1YEGH

Structure of igg2a fab fragment (d2.3) complexed with reaction product
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1997-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegH02
1F3DH 4HKJB 5GRXG 4BZYA 2NY2B 4HUKB 5I66A 5F7WC 1AKJB 4QOKB 3MRNA 2BX5A 4P4KB 4UV7H 3GI9L 1IKFH 1EFQA 5ID0A 3UTPE 1P7KB 4H25B 4M1DL 2Y6SC 3DYOA 4OI8A 1E4XH 2DBLL 1JGVL 4JQIL 4AQOA 1A4KA 2OZ4A 3KPOB 1OB1A 4H26A 4G7VL 5K9KA 2HP4A 2P24A 3VXRA 2KKQA 3MRLA 4HD9A 4HIJB 1OT1A 1LNUB 4K3DL 4Y5XB 4JFQA 3IFLH 2G9HB 4RAVB 2FSEB 3MRKA 1UADC 2DQTL 4D2NA 4YDJB 3LQAH 5DD5L 4PUBH 4Y4KA 5JMOC 4R4FH 1T7ZA 3HI6H 4YNYB 5T5FL 4HIIB 1WZMA 2J12B 5D1QA 1L4IA 5E1AB 4NFCA 2Q8BH 3TBVA 2ATKA 1AGEB 3U4AA 5L2KE 5AWNH 1CE6B 1N8ZA 3J7HA 5IGXH 5T3XE 1DVFA 1KLUB 4NZRH 5JNYB 3RI5F 3GSQA 4V1DD 3BQUC 4Q7DA 3QHZL 1A7RL 2X5PA 2MQCA 4JM2C 3LDBC 4YHYC 1MIEH 3LD8C 2HH0L 5LCVL 3LRHA 1CLZL 3TNMA 12E8L 4A6YA 4Y4FA 2VQ1A 1XR8A 5E95B 3O3DA 3WD5H 1R5IB 3G6JF 4LSUH 1OP9A 1ZAGA 4MJIE 4H0HB 2ZCLH 4IRJC 4P5TD 2G5BA 4I2XB 1K6QL 3SHSA 3H2WA 2VQTA 5KSBB 4U6YA 2UWEA 1EAPA 5DZOA 3VH8A 4WUKL 3TYGL 3P2TA 3QUYA 2IQAB 2XQBH 3VFTB 3VFOA 2LFGA 2AJVL 1FSKC 4X99A 4G8FA 3PL6A 1IGTB 4MXQD 4G6KH 3RWCB 1A22B 5EU6D 1DANT 1FVDB 3M17B 2I9LB 2OTWB 4MLIA 4PJ5A 3M07A 5F88B 5KTEH 3K46A 2NXYB 4ONFL 5LWYH 4NJ9L 4QXUL 4HCRA 4OCSH 5IF0B 1QFWL 1NANI 2BFVL 3AB0C 5DEGA 5F1IB 1EHNA 3T1FB 2IADB 2HKFH 4PJDA 5F6IB 4JO3L 5DVOA 4K55A 3O6LH 4UV4H 1HSAA 1EXUA 3TPUA 1BFSA 1C5CL 1VADB 1OY3B 5MERB 4NO3B 2YR3A 2G60H 5EOCJ 4LCYB 1RI8A 2WWKO 5DJ0B 4PRAB 4R26L 1HXYB 3R06B 4X5XB 3MRCA 5CBAB 2IMMA 4WGVB 4P5MB 2B1AH 3T09A 4P23A 1I1AA 5IOPA 4HEPG 4OGXH 5DJ6A 5ADOH 4XPAL 3ARBA 1K9TA 3TO4C 5EOCH 4MQXD 4OV6F 1XR9A 3JWDH 4F7TA 1IC7H 5JOFA 3GMQA 4TUKL 4WW2F 2A1WL 3HAEA 4AENB 5LGJB 5E2VL 4ZPVB 3DRTA 3IJYB 3MFGB 3MV7E 4R9HA 3EO9L 5AYUL 5C0NC 5CCKL 5EBGA 3VGFA 5D7IE 3FQNA 2BVQB 1CD1B 4YXHL 2BNQE 3FZUC 1CFTB 2C3WA 1Z9OA 2H26A 2DQGL 2QEJA 1MWAL 1D5IL 2Z8SA 5L6YL 5H37H 1CDJA 1GC1C 2AEIT 2H2SC 4MXVE 3MYZA 2IALB 3BGFC 4POZC 3O2DL 3HB3C 3H9SE 3Q48A 1A1MA 4AIXA 3UTSB 5FAAA 5HVHC 2ADJA 3MNVB 3GSNL 5TE7H 2NY0C 3EYUH 1G9NH 3RL2B 3QH3B 1QSFA 3V0WH 1TQCC 3SE3A 2L4OA 3SJVB 3B9EA 4ZOEA 4GT7A 4NBZB 4IHOA 1U95A 4Z5RA 1XF4B 1A7QH 2PNDA 3FHQA 1S7UB 4DKFL 5EZJB 3CC5B 4S0TD 1ACYH 3ULVF 2DQEH 3SKMB 2FLRT 3KXFB 2X7LB 3LKNB 1SM3L 3JV6A 5JDJA 2VLJE 2OL3L 5D72H 3GSUA 4FZ8L 1A6VH 2P8MB 4Z7QF 4F7MB 3RKDC 4PJEF 1AFVH 5CIPH 4AK1A 3QXUA 4DGYL 3HZKB 1UM4L 4JE4B 1U3ZA 1J05B 4G6FD 3AREC 5DJZA 3QPXL 5GGVL 3SDDC 2A6DB 3QHFH 2YC1B 1OAYL 2L0DA 4ORGA 5FHAH 5D2LB 2IQ9L 1L0QA 5EO0B 4XMKL 4ZAKB 4U3XA 4JFPA 2FB4H 2D0FA 3IAPA 1X3DA 4HFUL 2DBJA 3KPRD 5A16B 1I1YA 3CSYA 4G9FE 3KPQA 4P49A 3UTTA 3U4EA 4PGCA 4E42B 4BKLB 2B1HL 4BJLA 3NIDF 4G9FB 5HYFA 1YNKH 5C0EA 1F2QA 4NQDE 4HKZB 5KSUA 1QRNE 5EFIB 3P9LB 1I9RL 3IFOB 5JIKA 3ILPB 4LLUB 2AXJA 5HJ3B 1F00I 5J6GA 3V6ZB 3HUJA 1OAKL 4PLJD 3RVVC 3MLXL 2DQUL 5L0QB 2YUVA 2V5MA 5J6HB 1I8LA 3ARQA 4JZNB 5ESVB 2GK0B 2CIKB 4JY5H 4S1QH 2BNUA 1WWWX 3VGEA 4P2RB 2VN7A 2NZ9C 3NMEA 2HT2D 3GB7A 3TA3C 3ZDZF 5FUZL 4X7TA 2ZJSH 1YQ2A 2J6EL 4MWFA 4XGZB 4HK3N 2V2TA 4FFWC 2Y5TA 4GW4B 2AV1B 3WE6A 4EBQH 1KEGL 3PQYB 4PD4J 1UVQB 3VFUA 2P5WE 1OP3H 1DQMH 3S96B 2HWZL 2R9HC 4P2YA 2CH8A 3ZE1E 2GAZA 4FQJH 3RWEB 5ID1A 5GS1C 2Z93A 2R23A 4MX7A 4MMZC 5K9QI 2VZSA 1FNFA 1T80A 1UXSA 4L8DA 1EEYA 3DMMA 2NY7H 1SJVA 4KGLA 4NWTL 5KVGL 2YN3A 3PE9A 3I3DA 4P5TC 2WZPD 2EDXA 2BK8A 1TITA 3N0PB 1T5XB 3QEUB 3O11B 1GIGH 3FT2B 4XVUD 5TFSH 4LIQE 1J8HB 4XAWL 5F7UA 3DX6A 2ESVA 3LS5L 3C6SA 3QFDA 5E8OA 3TIDB 4B53A 4WUUD 3VFSB 3EDDA 3X11A 1YEGH 4MXQC 4HDIA 3U6RB 3VFWA 4OFIA 4RFNC 5T1LB 4NKMA 5LBSL 2X4UA 4JPKL 4Z7VA 3V5KB 5EUOB 2QR0B 5CKAA 3FB8B 3GI9H 2NLJA 3T3PE 4YDKL 1OARH 3PJSA 3VXUE 3VD7A 4M1DH 3DGCR 1ES0B 5C0AE 4U1MA 2DBLH 3DOSA 3O2WH 4L3ED 1QEWA 1GRWA 3DBXA 5DEZA 3QNYA 1R5WB 1MIMH 3MBEA 4G7VH 3V8CA 4X7EC 1NBYB 5GGSB 1ZA3A 3L95A 3PDGA 1FO0H 3OX8A 4PJBB 3MRQB 4JO4H 1D5ZB 2PO6D 4FQCH 3TESA 1MJJA 4GAJL 3FN9A 1ZLVH 1MFAH 5C1MB 1CD0A 3HI1A 4MXWL 1S7XA 3REWA 4H8WC 5T5FH 2GHWB 5EPMB 3ARGD 1XGQA 4WV1A 4FNLL 4P99A 2AJSL 4X9GA 4PG9A 5CS7A 5E8DH 3BHBA 5FB8B 2JELH 4WI6A 1OL0A 5KSAB 1W2KT 2GJ6B 2PW1B 4PJFE 1LP9E 1A7RH 1RIVH 3C6LB 2Z8WC 1SHMA 1G7HB 3HG1A 3LIZL 2HH0H 3RWIB 3WDIA 3KWWA 3PDDA 5LCVH 2QQKL 4JO2H 4OF3A 4PJCE 4WO4A 1UC6A 4MNGB 3SN6N 2HT3D 5D7KD 4X4XA 5DSCB 4MDIB 3UBXB 2NXYD 4MAUL 3A67L 4LSQH 1G1YA 5IB5A 4Y2DA 4FG6D 1KCKA 1U3HD 1U2CA 2RJMA 2X70B 1GZPA 3C60A 3HZVB 1OWWA 1NC4D 5DQDH 4GFTB 1RK1B 4PRBB 2E6PA 2LVEA 3I6KA 5KOMC 2HVJB 2OS7A 1BX2A 5B22A 5E2UH 3AY4C 4X4ME 4I0KA 4WI2A 3RTQB 3SGEI 3BVNB 3VFPB 5K9JL 3OR7A 3W9EB 4BH7A 4ZOCA 2BY1A 5H2BA 2FJHA 3WO4B 1IGIH 4BQ6A 5EZOL 4OCLC 1S7WB 4NDMB 3QXAB 4ONFH 3ROLA 4I18C 4NJ9H 5D6DA 1YZZA 3K3QA 1QFWH 3O4LD 4XHQA 1DQQA 3TH2T 3QO0A 4FQXA 1CLOH 4JRYE 3MCG1 4PGDA 3FFCA 4Q6IC 4EI5B 4XH2A 1EEZB 1NLDH 4HS8H 4NO0B 1C5CH 1NKOA 2KZWA 4U1LA 4JFDD 1OGAE 1YUHB 1LD9A 4WI5A 1UYWL 3WIFB 4BELD 4JRYB 1A3RL 5KZCD 5SWSA 1NEZA 4OGYL 1HHIB 5DFWH 