1YEGH

Structure of igg2a fab fragment (d2.3) complexed with reaction product
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A FAB FRAGMENT
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1997-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yegH02
5CD5C 2B20A 5ISZD 3QUYC 4OFDA 3BSZH 4NKDA 3F7VA 4FTVD 4IRZL 4JFYB 3LB6D 3PWJA 4XNYH 4KVNL 4YHPB 3MREB 3KYNB 3VGEA 1I9RH 1IKNA 1HI6B 4LIQH 5EBGA 3HI5L 5CHNB 1M71A 1QRNE 3GMNA 3RBGA 2YZ1A 3FN0L 1I8LA 3PP3H 2BNQB 3H42L 3VXQB 4U1IB 2ZCHL 5B3NA 4HPOH 2GFBA 4YHKH 3RP1A 3BZEA 5INDB 5A2KH 1UENA 4TQEH 1YNTB 4YEEA 3M1BA 3IRZA 1S7RA 1NCWL 3CXDL 4HXAL 3QUMB 4UV7L 5IJKA 4AZ8A 4ONHB 2JCCE 2I07A 3X12A 5HJ3A 1DANT 4JFXA 1C1EH 1T7WA 1W72B 3ALXA 3QA3B 2I5YL 1DBBL 1XGQB 1PG7X 4LLMB 1T7VA 1HHHA 1TQCB 4OUUB 2A1WH 5SWSE 1L6XA 4Y0GA 3KPQB 2AJVL 5DFVD 4UAOC 1CF8H 2A6KA 4Q2ZB 4D0BB 1OSPH 5SX5K 3BXNA 5GISH 3D2UD 4XAWH 3UJIH 1ZEAL 1FNFA 4L9LC 4XXDA 3W11C 3IXAB 4JM4H 2DQGL 3RL2B 1MLBB 3T77B 4Q9QL 4Y4HA 3SKOA 4DGIL 4UDUA 2C4XA 4Y4KD 5JW4M 2HYMA 4XRCB 1OTSD 3NCYS 4QEGA 1VGEH 4OTXH 2CXKA 5SWZA 1FYTD 1YEIL 2ZCKH 5FO8A 5D7LB 1JF1B 5D7IA 3ZLQC 3DX9B 5D7KE 1RUAL 1FIGH 4LVHC 3QUKB 3IFLH 1K4CA 1A0QL 1LHZA 1J1PH 2DD8H 3GBNH 5L8KB 3HAEB 5IFHL 1OP9A 1UKTA 1RIHL 5F1KC 4WEUD 3QEHB 4I18A 2FNBA 3LQAC 8FABA 5CFHA 4PJXB 5CMAA 1N5YH 4EUPA 4ZOBA 1VHPA 4Z7WA 2XWTA 4R26L 3BFOA 4OZGE 5C0GA 2P8MA 2VDQH 3AU1A 4V2BA 2NTFA 5L9DH 4M1GH 5I17A 3G6JE 5DMGD 3O6KL 3MV9D 4HWZA 3BZFB 5H2BA 4QCIA 3BKYH 1ERNA 1WBXB 1F5WA 3Q48A 2XTLA 3IXTA 4AQOA 2AJUL 3O0RL 4U1HB 4XNUH 5T33L 1HYSC 4M62L 4JQVC 4YWGH 3NCJL 5DUML 2UYLB 3RDTA 12E8L 5MEQB 1OCWL 1FGNH 4KQ4H 1DBJH 5IKCA 3VRIA 5F97E 3C2AL 2F5AH 3TNMB 5EFIB 2DQJL 4P4KD 4L3EB 4PJ7F 2P5WD 3V6OE 3GNMH 