2DIBA

Solution structure of the 11th filamin domain from human filamin-b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
128
structure length
128
Chain Sequence
GSSGSSGHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 11th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 9
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dibA01
1SVZA 3REWA 5DSCB 4HLJA 2X7LB 1YYML 1QTYT 3V6ZB 1GZPA 3I02B 4PRBA 3CC5B 5GJSH 3SGDI 4G80A 4TVSa 4HH8A 3VGGA 1P7QA 4N0YL 3KYAA 5H35A 1JZ4A 2GITB 4N1CA 2OM5A 5KVFL 5K59E 3HCVB 1PDKA 2NX5E 1MHPL 1VGEH 3NH7H 1FYTD 3LEVH 1CGXA 3CVHH 4YC2B 1UZ8B 5IW6B 3HR5A 3BZEB 1J88A 5JO5A 1MI5A 5DHXB 3QEUB 3SGEH 3EJJX 1U6AH 1OP5K 4TUKH 1QQDB 2A2QT 3UYPA 4LSUL 5I1HH 2R2EB 4L3EB 5DD5L 1RZKC 5KTEH 5C0DA 4BELD 2PW2B 4M9PA 3MREB 1KELH 3KAAA 3TYGH 1D5MA 3H9SB 1XCTB 3O2VL 4NBYB 5ESQA 5FGCB 4ODHL 4F2MB 3MV8E 4D9RE 2IF7A 4X6DA 4LCWB 4LNRB 2W59A 4FQXB 4PBVC 3UJIL 3D69A 4F37F 1G7QA 1GIGL 4P4KD 4JM2B 1E4JA 3DYOA 5EO1B 3EYSL 5DQ9A 5HYJD 5HHQB 5AD0A 1T20B 2L4OA 4XCCL 3OKOA 1SMOA 2FDBP 4DGVL 4C83B 5GJTL 4HSQA 4ZUWA 2VLJA 2G5BA 1FNAA 5DEFB 3O9WA 4DUXA 1VKXA 5M95B 5DRXA 2HAZA 3GBML 3G6DH 2IBZY 4ZYKB 2CR6A 2DLFH 5I19H 5GZND 5I18L 3ZHLA 5CUSH 3RHWF 2NY5H 5T1MB 5I8OH 1FFOA 4PLOB 1XGYL 2F19H 1RUMH 4KMQA 5F1IA 1IAOA 5GRXG 3ARDC 1BGXL 5E6IA 5D5ME 1D5BB 4ZFGL 1RSFA 3VXSB 4KZEH 4LHQB 5HVFB 5IFAL 4KRPB 1U58A 4Y4FA 4Z7VE 1R3IL 1WZKA 5D6DC 3EO9L 4WI6A 2FJFB 1FJ1A 2X4SA 3H42L 5LXGH 2ARWA 5FA3B 5TDOA 1MCNA 4Q6IC 4PG2C 1T7VA 3BFOA 2VWEC 1FORH 1MWAH 2R1WA 1VADA 2P24B 3SCMC 2OJEB 3PGDA 3O3AA 4KK9D 4OZIF 1AXIB 4AIZA 4X8JA 1D6EA 1KIUA 1ZHBA 3T4AA 3MXWL 4N5EC 5EFIB 3Q1SH 3BJ91 4QT5A 4YLQT 2M26A 3WL9B 2XTJC 4FMFA 4R0LB 3VI4F 1T0PB 2WINB 5C0BE 1HEZB 3H9ZA 4JRWA 3VDCA 4WFFD 3R06B 4KQ4L 2X4NB 1RULL 4OLZL 4Y4KA 3HC3H 3HNSL 5BS0B 1DQQB 5IVXB 4MS8D 1DLFH 5IEHB 3QSKB 2XFXA 4NQEB 4ZPTB 4KMTL 3VWKB 4MAYD 4JDVA 5EOCH 2ZSVA 2QSTA 2IPTL 2C26A 3PHOA 3AAZA 2VDML 3QFJD 4KWUA 3HC0B 2YEZB 4P2OA 5KVEH 1LO5B 3N85H 4Z7OE 1ZV5A 2VERN 4HWNA 1AY1H 1A6ZB 4PJXE 1N5YH 3OJVC 1RFDH 2UVFA 1E6OH 2DLIA 4GG6F 2VITB 4OF3A 2AI0L 3JWDL 4G9FB 2R1XA 1I9EA 1VFMA 3FOLB 3GSOA 3KNBB 2R0ZL 4W4NA 5HHPA 1IC5L 3PWLB 4PJHE 4CW1A 4LKCA 1U3JA 2EDKA 4OZHE 5FYJD 3R0MA 4N8PA 1CD1B 1KJMB 1BF2A 4QHNB 4BK5A 5KSVA 3VGHA 2JJTC 3EFDL 1T1YA 2F74A 4GBXA 2HVKA 3K8MA 3W0WB 4DAGL 2W0PA 1EO7A 5AZ2L 2HKHH 3QIWA 4P4RB 1NCDH 1XF2B 4YUEL 2ZUVA 1JYXA 3P11H 3U4EB 4P57A 4L1DA 2XPGA 3AGVA 2D7OA 2EYTA 3C6SA 5T3ZD 1KTLB 4F15C 3OJDA 1H3UA 4X6BA 5IHBA 3R8BB 4GW4B 1DEEB 1ZMYA 1I8LC 3QUXC 4K94C 3GMQA 5E5MB 4EIZC 3L3KB 3UTSA 4GKZB 1EAPA 4LF3A 3DBXA 1QBLH 1A6WH 2EH8L 3BIKA 4OLEA 5AUMB 4HZAA 3ULUD 1RK0A 1WTLA 5IM7A 2XG4A 2LV4A 5SX4I 1LEKA 3A6CH 3RWIB 4MNQE 3C09C 3KPMA 2YMXL 1JTTA 5D2LB 1P4BH 3RDTB 3U9UA 3FQNA 5GGQH 4AK1A 1AQDA 5HTSA 5IB2B 4HD9A 4ORGA 3MJ9H 1DQJA 1PAMA 4ODVL 4M7ZB 5C0EA 4KK5D 3H0TA 2QL1A 4HGWB 1KLGB 1SEBA 3L1OH 1LO3L 5HHME 5B8CC 3P30L 2ADGB 4CU6A 1OM3H 2KBGA 1FO0H 4K9EL 3TBSB 1BJ8A 1F2XK 3B2UC 3HUJF 4FQ1L 4XCYB 4KAQH 3EYUH 5EORH 1AGFA 2NY1D 5E94B 4IRJB 4V1DD 3QB7C 2R69H 1D9KC 1C12B 1U8OB 1BEYL 4NKIL 4PBWD 3RI5F 3DMMC 1IC7H 4R9HA 4WUUD 3NN8B 3DVNA 1WUNT 3V5DA 3NCYP 5E6ZA 1HQRB 2A74B 3AY4C 2RFXA 4FG6C 4NM8H 5JMOC 4NOBA 1KB5H 4XC3L 3ULSB 4FXLA 4KROB 4GKNB 2JELH 1OY3B 4P23B 4O02L 3C2SA 4Y5XB 3KYOB 5J3HC 1EZVY 2V17H 3G6AA 2OZ4H 4M6ML 1I1YA 4BQBA 2CO7B 1WFNA 1FYHB 5C07B 3T4YA 2C3XA 2DD8H 1NH6A 2A1WL 1HHGB 2WWMC 1KJVA 5CFHA 5T3XD 5DMGC 5DEZA 1XGUA 3MQIA 1YPZF 4HS8L 3E0GA 4GAFB 4B41A 2YUVA 2F53B 3OF6A 4OM1L 3Q3GB 4TSBL 2IPUK 3PNWB 4PP1C 2R8SH 4M6NL 2IGFL 3VXRE 2NY4B 5EPMB 4U3HA 1UKSA 1QG3A 4JFFA 1NGXA 4LCCC 5KSBA 1CBVH 5E8OA 5FUOH 5C0FB 4HWBA 1F42A 1Q0YH 3KLAA 4NQCD 3ARBA 3MRFA 2P5EB 2H41A 1TZGH 3MJ7A 5EOQH 4X9BA 3SJVD 2VXTL 4BSWB 5KN5B 1TTFA 3QUZB 1PYWB 5E1HB 2OBGA 2CIIB 5D2NA 5D1XD 3V5HB 1JGDA 1F8TL 3BKML 1G7MB 1XEDA 4Q2ZA 4ONGL 2H9GA 2EO1A 1KIRB 1Q9KB 1FDLL 4HUVB 4PLJC 5E4EB 5FHBL 4PR5A 4R2GD 1BVKB 5E1AB 3EJZD 4HUWA 4ZTPL 4UILH 5DS8B 4U1IB 5IT2H 1IKFL 1KN2H 2XA8H 1HXMA 1AR2A 3DHMA 3O0RH 4JGUA 3ZKSD 3DHJA 2I9TB 2NW2B 1IKNA 2ATKA 3GMPA 1UQSA 4LKXB 2HG5A 2FH6A 3EDEA 1S7SB 3TIDA 4FQQB 5SWSA 1BVZA 1WQVT 5C0ND 4PGEA 4UDUB 1DUYB 4BFEA 4L4VD 1KIPA 4I4WA 4IRZH 3HKFA 4JQXA 2GK0A 3AB0C 1A7OL 3UTPD 4HIJA 4LSVH 5K59F 2YD7A 4EUPH 2FSEA 2A6IA 4OLXL 3C5SA 1NMCC 1PG7L 1ZGLA 4FFVC 5DI8A 1GGBL 3BAEL 4FP8H 4XVJH 3ARZA 5F7KC 1WVZA 3T09A 1LDPL 5A16B 1XF4A 2R4SH 3UDWC 4WEBL 1H8OA 1HWHB 1GPOL 3MV11 5SWQA 4WTZA 5HJ3B 1RUKH 1T89A 4O2EB 5C70A 4QXUH 1ZE3C 3L3OB 3TWCH 1K2DB 4HT1H 4NQVA 3SGKC 4MWFA 5J57B 3HI5H 2C1PA 1S7QA 4L3EE 4G6MH 3WE6B 3DUUB 1CTNA 3OG6B 2D03L 2NR6D 4FFYL 1HIML 1WFOA 1ND0A 1WBXA 5FGCE 1VFUA 4YHMH 3CVIL 3MO1B 2AKRA 1MQKL 1UACL 3GDBA 2GUOA 2ZUWA 4PGZA 3QG6A 1AP2A 2E3VA 2MPAH 2BNUA 3C2AL 3MMEA 3ZLQC 1MLCB 1TFHA 2YD8A 3LS5L 5B22A 5BO1L 3BZ4B 4GMTL 4XC1H 1RPQA 3MROB 4OF6A 4U1KA 4P59L 1PZ5B 4D8PA 4KPHL 4WTZG 1MCKA 3ZDYE 1IGIL 4L4TE 3QXUA 4PLNC 3UC0H 2HMIC 3QXTA 1I7UA 2R2BB 3NPSB 5DVKA 5GHWH 3LIZH 3RKDC 