3UBXG 1R24A 3QIBD 5I8KL 5TDPB 3TH4T 4WEMB 1RZJC 4XNXL 4RFEB 2J8HA 3BP7A 4R26H 4PJAE 4YK4C 5LQBH 4NGHH 1XH3A 4HWUA 4XCNB 1NMCB 5B38B 2VIRA 4PRIB 1GPOL 5DXWA 2X4PA 4F7PA 2BSED 3BDBA 5HHOD 1MCHA 3KPMA 1N0LA 1WEJH 2ITDB 2X42A 3ARYA 3H9HA 4XPHL 2A1WH 2HJFB 3L5XL 4NWUL 1I7ZA 4WHDA 1BLNA 3EO9H 5AYUH 2BNRE 3MCKB 1CICA 1MCFA 1NUGA 1RZKC 3MRRB 1OD9A 2YN5A 3CVIL 3REVB 4NQVA 5KJRH 3V6OA 3SGDI 4HUWB 5D70L 1JHTB 1RV6X 4I0PA 3WJLC 1JWUB 1RJZA 2XWTA 1D5IH 4G80A 1CGYA 1OF2B 5CWSA 4LDEB 1CXLA 4Z9KB 1NLBL 2X44D 3WL9A 4P0DA 1FFQA 4PLJC 2ZUTA 2VLRE 3O3BB 3VXSE 2M8XA 3CCHA 1JPSL 4CRPA 4WY7H 5DRNB 2NW2A 3WHE0 4YXLL 3FO1B 4LMQE 1N6QH 5IB4B 5B38G 2HT2C 4X6FB 4OB5H 2R1WA 5F3HB 3V0AC 1XEDA 5DLML 3OJVC 1A5FL 1F4HA 1T1XB 2NW3B 2OZ4H 4QGTA 3PNWA 1YEEL 5DS8B 4C56E 3UX9B 1SM3H 3R1GH 2VSDA 3V5HB 5ICZA 2OL3H 4LLQA 2IWGA 4FFYL 5MEOA 1MY5A 5B39B 1OAUL 1VFAB 5TE6H 3PG2A 5FO9A 3UC0L 5DK3A 4CMHC 4D9LL 3DVNB 5DK2B 3SKNA 4HPYL 1NFDE 4JGUA 2EIBA 2HT4C 1T03L 1KPRA 3D18A 1DQLL 1D5XA 1UM4H 4J6RH 4P4KC 2LTQC 1ZLUK 3QG7L 1C16A 4LBEB 1U8IA 3DX9B 3QBTB 3HE7A 2P5EB 1KNOA 2MMXA 5HHPA 4XVUC 5CIPB 5J9PB 4BZ1L 5MHSD 4OZGB 1BQHG 1MH5B 5FM8A 4UOW1 1B0GA 5D1ZB 3E6FB 1ROWA 4LVNB 4GKNB 2CDEA 5BZWA 2BHUA 3TC9A 4CVZB 5HGGS 5I1AB 1J0ZA 4Y5XC 2JJSA 4M6ML 4HFUH 2R2EA 1X9QA 2XKNB 3HE6B 2EH7L 4ESKA 1RHHB 2DD8L 4A6YH 2IFFL 1Y18B 2G2RA 3BI9X 1XGPB 5B39G 2B1HH 5DJXA 3WKML 4YIQB 4MNQA 3UEZA 3ULVL 1U58A 1A1NA 4PJ9A 4JJ5A 1JZ6A 1TZHA 3CUPA 3P4OA 4L4TA 3UROR 1LDPL 1GGUA 1S5HB 3BZ4A 2PO6C 1OAKH 2DQUH 4G7YH 1OP5K 1G9EA 4B50A 5T3ZE 1RZ7L 5FECA 3AAZB 3OJDA 5T1DL 4EJ1C 4TNWF 4KI5D 4XCEA 3ZL4L 1OVZA 2AJ3A 1HDMA 3T4AA 2X4RB 3ARGC 2QQLL 4P9HL 1K4CA 3LN9A 3RZWA 5CHNB 4HCRH 5F96L 2M2DA 2D7OA 1B88A 2BMKB 4DTGL 5FUZH 5DQJA 4WW1B 4GUPA 1H5BC 2WBJA 2J6EH 2H2PD 1SJHB 1PDKA 4GG6E 2W0FB 2HKHL 2QHRL 2ZNXA 2FX9H 5EIIB 4L4VB 5IVXB 1UWXH 1AD9A 5MEND 4GG6B 2X1OA 5C08A 1P53A 4EI6B 5KN5B 4JHWL 4F2MA 3GMLB 3MACL 4DW2L 3OKNA 4JZJA 1YQVL 4TSCL 2BHZA 3K1DA 2AAVA 3IB4A 3MLTB 3T2NL 2HT3C 2Z4QA 2CLRB 2QQNL 4NWTH 3OGCA 5CZXD 2NXYC 4GG8A 5SWZA 5BRZD 2A6KB 4FG6C 4LDOB 1PKQE 1U3HC 5TQ0L 3QWRD 5JW4Q 3BE1L 3HN3A 4XAWH 1U8MB 4KROB 3PWNA 2FGZA 4WFGE 4QTHB 3RWFB 2XWJA 5GGRY 2XWBB 4PPTA 2J8OA 2IPUK 1P6AB 2VYRE 2JF1A 3BH8A 5F8QC 4KAQH 4BSWA 2COQA 4DN4L 2X4QA 2X09A 1XF2B 4M1CC 1NGXB 3QDMD 5FCUH 5BW7A 2R1XA 3RNQA 4HJ0D 5E6ZA 2A38A 3DYPA 4YDKH 4WGWB 3OF6A 3TZVD 3LV3B 1MFEH 2GEEA 1QO3B 4H88L 4J3WA 4S10A 4Y1AE 3I84A 1HQ4A 1M05A 1M7XA 3S35L 4PTUB 4FXGB 4V1DE 1JJUA 4K7FA 4LMQI 3K4DA 5DRXB 3WN5B 4Q74A 1JF6A 4Y1AB 4NRXA 3NFNB 3QIBC 4UMGA 1IAOB 4CDGC 4M62L 1C12A 1R3KA 3G08B 2R0ZH 1F4YH 1PX3A 3PWPD 5EH1A 2XTLA 1CGUA 2XKSA 2D7NA 4Z0BH 5I0DA 3RDTD 3O6KL 5CZKA 4FNLH 4OIAA 2W9DL 2AJSH 3P0YH 5EU5B 4PJ7F 1QA9B 4KQ4L 1KJVB 4POUB 2FATL 1EEUA 2D7TH 1QHPA 5CSGA 1G7IB 4J7RA 1T0MA 3O3EB 5KS9A 3FQRA 5EU6E 1J0JA 3V9FA 4L29B 3JTTB 3LIZH 2KQMA 4Z7UF 1R3HB 2Z31D 4PB0L 1IGJA 2JJUA 2FEEI 1EZVX 2FZ3A 1QUNA 2H41A 4I1NB 2XFXB 4IIQB 4DQOL 1EGJH 1MHCB 1U41A 3QIUB 4MAUH 1XIWB 1BIIA 2E3VA 2FCBA 4J1UA 5EOQH 5FO7A 3SGKA 3EGSA 4OGZA 4YLQT 3FB5B 3L5HA 5HHXH 3MRBA 2LU3A 1DBAL 1HEZA 1FNEB 2X41A 1WITA 1CE1L 1OW0C 3OGOE 3VG0L 3GK8H 3QXDB 5DFTA 2OM5A 4PRHB 4XPGH 3QJHB 3R8BB 2BVPA 3PABB 1Q9KA 4JG0H 1TETH 2N1KA 2Y25A 5E5RB 1K8DB 2IAMA 2P49B 4QHKJ 4U1HA 3W2DL 2PYEA 1K8IA 5BVJA 5TGBB 4ZMAT 4HHAA 5TH2A 3UTZB 1NMAH 5E2WL 3T04D 1JI2A 4Z95H 1WIUA 1TQBB 2GSIA 4LPXA 3T0ED 2OTPA 1XGUB 4X6CF 2C7UB 2C9AA 1UYWH 2UZYB 1A3RH 4HX1A 3VFVB 1YY9D 5HY9A 3VG9B 2F8OA 4XC3L 5I8KH 3S4SB 4M03A 5L2JB 5FOBA 3WS3A 3VDBA 5GHWL 1U8HA 1VFBB 5E2TH 4F7CB 4HLZG 5TQ2L 1KYOJ 3UJIH 1UWGL 3EOAA 5D1XB 1XT5A 5EUKB 5D7SL 3MR9B 2YBRB 3QFJA 4MA8L 5L0QC 2CDFA 2NY4D 2P42B 3G5XA 1D5MB 3U36A 4PJGF 3MFFB 1DE4B 1A6PA 4RGND 4YPJA 4LU5H 4IOSD 5ETUB 2YWZA 4OIIL 3STZB 1IZKA 5CLTA 4XP1L 5F6HI 3WSQL 3WNLA 3V52L 5D70H 1JTPA 1CFSB 1PLGL 2VXSH 3KLAB 3D39D 4NHCH 3O6FA 1U92A 4LPTA 4XXCC 3GJFK 1V3MA 3VI3E 1A7NH 2W9EH 3O6ML 3S4SG 1MWAB 5DD1L 4GBXA 4KI5C 1F90H 3DVIA 4WWKB 4YXLH 4HLJA 1PZUB 1QR1B 2VWEC 4GRWH 2E7BA 4JFEB 3ROOB 1J1OH 3ARSA 3TJHC 3M1BA 3GSNB 5DLMH 1A5FH 1XCTA 4JZOB 2D7MA 2J5LC 2YXMA 4ODHH 2H2PC 5CLWA 1IARB 3UYRH 4M93B 2CIIB 4R90H 5ACZA 5DYOB 5DJDB 1MI5A 2F53D 3HC3L 2WP3O 4OZIA 4JDZB 1AQDB 2DKUA 3IDJA 4K71C 4M8QB 1E27A 4P4RB 1VA9A 5GS2D 2R1YB 4MZ3A 4ZFZB 3UC0H 5F7LB 2ZOLB 2EYTB 3LS4H 2YD2A 4D9LH 3O2VH 1U9KA 3KPRE 2I07A 1RIUH 4KZEL 4XNQB 1T03H 2NMSA 2OL3B 2YD3A 1KTDB 1DQLH 5EBLA 2X10A 3O9WB 3T4YB 5ESAB 1FZOA 5CZXC 3LPWA 3QG7H 2DICA 5I1CL 1ZGLM 3QA3A 4LPWA 3IDUA 3BYYA 4DVRH 4OF7A 1A4JA 4X7DC 3WHXA 3SDXA 5CBEB 4KVNH 4KRPB 3SCMB 4BUGA 3MYJA 3QO1B 4G8IB 1U3YA 2EEDA 3H6JA 3MNWB 4G6ML 3PXJA 5F1NA 1U93B 2FD6H 2CPCA 1FNAA 1F6AA 2O93L 1U8OA 4U1GC 3NCJH 1U8NB 1NGYA 1JNNL 5IWLA 1RFDH 1D7FA 3LQAC 2Z0BA 4N0CD 3PWUB 5F3BA 3IDXL 2XY1A 1DTUA 1ONQB 1T89C 4L4VD 5J06A 2CKBA 3C6LC 2JB6A 2E7LA 1JFQH 3UPRA 1I8IA 4JY4B 3VRIB 4FZEH 1F8TH 2I60L 3BIKA 5DVLA 1LO0H 3L9RB 3ZL4H 5JZ7D 1P9MC 4M1GL 2GITB 4DKEH 4HWBA 5EN2A 