2DIBA

Solution structure of the 11th filamin domain from human filamin-b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
128
structure length
128
Chain Sequence
GSSGSSGHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 11th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 9
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dibA01
5IQ7H 4WUUA 1C08A 3KPMA 5HGBA 1MELA 4DN4L 3GM8A 1S9VB 4MHHI 3O2VL 1UKTA 1XF4A 5DD0H 4UMGA 3VGGA 3NFNA 1SVZA 1KCKA 1KN4L 5CHNA 1MY5A 4Q0XL 2OXHA 4N8VA 1N4XH 4OZGE 1RUMH 4EI5A 1N0LA 2X2YA 1M6OB 3ZT6A 4P5MB 2F58L 1U3YA 5ESQB 5KSBE 1I85C 3SY0A 4B41A 2ITCA 2MSPA 1G7HA 1OL0A 3MOAL 4ZPVA 1CGUA 3F5WA 5HDBE 3E0GA 5DRZA 1KIRB 4LRNH 1OAUL 1PG7H 3BH8A 1MJJB 2BHYA 2QV2A 3GSXA 3RVVD 5DMIL 4BUHA 5FOBA 4MA3A 4HH8A 3WMSA 4NN5C 2IQ9H 2A74A 4QTHA 3JWNC 1Q94A 2NY0C 1CGVA 3RUGE 4RA3A 2VH5L 3PQYD 2VLRA 1AXTL 3MRQA 1KJVA 4FZ8H 4M03A 1XGQA 2DLFL 4PD4J 2XFXA 1ITCA 3MZTA 3EO0B 4JQXA 1O7SA 2ZJSL 1DVFA 3V5DA 4Q6IC 1A7QL 4U6HB 3PWLA 1L7TL 2HKHH 3QIUA 4NM8L 4ZTPL 2X1OA 5C0CB 1FFPA 4PJCB 2P48B 1XR9B 1XH3A 5EU4A 3KPQB 5CWSB 4R0LC 3SBWC 1UZ8A 1NKOA 4F57L 4EN3A 3VXMB 3O6FC 4XBEL 4Y2DA 1MRCL 1JVKA 3VFGH 5KVGH 3DJ9A 4RDQF 4ZO9A 5D7LB 5DURB 3TH3T 5DEZA 3UTZB 4HEPG 4N8CL 4CN1A 1YUHB 3RNKB 2B4CC 3T2OA 2F5AL 3C8DA 3WKNA 3LHPH 3OAUL 3MROB 2HWZL 1BQLH 1C5DA 1GGUA 1KIPB 2R15A 1IAKB 5CBAA 4X5LA 2EYSA 3DO7A 1OAKL 1BEYH 4XNXH 5HVWA 4KK8C 3ARFC 3ET9F 2R23B 5I1HH 2FYYB 2I07A 3QDGD 3HZYA 4O4YH 2EH7H 5IHBA 4X5XB 4WENB 3WO4B 1E27B 2BSRA 4LEXH 1T21B 12E8H 5CD5D 3MODH 1WQVT 2V9TA 3IRPX 2V2XA 3GI9L 4X6EB 1MHEA 2GCYB 1GC1L 1RZKC 5FO7A 2XG4A 4Y1AD 4NBYB 1D9KD 2HRPH 3V0VA 5E9DA 4S1DC 1YYML 2ADGA 4GH7B 4WI5A 4MAYB 3B83A 2FX8L 2FL5A 1MLBB 2YUZA 3RTQA 3BRFA 3NPZB 2LFGA 4Z7UA 1KV3A 4JFDA 1Q9WA 1RIUL 4OCNC 4PJDA 3RWIB 1OSZB 2QR0A 3GMNA 1JPSH 3MNVA 4LCYA 1WZMA 3WD5H 1WAAA 1A2YA 5EU6E 2KZ1B 5C09A 4XHQA 1AFVL 2NY3D 1FYTA 1FLTX 3WJJA 4KROD 1N5YH 4I48B 3H9SB 3RVXD 3S8WA 4QXGL 4RGND 4P4KC 3FOMA 3ARGC 3CLFH 3ARTA 5DD5L 1GZQB 2IAND 3SKUD 3I02A 3HUJF 3VGFA 1W0WA 3HN3A 1S3KH 1W8NA 5J6HA 4DZ8A 2HFGL 2KDGA 4LCUB 4Y8AA 3MLXH 1R3LB 4CADA 1R3JB 1PY4A 3VWJB 4W70A 1IEBB 3QPXL 1RHFA 1BVKB 1Q9KB 4OIIH 5GGVY 4NT6B 4L4TE 3NH7L 4FFZL 5L88H 4NZTL 3G04A 5E8PA 3FN3A 3MTRA 4LEOA 4PR5B 4KKNA 1F4YH 2AXGB 4UBDC 3DETC 3PABA 4KDTA 3MBEA 5GISH 3DXAB 3BP7A 4R7NB 3KYOA 4OCMC 3GMLB 5BV7B 2VJXA 3JXAA 3DHMA 1KUMA 5GSVA 2ZCHL 4PRIA 3L3KB 5GJTL 1EGJA 3KJ6H 1DQLL 4FQHB 1MVUA 2NX5B 4QNPF 5GRJH 3V79C 4PREA 2HKFL 3LEVH 2VR5A 1KB5A 3CH1B 2LAGB 1YMHA 1XF2A 4UTAL 4D9LH 4XMLL 3GGWA 1E4KC 3LQZB 1DBJL 3LMJL 1U2CA 5C9JB 1GIGH 2B2XL 5FB8B 1JHTB 1HNFA 2AXFB 2CIKB 5HHOB 5MENA 1D5XA 5A1AA 3MRMB 4ZDHA 2B5IB 2JCCB 5F3HB 3OXRA 4EDWH 1QQDB 2F74B 2IJ0C 5DFTA 3C6SB 2BNUB 5DT1H 2XWBA 5T1DL 1C7TA 2XTJC 3P4NA 3VE0B 4PGZA 1J1PH 3VFMA 2C26A 1MI5A 5J3HD 3CZJA 5CD5C 2MFNA 4WCYL 1X5IA 3FRPA 2VSDA 3GSQB 1KEGL 1R24B 5AWNL 1HQ4B 1D9KC 4JFDD 1NCWL 2J1KA 3FTGA 3V5HB 2XWJA 3EW3B 1CXHA 3IFPA 2DWEA 4Z7WE 1NGZB 1YC8A 2XA8H 4NJAH 5E8NA 2AEQH 1UB5B 4AEEA 1UB6A 4JAMB 1F6LL 2H2PD 1A64A 5AYQA 3GSNL 1BF8A 4NPYB 2FGWH 3OV6A 4RWHA 4WGVB 2VUOA 5CZVH 3Q5OA 1JUFB 4KKBC 3MREA 3QUKB 4PTUA 5J89A 1WBXA 3VFRB 2QQNL 4E42B 5I30H 3OZ9H 1VGKB 3C60B 4FFWC 2YPLD 5IHZB 3GSOB 1A4KB 4OZIF 1YECL 3DUHA 4RGNC 3GK8H 1T5WB 2ARJB 5BXFA 5DHXB 2CIIA 1I9JL 3DHJA 4LLUB 4U0RB 1JPTH 3W9DA 5BOPA 3EZJB 3L5XL 5TF1H 2CDGB 4Y19D 2RAMA 4KTDH 3EO1A 1T80A 3VI4E 2VDOH 1EGJH 3KPNB 3NABH 1TZGL 5EOCH 5FO8A 2NNAA 1DP0A 3HPJB 3BQUC 1KGCE 5DJYA 1A6ZA 3FB7B 5T3XL 1YEJH 1JPST 3GSNB 2FX7L 4QHUB 4ETQA 5E4EB 5CP7A 4CVXB 2F8VA 1ES0A 5B39G 5DEFA 2UWEE 5DRNA 2GK0B 3WFBL 2Y7QB 2EIZA 3K2MC 3DVIA 4YLQT 4U1KB 5DJAB 4S0TD 3MRCA 4U05A 5DJ0B 1L4IA 2FHBA 3QFDA 3L95A 4WEMB 3CVHA 4L9LA 1ZVYA 5GRWA 2VZVA 1TNNA 4U2ZA 4YHZL 2MJWA 1G7MB 2VXUL 1MCJA 3BAEL 4NZJA 2YD1A 5IWLA 1SBSL 4UOJA 3LQAH 2H8PB 4IS6B 1JGEB 3FB5A 1U8HA 4BZ1H 2A77L 3RZCD 2CMRH 1D6EB 1K4CB 4PRPE 4MJID 4NOFA 3EHBC 3KPLA 1S9YB 4MQXD 3EYQD 3LEXB 5E99L 4YDIL 3ARBB 1RUPH 1T1YA 3QIWD 1OTSC 4JDTH 5L2KA 1F90L 3CAFA 4QEGA 3Q6GH 2R39A 3UTOA 5EC1A 1YJDL 3C87A 4M7ZC 2P46B 5DDHB 4HHAA 3U4EB 3I6GA 2ICES 1FO0A 1G6RH 3S3PA 3VXUE 4LK4A 3VA6A 2AJXH 3OB0K 3GBNL 5HHPB 3ZL4H 3CDFA 2PW2B 4P3CH 5IBUB 4YHOL 3MLYH 2BVQB 5TE4H 3L3HB 3ZE2F 5BO1H 4ESKA 2QQKL 2DQHH 1VGEL 4OLXH 3IGAB 1NAML 3INUH 4LSPH 2IMNA 2DRUA 3N50A 3WHE0 4I2XE 3GJFK 4RQQA 4XCNB 5FGCB 4GRWF 5C0ND 1NCAH 3FO9A 4KVCH 3Q6FB 4M1GH 1CXIA 5JOPD 3DSFH 4XAWL 4LVOB 3QRGH 4JZOB 4OM0L 1FV1B 3G6JB 5IFHL 2NY2B 4QHMA 5D9SA 5IVOA 2V7NB 4X7CC 2AJUH 1QSZA 2QQQA 1F2QA 1QFWL 2AV1A 5IROC 1U8JA 5ID0A 3DYOA 4K8RH 4PJFB 1EAPA 1RJYB 3CFCL 3IT8D 4UV7L 1JV5B 3MV7E 4M6ML 5D2LE 1QACA 4JZNB 2LVCA 4LMQI 1I9RL 2XTJE 3ECBA 5BJTB 1S7SB 1OARL 5DMGD 1WTGT 1RZ8A 4YPGB 1E4XH 3C5ZC 1HINL 3JV4B 1GC1C 3EFFB 4WEBL 2FJGB 5CJBA 5E8DL 4C83A 1HILA 3J8F7 4X4YA 1NAMB 4K8RD 5SV3A 1H3VA 5JUEL 2YEZA 5FECA 1KOAA 3WKML 2XI9A 3VFVA 1KTLB 3WIFB 3F8UB 4UAOB 2JIXD 1A02N 2DMKA 3OXSA 3V4VH 4MD0A 1JGVH 2PR4H 4MQ7B 4P46D 3TYGH 