3FCTB 2HJKB 4YXLH 5LWYL 1KYOK 1EEYA 1S5HB 1UWEH 3P4OB 3MCLH 4M5ZH 4GJTB 4EQ3A 1KXTB 3UTQA 3VXUB 4QRQB 1QKZL 3MRIA 3CMOL 1JHKL 3CVHA 3FQRA 4MD4B 5H2BA 2VTFA 1N2RA 1NGPH 3MUZ1 5ISZB 5GS1C 5IG7B 3EHBC 5D5MF 5L0QB 2D9QB 3DX8A 5ICZB 4N0UE 3QDJD 1P4IH 1LK2B 2Q86B 1EGJH 2XWJA 4OCLC 3OBAA 4OCYL 2ERJB 3FRPA 3IS0X 3ARFC 4YEFA 3L3DB 5C0AE 4XNYL 4PJ8A 1P9MA 1ZHNB 2FIKA 4LQFH 2LTQB 3M17A 1CS6A 1UVQA 5CMAA 4CADB 3MTRA 5FO9A 3RVUC 5CSZB 2WLYA 1MLBA 2HLFD 3GHBH 1T4KA 4NN6B 4QCIB 3U83A 2BFVH 4ZPVB 1A2YB 1X5IA 1OAUL 1KCUL 3R0NA 1SYVB 3BEWA 1CE1L 2MCPL 1D6VL 4S1QL 2R4RH 4NQSB 1RZ7H 4U0RC 4XBEL 4D9LL 2HT2C 2YD6A 5C0JA 4OJFL 1QRND 3CZJA 5BS0E 5FYLE 2D31B 1CL7H 2DL9A 4RMUA 5KJRH 3FRPG 2HWZL 3Q6GL 4RNRB 3ZE0E 5L8KB 3GI8H 4G6FD 5KAQF 3D87B 1JNLL 3LEXB 1LNUA 3WUWA 3GB7B 4XXDA 4KUZL 4DZ8A 1AXTL 3S4SA 1PKOA 2D9CA 2Q76A 2AJZA 3FO1A 3CFBB 1CE6B 4RFEA 5EU6A 2X6MA 1GGIL 2BDNH 3SDAB 4G9FE 4HUNB 1H0DA 1XIWB 1K8IB 1MWAA 1AGDA 2EDRA 5E5UB 1OAKH 1FZJB 4NCC1 4PJHF 4PJBE 2P43B 1WBZA 4IDJH 5TGBA 1ORSB 4C4KT 4XNZC 4ORZC 4U7MA 4R90H 1JF1A 2DKSA 1T2QL 1BD2B 4KI5C 3GO1H 4LIQE 1MOEA 4QWWD 3WUWG 3TZVA 2FB4H 4JB9H 5IEKB 2VQUA 3NTCH 4OCSL 4WW1A 5DA0B 3W0WE 3S4SG 4NQDE 3ARGA 3MRMA 1NC4B 3IFNL 3C60A 1KEGL 3KPLA 5J89A 4Q0XH 4F57L 3PWNB 3ISWA 4R7NA 4J3XA 3AMKA 5CIPA 4P9HC 4LLMB 4U6YA 1JTPA 4GKSB 4JRYD 2JF1A 4RIRA 4P2RB 5HHOD 2HTKC 2YHGA 4X4YA 1RMFL 5IIEB 3I84A 4Z77A 4TVPD 3FZUD 3UROR 3T0VA 4X4XB 2F58H 1ZT7A 2EEDA 4YGVA 1N59B 4UT7H 5HYEA 1MY5A 1O0VA 4MA7L 4XNUL 1TETL 4LHUB 3R8QA 3GKZA 2M1KA 5J13B 3DECA 3FT4B 5D2LE 4N1EA 5JXEC 4JRXE 1RZJL 5LCVH 3B6SA 3ZMRA 2XZAL 4OI9A 4RMWA 2R15A 1U95A 5L8LB 1BF8A 1XR8A 5CJQH 3FT2A 4HIXL 5E8DL 4HH9B 3DX9A 2HKFH 4XNQA 3ZTJH 3ME0A 3QT2A 5IB4A 3EYQC 5BXFA 2P5WE 3S35H 3CD4A 3CZFA 5CEZD 1DVFB 2XV6B 4NZJA 4R4FH 3FB6A 4HW6A 4PS4L 3TFKC 3D9AH 6FABH 5DMKA 1DBBL 4JLRA 4TOYL 4M1GH 1QLRA 4RISL 3TP4A 3WV0A 4K94L 2WBJA 5C0CD 3NA4A 1SJEA 2DYPD 1RZFL 5J11C 4P3CH 1YNKL 1PSKL 2YA1A 4GW1A 4XHQA 4FQLH 4FQXD 5C07E 2ZJSL 4PJFE 3O4LD 1JL8A 2GTWB 5SWZB 1CICD 3EDFA 3RNQB 4YHKH 5DJYB 1EHXA 3WXVL 1J05A 2D7PA 3C5ZA 1ZA6B 2W65A 5C09A 4P5TA 3MRKB 5TH2A 1DFBH 1YMMA 1GHFL 2UZIH 4X6CB 2G75B 4KTEL 3RWFB 1A7NL 1CGSL 1INDH 5AAMA 1Q1JH 2XG5A 4HMDA 2BNRA 3QIUB 3TT3H 3ZT7A 4RA0C 4JZNB 5BW7C 2YK1L 1UJ3C 1ZHKA 1S9XB 4W6WB 3DRTA 2P5EE 1NEZB 3VXSD 2N4IA 4L8DB 2HH0H 3BDBA 4J1UB 3ES6B 1BLNB 2VSCA 1G9EA 1G84A 3O41B 3BD3A 1KB5A 2BJML 3F62A 1N6UA 3GIZL 3INUH 2P8PB 3UX9B 5HY9A 1YJDH 1QLFB 1S5IH 3L3JA 5BV7L 1Z3GH 2OZ4A 3X11B 1KT2B 4CJ0A 3CFDB 3TLRA 3LQAH 4I8DA 3AREA 3KHOA 1B0RA 4PJ7E 5F9JB 1EJ6A 2O5YL 3HZVA 1MJ8L 2VABB 4JR9L 1OGAB 4L8SB 4PV9A 3RNKA 5J1TC 4Q9QH 4QOKE 3E8UL 5F89B 4ZUSA 3BP6A 4LFHD 5BOZG 1NC2D 5DFVC 2PUQT 4X6EA 3U9PL 3QUYD 1AGEA 4E41B 3GSUB 3MRQA 5CD3B 3MLSH 1K4DA 1K8DB 3TEUA 3WDHA 5DD1H 2E7BA 5F97E 4I0PC 4PJCB 4PP2A 1WSST 4N9GA 1PQZB 2LU3A 4U6VH 3I75B 2QQKH 4L9DA 4JFYB 4JKMA 1N6QH 4MB4A 3AS2A 5FYJL 2H2PC 5JXAL 1KF9B 3MPCA 2E8YA 3QRGH 1Y6KR 4U1SB 5GRYA 2W0FB 2B4CC 3LEYH 3HC4L 5TFSL 2ICCA 3O6FB 3GKWH 3MUGB 2RCSL 4JANA 4QGYA 5DHVH 1AKJA 4AM0A 4QXTB 4WI8A 3QI9B 1E28A 3RWHB 3GK8L 5HBBA 2YSSB 2O5XL 4ZQKB 1SQ2N 3LD8B 5T3ZL 1A14L 2IAND 4HDIB 3RVXD 3KYKL 5BMFH 4Z8FH 3KJ4B 1ORQA 4JDTH 4CBPA 4FXGA 3THML 3GSNH 1RQ5A 1NMBL 1G7PA 2P1YA 4QHLA 4ZFOL 5HYQA 2OTWA 4WHDA 4KXZH 1MUJA 5CGTA 2ZUQB 5JOFB 1G1YA 5JTWA 3FQWB 5ITBH 3ULUL 5GGTH 4A6YB 1NSNH 1ES0B 3FTGB 1JWUA 3GMMA 3QEGH 3X12B 1JZ6A 4YFDB 4LVEA 5TE4H 3RUGB 3WNLA 1X6NA 1IEBA 5EZOL 1HKFA 1UXSA 2HVJB 1M7IB 1MJUL 2YRLA 4XP6H 1T03H 2MKLC 4JDZB 2B0SH 4HWEL 5DMIH 4AT6B 4RGND 3MLUL 4O2FA 1U0QA 1DL7L 1NL0L 2D7NA 3D3VA 1RIHL 3O6KL 2OXGA 2PO6B 3ALXA 3FFCE 4XBPA 1UEMA 1CR9L 3V8CA 1IAKB 1P53A 1TZIA 3WHXB 4GXUN 3GSWA 4KRPC 4Y19A 2DM2A 4L3AA 1Z5LB 4NRXA 3B9VA 4OZGB 1IQWH 3UO1H 3O3EA 2XNAA 2EZ0D 3CFCH 3KYMA 2FATH 3DV4A 5I1IL 5CCKL 1B90A 1FPTL 3FJTA 3DTXB 4N1HB 3RTQC 1KGCE 1RU9L 1YC8A 3MFFB 3HE7A 4I18B 4KKBC 3G5XB 4HXBL 1JHLL 5T3XL 5JLZA 1JI1A 4K71B 4PJGA 3SE3C 1A0QL 5C3TA 3PGCA 2BSTA 4F9PC 4KY1H 5GPRA 1A6TB 1T1XA 3PDOA 1LQSR 2J8UA 3D39B 4PJIB 2UWEA 4C59B 4DUWA 4R0LC 1JRHH 3BPLB 1U8JB 3O8XB 3HE6B 5CINH 4JPIA 5DD0H 2PYED 1KB9K 1FNSH 5C9KA 5FB8A 3DX7B 3BYTA 1UA6H 4HCRL 1U8MB 1V8HA 3R1GH 3QXVA 4P23D 1OWRM 1JUFA 1AC0A 1OCWL 2AEQL 5FECA 3BKYL 2BX5A 2ZCKL 3QIBA 3O81A 3GMNA 3S36H 5IWLA 3RBSA 3REVB 4ONHA 3B8YA 5CJBA 2FZ3B 2NY3B 4KMLB 2YOCA 2DQDL 5IROA 1BOGB 2FGWH 3V6FB 1AFVL 1IGCL 2QQNL 5DQDH 3KPPB 5C7XL 2YZ1A 3ZE0F 4ZOBA 2DWEB 2NXZB 2CQVA 3WJLA 1J0HA 3NFPA 1CXLA 4ZXBD 3WSQL 2ZCHH 3QDHA 1I75A 5CJ8A 3B5GA 1FYTA 2ZCLH 3V7AE 1PY9A 4KZDL 4IMKA 1AXSA 5F7DB 3WKMH 4I3SL 3P40A 3WMSA 4LBEA 3LQZB 2R1YA 5JUEL 2CRMA 1F3DJ 1RIUL 1T0MB 2CIKA 3KPNB 4XPGL 3VFWA 1N5AA 3ROOA 2DMCA 1YEJL 1J5OH 2UYLB 3QUZD 3KR3H 5BZDA 4R8WL 1DQDH 4M4PA 3GIVA 2VH5L 1KYOJ 1CT8A 3Q5OA 1PGRB 2VE6B 5DK2B 1DE4B 1CDGA 1H3PH 2FJGA 4NNYA 1AHWC 5GIRA 1BD2E 3BPCA 1IMHC 1BX2B 5GSVA 2ZOKA 4KJYA 4P4KA 1J1OH 3VXOB 5L2KD 5HYJA 4ZUTB 2HP4A 5HDBF 1WF5A 4OD3L 3S5LA 4LVHC 4WW2F 5C8JB 1Z9SA 3O3DB 