3RDTC 3MGTB 3NN8A 3VXMD 3ABZA 5ALCL 2JB5H 3X12B 1BBJB 1UZ6F 4NP4H 5EIQA 3DSFH 3HC0A 1LEGB 2RIKA 5E6IA 4YBLC 2HKHH 4WUUE 3U7WH 4XNZB 2CK0H 4KI1A 2NX5B 4PV9A 3DJ9A 1T04A 4NQSB 3I2CL 1GGBL 2J3SA 5E9DB 4ODBD 4JHWH 4NNXA 3MACH 2Q7YB 1FYTD 4QYOB 1M7DA 3LKQA 1RZ8B 3B9KD 3F12A 4JN1L 3RTQC 43C9A 3B8SA 1UB5B 4IOIA 4PGEB 3SGJC 4Z78A 3OKOA 4OD2B 3D2UA 3H3PL 4C83A 3QUZB 5M94B 4D3CL 1CTNA 3RUGE 4DEPB 1WSST 1HE7A 4L3EE 1FZJB 3SPVB 1K2DB 1INQB 5CJ8A 3X3GL 3GM0A 1UACL 3BESR 3MLZH 3BE1H 5FYKL 1MRCL 1LO4L 5CGYD 5IMLA 2LU7A 1T22A 3EYQD 5GZOD 4EI5C 2A73A 2DOCA 3V0VA 5EDXA 4R4BA 1X4YA 2CO7B 4OSUL 1ZHBB 1T20A 5IB1B 1Q9OA 4N68A 2Y06L 5C07B 1GJIA 4K7PX 3L5JA 3F8UB 1FDLL 3ALPA 4XCCL 1WWCA 3FFDB 1NMCC 4E41E 3TBTA 5JO5A 4QRPD 4Y2OA 1JGUH 4E41B 5BXFA 4OF0A 5ERWB 4WNQB 4UDTB 1SYSB 1JE6A 4KK9D 1FBIH 3CVHH 4LCWD 4QKXB 1ADQA 3S35H 5I30L 5H94B 1JGEB 5CINH 4XMLH 3KYNA 2EDJA 5IBLD 3JWDC 3EOBA 1I1FB 5E8NA 2GK2A 4KPHL 3BGMA 3HNSH 3QUKB 1PZ5A 3VE0A 5D7KE 3V4PL 4LFHG 4WDIB 3P40A 4Y16D 2VC2L 2FRGP 2K7QA 3EHBD 1XCQA 1MQKH 5FA3A 2A9MH 5MP6H 1QKZL 5C8JA 1CFVH 2V9RA 3ULUD 4OFYA 2XY2A 1K85A 4KQ4H 2NY4C 1OT2A 2WUBL 1EFXB 2B2XL 4MCZA 5CP3H 5DWUL 3LQMA 4RGNC 3QUXD 3FAXA 2V7NA 3CFDB 2X4TB 1MFBH 4JFFD 4RGMC 3TV3L 2FJFB 5D7LA 4JM2A 1PFCA 3SBWA 1J7VR 4YDIH 3UYPA 1A0QL 4DCQB 2NXZD 3TVMA 1G9NC 2AXGA 4LCCB 4F80A 4ZUSB 3UTOA 4PB0H 5AUMA 1MPAL 2EO9A 4NIKB 1I9IL 5E4EC 3I75B 5IKCB 2LABA 3P73B 5C0BA 1CI5A 2ZNWA 3KYMA 4DQOH 4KMTH 3O4LE 2W9LA 3OJ2C 2ZG1A 4O4YL 3CZFB 4IRJA 4Z7WA 1TJIL 4ORZC 4QHMA 4JPIA 1M71B 4LLMB 4HXBL 2F74A 4Z7NE 4CN6A 3P9MA 4Y4HB 4TUOB 3MCLL 3Q5OA 3C5ZD 3EDEA 2VABA 1DBAH 1RUKL 4BK5A 3LKPA 3EBAA 3MV8B 4PJIF 1AGCA 3RWHA 1JZ5A 3GO1H 3AM8C 2IG2H 1JRHL 3C09B 3VI4E 2EXWD 5EU4B 4U6TA 1BBDL 5EO1A 1J1XL 4WFHD 5HHOE 5JW4M 1PQZA 1S7QB 3NPZB 4LVNC 1HI6B 1KCLA 3OR6A 3OXRA 2ARJB 1H3XA 3W2DH 3VJ6B 5CJXC 4UTAL 3NGBB 4Q97A 2O5XH 1U8QA 1C5BH 4L3CB 4ZXBB 1Q38A 3HE6C 5E2WH 2D31B 3GEWB 4KJYB 3BISA 2OP4H 4X9FA 2VN4A 4D0CB 3MV9B 5C09D 2X2YA 4C4KT 5GHWH 4L8SC 3PXHA 1AO7B 1BZ7B 4P3WA 1Z9MA 1F02I 3EJYD 1CZ8H 4PJHF 1NUFA 2DLHA 4QRQB 1S78D 2EE9A 5FUOL 5FYLL 4CNIA 3O3AA 4HKXB 5DMIL 1KULA 4MA8H 4MCYA 1F4AA 3K80A 2GTZB 1KG0B 3VCLA 3C2AL 3D85D 5IK3B 5I1KL 5TF1L 4XX1G 4QRTA 4R96B 4LKCB 2XRAL 4CVUA 4YHIA 1A6TB 3MNZB 4H1LB 3G6JB 1IGYA 3DPBA 1RK0B 4NC0B 4OV5A 4DUWA 4F8QA 2AJUH 1WCBA 1C08A 2W07A 3V52H 5I15L 4TVSa 4R97C 1PLGH 1BECA 4XPTL 2C3VB 3U79A 3M45A 4S0SD 3BDXA 1R0AH 2Z8VC 2F54E 4HUUA 4OCWH 3IS0X 1ZXQA 4OIBA 5HHVL 5GS0L 4P3DA 3C8KA 35C8L 2WIIB 3O6MH 4J3UA 4HUMB 2F54B 4OUUA 1G1CA 3R0NA 5JZ7C 4MA3A 3S5LA 2WAHA 2OJEA 1QLEL 1N7ML 2DIJA 4O02L 5FUCC 1ORQB 3JUYA 3Q3GA 3G04A 5IM7A 5KG9B 1HWHB 2LU4A 4QHNB 3FO9A 4BYHA 5MHSE 4MJ5B 1KSRA 5E7BA 2WM0A 2ICWA 1OCWH 2W60A 4MB5A 5I19L 3DSNA 4Y4KD 1YPZA 1KBGH 1FV1B 1U8KA 4PJ8B 3MODL 5D1QD 3ULSB 5E4IA 5I16A 3NFPB 5ISZB 4Y5VB 1MOEA 1HK6A 4GQPH 5EULV 5DJCA 5BOPA 5E8EA 2YSSA 1MFDL 3B9KC 3DTXB 4XI5D 1WJ3A 5BJTB 2LE9A 3MLWL 3QDJA 4UILH 5DEFB 3QWOA 3AREA 5DJAB 3WLWD 3H0TB 2MOVA 3R8QA 2C1OB 3GMPA 4WW2B 3ARPA 1N5AA 2FIKB 2GTWA 5BS0E 5CGYC 4ZO6A 1ZT1A 4FXLA 3PHQB 1DBBH 4NSKA 2PW2A 4S1SL 4Y4FD 5GZOC 4JKPH 4BA8A 4OGAD 4NKDA 1BD2B 5BS0B 3GHBH 4BK4A 2XXCB 2CUIA 4JLRA 3GSVB 4U05A 5AD0B 2WWKT 2YA0A 4KI5E 1WAAA 2Y1VA 2BVOA 4HJJH 4HS3B 3QIWB 3QISA 4NUJB 3DURB 2ZPKL 5ENWB 2VWEE 1IM9A 2YMXL 3OAZK 3JVGC 1WBYA 1JNNH 3PL6D 2G75A 3D25A 5KW9L 1MCRA 2VB5A 3DRQB 5SWQB 1CXHA 4AH2B 4BQBA 3I3EA 4KK9C 4TPRL 4PJ5D 2Q8AL 4DUVA 5GGUB 5C2BL 3N85H 4JN2A 3CH1B 1CXFA 1X5JA 5MENE 3B5TA 1I7UB 3WXWH 3F6LA 1XGTB 3PWJA 2YKLH 1CIUA 3E6HB 1CDGA 5FV2A 2DQCL 4HC1L 3FN3A 2E5EA 3QUML 4X6BA 1PYWA 4HIXL 4PRDB 2Z92B 1NCWL 2VLKA 1RJLB 3EHBC 3CPLB 1RUMH 4ELME 3TA3A 5J89A 5ALCH 3OKYA 4LLYB 4PJEB 1DBJL 3HI5H 4KDWA 5L9DH 3S34H 4XBGA 3QNXB 3HZMB 5F9WB 4KHTL 1PG7X 4HUVA 4LPVA 2GIYA 1JUFA 2DDQH 4TYUA 4P23D 1I1AD 5GGTH 3PF2A 2UZIH 2BOCB 3ARBD 1PG7W 3MUHL 3FO2B 5FGBC 2NXZC 4CJ0A 1I8KA 4HEME 4JN1H 3QDME 4XP6H 3LKRB 1XZ0A 1JPFA 1EJOL 1C5DA 3IU3A 3PIQA 4Q0XL 4R0LB 1KB9K 3GSWA 2DI8A 1OTSD 5FYKH 5GGQL 3VFRB 5IW6A 3ZKXC 4OCRH 5CSZB 1U6AH 4ZDHB 1NFIA 1LK2A 2V2XB 1HH9B 2F5BL 4OZHE 1YYMH 1P7QD 3EYFB 4QF1B 3NZHH 2FR4A 4OSUH 5DC0A 4F7EA 5DRWA 3PWPE 4OM0H 2EXWC 1FHGA 4G43B 1QSFD 1Q9WA 2PR4L 4V2CB 1FDLH 1UB6A 3P77A 2C4FU 4UI2A 1D5BB 4XCCH 4FQ1L 2QJDA 1E4KC 3DUUB 4AJ0A 1S7SB 1I3RB 2A77H 1N2RB 1ZSDA 1PEZA 4UINH 4M7ZB 4QRUA 5DJ8A 5DTFA 1GGIL 3D0LB 2BRRL 1SJXA 1Z5LA 3I6LD 2R4SH 3IDNA 3MJ7A 4JRXB 3CD4A 3CJJA 4K2UH 5FDWA 2CRZA 3MV11 1NEZG 3OBAA 5IVNA 5CEYA 4NHUA 4X6DA 3RIFF 3WS6C 3BZFB 4KPHH 2C26A 3B3IB 2YPLA 3T3ME 4JCMA 4APQB 2B8OT 5I0ZA 1BFVH 1ZT7B 5F93C 3EJYC 5IQ7L 4AM0B 2X4SA 1Q94B 5D2NE 1N64L 3AS1A 3FN0L 3VXNA 5C71A 1NDMB 2WUBH 4HSQA 5D2NB 3BZEB 4KUZL 2AJYH 5BMFL 4MDJB 3MROB 4RX4A 3NCMA 2LV4A 4CAGA 4KMLB 5HGHB 4ZUUB 1P84K 1T66D 2BCKB 4NZTL 2WUCL 3NCEB 3MUGB 3N9GL 1YMMB 5JDSA 4MD5A 3HR5A 4S11A 2DYPA 4M5YH 4XP9L 2BY3A 1HIMH 3TT1L 2VDLL 1FN4B 2JJVA 4QRRE 2IFGA 3SY0A 2ZCHL 3ME0A 1G7MA 2AJZB 1TJIH 2DL9A 