LG 3MLSH 5FYJL 1HI6A 1S8DA 1LEKA 4PJAE 3P4NA 4CADB 1H0DA 2W91A 4HLJA 1VSCA 3QB7C 4NGHH 3ZDXF 3RAJH 5DEGB 4ZOAA 5DJDA 1KN4L 1BFVL 3TBVB 1NGQH 1DDHA 1YN6A 4G6AC 3PP4H 4WHYG 5HGHB 2QHLA 3WEXB 2D9QB 4ZUVB 5C2BL 3ZMRA 4RX4D 3VXOA 3LVEA 3AREA 3CC5A 5D7KE 2NW2B 1NC4D 5I74B 1MY7A 1PZ5A 5FGBA 5J1SC 2FEEL 3GIVB 5LQBH 1U8KA 2E7CA 1FL3B 4LVNC 5LGJA 3MO1A 1XR8A 3ARDB 4WJ5A 5J6GB 4LQFL 5I1CH 2XOTA 1ZLUK 1T1ZA 3P77B 5FUZH 3BDYH 5ESAA 5GGSA 5FB8B 3O9WB 3IDYB 3NZ8A 4GG6E 4KJWC 4YQXL 3O6LL 4AEEA 1S9XA 2AEWA 3O81A 3RGVB 4NHUB 1KYOJ 2X40A 3HG1B 3UBXI 4LLAA 5D1QA 4PV9A 4CW1B 3TYGL 2H6PB 1RUQH 4PGEB 2BERA 2IH3B 4HIJA 2EXWC 4DZ8B 5T1LB 5IM7A 2EYSA 4XBEL 1M4KA 1KTDA 4HCRA 2VABB 1E6OH 3CSGA 4GRLC 3FB8B 2R29L 1PG7L 1C5DA 3PIQB 4JPKH 4LSSH 2ARJB 1MJJB 4JFHE 4MXQC 4HUWA 2ADGA 1DUYB 4NKOB 2X4SB 3KNBA 1QPXA 4GKOA 4JHZA 4MCZA 1C5BL 2DJSA 4C4KT 5JR1L 4JFED 4BSVA 4LSUH 2VLLA 2VUOA 3F7RA 1XCTA 4OFYA 4Z8FH 1YN7B 1YMHB 4LASL 3S4SB 3TO4B 1A1MA 4HGMA 5C08D 1QFPA 5I0DA 3GSNB 1MCCA 1V8HA 3GRWH 2MOVA 2VXUL 1BVLB 1U36A 5C6TL 3U7WH 4Z7VF 5D2LA 1N6UA 3D39A 1BQUA 1D6EB 3QNXA 1TNNA 4GXUM 3H2WA 4XX1E 3ZLQC 2XN9A 5HPMB 3ES6A 3V6ZB 5INCB 5CEZH 2VN7A 2ZSWB 3L3GA 4YDIH 3IGAA 5GGRY 1AGCA 1U3JA 3MCG1 5FYKH 2V2XB 5TDNB 4Y4HD 3P4MA 1BJMA 4NKDA 5H8DA 1CGWA 4NQDB 4I9WD 1I8MA 4P2QB 4U7KA 5MP6L 1FFRA 1G7LB 4O4YH 3U4BL 5E8OA 5C09D 3N85L 1HCVA 2ENSA 4Q97A 3R4DA 2ESVB 4KK9C 35C8H 2O5ZL 1BJ8A 3FO2A 3MNVB 3BFOA 1P4IH 4FQXA 4O58H 3OR6A 3QCVL 4EN3A 2HJLA 1BOGB 5KSBF 3ZKQD 3U1SL 2HFGL 1M1SA 4HKZA 4I18C 4Y19D 5T1KA 5DDHA 4P2OA 3LB6D 3NABH 3E8UL 4YHYB 1MAML 4LPVA 4G42A 2P44B 1Z6JT 1UACH 5IROA 2CLZB 2G60H 5EZOL 3MV9A 1U3HC 5KN5A 1UFUA 1YNTA 3C8KB 4LARL 1JE6A 3VWKC 2VITA 1ZS8B 1N6QH 4P48A 2BMKB 3OPZH 3OAUL 4Q9RH 3C6LB 3VFMA 2QQLL 5LGHL 3BRFA 4P4RA 2V17L 2HVKA 1NMCB 4JO3L 3W0WD 2A6IA 2UZIL 5IHLB 4LCWA 2C4XA 3NGBB 4NZRL 3MRQA 3MZTA 1XGYH 2XWJA 4OF8A 3JTTB 1AXSB 3JUZA 4PY8J 1GC1L 4QRPE 5F7LB 3VFWA 4P2RD 3VGFA 3SY0A 4XVUD 2AV7B 1D5BB 1UGNA 3WYRA 1UJ3B 5GS1B 2AEQH 3AY4A 1SEBB 1MHCA 3RWGB 3KJ6H 1DJSA 4J3WA 4ZS7L 3TN0C 2ZOLB 3UZQA 3SKOB 3QCUL 4KRMB 1A9BA 4AMKH 1I8KA 4QXTB 1EDQA 2HKHH 4WUKL 5D6DC 3QH3A 4R90L 3SE4C 1KIQB 4H5SB 3VG0L 2DQEH 4P99A 3EYOA 3SCMB 1KPRA 3FO0L 4PJFE 5C0RH 2Q7YA 1MCNA 1QOKA 1BHGA 3BVNB 4PJ5B 3PV7A 1PJ9A 5D2NC 5GGUB 5D71H 1RK1B 4R96A 5HY9A 1PAMA 4M62H 2EKSB 2QKIB 5GISH 4HG4J 3QNYA 3HE6B 2ZNXA 2DL9A 2ZP0T 5M94B 5CZXC 4J3TA 3BH8B 4LFHD 2HH0L 4TTGA 1XZ0A 2WLZA 2OQJB 3U36B 2YD6A 3QYCA 4GAGL 4OLXH 1JK8B 2BRQA 2VXSH 4LHUB 4FQ2L 1ONQB 1T2XA 3ILQD 4XCYA 5GIRA 4XP1H 5GRVL 3CZJA 4ODXA 1QLFB 1JYXA 4J6RH 3ULUC 3GHEL 4JFXB 4H88L 5J6HA 5JHDE 2PYFA 4XCNA 4F80A 3TZVB 1MCRA 4OTXH 1TFHA 3U46A 2HJFA 4BZ1L 3CK0H 3MBEA 2PXYA 3NIGE 1LD9A 3NIFF 2NR6D 3UTSE 3HS0A 1P7QD 3SDAA 4F7TA 4JY6B 4LPTA 5L2KD 3CJJA 4ZFZA 3BKCH 5HHQA 2C26A 4YGVB 4BKLB 4OGAD 5GRUH 4JANB 2YPVL 4PJAB 2EZ0C 2K1MA 4JFYA 5KVGH 5BJTA 2X1WL 3L7FB 5IOPA 4MHHG 2Q8BL 3PWLA 1N8ZB 4JRXA 1ZAGA 4D9RE 4NCC2 3GBLA 5BW7A 5L2JA 4EVNA 1HK6A 1OP5H 1IRAY 3QPQC 3D6GA 5EUOE 3DBXB 2PW2B 3BEVB 3D0VB 5I74C 1GGTA 1OHQA 5FUCC 1QRNA 3L1OL 4HGKC 1I4FB 4PFEA 3EO0B 3DV6B 2J6EA 4OZGE 4OCLC 3ARDC 3UBXB 4GLRI 1WIUA 4YXKL 1JNLH 1RZKL 5DI8A 4PY7B 1J86A 2LU4A 1NBVH 3O9WC 5E24E 1B9ZA 2JK5B 3G04B 3IDYC 2APBA 4L3ED 3K7UA 1GOFA 2G9HB 5D2LE 5ERWA 4Y16B 3CFCL 3RGVC 1NLBH 2XN9E 1JHKH 4G6FD 1Q9WB 3O3DB 4AIOA 1JF6A 3TT1H 5DJZB 