1F11A 35C8H 5E00A 3A6OA 3CGTA 3TBVB 3QEQE 1TDQA 2FJHA 5FYKD 2OTUA 4W68A 1F58L 4P2RE 5DJDB 1CFNA 4ONFH 5DURD 3X14A 2HT4C 2FBJL 3OKKB 4YDVB 4OV5A 1HHIA 3S37L 2D7TH 5E6YA 1OW0A 1ED3B 5ESAA 3VJ6B 4M7ZC 2VDKL 3BO8A 3QPQC 4LMQE 2NY0C 1MRDL 3BUTA 3EGSB 3TN0C 2ZUSA 3B9KD 1UM5L 2WUBH 5FV1L 1UJTA 2CLRB 4YXHL 1I7RA 4PJAA 1FVDA 4IRJC 5ALBL 3D2UD 5L88H 3S5LG 1QBMH 3NIGE 3LAFA 5DJ2B 5GGUB 4GMSL 3O6LL 2YN3A 3S35X 3C5JA 1E4XI 1DCLA 4KK6D 3AU1B 4KKNA 3IFPA 1QFWH 4KROC 1E6JH 1A6UH 2HN7B 2P42B 5E8PA 3MRJA 4WY7H 2YPVL 3L5WB 4PJ5D 5DVNA 4Y5XC 1R5WB 5EU4A 3ZTNL 3AS1A 3P4NB 3ARSA 1S3KH 5K9KA 1LEIB 1TNNA 1CG9A 3NMEA 3PHSA 1Z9OA 3V7MA 4BH8B 2PCPA 5C2BH 1ZXQA 4PJFF 4HKJB 5DD6B 2UY7A 12E8H 3U46A 3WS3B 5J6HA 4BFBD 4MAYA 2NY4C 3UTTD 4MDIA 4NUGH 5K9JL 1BBJA 5D8JL 2VDMH 1JN6B 1QLEL 2R0WH 1H8SA 3QFJA 4ODTL 3UCRA 2AEWA 1M6OB 1E27B 4NO0B 1UM6L 4IHOA 4Z95L 1S9KC 4NFCA 5KSUA 3REWB 3QQ4A 1REIA 2WV3A 3FMGL 4I13B 2EIZB 1I3VA 1CXIA 2V5YA 1GZPB 1G9NH 4LLVB 1J8KA 4HPOL 4PRBB 4G80B 1NBVL 2J88L 2H26A 4Q6YA 1NEUA 1P7QB 1AC6A 1EK3A 5H35B 1HWGB 1PLGH 4F7TA 4HEME 3E6FA 1FVEA 5EO0A 2AJYL 3WCYA 4A2MA 1NCBH 3EO0A 5E4EC 4FQCH 1JHTA 1ULVA 4TSAH 1UCBL 5JO5B 3A6BH 4WI9A 4RAUA 1MI5B 3H9HA 1JGUH 1BQSA 1NUDA 1NUNB 2WQRA 3HB3C 5GQBA 5GGSA 3OTTA 4FFZL 5ID0A 4BSJA 3AMLA 1HINL 2BC4A 4C54A 3KPSE 1QR1A 1V3KA 3ULVF 4G6KL 2W60B 3RY6A 4PJ7F 3I50H 5C0DB 3IJYA 4PUBL 3ECBA 1W0VA 2IBBA 4UINH 1D5MB 5ESQB 2EXWC 5HGBB 3VXTA 4I5BA 4X6DB 5KSAD 5DUBA 4G42A 3O3BA 1BQLL 1QACA 4WFHE 1AE6H 1G7QB 5D96C 4ZFOA 4E41E 3MJ8A 5DQ9B 5GGVY 5AD0B 1NAML 5C6WH 3OKOB 4S1DD 4XXCA 1QYGH 3QDMD 4MXWL 4IRSD 2JJWA 4ZUWB 4UU9A 2VLJB 2G5BB 4PJCE 3O9WB 1VKXB 5DRXB 4KDTA 3HG1D 1QSED 1AJ7H 3U7WH 1KNOA 3UJTL 1CQYA 1QRKA 2ZWLT 5D7SH 3V5KA 5I74B 4KTYA 4F8TA 1LO3H 1CN4A 1FFOB 4PJDA 1IBGH 3VFUA 2DQHL 4NYLA 4O4YH 5SX4H 4ETYA 5F1IB 1IAOB 4PRID 4XVTH 3TPUA 2XQBH 5EOTA 2WIMA 5E6IB 2P7TB 1EFQA 4V1DA 1FE8L 4JFHD 3RAJH 5D7JC 1G9MC 3CU7A 2XZQL 2EC9U 1U58B 4WUUA 4ZDHA 3J8F7 5B4MD 3VH8B 1TQBC 3MRDA 4ZUVB 3MXVH 1FJ1B 2DI8A 2X4SB 4HBCH 5B3JE 2XQYG 1W72L 4TVPL 5TDOB 3Q48A 3ABZA 4TNVK 2Q7YA 5GRZA 1JPST 4M7JH 4Y4HC 4M6MH 2AJXL 1QA9B 3PGDB 3O3AB 5J8OA 4CUCA 4AIZB 2YD4A 3MRHB 1D6EB 3RUGE 3T4AB 3Q5YA 3ZZ1A 4H88L 2H32A 4RGOH 1X3DA 5IVOA 3NPSC 4Z0BH 5EOCJ 4DCQA 3MRNA 1WITA 5GSRA 4YZFE 2G2RA 1DBML 2Z31C 2OR9H 4P0DA 4EKXA 4HCRA 4G43B 5I9QB 2KH2B 1HE7A 5L0QC 4JDVB 2ZSVB 3TPKA 1FRGL 3P9MA 4L4JA 3MLVL 1PD6A 3PHOB 4PLJD 5FHAH 3AAZB 4UTAH 5E2JA 1VFAA 4NQCA 5F9WB 2Y06H 3GMLA 1C7TA 5JW5A 4P2OB 4LLQA 4OTXH 4OZGE 3D25A 3SJVA 3P9LA 5ADOL 1DBJH 5D1XA 1JPGA 5DK3A 3SQOH 4XVSL 5KS9E 1M7XA 3DSNA 1FDLH 1I9IL 2XA3A 4NPYA 2LTQC 2R1XB 3FFDA 3IJSB 5KZCD 2B1HH 2JJVA 3GSOB 3TA3C 5HPOA 4O5LH 4IOFC 4NN6C 1HCFX 2NNAA 5F9OH 2EYRB 5HHPB 3ZKXB 4CW1B 2V2TA 3D39E 4PJIE 4LKCB 4MX7B 4YHPA 4YJZL 1H15B 1P69B 1OTTD 4HUKB 4YAQA 4RWYH 5GRVL 5C0IA 2NX5D 2Z0BA 3S36X 3NA9L 3U0TA 1T6VN 3B9EA 4HZLA 1T1YB 2F74B 3MUY1 4Z7WF 2HVKB 1F6AA 1EMTH 3STBA 1FVCA 3S96B 3IAGC 1SYSA 3QIWB 3ZT6A 3T8XA 4KDWA 4P57B 2XPGB 4MD0A 1YEKH 2EYTB 5J6GA 3GSQA 3C6SB 3FOMB 2R9HD 4JHWL 1J8HA 4X6BB 2UV3A 3NFSH 1GAFL 1HOCB 3UAJC 3BKCL 3GMQB 1I4FA 3VFPA 5F1OB 3W9DA 5KOMC 3UTSB 5D93C 3MV8D 2EDNA 3FAWA 4D9RD 4GRMB 1DQLL 2WUCH 4LF3B 4Z78A 3DBXB 3SDAC 5IQ7L 3BIKB 4JFZL 3VFNA 1CLOH 2DDQH 4DW2H 1T5XA 1RK0B 1QFPA 5IM7B 4J3WA 1SY6H 5F7UA 5CEXA 4JO1L 1LEKB 3KPMB 3BP5A 3U9UB 3FQNB 4XMPH 1FGNL 4MJ5A 4NZUH 5EC1A 4ORGB 1DQJB 4KTDH 2IAMB 5C0EB 2X10A 3F7VA 2EDYA 3H0TB 2QSCL 2VXVH 3F12A 3LB6D 1D3CA 2VN4A 4HJGA 1AGFB 1NFDE 1YY9D 2HMID 1ZSDA 2R29H 1H5BA 3DVNB 3V5DB 3SGJC 1MEXH 2RFXB 1AH1A 5BO1H 2EDEA 4EOWH 1T04A 3AVEA 3U2SA 1DLHB 1SJHA 2WAHA 4D2NA 4KK8C 1T5WB 1T2JA 3FN0L 1MCOH 3HNVL 4V2CB 1I1YB 3T4YB 4J23A 5LAXA 1WAAF 1AR1C 1KJVB 4JHAH 5JHLL 3RWCA 2NYYC 1XGUB 2BVOA 2HTLC 3ARYA 4RX4D 4MXVE 5J13C 5GS2H 1T66C 1KB9J 4XI5C 4APQC 5A43C 4EDXA 3BDYH 4N0RA 2BY1A 3H3PH 5CP3H 5CILH 4EEEA 4JFFB 2PTUA 3IRZA 1SM3L 3LV3A 1NGXB 3QDJA 4J2XA 5KSBB 1RZKH 5C0BD 1I1RA 3RVUD 1OGTA 3DRQA 5E8OB 1UH3A 1IAIL 3ALWA 4S0TD 5TE7L 5F3HA 2A9NH 3QI9D 3ARBB 1MSPA 2J8OA 3X3GH 4OCXH 3MJ7B 3SY0A 2A0LC 2F8OA 2QADB 3LRGA 5EZJA 1CI5A 1A02N 1ONQA 4ZS7L 2G5RA 5D2NB 1TJIL 2FWOA 3CXHJ 1PKQE 2A83A 3G5VA 4OZFA 3WFEL 1S78D 3C87A 2H9GB 3GSXA 4BQ8A 4QHMA 2I07A 1OAZH 1YDPA 4PR5B 3IT8D 1CE1H 5LGKA 1P5VA 5ICYB 3MV01 4X0KA 1N26A 4HUWB 1QRNA 1S7UA 4TQEL 4K3EH 5K9QI 2BVEA 4MMZC 1UENA 5IHUL 2PW1A 1JNLH 5FYKH 1S7XB 3MGOB 1I1AB 2ATKB 2E6PA 1UQSB 2DLHA 2HG5B 4OZFG 3B43A 1GGTA 3QIUC 3LN4A 3TIDB 3PQYE 5SWSB 4PGEB 1A3QA 1KIPB 4I4WB 4PG9A 1JZ3A 1IZKA 2PYFB 4M7LL 2GK0B 1W2KT 4Y5VC 4M5YH 1JMZA 1NAMA 1Q72H 1MNUH 2FSEB 4LPUA 3NGBB 5EUOA 5E5RB 1S7WA 3C5SB 4QRTA 1KPVA 5FO7A 4OLVH 4B7IA 4GW5A 5SWQB 1MI5E 3RJQB 1DEDA 4OGXH 4UNUA 2APVA 3OXSA 2HTKD 4M48L 2VDRH 4JREB 4HMCA 3OXRA 4UNTA 4NQVB 4MWFB 4WWID 4MNQD 5CKAA 4H5SA 1T1ZA 1G0YR 1ND0B 1WBXB 3DUHA 1DBKH 1G7HA 4JRYA 5HHMD 3NAAH 2AKRB 2YPLD 1B2WL 5HHOA 5E7FA 3MLRH 4EI6A 3QG6B 1AP2B 3I85A 2BNUB 3QXDA 4JO2H 1W72A 3QO1A 3MMEB 3RX8A 5DSCA 2XWBA 4U1KB 