3N50A 4NO3B 3ARVA 4L8BA 4PY8I 4AMKL 1J86A 2J8UF 3OMZA 1I1AD 5IB1B 5C0RL 5E1AA 1FAIL 2F54D 5MEPA 3TNNB 1KV3A 3UC0H 4HIJB 5IFAL 4XCEA 3MLWL 1FPTL 5EBLA 4DKFL 2XTJD 3CPLB 1WAAE 2A0LD 5I8EA 1FL5A 1IGCL 5TQ2L 1CFTB 1ZHLA 5FXCH 4Y4FA 5IBUG 5DDHA 5F1IB 5SX4I 5HPOA 2ATKA 5GRJH 2A73B 1E4XL 3QG7H 1BQHA 2YD8A 3HE7B 3B2VL 4D9LH 1KJ3H 3TJEH 3OXSB 1QLFA 4NBYB 2DBLL 2NY7L 4JHAL 1D5BA 4PS4L 4WU5B 1I1RA 4TUOB 4JKWA 2WQRA 2BCKA 2PTUA 1W0WB 3U9PL 2NZ9D 1AE6H 3GM0A 1QRNA 2R2BB 3O9WB 4YIQA 1K2DB 2WBKA 1NCNA 4XGZB 4I5BA 2IH1B 4KKBD 1KPRA 1MVUA 4LRIA 4ELKA 2QADC 3I6GA 5I1AA 3QDHA 5IOPA 5MHSE 1MI5B 2V17L 4JPVL 3PDGA 1NSNL 3P4OB 3AM8C 4CJ1A 4C59B 4JY5L 2P7TB 2BRRH 3GSNA 1ZHKB 5HHPA 2CDFA 1I7TA 1TZIA 4XX1G 2DYPA 2YN5A 3PP3K 5D1ZA 2JCCA 1YEDA 4XMLH 4MJ5B 1RJZB 2Q6WA 2O5ZL 1A8JH 4X5XA 2VE6A 5I76A 5A2IH 4YHOH 5E2TL 2OP4H 2CD0A 5FYKD 1BZ7A 1J11A 3QIUC 4OZFB 4JFEB 4PP1C 4Z78B 3RKDD 2UY6A 4PLOB 1IC1A 1NCCH 1XEDA 2W91A 2NY0C 2X4PA 4MS8C 3JV6B 2PO6B 3PGCB 1G9MC 1Q72L 3KPLA 3UXFA 3K4AA 1TVBB 4NHCL 4PJ5B 1RUQH 2YKLL 4NWTL 4GMSH 3VGHA 4HPYL 1FJ1A 1NCAL 4EN3C 5IB4A 4YXHL 3OKEB 3CSYB 2VH5H 5IT2L 1WC7A 4QRTB 3GB7A 5AG8A 3LV3A 3UPAA 3IGAA 2C3VA 4S0SD 1PY9A 4Z7VF 5I1CL 1B4JL 4GBXA 4JFFB 4TVSa 4X6CA 2HLAB 4F2MA 2IAMA 5D7LD 5JIIA 2FATH 4OZ4A 1LO2H 5JXAL 1R5WB 1XMWA 4JO4H 4NZDA 3CNKA 3QCVL 15C8L 1V7NH 3AXLB 1T7XA 4N90E 1SJXA 2FIKB 3F6LA 5JHDB 3BX7C 1Q8MA 1TJIL 1NGPL 4N9GA 1A7OL 3ZKMD 3S36H 4LNRB 1RUKH 4GXUM 2Q76A 4HKBA 1HXYB 1AKJD 4XP6H 3QIBC 5IJVB 1MREH 4PJCF 2PR4H 4R0LB 4R90H 5CJQH 1IAIL 5KW9L 1JV5A 4BZ1H 2BHZA 1FL6A 3DURA 3CH1B 4WTXA 4OZGA 3GSWB 2L7UA 2VQUA 3SQOH 3D48R 4ZUUB 5CZXD 5DC9B 4O02H 3TN0B 1A14L 3F7YA 4NN7B 3G6JA 1JL8A 4KK9C 3RX8A 4G9FE 1PSKH 2HJFA 1KT2B 4O4YL 1YEKL 4ETYA 