2ZSVB 2DJUA 2VXQL 3KPPB 5T1MB 2IALA 5HDQL 2AJZA 1EEUA 2RR3A 4WEUD 1NJ9B 3V6OE 1B90A 1CBVL 2VC2H 3F6LA 1LE5A 1QD0A 4N0UE 2E27H 3F8UB 2WIIB 3FT3B 1G7MB 3GSOA 1MY5A 3BT2H 4YR6A 5JZ7C 4UUJA 5KVEL 5K9KA 4DVRH 1UA6L 4GXUN 3D3VE 1A3LH 3WNNA 4XMKL 4C59B 2HFEA 2PUQT 3V9FA 5ANMA 4XPHL 4E0RB 3ARTA 2BCKA 3BP4A 4GRMA 2Y07L 4PRIE 1LO3H 4QHUB 3TO4C 1KCVL 1ZVSB 3ALWA 3CH1A 5CJ8A 2FIKB 4XCEB 3MODH 1K4CB 4Z5RB 2R2HB 1Z3GL 4CJ0A 5FECA 3FT2B 1KTLB 3QUXD 3ARFB 5HD8D 3EHBD 1QSZA 2K7QA 4YHLH 5EO0A 1NDMA 3QXDB 3DRTA 4LDLB 4OD1H 1RZ8A 2R1XA 2WWKO 4PY8I 1MCOL 2P5EA 4Y4FB 5AWNL 1U8OA 3DX6B 5JA8B 1YEKL 4OLYL 2NTFA 3KPSE 2ZOKA 4I4WB 1K3IA 5IJKC 2DIAA 1U42A 1UM5H 1YPZA 3FN0L 3GB7B 1JNJA 4G9DA 2BNRA 2XFXA 1TJGH 4L4TD 5FO9A 3JVGA 5AG9A 3MA7A 4IOIB 3A6CL 1I9IL 3WFCL 4X7DC 3IJYA 1FSKB 4IMLB 3FQRA 1SJVA 2AK4A 1MRFL 2CLVA 3P9WB 4GQPH 1KJVA 3BPOB 2VWEE 1KJ2B 3P9LB 4NQCE 1FVDB 3BP6B 3O6MH 5E6ZA 3ARBB 4HPYL 3ELAT 4M8QB 4ZXBD 4PJXA 5KSVA 3I3BA 4O5LL 2XZQL 1DE4A 1K8DA 3IJHB 3SGDI 3BQUA 3QUML 3ZT7A 1M7IB 3MXWH 1UM4L 4PLKD 1GL4B 5CZVH 1A7RH 4J1UB 2FHCA 3ORJA 5C0AD 3BGFB 2RGSA 4G8GD 4MA7H 5C0JB 3UTQB 5CUSL 2NY4D 1IGCH 1MCJA 1KF9B 1F3DH 2BNUB 3NFSL 5DO2C 1YECH 3T4YB 3ZYOA 1PG7W 4FTVB 1GH7A 4ZUUA 4X6CA 1S5HA 1KCUL 1JCKA 2GTZB 4YHKH 1DN0A 3L9RA 3C6LC 3VRIA 2CRYA 5J4MA 3BKJH 1G7JB 2BY0A 1HHGB 1NMCC 3LKNB 3HB3D 4WHDA 3IXTA 3B2VL 3NGBC 4JM2A 1HHHB 3LQAL 4I0PD 2YEZB 4DW2L 5A40E 3ZTNL 3DRQB 3FHAA 3ZKNC 1S5IH 1FV1A 2XA8L 5DQDL 5GS0H 3K2UL 4DJMA 1OF2B 5HYJA 1UJ3C 3L6FA 3QIWC 1X5FA 2XY1A 1X5LA 5GS1C 4PB9L 1QQDA 4RNRA 4OD2A 1XF3A 3SDXB 1SMAA 5BZWB 2BHZA 5F7HA 3CUPA 5I30L 3RTQA 1E4WH 2GJ6A 1N0XL 3QQ4A 5DK0B 4YO0A 1SYVB 2AERT 3V0WL 1QBLL 4JY5L 3SCMC 1XGUB 1WK0A 3VW3L 3LKSB 3RNKA 2B20A 2D03H 3LOWA 4NC1E 1QFWL 4M7KH 3VDAA 1UZ6F 1CGXA 3RWFA 4FNLH 5BO1L 1BJ1H 2IG2H 4PJFB 2NLJA 2LQRA 3LV3B 3HE7A 5IQ9A 2B2XL 4PLJD 1IAOB 4JQXA 1KT2B 4Y89A 4IRSB 5E5MA 5DMJB 1FN4B 3MRNA 4XVTL 3HE6C 2HMIC 5SWZD 3MGOB 3VDBA 3QUYD 4N0FB 4BUHA 3SGDH 2FH8A 1HI6B 1S8DB 3PHSA 4ONGL 1LEKB 3W9DA 4HKJA 3P4NB 5DUPL 3TH2T 1H0DB 4RGOL 3UYRH 2MFNA 3RY4A 3T2QA 1RHHA 5EO1B 3D9AL 5E1AA 2G5RA 2H2PC 4NHCL 5DZNA 5DJDB 4PBVC 4OZHE 1G0YR 5SV4A 2YN5A 4H1LH 3E1F1 5HHOA 4QHMB 1DDHB 3GJFH 4Z95L 1YN6B 3WBDA 2NXZD 5IV2A 2QTEA 1MAJA 2FCBA 2NYYC 4Z7WA 3VXOB 1QRNE 43CAA 4YHNA 3AREB 3CC5B 5GGTL 4OZIF 2D3VA 4Y8AA 1PZ5B 2X41A 4GRWH 1OY3B 5MERA 2GEEA 5CKAA 4MZ2A 5BZDA 5LGJB 1SYSA 2ZCKL 3MO1B 3TZVC 5DRNB 4APQD 1T7XA 2DB8A 5I16B 5FYJE 4WJ5B 1FDLH 3QDJE 1T1ZB 1QR4A 4KROB 2XNAA 3E2HB 3L3IB 5ESAB 5GGSB 2W0FA 4H0IA 1J18A 2VSDA 3HRPA 3NZ8B 3D85A 4YDLB 1A6AA 1S9XB 1U41A 3UTSB 4N5ED 4UT7H 4PV9B 5HHPA 5DC4B 3GMRA 3KVQA 3VXUA 5CJXA 4GMSL 4UB0H 4HX1B 3VU2A 4Y5XA 4PJGF 3RIAF 5JXAL 4LVHB 2EYSB 1NCCL 1NCDH 1GIGL 1KTDB 1F58H 2HT3D 4ELME 4JDVA 3X13A 1AE6H 1C5DB 5H37G 5BS0E 4JE4B 3KYKL 4HUWB 1N5AA 3LKRA 3S3PA 3MA9H 3ZZ1A 3PL6D 2D2OA 2ADGB 3ILPA 5ANME 2VZ1A 3RZCD 1OGAD 2BVEA 2QQNH 4MCZB 5KW9L 1K8IA 2IEPA 4X99A 4RMRA 4HGWA 4QRQA 1KCLA 2VLLB 1U8HA 5CEYA 4KV5E 4RX4A 3EJYD 2HRLA 4WI5A 4WI2A 3MRDA 4OZGB 2AQ2A 2FEEI 1NC4A 1QYGL 2R1WB 4Y16C 5D1XD 3MLZH 3WFBH 2VDOH 2KPNA 5F7EL 4X7SH 5D2LB 3D39B 1RK0A 2WBKA 3QNXB 4HBCH 4YXHL 2XN9B 4ONFL 3ES6B 5CILL 5JDSB 1LEGA 4X0KA 1MFEL 3L3GB 1HHJA 3IGAB 3BO8A 1AGCB 1G9NL 4JREB 3ARGB 3T0WA 1U8PA 4NRYA 4D9QE 3RKPA 1GXEA 1QKZH 2WP3O 5TQ0H 2BNRE 3P4LA 3L3OA 3CFDA 3BH9A 4NKDB 4WFFE 3VMOA 