4UV7H 2BOBA 4D8PB 2P47B 1V7MH 1RY7B 4UB0H 4BZ1L 2VLJE 2Y7QA 1I7UB 1N3NA 2AJSH 2CUHA 3O6FC 2W9DL 2NXZD 2KQNA 5HGHA 3TO4B 5F6HJ 2DLEA 2DQEH 4FNLL 3L5XL 4YGAB 1EEYB 4RRPA 1IGJA 2VRAA 3HCVA 2OJZH 4XPHL 3UTQB 1CYGA 3MRIB 3OJ2C 3TFKD 2UZXB 3CVHB 3FQRB 5H2BB 1FC1A 1N2RB 4FZEL 5IJKA 1WICA 2UVEA 2N56A 5IUSA 1QR4A 3N9GH 3BPOB 4BKLA 5DVLA 1X9QA 3NCJL 3DX8B 3RGVB 3MA7A 1HYSD 4WJ5A 1KEML 2H2SC 1XFPA 3RQ3A 1NCAH 4C4KO 1GC1L 2OI9B 3IFLL 4YXKL 3SDXA 1F45A 1J9CT 4NUJB 3PP4L 4K94H 1XCTA 1XF3A 1LHZA 5C0CA 4X7FC 2DYPA 4PJ8B 3X3FH 3G08B 2FIKB 4RRPG 3CX5K 3M17B 4FQXA 4F7MA 4WUKL 4Z7UB 2O61A 4WENB 5CMAB 1I9RH 3O4LA 4QRUA 5FO9B 1QFHA 1MLBB 4LP4A 4DJMA 5IHLB 4JPWL 1CICA 4DN4L 1NPUA 1T20A 5T33H 4KH2A 1OSPL 3WXVH 1R24A 3UXFA 1NCUA 5DLML 1RJYA 2PO6C 3BEWB 3P0GB 3V4VH 4LCIL 3VMNA 4ZYKA 5C0JB 2X4OA 1Z2KA 2AQ1A 2IFGA 2DOCA 1YYLH 4YDLC 4MQTB 1I3UA 4KVCL 3HRPA 1KSRA 2F9BT 5MP6L 1LNUB 3CNKA 2YK1H 4NC1E 1NGQH 3WUWB 1GOFA 4XXDB 4DZ8B 3VXSA 3S4SB 5I1LA 4Z5RA 2Q76B 2AJZB 3FO1B 5GRJL 3BKJL 1FN4A 5JNYA 5E2UL 4YHOL 4DVBA 4RFEB 1OD7A 5J4MA 4M7KH 3F58L 3GIZH 4UQ3B 4PJEA 1BWWA 4POZD 1H0DB 4WEUD 3WFCL 4NDMA 4HIIB 3HE6C 4QHUA 1MWAB 1AGDB 2DBLH 5E2TL 1WBZB 4PB0H 4YFEA 4JQVC 1MJ8H 2NY6B 1CDJA 3I6KB 1WK0A 2DM7A 5EFIA 3HS0A 4Y1AE 1JF1B 3QR2A 3KXFE 3S88H 5E08L 2VZ3A 3O6MH 3TZVB 1JZ5A 2WINA 5MEQB 2NY3C 1NC2A 4O51A 3K2UL 1S7VA 3B9DA 2D0GA 1Z9MA 1WLHA 3ARGB 3QUYA 5JW3L 3SE4A 3MRMB 4WTXA 3C60B 5DD3H 2X09A 4KVNL 4MGXA 4R4NC 4X7DC 2L0DA 3CPLA 3P0YH 2AV1A 1TJHL 1FIEA 5CIPB 1JBJA 4U6YB 4YR6B 3IGAA 4RIRB 3JV4A 3NZ8A 3V6OA 2J2ZA 4FRWA 1HSBB 4ESKA 4X4YB 4HIEA 2CMRH 4Z77B 3MV9B 4ODBD 3Q2CA 4G7YL 4L29A 4EBQH 5KW9H 1ZT7B 4NBXB 1K4CA 3RPIA 2RCSH 1OQXA 32C2B 4K8RC 4LFHG 4MA3A 1MCEA 1WFTA 1XR9A 1I8MA 4UIMA 2EDBA 4JAMA 2VZSA 2IANA 4YHYB 4YHIA 1RK1A 3KNBA 3TJHC 4RBPH 3B6SB 1MJ7H 4YE4H 1F4YL 1U95B 1XR8B 4LSQL 3ZYIA 3FT2B 3AM8C 4PRPB 4QHNA 1NFDF 4XNQB 1ZLSL 4X5LA 5IB4B 3GBNL 5BXFB 2X9WA 1I8IB 4Y5YC 25C8H 4P4RA 3CZFB 2FL5A 1RURH 3NCCB 4FABL 5DMKB 1C5CL 2XOTA 4JLRB 3CX2A 5CWSA 3BYYA 2DTMH 2WBJB 1SJEB 3BE1L 3N50A 5FV2A 4Y16C 1MFAL 4GW1B 3CFIC 2YD5A 2AGJL 3L3KA 5JORA 5D7LE 5C0AD 1ZT4B 4HV8A 1CFVH 4IDLA 2FIRT 2OMBA 4MXVF 1J05B 5EBMB 4JY5L 4EI5D 4MCYA 5CD5C 1RUQL 3F6IA 2W65B 3IKKA 2HLAB 4P5TB 2I9LA 3RDTA 1YMMB 2V7HA 2RHEA 4YX2L 2ICEA 3K7UA 4JFFE 1GOGA 2BRQA 3ZHKA 4U1GB 4LAQH 2XKNA 5DUPH 1U92A 5DR5L 2QTEA 2BNRB 2YXMA 3CDGB 4YDIH 1TQCB 5AZEH 4ISVA 1ZHKB 5HDLA 2HYMA 5FUZL 1AD0A 1FH5L 3BH9A 4W70A 1OAXH 4YHLL 1W8OA 2E5EA 3QUMH 2HFGL 3LKQB 2PYEA 4UBDC 4XX1G 1A7QH 1KB5B 4P5MA 2BVUA 2DI9A 3AC0A 5HY9B 4P23A 2AEQH 4LEOA 3L95A 3AUVA 5DT1L 2VLKB 1D5XA 5ENWA 1A6PA 1IFHH 3VWJC 1HHGA 1B0RB 2XRAL 5TE6L 4I1NB 3HZVB 3RNKB 1K6QH 5ACLA 4PV9B 2DQUH 2QQNH 5BRZD 3V8OA 1IGTA 3BP6B 1FLRL 3G04B 5EA0H 4ZTOH 3UJJL 4OSUH 4LPWA 2CUMA 1XAUA 1AGEB 2G9HB 4ZXBA 4BFIA 2AXGA 1CF8L 3MRQB 2SEBA 3C6LB 2ADFL 4P9ML 4WCYH 1K4DB 1DUZA 4X5WA 5AG8A 4UT9H 4ELMF 5I75B 2FCBA 5I8EB 5SWSE 4NQDD 4PP2B 4DGYL 4OFDA 4N9GB 4NHUB 1EBPA 1CGVA 4XPGH 4YBQC 2AK4D 4X7SH 5HHVL 3BSZL 3OZ9L 5JHDD 3DVFA 4LEXH 4NO5A 5KN5A 3QQNA 2G60L 5J12B 3QUZA 5EBLA 5DF0A 4R8WH 2DWDB 3VRLF 3LQMA 3MLXH 4BUGA 4DKEH 2C4FU 3EZJB 1PW3A 4JANB 3V5HA 3VFTB 1AKJB 2F5AL 4AM0B 5D1QD 3E1F1 3UYRH 1G7MA 4ENED 2GYSA 1KIRA 3QHZL 1J1PH 5D7IE 3ZSSA 4RDQF 3UZQA 1CCZA 2KDGA 1ORQB 4ODUA 1M71B 5IVZB 1L7TL 4FXGB 5L2KA 1F5WA 5T1DH 1G7PB 4QHLB 4MNGB 4JKWA 5HYQB 3SOBH 1HDMA 2OTWB 3LY6A 3HI6H 1YEIH 4JRXD 2XXMB 4TNVF 1EPFA 4D3CH 3CFJA 3F5WA 4CDHA 1MUJB 2NY0D 4U1IA 1D5IL 5A2JH 4MNHA 3GMMB 1JWUB 3STZA 1CZ8H 5F3BA 1DBAL 1IE5A 1KCSH 3HNTL 2IQ9H 1J87A 1IEBB 4U6HA 3U7YH 4LK4A 4OD1H 5EIQA 1F90H 2BVQA 3RP1A 5D6DA 1BM3L 1SEQL 5FCUH 5DHYA 5CBEB 4Q6IA 4OZIA 2FX9L 2Z93A 2HJFA 1DUYA 4TRPH 3WD5H 2A6JA 4O2FB 5I74C 1O5DT 1YEHL 1N7MH 2CDGA 4ELKB 1L7IH 3D3VB 3B9KA 4M1CC 2MQ3A 1HSAA 4XMLL 1QSFB 3LKPA 4NNPL 4XBPB 5E6IC 4CU8A 3GI9H 4HIHA 3D2UA 3HTLX 1TZIB 1MCJA 3QG7L 3ESUF 2C4FT 1IT9H 4P49A 3T2QA 3STLB 2R56H 3GSWB 4Y19B 1R3LA 4NRXB 4Y4FC 3O3EB 5J9PA 3D18B 4JVPA 1H3WM 4PGDA 3WIIH 3KYMB 3O2WH 3O45A 4NC0B 3DV4B 1IVLA 3OSKA 4XAKE 2H6PA 2IAMD 2NXYB 4PJ5A 4XPTH 3WN5B 4LQ1A 4O9HH 4AEHL 1QP1A 2CK0L 2IPKB 3HE7B 4P9HH 3WE6A 3HR6A 3T0AA 3GHEL 1YECH 1E4XH 1MHHA 2J1KA 1CU4H 4PJGB 1G6RA 1WZMA 2DTSA 3PGCB 3WFBL 2BSTB 3EOAA 4GG6A 1T1XB 4AEIL 3PDOB 3MO1A 3T0WA 2UWEB 1ZGLP 5DQJA 4IOSD 4JPIB 1FFRA 3S34L 1MCWW 4LASH 4OFKA 5D9SA 3BZ4A 3H2WA 2ESVE 3UTTA 4LVNB 4AQOA 3QNZA 1WV7T 4Y4KC 2O26U 1CFSA 4P3DA 1JUFB 5FECB 4FQHA 3QIBB 5I1CL 3GMNB 3V2AR 1AI1L 2GKIA 4ONHB 2R2BA 4ZSOA 4KHXL 1YEEH 3K4ZA 4DGIL 3TCLA 2CO6B 1X5KA 4YIQB 5F9WC 2D7MA 4NC1C 5ACMA 3QDGE 4P2OC 4OF0A 2J88H 3LH2L 1MH5B 3ULVD 4KJWD 5JMRA 2JJTA 3NFPB 3L3IA 4J12A 5KVGL 3QWRD 1A1MA 4Q7DA 4H20H 1RIVL 4M6OH 3RVVD 5C08E 5KVDL 3PIQB 3BQUD 1FYTB 2YWYA 1NGZA 1AXSB 4NP4L 5GZOC 5E2WH 5AWNL 4H0HB 1C1EH 1JNNL 1LO4H 5DRWA 4JKKA 4LBEB 4OIBA 5EU6E 5MEND 4MA8H 2R1YB 3ZKXC 4OCMC 4E5XA 3CFKA 2CIKB 2XY2A 3D48R 3VFWB 2E9BA 1N5AB 3ROOB 3WS6A 1X4XA 1TTGA 1C5BH 4B53A 3I6GA 1ZHNA 2AK1L 3WFHA 1X5FA 