2E9BA 4NQEA 3NACH 4HXBH 4IMLB 5GIRA 3T0EE 3AXLA 2YS4A 1YNLL 1SEBA 2FX7L 3MCLH 2HA1A 1JCKA 4EEEA 2A83B 5F21B 5HYJD 3S88H 2PCPA 3GMNB 3ZYIA 3B2VL 1JHLH 5CILL 5EZLA 3PP4L 2IANB 4LVHC 4PREA 3RJQB 3KHOA 5I9QC 1BBDH 1S9XB 3FHAA 5EWIH 5E8PB 3FAWA 5D1QC 1XGYL 3BWAB 5MI0B 1A6WH 1KCRH 1A3LL 1A6AA 4GLRI 4D9QD 5KVEH 1UH3A 4GRMB 4YE4L 4IRSB 3MMEA 4XI5C 1OTTC 4I3SH 1K5NA 4JPWL 2E6JA 3MRFA 4K3JL 3L6FA 3WLWC 1DEEB 4YHPA 2MCPL 3X3FL 2IBBA 2OQJA 1FGNH 2BERA 4ZFFB 5AZ2L 4GMTH 1T0NB 3IKCB 4XWOD 5FGSA 1UEMA 3PV6A 4HS6B 2R4RH 5DDHA 4UU9A 3KYAA 3KJ6L 4Y4FC 1T5WB 1NMBL 3D39E 4OGAC 5EG6C 1ZVSB 3IDGA 1WIOA 1KJMA 1ZLSL 1E4XI 3WUWB 1Y6MR 3UJJL 1QVOB 5I8EA 3C08L 3X13B 4U31A 1UZ8A 3C2AH 4BQ9A 4ODXB 4BH8B 5I1KH 4DN3L 2FHBA 3IRZA 2ESVD 5D7IF 3DETD 3GNML 2X1XR 1T21B 5C0DA 3I02B 1EO8H 4GW5A 4P2OA 3PL6C 2JCCE 2NY3D 1BZQK 5CEXA 5KSVA 5D5MA 4MXVF 4RMSA 3WJLA 5JW5A 2C4FT 4NQCE 3F7YA 2F53E 4XPTH 4OI9A 4U1IB 4N90D 3WFDH 4XNZC 2P46B 5FYKU 1WK0A 4NQCB 3L3IA 1J0HA 2R2BA 1FYHB 1G7QB 5J1SC 2XTJD 5HHVH 4JKMA 4FABH 5JLZA 2FGWH 3GUTB 1MHPH 5HVFB 2DTMH 2XZCL 3MBED 3ARZA 3ECBB 1ETZA 1LO5B 3UPCA 4K7PL 4DUXA 4FQLL 3MSPA 4DKDC 3NTCL 3WUWG 3Q2CA 5DD0H 1DUZB 1MHHB 3S37H 4N9GA 2DMCA 2AXHA 2WK2A 5I19H 4LEOA 2IEPA 3FRPA 4P23C 1I1AC 3MODH 1Z9LA 1ZS8A 4K07A 5M95B 3ARBC 2OJZL 4JANB 4HKJA 4AEHL 1MFDH 3KJ4C 5CKGA 1AKJA 1QZ1A 4QOKA 4P4KA 5HTSA 1MAMH 4M8VA 3MLWH 5HVWA 1P7KA 4H25A 4HT1L 4EVNB 1FFNB 4U6XB 3HG1D 4JREB 2J8UE 2KH2B 3B9AA 3KPOA 5EBWB 4PGBB 2UV3A 4WO4D 3QEGL 4N8PA 1RULL 3BKCH 3KLDA 5CJOL 5HDLA 4Z6AT 3K2UL 4QXTB 5IT2L 4HIJA 5IHUL 4Y5XA 1F4WL 3IT8D 2VDNL 4PRPB 2G9HA 4RAVA 4X98B 2FSEA 3PGCB 1QYGH 3C60D 4N1EA 3V4VL 4YDJA 5HD8C 2YPKB 1WBZB 4YNYA 5EOTB 2XN9B 3SE3C 2NR6D 2ZPKH 4HIIA 2W1NA 1IAIH 2XNAB 3WLBB 5FF6B 4UIKL 1CLCA 1RY7B 3VXME 1VACB 2YMXH 1RMFL 4O2CB 3VWJB 1MCOH 1MCPL 5E1AA 4LRIC 1ZHNB 1AGEA 5KW9H 1XF5B 1VFOA 1CE6A 4KRLB 3RWDB 2EDDA 4TSBL 1MUJB 5GXBB 1TXKA 1L7IL 3B4NA 2Q8AH 3GJFH 1KLUA 5C2BH 5JNYA 3GRWA 4KRMB 4PRNB 5E08L 4IDLA 3MGAA 1FYTE 1LEKB 5GSVB 4YC2B 2E6QA 1TLKA 3S6CA 4FQXD 4HC1H 4LSTH 5F9OH 1HHKB 3HNVL 3FFCD 1NCWH 1KC5L 5IB2B 4YWGL 1R5IA 1YJDL 4C59B 5F9AC 1JMZA 3QG6B 4DOHE 1F13A 2DRUA 4GAYB 4LVOB 5J11C 3HTLX 2XACC 4X6EB 4I2XA 5TE4H 1RUAH 5KSBA 4KZDL 2IQAA 1BZ9B 3VFTA 3ZE1F 4EUPB 4NO2B 1IGTA 4YZFF 3I50H 5C70A 3PP3H 3RWCA 1FVDA 3M17A 1TVBB 2I9LA 2OTWA 2DB8A 4GAFB 3BKJL 5EU7C 3U30B 3CMGA 1LO3L 1BHGA 2YWYA 3AUVA 5F88A 5C0CB 1CICD 3WBDA 4Q0XH 4R4NC 1G6RH 5IF0A 3VRLE 2NY1B 3IFPB 5FM4A 1MRFL 5E5UB 3OAUH 5JXAL 2GCYB 1RD6A 3T1FA 4EDWL 2IADA 4EDXA 5ECJE 3NGBC 4LCWE 4I0PD 4ZXBC 4Q9RH 1DL7L 4F58H 4JO1L 1C7SA 1VADA 2MJWA 5MERA 3V7AE 2HLFD 4NO3A 4G5ZL 1KJ2L 2VISB 4LCYA 1PSKH 1FL3B 3HNTL 5DJ0A 1I8LC 2E27H 4PRAA 2YUZA 1Z3GL 4XVSL 5HHMB 5HYIA 1XF1A 1HXYA 3T3PF 3IDIB 4KKLD 5CBAA 1YN7B 1J88A 4P5MA 4FQ1H 4GAGL 2YD1A 4IDJL 3V5DB 5JOPD 2Y9RT 2XA8L 4EUPG 3ULUE 3L3DB 4NNPL 1KCSH 3GBNH 2VDML 3F7VA 4RWYH 4AENA 5LGJA 1ZTXL 3DNKA 3QT2A 3N1FC 1GGIH 4ZPVA 3CDYA 3IJYA 4JFFE 5C9JB 4X5WB 5I71B 4JFDA 4BFGA 5I17B 4LLVB 5FA4B 5CEZH 5D7JB 4M4RA 3EYOA 2W91A 5I1EL 2BVQA 1CD1A 4PY8J 4XWOC 1CFTA 1EMTL 5LJYH 1K3ZA 1TPXB 4PJXE 3AMKA 3EYSL 1TZGL 2WW8A 2WWMD 5IQ7H 2UYLB 2IALA 5FM5M 1IGML 1UM5L 1N64H 3QCTL 2AEPH 3BDYL 3IU4L 2P43B 3FN0H 1CU4L 3UTSA 4GRLB 3HE7D 3MNVA 1GZQB 1LP9F 1YMHB 4PJFF 3RL2A 3QH3A 2Q76B 3DETC 4KUZH 4ZSOE 1KB5L 1G7LB 4LDLB 2D7QA 5BMFH 3FONB 3SJVA 3TF7C 3N50A 3OKLB 1XF4A 4PJCF 3VXTB 1LWRA 3LQZB 4R7DB 1S7UA 5EZJA 3CC5A 1GL4B 4RDQF 3SKMA 2WUCH 3N9GH 4NO5B 3KXFA 2MPAL 2X7LA 3LKNA 4WFHE 1CT8B 1EK3A 5I74C 4XC1L 5HHNB 1IZJA 2XQYK 5ADPL 4LGRB 1KPVB 2PUQT 5BV7L 4N0FB 1VENA 1CXKA 4PJ8C 3IDYB 3HMXA 1AH1A 2XTJC 1RZFL 2VMFA 4MNQD 2P8MA 1L6XA 4AIOA 4F7MA 4PJ9D 2YEZA 3HZKA 5F71A 1J05A 2DMKA 2FX7H 1B0RB 4M02A 5JQ6L 4L4TD 2FH6A 2XZAH 3QAZB 4ELKB 4M6OL 5KANG 1NUDA 1J11A 2A6DA 3ZDYF 1AXSB 3MJ9A 2YC1A 5IB3B 3B2VH 5I1JL 1WFOA 2H32B 5D2LA 4N1CA 5EO0A 4BQ8A 4OLVH 4ZAKA 4KKBD 5EZIL 4WV1C 3BJLA 4G6AC 4M3JA 3OKMB 4NM4L 3RVXD 3G5YB 3U1SL 2B0SH 2WBJD 3TWCL 5A16A 4JPWH 1KTKE 5TPWL 2HVKB 3JXAA 4ZNEA 4PP1D 4XVTH 2PKDA 2APTA 4RA0C 3MZTA 1JNHB 4BKLA 4E42A 3RGVB 4PJ7B 4G9FA 4PJAF 2A9NL 2ADGB 5C08D 1ACZA 2FHFA 3U9UB 1MCDA 1Y6KR 5K9OB 4BSVB 2J88H 5J4MA 3CU7A 3P4NB 3P9LA 5EFIA 4WO4C 3S97C 3IFOA 3ILPA 4LLUA 3NZ8B 3EFFA 1LK3L 3MLSL 5HJ3A 1ZLSH 3V6ZA 1WVZA 3ARFB 3AROA 4J8RB 5SWZD 4Z7UB 2VDPL 1PG7L 1SMOA 4NJAL 2C1PB 5J6HA 4X9HA 1B0WA 2R29L 4YAQB 4JZNA 5ESVA 5FYLE 2GK0A 1SMAA 3VXRE 3MRDB 2AK4B 2CIKA 4YUEL 1A4KB 4P2RA 2NR6C 2EYSA 2IPUG 5D6CB 5J1AA 4KKAC 3E3QC 4M61B 3NIFE 4RAHA 1NGQL 3BP6A 1BJMA 3BPLC 2QSQA 4XGZA 1MFCL 3BEWB 4GW4A 2AV1A 4FQ2H 3PQYA 2ZSVB 2KQNA 1UVQA 4QXGH 5DVKA 1VPOL 5D6DC 3S96A 3OF6D 3MLVL 3JZ7A 3GMMB 3F7PC 1U8PB 3RWEA 3W39B 3CFKB 4FQXC 1GGCL 3RX5A 1MCSA 2XZCH 1IGFL 2R8SL 4W6YB 4K7PH 4FQLH 4R0LC 2MFNA 1DVFB 2Z9TA 3NTCH 1NCBL 3SDCB 4W4NA 1NBZB 4XPFL 1T5XA 4GXUN 3QEUA 3O11A 5ILTL 3FT2A 3KPSB 3VXPB 1J8HA 3P4LA 2F9BT 4X6CB 4XCYB 2CRMA 2YD6A 3TIDA 1GHFL 3VFSA 2VZVA 1NFDF 3D3VB 3WFHB 