2Y23A 3O4LD 1FE8H 3QAZB 2J4WL 1UKTA 3NTCL 4UINH 4I13B 1NAKL 1JGDA 4K3DH 1WICA 5E8OB 2A73B 4M4PA 5C71A 1QZ1A 2YZ8A 3FO2B 7FABL 4D2NA 4G7YL 4FQXB 5DJCA 3RU8H 5IWLC 3OR6B 3EYQC 3PJSA 4EN3B 2HJLB 3JWDH 5DD3L 4HKZB 5T1KB 4PRIB 1OTUC 4P2OB 5FF6B 1N5YH 2FJFA 4JFEA 3H3PH 1LDPL 1AKJD 3ARFC 3IDXL 4G42B 1WITA 1S3KL 2XWBA 1RFDL 2VDRL 3KR3H 4LCUA 4XC1L 5TF1H 3B9KD 1GPOH 3EYFA 1I1YA 3TPKA 4LSQH 3QSKB 2NNAA 5GRJL 2DTMH 5C08A 2V9RA 4X6CE 4Y4FC 3S6CA 4Z7VA 5KN5B 4ZAKD 1YNTB 4M3KB 5EIVA 2VITB 2YK1H 4S1RL 5JA9A 1Q1JH 3IFOB 5ADOH 5JOPE 12E8L 3B43A 4ODVL 1DUZB 3FTGB 1V7NH 3S34H 4RIRA 1FG9C 5K33A 4P4RB 2HVKB 2Q7NA 3WJLC 2A6IB 1CFTA 3HI6L 4LCWB 1FSKC 1KB5L 3MRQB 4XMLH 2BY1A 2BVPA 2XWJB 3GIZH 4AQOA 5L6YH 4UBDC 3BPOC 32C2A 3ARBC 1NEZG 1CWVA 3SY0B 1YJDH 4M6NL 4U1NA 3H42H 4K3JL 3DARA 4YDVA 3R0NA 1RIUH 2P7TA 3D48R 5LKNA 5SV3A 4QY8A 3KDMA 4GS7B 1MHCB 5KSUA 5C09A 1OP5K 1DQMH 1A3RL 1ACZA 5TE6L 1AGEA 1I85C 4HWZA 1X44A 1A9BB 1I8KB 1MF2H 3WS6A 3QH3B 1WWAX 2YR3A 3BGFC 3ALPA 3EYOB 2PTVA 4S0SD 4I3SH 1ZVHA 1W8NA 4Y19A 2R29H 2Q7YB 4AL8H 3FRUA 1DSFL 1BAFH 1VENA 4M7ZC 1EVUA 2I24N 4MA3B 4DN4H 1RIHL 3VI3F 2EEAA 1LO0H 4R96B 5HY9B 1ZHKA 4U3XA 1J8HE 3QNYB 1S9WA 3HLAB 2DQHL 1C5CL 3O6KL 4QHLA 4K9EH 4XXDB 3U7AA 2A6KA 4F57H 4R6UA 3NIDF 4NFDA 4MDIA 3V6FA 3EKCA 1PX4A 4TRPL 1UM6L 4JKPH 3MRKB 4JHAH 4NKIL 1XZ0B 1T0MA 5HHOE 4FABH 2EDDA 3W0WA 1KCSL 3QUMA 3LS5L 4LLDA 5FO7A 4YBHA 1ED3A 4XCYB 4YEEA 5EOCL 5GIRB 4P2RA 4ODXB 3BN9C 3W5MA 4RGNE 3KYOB 5J6HB 1C7TA 4DEPB 2A9ML 2E7HA 4YBQD 1ZLWH 1FNHA 5IFAL 4G6KL 4PUBL 3T4AA 4LKCA 3O2DH 4R26H 1EGJL 4TNWK 2QSTA 4RGMB 3GSUB 3BUTA 3MXVL 3U46B 1ROWA 3QDGD 4IRSC 4OZFB 4G6MH 3RJDA 3MBEB 2PXYB 1LD9B 3HI1A 3WNMA 1FNGA 1WIOA 3ET9F 3HS0B 3SDAB 4HWEH 5B38A 1UB5A 4F7TB 2ITCB 5EU7E 4ZFZB 5HHQB 2GUOA 1QRKA 4JN2B 4EDWH 4QXUL 5E2TH 4P9HH 2CK0L 5EB9A 5I1DA 4NUGL 1CQYA 1FNFA 3DYMA 2AVGA 4NO2A 2HTLD 3L3DA 5FK9A 5CSGA 3KPNA 5BJTB 3MZGB 5IOPB 5KSAA 2E7LA 3PWLB 1T21A 2HT4D 1JWUA 1DQTA 4LPXA 4XP6H 2V6HA 4JKMA 1AHWB 5L2JB 1QHOA 4EVNB 4PRPE 3AREC 3DX7A 3MC0A 1YEHL 4LARH 3VFPA 1S78D 5ID0A 3CVHL 5IMMA 1ETZA 5I17B 3RDTB 1QRNB 2UUDH 2AJXL 1EBPA 1C1EL 1OAUL 1RMFL 3G6DH 5LGHH 2OTWA 3MUJA 4P59L 4Y88A 4KJQC 5LXGH 2YWYA 3L7EA 2W07A 5L9DL 2IPUK 3QQ9D 1CD8A 4KROC 4ZTOH 2QL1A 3E2HC 5DI8B 5IEHA 1MCLA 2DQDL 2RJMA 3OZ9L 1WISA 4WHYH 4OLWL 4YDLC 5F97E 1WTLA 3GM8A 3QDJB 3DLQR 5I6XB 1NMAH 1AP2A 4HJJL 4DN3L 5F7UA 2X4PB 5GGQL 2BSRA 4WDIA 2VMFA 1ZV5A 4MAUH 1H15A 3V6BR 4M7LH 2NY5L 3WUWB 3QCUH 1P7QA 4LVHC 4O00A 3CVIL 4XBPA 3GUTB 2IALB 5L2KA 1FNAA 5T5FH 4WFED 4HH9B 2DQIL 3GSOB 3FO0H 4YR6B 2ZUTA 3X3FH 4UUJB 3LD8C 9CGTA 2R9HD 1EBAA 1NBQA 2MHAA 5DJYA 5IBTL 1KIRA 3OJDA 2C3XA 2BRRH 4JO1H 2EH7L 4M03A 2HFEB 5JPMA 5CBAB 5C9KA 1QLEH 5ANMB 1RSFA 3BP4B 3BEWA 4FFVC 3ZDZE 2EE3A 4BZ2H 2FDBP 3EAKA 1NAML 2FGWH 2DS4A 3CH1B 1FPTL 3BDXA 3PG2A 1ZT1B 5KZCB 2OSLB 4OB5L 3WSQH 1L9NA 4FQCH 2NY6B 4ZUTA 5FECB 4RFNB 3B9VA 4ZO9A 3DUUA 4K7PY 3DMMD 3HZVB 5C08E 2F5AH 5EO0B 2FO1A 1OPGH 1NDMB 1AGFA 3TJHC 3DRTB 5FV1L 1L7TL 4K8RC 3I6LE 3MJ9L 1RZ8B 4EXKA 2QV2A 4L3EA 1X5IA 2R1XB 5CINH 4ZPVA 1FGVL 4JREC 3ARGC 4ZD3H 1U8OB 4XVJL 3WHXA 1T7ZA 1VACA 3C5ZA 2ZOKB 3BUYA 3EYVB 3OKEB 3V6OC 3DVGA 3LAFA 3VXRE 4G9DB 2BNRB 3GSQA 1YEEL 3QISA 1CGYA 4CVUA 1I7RB 3V5KA 4QWWC 2AK4B 3GBNL 4ZG1A 4I9WE 1ZHBA 5I1HH 3O0RH 3WXWL 2PO6D 2XA3A 4FQXC 4NO5A 1KJVB 5C0EA 3GJFK 5C09E 4ZDHA 4PRAB 3UMTA 4RCAA 4AIZA 