4EIGB 4WHTA 3HZKA 5BZDB 5CLTA 3VFGL 4GBXC 3GIVB 3H3BC 5CSZA 4I2XA 1KJ2H 4URTB 4XP1L 1KPRA 3V4UL 2YPKB 2IALA 3QIWC 4HKZA 4QLRA 5INDA 2FJGB 5KSAA 4NNYB 5GIRB 5GS0D 4M43H 3GNMH 2XZCH 2ZOKB 1SYVA 4KJYB 1K5NB 5FA4A 5I1GH 3HUJA 4P4KB 4JFXA 4LLUB 4HUUA 2AV7A 2AVGA 3QDMA 4QRRE 3X17A 3VD3A 1BZ9A 4IRSA 5IFJA 3BZDA 4XAWL 4RNRA 1F11B 2EXYC 1MVFA 1MRFH 2GJJA 2JE8A 4RFNB 5DJAA 3T04D 3HG1A 1EBAA 1RZIA 4FZ8H 1QSEA 3BRFA 2FJHB 5IBUG 2OTUB 4QYOA 3WDIA 5D7JD 1CFNB 3QCUL 3X14B 1I1AD 4XPBL 4JFED 4OV5B 1HHIB 4G7VH 4UV4H 2Q6WA 1OAYL 1KBGL 2DN7A 1MREH 1CE6A 4H8WC 4PB9H 1J0YA 4S10A 5ESAB 2CRZA 4PRIA 2VDNL 2FECI 1ZANL 4KV5E 3RU8L 3BO8B 1HKLH 4LSPH 1URLA 3G5ZB 3JSSA 1JYWA 1YPZA 2VZUA 3EO1A 4LU5L 3MC0A 1ACYH 4PREA 4HGKC 2I60L 1I7RB 1TVBA 4PJAB 4DTGH 4FFWC 1BFOA 3V6BR 4DVRL 4BQCA 3C8KA 4U1HA 1G6VK 1MFEL 3ZDXE 4ELMB 4WDIB 5E7BA 5LBSH 2VDPH 3DWTA 3IFPB 4JPVH 5IEKA 3RY4A 3EOBA 5E8PB 3MRJB 1IEAA 1TJGL 4GO6B 3EYVB 4QHKJ 4PRHE 2X1WL 1E4WL 1R0AH 2ADIA 4RWHA 3RPKA 2CRIA 4MDJA 3K8LA 4M9OA 5EU4B 5IW3A 4U4BA 5K9KB 1KGCD 1CG9B 3LSOA 5F8RC 4ACPA 2VZTA 2YBRA 1MAMH 2YD3A 1DBMH 2B4CH 2HRPL 1BFVL 2PCPB 1I9JH 4TNWK 3CSBA 5HDQH 3U46B 5TQ0L 3HMXL 3V0WL 4MAYB 4LCUA 3TJEL 5BV7B 2X70A 4M3KB 3QFJB 4OUUA 4ZNEE 4MVBC 1INQA 4IHOB 2MHAB 2JB6B 4NGHH 3RKPA 5ADOH 2X4PA 3I9GH 5C09E 3TO4D 5KSUB 1VENA 2DQFB 3QQ4B 1ADQH 4UAOB 5DYOB 3ARBC 3UYOD 5F6HI 2NLJA 4HPYH 4EQ2A 4TSCL 5IR1A 2QADC 2H26B 1CGYA 1UM4L 2BNRE 2DQTL 3FN9A 5D2NC 1J0JA 3VW3H 3O3UN 5F7EL 3MLTA 4UOJA 4F7TB 2VLME 3ZDZE 3E6FB 5KG9B 5DUMH 3LHPH 4WVRA 1FVEB 5EO0B 3F7PC 4AEEA 3RGVD 2B1AH 2X4UA 4PJ9B 3EO0B 3QO0A 2EE3A 1JHTB 1MIMH 4YHZH 1V7NH 1YNLH 3FN3A 4RAUB 3SDYL 5DA4A 5MEOB 2V2WA 2NX5A 3FQTA 4HFUL 5E2VH 1TNMA 1LP9F 3H9HB 4KQ3L 4WO4B 5GGSB 1F02I 4DKAA 4PLKD 2JJUA 5IB5A 1FCCA 2NY2C 4JKPH 2BC4B 3MBED 2GSGA 4NZDA 4U33A 2QQLH 1F4XL 2CUIA 3IJYB 3ECBB 1W0VB 4K7PH 1MRCH 5HI3D 3RNQA 1IKNC 2E27L 3CMGA 3UDWA 5MI0C 4I5BB 4HS3B 4G42B 4X80H 3O3BB 4GOSA 1CL7I 1JF5A 1MPAH 5FM5M 1TPXB 4JVWA 4AENA 2AJUL 4WU7A 2ORBH 4FQJH 4OKDA 4ZFOB 3MRKA 3MV8A 1OSZA 4H1LH 3MJ8B 1NLDH 1BECA 5I1EH 5BOPA 1F4WL 2F5BL 5LQBH 4UU9B 4P2QD 4JO1H 1RUAL 4ZAKD 3ILPA 3NGBC 3T0DA 1MCPH 3FKUS 3ARUA 1G7JA 1KNOB 4JZNA 3F7YB 3MNVA 2ZOLB 3V5KB 5TDNA 3BX7C 4RCAA 1GGCL 1HQ4A 1L6XA 4PJDB 3VFUB 3QEQD 4NYLB 3BN9C 1BLNA 4LOUC 1OD9A 3QUMA 1NDMA 4AMKL 5FYLH 4JREC 1S9YA 5EOTB 4HJ0C 2DLTA 4XCFH 2NY1B 3O11A 1A1NA 4GSDH 4V1DB 1QOKA 3VD5A 5D7IF 4CVXB 5F96H 4C56B 4HJJL 1M7DA 4WUUB 4JJ5A 4ZDHB 4OLYH 1AR1D 1KT2A 3A0OA 5ILTL 4ERSL 3HAEH 5D5MA 3MRDB 4RFOL 1TZHA 3QXWA 4KRLB 2Q7YB 1T66D 3HFMH 3MLWL 5GS1A 5HHXH 5F89A 4APQD 3HNVH 2LU4A 5C0RH 4RBPK 1MFDH 5GXBB 4D0DA 3K46A 3DYMA 3KG5A 5CD3A 1C16A 2H32B 1LE9A 3OX8A 1DANU 1S9WB 4DCQB 3MRNB 3C08L 3D0VA 1LK3H 5GSRB 4HXAH 1OARH 3ELAT 5EC2B 5GGVL 2CJUL 2VKWA 1UWGL 2G2RB 2GQHA 2PXYB 5DVMA 3UPRB 3D3VE 5I1KH 3GSRA 5C0BA 4G3YL 4NKDB 4K3DH 3MV9D 4R7DB 4JG1H 3T2NL 5I66A 2DJ4A 15C8L 1Q94B 4DKFL 3RA7L 3P9MB 2OL3L 3BPOC 3GRWH 1B4JL 3JV0A 5DHVB 1VFAB 4NQCB 3QI9A 2CH8A 5FKPA 3P0VH 2ICES 4HUMB 4AIOA 1PZUB 3GMLB 4Y19E 5JW5B 2Y5TA 2KPNA 1INEH 3L3GA 2OI9C 1IJ9A 1N0XH 1NJ9A 2W92A 5D1XB 3BRGC 3GSNB 1KENH 4PJ8C 1NLBH 1P9MC 3KPOA 5JPNA 4NPYB 3FFDB 1MCQA 3UP1A 5GRUH 4PRPD 4PJGE 1EERB 3JWDC 2OCFD 5JZ7C 5LKNA 2NNAB 3FQWA 2ZKHL 2B7DT 2V2TB 1L0QA 2J8UE 1ES0A 3GSVA 2UWEE 4TPRL 4LRNL 1KN4H 4YAQB 1KCKA 2R0LL 2HVJA 2FX8H 4HS6A 5IB3A 5I0DA 5JOPD 5C0IB 3SEPA 1JNHA 3U0TB 1B6UA 4PJHA 3TV3L 5I1DB 4HZLB 4RGMB 3N1FC 1F6AB 1FAIL 3D1MC 3K81A 4GH7B 1FVCB 4U2YA 3JTSA 1AO7E 1SYSB 1NDGA 3EJYC 1I85A 5KAQG 5IESL 4KU1A 4RAHA 3T8XB 5DWUH 4NZRL 4MD0B 4EXKA 5J6GB 3GSQB 3GJFH 5CZXC 1S7RA 4L4VB 3RX5A 3KPSD 2WSKA 1MCRA 4LSSH 1EHLL 1LO0L 1I4FB 3VFPB 2CLZA 4G5ZL 3W9DB 1QPPA 3NACL 4OLWL 5FOJA 1KIQA 3MACH 4F7PA 2GY5A 1A9BA 2L7UA 2VR5A 2FLRT 2YXFA 4L1HA 4WFHD 5LGHL 4GKOA 1UB6A 4FQ2H 1AQKH 4K2UH 5CEXB 4I18A 3G5XA 5AYUL 4K3GA 3BP5B 5HI5C 4MJ5B 3LMJH 3VD9A 5EC1B 3JXAA 2NY6C 3F7VB 3MOBH 4HAGA 3F12B 4CN4A 2FNBA 4MNQA 3Q0HA 3DI2B 3N1GC 3TZVC 4EXPX 5L7XL 3MZTA 5JIPA 2ICWJ 3ARGC 4LIQL 4WFED 4K9EC 3C60C 4HK0A 1B2WH 1ZSDB 2YPLA 2OS7A 3QPXH 1LWRA 1RJCA 1H5BB 4IIQA 3FT3A 4QRPB 3GUTA 1DQML 3VA2C 2VLKD 4NWTH 4KGJA 1BBDL 3U2SB 5HYJE 4TULL 3BJLA 4OD2A 3V6FA 2N1KA 3OKNA 4GRWE 3KPPA 4JG0L 4PIRF 3B2VH 5LAXB 4TTGA 1WCBA 5J7CC 3QHFH 4JVUA 5C6TL 3RWCB 2A77L 4WI5A 3CJJA 1Y0LA 3Q5TA 1OL0A 3C6LD 4F3FA 5I30H 2BVOB 5TF1H 2DQCH 3RWDA 2AEPL 4YHYC 5I15L 1H3XA 4LSTL 3V4PL 4KV5F 3IU4H 3EOYG 2LAGB 4EDXB 4HLZG 3CLFH 4JGJA 2A38A 3HMXA 5EBWA 4KKAD 3LV3B 3F6LA 3QDJB 3TVMD 3WNOA 43C9B 1KEMH 1RJZA 2R0KL 1OGTB 3DRQB 2Q20A 3MLYL 3BP4B 4PGJA 4FQIH 4ZO9A 1ZVYA 2C5DC 5F3HB 3OGCA 1Q9WA 3MUJA 1RUPH 1N0LA 4G6JL 3ZDXF 2J6EH 1DE4A 4XVUD 3SY0B 4GQ9L 1UT9A 5EZJB 1EJOH 1ONQB 3D6GA 1JTOA 2W9EL 4X98A 2FWOB 3ZKMD 3DSFH 2JK5A 2A83B 3G5VB 4OZFB 2WBJC 1MCIA 2X1XR 4O2CA 4X7TB 4XZUA 5F7FA 1XGTA 3GSXB 2VISA 4U1JA 5IBLD 2DBJA 4QHMB 2I07B 3KJ6L 1YDPB 4KKLC 1CD0A 2QSQA 3WDJA 2Q8BL 4X0KB 4LARL 4R3SB 4XNMA 3WLWD 5DJDA 4KKCD 1QRNB 2AABH 4XH2A 2FD6L 1S7UB 3C5ZC 