3HHRB 5B22A 1ZVSB 4Z8FL 4DK3A 5FGRA 4NHUA 4QT5B 1NCDH 4P3DA 1IGJB 2CDFB 5DJ8A 2EDRA 2WW8A 3ZZ1A 4N5UA 4QRTB 1HK6A 8CGTA 5F7MC 3RZCC 4F7CA 2VXQL 1YEDA 3EYQC 2NPLX 3MV8A 4FOMA 5MERB 3GBMH 4LLAA 5C07E 4XMPH 3CC5B 3QIWC 4JO3H 3BOVA 5D1XB 4Z76B 5B38A 1VFAB 2IPUK 4MCZB 3CDGA 5JZ7C 1IILE 1WZ1H 1JWUB 1FHGA 1YEEH 3JSSA 3ARVA 1MCPH 4RAVA 3GB7A 4K9EH 4KRPD 3VWKC 4K3DL 1CFSB 3N1GC 4DOHB 1A7OL 3IAPA 1NCUA 1RULL 2Y6SD 3HMWL 4LOUD 1BD2A 4LPYA 3ES6A 5TDNA 1WVZA 2NY4C 4Y4KB 3LN5B 3TIEB 4HWBA 1VACA 1FZJB 2D0FA 1KJ2L 2RCSH 4M6OL 2BNRE 2R2EA 4U6VL 2QQLL 2AJSH 2ZNWA 4IRZH 4G8EB 1PX3A 3FFDB 2CRIA 4JY6A 4BH7B 3VD4A 1ODAA 3CDYA 4ZXBB 5F3BB 1GGIH 5C0AE 4P5KB 1OCWH 1YN7A 1K2DB 4PG2C 3S5LG 2Q3AA 5T5NG 1BQHA 1NQBA 3DV4A 3U30C 1J8HB 4BSJA 4P9MH 3DMMA 4JFFA 4XPTL 4DCQB 5C0JA 1YMMD 3WE6B 1F45A 5C0RL 2AJZB 1CI5A 4K7PL 5SWSB 3C9NB 4GG6B 4P4RA 5FUCC 2OQJB 1I3GH 3IJSB 2HVKB 1U8NB 4HGWB 1I1YA 2DBLL 5D7IF 1DDHB 2A73B 4WFFD 3OF6D 3EJYD 2YXFA 5TJWK 3L3DB 1KB9K 3CDCA 1RZFH 5D93C 4R90L 5TH2A 1HKLL 4G42A 4LPCA 1AR1D 4GW5B 2DQIH 4JRXA 1LEGB 2BRQA 2DYPA 3EYVA 3OJMB 4LU5L 5DVKA 4ACPA 5F7EL 1JFQH 3CPLB 1M7IB 4KI5D 2D7TH 1EJ6A 3EFDH 1ZA3B 4GS7C 4N0YL 1DE4A 2P44B 1OVZA 3CXHJ 4YXHL 3OKLB 1ZTXH 3D2UD 3V9FA 4XNUH 3RX5A 1C5BL 1BQSA 1QEWB 3CFDB 1EA9C 3K81A 4M5ZH 4NO0A 1K5NA 4HT1H 3ZMRA 4TRPL 4M61B 1EVUA 5CJQH 2P24B 5D2NA 3G9AB 4Z0XB 1IM9A 3SDAA 4PJ7A 4LLYB 4FG6D 2CUIA 1S7VA 1AY1H 5EUOE 1I9IH 3HNVL 1DEDA 4OZGF 3MJ6A 1WTLA 4MDIB 5E7FA 3C6LB 1UXWB 4Y4HA 1IGTA 1I7TA 1UZ6E 4XAKE 4OTXL 5KSBF 3VXOA 1FVDA 1AXSB 3MGOB 1U95B 2G9HA 5TQ0H 3VD9A 1EEQA 3UJJH 2H6PB 5KW9H 5SX4H 4QTIH 4U1JA 4ONFH 4RFNB 4U1MA 5I1LA 4I3GA 2ADIB 1X7QA 3LV3A 4LCWD 4C59B 1UYWH 5D6CA 3QWOB 2H3NA 3PHOB 3I85A 2P5EA 4LOUC 2MCPH 3BGAA 5IMLA 3W0WD 4H25A 3O8XD 2LVEA 3ZDZE 2OSLB 4L5FL 4Y0GA 3RUGF 1RZIA 5F88B 1NBQA 3HUJA 4X6FB 2W0LA 5T1MB 1JNLL 3WDHA 5IMOB 2HLAB 4P2RA 1FVCA 1MFEL 1ZVHA 4FXKB 4GLRH 4M8VA 1B0GB 2EDFA 3P0YH 5HI3D 2HYMA 3MRIA 3GMPA 1TTFA 4U1LA 3QUMH 3N0PB 4I0KA 2XWTB 4PLJC 2XZQL 1N0XH 2IMMA 4QRRB 1OSPL 2BK8A 3VG0H 2IPUG 3FT2B 1FPTH 5DK2A 4OCXH 3WFHB 5T33L 1FRGL 4CVUA 1JHKH 2Y06H 3FFCA 2VR9A 4KAQH 1YEFH 4J23A 4RDQG 1G84A 4M6AA 1KTKE 3NA9L 4HS8L 3CSBA 3HE7B 4HWEH 1ND0B 1T4KB 4LARL 3GKWL 1H3GA 4KMLB 3SCMA 4HUVA 1UXSB 1D5MA 4KJYA 4YC2B 4U3XA 3QUYA 4XC3H 3DBXB 2I5YL 1WEJH 2J8UA 1QD0A 1QBLL 1HDMA 5ICZB 2QTEA 3L3OA 3U48A 1N6UA 3A6CH 3WFCH 3MLVL 2NTFB 1J0IA 3V0AC 1S5IH 3QO0A 1NGQL 3O9WC 4GRLC 4KI5C 2DKUA 1YY9D 3EYOB 5DUBA 5HHOE 3IFNL 4PB0L 1OWRM 6FABL 4D2NA 5E00A 4OV5A 2JCCE 2WBJA 3NN8A 3ORJA 3KPSD 4AT6A 1TIUA 4JZJC 5DVLA 3G5YA 1TZHA 5DEGA 1WF5A 2HRLA 3C8KA 1FIEA 2VXSL 2ENYA 4X4XA 3AXLB 2X4TB 1TXKA 3HNTH 1KFAL 4D9QE 1GGTA 4GBXA 5IW6A 3TCLB 3QFJE 1F8TL 1FZOA 3MA7B 4JFEA 2AK4D 3MRPB 2OJEB 4P5TB 2IH1A 1TETL 1I7RB 4RFOL 4P99A 4I0PA 2FWOA 5EOQH 3KJ4C 4TUJA 2DQFB 3WHXA 4I8DA 1HNGA 5F7HA 4OCRL 1GHFL 2CK2A 3BZFA 2PXYD 4GLRI 4KXZI 3V6BR 3L3IB 4OZIA 2NTSP 3ARRA 4XPGL 2R1XA 1KTDA 1BJ8A 2ESVA 3SGJA 1KSRA 4JN1L 4NCDA 2APVA 4H5SA 4KMQA 4WI7A 5I0ZA 4L3CB 1HIMH 2O5ZL 1T20A 1A5FL 1PSKH 1VCAA 3SDCD 3TBTB 4MSWA 4PB9H 2BDNL 4K7FB 1HXMA 1I1FB 5FFLA 3JVGA 1C16B 3JV6A 1AD9A 3B5HA 4RWYL 3LDBB 3GRWA 3MUJA 4Y4KC 4NP4H 2E7CA 2J6EA 2DBJA 1AE6L 4OB5H 2NYYC 5L9DL 3OKEB 1NFKA 2CLVA 2HTKD 4KMTH 3BPNB 5E4IA 3WUWB 3IXTA 1QFUL 1FFNA 1QVOB 4LAQL 4OQ1A 3SKNA 1C5CL 5IQ7L 5HHMD 3SDXB 4O58L 1JHLL 1T2QH 3FRUB 4G9FD 4HAGA 4TOYH 1ADQA 1OP5K 5DD0L 4HFWB 2VQTA 4CNIA 4ZUSA 3ZHKA 2F5BH 1CD1B 4HQQH 2UZXB 3WBDA 1A3RH 4PJXF 3D69A 4P23D 1U6AH 2DQTH 4OZFH 1RUML 4EDXB 4LSQH 2F53A 2W60B 3LS4H 5GZOD 4K71B 1S8DB 5GGRB 1ACZA 1XCTB 5FV1L 3EYFB 3MUGB 1OAZH 3VFPB 1T04A 3ARDD 4C56A 5I15H 1P7QD 2A6JA 5DMJB 2DL9A 1NKRA 3VG9C 5IFAH 5IIEA 5DO2C 3S4SA 5ACMA 4MJ2A 3BGMB 4M93B 3HI5L 2B1AH 2B1HH 1AD0B 4LQ1A 1CFQA 2VITB 4WW2C 3ARED 1XF5A 1KCUH 1S9XA 3TESA 3LKRB 5IQ9A 4PRBB 3O4OB 5IW3A 4FZ8L 5KVEL 4KI1A 1A6WL 2CSPA 1YZZA 4RIRA 2JJTA 5DMKA 4JFXB 1A6VH 1PG7X 2HKHL 5K9OA 4HXAH 5C0DB 2VLJA 2CH8A 3DO3A 2IF7A 3QI9B 1KBGH 5HHQB 3SOBH 3WFEL 3DGGA 3DI3B 5C7XL 3CSYA 2UUDH 1NDMA 5FM4A 5GGTA 1CG9B 3PQYB 1U8KB 2E27H 2PXYC 1QSED 4MXQD 4PGJA 4PJIA 4K55A 3RQ3A 2J6EH 3PWUB 4I0CC 1JYNA 3EOYG 5LJYH 1H0DB 4DJMA 3RL2A 3HMXA 3QWRA 3OHXB 4EUPG 5I71C 3LHPL 2JK5B 3O6KH 4PGDB 5EZLA 2ZSVA 2VLKD 1FZMB 5F8RC 2CRZA 3D3VE 3DX7B 2NY6C 1BEYL 4JKLA 4PRAB 1ADQH 3BSZH 1N26A 4FS0A 3IRZA 2JF1A 4X6CA 2KL6A 1X5JA 1CDBA 2YZ1A 4MMXC 1IZKA 4QRPE 5E5MB 5FUZH 2YA2A 5I1HL 4JJ5B 3TA3A 3QQ4B 5SWZD 5EO1B 2F54A 4DEPB 4X6DE 4BSWB 3DOSA 2EH7L 2GSGA 4O4YL 1BP3B 1TJGH 4NO5A 4PJ9D 4I5BB 1NC4A 5C0GB 3DX6A 4F37K 4HD9A 3T77A 12E8L 3MYJB 3U7WH 2DF3A 4LSSL 2V2TB 3I50H 1CQKA 3BW9B 4RBPK 1XF3B 4F2MA 4Q97A 4YZFE 5ESAB 4A2LA 3IVKB 4ZOAA 1IQDA 3QJFB 4XNZC 1FIGH 2HRPL 2HG5B 3TVMA 3L6FB 1YY8A 2EXYC 4U6XA 3BIBX 5BZWA 1OAYH 5GRUH 3ABZA 2YN3A 1QFWM 1UVQA 4XP4H 5C08D 1CFTA 5JHDB 3IDUA 3QDGB 5F72S 2XYCA 1MY7A 5DGRA 1PKOA 5GZOC 3DX9B 4MJ6A 4WUUB 1C08B 4Z77B 1JPSL 1X5KA 3NCYS 2MWCA 5E24E 3OX8A 1OPGL 3RWGA 1GPOH 3LKPA 1B88A 2YWYA 5JA8B 