3U6RA 3O3DB 5IESL 5T1LA 4J3XA 4ALAL 2UWEE 3MRGA 3V5KA 1IBGH 5I18L 5EUOA 1TTGA 3FB8A 2AP2A 4X83A 1EAPB 4HT1H 3QUYB 1BJ1J 1ES0A 1JPTL 5J12C 3V6OC 4ZO8A 4OCXH 4PJGB 5A2IH 3L3KB 1CGWA 4PJ5E 1IEBB 4I0PC 4XHJD 1R5WA 2X40A 1I3VA 4LF3B 1NBYA 5T1KB 4HFWB 5GGSA 2OK0H 1RULH 1SEQL 5CJOH 3SKJL 2HLFC 1PBYA 3D1MC 4PJBA 2DM2A 3MRQA 1D5ZA 2PYFB 2VL5B 3CX5K 3BKML 4X8XA 2VDNH 4PJDE 3U9PL 1OQXA 1G9ML 4X0KB 4DGIH 3TO2B 5EPMA 4WVRA 4UIKH 1HSAB 1H8SA 5KVFH 4KHXL 5T33L 3MRJB 4RSVA 3CIQA 1BGXH 1YC7A 3STBA 3STLA 5FB8A 1JHKL 5HI5C 1IC4L 5KSAA 2QV2A 1Z0MA 4TSBH 1L7IH 5C0GB 2GJ6A 4Y88A 2PW1A 1J86A 1T89A 5L7XH 3C6LA 4QTIL 7CGTA 3FJTA 1G6VK 2IAMD 4QHLB 1NGWB 1G7HA 5DURD 3BPOB 5DQ9B 2PYED 3RWIA 1S9WB 2CJUH 3L3HB 3GJFB 4MNGA 4MVBD 1JRHI 1KC5H 4ODTH 3DRTB 4MDIA 3UBXA 4YWGH 3OAYH 5C2UB 4LPUA 4GG6F 1KOAA 1A6UL 3HE7C 2Y07H 4JKWA 3LOWA 2IH1B 2X70A 2VR5A 1CS6A 4AMKH 3QUMB 5FEBA 4TVPH 4KY1L 1EHLH 1RK1A 2Q3AA 4PRBA 4KZDH 3LEXB 2HVJA 5C6TL 4KK5D 3JWOL 4E0RA 2H26B 4KGJA 2CR6A 1YEJL 2JJSC 3QFJD 1QSFE 3RTQA 3VFPA 1RU9H 1U91A 3W9EA 3V7MA 2DTSA 1S7WA 4NDMA 3QXAA 3RHWK 2BSRB 4R2GD 5MI0C 4Y19B 6FABL 4U7MA 1MRFH 5JXAH 1UJ3B 5ELIA 3ARWA 4HIEB 1QRKA 3I6LE 4IRSC 4PJ9C 1RHFA 3GGWB 2EDWA 1NANH 5KVDL 1ZOXA 4EI5A 1EEZA 3MJ8B 4NO0A 4P46B 4YHZH 4AEEA 4NNYB 4U2YA 1YUHA 3WIFA 1WZKA 3O6FD 4ODSL 5GJSL 5HDQH 3P0GB 5TDPA 1KACB 4FQHB 1Z3GH 4HQQH 1X5YA 4GBXD 3RHWF 2BJML 2NY6D 4XCNA 1NSNL 4AL8L 5B38A 4PRIA 1KLGB 5JORB 4KKBC 4BUHA 2ITDA 3RVXC 1KFAL 1N4XL 2HJFA 3TT3H 2WBJC 1KCVL 1EVUA 2WINB 4LRNL 1UZ6E 1N59B 4PP1C 3MCKA 1MI5D 2NPLX 3MRRA 5DJ2A 3REVA 4OZFB 4U4BA 1MLBB 1W72L 5I1EH 2VXUL 5EU7E 4HUWA 4IJ3B 4JZJC 1D9KB 2FO1A 2AI0H 1JHTA 4AT6B 5BZDB 2C5DC 4FS0A 2J4WL 2WV3A 4I9WD 1OF2A 3EYSH 4M00A 3WV0A 4B7LA 3BRGC 1TZGH 3UTTE 3SOBL 3ZDXF 4EZMA 1NPUA 4LIQL 4O51B 1IGMH 3QCTH 3BDYH 3IU4H 1UKQA 3UTTB 3DX8B 3O3BA 1DFBL 4PP2B 1CU4H 3CLFL 3U4EB 4NQXB 1BQHA 2AV7B 1H9VA 4F33B 3LN4B 3MLRL 5DRNA 1KB5H 3LAFA 5E99H 3FO1A 3TCLA 1OWRM 3LSOB 5IB4A 3HUJE 3VDCA 3E2HB 2DQIH 4X6FA 1VGEL 4FTVB 2EIZB 3NABL 3EO1B 4TTGA 4MAYB 1CL7I 3BEVB 4JDTL 2OMBA 3MGOB 4HH9B 5F3HA 4CJ1A 5GRVK 1UENA 4LCIH 4F57L 4N0RA 2H3NB 1T1XA 3CFEA 3BAEH 4JFZH 2OI9C 4F15C 2NW3A 5DS8A 2AERT 3V5HA 2NTSP 4MA7L 5BW7C 4QT5B 5B39A 1VFAA 4CVXB 1MVFA 4D9QE 5HGAB 3MRIB 1RZFH 2R2CA 3DVNA 5DK2A 1HN1A 2KL6A 2FIRT 1RPQA 1S8DB 2V5RA 4OM1H 4XVJL 2B39A 4TTDD 2H1PH 3S36H 3DXAB 3VGDA 4FA8A 3WE6B 5GISH 3DX9A 4MHHI 3SE8L 3QDGE 2HRPL 3GKWL 2P5EA 5F7NC 5CIPA 5J9PA 1KTRL 2QSTA 2AK1H 4OZGA 1MH5A 2GAZB 1Z9SA 3QDGB 1A21A 4Z18A 3E6FA 4GKNA 4L8DB 5E00B 4DFHA 1UCBL 4CVZA 2PXYB 3RBGA 4NFBA 2CGRH 3CXHK 5T3XH 5I1AA 1G0DA 3U1SH 1YEFL 4JHAL 5GRUL 2P8LB 3TWCH 3HE6A 4HBCL 2V17L 5DHYB 5TPWH 1RHHA 1H3VA 3ZYZA 1Y18A 4C58B 2GJZA 2VDQL 4ZYKB 1F6LL 1XGPA 2ZSWB 5HXMA 2HTKC 2A9NH 4YIQA 1ZK9A 3TN0B 4OAWB 2MKWA 4Z7VE 4I13B 4L8SA 4N90E 4YFLI 3FMGL 4GRWE 1I7RB 4MS8D 3D2UD 3MBXL 1S5HA 1LK3H 3MLSH 4NRYB 2XTJE 3EW3B 2D4FA 3TBSB 4W81A 2UVEA 3B9DA 5EA0H 1FNSL 3AAZA 3LHPL 1GAFL 4QCIB 3MO1B 4ZUVB 3B2UD 4KDTC 3SKUD 4YUEH 5GJTH 5FOJA 2X4RA 5IJKC 3MREB 2FL5B 2W92A 4K9EH 3QEQB 1DUYB 5CHNA 4LQFH 1YDPB 1NGQH 5J3HC 2BMKA 4WW1A 3CFBB 2GY7B 2RR3A 4HULB 3KPSD 1F42A 1MJJB 1SJHA 2W0FA 4X7SL 2RFXB 1C1EH 3VI3F 4TOYH 2EDQA 5EIIA 1RJCA 4L4VA 4MQ7B 5IVXA 4PJIB 4YXKL 1S7XB 3GBML 1GYAA 2Y6SD 3JV4B 2IAMC 2KZ1B 5CMAB 4EI6A 5KN5A 3GMLA 4JFHD 4LHJB 3ARXA 3D3VD 4CW1B 3U30C 1FFRA 1F58H 3MLTA 3WXVL 2CXKA 4MVBC 2O5ZL 2CLRA 2QADB 1CFNB 1P4IL 7FABH 2R8SH 4FFVC 1QSEB 4JKLA 2A6KA 3HG1E 2NY1C 1NCBH 3QULB 1CGSH 2LVCA 4XPFH 4D94A 4MA1B 3G6DH 5MEPB 4N0UB 5FYJL 3VWKB 1I9JL 3EYVB 4KK5C 4OZ4B 1OLLA 1YN6B 1R3IL 5D93C 3SDAB 1GHFH 4QTHA 3RWFA 2EE3A 4X4XB 2XWBA 5IESH 4OFYD 4TULL 1T1ZB 2MKLC 5DMGC 4ALAH 1I8MB 4JVPA 5J0BA 3KS0J 3QR2A 5I18H 3MOAL 4KXZI 4PJHB 4BM7A 1NGXA 4G8GB 5JHDB 1XF2A 1AY1H 3ZKMD 3KYKL 5A1AA 4R2GC 5F72S 5D7LD 3LV3A 2OR7A 4JM2D 4RBPH 1JPTH 1SYVB 1DDHB 4JR9L 1QO3A 3UDWC 1A7PL 4EOWH 3TVMD 4N0YH 3D48R 3KS0H 4RFOL 1L9MA 4PTUA 4FXGA 1NDGA 1BM3L 1P4LB 5C0BD 3HPJB 5F1OB 1B6UA 1RVFL 3O6FC 5D7JC 3GI8L 4Y1AA 3NFNA 3GZKA 4IRJD 3EZJB 1I1RA 1IAOA 3BKMH 3G08A 3U9PH 3BW9B 5DT1L 4UOW0 1G9MH 1TVHB 1N6UA 2NY6C 3FFCE 3LN5B 1LEIB 1HCFX 1TPXC 3KPPB 4W6WB 3JVGA 3MX0A 4QXWA 4NCC2 5SWSE 4LNRB 4M5ZH 3RZCB 2F58L 3HMXH 5EU5A 3CMOL 1QA9A 4HGWB 2EECA 1KJVA 1JHKH 1N0XL 4X7CC 1E0OB 5DUBB 5SWSB 4XP5L 3ZHLA 1G7IA 2BOBB 4K3HA 4RRPG 3O3EA 4IOFD 4LSPH 3V79C 5CD3B 1I3GH 4L29A 4JQXA 5JW3H 3JTTA 2X4PB 2VXQL 2F19L 3ARTA 1R3HA 3QP3A 3ZKQD 1O5DT 4UZGA 1OOAA 3IFNH 4FFZL 2HJKB 1B4JL 2XFXA 4IIQA 2D9QB 2FO4B 4KTEL 1MHCA 1IAKB 3QIUA 4HJGB 3U7YH 1XIWA 3SQOL 1FH5H 3V6OE 3KR3H 2FEEL 4U1KB 1GC1L 2YRPA 1Q0YL 3TYFB 1S3KL 3NFSH 4KY1H 3CFJB 3FB5A 3DO7B 1W0WB 5C6TH 5KAQF 2B5IB 3R0MA 1FNEA 1YEJH 3BP4B 1INDL 1DBKH 3AS3A 3QI9B 2N7AA 1D6VL 1B3JA 1S5IH 4HXAL 4PRHA 1KENH 4OCYH 4JGJA 3RUGF 3QJHA 5C0ND 1CLYL 3UMTA 5I1IL 5JOPE 3PABA 2R0LL 1G0XA 3SGEH 5LGKA 1M1SA 6FABH 1K8DA 2ICES 5IW1B 2VZTA 5IWLC 1BJ8A 4KK8C 4DZ8B 2F5AH 2I5YH 3DVGB 3EOYG 1HHGB 3UTZA 