4AG4L 2ZPKL 3DGCR 2YR3A 3DVGA 3CDCA 4P5TC 3WLBA 1S9VA 3ARQA 3HHRB 4G8GE 1WZLA 5MP6H 4G6FB 5GGRY 4NOFA 1CLYL 2PR4L 3VJ6A 1G9MH 1TMCB 5D71L 2EH7L 4IOIA 4HHAA 4ZOAA 4R96B 3NIFE 5I8KH 1QSFD 1IRAY 4F9LA 2CLRA 4OLUH 5DZNA 4PG9B 3MLZH 5EWIL 5CSBA 1MFCH 5JR1H 4P48A 4I77L 4AQ1B 1NAMB 3B4NA 4OCWL 4GAJH 5EUOB 2ZZUT 1S7WB 5TPWH 2NW3A 4MLIA 3WFDH 4UTBH 1OTUD 4QRTB 1B3JA 4P5KB 3L5WA 4YQXL 3MV7B 1KPVB 3V95A 4M1DL 5FO7B 1U42A 4LDOB 3PL6C 4S1SL 4MZ3A 4GW5B 1R5WA 3LS4L 5FYJE 4AYFA 1WWCA 3BXNA 4J4PD 1JRHI 1IGMH 3AREC 1WWAX 4S1RL 2ED7A 4M93B 3OXSB 4P46C 2X1PA 2W07A 4K7PX 3ULVL 4NIKB 4NWUL 2BRRL 3OXRB 1RI8A 3WXWL 3VRJB 1KCRL 3DETD 1JFQH 1XCQB 4M00A 5E8EA 1X5HA 3QCTL 4H5SB 2J4WH 1T1ZB 5E99H 5D72H 3WS3A 3T08A 3OGOE 5T3ZE 1FGVL 4NRYA 1QPXA 5IMKA 2A9MH 4L5FL 1G7HB 4JRYB 3K1KC 3N1MC 4NCC2 4HWBL 1IL1A 1N8ZA 3RVTC 5HHOB 1JN6A 4LRIA 2YD2A 3CH1A 4EI6B 3IF1A 5I75C 3QXDB 1M6OA 1E27A 3QO1B 3Q6FA 5DO2D 3ETBF 4G7YH 5MHSD 1HZHH 2XWBB 3GMRB 2BOBB 2EIZA 5CEYA 3BPNB 2OP4L 4LLVA 1U8LA 4MYWB 3ULUE 4YBLB 2Y7QB 2ARJA 1N3NB 5HGHB 1U2CA 2JJSA 2XKUA 3B9AA 3BD5A 4R97B 5FKAA 5GS0L 1IGJB 2Q8AH 4XGZA 1V3LA 1KULA 3FO0H 4NCDA 5BVPH 4LPVA 4WV1A 4XCNA 4PJDE 4AL8L 4WHYG 3NZHL 4OF7A 5DC0A 3QA3A 3PABA 1I1CA 2VIRA 1YEGH 3VDBA 1JCKA 2YUZA 4BKLB 4V1DE 1FFPA 2V7NA 3MA7B 4WJ5B 4N8CL 4XP9H 2OL3A 3P4LA 4WUUE 5HI4D 4YWGL 5E03A 2YRPA 3K8KA 4XPFL 2W60A 2V5RA 3SDXB 3BT2L 4N0UA 3DX6A 1XF3B 5C0CB 4MSWA 5HGBA 5H37H 3PV6A 4AIXA 2DYPB 3RZCD 4F7MB 2O61B 2AGJH 3O4LB 4QRUB 1YN7B 7FABH 4I3RL 3KVQA 1CICB 5C0AA 5T3XE 3O2DH 1HH6A 3SE8H 5DFTA 1R24B 4OQTH 3JV6A 1RJYB 4EI5A 1UWXK 1U2HA 1YNTA 1NFIA 5HD8D 1CLZL 2MQ0A 1DP0A 4Y2OA 2X4OB 2DB8A 2VDOL 2CGRH 2VKXA 5L6YH 2C4XA 1OAQH 2K1MA 1V3MA 4ZD3L 3SE9H 1Y18A 1UC6A 2E7CA 4N0CC 1RZ8B 3W2DL 2X9XA 3LKOA 3QJFB 4YDKL 4EDWL 1U3HD 3QQ3A 2P7TA 4JZOA 3HE7C 3SJVE 5I1LB 2A6DA 4Z5RB 3WIHL 3VWJD 3EFFA 1FN4B 5JNYB 4UIKH 3U4BL 4CDGC 1N4XH 3KPQA 5LGJB 3VH8A 4DVBB 1CFQA 4XNXH 1QFWI 1WEJH 4ZUVA 2VDQH 2CKBL 3PHQA 4E42A 4PJEB 1NFKA 1MCFA 3PQYD 4NDMB 1HH9A 4QHUB 1QA9A 1EZVX 1C08A 4PRDA 2IFFH 5GJSL 4DEPB 1XH3A 2VO5A 3KPRE 2J8HA 3MRHA 1JVKA 4HK3J 3ARRA 3HS0B 3VXME 2YZ8A 1VB9A 4QHKI 5D7KD 5BRZA 5IWLC 5BJTA 4K07A 4S11A 5J06A 3NH7L 1VGEL 2P44B 3ZYZA 3LEVL 1NC2B 4O51B 3ZE2F 1S7VB 4YBQD 5IROC 1F97A 2FBOJ 3CVHL 3QUYB 1IGFL 3WBDA 1YY8A 4LSDA 4CN1A 2PTVA 4BZ2H 3MODL 3VH8G 3CPLB 4CMMA 2L7JA 1R3HB 3DYPA 3OR7A 1U6AL 1QFUH 2AV1B 5FXCH 4TUKL 3WJLC 4G43A 2XT1B 4NQDA 5I1HL 1FBIH 3U48A 4U1LA 1Q0XH 3GRWA 1J8HE 4C58B 1AHWA 2XY1A 3IGAB 3JV4B 3NZ8B 4MXQD 2AK4A 4IMKC 5KTEL 3UTPE 4HIEB 1KELL 3WNMA 5JHDA 4WW2A 3TYGL 3TBTA 5F1KC 4L29B 5FDYA 3IDUA 1K4CB 3RPIB 2F5AH 5D1QA 4NN5B 4Z9KB 4MA3B 1A7RH 2Y6SD 1XR9B 1I8MB 4UIMB 1Q38A 4JAMB 3T65A 3IJSA 3VGFA 2IANB 3SDDB 4YHIB 3SBWA 2H1PL 1Q9OA 1RK1B 2HT3D 4FHBD 5JQ6H 4N90E 2JCCF 2V2XA 4Y2DD 3RZWA 4KHTH 2EYRA 5ADPL 3MRRB 5HXMA 4PJ9D 2IG2H 4MX7A 1GGYA 1H15A 1RZJC 3G6DL 2DLFL 1I3RA 3MJ6A 5I19L 4JRXA 4P4KC 4XMKH 1P1ZA 1A8JH 4JN1H 3FHQA 3W81A 5CUSL 1I7TA 2NY5L 4M03A 4WO4D 1KTKE 5E8NA 3WHE1 5I8OL 5D4QA 3KPTA 4HC1H 2F19L 1I7ZB 1RUML 4UI2A 3S96A 1FP5A 4LPTA 4J6RH 2FL5B 4WIQA 1EEQA 3BHBA 4RFNC 3B3IB 4KI5E 1Q8MA 4RZCA 1A6VH 2LU7A 3HI1A 4G6AD 5CWSB 4KZEL 3FOMA 1A7BA 4RGNB 5GZNC 4GRWF 4FXKA 3G6JE 1WTGT 5T5NF 1VPOH 4L9LA 1HOCA 2DQJH 3JUZA 1VGKA 1CXHA 2BNQB 4FTVE 2DLGA 5LXGL 4TNWF 2IPUG 4XMLH 5JORB 2WLZA 3HA0A 2J5LC 4HV8B 4GRMA 1MIEH 1MCDA 1FORL 1MWAL 3IDMB 4YPJA 2ED9A 4PJFA 4HUXA 2M8XA 4MCYB 4XWGH 5T5FL 3UEZA 3BH8A 3HPLA 5ID1A 2Y36H 1PG7W 4GS7B 4QTHB 2I9LB 4NO3A 7CGTA 3Q1SL 4Z7NF 3DO7A 2V7HB 4LLAA 2GSIA 2ICEB 1AIFB 2CKNA 2HFFA 2UUDH 2IAMA 3ARTA 3QDJE 4I9WE 4L3CA 3RVWD 2XKNB 2BY3A 1U92B 4HFWA 1U91A 4NKOA 5IQ9A 3U0PA 4FOMA 4K55A 4KK9C 4OB5H 3WFBH 3HC3L 4DN3H 4OT1H 4ISVB 4Z0XA 1DLFL 5D1ZD 1P4LA 4AEIH 2FYYA 1AD0B 3BH9B 3M8OH 5EOCL 4C56D 1YQVL 1JIBA 2VSDA 1U8HA 2MMXA 3IXTA 1J10A 1MJJA 2PYEB 4P5MB 4JO4H 3NCYS 5KVEL 1DLHA 2LVCA 3N85L 2FH8A 1T5WA 1AY1L 4MS8C 4LEOB 1N5YL 1WIPA 3L95B 5T1KD 4HKBA 1RFDL 5CLWA 4YEEA 1D5XB 5ENWB 1LO2H 3DGGA 4MAYC 3WHE0 5F7MC 5BV7C 1BAFH 2H8PB 5DK0A 2Z35B 1AGCA 1DSFH 3RRQA 5ANME 2CRYA 4Q97A 1IGTB 4JFOA 4CVUA 2DF3A 4W81A 4PJ7A 1CK0L 5F7YC 4I3GA 3QWRA 3BWUC 3LPWA 1A7PH 3M1BA 4ZXBB 4BFIB 4Y1AD 2AXGB 2SEBB 3BQUA 2PXYD 3KXFD 5JOEA 5AEAA 4ODWA 2ED8A 2VQ1A 1DUZB 3NIFF 4X5WB 1EIBA 4A6YH 2AERT 4X6FA 4U6XA 1LVEA 1SJVA 2HKHL 4OUOA 2ZUUA 5MENA 4EN3D 4X9FA 2XN9E 3P11L 1IGYA 4EJ1C 3ZE1E 1ZA3A 2J6EA 3DXAB 1Z9LA 3ZT5A 4GAYA 4NO5B 2GK2A 1QNZH 3GJFK 1TVHA 5EBLB 5EUOE 4K3JH 1F00I 5FK9A 1JPTH 5HSFA 2NPLX 8CGTA 3HRZB 3T0ED 4ODSH 3TNMA 4U6TA 2YA2A 1QBLL 3LRHA 1A6WL 4LPYA 4ODUB 5ICYA 1VA9A 5L2KB 1KC5H 5CGYD 3HN3A 1EEZA 2BERA 4MJIE 3A6CL 4GFTB 1TPXC 1P4BL 4JY4A 1HDMB 5GGQL 3IDJA 1WZ1H 1XF5A 4QTIH 3MJ9L 3CFJB 3F5WB 3W39A 1UH4A 5A40E 1UH2A 4JRYE 3SO3C 4MNHB 1I8KA 3L1OL 3STZB 1JI2A 1JPSH 4XXCC 5D7JA 2VXSH 5DURB 1S7XA 3QQ9D 5HHOE 3MGOA 1OM3L 5F3BB 1FO0L 1BJ1H 3ULUC 5KOVC 4R26H 1I1AA 4U6HB 4JFEA 2A6KB 5CJ5A 2BVQB 4TVPE 1YMHA 4KAQL 3EYUL 5I6XB 3LZFH 5EORL 4KDTC 4G8EA 