5ECJE 5A16B 2R1YA 1D5BA 1S9WA 3BE1H 4ZODA 3SHSA 4NGHH 1MREH 4H0IA 4Y1AB 1WBYA 3U46A 3H9HA 3QEQA 4UQ3B 5JNYA 1CWVA 4G80A 3MNWB 3CMOL 4LHUD 4EI5B 2A0LC 3NCEB 3LQMA 1MHPH 1P4BH 4U7SA 4ZSOE 3D39D 3B2UD 4ZPVB 4JFOA 5AG9A 1G7LA 4HWNA 3RDTC 3MLXL 3A67H 4PV9B 1YN6A 3NIGF 3QZWG 3BH8B 1FN4A 1SEBA 4OIIL 5FOBB 1I1CA 4MA3B 5F6HJ 5L88L 2C3WA 3KVQA 3ARYA 1MIEL 3TV3L 4QTHB 1F4YL 4KROB 1INEH 4DGIH 5JW4R 2YRLA 3R8QA 1U91A 1P5UA 2VLRB 5GISL 3MRQB 3WNMA 2IAMD 3GM0A 4JPKH 4Z7VF 1I8IA 5HY9B 4LFHD 2IANB 3LEYH 35C8H 2QSTA 5E56A 3JV0A 1TVBA 3V5DB 3GKZA 4L4VA 4KKLC 3KJ6L 4UIKH 1F02I 3MMEA 4MXQC 1N8ZB 1EBPA 3LB6D 5GRVL 3UTTA 4WHDA 4KQ4H 3LCYA 3LEVL 4N68A 1OGAA 1K8IA 5IHUH 4LHJB 5FKPA 1XH3B 4ZUWA 3A6BH 2XN9A 4D9LL 5B3JE 1A9EA 1GXEA 1UZ8B 2FO1A 4EN3B 1J8HE 1GIGL 4N0UA 4Y2DB 5D7IA 3SPVB 2JJWA 3D87B 3KNBA 3SJVE 2LTQC 4YBQD 2FEDC 4MNGA 4PP1C 4UU9B 3GJEB 5FHAH 1PGRB 5D2LF 1T7VA 3TBSA 4LCCA 3BKYH 1MJUH 5DT1L 2NY1C 3QDAA 1FNGA 1RJCA 3NFPB 1WCBB 3G9VA 5CBAB 4NQCE 2VOTA 3DO7B 2DOCA 2ARWA 1ZHKA 1MHCB 4HIJA 4ZQKB 4FQXC 2R8SL 1F97A 2VZ3A 5ICYA 5E6IC 5FYJD 1CDJA 4LNVA 3FQUB 5C8JA 2I24N 3HZYB 3L7EB 4NJAL 1UM5L 2AEQL 1UCTA 4JHWH 1F4HA 4RMUA 5KS9F 4X9IA 2FGWL 2OTWA 3TYFB 4EXKA 3I75B 2PYED 4OQTA 4PUBH 1IGCL 5CZVL 2DWDB 3IU3A 1YC7A 3O4LA 5FO7B 1KPRB 4HKXB 5E9DB 2ADGB 3VXSA 5I30L 3HC4H 3C09B 4PP2A 4MNQD 3BO8B 4LLWB 2R2BB 1S78D 3O45A 4JFDB 5C3LD 3RIAF 5FF6B 3MLSL 4PJDB 3GK8L 3IDIA 1TJHH 1YDPB 1B6DA 2E8YA 1JPTL 3ETBF 5D71H 5TF1L 4I4WA 4WVRA 3QEUA 1U8QA 1A2YB 1LP9E 4UT6H 4KTDL 3DYPA 3VXRE 2VDOL 4U33A 1EGJL 1FYTB 1PDKA 1DUYA 1SBBA 2QJDA 3NABL 1JF1A 2P5WE 5EOCL 3TNMA 4L4JA 2GW5A 5D1QC 5D6DC 1TCRB 1D5IH 1KB5L 1NBZA 4RNRB 4YHLH 1YEJL 1HN1A 3AVEA 3MCG1 3FOMB 1MSPA 2CKNA 3QUXC 1W0WB 1N3NA 5DK0A 5BW7C 3BUYA 5EPMA 3P4LA 4DZ8B 4BSVA 5IV2A 4CADB 2DTMH 3KHQA 2IBZY 5JMOC 1ZHBA 2P8LA 4JRYD 4Y19B 5HHME 1AR2A 5GZND 3WLWC 1AKJD 4PJCF 4HLZG 2Q6WA 4QRRE 4WO4A 1S7QA 2CR3A 3FO0L 3PABB 2BVTA 2P49B 4IOSD 3O6LH 3WLBA 3ROOA 4HJ0D 2FO4A 4EI6B 3QDMA 4M4PA 2GJ6E 4UNTA 1ZT1B 4JPVH 2W65B 4K3EH 1E4WH 1SJHB 4LLDA 2ICWA 5LGJB 1XF2B 4XXCC 1RUPL 4ZAKA 4H8WH 5CD3A 5TDPA 3W5NA 4GAYB 5I1DB 1OLLA 4IOFC 4L8DB 5FKAA 3WJLA 5C86A 1OGTA 4JDTL 2ZPKH 3Q6GL 5F7DA 4APQD 3T4AB 1AIFA 1UFUA 4N1HB 4DW2H 1D5XB 3H3PH 4XT1C 3T2NH 2ZKHH 3OXRB 5BS0A 2EDQA 1AO7D 2ADJA 1X6NA 2Y36H 4OV6F 5KBNC 2XWBB 1CBVH 4IMKA 1RZ7H 3P4NB 4G6AC 2AJXL 2GTZA 3ZL4L 4MJIB 2GTWB 4P3CL 1CICA 4HAFA 3L1OH 1RIVH 2FR4A 1H15A 3B2VL 3GHEH 2P47B 3QHZH 4OLXL 4GW4A 2ZG1A 3INUL 1FL6B 2XKNB 1UZ6F 2XWJB 4LSPL 4X9GA 4YXKH 5E8NB 3OKDA 4EQ2A 4HK0A 1S78C 2SEBA 1NCAL 4M1GL 3BDYH 5K9QI 5DQDH 4V2BA 1SJEA 4PJ8A 4QRUA 3UTQB 3DSFL 4L8CA 3QRGL 1M05A 4QHNA 5JXEA 2AJVH 2K7PA 1F5WA 1WBXB 2Y5EA 4HWZA 3ZT7A 3EDEA 4BA8A 1D6VH 1M71A 1G6RB 4JHAH 3QNYB 4N1EA 4JDZA 5E2JA 4FXGB 4ZUTA 5IW1B 3I9GH 3STLA 4PD4K 4K8RL 1UM4H 1RVFH 2X4SA 3CVHL 2J5LC 2OP4L 1LNUB 2QADB 1FL5A 4LQFL 5E2VH 2R0ZH 2AKRA 2VDLH 2BNQE 5JLZB 1E4XL 2AJYH 2A6IA 4XNQA 2BXYA 5ADPH 4WWID 2HTLD 4GRMB 1A6ZB 4JM2D 3NGBB 1N7MH 3ULUC 3SDDA 3V4VL 3MRBB 1UEYA 5SWQB 2PR4L 4ETQB 1H3XA 1ZV5A 3L5IA 3TN0A 1F11A 3QDJA 3WCYA 5CP7B 2YRZA 1ES0B 5BMFH 2JLLA 4HJ0C 3HI6H 4PBVC 2VSCA 1NCDL 3NIDF 5E8OA 2FECI 3U6RB 4N0CC 8FABA 2VABB 4JQXC 5DRNB 1DVFC 3LSOA 1IFHH 2EIZB 5IM7A 3WEXA 4OGAD 3GSWB 3QIUC 4FFVC 3MJ7B 3MRCB 5JO5A 2Y5TA 2XTLA 4HUUA 3BEVA 2YUXA 2YPKA 2Z92A 5F21B 2KZWA 3BWAA 3G5XA 5HYJE 3GBML 5INDB 3QEHA 4XMPL 4XCCH 3ZO0A 4D94A 3OR7B 4P46B 3GMOA 3QHFH 1WZ1L 4KK6C 5F1IA 3PWVA 2APFA 1P9MA 1YEEL 1MCPL 3FB5B 2JCCF 4J8RA 4K9EL 1UH2A 5DYOA 4JREC 4NQED 4OZ4B 1PKQA 3OR6B 2OMNA 4PRHD 3KPLB 4WDIA 4D0BB 5DQJA 1CGTA 4KK5D 3U83A 3VGHA 1NBVH 3BZ4A 4DKEH 4O51B 5DMYA 5L2KB 4ERSH 3MV11 1A3LH 4OCYH 1RHHA 1VB9A 2ZG2A 2UYLA 3DX8B 3ZKMC 1EFXA 2RCSL 5DI8A 2R9HC 5F71A 2AJSL 1H3TA 4IRZL 3B9KA 1TPXB 4XP1H 1IKNA 1Q0YH 3PWPA 4N90D 3VRJA 1GGIL 2VDPH 1QHOA 5GS1A 2HT2C 5MEOA 3T1WA 3U7YL 3QA3A 5MI0C 4OLUL 5IVXE 4UV4L 3RY6A 4OFPA 4KUCF 5F1SA 3T3ME 2V5SA 4P9ML 4NKDA 3IDMB 3WXWH 5CZXD 3MV9A 3KPPB 2BFVL 3LVEA 5J12C 5TFSH 3HRZA 2YSSB 1INQB 4G6FD 3TO4D 3H7LA 4DGYH 2COQA 2WIMA 4WV1B 3RTQC 4R96A 3EYUH 1W8OA 3SKOA 5ILTH 3KPRD 3VCLA 3FO9B 3PHQA 3DROB 1I1AD 4L29B 3DURB 1AQDA 1OTUD 5GJSL 1A7BA 1FNAA 5H2BA 1UCBH 2DQIL 4PYGA 2ICWI 2JTDA 5D9SB 4QHMB 1JFQL 2NY5L 2D7TL 3BYYA 2X1PA 1YMMB 2G60H 2HTLC 3EFDL 4FQ1H 5ID0B 2O5XH 3DRTA 4XNYL 4YDVA 4JM2C 1EAPB 3JWDH 5FGSA 3LRGA 1HYSC 3IFOB 1ZTXL 1ZT4A 3ECBB 1I3RA 3VD3A 3CD4A 3MOQA 3CU1A 1PD6A 1EUUA 2UY7A 4HT1L 5KSVA 3SDYH 4C83B 1J9CT 1HILB 1GGBH 4LSRH 1HQRA 3S5LA 2BY1A 4PYHA 1LEIA 2FSEB 1TVHA 1M7DA 1IC1A 3OJDB 3VFVB 1R3KA 1AY1L 1DN0B 1OT2A 2VQ1B 5GGSY 5IMKA 1R5VA 4MVBD 1CR9H 1LE9A 1JWMA 4J2XA 4MNQE 4K7PY 4KDTC 2X7LA 3IJYA 3MBEC 3CFJB 4HWBL 3WS6A 5I1CH 4WI3A 5IESL 4P3DB 5F93C 5DJ8B 5TQ0L 1VFBB 3D2UB 3UJJL 3MRLB 4OBSA 4QTIL 2R0LH 5IMMB 4WUUE 3KYNA 4ONFL 2APBA 4WRLA 1CL7I 2DICA 4F7CB 1MCFA 3V4PH 2ZUUA 2VWEC 4M7LL 2MCPL 4BZ2H 3MJGX 4X0KA 3GJFA 5IB5A 3WDJA 1RJLA 4L8BA 1MFAH 5B38B 3MA9H 2LU4A 5ISZD 5ALCH 5JR1H 3VRLE 3S96A 4L3EA 2BMKB 