1NGZB 5IMMB 3ZE1E 1X7QA 5ENWA 1PAMA 2NX5B 4H5SA 1II4E 2NW3B 4FHBD 1KXQE 3SJVA 4RGMB 1AQKH 1EHNA 4N5EC 1AIFA 4MAUL 5I1JL 2PF6A 3WLWD 1RJYB 5T1LB 3OHXB 1OQOA 2VL5A 1RZFL 4JQIH 4M93C 4ZSOE 5E8EA 4IOIA 2OZ4L 4QTIL 4EQ3A 2PUQT 3GMRB 3KPMB 2BNUB 2ICWB 4LSPH 2W65A 1U8KA 4L4TE 2EDOA 1UEYA 4PRIB 1F4XH 4H26A 1EXUA 5C0CA 4IBLT 3O6MH 3DBXB 3RFZC 3RIFK 5EG6C 3FL7A 1ZGLB 4ZD3H 3TFKC 4PJ8D 2ZOLB 1AHWB 1CLZL 4U1LB 1A5FH 3QIWA 5IVNA 3L3JB 5HGDB 5D1XA 4ONFH 3KPOB 4TSBH 5TPWH 4JKPL 1RZIA 2IQ9H 2JF1A 4E0RB 4HSQA 3U0TB 4MXVF 2X4OB 2FYYA 5BQ7B 1GC1C 2P8LA 5E2JA 5AAWA 4YAQA 3HE7D 5CIPA 2O5YL 1DQQB 1EHXA 1HINH 2QHRH 4LU5L 1YNLL 4IMLB 2VDLL 4N0CD 3U36B 3A6CL 2EZ0D 2QQKL 3LN5B 5IB3A 4MAYA 4HMEA 4D3CL 4LOUD 4UZGA 1A4KB 4ODUB 2E6JA 3EJJX 3KJ4B 3O9WD 3GRWL 3ROLB 4P0DA 1MI5D 1U8HA 4QF1A 5F7YC 1TTUA 3CFCL 2HVJB 4MXQD 1CE6A 3FJTA 4FQPA 2DLHA 3BD3A 4NRZB 4FOMA 5TGBB 1AFVL 4NRYB 4K9EH 4JFHD 5C6TL 1YY8B 1G7HB 1IAMA 3GI9H 4HLZH 1R3HA 4NQDE 1F6AA 2AJYH 3A6BL 1JGLH 4TSAH 3RJDA 1QLRA 3GMQB 3T0AA 3GSRB 3WUWG 1MFCL 5TH2A 1KIRA 4X0KB 1I8LC 2JKXA 3O4OB 4U0RC 3LS4H 1RUPH 3QNXB 3BESR 4JFED 3RHWK 3DSNA 3G6DL 2FGWL 3L6FA 5D93C 4OKDA 4XBPB 4ZUWA 2R0ZL 3LMJL 4G6AD 1YPZA 4DZBA 1WTGT 5D5MB 1ZV5A 1U41A 2RCSL 3QUXA 2O5XL 4PG2C 3UBXB 3IYLW 1LD9B 3R8BB 3U7WH 1OM3H 1CFVH 4UQ3A 1ZWIA 2P1YA 2C1OB 3QZWB 3SPVB 1CS6A 4HHAA 1B6UA 3IKCB 4BSJA 4R96A 3VGBA 3SKJH 3NFNB 3GFUA 1JE6A 2EDTA 4E41B 4JFFD 4Z0BL 4AYFA 3PWVA 1YJDL 4RRPA 3ARDA 4L5FH 3QJHB 4PRDB 4OD1L 2VLLA 5KSAA 4PGBA 3T8XA 1DBKL 2FEDD 2EYRA 4JM2B 1UJTA 3WFHB 4ONGH 5C0BB 2O93L 2YUVA 5IHBA 2I9TB 2UWEF 3BI9X 3BJLA 3HG1A 1ZHBB 5E7BA 4E42A 5JHDD 4GG6A 1Z9MA 4TN9A 2BMKA 3B9EA 4G7YH 5CINL 4XPTL 3SE3C 2GQHA 1CXLA 4PYHA 3ZDYF 4KJWC 1IGYB 1KCRH 1CFQB 