3MSPA 5DHYB 1BVLA 2R69L 2EC8A 4Q6IB 4OZIB 3PWPD 2Z93B 2HJFB 5K33A 2A6JB 1IC7L 4KK5C 2PYFA 5E24E 2CDGB 4NM8L 5M7QA 1NMAH 2DIJA 3B9KB 1KB5L 1EA9C 5HYIA 1HSAB 2JELL 3IDXH 1HYRC 3LKPB 3UBXI 1I3GH 1KLFA 2NY1C 4HIHB 2V17L 3D2UB 4OIIH 2OZ4L 4OF5A 1AD9A 4FN0A 5EZIH 3TH2T 2XTJB 2DD8L 5C1MB 3TBYA 1R3LB 2GFBA 5D7LD 1FC2D 3SKJH 43CAB 1ZT1A 1MVUA 2F54D 5J9PB 2C9AA 4O58H 4JN2A 4PGDB 3BIBX 3OKEA 3O45B 4F7CA 1T2XA 1WJ3A 2H6PB 4PJ5B 1PBYA 3P3YA 2CXKA 3IB4A 3IJHA 1U3ZA 5JIKA 1HHKA 2R8SL 2CR3A 1FL6A 1MHHB 4UT6H 1G6RB 4OZ4A 3EOAB 3WIHA 3U30C 3H9SE 4HF5L 2MFNA 4AY0A 3A67H 3OKDB 4GG6B 1CBVL 2NQCA 2HRPH 1WCQA 2ICWI 4LCWE 4WWKD 4X4MA 4QRPD 1Q0YL 5DQJB 5IK3A 2DQIH 2RR3A 2CKBA 3O4LE 3MGAA 1OTSC 4K8RH 4WHCA 5D9SB 5TQ2L 4OF8A 4IMLA 1TZGL 1DR9A 3S3PA 5EOQL 3UTTB 3X13A 3QNZB 5EBGA 1FNEA 2FR4A 1CFSB 4P3DB 4ALAH 3QULA 4FQHB 2ILLA 2ZNWA 1CLCA 4BSVA 4ZSOB 1L9NA 1MCSA 3TO4A 4UUJA 3TCLB 1EHAA 1HHHA 2C3VB 4Z7WA 4LSRH 5EU3B 5DJCA 1KCVH 1QSVA 1UM4H 1YN6A 3HPJA 3VXPB 1YA5A 3WYRA 3L3IB 3L5IA 1A1MB 3WNNA 4HWUA 5A2LH 2NY2D 4ZMAT 4UILL 3MFGB 3RGVA 1NGZB 3VXSE 5IT2L 1KN2L 2XA8L 3MCKB 4Z7VF 3O0RL 3P77A 5A2IH 4ZNCD 3H7LA 4R2GC 1CXEA 5DRWB 3JBG7 4HFUH 3QXAA 4E5XB 3EJZC 3CFKB 4NUJA 3U0WH 5E9DD 4QXGL 3ORJA 5IBUB 3VFMB 3I6GB 3G08A 3WFHB 3MBEA 4WHTB 3HZKB 4I48A 4NNXA 5B21A 1KLUA 4Z7UA 3TCXA 4IRZL 5LJYH 4NQUA 4U31A 4I2XB 1KPRB 2W0LA 4W6YB 2IALB 3VDAA 4HKZB 3IDGA 5INDB 4LSVL 5KSAB 4KJQC 3C09B 2FECL 1WBYA 3AS3A 3ZL4H 5FA4B 3HUJB 4WU5A 3DROB 5C0NC 4FP8L 4JFXB 4XVJL 4NJAH 1NUGA 4OGAC 5CZVH 5DDHB 4HUUB 1KFAH 2R4SL 2AV7B 1RZGA 2I5YH 1RUKL 3QDMB 5IVXE 1BZ9B 4QEGA 4IRSB 5IFJB 2Y07H 1KJ3H 4NQEE 4QXUL 4P2QA 3V7AG 1RUAH 4RSVA 4Q9RH 3TWCL 4HJ0D 3OPZH 4ZAKA 4HT1L 5DJAB 3HG1B 1RZIB 1QSEB 2LVEA 4XPAH 4QYOB 1JMXA 2YUWA 4G6ML 5DGRA 3DMMB 5HDOA 1HILA 2PTTA 4YPGB 2YKLH 1GGCH 4Z7OF 4H25A 3U4AA 1N64H 4PJXF 2Q6WB 4NM4H 4YHML 3QEQA 5CJOH 1JZ8A 4PRIB 1NCWH 5DJ6A 1WAAA 2QHRH 2MPAL 5E95B 3U1SH 4UQ3A 1YPZB 2APXA 1A3LH 2O5ZH 4HIIA 4XC1L 3EO1B 2NR6C 2FX7H 3T3PE 2BVTA 3LKRA 4PREB 1TVBB 5EH1A 3CK0H 3UC0L 1BFOB 1NCCH 4GQPH 4OZHF 3C8KB 3MV7D 4U1HB 2IC2A 1EO8H 1H5BC 1PY4A 3I6KA 5GHWL 3LIZL 4YXLL 3PWJA 4DOHB 4APQA 1UWEL 4M5ZL 3MCLL 4JCMA 4JKLA 5IP4A 4LL9A 5MEQA 3EOBB 1YEFH 1IEAB 1FFNA 5SV3A 1NGPL 5A2KH 2ADIB 4XTRD 3V52L 4KI5F 4MDJB 3VMOA 1VCAA 5FM5O 3T3ME 4MAUH 2YS4A 1P4IL 4YR6A 3G6JF 3LSOB 4RGNE 1ZLWK 2YBRB 5B39A 4YFLF 2WWKO 4JY6A 1UGNA 1EGJL 4OCRH 2ARJQ 1HSBA 1EEUA 3CLEH 1PX3A 3HMWH 3HZMA 3MV9A 1A3RH 4LCUB 3RA7H 1CGUA 1B4JH 1T7XA 4LQFL 1A4JA 2X70B 32C2A 3BVNA 3N1QC 4OUUB 2X4QA 5I17A 5JZ7D 1INQB 1JPFB 2PF6A 2X4PB 3GHBL 2ESVD 5BQ7B 3BDXA 2BFVL 4AH2A 5IOPA 1T83C 2NLJB 2R4RL 5IR1B 3WNKA 1ZTXH 1RZ7L 3SKNA 3CH8A 5KZCB 1BWMA 5B39G 5CP7A 4WTWA 1MHEA 4PRPA 3MLTB 3MRCA 2HLFC 3QDGD 1CL7L 4XHJD 5KJRL 3FO9A 2X4UB 3QO0B 1I8IA 1QHPA 3GI8L 3I6LE 3BOVA 5CZXD 4TYUA 2Y23A 5C08D 2V2WB 2NX5B 2Z4QA 3FQTB 4MMXC 1T7ZA 5HGAA 4ZFZB 2EDHA 5CJXA 5IB5B 1VFBA 3MA9L 2GSGB 3DARA 2BDNL 5L9DH 4U1NB 3MOAH 1ZT4A 2AAVA 3KPSA 1OAKL 2VDLH 4LVOB 4D94A 3H7BB 4JE4B 5EBMA 4GAGH 4IDJL 2F53E 4AENB 4WU7B 3TNNB 4OFVA 2HLAA 3MV8B 1OSZB 1DN2A 4R90L 2DQGH 3MJ9A 1L0XA 4MB3A 3CAFA 3GO1L 4R6UA 2FB4L 3SDCD 3ZKND 1G0DA 4JB9L 3NTCL 3ILPB 1FO0A 1TCMA 2CXGA 2WMPA 3CDGA 5HVHC 3LPFA 4Q0XL 1G7JB 5ABDE 4QRRD 3ZE1F 5I71B 3MNVB 2VC2H 1FG2A 5TDNB 3TESA 4Y8AA 4OM0H 1HQ4B 5H94A 5IFHL 3S9DB 1WC7A 3WO4B 4QWWC 4RQQA 3QUMB 4M93C 1NDMB 3LKQA 1S9YB 1M05A 2EKSA 3O11B 2ZUXA 1A1NB 3AFLA 4DQOH 2F58L 3FQUA 2GJ6D 1M7DB 5IBTL 4JJ5B 2VLKA 4OAWA 4FMKA 1N6VA 5D5MB 4U1MA 3CXDH 5L2KE 4NJ9H 1TZHB 2YD9A 4N8VA 5C2UB 3VXQA 5GS1B 4JQIH 5FO8A 3FZUC 3G04A 5LCVL 2OSLA 4D0DB 5KANI 5E56A 4D9QE 2G9HA 3BPNC 1JGVL 5CJQL 4F33A 2FLBT 3HZYA 3QP3A 3C6LA 1C16B 1MF2H 4PGCB 1NGYB 3DIFA 1LE9B 3OX8B 5I15H 3D85D 4R97C 5I8EA 3D0VB 4PRHD 3TBWA 4NHUA 3S35L 1ZEAH 2X4RB 2Z9TA 4R4FL 1G7LA 6FABL 3D9AL 4YC2C 3TVMA 4BH7A 3GSRB 5C0BB 3ZYOA 4M1GL 2K3TA 5IJKC 4N8VG 5I66B 2VL5B 1KG0B 1BQHA 2Z92A 3EZ8A 3VD7A 2DWDA 4Y88A 3VFTA 2IEPA 5FKPB 4FQLL 1SBSH 1MFBH 1QD0A 4G6JH 1Z6JT 3EOTH 1UB5A 2NZ9D 2Y5TB 3L3GB 4Y8DC 4MA1B 5IMLA 3SDDD 3L7FA 2AQ3A 5I16A 4PTTA 2W9EH 4YHKL 5IGXH 1NJ9B 5IF0A 5EU5A 3C5ZD 3OAUH 1M71A 1U8NA 5IVZA 4PJ5E 1OHQA 2AJVH 1CIDA 4LDEB 5MEPA 2GHWB 3KPOB 5JPNB 4M6AA 4MNGA 4FQXC 4PJXB 1DFBL 1A1OA 1NCNA 2UZIL 4JM2C 2UUDK 1CICC 4GG6E 3S98A 2N7BA 1INDL 1Q1JL 3GSVB 1BQHG 3OKLA 4H8WH 3TT3L 5A3IC 4G8IA 5F71A 4JM2F 5H8DA 5ACZA 4HS6B 5IB3B 1JNHB 4YK4B 4PJHB 9CGTA 1ZOXA 4F58H 3UTTE 1R5IB 5CBEA 3ZDYF 2W1NA 2HH0L 2OTPA 4OZHB 5D71H 1LGVA 3JTSB 3IAPA 1NDGB 1FIGH 5JA9A 2APFA 4P2YA 3D0LB 4ELKA 4WGVB 1D7FA 2BNQD 2DMBA 4POUB 3INUL 1QSFA 1S7RB 3ZSTA 1YJDL 4EUPA 1S5IL 1IC4H 2D3VA 3PL6D 3VXUE 1Z3GL 4XP4H 3LQAL 3STLA 3RWGB 2CLZB 1OF2A 2WIIA 3MBXH 4P46D 2HFEA 5ISZE 3BGAA 1EUUA 1KIQB 4F7PB 1A9BB 3D18A 4Q9QL 1KCLA 4QRSA 2EIEA 1JNJA 2OQJA 5GISH 1J1XH 2VXUH 3WN5A 1UB6B 2VAAA 5J1SC 2IPKA 3TIEA 4J4PA 2FEDD 4M8QA 5SX5H 4S1RH 1RVFH 3MLSL 4J7RA 4DEPC 5ALCH 2BOCA 3I2CL 5DD1L 3TT1H 1KCRH 4GRLD 4XP5H 4MNQB 4U6VL 1W8NA 4EUPG 2VLRD 1N6QL 