1T7XA 5GIRA 2IH3B 4D9RD 3P0YL 4MA7L 1IQWH 4AG4H 3X3FH 3PGDB 5BRZA 3VD7A 2F19H 2UZYB 2HFFA 5IOPB 2X4PB 3ES6B 5KSAA 2D0GA 3CFEA 1GAFL 3AB0B 3HFMH 1N0XL 4LCWB 5GGUB 1FPTL 4XC1H 1F3RB 3W0WB 4OCXL 1JHKL 3ULUE 1VACB 3O8XB 2PCPA 4KAQL 5C6PB 1YEFL 5DUML 3QXAB 2ZUVA 2X70A 3MGAA 4HWEL 4JY6B 1J88A 3FCTB 4F37F 2X4QA 1CGYA 3TLRA 1K85A 4ALAL 3TO4C 5JMRA 1PZUB 1AI1H 1NMCC 4U3HA 5I1EH 4XC3L 4KPHL 1RZJH 1HH9A 2XZCH 1WEJL 4J7RA 1JGDA 1SJVA 1NUNB 2ZOLA 1OTUC 2WWMC 3CGTA 2C1OB 2VL4A 3A6CL 3ALWA 3WFCL 3G6JF 4P4RB 4E41A 5L8LB 1T1WA 4S11A 2VB5A 1S5IL 4BFGA 5AZEH 4MDJA 1MCCA 3QUMB 5EA0H 5IEKB 4HCRA 4X6DF 4PJFF 1I8LA 2EKSA 3P30H 1E28B 2E7MA 4M3JA 4X7SL 1Q9OB 4PJEA 4Y4FA 4M9OA 4WWKA 1JJUA 4KKCC 5TH2B 1OD9A 1ZLWK 4QRQA 4JRXB 2DYPB 2GEEA 4RGOH 3T0EA 4ELMB 3EJJX 3NOIA 4OFYA 4H0GA 1IE5A 1JRHH 3LIZH 3HNTL 4WTXA 4XB8A 5FO9A 3NGBC 4MVBC 1FCGA 2BVOA 3Q1SL 1FDLL 4N0RA 1RJZA 5HHXH 5KS9A 5DJ2B 3IJHA 4K3JH 1FZKA 1MHHB 5L8KB 3BI9X 1K5NB 3KPSB 3D18B 5EOQL 2LABA 1HZHH 3J7HA 4NKMB 1M4KA 1BBJB 2FJFB 3QAZC 5HI4C 4XTRC 4PJHB 1V7NH 4WI6A 5CAYB 1AJ7L 4X8JB 3MCLL 1QFOA 3TJHD 1M6OA 3PWNA 4HZAA 4L9LC 4ORZC 2FHFA 4P5MA 1I7TB 4Y4HB 4LGPB 5ESQA 1HHKB 3EAKA 3ZLQC 1FFQA 4M62H 3VXOB 5IWLC 1FVDB 4Z7UE 2AK4B 5EFIA 1RAMA 2ZG3A 5L6YL 1BWMA 5BRZD 1HIML 1S7TA 2DLEA 4GQPH 3H7BA 3DNKA 4EOWH 3BPOC 1PSKL 5LAXA 4PB9L 1MJJA 5I1LB 3H42L 2NLJA 43CAA 4QKXB 3LV3B 1WAAE 2H3NB 5C09E 3G6AA 1AGDA 1EFQA 4KHXH 1KC5H 5E2WH 3UEZA 3AS0A 1RZIB 2PETA 1TJIH 1NANI 2Y07H 1TCMA 3W11C 3WN5A 1FVCB 4WFEE 4EXPX 2Z4QB 3D0VA 4KMTL 5L7XH 5CINH 5EZIL 3QEGH 4WHYG 4TVPH 5F9OH 4TUOA 3MRIB 4U1LB 4XI5C 1KPVA 1T2QL 3SDCB 4NKIH 4PJCA 4X98A 1X5ZA 1XR9A 3KPQA 3ROLA 1NSNH 5DK2B 4ZNEA 1FNEA 2F5BL 4HQQL 4NQDD 1NGPH 3OKMA 1A3RL 1U6AL 4M8QB 2DQTL 4DWHA 4NBXB 5D7LA 4GG6F 3T2QA 3UTZA 1CXLA 5FXCH 1YUHA 3SCMB 5FA4A 2AS5M 5J9PA 1D5MB 4KJYB 4F9LC 2R1WA 5CJXA 1Z5LB 4PRIE 1QKZH 2DQUH 1OAZL 1GOFA 3MROA 4NQEE 2J8UB 2GAZA 1JTOA 4KTYA 4G9FB 4PRHE 1KIPA 5D7JD 1HDMB 1IAKA 4K23L 5C0BD 5IFAL 1D7FA 4MXWL 4M3KB 4P2QA 4WW2F 3FT4B 4IRSA 1BVLB 3MBXL 5MHSD 4HMDA 2B1AL 4P23B 3E6FB 2R23A 3QO0B 4U1HB 2AI0H 1KCUL 3UJIH 5DUBB 4PY8I 4R2GB 5MENE 2VIRB 2QSVA 5E00B 2CKBA 4OV5B 1F42A 4YXLH 2WBJB 3NN8B 4GXVH 2VKXA 4AT6B 1A6VL 4MB3A 2CGRH 4X6EA 2GCYA 3ARDB 4OZFB 1F00I 1RZGB 1RY7B 2D7MA 1GGCH 1P7QB 5HJ3B 1MI5E 3LKSA 3PP4H 3JBG7 1KBGL 3SOBL 4X4XB 3PP3H 1MLBA 1MIMH 4GBXB 4EJ1C 6CGTA 5IW6B 4XWGH 4O9HL 1NEZB 4JFEB 4AM0A 3IF1A 3RWIA 3MLTB 3GRWL 4R26H 2IH1B 1U3HD 1WT5A 3JWOL 4XPAH 5J11B 2FATH 2J6EL 4XVTH 4HDIA 1QSFD 4OI8A 2PO6D 5FDWB 3IAGC 4TUJB 2X10A 3Q2CA 4V1DE 3WHXB 4WGWB 1IL1A 2NY5C 4P0DA 4PLKD 1OAQH 4ODHH 5F97E 4UDUA 4I48A 3H9SA 1SM3H 3BZFB 5M94B 4OFDA 1ADQL 3BSZL 4FTVD 5E1HB 3ULVF 3RRQA 5HXMA 4OZHB 1KTDB 4G43B 2ESVB 4GG8B 2GYSA 5KG9A 1TQBB 1QPXA 3UTSA 3DYMA 4FQQB 1QSEB 2DLHA 1BBDH 1JI2A 3R1GH 1U93A 4F8TA 1T20B 5HPOA 2C4FT 4LCUA 1BWWA 3VWJA 4MSWB 4WU5A 3GMMB 3U7WL 4LLQB 4NT6A 4FQPA 3QIBD 1TZIB 1PJ9A 4KKAD 1MQ8A 4PJAE 2VLKB 1JN6B 4PR5A 3JV6B 2X89D 2AXGA 5KOMC 1HHGA 1FIGL 2CO6B 5LVEA 4F7EB 3RJDA 5J13C 3DXAA 4R7NA 1VSCA 3RWDB 1OAYL 5GRUL 2P8PB 5J1SC 4XP4L 3TP4A 5SWZB 3L3KA 4YIQB 3IXTB 1K8DA 3WIIH 4FQHA 1FFNB 3SKNB 1EAJA 3FQNA 1EO8H 2NX5A 1QZ1A 4PJ9B 4HIEA 3IFLH 2B0SL 5HVGB 1GPOL 4Z95H 2CKBH 1XGRB 4RRPG 2W92A 2RQ8A 1J0HA 4GUPA 5T3ZH 4LHQB 3LQZA 4NGHL 4XBGB 4ZUSB 1MREL 1LQSR 4XGZA 5HGGS 4IRSD 4YHNA 3UCRA 4NIKB 1IGIL 3D69B 3DI2B 4F3FB 1JHTA 2AXFA 4P2OD 1UC6A 3DMMC 2F53B 1ORSB 3SKMB 3CXHK 5F3HA 5C08B 1XR8B 1B0RB 1MHPL 1P4BL 4KK9D 4JN2B 2F74A 4GMTL 5DA0B 1MAJA 2DMCA 3C6SA 4JY5H 2BNUA 5GGTL 4IIQB 1EO7A 7FABH 1CGSH 2QKIB 2VLME 3A67L 3MACH 2DI9A 4LBEB 5C70A 3BZEB 5IGXH 2W9EH 4M48H 1TDQA 1BOYA 3S4SB 3RY4A 2C3GA 1Z6JT 3GSQA 2FCBA 4HK3J 1INEL 4DGIL 1R24A 4F9PA 5L2KE 4G6KH 5IQ9B 3ZDYE 2R4SL 4JPKL 4U6TA 1NGZA 5EC2A 1YNTA 3LEYL 4NFDA 35C8L 4YBLC 1UB5A 1R5IA 3U9PH 4JAMA 2BSTB 2J8OA 3D39B 2EIEA 4NPYA 5DMKB 1CDIA 3L5JA 4XP5L 3VI3E 4Y5YB 3E2HB 1RV6X 5K9OB 3BRDA 2NZ9C 3DVNB 4KQ4L 1BFVL 1IGYB 1X5AA 5KAQG 4IRJA 1JUFA 4JVPA 5IHUL 4HFUH 2XY1A 1BZQK 1UENA 3FQRB 3A6BL 2A83A 3VFRA 4LLVB 3RBGA 5D2NC 4E42A 1VGKA 3SDAC 3QXVA 3L3JB 4PLKC 3CSYB 4DUWA 1NDMB 5IHZA 2V2WB 2IAMB 5IJKA 2ARJA 3BESR 5IT2H 3STZA 1U58B 5ITBL 4LLUA 1DBMH 5DRWB 3MFFB 5IBLC 1HCFX 3BKYL 4HS6B 1P6AB 1LWRA 5JQ6H 4YDKH 3P3YA 2NR6C 2Q76A 3KXFE 5EZLB 4FMFA 3MLRH 5CFHA 3KPNA 5DJDB 4G8IB 2WUCL 5LWYH 4EUPH 1GOHA 1MLCA 3BRGC 2ILLA 2X4UB 2BOBA 3IKKA 3LPWA 3TA3B 1Z9OA 5AEAA 5C71A 4CVXA 4BQBA 1A9BA 1G9MH 5DZOA 3N06B 4NO5B 4JHWL 1JZ6A 3BVNB 3DX6B 3ELAT 2GK0A 1KENH 2WQRA 1SMOA 1GVIA 4PUBL 3SDXF 4J4PA 1N2RA 1NGYB 3UDWA 1IQDB 5AUMA 3OWEA 1MCIA 1JNJA 1YY8B 2ZCLL 4UINL 3HC4L 1N5AB 5C6TH 3SE8L 1UVQB 1BFOB 5CUSH 3HC3H 5HD8C 3M45A 2EDBA 2IFGA 2OL3A 1JGEA 3NCYP 1TJHL 5A2KH 2ZUQC 1D6EA 3V2AR 3RWGB 1YPZB 1AGEA 1S9YA 3RFZC 3LEXA 2PYEB 4UT6L 3QUYC 1S9WB 3SGKA 3ARBA 3F7VB 5F9WC 3BGFB 5MEPB 2UV3A 4N0FB 5JNYB 4G8FB 1D5IL 4G80B 1FNHA 1ZLUK 4HUKB 2ZWLT 1YEKH 3MV8E 5DK3A 4YHLL 4LCIH 4M7KH 3P9WB 3CLEL 3UBXG 5DDHA 4L8SB 1ZA6A 1KNOA 4LIQL 4HS3B 