1YNLL 4EN3C 4UQ3A 1FYHB 5KSVB 2VQ1A 5C7XL 5KSBE 4CMHB 5HYSG 1K8DB 4P2OC 4UMGA 5C0NC 3NAAH 4KFZC 8FABB 3BQUB 3DROA 5HVFB 1TZIA 3MUZ1 1C8PA 4OAWB 3GK8L 4G43A 5IROC 5GZOD 3ZE1F 5DLMH 1A4JA 1NCAH 4N1EA 2VR5A 1OQXA 5T3ZE 3ETBF 2I5YL 2X42A 5CGYD 1FO0L 4ORZC 5DA4A 5F6HJ 3QUXA 4JO2L 5GRXG 2DQJH 4X6CB 1DBKL 2BXYA 4GKNA 4NO3A 1DN0B 4KKAD 3VRIB 3JBG7 4LRNL 1H8SA 1FZKA 1A5FL 5FHAH 4DGIH 3OR7B 1H3PH 3IXTB 1I7TA 1I9JH 3CX5K 3QIUD 3BRGC 2F53E 4JM2B 5IFHL 1G0XA 4WWKD 3TM6A 4JQVA 5GS2D 3TA3B 2E7BA 1OOAA 1FV1B 3W0WE 4H8WH 4NNYA 2P42B 4O2FA 4F3FA 1WBZA 4F7EB 4L4TA 3UPRA 4TQEH 4YK4B 3CMGA 1QQDB 2ADFL 2VWEC 3MLVH 4GS7C 2J1KA 3M17A 3KPOA 5DMIL 4P2RE 2FX9L 5T1DH 1IZKA 1MWAH 4RAUA 5D7SH 3RTQB 2KQNA 3EOAA 3DUHA 2GJ6B 2R15A 5FA4B 2GY5A 3QQ4B 1U2HA 2Z35A 4YO0B 3GKWL 4FXLA 1NDGB 1PY9A 4EUPG 5F96H 3UJJL 4ZXBA 3QT2A 5EBWB 1T2QL 3RNKB 1QSFA 3W11C 1FFNA 3ARUA 2VQUA 3GO1L 3RWFB 1KENL 4L9LB 1RU9L 5AEAA 1GGUA 1I7ZB 1JTOA 3HE7B 5IQ9B 5C0AA 5FCUL 1MEXH 4XGZA 2CUMA 5CIPA 4G8GA 2D7TL 4JRYE 3OXSA 5E5MB 3MRNB 5E2VH 1KB5A 3HI5H 4KPHL 3QDHA 1MFBH 1QA9B 3Q0HA 3W9DB 4EEEA 1H3WM 1DBJL 3PF2A 4ZOEA 3PABA 4HWNA 1JZ8A 4U1GB 2HG5A 5DF0A 1RHHB 3QWOA 5E1AB 1HXYA 4HUMB 4Q6IA 1CFQA 2KH2B 3BD4A 4I0PA 5HHOB 1Y18B 4HFWA 2C3GA 2BJML 3ROOB 1BQLH 1CU4H 3UPCA 1EAPA 1T22A 5IV2B 4PRBA 4LK4A 1JZ6A 2R2BA 5DD1H 1FHGA 4X80H 5DMGC 4Z7WB 43CAB 3AMKA 4YHNB 4UU9A 2O26U 2ICWJ 3KYNA 4E9LA 3V4VH 4DEPC 2OR9H 1CLYL 5T3ZH 2OTUB 3OJMB 5MERB 1JZ2A 1IBGL 5BZDB 1PSKH 4N0RA 1SYSB 1ZWIA 4NC1C 1J0KA 1BD2E 4X7EC 2BFVH 4RGMC 1U8IA 5ILTL 3MJ7A 2BY2A 1QFWI 2XNAB 3MBEC 2PXYC 4K2UH 5F71A 5JO5A 5LVEA 4AJ0A 4CU6A 2W0FB 3NIFE 3NH7H 1CR9H 1KBGL 1T1XA 3F5WB 5D93B 3RY5A 3SDAC 5MEOA 5IP4A 3D85B 3KYMA 1UXSB 4GRLD 2AEIT 3TBTA 3MLRH 3TYFA 5AYQA 3GMRB 3VXUB 2EC8A 2MPAL 4X83A 5CEXA 4Y5XB 5SWZA 2JKXA 3QUYA 4OIIH 1MQKL 3TIEB 1U8JA 4HEME 2XKUA 5IB1B 1VGKA 4KMTL 3ARVA 5JQ6L 1G7QA 4JDVB 4CVWA 2D7NA 1AHWC 1MIEL 3U82B 1VCAA 5CUSH 3KJ4B 2FO4A 3QHZL 3RVXC 5ITFA 4QXGH 3F7YA 1N5AB 3LKRB 5ALBH 2FYYA 3OKDA 2Y06L 3ILPB 1P1ZB 2IBZY 4X9HA 2XKNA 3EGSA 3RDTC 5DEZA 1K8IB 1KCUH 3FCTA 4OM0H 1EGJA 2OP4H 1B4JL 5AYUL 4OZIA 4HGWB 2ICCA 3NCJL 2HLAA 3RIFK 3VFNA 5K9JL 5CEYB 4W68A 3T77A 1AY1L 3MRDB 3LCYA 1RUPH 1NC4B 4M8VA 5DR5L 3EIFA 4DW2H 1BZQK 4R4FH 2H3NA 3RBSA 5I6XC 2DQTH 4OLUH 4GQ9H 4F8TA 4BK4A 2WUCH 1TJIH 1AXTL 1CLOH 3SKUD 4APQA 2IFGA 5EOCJ 1RK0B 5BVJA 1MCQA 3N1MC 2DQGL 3I2CH 2F19L 1OAYL 1NGWA 3OAYH 1LEGB 2N56A 4X0KB 5E2WL 3H9YA 1EO7A 1HHJB 5I15L 3BO8B 1U8PB 4NRYB 3LY6A 3STBA 3L3OB 3CFDB 3BH9B 1RZFH 3ARYA 1SEQL 5J13B 3B9AA 1OCWL 3HUJF 4P3CH 5D70L 4RDQF 1RZGA 1JGDB 2APTA 5C0CD 5DVNA 2EE2A 3WD5H 2X89D 4L8CB 1R0AL 5JXED 4HXAH 5DJCB 4KI5D 4HZLB 3LKQA 3PJSB 4JFZH 4AG4L 3RZCA 1OGAA 5F6HI 3LDBB 1QFUH 4KI5F 2FJFB 2NY6C 3UTZA 4RFNC 5HHME 1I9RL 1CFNB 4ENED 1ZLWK 5BMFH 1EMTL 2XWBB 3K74B 4POUB 4LCUB 4OCRH 1J0HA 1Y6KR 3MGTA 1E4XL 1I1YB 1JGUL 2NNAB 4IHOA 2JCCE 3MR9A 5C08B 4Z7VB 3QEGH 1GCFA 5D1XA 4QHNA 4ODHL 5EU4A 1LGVA 3U0WH 4WI8A 3OKOA 4OJFL 2EDJA 2OZ4H 4WW2F 1E4KA 4HUNB 5HVHB 5DVOA 2PN5A 4LF3A 2PCPA 4W4OA 3VXSD 3JVGC 3MRMA 5C8JA 2G75A 2BOCB 1CFTB 4HMCA 2O5YL 2WINA 3VXRB 2BVPB 2W9EH 5EZIL 4Y4HB 4L4TE 4JG0L 3BZ4A 3TVMC 32C2B 3T1FA 3O4LA 1NAMA 4U1NB 5ICYA 5D72L 4YDVB 1HQRA 3I6GB 3Q1SL 4CMHC 3LIZH 2P7TB 4B53A 2OBGA 3KDMB 1QSEE 4MWFA 5C09B 4ZO7A 2W0LA 3NA9H 3VCLB 5JOFA 5JW5A 5KSUB 1X4YA 4HWZB 1YZZA 5KSBB 4GKZA 5IQ7H 