1LDSA 4TTDC 1XGUA 2CUHA 4YHKL 2C7UA 4UQ2B 2CLZB 2EICA 5IFAH 5FIEA 4P59H 3VFVA 2EKJA 3Q6FB 2ZUQC 3X14B 3BPNB 4OTXH 1EBAA 3S4SA 2EXYD 5IEKB 3LRSA 1T7VA 1D9KD 4P5KB 4F7CA 3UPAA 3ZSTA 3V6BR 3NH7H 1KJ2B 5CEZD 4HF5L 5C0RL 2I27N 4D0BA 1MLCA 3L5IA 3HHRB 5D1XA 5EUKA 3W0WB 2BVYA 1KFAH 3DI2B 3MR9A 2YBRA 4Y5YB 1N4XH 3GFUA 1D5MA 4G6JL 1C7TA 2R0WL 4WTZG 1OSPL 3MFFA 2X4NB 4LRNH 1DE4A 1AE6H 4IS6B 5GRWA 4YQXL 5ETUA 1X5LA 2EYRB 3STZA 2BVUA 1W72H 2JJTC 3M8OL 1DP0A 5JQHC 1CFSA 3RKDD 3FQTB 3QPQC 2J4WH 1KLFA 4HG4K 2YK1L 3KLAA 1MRDL 1BQLH 3QDJD 4MS8C 4YGVA 3SGDH 3ARED 4UAOB 2JKXA 3PWVB 4LIQH 3HA0A 4MNQE 1DFBH 2HLAB 3CLFH 3ZT6A 3B2UC 2D7PA 4L4TE 1W8NA 4NN7B 1I85C 4WWKA 3CSPA 5ITBL 1QR1A 1VGEH 3O2DA 3RNKB 3NABH 4M7JL 1IL1B 4JFEA 4NKIH 3ROOA 1LQSR 1R3LB 2D3VA 3GSNA 5E24E 4PBVC 1V7ML 1S7TB 4JZOA 3SDCC 1MEXL 4BFEA 4OCMC 4RMQA 2ERJB 1KB5B 4ZOBA 2CIIA 1FRGH 5ACLA 5DYOA 3OJDB 4JDZA 1AQDA 4M8QA 4Z7NF 4P4RA 1IM9D 2AJ3B 2R1YA 2FX8L 2ZOLA 2EYTA 1MCNA 3SQBA 5BVPH 3F5WB 4WCYL 4XNQA 2MHAB 2OL3A 3DHMA 1KTDA 4JG1L 5BV7B 3BP5B 1K3IA 1YNTB 3D9AL 4YHOH 3O9WA 5EU3B 3T4YA 5ESAA 2Y36H 5C08E 4XZUB 4GH7B 3RVVD 3O3UN 3VI4F 4KTDL 1Q0XL 1HINL 3SE8H 1P4BH 2SEBB 3GKWH 2L7UA 2Q86A 4CU7A 1O7SA 5CBEA 4S1RL 1G7PB 3SCMA 1OSZB 3QO1A 2NZ9D 1KV3A 2VLKD 3FRPG 15C8H 1N5YL 4UDUB 1VFUA 3TA3D 3MNWA 1QSVA 3OGCB 4TQEL 4AYFA 4N8CL 1ZANL 1YEFH 1U93A 4JHAH 3SE9H 1RZGB 4FFWD 1UM6H 4YDLC 2BDNL 3ZKMC 5L2KB 1CD9B 5I75B 1X6LA 3HRZB 4DAGL 1U8NA 1T7YA 3PWNB 3SBWC 2R9HD 3FL7A 2OR9L 2BP3A 2EDTA 3OPZH 4U1SB 5IROA 3TVMC 2E9WA 3VGAB 1QPPA 2DQJL 2FBJL 2V9QA 1NJ9B 1FZKB 1EEQA 1KELL 5FKAB 3PWUA 1T7WA 1FG2B 4DGVL 4D0DB 4BSWB 3MBXH 1ONQA 3DGGB 3BH9B 4HIHB 2UUDH 5C0IA 3T0BA 2R0KL 3LEVL 3VRIA 1NAKL 5KBNC 4MJIB 2DWDB 3LHPH 1NC2B 1E28B 3EDFA 3L9RA 3Q6GH 5JHLH 2GITA 4OT1L 4RMTA 2WBWB 5GRVL 4MD0B 4AEFA 3BRFA 3MGTA 4JFXB 3X12A 3ESVF 1BBJA 5IG7B 4LASH 1MNUL 1LEGA 4NBYB 3WIIL 3FOLB 4X7SH 3FB7B 4S1DD 1JNJA 3BIAX 4IOFC 2NX5A 4YXKH 4NQSA 5HHQB 3GBMH 5E9DA 4PG2C 1JL8A 2J6EA 2Q7YA 3O8XB 4UB0L 1OTUD 2AEWA 3T2QA 1AHWB 4KU1A 1RZ8A 1NCDH 1UB5A 3BJ91 1EIBA 3T8XB 3VXQA 5KS9E 4OD2A 2IGFH 2X6MA 3QUZA 4K8RH 3V8OA 4I48B 1AC0A 5B8CB 5GRZA 1FZJA 3BD3A 1K2DA 3SPVA 4XBEL 1INQA 1PD6A 5JW4N 1UJ3C 1WT5A 3HC4L 4PB9L 4R7NA 1CFBA 1I9JH 2YPLD 4HZAA 1LO2L 2JK5B 3KG5A 1J0KA 8FABB 1I1CA 4P46C 1R3IH 3A0OA 4F9LA 1AGDB 4AZ8A 1EUUA 4EIZC 1F3JB 1ODAA 1DLFL 1A3QA 3QCVH 4A2LA 1ZHBA 5IB1A 5I2IB 5C07A 3OZ9H 4I77L 3MOAH 3UJTL 1WZ1H 3D69B 3FFDA 3KYKH 4RX4D 3MV7B 2M1KA 4E41A 3QQNA 5LXGH 2YPVL 2GJJA 3ISWA 5D7IB 2HJLB 3FQWB 3W82A 4WNQA 4UDTA 1SYSA 5ICXB 1YYLH 3H7BB 4LEXL 4XMPH 3VGBA 32C2A 1IFHL 2BNQB 5JUEL 5H94A 2DYPD 1BM3H 1JGEA 5DD3L 4HH8A 1P7QA 4KI5F 1JMXA 1I1FA 2PYEE 2GQHA 4B5EA 2EXYC 4EN3B 4NQED 2JIXB 2D9CA 2VQUA 3QUKA 1D9KC 5DT1H 2AEQL 3H9SB 2LQRA 3QXVA 5BVJB 3SO3B 4WDIA 1RZJL 5IMKB 3K1KC 1QBLL 5K9QG 1X4XA 4LRIA 3A6CH 4UNUA 2F58H 1TTFA 1ZWIB 3H42L 1JK8B 1EFXA 4XP5H 5ACMA 1TJGH 4J3SA 4XXDB 5CUSL 2FYYB 1NGPL 3CFDA 2X4TA 2FJFA 2FNBA 1REIA 3E2HC 4ZTOL 2VLJB 1Q1JH 4MAYC 4DCQA 2I9TB 3QFJE 2AGJL 4LCCA 4JFOA 2VXQH 4LCUB 4Q2ZB 4TVPD 4ZUSA 1SBSH 4ELMF 3I75A 5AAMA 1CGXA 5IKCA 3P73A 2CDFB 4NN5B 4FFZH 1MAKA 3HFMH 4KTEH 1PEWA 3SQOH 3CZFA 1RURH 5I1LB 1M71A 3GSOB 4LLMA 1S3KH 1TIUA 4KVCL 4Y4HA 4TUOA 1EGJA 1HNFA 3ARDB 4O9HL 4L8BB 3ESUF 1JNLL 3CK0H 1LHZA 3MV8A 1FE8L 1EHXA 1KIQB 5SV4A 5CZVL 5EU4A 4U3CA 3VFNB 1M6OB 3I9GL 3MLUL 2VDOL 2R0LH 2AS5M 1S7QA 3OG4B 1HI6A 4LSSL 4P2OD 2ARJA 1DLHA 2Q6WB 3VJ6A 2PXYC 3BFOA 1CK0L 3ZE0E 4L3CA 4NUGL 4ZXBA 4FHBD 1MI5E 4OZHF 4OZIE 1PAMA 2A0LC 4KJYA 3LVEA 4NQDB 1FCCA 4YHKH 1QRNB 5T3ZH 4R8WL 4P9ML 5HYJA 4UTBL 2DI7A 5JR1H 2ED8A 2Z91A 3WFEH 4D0CA 1E27B 4U0RC 2JE8A 3TN0C 3MV9A 4I9WE 4JPVH 4ZFGL 3BPCB 3K8LA 2XV6B 3OXSB 4OLUL 5HYEA 4YHML 1BZ7A 1AO7A 4Z8FH 4QRQA 4W70A 5IQ9B 4MJ6B 2ZOKB 2Y7QB 1I7TA 3BSZL 4HKXA 1EDQA 3PHOB 2GTZA 1KG0A 5IK3A 3SDXE 2R0WH 4R96A 4LKCA 1OSPH 1U36A 2XXMB 1A6TA 2APWA 3MNZA 5F6HJ 3G6JA 2YZ1A 1RK0A 3UAJD 1AI1L 3MUY1 4PV8A 3QYCA 4HPOL 3T3MF 1JN6B 5HPMB 3M8OH 5GRJL 3WO3B 2P5WB 2NY2D 4YZFE 2HT4D 4E5XB 1AKJD 4QOKD 2C3VA 5DR5L 3RWGA 4P4KD 1MRDH 4ONHB 3VGHA 3RA7L 5FYJU 1W72B 3W5MA 2IH3B 2X89A 4LAQL 4O58L 2WIIA 1ED3B 4TSAL 4OD3L 2XZQL 3QRGL 43CAB 4M7JH 5KG9A 3O4OB 5D96B 25C8L 4QHNA 4MJ5A 5T1MB 3IS1X 5L8KB 1EJ6A 1MEXH 4MA1C 3EDJA 3W9DB 1YEKL 1KJ3L 4S1DC 1DN0A 3IJHB 5D71L 1FV1A 4PJ8A 1IQWL 3ULSA 3BIKB 2FWOB 3JBG7 3NFPA 1FNLA 5ISZA 5ALBL 1R3JB 2CD0A 1JGVH 1WC7A 4JQIH 5EN2B 1OTUC 3IAGC 1A7BA 1CWVA 3DTXA 3VXUB 3K81A 4WWID 2EIEA 2FDBP 5C0AB 5DC9B 5DEFA 1FPTL 3D9AH 4MYWB 4ODVL 4R6UA 5DJAA 5E6IB 4XWGL 3H0TA 4N9OB 2ZCKL 2C1OA 4WW2A 5B4MC 2FIKA 3G5ZB 4GXVL 4K3DH 3JSSA 4QY8A 5T3XD 5SX4H 2DQTH 5F7EL 5DD5H 3LB6C 2QSCL 3PHQA 3LKQB 4ZOAA 1BD2A 43C9B 5BS0A 1FLRL 3TH3T 1N5YH 4OFDA 4MJ2A 3ES6B 2CRIA 3GSVA 4WFFD 2GT9B 4KQ3L 5AD0A 4N8CH 1ZANH 4BZ2L 3MOBL 2KBGA 4HS3A 5C0FB 3QIWA 5JOEA 3TFKD 2BDNH 3DURA 5I1HL 2BVEA 5ENWA 3FB6B 5F7DB 3QHZH 1T2QL 4PJFB 1LP9B 4LLWB 2BRQA 1Y0LB 3DRQA 5SWQA 4AH2A 1CLZH 3HPLA 2DQJH 2FBJH 