1T0NB 4KHTH 4AIOA 5KOVC 4ZD3H 4JFOB 4MMZC 5IVZB 2DTML 2B39A 3MRDA 5HHPA 1YN6B 2PW2A 2J12B 1SEBB 1OP5H 1HH6B 2V5YA 5LGHH 2GY7B 1BD2E 2YA0A 3EOBA 5DFVC 2YRPA 3T3MF 3L3HA 4G7YH 2YK1L 4K3GA 2VDNH 3IGAA 1I8IB 2JJSA 3FQTA 2DJSA 4LPTA 2X9XA 3SGDH 1TVBB 4MZ2A 4TNVK 2CDEB 2FH8A 4NBZB 3Q6FA 3L7FB 4JPVL 4K3EL 5JIIA 1OGAB 1K8IB 2H32H 4JRYB 4I0PC 4JZOA 4NUGH 5FKPB 3KLDA 5LGKA 1FV1A 2FECL 3HG1D 3MCKB 4H8WL 1AKJB 3G6JA 4X8XA 2EXWD 4PJBB 2V7NA 3PV6A 1K3IA 2ZPKL 4XP9H 5EZOH 1MAMH 4JFFE 4X7TB 1XGPB 4GAGH 1JPGB 3KNBB 4PJFA 1FG2B 4DW2L 2RB8A 3H3PL 3HE6A 3T2NL 1RJYA 2ZKHL 3MRNB 3BPLB 4JZNA 4XCFH 4ODSH 3D9AH 3SGJC 2Y36L 4LCCB 5GGVH 5BJTA 3KLHD 4MA8H 1CBVL 4G7VH 1RZ7L 5I6XB 4OFVA 5KJRL 3JV4A 1IC5L 3EFFA 2FJGA 2VC2L 2OL3H 1NAMA 1BX2A 3TH2T 1RIVL 5IB3B 1L6ZA 1KTLA 2W38A 2OK0H 3WIFA 1ZHKB 1RU9L 3GHEL 3GEWB 4HIJB 4P3WA 4QOKD 3JVGC 1FVEA 3QHZL 4APQB 2BX5A 4QXWA 5C8JB 1A4JB 1PLGH 1ZVSA 4OF7A 3JWOC 4YXKL 4P48A 4KWUA 3TZVD 3QG6A 4QT5A 1HE7A 4EKXA 1IGJA 1AO7B 2CDFA 3QXDB 5C92A 1I3UA 4BQ9A 1ACYL 3BDYL 4JO2H 2Q20A 5DQDL 3RWCB 4HKZB 3EIFA 3IU3B 5GS0H 1NC2D 4TNWK 2AJVL 5D2NE 4JJHA 2Y1VA 4PJ7E 3EOTH 5MERA 3RVUD 5T1LD 1D6VL 4PP2B 3VGAB 5I18H 4MA1B 4JHAL 4Z76A 5D1XA 1VFAA 3I9GL 5I8OL 4MCZA 1MFCH 3F7RA 3KPTA 3RNQB 2N56A 5C0EB 3VRLF 1DQDH 1UM4L 1UM6L 4WTZG 3PNWA 3W9EB 4CU6A 2W07A 3RKDC 1LDPH 3QUZA 5CSZA 3WV0A 1CFSA 3ZKNC 3D48R 5D7SH 4Z5RB 5E2VL 1K9TA 3S7GA 5GRYA 5GPRA 4UOW1 3QEUB 2YD4A 4LKXB 1U8QB 2VDLL 1CU4H 1BAFH 1KCLA 1LVEA 2AJYL 2HVJB 4RBPH 1JF1B 1LGVA 2XQBH 2HFEB 3B9DA 3LN5A 3HB3C 3KDMB 3TIEA 2YZ8A 2P5EE 3SKJH 2IFFL 4U1SB 1VHPA 1FZJA 1N7ML 2DLTA 1BFSA 4BH8A 3HUJE 5HYEA 5CIPA 3U1SH 3FFDA 1PBYA 1N3NB 3M8OH 5D96B 3BUYB 4OLYH 1JNHB 1E6OH 3HI6L 4P2RE 5CEXA 5EZJB 4P5KA 3W39B 3LKQA 4NC1C 4YDLB 1HWHB 1ZHBB 4FXLA 2VTFA 1K2DA 4IJ3C 1IFHL 5EOTA 3FO2A 4NO3A 2JJTC 1A1NB 1KXVC 3D25A 2AEPL 4X9HA 3P9MB 5A3ID 4NHCH 2Q6WB 5E8EB 4JVUA 4XHJC 2AJZA 5SWSA 3C9NA 1U2HA 4GG6A 2V5TA 3VFWB 1Z3GH 3FFCE 2HVKA 4JE4B 4XCCL 3F58L 2FO4B 1U8NA 1SEQH 4HGWA 4LP5A 1ZT7A 3FB8B 1DDHA 1XGUB 3MZGB 4G8GD 3EJZD 2PN5A 1FP5A 5B8CB 1FBIL 4QNPE 4B7IA 3PG2A 2EE6A 4Q9RH 1W0YT 5FYLD 4GW5A 3KLHC 1UEMA 2EDDA 1LEGA 1U3ZA 2NXZC 3QG7L 4JDVB 4N1CA 4XNMB 3FMGL 1WZLA 4DKEL 1M7IA 3TNNA 1OGTB 4ERSL 5F7DB 4OCYL 3UP1A 2DLGA 4ZS6D 3VMNA 5I9QB 1CDHA 4RMWA 1RMFH 2W59A 5B39B 4X7EC 4BFEA 3FL7A 3OKLA 2ADJB 4R9HA 3RY5A 1R3IH 3X17A 1Q0YL 3CFDA 4YHPA 3L5WB 3QNZB 2GTZB 2VDPL 3MNZB 4M61A 1CICB 2H41A 2P24A 4J3OC 5D8JH 1HWGB 3U9UB 4LLYA 1CXFA 2PTTA 4G6MH 5H8DA 3WXWL 2OR9H 2MKWA 4MDIA 1DANU 3C6LA 1UXWA 4OJFH 3RVUC 4Y5VC 5TFSL 3TVMC 1GRWA 5B3NA 3CFBB 4YR6B 4HK0B 3TF7C 4DGYL 2VDQH 2VDKH 1AXSA 3EYUL 5A2LH 1U42A 5ILTL 4Z78A 4PJDF 2H6PA 1JZ3A 1I1RA 3RWJA 4RA0C 4ZUUB 4PJ8B 5CIPH 4JPIB 4L8CB 4ZFOA 2WP3T 1AHWB 1UCBL 1WAAF 3QWOA 5F6IB 4R97B 1WISA 3H3BC 4MNHB 2E3VA 1M71B 4X83A 4JDZB 3ARPA 2G60L 4X6FA 4MYWB 1C1EH 5T1MA 3RIFF 3STLB 4FQ1L 4OZIE 2O5XL 2R4RH 5IMOA 2HLAA 4JQVA 4G6FB 1EEUA 3ZKXB 5MP6H 2ESVE 4S1SL 4P57B 1B0GA 1FL5B 3V6ZA 3KPRB 3BDBA 5HVHB 3PDGA 1I1AB 2XWTA 1GGBL 2JB5L 1P84J 2XZZA 3WFHA 1JWSB 4Q7DA 1SQ2N 5A3IC 1CR9L 3NPSC 2J88L 4PGBB 5EU3B 3HE7A 3TC9A 1EHXA 1ND0A 1T4KA 4X99A 3BN9D 2L7UA 5I1CL 1UXSA 3JTSB 2CXKA 4CL7A 4HSQA 4C4KT 3UPAA 4OD1H 5CJ5A 2Q8AH 3EJZC 4L4TA 3WS3A 5IM7B 3VGBA 1CXEA 2QSCH 5DZLA 1QFWI 3V4PL 2D0HA 2Y5TB 2J3SA 4HUUB 4LDLB 3UC0H 3RGVA 4BZ2L 4GXUN 2NTFA 3BWAB 3DVGA 3FZUD 2OMBA 1MFAL 3EYOA 1KTRL 2W91A 5ALCL 5JR1L 2F53E 4AQOA 2I9LA 3LPGA 2JELH 4J8RB 5DYOB 5F89B 4O00A 3SGEH 4AG4L 4CMMA 3IU4H 4WDIB 1KLGB 1GH7A 3RL1A 1TQCC 4OGZA 5TE7H 4C56E 3BZ4B 3HFML 5F7WC 4XC1L 3SQOH 4M43H 3V5KA 2UYLB 2HLFD 2X4TA 1EFXB 2XG5A 1QRNA 3TCLA 1MUJB 1J0KA 1DSFH 3MA7A 5ISZB 3MRPA 4BQCA 2GIYA 3VD5A 5I16B 3Q3GB 3WL9A 1AP2B 1I7RA 2KPNA 3PL6D 1ZGLA 5C6WH 1RK0A 4NC1E 1AI1L 5GS1B 5I1EL 2GJJA 5I1GH 1RZJL 2HMIC 4F33A 2DQFA 1CTNA 1T2XA 2XZCL 1WGOA 4BZYA 5I66A 3TEUA 1I7ZB 4MX7B 2VLJE 4PTTA 2CUMA 3ZE2E 4NKDB 1G0XA 3CFKB 3F7YA 3L3IA 3MV9B 1GYAA 3FAXA 3HRZB 1JYVA 3N85H 3RWHA 5EA0L 1P7HL 1OD7A 3SKOB 3VCLB 3PHQB 4L3CA 3P30L 4PJIE 1NFDA 5EU6D 3TBTA 3MRJB 4K7FA 5ADOH 2ED8A 4PS4H 4R0LA 4YHYC 5GS2H 1I1FA 4CU8A 3KS0H 1C16A 3LY6A 2ZSWB 4RGOL 3O6FA 2B7DT 3MJ9A 4DQOH 3E3QC 4BQ8A 4NQUA 5F9JB 2X4NA 3C5SB 2NW2B 1EERB 1JRHL 3S34H 3LIZL 1KYOJ 4GT7A 3OKEA 4X6CE 4KV5F 2FJHB 3NZHH 4CJ1A 2W0PA 4KZDH 3WUWA 5GS2D 5HHXL 2Y9RT 1BJ1H 2F54E 5JXAH 1NGWB 5HGAA 3WHE1 1I3RB 1JE6A 2IG2H 4K3JL 3BN9C 1FJ1B 3O0RL 3FRUA 5FGBA 5HDOA 1HZHL 3S5LB 1B2WH 5I8CB 4HMCA 5AZ2H 4KJWD 3OQ3B 1TVHB 4MGXA 3E8UH 1JNNH 4QF1A 1CD1A 4S2SA 4XXDA 4MLSA 2A2QT 1R5VB 5EG6C 1LE9B 1JGUH 4EDXA 3UXFA 1H3UA 4WO4C 2W60A 2QHRH 5EBMA 3QPQD 2X7LB 3CK0H 3TGXA 1YQVL 3FZUC 1CIUA 2GK2A 4M62L 4QXUH 5GGRA 4YWGH 3EYFA 3MR9B 3MUGA 4CBPA 3VFPA 1BMGA 1LEKA 1K6QH 1U8PB 2C4FU 2Z8WC 4EOWL 2E9BA 3V7AE 1L9NA 4KHXL 3HAEG 3IXAB 3QCTH 5IB5B 1TNMA 5E2WL 4ZAKC 4Y5XB 2YHGA 3QEQE 4L8BB 3VFUB 1B6UA 3LKRA 3T2PA 3CSGA 4PRBA 1JK8B 3ZDYF 4FA8A 2GI7A 4MXVF 3S96B 4L3EB 5GIRB 5ICXB 5I2IB 3U0PB 5FYKD 5L7XL 4YDJB 3QEGL 5HDQL 1H5BB 4TVPL 