1V3LA 2MNUA 2UUDK 1BVKA 2IQ9H 3MJ9A 4GSDH 1MHPH 5IHUL 2YS4A 3JTSB 4BA8A 1JGVL 4U1IA 2FHBA 2DMBA 5C0AE 2Q20A 3SJVD 2DLTA 4G8GE 1AKJA 3K1DA 2CXKA 4ETYA 4WWID 3IFLL 3D0LA 5DJ6A 5IW6A 2F8VA 4LSPL 1ZHKB 3B9KA 5KW9H 3PQYA 1T66D 4FQ1L 1NL0L 3WJJA 2VLMD 1S9WB 4YDKL 4JM2C 4ZAKA 1S9VB 4QHLB 1UYWL 2A6KB 3TA3C 1B4RA 2CDEA 5IB4A 4MDIB 3V6FB 1JRHH 2GK0A 2ICWI 5DZLA 1T04A 4V2CB 2HLFC 2AABL 4OF7A 4YK4C 3SGEH 2K9UA 1YYLH 4F8QA 3W0WB 3DYPA 3EW3B 2NY3D 3QUMB 3NFPA 4FMFA 3RTQC 3U9PL 1ED3B 1K6QL 1XT5A 1GRWA 3P0VH 3JV4A 5K59F 2OX5A 4P2RB 1W0WA 3CSYB 1KCRL 1MLBA 1ACYH 3KXFD 4LBEA 1RAMA 1FO0A 4UDTA 1S7RA 4MNGA 1L7IL 4DKDC 1UZ6E 4L9LC 3T4AB 2Y4SA 3HAEG 4LKCB 1PKQA 4M7LT 3HE7C 4JQXC 3MACH 3BWAB 1TJHH 3C8DA 1MRDL 2AJVL 3HI1B 1FNGB 4IS6A 2NY2D 5B38B 1UB5B 3GI8L 2XTJD 3CMOH 2A6DA 3LRSA 4XWGL 1GC1C 1JYWA 3WCYA 1ZTXH 3RVUC 5ICZB 1OT2A 3HMWL 5JUEH 5SWZE 4OCSL 3QPQD 4U1GC 1OM3H 3DSNA 3HC4L 1JN6B 3IDMB 4NO2B 1F97A 2DLHA 3QG7L 3L3DB 5FK9B 5I1IL 2YPLD 1NANI 5JPNA 2WMPA 4MMXC 1T21B 1J0ZA 1JWUB 1S7SA 1T7WA 3T8XB 1CS6A 3MREB 4JHBA 3MFFA 3R1GH 4B5EA 4NQSA 2A0LC 3VFPB 1QTYT 5F7DA 4OZIE 5IMMB 1NLDL 2RAMA 4KXZH 1IEBA 25C8H 2YD8A 1ETZB 2EYTA 1YEIH 3MLXH 3QEQE 3TIDA 5GRWA 1SM3L 4GW5B 2ZJSL 4NZTL 1VEOA 5DHVH 4PREA 2OTWB 3VXTA 1YY8A 4JM4L 3L7EB 1H8OA 4OCNC 4RFEA 4MQ7A 1CLZL 3PDGA 4FG6C 5CJOL 5IEHB 3MJ8A 1IEAA 1BD2B 3Q2CA 4L29A 5HHXH 5D93C 4PJDF 1T7YA 3QEUA 3QFJD 3B9EA 1AP2B 4L4JA 3H9SE 3QFDA 3S7GA 2A1WL 2BSRB 4WDIB 1J88A 3LEVH 1TPXB 3KS0J 4FFZL 4MSWA 1H15B 3QDGA 5FO8A 3LQMA 4KVCH 1BBDH 5DRWA 4Y5XC 1P7QB 4PJGE 2VISA 4QRTA 4XBPB 5T33L 3IKCA 5HDOA 3RUGF 3QJFA 4HUVA 1HXMA 5L2KB 3EFFA 4GAJH 4PGDB 3U4AA 3VXME 4G80A 2X4RA 4LLQA 3MV7D 3KJ4C 5FXCH 5IW1A 5I1KL 4KK8D 2I60H 2CSPA 2WSKA 5F7MC 5DJYB 1IILE 3TO4D 1UCBH 1KIRB 1D5XA 3WDIA 1EJOL 3OJDB 3HNSL 3HC3H 5DVLA 5JW4R 1FGNH 5JPMB 1HH6A 1B3JA 2JJTA 2AKRA 1X5XA 4S1QH 1OGAE 3L5XL 3BEWB 1S7VA 3NACH 5E1HB 3FQNA 5D8JH 4UV4H 3SQOH 5H37H 5FHBL 3GMPB 1LO2H 3M8OL 3HN3A 4NKIH 3DUUB 1KJ3H 5DSCA 5IBUB 3MSPA 3IU4H 1AGFB 1BPVA 4DAGL 4OLVL 4HLZG 1SQ2N 2JB6A 4UILH 4L3EB 4ZPVB 5MEND 2AAVA 4KKLD 4LLVA 1II4E 1VACB 4TSBL 5GSVA 3WHXB 4G6FB 3K8MA 4JJHA 3MJGX 3BUYB 4P4KD 1XGRA 4R97B 4N0YH 3WLBA 5J13C 3VH8G 1F00I 3DVGB 3VXNA 1MFDH 5JMOC 2WW8A 3GSQB 1BREA 3CXDL 1N26A 4KZDH 1V7MH 3V5KB 5E4IA 3F12B 3O4LE 4IRZL 4FN0A 1WEJL 2GT9B 1ZHBB 5KJRH 5IHBA 4NO5B 4YXLL 5C0EB 1OL0A 5LCVL 4AIZB 1DLFH 5I1EH 4UQ3B 4V2BA 3S96A 4OD3H 2VQ1B 3OGOE 2AJSH 4QLRA 3LDBC 4QXUH 3V52H 5KVDL 5DK3A 3FMGL 2HJKA 3DROB 1GAFL 1TZIB 4CVZB 1P4LA 3ZO0A 1F4YH 5SX4I 3C5JA 4S10A 4G43B 5HHMB 3UC0L 2B7DT 2GAZA 1A4JB 4H20L 2CO6B 3T0VA 5I2IA 4QNPF 1VA9A 1CVSC 1MHEA 4RRPG 1LQSR 1IC1A 4UIKH 3QUXB 4L1HA 1JNNL 3DMMA 4GKNB 4NO3B 4AEHL 3MCKA 4K3EL 5KTEH 1B0RB 1SMOA 3QIWD 4UOW0 5EO9A 4BFGA 1FZKB 3I75A 3IT8D 3B3IA 3NOIA 5JW3H 1DVFD 3JWOH 3D18A 3EYSL 4Y4HC 2DI8A 2D7PA 4OCXL 3MBXH 4NNYB 4O2FB 4F3FB 1WBZB 2Z91A 4L4TB 3V4UL 3UPRB 4KWUA 1SBSH 5CCKL 3M17B 3U2SA 3KPOB 1I7UB 4QXWA 3ZSSA 4RAUB 3MJ6A 2W9DL 5J57B 1JPTL 1YEFL 5DD5H 3EOAB 5C0FA 3WS6C 2NY5H 2PO6A 4NBZB 2VOTA 2Z35B 5F8QC 2CIKA 2R39A 5FYLH 4MXVF 2ED8A 4S1SH 1HZHH 4FFYL 1FFNB 1NFKA 3P0YH 3LB6C 3BYTA 3TT3H 4WU7B 1DBBH 1JUFA 5FUOH 1W0YT 5C0AB 4XGZB 2ZCLL 3VFUB 2J88H 1CZ8H 4G8GB 2ICWB 2COQA 2H2PD 1FG2A 5F88A 5HGBB 4L4VD 2NY4B 1KB5B 1OW0A 4U6VL 2XZAL 1KGCE 1F11A 3OAYK 4P5KB 1P7HL 4ZPTA 3MRHA 4IDLA 1SY6L 2YUWA 3PABB 