2FEEI 1UZ6E 4I2XE 2VXQH 3QUYC 3SE4C 2QV2A 2FHBA 3CDFA 3QRGL 2OK0H 3KGRA 4HK0B 4G9DA 3LEYL 5HHMB 5IB1A 3WKNA 2YPLB 3VCLA 3GKWL 4IIQB 3GUTB 3FT3B 3IRPX 3CUPB 3VWKC 5FAAA 3PE9A 4S2SA 1DQTA 1NFDA 3P73B 2WW8A 4NQTA 1G1CA 5HYFA 2JTDA 4YIQA 5IVXF 3V6OC 1YYMH 1P84K 4OD2B 5BMFL 4Z8FL 3OKNB 1DN0A 1MH5A 1VSCA 1JV5A 1CDIA 3QAZB 4JDTL 5GS2D 3QBTB 4N0YH 1IEHA 3GSNL 2Z8WC 4F7EA 1V3JA 3CXHK 1WCBB 5KVFH 4NN5C 1MHPH 1Y0LB 3PIQA 4F3FB 3RWDB 1ITCA 3OQ3B 5ITBL 5GGTL 3QHTC 3RVXC 1EGJA 1NSNL 4PRIE 3QEGL 5IHZA 2VOTA 4WGWB 5TE4L 2C3WA 5J11B 1NKOA 4LSUH 4XP6L 5EBWB 4JFHE 3H8NA 1YPZE 1T03L 2B0SL 3DXAD 1B4RA 1RJZB 3T1FA 4G8FB 3T3PF 5DMIL 2DRUA 5DD5H 3P4MA 4PJBF 1OT2A 3OGCB 2AQ2A 2IMNA 1Q9WB 1ZVHA 1S7TA 3O2VH 1V5JA 2YPKA 4ODHH 3RFZC 4OI7A 3HLAA 4JHBA 3SKOA 2ID5A 4CL7A 3RZCA 3QCVL 3UJIH 1K5NA 4X98B 1GIGH 2JK5B 3CFEA 4J8RA 4RGNC 3EYSH 4LLUA 5I8CB 1P7KA 1ETZA 4O2CB 1LMKA 4XCCH 4XZUB 4WFGE 1IQWL 1OPGL 1XGTB 3UO1L 3W11C 4DGVH 2VISB 4U1JB 3PWVA 5GJTH 3T3MF 3CFCL 2DJUA 4DZBA 5DMYA 3ARDD 2FATL 3MX0A 1PKQA 3QISA 1X7QA 3QYCA 1UJ3B 3GBMH 2KZ1B 4XNMB 2ITDA 4XH2B 5I18H 1XGRA 2AP2A 3DVGB 5ETUA 4HMEA 3VXNA 4KY1L 1XGYH 2EZ0C 3WLBB 1S9VB 3RDTC 3RWJA 1BGXH 1U3HA 1WT5A 1EH9A 1JRHL 2H45A 2OMNA 5CINL 3G5ZA 4IOIB 4NHCL 3SCMD 5DD0L 4ZFGH 3QNXA 4HHAB 5D2LF 5IFAH 1FNSL 3VWJA 1UA6L 3U4BH 3R1GL 1R3IH 4PY7A 5A1AA 1AO7D 3EO9H 4N5ED 4YFLI 3H42H 4WEMB 3S36L 2KKQA 2XTJD 4HWZA 3PQYA 3V0AC 4ELMA 1FNFA 2X05A 4WDIA 3IU3B 1SMAA 4NN7B 2FGWL 2NW3B 1HK6A 5DQDL 4P23C 1QFOA 3EYVA 3MXWH 1FV1A 1XGPA 4I0PB 3BXNB 2ZCHL 4XWOC 5IJVA 2YD1A 2PETA 3OR6A 2Y5EA 2ZCLL 1T6WA 1IGFH 4Q9CA 3VGBA 4KQ4H 1RULH 4OLZH 3U6RA 3DPBA 3MODH 3WKML 3HNSH 5E8EB 1NANH 4KMTH 2D0FA 1M1SA 5SWZE 4ZXBC 4NRYB 1VEMA 5IMKB 2IPTH 1GYAA 1J5OL 1GL4B 1IL1B 1N8ZB 3KR3L 1X5YA 3CH1B 1DQDL 3IF1B 3FB5A 3Q6FB 2MHAA 2JB6A 4RMTA 2DQFA 2D4FA 3M45A 4X9HA 1H3PL 1C5DB 4X6CE 5DYOA 5CEYB 2QR0A 3PGFL 4KRMB 1U8LB 2AI0H 3JWDH 2ARJB 1J1OL 3K3QA 3QUZC 1CWVA 2H1PH 2R0ZH 5FKAB 5KG9A 3IXAA 4Y2DA 4L4TB 2ZUTA 1NBYB 1IC5H 5ADPH 4RDQG 4XGZB 2AEIT 5DRZA 4NFBA 3L7EA 4PJ9A 4WV1B 35C8L 4Q58C 4XCNB 4NRZA 3QA3B 3PABB 3FONA 4ONFL 5MEOA 4IJ3B 1U8KA 2VIRB 4MCZB 5EG6C 3WEXA 3KDMA 3EFDH 1VDGA 4DAGH 1FFPB 2V7NB 3QUXD 4WO4A 2D7TL 5AZ2H 1NAKL 2OL3B 4YUEH 3CDYA 3MGTA 2BHZA 4N0UB 3DX6B 3BRDA 1GC1C 2WUBL 1OGAE 3RBGA 4MSWB 3PV6B 4HS3A 1OB1A 1FZMB 5I6XC 3QZWB 3ZTJG 5L88L 1HNGA 1QBML 3RTQB 1JWMA 4H1LB 5C0AB 3RX7A 3WIFA 1HH6B 2B20A 2EH8H 1KTRL 3JV6B 3B9KC 3B2UD 1WWBX 1QFWL 4EI5B 1E6JL 1A6UL 5T5FH 1YNTB 1NFIB 4WY7L 3BESR 2PKDA 2YMXH 4U7SA 3DURA 1D9KD 1CVRA 4J3OC 3F7YA 4ODVH 2MOVA 3DMMD 2DMKA 2ZOLA 2VB5A 1Y18B 4K7PY 2BXYA 5FDWA 1S3KL 4FG6D 3P30H 1BIIA 2ZG3A 2VN7A 2BMKB 2ZG2A 4K9EH 4KK6C 3LKOB 4FQ1H 5EIIA 5C2BL 1DDHA 1HN1A 1QVOB 3QQ3B 3VMPA 5J3HD 1NQBA 5D1ZA 12E8L 3QWQB 2CDEA 4JZOB 5CIPH 3BGMB 1BEYH 2A6DB 4NKIH 4CVXA 4G8GD 1YQVH 4DFHA 4C56A 3EFFB 2WWMD 4NUGL 3KPQB 1CFQB 2OR7A 3HAEB 5DMGD 2R0WL 4XC3H 4P3WA 1GRWA 2GTZB 3PHQB 4YNYA 4E42B 4MZ2A 1UG9A 4O02H 1HH9B 1X5GA 5T1KA 2IQAB 2P46B 1VEPA 4PP1D 4LPXA 4ZG1A 1C08B 4PRDB 1G9NL 3MRLA 2A1WH 5F6IB 1IAMA 3IDNA 1XH3B 4CJ1A 1OT1A 2EE6A 3LPGA 1PLGL 5BRZB 4HS8H 3TM6A 5BJTB 1S9WA 4PJBB 1CK0H 2F8VA 3ZKQD 4OM1H 4TSBH 1NCBL 1QBAA 5MERA 3PV7A 4M6NH 1WGOA 2IGFH 4FQCL 1IM3B 4Y1AA 5EC2A 1YY8B 4TSAL 3KXFA 2PXYA 3A6BL 5F93C 2Z91A 4CMMB 3UPRA 5JDSA 3W9EA 3OR7B 1EVTC 5HGDA 5DVOA 4JFDD 4NKDA 4R7DA 1JGUL 4NQDB 1Q94A 4KI1A 1MAKA 4U1LB 3DV6A 3K4AA 5DHVA 4EN3A 1AHWB 2EDXA 4BFGA 5CEZL 4HX1A 2WZPD 2AK4B 3I50L 1B0GB 2EE2A 4QO1A 2DIBA 2VXTH 5JHDB 4UZGA 3GJEA 4UINL 4WW2B 3TBTB 4NKMA 2ERJC 1F8TH 3BKMH 3DO3A 5D1QB 1IM9D 4ONGH 3WS6C 1AE6L 3GSNA 4LVHB 3T65B 3MUHL 5FHBH 1IZJA 1Q9OB 3GM8A 3T0EA 2V2XB 3T77A 1MCWM 1QYGL 1FQ9C 3WJJA 5GGTA 5CS7A 5KSAC 4ZTPH 2GEEA 5FOBA 4WNQA 1AJ7L 1UZ6F 3BZFA 1I3RB 3U7WL 4JRXB 2FO1A 3MRPA 4X5XA 1IKFH 2NY0B 5D7SL 2VJXA 1P1ZB 4PY8J 5I1DA 1H8NA 3TN0B 1I7TB 1XF1A 5SV4A 5E8NB 2YPLE 4S1DC 1IBGL 5B38A 4O4YL 4IRSC 1ITBB 1JYVA 4XVTL 5K9OA 4YHNA 2XQBL 3BHBB 5C71A 4ZUUA 4RZCB 4HQQL 4FFVD 3HI1B 3GJFB 3OKMA 3RAJL 3PWPA 2P5WB 4L4VA 4FXKB 1W0WB 5DJ0A 4CMHB 3VFVA 1BZQK 4L9LB 1A7OH 3MXVL 4HBCL 3JVGC 1VGKB 2RJMA 4OLXH 4M7JL 1PG7H 4CVWA 1GGBH 3BAEH 1LDPH 5DC9B 4PJFB 1T22B 1EXUB 4HUXB 1XIWC 5FCSH 4WEBH 2VYRE 1GPOH 3BH8B 5B4MC 3HPLB 5D7LA 5ID1B 3TYFB 5B38G 2F54A 1O7VA 5J1AB 4NO3B 4HKXA 3DO7B 4RGOL 2GSIB 2GCYA 2HFFB 1CXFA 4RA3A 4Z0BL 4L3CB 3EDKA 4WI3A 1OTSD 4HFWB 1U91B 4NKOB 1TXKA 5IQ9B 3U0PB 2EEBA 2D03H 4PRAA 4FFYH 1HIMH 1A64A 2OR9L 4HF5H 4Z0XB 3CVIH 3OAYH 1P4LB 2MWCA 2C3HA 2FYYB 1MQKH 1UACH 2ENSA 3JTTA 4WWKA 3RKDD 5F1NB 3VGAB 4QRPA 1U8HB 3C2AH 3F65A 4NC2B 5FHAL 4UTAL 1X5AA 3IXTB 1MJJB 2BK8A 2Y06L 3LS5H 4NZTL 5TQ2H 2IH3A 2W38A 4GMTH 3VGDA 4OTXL 4P59H 5FIEA 4KPHH 1IGIH 1A4KA 4HKBB 1DBJL 3EHBD 3SQOL 3DGGB 5FGBA 1YUHB 2C7UA 5K93A 5LWYH 5DK0B 1LP9A 3OJMB 3KLHC 4MQ7A 2IH1A 1AGCB 5T1LD 2B1HL 5I1AA 1FZOA 1QKZH 3PDDA 3CMOH 1JHKH 3GBLA 4O5LL 4JFOB 5F9OL 4M61A 5JW4M 4PJ7B 1IAII 5C0GA 3ARFD 3KPRD 3M1BB 2BSRA 3VXMD 4QOKB 4QY8A 3BQUB 3T2PA 4RWYL 4ODWB 43C9A