1G7PB 5BRZB 3TFKC 2R0KH 4MHHG 3VJ6B 2BOCB 4NKIL 3VFNB 2EDWA 1NJ9A 1UWEH 1HOCB 5I74C 1NSNL 1NGPL 3LRSB 2BZDA 3K0WA 1CG9A 5I8KH 3PQYA 1U8KA 4P9HL 4CMHC 1FNFA 1UJ3B 5DQ9B 3ME0A 3MJ9H 5AYUL 2DKSA 3DARA 2IGFH 3PWUA 1IAMA 4WNQA 4LVHC 2ERJB 1IZJA 2DQUL 4L4VE 5DHVA 3OHXA 2B4CH 1EXUB 4PGDA 5HHNB 3UTTE 1Q8MA 4HX1B 1ZLSL 1OGAE 1FZMA 2OI9C 3DX7A 1PYWA 3QQ9D 2IPKB 1JMZA 4ZTOH 3RWEA 4PRAA 2XN9E 2MOVA 2QBWA 4NQDB 4LIQE 4UB0H 5E5MA 4I2XA 4N0UE 3QQ4A 5D7IE 1P4IL 2BJMH 2E9IA 2J4WH 1EX0A 4MNGE 4YXLL 4GXVL 4JFYA 1CCZA 4I5BA 1CT8A 4Y4FB 1A8JH 3W5MA 2AEWA 1NFIA 3TPUA 5LG1A 3LRHA 5BCAA 1XMWA 2AV7B 2ICEB 4QRQB 4QHKJ 1E4KA 2CGRL 1MFDH 4S1RH 3BW9A 1XF3A 1KGCD 5D7JB 5ESAA 1GGCL 3ARFD 3IVKA 4UZGA 1OTTD 5C0BB 3P4OA 4K94C 4LSTH 4Z7OF 4OCSH 1KIQB 1RZKH 2HG5A 3QXWA 3NIFF 4OGYL 4LHUG 3REVA 3T4YB 4PJ5D 1MIML 2UVEA 5ID1B 2XIDA 4U6YA 3SDDC 1KCRH 3T8XB 1RJZB 3QDGA 3S36H 2UZIH 5M7QA 3TN0C 4R26L 4XP6H 4XPAL 3DX9A 5TF0A 2FATL 2YUWA 4Z77A 4XVTL 1Q0XH 4ODVH 3AAZA 2A1WL 5A16A 4S1DD 4JFHE 1KJ3H 1CLZH 3ARZA 1UWXK 4Y1AA 4UQ3A 1D9KA 1S7XA 3KS0J 3O4LE 1BM3H 3MNWA 1H3WM 4YHMH 4DTGH 2FB4H 3PWNB 4S1QL 3VXSE 5IFJB 4LFHG 5EFIB 1Q38A 5HGDB 4YHIB 2C9AA 3IDYC 4PRPD 4Y16D 4HK3N 3R1GL 5D5MB 1S7TB 1U3HB 2WP3O 3GIZL 1BJ1J 3H7BB 2F15A 1P9MC 2V5MA 1QSFB 4PV9A 5LAXB 1NLDH 4RGMC 1DQQB 2NLJB 43CAB 2C3VA 1E0OB 9CGTA 4P4KD 3G6AB 1AGDB 3ARGD 5DHVH 2YMXH 1CXKA 3E3QE 3F7QA 5IB4B 2D9CA 5BVJB 2Q7YA 4FTVB 4KRNA 5GSRB 5B4MC 3WN5B 2BHZA 2E7BA 1FSKB 5HY9A 3VXUD 2IANA 2FIRT 5CEZE 4M5YL 1WICA 5H35B 1PY9A 3D0VB 1SJXA 4TUOB 2M2DA 3WIIL 1N8ZA 3R0NA 3CX5J 3B9KC 1EO8L 1PZ5A 4HJJH 1KPVB 1LMKA 1NMAH 1ZEAH 3S3JA 1IKFH 4JFZH 1IKNC 3IFLL 1VFUA 4X98B 3QCUH 4Z95L 4UBDD 2CKBL 4O2EB 4WHYH 3DETD 2MKLC 3QIBB 5HYSG 3OKOA 3ROLB 5T3ZL 4Q9QH 3DV6A 2DQJL 2ZUSA 1FNEB 2GJZB 2NXYD 3OKMB 4KY1H 1XCQB 3TM6A 3Q5TA 3RY6C 3QQ9C 3SPVA 3RX8A 3UYOD 4UU9A 3GJEA 4C4KO 2IQAA 2N4IA 3QDME 5FA4B 5T1KD 5J9PB 1IC7L 2R1WB 5KZCD 4JY5L 3FHAA 2FBJH 7FABL 2EO1A 1CGSL 3MLWL 4TNWF 2ADFL 3NFPA 2GAZB 4FQIH 5E08H 3MACL 4HUWB 3ZSTA 2AGJL 1WCBA 3MLZH 3LH2H 1LO5B 1DBBH 1WBZA 4UT7L 4W68A 1IAIH 4M48L 3SO3B 1MHCA 5EBWB 4P2QB 5KANI 4ZQKA 4IRSB 2X09A 4ELMF 1OTTC 4I18B 3BPCB 1MRDH 4P2OB 4G6KL 3MV7D 3FQUA 3N1QC 4D3CL 3L7EA 2XTJD 2CKBB 3BJ91 3U9PL 5BS0E 3ALXA 3H8NA 1FCCA 3V0WH 2WK2A 4MJ5B 4XBPB 3TYFA 3I75A 4GAFB 2DWDA 4LL9A 2H2SC 1Y0LB 4HFUL 1V5JA 3LKSB 4U7MA 4JKKA 2MQ0A 1KPRA 3GNMH 4HKXA 4RX4D 1DBKL 1MCNA 4PJHF 4PJ7F 3UO1H 2J8HA 3MO1A 4N8VG 1T1ZA 1EJOL 1IM3A 3BO8A 1XIWD 4LLWA 5D1ZD 1CZ8H 4ZMAT 2R2BA 1JZ7A 1PQZA 3V6FB 5FF6A 4OSUL 3REWA 2DKMA 4P2YA 4AM0B 3BFOA 3HS0B 3IF1B 2VUYA 1HSAB 5IT2L 5CILH 5ALBL 1YDPA 1DBML 3N1PC 1OW0C 4HDIB 4KKBD 3WS6C 1H8OA 4GXUM 2UY6A 1HKFA 4Y16C 4EIGB 3WDIA 5BV7L 5JQ6L 4YDKL 3K46A 1ZLWH 4RFEB 4ZOEA 1IL1B 3RVTC 3MLRL 4HJGB 3M17B 5EUOA 1Q9LB 4FFWD 5C07D 5ACZB 1KG0A 4UDUB 4HBCH 5DC0A 5T5FH 1TCRA 2K3TA 2YD2A 2BVPB 1ZSDB 3GSVB 4RNRA 2R69L 3PDDA 1YYLL 3EBAA 2BRRH 3CU7A 2BVYA 2YPLA 5KG9B 2V7HA 3UTSB 4Q58C 3EDDA 1G9ML 1U93B 3D85D 2X44D 4JB9H 1MJ8H 2VN7A 3X11A 2Z31C 3K80A 4WU5B 4Y19A 1KENL 5IK3B 3BQUD 1A1OB 1OT1A 1LILA 2D03H 4UQ2A 1T03L 2ZUYA 4UUJB 5KSAC 1HHGB 5IROA 2BNRD 3KR3H 4GOSA 1UACH 2NXYC 1FAKT 3LD8C 3V4UH 4EI6A 1JP5A 4NOBA 5CUSL 3R8BB 4OD2B 5C0AD 5I75B 2VYRE 3QDJE 1K8DB 1WSST 3VU2A 4ENEC 1T5XA 1ZT1A 3FQNB 2W65A 1MF2L 5HVFB 3GIVA 4HIEB 3HZKB 1SJHA 4ZS7H 43C9A 4EUPB 1OAUH 1WCQA 3KYKH 1T1XA 5HYIA 5LGJA 3S98A 4UDTB 2J8UF 4GUPB 4AEIH 4XGZB 4GAYA 4NWTH 5I1DA 4L8DA 4YHNB 1P5VA 4PJXE 2GFBB 4F80A 4LSVH 2EDEA 3VXMD 3T4AA 1YEKL 3WIHH 1MAKA 4LCIL 1U3JA 3NCMA 4M7KL 4ODWB 4J3UA 5DURD 4I9WE 4LNRB 3QO1B 4GQ9H 4MS8C 2ZJSH 1QYGH 3EHBD 3IDGB 4KHTL 1A7QH 4ZD3L 5FYKE 2XRAL 3RZCA 1PKQE 4MJIA 4MB5A 2GTWA 1OTSD 1X9QA 4WWKC 5FK9B 3IS1X 2DB8A 3QIWA 3P0VH 2H26A 4G7YL 4NN7B 4P9HC 4OCLC 4HIHA 2VDNL 4XBEH 3T0EC 3VXPA 1FL6A 2XKNA 3UYRL 5EC2B 3VWKA 1YNTB 4C54A 1XIWC 5D1ZC 3UAJC 4DKAA 1R5IB 2I27N 3QP3A 2ICCA 3QISA 3U79A 1LD9B 3K1DA 3OAUH 3UTQA 3PWPE 5L0QB 2HWZH 1FE8H 4IRJB 1F6AA 3PGCB 2YC1B 4NUGL 3WXVL 3K4DA 3B3IA 2A83B 4AIXA 2GQHA 4TYUA 4O02H 1FFOA 1G6RA 4MAYD 4XAKD 3QNYA 5BQ7B 2J7LA 4XP9L 1I3VA 5EZOL 1MAML 4FXGA 5IW1A 4GAGL 5L8JB 3MV9E 4OZHF 3DGCR 1LNUA 3NTCH 3PHSA 3STZB 3QBTB 4XCFL 4ODSL 4YX2H 3D9AL 4PG2A 4MA8L 4G7VL 5EUKA 4AH2A 5JLZA 3QZWB 2Q76B 4WHTA 5DWUL 3T3PF 2OL3L 1GC1H 3T0AA 4LASH 3HG1B 1EZVY 4F15B 4GRMA 1ZLVH 1MLCB 5D70H 2OK0L 2BOBB 1CFNA 3H9ZA 3U36A 1XZ0B 2AQ1A 3MRBA 5SWQA 5A2JH 2RJMA 1RIUH 1PLGL 1J18A 4PJ5E 2EE2A 1A9BB 2H32B 1YEIH 2G75B 5I19L 4PRNA 3C5ZD 4J1UA 3EOAB 1AGBA 1VESA 2G5BB 3U6RA 2VABA 1WIOA 4JO2L 4AIZB 2DQEH 3GSWA 5GS0L 4O2CB 3MJ7A 1AH1A 1NAKH 3P9LB 1N2RB 5C1MB 5AUMB 4KH2A 4QWWC 4X80H 4OD3H 4DZBB 3EOTL 1EHLH 3MRHB 5INDA 2JIXA 4QOKB 5I18L 1F6FB 4NZUH 1B4RA 3OR7A 2YWZA 4BFIB 4P46A 5ENWA 2V6HA 2I9TA 3BH9A 5F7UA 4HV8B 2OL3B 3TZVB 1LDPL 1KLUA 1XGYL 4TPRH 1D5ZA 4OZ4A 5D7SL 5C2BL 2HT3C 4YK4B 3OR6A 4ONHB 1TMCB 1J1XL 1AGEB 4PGEB 4X4MA 5CJXC 3GSRA 1CU4L 1BAFL 4JGJA 3RBSA 4D0BA 4NZTH 1NC2B 1FYHB 4ONGH 4O51A 2V17H 1U8IB 2XQBL 3B5TA 