12E8H 1F4XL 4HLZH 5IFJB 4TUJB 4DGVH 3CH1A 4PJCB 3TM6A 4OD1L 1I7UA 5E2JA 4JFHE 1XGTA 3EAKA 5D9SB 3E6HA 1K6QH 4JHBA 2R0KH 3LEVH 3DX7B 1NAKH 4NCDA 5FHBL 4AEIL 4ZS7L 5J13B 3GKZA 4ZTPL 4WUKH 3TYGH 1II4E 1HKLL 4L4JA 5ANME 1IEHA 2JCCF 2Z92A 4PRDA 4PTTB 1RJLA 3CPLA 3BUYB 4ZPTB 2AJVH 1VEOA 5IHBA 4RWHA 5ANMB 4LLYA 1WWBX 3KYNB 3MC0A 4MLSA 4PJEA 4XTRD 3ZDYE 3QCUL 3EOBB 1MNUH 3X17A 4LHUB 5E8NB 4NPYA 1LE9A 1VKXB 3QNXA 3HZMA 4M1CD 3ZYJA 1FIGL 4GXUM 1ND0B 4QXUH 2BOCA 2BFVH 3HMWL 4ERSL 3FO2A 1T0PB 1L7TL 1MF2L 1JYXA 4JO3H 4OLZL 4FQPA 3JUZA 1FNGB 4P3CL 1WUNT 3LKRA 2FECI 1NAML 1A2YB 4MCZB 5D7LE 3O81A 4R0LA 3KPNB 3BQUB 1OGAB 3BKYL 4RDQG 4XB8A 4LSVL 3DVFA 4PB9H 3VFRA 4HW6A 2AXGB 1MVUB 1ZT4B 5CSZA 4ZDHA 1X5IA 4PJAB 5B3JE 5FYJE 4XPAH 4Z7WE 3DIFB 1JF1A 1HH9A 2V2XA 1UQSB 2YUXA 3EYFA 4QF1A 4ZFOB 4TUKH 4FN0A 3TGXA 4MGXA 1CBVL 5E2VH 3UTSD 5DHVH 4OLXL 3BYTA 2K3TA 4G43A 1OP3K 4I77H 4LHUG 5CCKH 3UJTH 2CMRL 1D5BA 5I76B 3F7QA 1KCUL 1RZIB 3DUUA 3SJVD 1EPFA 3BO8B 2J8UF 4WIQA 1S7SA 1I3RA 1XGRA 4P2OC 2BNRB 1JIBA 1N2RA 4YXHH 3D0VB 1FSKB 1E4WL 4GMSL 2YPVH 3LKPB 2XQYG 4Y5YC 4B0MM 3LPFA 5INDB 2DQGH 1MWAH 5L6YH 3D0LA 3KXFD 5JUEH 4JRXA 5BCAA 5HGBB 1QBML 1X5GA 2X9YA 5F9JB 3O2DH 3GJEB 1UH4A 5J1TC 3GSNH 3K8KA 3B3IA 3AB0B 3CVHA 4NBXB 1AR1C 4APQA 4GW1B 2VLRB 2VUOA 3VXSB 1ZT7A 2IPTL 3KLHD 1DBML 4AM0A 2WQRA 4OJFL 4K3GA 1Q94A 2FLBT 4UAOC 3VA2C 4LVEA 2DLIA 4DKFH 2ED7A 2JLLA 4JFYB 3B83A 3H42H 4WFED 1NDMA 5D2NA 3BZEA 4RIRB 5BO1L 1IGCL 3LZFL 4MDJA 4FZ8H 3MROA 3PDOB 4QRSA 3UAJC 3T77B 2IF7A 4C56B 4ZTOH 1EAJA 4ZAKD 5HGHA 4O5LL 4ZUUA 2F15A 3TO4B 3CFIC 2BSSB 1HXMB 2NY2C 2OX5A 5CP3A 2BCKA 5DZNA 1JYNA 1YMMA 2EDKA 3QZWB 4DGYH 5JIPA 1UH2A 3RPIB 1WBXB 2AQ3A 1NFDB 3IXTB 3QPXH 5GGVH 1FN4A 2NNAB 1J18A 2HAZA 2AJZA 4G9FD 4JB9L 2RQ8A 1OAYH 4IMLA 1BVLB 4OFVA 1JVKA 4KVCH 2IQ9H 4XMKH 5F7MC 5GSRB 2M26A 2A83A 2DQDL 1JNLH 4OQTL 2BY0A 3GMNA 3BGFB 4NRZB 1H3PL 4FQQB 1JZ2A 5HVHB 2IANA 5L88L 5CEZE 3VRLF 1S9XA 3I9GH 1TQCB 4P2RD 3MLUH 5E8PA 3U2SB 3BWAA 3AC0A 3FTGB 1FORL 4LSSH 4P2QE 3RL1B 3H3KA 4GRMA 4GSDL 4WI4A 4DK6A 5LGHL 5EIVA 5IM7B 2GFBB 4IRSA 3WEXB 1I9RH 4JM4L 4NUGH 4P2QB 2W0PA 3QZWG 3WJJC 1YPZE 1UWEL 3EZ8A 2OTUB 3PQYD 1DEEA 1DSFL 4R8WH 2V5TA 3O45B 4PLNC 2DLGA 3MLXH 1FFOB 1WICA 1U8KB 4ZFFA 4MSWB 1T0NA 3IKCA 4U49A 4HS6A 4ZFGH 2DQHL 3VFMB 3VGAC 3QDJE 4KJQD 3EO0B 4OLUH 3ULUF 1T5WA 3VD3A 2UY7A 1YECL 1ZVSA 1V3LA 3QDHA 4UV7L 5DI8B 3WUWA 3TJHD 5C3LD 1QVOA 3SDDB 1IKFL 3X13A 1BFOB 3I6GB 1OD7A 4KKCC 4ODXA 4BH8A 5E7FA 1J8HD 1E4XL 1IM3B 2YZ8A 3GMOB 2GTWB 3TFKC 5I8CA 1MQ8A 1KEGH 1T21A 3I02A 1TTUA 5DMJB 2HWZH 5E94B 1AI1H 2VERN 1JI1A 4HPOH 4PJXF 1WAAE 1P5UA 5T1LD 1JGDB 1QG3A 3IFLL 5DR5H 1B2WL 5KVGH 4K9EC 3LQAL 4HWZB 4PUBL 2APXA 1JZ7A 4NQCA 3HI6L 1WCQA 4A2MA 4KWUA 1G7QA 1QFUL 3CSBA 1QFOA 1ZGLB 1PJ9A 5F6IC 4F8TA 1J9CT 3GUTA 1PKQB 3LS5H 3D25B 3PGDA 2Q8BL 4TSAH 1KUMA 3RWJB 5AWNL 3ECBA 1QFHA 2XZQH 5J57B 3QRGH 1LO5A 5IGXL 4RAUB 25C8H 4NZRL 5F7HA 5C9KA 2CLVB 1X5AA 1D6EA 4X8JB 4XTRC 1DUZA 5LBSH 3OKEB 4HK3J 4WHYH 4JPKH 4ZUWA 5GGSY 1MIEL 5D71H 4LK4A 1HYSC 1FVCB 3RIAK 4ZS6C 1Z2KA 4JANA 3FOMB 5DUPL 1QLRB 4CADB 1G7JB 1V8HA 4IMKC 5KSAD 2ZCLL 4U6HB 2J7LA 1FGVL 2EKSA 1FPTH 2GJ6D 4MD4B 2EE6A 4ODVH 2E9JA 3THML 2XQBL 4V1DB 3C6LD 5HVGB 4EVNA 1CG9B 5HBBA 1FFNA 1JUFB 2VNCA 4U6XA 4GAJH 5F7EH 4U1JB 1IKNC 1ZVYA 5EBWA 4PGBA 4MXWH 2QSCH 5GS1B 1IAIM 3QQ4B 1HILB 1UXWB 1PGRB 1XZ0B 4QXTA 5C3TA 3B5HA 3G6AB 3T0VA 1FC2D 5LWYL 4KQ3H 1YC8A 4PRPA 1M7IA 2YOCA 4X98A 3ZDXE 3PGCA 4P5TB 3MOBH 3G9VA 1JWSA 2YPKA 5A2FA 1WBZA 4H5SA 3TPKA 5EOTA 2XN9A 3SO3C 5I1HH 2XNAA 4I5BB 2VL4A 3WLBA 5FF6A 4CMMB 3KDMB 3O6LL 1VACA 4H0IA 4UV4L 4O2CA 3C5SB 2VOTA 3VWJA 4ZUTB 1A9EB 2G60L 1XF5A 2HFEB 1ZLWH 2QQKH 4OKDA 3RTQD 1G9MC 5EU6B 2VJXA 1WFUA 3RWDA 3UZEA 1V3KA 1MUJA 3GIVB 4RFNB 3MXWL 2ATPB 1GSMA 4B41A 2C4XA 4HZLB 3IGAB 4OD1H 3A67H 4PRNA 4EKXA 3P77B 4Q9BA 1NKRA 2B1AL 3L3JB 1LEKA 3VFGL 1JZ8A 3RP1A 5ADOL 3BXNB 1NUNB 4AEIH 5FHBH 1ZE3C 1IC7L 4KDTA 2GY5A 3NIFF 1HHKA 4ZTPH 3JTSB 5DTFB 5IJKA 4EI5D 3KLHC 1MJ8L 4NO0D 1QACA 5IB2A 4JRYD 3IDNB 2BXZA 3QG6A 1H15B 4GAYA 4X6DE 1RUQL 4X6EA 3IYLW 5K9JH 4YDVB 2ICWI 2Q7NA 5CEYB 5AEAA 4M48L 5EZOH 1BZ9A 1FIGH 4K8RD 4PRID 3UCRA 4EUPA 4ZAKC 4NO2A 2XPGB 1KF9B 3L7FB 1FCGA 1MF2H 2XT1B 3WYRA 1TVBA 4XNUL 5EO9B 2WLYA 4P3CH 5TE7L 2Q1EA 3EYUL 1G9NL 5GGTA 5C0CA 3V0WL 1T3FB 4OGYH 4KUCD 5JMRA 3IFPA 3K74B 2GCYA 3QNZB 4XNXH 1A7QL 3GSXB 4G42A 1FL5B 4LSVH 4YH6A 1HHJB 2P7TB 1ACYL 1A14L 1RSFA 2DQEL 2OBGA 1GPOH 4H1LH 4HMEA 2VISA 2UWEF 4NQEE 4Q58C 5CJ5A 4JDVB 4XPHH 1TDQA 2ZUXA 3L5XH 4NWUH 4ODWB 5E0QA 2DWEB 3WCYA 2YUWA 1A6VL 3IDIA 4G8EB 1UWXK 3NCCB 1YN7A 2CMRH 1OAZL 5GIRB 4OF8A 4I4WB 3V5DA 3CVIH 3AXLB 3BMWA 3L3DA 3IAQA 2MSPA 5DHVB 3UDWA 4WU7B 4RMRA 1E4WH 1Q8MA 4OFPA 1VGKB 1ZGLP 3C2SA 5C9JA 4ZODA 4X5WA 1PKOA 2DMBA 1NLBH 4LLVA 1QBMH 2CSPA 2R2HB 3NCBB 5D7JA 5FA4A 4PJDF 5FHAL 2NTFB 3RAJL 2NY5C 4I18B 5HYQB 4TVPE 3W81A 1MAJA 3IETB 1JPSH 3DECA 4KJQC 1PX4A 1A64A 2N4IA 3L5WB 1BAFL 1DBMH 4Q6IB 2UYLA 4BFIB 4G6FB 4GRLA 5FK9B 4CN1A 2P5ED 1YMHA 