4U31A 1RZJL 4W6XB 4AK1A 1IKFH 2HG5B 2XZZA 1X9QA 2XZCH 3QWOB 3QIUA 1HXYB 4Y2OA 4YHIA 4Q6IB 1CFQB 4KQ3L 4I0PB 4WWKA 5EOQH 4HFWB 5FDYA 1Q0XH 3GI9H 5DQ9A 1CGSH 5BV7L 1EAPB 1T22B 2DBLL 4PRBB 4U6XA 2R2BB 1DQJA 4XVUC 4KY1H 2DMCA 4N90D 1CFSB 3KYNB 3SE9L 3TESA 3AS2A 1FNEA 3MRLB 5KOMC 1J05A 1Q9KA 1ZWIB 2E6PA 1U8IB 4HV8A 1J5OL 1CK0L 4D9LH 4XAKD 5IBLD 1UXWB 5D7IF 5JO5B 5CEZD 1QBAA 4HWBH 3FQTA 3LQAC 1T1XB 4OZ4B 5MEOB 4MS8D 5GS3A 1IL1A 3L3HB 5FYKD 3X3GH 3QDGE 4UTBL 4OBSA 3TBTB 4I2XA 3TYFB 3LSOB 3ROLA 1KUMA 4NRXB 4MX7A 1JMZA 1M05A 5CEXB 2NZ9D 5SWZB 2IAMD 1CFBA 3QUYB 5D7KD 1CIUA 3WN5B 2E7LC 1U8JB 2FECL 3GEWB 3EO1A 3WIFA 1VGKB 3N1PC 3MUHL 4DK6A 1G7QB 1RZ7H 4BUGA 1QNZH 4OBRA 2V5YA 2FO4B 4HC1H 4XPBH 5EOTA 2C1OA 3G5XB 2WV3A 2FYYB 4P2CG 2ZPKH 4YZFF 3OKDB 3CSPA 2XKNB 3EGSB 1YQ2A 3FCTB 3U9UA 2Z8VC 4RA3A 4OZIB 3ILQC 2HLAB 2NXZB 1E6JL 2YMXL 1F42A 1A5FH 3VFNB 4M9OA 3T77B 4GG6F 3KLDA 3REVA 4FOMA 2ZZUT 4XPTH 5C3TA 4PP2A 1AJ7L 4DTGL 2E8ZA 1KXVC 1YNKL 4OKVA 5DJ0A 1OP3H 2R4RL 2WUBH 3QRFM 4APQB 5EA0L 1JZ4A 1TPXC 2AK1L 4HK3N 4NBYB 3GMLA 2NR6C 3SOBL 1H3UA 1NGWB 1YEGH 2B39A 4HSQA 1PGRB 5E5UB 4GRLA 2DBJA 1FORH 4OGAC 5D7JD 4PJGB 5IVZB 3VD9A 3VFGL 3F58L 3EYQD 2A77L 2FX8H 3LZFH 2IGFH 1F13A 3CVHB 5DUML 2FWOA 1F90L 2I07A 4OQTL 3T65A 5FDWA 3MLWL 1IQWH 4DQOL 1P84J 1R3JA 2FATH 3HKFA 5JIPA 1ODAA 1DEDA 1MCPH 4NP4H 5E9DA 4PJEF 1ZEAL 5FOBA 1VPOL 4K55A 4QRRE 4JFPA 3PL6B 3K1KC 3RZCB 1OGAB 1VFBA 4PGBA 1QBBA 3AS1A 1Q8MA 3F7VA 1DANT 1NFDF 2E7MA 3UTZB 3MV11 5TQ2H 2ZG3A 1JPSL 1CXKA 4ODTL 5FGRA 2YD7A 1LVEA 3B5GA 2WWMD 3MGTB 1XAUA 1OLZA 2CO7B 4IHOB 5D9SA 3MR9B 1VKXA 4BZYA 1RIVL 4NM4H 4M1DL 5D1XB 1IFHL 1OAZH 3QXAA 4QHNB 5BXFA 3MLTA 3OKOB 1BQHA 4NJAH 2V5TA 4R97C 1F3JA 4JPWL 4LF3B 4S1DC 1JWSA 1FAIL 2PCPB 3BP7B 4N8VG 1LK2B 3MRMB 3SKJH 5C8JB 2G75B 4XNQA 1BWMA 3MV01 4NM8H 3MLSL 5J0BA 3BZ4B 1MREH 5E8NA 3O4LB 1NAMB 3DOSA 4DCQA 5ICYB 1HQRB 1JV5A 5H35A 4NGHL 4F7CA 4MWFB 3RAJL 5C0CA 5JW5B 2RFXB 1CGUA 1PEZA 2X89A 4Z77A 1DQQA 5TPWH 1NGQL 1NGZA 4GKZB 4UTAH 2FR4A 3PP4L 3U48A 2F54E 1BVKB 1VEMA 3QI9D 1O7SA 15C8H 3ESUF 3ZE1E 1G9NC 4KMTH 3L5WA 5ACMA 3SKMA 3MOBL 1M7XA 3KLSA 4YFLF 4UQ2A 3QUXC 2VDLH 5HD8C 5D4QA 3WV0A 5LQBL 3EHBC 2Y06H 1E4XI 5ELIA 2CGRH 5DJ6B 5IW6B 2RCSH 2XT1B 3EO9H 3B9KB 4LLMA 4QRPD 5I1CL 3DGCR 5FUZL 3BDYL 2C3VA 1DQDH 4CRPA 1DBAH 4ZAKB 4JFQA 1PG7X 1OVZA 4JQVC 4NWTH 5IB4B 4JVPA 4DFHA 2GK0B 3BIAX 5T5NF 3T0AA 1T04B 4QF1B 4U1JA 3GZKA 2BNQE 3VXSA 1RUQL 2IBZX 4UIMA 4BQ9A 1XH3A 2G2RB 3SN6N 3NFPB 5L7XH 1E6OL 3ULVH 3M07A 1J87A 1R5IB 3JV4B 2WK2A 3NCCB 3QZWB 4PD4K 2Q86A 4JPKL 4LSSL 1HSAA 4MMZC 2ATKA 3RL1A 4IMKC 1MLBB 1D5IH 2X4QA 3B2UD 4CN1A 4LBEB 1FO0B 4UDTB 2IC2A 1S7RB 4MNGB 2X09A 4PBWD 5D2NA 4KHTH 2BSSB 1NBYA 2MQ3A 2AXGB 1PKQB 4LSUL 4XB8A 5GHWH 1UWEH 3IDIA 2DYPD 4Z8FL 2NY4C 4IS6B 3DV4A 4HJGA 1AI1H 2GQHA 5HYQB 2C7UA 3LRSB 2PYEE 5D5MF 4KK5D 2F8XC 3U7WL 3E0GA 2CD0A 1B6UA 3HB3C 3IETB 5CEZL 4Q6IC 4LCIH 1EMTH 5JPNB 4YDIL 4I0PC 5JHDD 4CMMA 4N5UA 1FLTX 5FYKL 1KULA 1P53A 3ABZA 5JIHA 3T1WA 4O02H 3I50H 1IAMA 4Q6YA 4RWYH 1T3FA 4CN4A 2DM2A 5F7DB 1MFCH 4WFGD 4O4YL 4WTZG 2EYTB 2HRPH 1I1AD 3QEHA 1A14H 4HG4K 3TIDB 2Z92A 35C8L 2YOCA 3PXHA 1TVHB 1ZANH 4PREB 5ICXA 3VXTB 1P4IL 4RFEB 4MQ7B 4TNWF 5DD6B 4O58L 2DIBA 4AQ1B 1SVZA 3T04D 1V3JA 3MJ8B 1IEAB 4L29B 2ICES 3KXFA 4RA0C 1CD9B 3QEUB 4LLUA 4NRZB 4CADA 1SY6A 2IFFH 3NABL 3QFDB 4LLWA 4NPYA 1YEJH 4PLJC 3KG5A 4MSWB 3QDGB 