1HEZB 5JZ7D 3FRPG 3G5ZB 3SKJL 3DX8A 5T1LB 3D6GA 5HHOD 2CRYA 3VWKD 1ZA6B 1KNOB 3U1SL 2P42B 2ZCHH 1V3MA 4OLYL 1E6OL 4HUXA 4L3EE 3CXDH 1S9KC 2F9BT 2NY4D 3MRDB 3NIGE 2HKFH 2Q86B 5HYQA 3WO4C 2JE8A 5LBSH 4S0SD 3MRKB 5CGMA 4XMLH 3EOBB 3LMJH 4NHCL 4D9QD 3IDMA 3AU1B 3QFJD 2OJZH 2A6KB 3KPPA 4Z7VE 1Z3GL 2YSSA 3FQTB 1INQA 4MAYC 1SEQL 2A38A 2LU3A 4NWUL 4WV1A 5I8EA 5DZNA 2D31B 3DROA 4L29A 4PJIF 5E94B 3DURA 5JTWA 5L2JA 4U1NA 1WT5C 3SN6N 1T0MA 1L0YA 4R4BB 1IGFH 1FGVH 4Y88A 5CP3H 2KKQA 3MRRB 2Z35A 3PV6B 1YMMA 2NW3B 3LN9A 4G6JL 3C60D 5E6ZA 2XZAL 3BZDA 3ESUF 4TULH 3HE6B 4E41E 4TVPE 4X6CF 1VFMA 1MPAH 3VMPA 1RMFL 3UPRA 3IFOA 3OF6A 4XVSH 4ZG1A 4RMVA 4LVNB 4G8GB 1R3IL 4CW1B 3EDFA 1QFPA 4PJEE 5EO9A 1T83A 2FZ3A 5D8JL 3RWFB 1BX2B 3VWJC 3LN4A 2FSEA 2EE3A 3OL2A 3OJDA 1DN0A 2QQNH 2YXMA 2VQ1A 4G6ML 3T0EE 2VAJA 1FVEB 1WV7T 3KLAB 5AAMA 2KQNA 2HJLB 3CFJA 2VDQL 3QG6B 1I9JH 4JZJA 1S7WB 5IVNA 5BV7C 1VFBA 2A6DA 3D2UA 5KS9E 3MRLA 4DVRL 3ZTJG 5IMMA 3K74B 5F7LB 1A1MB 1YPZF 2ORBH 3EUUA 2DI7A 3VGEA 1R5WA 1C1EL 2R4RL 3PNWB 3K4ZA 2BMKA 2EDNA 2IH3A 1UJTA 3QUZB 4O5LH 5CSZB 5KVFH 5MP6L 3C08H 2B5IC 4XVUD 2YD6A 3EZ8A 3IB4A 3PGDA 3B8YA 5T3XD 2K7QA 1NUGA 1IT9H 2X4PA 5IOPA 1IBGH 2MHAA 3L9RA 5J7CC 2AK1H 4LCWA 4YBHA 5GGUA 4WJ5A 3W0WA 3ALPA 5EIVA 3O8XA 3I2CL 2DL2A 3QXAA 3ZYIA 4BH8B 4NN7C 5CIPB 4F9PC 3FCTA 3HZVB 4CN6A 3O3AB 5CEXB 1LO4L 1X44A 4PLJD 4OUOA 2A77H 3LKQB 4HZLB 4FQ2H 1AQKH 2ATKB 4OD1L 2Q8AL 4CU7A 4OT1H 3FO2B 4NO3B 5EOTB 5IB1A 5E99H 2QSCL 5C0CE 4HH9B 2X1WL 3D25B 4PJCE 1IARB 2XOTA 1SY6H 2C1OA 3UC0L 4UNVA 2P1YA 5KTEH 1ZLUH 3PP3K 3RI5K 3VDCA 4ZNEE 4PJBF 2CUHA 3QUMA 3VXME 5IEKA 1O7VA 2DLIA 1ZT7B 3C60C 5E5UB 1DQTA 2XICA 1E4XI 5D7LE 4U0QB 5J0BA 3LAFA 1E28A 2JELL 3E1F1 1Q9OA 1DFBL 3OJ2C 2DDQL 4NRZA 3PV7A 4U0RC 3GSUA 2R2HB 4N9GB 3D3VD 1C7SA 4I77L 4YHOH 5TGBB 1IEHA 5TE7L 2C5DC 4ELMA 3O9WD 4GRLD 3TNNB 5I1AA 4QRPD 4WFHE 2C3XA 4M43L 3SQOL 3G6DH 4J6RL 4ZFOL 2RFXB 4ZYKB 4P2QE 1U92B 4IDJH 1DSFL 1BIIB 1X4YA 3ULVL 5E4EC 5DJ2A 5J06A 4GSDL 3B4NA 1MHHA 4KVNH 4L3AA 4YHPB 3KPSA 3D18A 5I1GL 5T3ZE 4NKMA 1BBJA 2FJFA 4PJHA 2XNAA 3KHOA 3OPZH 3JV5A 2RR3A 2RIKA 2PTTB 5IFHH 3CZFB 1OP3K 3RX7A 3MOBH 4X8JA 4JCMA 4V2CB 4CKVX 5BVPL 4KZEH 3HZMB 2XKUA 1HHKA 1T7YA 3N85L 4RMRA 5B38G 1QPPA 4XPHH 1BZ7B 4UV7H 2AK4A 3ILQC 4Z78B 1NCBH 1I8KB 4ORGA 1U8MB 3P0GB 2VN4A 1I9RH 4O2FA 5GGSA 5E0QA 3PL6B 2WM0A 3RWJB 4C58B 1J7VR 4KGLA 5JHLL 4XVUC 5E8DH 4ZFOB 2EE9A 1CS6A 1NLBH 1IEAA 4ZUVA 2EC9U 2E7LA 3ARBC 4WY7L 3VH8G 2MPAL 4L1DA 2PXYA 4DQOL 3FN0H 3H9SE 1XFPA 3S34L 1T2JA 2ZUXA 3SO5A 4NYLB 4BJLA 1A7NH 2Z4QA 3NZHL 4KZDL 3DPBA 2CK0H 3V6ZB 3C2SA 3F7PC 1WK0A 3UTSE 5JXAL 4MAUH 1KPUB 2IG2L 3IETA 5IF0A 5EU6B 3U2SB 3SDCA 1T3FB 1B2WL 3OGCB 5AZ2L 1BQHG 4Y4KD 3C8HA 2BC4A 3E8UL 1JNNL 2NYYD 4EBQH 4QGYA 1QG3A 4MWFB 4ZOCA 4M8QA 1JGUL 5HI5C 5J1AB 1VERA 2ZUWA 2BY3A 3FHQA 2QHRL 3DXAE 4OCWH 3SE9H 4X99B 1VENA 1ED3B 3CK0L 5C9KA 4ZXBD 2JJSC 5FEBA 3EDJA 4YWGL 1A7OH 3NIDE 1Z5LA 4OF0A 5HBBA 1A7RH 3KPOB 5I1JH 2QEJA 4DUXA 1K6QL 1QHPA 4L4TB 3WS3B 2NX5E 4G9FA 1WWCA 2ZP0T 2Z91B 4LVOC 1J8HD 1YJDC 3RGVB 3HCVB 3DVGB 3FT4A 3QCTL 1BVLA 3SJVD 4P23A 2NY2C 3E6FA 3FAWA 4U1HA 1KJ2H 1RUAL 4U1GB 1G9NL 1DLHB 5DJCB 3S37H 32C2B 2VIRA 2I9LB 2IEPA 4M6NH 3FQWB 1EMTH 1WUNT 4W81A 3F62A 4CMMB 5TPWH 4NQCD 5DO2D 2R0KL 4AL8H 3QJHA 3W82A 2D3VA 3RL1B 3ARDA 3HR5B 4OZFA 5IHLB 1RZGA 1P7QA 3FONA 5K59E 5HJ3A 1BGXH 1OY3B 1UWEL 3V5KB 5C0RH 4UTBL 4K7PH 2BSSB 1EV2E 3WFDL 3LPFA 1QRNB 3AREA 4UAOC 5I8KL 5SX4I 4H26A 1NEZA 4WI2A 2BERA 25C8H 1QNZH 1F58H 3MJ9L 1K4DA 2H9GB 3MLTA 3WL9B 1ZGLB 2IGFL 4U31A 1RK0B 5FDWA 1SYSB 4F33B 2B4CL 1HKLH 3ARQA 4NN5B 2GKIA 3HLAB 2M26A 5I66B 4ZFFB 1OAXL 1VADA 1RFDH 2NY0B 4PTTB 4QCIA 4ZTOL 3F7YB 1IGMH 1L9MA 4UB0L 4Y8DC 1ZHNB 4Z7WB 1R3HA 4OZHA 1DUZB 4G43A 3RWHB 4GG8A 4WTWA 2X4OA 4Q6IB 1B4JL 2BJML 4FQQA 1QSEA 4JFQA 5D1XC 4YXHH 2J4WL 1N6VA 1C5BH 1NFDB 1QA9A 3DUUB 3VXRD 1KF9B 3GMMA 4TRPH 1NEUA 4LLQA 2NY6D 4HPOH 2P5WD 4R0LB 1J5OH 5IKCA 1MFDL 1TZIA 3LZFH 3OKYA 3P73B 4KJQC 2VLKA 3VXNA 1JN6A 3MUZ1 3O6FB 4LSTL 3IYLW 1CE1H 4OCSL 3ULSB 3HNVH 3ZKSD 4F7EA 1WC7B 2VL5B 2X4NB 3RWDA 2IWGA 2P8PA 1MEXH 2M8XA 3UPCA 5SWZA 1KCRL 4YIQA 1P53A 5HGAB 3BXNA 4XP6L 4GKSB 4PY7B 2O93L 2IALB 4PJ9A 4U1IB 1Q0XL 4ZXBC 4ODVL 2ATPB 1FH5H 1XGRA 1RURH 2X41A 4QRRD 1E6JH 2EXYD 4XBGA 1G7QA 4QF1B 3ARFB 3QULA 2D9QB 1KJ3L 1CLZL 4S2SB 4XXDB 5E5RB 5E6IA 4LDEB 1NH6A 3BUTA 1BM3L 4F3FA 1ETZB 1M7XA 1N4XL 4DKFH 1P7KA 1ZANH 2GJ6D 5EBMB 1ORSA 3SKMA 3S36X 5C08A 1XR8A 1B0RA 4JN2A 4UT9H 4ODXB 4OI9A 3SE3C 5DC9B 2Z0BA 2UWEB 3CCHA 3I6KB 4BQ6A 3S88H 4IIQA 3P77B 1LO2H 2E8ZA 2EEDA 1EUTA 1LEKB 2QKIA 4Y89A 4HWUA 4LRNL 4Z7QE 1PG7L 4FHBD 1NLDL 4LBEA 5T3XE 3BZEA 2VERN 1FNLA 4OLWH 4I3SH 4LPUA 2A0LD 2IQ9L 2YMXL 3X3GH 3N1MC 3KAAA 1CF8H 4LHUA 3VGDA 5HGHB 4OFKA 15C8H 4N9OB 3HAEH 3RDTD 4HW6A 3GKWH 2W0FB 2BSTA 3OG4B 3HC0B 3D39A 4PRPB 4RAUA 4Y2OA 5CEYA 1KT2A 3I6LE 1KCVH 4Y5YA 4HJJL 1NMAL 3DVNA 1IKFL 2Z93B 1IGYA 4JFZL 5AD0B 1QFHA 2MQCA 4JKWA 3T0VA 1NJ9B 3FQRA 4Q6YA 4P4KB 1LK3H 4LLVA 3P11H 4WFGE 3SQBA 5JW5A 4Q9QL 3ARGB 3T08A 