2ID5A 1RJYB 1YEEH 1YNKL 2Q76A 2ADIB 1MFNA 1G7LA 3H3BC 3LKOB 3Q5YA 5LVEA 1KIPB 4YK4B 3LZFH 4FFYH 4F37K 3FONA 1OAUH 2H8PA 1M4KA 5D1ZD 3OKLA 3VXTA 3LQZA 3ALWA 4R7DA 3O4OC 4HPYH 1NEUA 4ONOA 4NO5A 3HRPA 4GQ9L 3HE6D 1CT8A 3KPRB 5HHNA 5I73B 1KPVA 4N0FA 4JY5L 4S1QL 4YR6B 4YFLF 3KPTA 4D8PB 4HGMA 4BZ1H 4F37F 3D5OF 3EIFA 5FKPB 2HN7B 1FIEA 1TJHL 3HZYB 1B0RA 4ELKA 1CDUA 4EBQL 1AXSA 3TP4A 4M6MH 1DQML 5IB3A 5A2LH 1H3PH 2EH7H 1FFPB 1CCZA 4FQJL 5L88H 5DK0B 2DD8H 2H32A 4ETQB 1INEL 2IFFH 5JPMB 5T3ZD 4OI7A 5IIEB 3V2AR 1FORH 2NY7L 4OFKA 3WKMH 4EIGB 2XZZA 3OKMA 1MCLA 3ULVH 3S7GA 5LGHH 5FGRA 1IEAB 4PLKD 1QNZL 5KSAC 5CGMA 4JM4H 3F6IA 4KV5E 3GBLA 2HVKA 1GIGL 1LDPH 5TFSL 3HS0B 3P11L 1SJEB 1H3GA 1JNHA 4PJ7A 3QQ3B 2ADGA 5FDYA 4PY7B 3S3SA 3U9UA 1RZ7H 5K9OA 4QOKE 4CMHB 1YEGL 5T1DH 4OBRA 3P4NA 2DQHH 3SDYL 5C0JA 2EDFA 2Q87A 1CQYA 5IR1B 2PTTB 1YECH 2QQLH 4P9HH 3NZ8A 2LTQB 3ARFA 4J8RA 5F96H 4Z7UA 4DTGH 3ILQD 2C1PA 2A6JB 4LLDB 4YAQA 1OARL 5DD6B 2VUYA 2QHRH 3O2WL 5HI4C 3MRDA 2AK4A 5J13C 4KROD 4C4KO 5D6CA 1MIML 4M61A 4WUUB 5HPOA 2JJTA 2XI9A 2QL1A 4DW2H 1FO0L 1YQVH 1IQDB 4TSCH 4JO4L 1QHOA 4WFGD 2E7HA 5DUML 4FQCL 3RI5K 2O61B 3T2NH 4DKAA 5JW4R 3WO4C 1G84A 3BEWA 5IMOB 1B2WH 1F97A 2QQNH 2ZSVA 3N1MC 3U83A 1MFAL 2E8ZA 1NCCL 1VCAA 1GGYA 2H6PB 3LMJL 1GH7A 4ZO9A 1FC1A 4NOFA 5TQ0H 1QFUH 3GMMA 1U8PA 3W39A 3RUGB 5DVNA 2VO5A 3CFKA 3HUJF 4L3EB 5JA9A 5E8DL 1I85A 2JELL 2VZUA 4ISVB 1T1WB 5IUSA 4UBDD 4Y1AD 3LPGA 3SDCA 4F3FB 1NBZA 2PO6B 1RIVL 3KPSA 3VXPA 2AKRB 2AVGA 2NZIA 4DZBB 4DN4H 1KYOK 3ULUL 4W6XB 4X6CA 4XCYA 4MB4A 4JO2L 4K8RC 3RY6C 4WFFE 3FT4B 1PVHA 3ARGB 3D3VA 3WFHA 1ULVA 4I2XE 4NKOB 4H88H 1KT2B 5DUPH 4LSQL 5KSBE 3KPLB 4UT7L 1H5BB 1FGVH 3OTTA 5KAQG 5DQDL 1KGCD 1E6OL 3THMH 3VW3L 5E2UL 4GKSB 4M62H 3TNNB 3UTQB 4PJGA 4XBPB 3L3KA 3EDKA 1IEBA 1WTGT 3WDHA 1XMWA 4LF3A 1AGBB 5T1KA 4HFWA 4J3OC 3BIBX 3O6KH 1IGIL 2V6HA 3QIUD 2DJSA 2PYFA 1XIWD 2VL5A 2W9DH 4MMXC 2D0HA 1U3HB 2FATH 4X0KA 5MEQB 5HSFA 5SX5K 2P4AB 1NC4B 4EDXB 3TO2A 1CLOL 1IE5A 2IPKB 5I1DB 3ZKNC 4Z7VF 4J12A 1NLDL 4HS8L 1TZIB 3MRJA 2DJUA 4HV8B 4CVWA 1BOGB 4GRWF 4WHYG 4PRHD 3P0VL 4I3RL 4ODUB 3LY6A 4YO0B 1X7QB 3FCTB 5C0GA 5ICYB 3MXWH 1CYGA 5LQBL 4NGHL 3TLRA 5ITFB 3H7LA 4UUJB 1SY6L 4QHLA 5K59E 1NGWA 3G5VB 3VFGH 5DQ9A 1A9BB 1S9WA 3O4LB 1OM3L 1NL0L 3CSGA 1WEJL 5DHXB 3L3HA 3GJFA 4JFDE 3J8F7 3F7VB 1NCTA 1MJ8H 4U7KA 1CE1H 1IVLA 4JFDB 3VG0H 3TEUA 3ELAT 3MUZ1 5KZCB 1RUQH 1FL6B 4HC1A 2IH1A 3EYOB 1U8JB 3QIBB 1ORSB 3QUMA 3QWQB 4NZDA 2X05A 5KJRL 4L1DA 3LEXA 2HFFB 4M48H 2A6IB 1QOKA 5D1ZC 1OAQL 4JAMB 4XNMB 4PG2A 5D1XD 3UTSE 1IAMA 5HHOB 3WIHL 2E9IA 4PBXA 3HR6A 4XNUH 5EBMB 4O2EA 3S35X 1J1PL 3SJVE 1J87A 3MJ6A 4RQQB 4WY7L 2BSRA 3ZT7A 1A6ZB 4Y19A 1N6QL 2DS4A 4XC3H 4MQSB 4J3VA 3VD5A 1UJ3A 4OB5L 3EJZD 3KXFE 4HIEA 3VU2A 3CU1A 3KNBB 3GGWA 5CJBA 1NAMB 1A14H 5TQ2H 4J2XA 3MJ8A 4P46A 2OZ4L 4NNYA 1UWGH 1G6RA 1A8JH 3R1GL 3MA7B 5D7SH 3KAAA 4HK0B 5TE6L 1X4ZA 3FQXB 3QQ9D 4FQHA 4RGOL 4M9OA 4O2FB 4LPYA 4U1NB 1OAZH 2VE6B 1B6DA 4WWKD 3DV4B 1KLGA 2YEZB 5JORA 4J6RL 4OIIH 5I6XB 3BOVA 4JFED 4IBLT 4WFEE 5GS3A 4XP1H 3WSQH 5DFVD 4PLKC 5FO8B 1BF2A 4KKNA 5GS2H 2WINA 5D2LE 1N59A 1KN2L 4HUXB 4OZFA 3RAJH 1MLBA 5SV3A 3QEHB 1D9KA 5DD1H 2Z35B 3ZTJH 2BVTA 3OB0K 4AT6A 5BZDA 4S2SA 4ZNEE 1JPST 5JPNB 3O9WD 1BAFH 1QP1A 4O51A 4A6YL 3ILQC 5IJVB 3DX8A 4PP2A 4NQXA 1FZMB 2AV7A 1T7XA 4GKOA 4F33A 2DN7A 3LKSB 3LN4A 4X4YB 4KROC 3HC3H 5F44A 4H1LG 4KRPD 3LSOA 4RZCB 3SCMD 5A43C 4FTVA 3TBWB 2EIZA 3VDAA 3EO1A 4MAYA 3BEVA 1HQRB 2EDHA 3MGOA 4LQ1A 4HH9A 3NCYS 1ZEAL 1MHEB 1LGVA 3EFFB 4DVBB 2H3NA 4KZEH 1OTTD 2VLLB 1DQTA 5GGVY 1Q9LB 4G7YL 1CL7L 4GQ9H 4P2RE 5EC2B 1J5OL 3HKFA 4R3SB 5IHLB 4UQ3B 1L0YA 4QT5A 4CVXA 3U0PA 4LNVA 5I1CH 5INCB 5HGAA 2EYSB 4HKBB 3MRIA 5J1AB 1KN4L 2AJXL 4D9RD 4HCRL 5CJQL 4NC2B 3BP6B 4PR5B 3ZYOA 1S8DA 3PQYE 2ZWLT 1DQJB 1TJHH 4UNVA 5FCSH 2NQCA 1YY8B 3WN5C 4Z76B 3DXAA 4UBDC 2FX9L 4G6MH 2V7HB 2X1WL 2FJGA 3ZO0A 4WU5B 1N26A 4FXKB 3QDGA 5AYQA 1INEH 4RA3A 4Z77A 2W65B 5E00A 1HOCB 1DCLA 3MRPB 2PXYA 3FT3B 2CDGB 2EH8L 3WNKA 3O41B 1J8HE 1XF3B 1QNZH 2P8LA 4P57B 2VAAB 5HGDA 1ITCA 5DHYA 2J5LB 2CXGA 3IDXH 1UCTA 3OHXB 3S98A 2JJWA 3IJSB 1R5VA 3P11H 4EQ2A 4ZYKA 1H3UA 2NX5D 2ZSWA 2APVA 1Z0NA 4K71B 4JQXC 5E9DD 5MENB 3MZGB 3TN0A 4OAWA 1KTLB 5IV2A 4X9BA 1W0VB 2UVFA 1BIHA 2I60H 2RGSA 2W0LA 5EUOE 3SDYH 4M1GH 5BRZE 3K2MC 4KAQL 1I7RA 4IIQC 3MRGB 3QUZD 3B6SB 3QIUC 3QSKB 4JKKA 4NRYA 4EUPH 1XIWC 5FCUL 5F89B 4WRLA 3TBSA 5DRZB 5BRZB 5LAXB 4ELMB 3B43A 4U7SA 1MFEL 3MV01 1P1ZB 3MO1A 4QCIA 4LFHD 4ZUVA 5GGRB 4U2ZA 4PJBE 3MREA 5TDOB 1CR9L 2AXFB 1CD8A 2FL5A 3CXDL 1GGBH 3I2CH 1DUYA 3QEQA 3I85A 1YDPA 1MREL 4G9DB 3S3PA 3CFBA 5DUMH 4OKVB 1ZLUH 5C07D 5DVMA 2RFXA 3OSKA 2R0ZL 3H3PH 1CXEA 1F4YL 4D3CH 1OQOA 4MQ7A 4PLOB 1NCCH 2DQFB 2VKWA 3QDMB 4U1GB 1WQVT 4PJIA 3VMNA 3DV6B 3LMJH 4LAJH 3JV4A 5CMAA 3MQIA 4Z0BL 3X3GH 1UACH 3TZVB 2QSVA 4CW1A 4E41D 2QKIB 4MQXC 1MRCH 1LO4H 2IBZY 2OYPA 3P0YL 2GJ6E 3IF1B 3STLB 3ZHDA 1TQBC 1LE5B 2JTDA 1AGFB 3PHSA 1CFNA 1KXTB 2D7TL 3UYOD 1QSEA 2R56L 1QPXA 2YD4A 3VG9C