5DEGA 3NBNA 1X5HA 4LDOB 5DRWB 1UACL 4ONHB 3RI5K 2VISB 3QUYC 4QRTB 4CU7A 3IKCB 3WN5C 1E27B 2G60L 3QJFB 4HUVB 1HXMB 1I8LA 3S8WA 4G80B 2CLRB 2X4RB 3WEXA 2R1YB 4LNVA 1YMMD 5EUOF 4MQXC 1U3ZA 5IW1B 4YH6A 2XRAH 3I6KA 4AT6A 5KAQF 3OPZL 1D5XB 4Q9RL 1FZMA 1DBMH 3H9HA 3LPGA 3BZFB 2YPLA 1CDHA 2M8XA 3IFLH 2ADJA 2DN7A 1VERA 4LQ1A 3ULSA 1XGYL 2NXZC 2AKRB 4OFIA 1QO3A 1S7VB 3QP3A 3TJHD 2AI0H 2Q8AH 2AXFA 3FQNB 1WC7A 2X5PA 3ARGD 2KUTA 2AEQL 4NCDA 3NZHH 3P11H 3KJ6L 3W2DH 4APQC 1H5BA 4WW1B 5DWUH 2H6PA 4IEFB 4AMKL 3NCYP 2DDQH 4MJ5A 2IH3A 5DSCB 1KSRA 2HKHL 4LCCB 1BECA 4DZ8A 2DQEL 2VABA 2JB6B 1I8IB 1KEMH 4QWWD 3O8XD 4L3CA 1AR1D 3D3VD 3QFJA 3T2OA 5C0RL 4LLVB 3RGHA 2VDNH 1MJJA 3RUGA 1FH5L 1XGRB 5GS0D 1DUYA 5D71L 3WLBB 2ZCHH 3VXNB 1IM3B 4PRID 4AY0A 5GISL 3HUJE 4I1NB 1UG9A 4BSWB 4U1MB 1AFVH 4EXPX 2HT3C 4CU8A 1LO5A 2JELH 3CFEA 3K4ZA 5DD0H 5M7QA 4W70A 3OQ3B 3MV7A 2X1XR 3S4SA 3QR2A 4OFVA 4OCMC 3TO4A 5CSZA 3PL6C 3T08A 2BVYA 3RZCC 5GSRA 2V2TA 1W72H 4U33A 1BVLA 3RPIA 2IANE 2L7JA 4KI5E 1FNSH 1BGXH 2CUHA 3KGRA 4OLXL 2HJKB 4OM1H 1P4LB 1W2KT 3PGFH 3QUKA 5INCA 1FC1A 2NY5C 1GGCH 3C5JB 3EJYC 4IOSD 3CH8A 2OTPA 3KPSD 4XP1L 3H0TA 1WZ1H 2OK0H 5I2IB 4J6RL 3I02A 3X14A 4N68A 2V2XA 5TDNA 5D1XC 1MHEB 3RY6A 3KPRE 5E7BA 4NQVA 4OGYH 1OARH 4NQDA 1E4KC 4M5ZH 5EIQA 3MCKB 4OTXL 1CCZA 4OQTA 4W4OC 5CSBA 4NQCD 2ZUWA 3I75B 3EDEA 3CK0L 4B50A 3B3IB 3KPLA 5MENA 3WFHA 3D18B 4EUPB 1T0PB 3LRGA 3VXSE 1ZA3A 3BKCL 5I1GH 4P4KA 5GRUL 4RSVA 4ZODA 1EV2E 2Z91B 1S7TA 4HIXH 2XQBH 3QXUA 2A1WH 3U2SB 1ZLUH 5KVGL 3IAGC 5C0FB 2CRMA 2PO6B 1TMCB 1F6FB 1IZJA 3ARPA 2PW1B 2CIKB 2I26N 4GRWF 5K9QI 2VIRA 4PG9A 3FJTA 4XH2B 4L8BA 1ITCA 3WHE0 1G9MH 2HP4A 5CZKA 4X7FC 3DXAD 4YUEH 5IT2H 1CE6B 1ULVA 3H3BC 3W81A 5DC0A 2OI9B 1OP9A 1EJOH 3UAJD 3VMPA 1OP3K 4U1LA 3B9KC 4R7NA 3SJVE 5EZJA 3K46A 5DC9B 1JNLL 1NBVL 4ZAKC 3JTTA 1AXSA 2DLFH 3Q5OA 1F11B 1WCBA 2NX5D 1K3ZA 4KK6D 1NLBL 4D8PB 1JHKL 1D5BA 3P73B 4TUJB 1G6VK 3QIWA 2LVCA 1M71A 4IIQA 3TT1L 4L5FH 5D7LD 2ZOLA 3QIUB 4YHIB 2FBJH 1DVFA 4WWKB 2BNQB 3ZKXB 5JLZB 5DQ9B 2P43B 2VC2L 4U6HA 4U6XB 1BF8A 2P8LB 3SCMA 2E27L 5K59E 3BT2L 4KJPD 1DP0A 4DVRL 4URTB 1HIMH 1A3LL 4PJ5A 1G6RH 2MQ0A 2XPGA 1CL7H 3O3EA 4XPFH 1J05B 1Q9KB 3I9GH 1A6VH 2VH5H 4YAQA 3OMZA 3KXFE 1BMGA 1FQ9C 4FXGB 5CLTA 3RWIA 4PG2C 3FQTB 1LO3L 1CICD 1IL1B 5E5RB 1K5NA 1U9KA 3V0VA 4I2XB 2MQCA 3PHQA 4O9HH 2CMRH 1BQSA 3ROLB 5I1AA 3EFDH 1B2WH 1IGMH 1AGBA 4MX7B 3BD3A 4MB5A 4OZHF 5FGCE 4KTYA 3HAEH 4L4VA 2PYEB 1RJZA 5CP3H 4YHZH 4OD1L 4I3RH 3JZ7A 5HYIA 1UWGH 3MRIA 3HCVA 2AEPH 4JCLA 2VAAB 4OIAA 1L0QA 2P5WD 2R0WH 1J0JA 4LRIC 2O93L 4GH7B 5IJVA 1VDGA 5EOTB 1OAKH 3QDJD 5CP7B 3DVFA 1TJGL 4MLIA 2GJJA 3U9UB 4PYGA 2NMSA 4EI6A 1TETH 2WNGA 5LAXB 3EDFA 4Z9KB 3O6ML 4JGJA 4DUXA 4JY6A 3REVB 4KQ4H 4PP2B 4PJDE 4YBQC 1YC8A 4OKVB 3GRWA 2F15A 2RBLA 5DJ0B 4LGSB 4AYFA 4JANA 1EJ6A 3MXWL 5KG9B 1AIFA 4PGCA 1A7RL 1PQZA 3QFJE 5DS8B 1HOCA 3REWA 3UTTD 5BS0D 3GMLB 1ES0B 3MRBA 1JFQH 3P9MA 1N8ZA 2X7LA 1I9EA 3V0AC 4ELMF 2QSVA 1UQSA 3RUGE 1IGCL 4LPUA 1N59A 4P5TD 4YHOH 3RHWK 1YECL 4J2XA 3BEVA 4NFCA 2LTQB 4FFYH 4YHKL 3QPXH 2FECI 2HTLC 2FWOB 4RISH 4F37K 2IAMA 2I07B 3BKJL 5D96B 5DHXB 5FDWB 5HDBF 3MV7E 3T65B 4G7VH 5TDPA 2HT4C 3EDKA 4MAYD 4IDJH 2ATPA 2V2WB 2JJTC 1INDH 5ESQA 1TZGH 4FS0A 1MCWW 3BGAA 1I3GH 2JK5A 5FOBB 4U6VH 5I8KH 5A16A 1J1PH 1S78C 4JFPB 5GS0L 4PB0H 2G9HA 4K94H 2Q3AA 1VFBB 1J9CT 1T4KA 1QFWM 4GG6A 2B1AH 1E4WL 1HINH 