1MRFH 3L3JA 3BD4A 3OKNA 3O41B 3FOLB 5IP4A 5KVGL 3VFGL 2V2WA 4KKLD 2IAMA 1QUNA 3VXUB 3IFNH 4PB0H 3C6LC 4P5TD 1U58A 5CLWA 3PWJB 4WNQB 4JLRA 5DRWA 3MFFA 4TSAH 5FGCE 4HS6A 5DHVB 2FBJL 3IAQA 3OAYK 5INCB 4FQIL 5E08L 1P84K 1BQLL 4WUKH 3MLZL 3M1BB 5DJDA 1Z9LA 3LH2L 3ZKQD 3MYZA 4RFNC 2EDLA 1PYWB 4G8IA 3MX0A 1IAIL 5DR5H 3RWEB 2VXSH 2X4UA 4XNXL 2FEDD 1T6VN 3G6JE 2HJKB 4PP1D 3WYRA 4QRSB 4NCC2 1L7IH 3ULVC 4I2XB 1KCSH 5IG7B 4PJFE 2NY1D 5CGTA 4JQVC 1TETH 2BNQD 4JFYB 5T1KB 1FORH 1CT8B 3BVNA 4RFOH 4LEXL 5EO0A 5KZCB 1NFIB 3TPUB 3V52H 3V0WL 3MODL 2LV4A 5EU5B 4NRXA 4FQXD 5HYSA 1NGXA 1NGYA 1N6QH 5E6ID 3P4OB 1GHFH 5T5NF 3GNML 1MJ7H 3V8CA 3UO1L 1DCLA 1T89A 1N5AA 1Y6KR 5KVDH 3REVB 4GKOA 1CZ8L 4XPGH 1NUFA 3U0TA 1BFOA 1FC1A 4U6YB 5D2LB 5C0IA 1NCNA 2XTJB 3HE7C 5CILL 5K9KB 3WD5L 1EVTC 3AAZB 4DFIA 1YPZA 4YC2C 2PYEA 3F7VA 1CLYH 5HYJD 2X4RB 5MEPA 1D9KB 1S7XB 4HBCL 4M02A 5T5FL 1W72B 4N0FA 5IB2A 4G8FA 1N5YL 1HI6B 1VA9A 4N5EC 1RK1B 1EPFA 3Q48A 1FQ9C 2HFTA 4MNQA 3R06B 2BRRL 3CLFL 4L8SA 1LHZA 4HS3A 1MVFA 5EULV 1T0NA 2N7AA 5C3TA 1S3KL 4AENA 3EGSA 1QFUH 5BZDA 3DUSB 1MJ8L 4HC1H 1C5CH 5IVZA 4DOHE 5JW3H 4O58H 5DD6B 1JPFB 1JHLH 1SMAA 1HH6A 5D1QD 1NPUA 2C3VB 2FIKA 4B7LA 1SYVB 2D03L 2VKWA 2NY3B 1TENA 2VLLA 4NNYB 5C07B 3QUXD 1DJSA 3NBNA 4RGNB 2Q7YB 1YNKH 3KR3L 4CAGA 1UACL 3VFSA 3V4UL 4NNXB 1J05B 4M1CD 4AK1A 5EN2A 2CDEA 4F7MB 5I73B 1AXIB 3L7FA 5F7YC 3D85B 1PZ5B 5GRJL 3WLWD 4P5TC 4ZS7L 4JRYA 4J3XA 2BSED 3KYKL 3BQUB 3OKOB 4AEIL 3MCKA 3TBWA 1AKJA 5EWIH 3DV6B 3QI9D 4PJBA 4NWTL 1R0AH 1LK2B 4YQXH 5DSCA 3HI5H 1G9NC 1KYOK 2BNRB 4LSVL 4X7TA 1XGPA 3CUPB 3ZSSA 1JPGA 5SWSE 1FG2A 3WIHL 4B53A 4OAWB 4GG6E 1QP1A 3MRNA 4NQXB 4EDWL 2IQAB 4GQ9L 5CCKH 4DKDC 3DIFA 5KVEH 1P6FA 3TT1H 1Y18A 1NCCH 5JORB 5C0AB 1QYGL 1H8SA 1A6WH 5FYJH 1X5HA 1TITA 5EORH 1J1PL 4PJEF 4M9PA 5H94B 4IOFD 5HTSA 1HYRC 4EVNA 4K2UH 3V6OA 1WBZB 1HSBB 5IB3A 3ARXA 1TVDA 3P0VL 3WFEH 4HIIB 1NUDA 5C7XH 1A21A 4Z7NF 4APQA 3LDBC 1DLFH 1A4JA 4DGVH 2XA8L 4G6AD 4KDWA 3GUTB 1L0QA 1WFTA 1AO7A 1A22B 3QXDA 3UX9B 3BPNC 1B3JA 3F12A 3RWCA 3MC0A 3V7AG 3PIQB 4HKZA 1UWGH 3NZ8B 4LVEA 1FE8L 5AAWA 3QQ3B 1KACB 4HG4J 1REIA 5FGBC 2AXJA 3ZDXE 4GFTB 1U36A 4M7ZB 5IEHB 1S7RA 1Z9SA 1RIHH 4HKJB 3MO1B 4O02L 1T1ZB 3OZ9L 1IM3B 1PQZB 4MLIA 2Z8RA 1RUKH 5JHDD 3REWB 3RNQA 4XCEB 5C0EA 3W9EA 4R7DA 4R4FH 2ZNXA 3NTCL 4K71C 1IRAY 4UOW0 4WUUD 4YX2L 4Z5RA 5DFWH 4LAJH 1QO3A 4LKXA 3T04D 5D5MF 1X5LA 1ITBB 1QR1A 4J3SA 4LSSH 2R29H 2HVJA 1UA6H 1JZ2A 3TBVA 2H45A 1P4LA 3RI5F 5EUOB 1KG0B 2HFEA 4LASL 3HR6A 2ZOKA 3KDMA 5D70L 5DVOA 4U1SA 4EI5D 2EKJA 4OKVA 1MCEA 3ULVE 4M93C 2X40A 2YPLB 1K3ZA 3K8KA 2V7HB 3ILPA 3ULUH 4XPFH 4W4OA 1JNHA 1YEIL 2FEEI 3O4OC 2DMBA 2OXGA 5EZJA 4H88H 3X11B 1OLZA 2C3HA 2X42A 1U8LB 2CD0A 4M1CC 3W39A 4D0DB 5K9QG 1FAIH 2IADA 3MQIA 1V8HA 3N1FC 1OPGH 3RP1A 5ITFA 4UQ2B 2DQEL 4G9DA 1A1NA 1C12B 3S97C 1NAKL 3ULUD 3P9MA 4NC2B 1UWXH 5E8EA 2QL1A 1J86A 1G0YR 4X80L 4OD3L 3RVVC 1G7IB 3V8OA 1EHLL 4JM2A 3CMOH 3VFWA 2VLRD 3QI9C 4M4RA 4NZUL 1MH5A 5CLTA 1PVHA 3FB8A 2OS7A 4N0CD 3MRFB 4YAQB 1DVFD 1XGUA 3LQAL 3C5ZB 1T5XB 5B8CA 4TPRL 3QIUD 4BZ1L 3GIVB 4FFVD 2CMRL 1GSMA 43C9B 2YD8A 4XRCA 2XXMB 1T1XB 3BKMH 3D1MC 3K7UA 4JDVA 4PJGA 4NKOA 4ODTH 4XNMA 2FNBA 1MIEH 4H20H 4ONGL 3TV3H 5LQBH 2V17L 4EN3D 1J12A 4KK6D 4Y2DD 1F3DH 2ARJQ 4PV8B 5SX5H 2VAAB 1T66D 3I3BA 5B39A 1G6RL 4WHCA 4DEPC 3CXDL 4NQEA 3L5WA 4YE4H 3QNZA 3RZCB 3MJ8A 3MNZA 4PRHA 1A7PH 2VDMH 1J87A 1A47A 5LBSL 1KJMB 2KQMA 3U9UA 3MLYL 1ZGLM 1HHJB 3ZKMD 3QIWB 2R9HD 2H26B 5TE4L 5BO1L 4HIHB 3HA0A 2DQHL 2APTA 2OJZL 2VZ1A 3VXPB 3MUY1 4D0CA 3NCFB 4GKZA 4RMQA 3VWKB 3CFBA 4YR6A 1BHGA 1QRNE 4ISVB 2A9NH 2HT2D 4ZO7A 3U0WH 4KVCL 1FFRA 3AMKA 3EDKA 4EIZC 4WEUD 4ZUUA 4NZDA 1MCSA 4JPIA 2E9JA 2NY4B 1T22B 4JGUA 1G0DA 4MZ3A 1F6AB 3ZTNH 3VFOB 4JO1H 3VXQA 4EEEA 1AHWA 1IGFL 1FGVL 1QLEH 5EB9A 3B3IB 3IKCA 1A3QA 5E9DD 1FFOB 4MNHA 2WUBH 2R8SH 3RTQD 2AJUL 1HCVA 2ZCKH 3QFJB 4ZFZA 3UBXB 1KULA 3ARUA 5HSFA 4TULL 3FT3A 4EI5C 3TO4A 1KELH 4NFBA 1MPAL 1UM5H 4P57A 5JA9A 3CX5K 3KPRA 2CO7B 4XVSL 3GMRB 3GMQA 1I1AA 5EUKB 4AH2B 4V1DA 4CUCA 4WHTB 1NFDE 3U30B 1IGCH 5C09D 1EEYA 3B9AA 4PG9A 2OLDA 1FYTD 3TO2B 1JWSA 1HHHB 1CFNB 2NY3C 3U36B 4JQIH 5DHYA 1JGVL 4WFED 4PGBA 5EU3A 1HYSD 4KROC 3TYGL 1N59B 3RVXC 2IBZX 3MLSH 3QYCA 4H1LG 5D93B 4YFEA 3AFLA 4PRNB 4J1UB 4PGCB 1AGBB 1S7UB 3JTSA 3OBAA 4QXTB 4LF3B 4RAHA 5I73C 5E03A 3SDXE 2AXHA 4PJAA 2Q1EA 2G2RB 5FA3B 2ORBL 2ID5A 3WSQH 1UQSB 1W0VA 4GS7B 1UGNA 3VA2C 1KB5H 4WI9A 1I4FB 3MBED 2JIXB 4AQ1B 5DJXB 4JO3L 1ZS8B 1BLNB 5ENWB 1AC6A 2EC8A 2I9TB 4EN3C 3F6IA 3BH9B 4Y2DC 5K33A 4PRID 4JFPB 1J0ZA 4LLMA 3BT2H 2P7TB 4O5LL 1KLUB 5F89A 2ZUTA 5KVFL 5JQHC 3C08L 1D5ZB 1T66C 4RZCA 3GSRB 2JB6B 1KLGA 1IT9L 5IJVA 1IBGL 4A6YA 1Q1JH 2AK1L 5K59F 1PAMA 3T65B 2W0KA 2OR7A 3FO0H 4Z0BH 4OUUB 5MEND 1MUJA 3S3SA 5ISZA 2R0WH 3PDOB 4P49A 4YO0B 5I16A 3Q3GA 1AP2A 4KRPB 4HUXB 3TBYA 2X1QA 1OCWL 1OF2B 5HYQB 4FQ2L 1AQKL 1MI5D 4OT1L 1OWWA 2D7OA 2VMFA 1I7ZA 4MX7A 1SY6L 2R56H 4JY4B 4RISH 5J3HC 3CFKA 4POYA 5KTEL 5DJZA 4KQ3H 5ESVA 1I3GL 1MCRA 4QYOB 3BP6A 3C09C 2E6PA