4LCCC 3QQ9C 1HDMA 1ZLSH 5AAMA 2OYPA 3TH4T 4BFIA 4WRLA 5DQJA 2XYCA 5D9SB 1VKXB 2D03L 1HKFA 2WIIA 3QXAB 4TVPE 1AD0A 1G7MA 4M7KL 5BXFB 1DQLH 3TVMD 4FNLL 5C3LD 4OSUH 2IG2L 1BQHB 2Z8WC 1P5VA 1Z9LA 4PJCF 5L88H 2CKBH 1IT9H 3FT4A 5CHNA 4XNQB 2IQAA 1WWBX 4Q0XH 1WUNT 5D7JA 2FHFA 2P4AB 4HLZH 3HUJB 4BQ8A 4DGYH 4F2MA 2R9HC 4QHUA 4CUCA 3OG6B 4R3SA 1ZVSA 2Y25A 4DCQB 2YHGA 1K4CA 1LHZA 3UYRL 4Z5RA 2VE6B 1JV5B 5C0CB 3TC9A 1M7DA 4GT7A 4MJ6B 1YYMH 1IEHA 1KV3A 4Z77B 1DQQB 4WEBH 3G9VA 5I1LA 2PR4H 1NGZB 3CZFA 4PIRF 4ZO8A 5J12B 1NFDA 5JOPD 1RY7B 2FIRT 3HRZA 3QO0B 1MCKA 3L5WB 3SKMB 4QNPE 4XCFH 2HN7A 3TA3D 4I4WA 3BISA 4FA8A 3GB7A 3OKYA 3EDJA 2YRPA 4LLMB 1FDLL 3KPRB 1PY4A 4XNYL 2ZUUA 2GW5A 2J5LB 3GNMH 2C3VB 2OR8A 3MOAH 3T0ED 1VFOA 4TYUA 4WW2B 4JFQB 3WO4B 3BP5A 4N0CD 3UP1A 2R8SH 3GSXB 5DT1H 4J23A 1FVDA 1R24A 3S36H 4UT7L 4WCYH 4DZBA 2BX5A 2JB5L 2O5XH 3VXSB 3VWJD 1MVFA 1HSBB 4Y5YA 4UIMB 3TNMA 4HD9A 5H2BA 1XH3B 1T1WA 5K93A 1NCDL 4D0DA 1PBYA 1F58L 2QSCH 4LMQE 1GGIH 2PO6C 3SE3A 1AE6L 5C0JA 2DKUA 3PP3H 2Q86B 1K2DA 1UKSA 5EG6C 1FVEA 1WLHA 3RL1B 5F70A 3L3JA 3N1FC 1J8HD 2DQUH 4MXVE 3ZE0E 2LAAA 1CD0A 4G8EB 2QQNL 4B7IA 5I8EA 1GGBH 4WI4A 2OI9C 1NBYB 5B3NA 4YFEA 5E2JA 1JNHB 4TVPH 3QI9A 4LMQI 5GZOC 3T0DA 3BN3B 3IDIB 2O61A 4X4YA 1HHHA 2N1KA 1KB9K 3TBWA 3DV4B 1OW0C 1ORSA 4HJGB 2YEZA 2P8PA 3SJVB 1P4BH 1HH9A 2V9QA 2CDFA 3MLZL 4YBLB 2VLRE 4L4VE 2VDOL 4KKAC 1KLFA 4QRPA 3RA7H 3SDYH 3C60D 4RAVA 4HBCL 3QIUC 3UJIH 3HZMA 4RGND 1K85A 4WWKC 3ZKXC 5I19H 1EHLL 4CMMB 1WZMA 1QKZL 3CCHB 5TQ0L 3UO1H 1FIEA 4KZEH 1T3FB 1FE8L 3QUZD 4WIQA 3LMJH 5GGVH 5ITBH 2NY3B 4UINL 4PJFA 4K3DL 3LV3A 3QEHB 1D7FA 2Z92B 2K3TA 4N90E 1E28A 1MFNA 5JORA 3U83A 3RU8L 5D7IE 4PTTB 3KXFB 3T3PF 3JWDL 4Q58C 3TBYA 5E56A 5FKPA 1NCNA 4LLUB 4MNQD 4XAKE 2EDBA 4FQIH 4NKQB 1FZJA 3CFKA 1N5YL 4WHCA 5EDXA 5CEZE 3H3PL 4NPYB 4LLWB 1SJXA 2HTKD 3E6HB 5EO1A 3GMOA 5FYKE 1EUUA 3BIKA 1CDBA 3KR3L 5TF1L 4JRWA 1GPOL 4PRPD 2HWZH 2NY2B 4LSQL 4QHMA 1T0NA 2DTML 4HW6A 3S36X 2H32B 2XTJB 4HEPG 5BV7B 4U2ZA 1Q94A 3S4SG 2NY0B 2YK1L 4ZUSB 1Q1JL 5ADOL 2OL3H 3I6KB 4AT6B 3MOBH 4XP5H 4GAFB 2Q76B 5B39B 4YZFE 1FZMB 1V7NL 3S34L 3H9HB 2YPLB 1LNUA 4Q7DA 1X6LA 2ADJB 5DA0B 5JHDA 5DRNA 1U6AH 3ULSB 5I16A 5DRZA 4XMLL 4ZUWA 3GIZL 1X5GA 3ZKMD 1CXHA 2E6QA 3MGAA 1QO3B 2DKSA 3L3IA 5L6YL 2VB5A 3ARQA 2AXFB 1YJDL 3NFNA 1WC7B 3H42L 5IB2A 4MJ4A 3I85A 3BKYH 1RIUL 4ZFOL 3UTSA 3VRJA 4MJIE 1I1AA 1SHMA 4HK3J 1DQML 4NDMA 5EPMA 2UWEF 1H5BB 2R2EA 1KNOA 4PJDB 4MJ5B 1MF2L 5E2UH 4QTIH 4HX1A 4XRCA 1T20A 2A83A 4LSDA 4NZDA 4I3SL 4L3CB 3QFJB 5C0IA 4JJ5A 4AL8L 3UJTH 3C09B 4LVOB 3RL2A 4F7PB 1BAFL 1WF5A 1LP9F 2FD6H 3RUGB 4DN4L 2LTQC 2KQMA 2ERJB 1J1XH 1LO0L 5D96C 5EUOA 3DVNA 4R4NC 1JZ7A 4GG8A 4LGRB 2EDFA 1LO5B 3ZDZF 3CFEB 4K9EL 4F57L 3MV7B 1IE5A 2NCMA 4PGZA 4OZGA 3H3KA 2HFTA 4PJEE 5CSZB 4L8DB 5GSRB 2R1WA 4JKPL 4JHAL 4FABL 2V2TB 3T2PA 3I6LD 4JDZA 3RPIB 1NFDE 1AC0A 2FLRT 1X4ZA 1IGJA 2D7MA 1T5WA 1S9KC 4NBXB 3X17A 3QUKB 5EN2B 5JDSA 4I77H 1ZKAA 2QQQA 1EFQA 3H0TB 4ONOA 1A6WH 1R5VA 3ARGA 3I02B 3X14B 3VXRD 1D6VH 1CF8H 5F89A 3DVIA 1UEMA 4BJLA 3BZEA 4J4PC 4NQVB 3V6OA 1RVFL 3O2DL 4R26L 3HNTH 4N0UA 3C2AH 4U6TA 2A73A 1X7QA 4G6ML 3KPLB 3D3VA 5MENB 3WFHB 4HWEL 4HS8H 4PTUA 3K3QA 3FL7A 1ZA3B 2DLGA 4EDWL 2HAZA 5E2TL 4P4KB 4P9HL 3RWJA 3DHJA 2MCPH 2YD1A 4PRIA 1S7TB 5FF6A 4MD5A 4ALAH 1OTTC 4AM0A 2VYRE 4UDUA 5T3ZD 1F3DJ 5JXEC 1WIPA 3JV6B 4XP6L 5AUMA 4KI5C 5J12C