3S5LA 4F7EA 2F8OA 4G5ZH 2AI0L 2WIIB 3MGOA 4YHIB 3F58L 3OKKB 2EC8A 4X80L 4FQQB 2A2QT 5C09A 3X14B 1TZHB 3UTZA 1ZLUH 1FZKA 3OZ9H 1P9MA 4J1UA 4LDEB 4LLDB 2C3GA 3IDIB 3HZVA 2Y1VA 3PWUA 3TN0D 2MPAL 3CFIC 5D1QD 1BBDL 3SO5A 4NKIL 1A2YA 4JVUA 1BQUA 5CBEB 1JTTA 1KCUH 1MFNA 4I18C 1I7UB 3FZUC 1JNLH 1OW0A 4G9FA 3WO4C 1AI1H 2H1PL 4NKDB 3RY5A 3BZ4A 2XYCA 3F7VB 4Y8AA 5CP7A 3PWJB 3I6LE 4Z0XA 3RNKA 2A9NH 2HMID 3A6OA 2V9RA 3ARFC 3OR7A 5FCUL 4BFEA 3MV01 4LLQA 4OD3L 4WCYL 4F58H 3PP4H 1MAKA 3LS5H 3GMNB 2VLKE 3S3JA 5I66A 1SM3H 5JUEH 4ZSOA 1D5XA 4PRID 4U0RB 3PWLA 1JGEA 2GFBB 3B9KA 4HZLA 1UWXH 4I2XA 3BZEB 4EUPH 3RU8H 5IHZA 2J1KA 3M1BB 2GJ6E 1G0DA 5CILL 1S7RB 1A7QL 4UOW1 5K9JL 1A6UH 1VCAA 4L8DA 3RVVC 3I3BA 3VRLF 3ULVH 3SCMD 5EU7C 4ZO7A 4LDOB 2I07B 4NKQB 1FO0L 2R4SL 1MPAL 3X12B 3REVA 5HJ3B 3VGGA 5DA4A 3GO1H 4JFXB 5F7UA 2E5EA 1KLUA 4OGYL 3Q1SH 3DI2B 4M5ZH 1MCCA 1LP9E 3D3VE 2E7CA 2RFXA 2EXWD 5EC2A 2NY3D 2M26A 1HHHB 1HE7A 4PD4K 3ES6A 4IJ3B 2A6KB 4FA8A 1H3GA 3BXNB 3OB0K 5K93A 2HT4C 3U0WL 3NCFB 2VZVA 5JPMA 4L4VA 1BD2E 1KCLA 3B8SA 2AEQH 2H2SC 4XXDB 5IB5A 4JO2H 1CGTA 1RZJL 3HE6C 1PLGL 2QSCH 1WITA 4F37K 4QHKI 3S3PA 4QYOA 1N7ML 4Y4HB 5AYUH 3SKOB 3G5ZA 3VGAB 1YN6B 4UNVA 1KJVA 1BJ8A 3PWPD 3BP6A 4YHML 3GHEH 1NFDF 3G5XA 3WIIL 5GS0D 3VXSE 5SWZB 3UTTE 4HIIA 1NQBA 5ESAA 4OCLC 5FO8B 3BQUA 1ODAA 5D7IB 3AUVA 4LL9A 4U7SA 1ROWA 1I8IA 4PJGE 1WWWX 5C0NC 1FC1A 1K4CB 1CI5A 2OM5A 1VB9A 4LRIC 3RA7L 1X5ZA 3MFGB 2Q7NA 1TXKA 5F7FA 1V05A 1CGSH 8FABB 4FFZH 1V5JA 2AP2A 3IDXH 5CMAB 4EUPB 5JDSA 4DQOL 43CAA 2XWTB 1SY6L 2J2ZA 4JEGB 4FQ2L 3WFZA 3LZFL 2HFEA 5C0GB 1AGCA 4KKLC 2P8MB 3OPZL 3AU1B 4E41D 2NTFB 3SO3B 3WIHL 3LEYL 4JCLA 1U36A 5I17B 4HWZB 5H2BB 5T1DL 4GW5A 2V5SA 3FMGH 4QCIB 2HTLD 4YE4H 3ZT6A 5T3XH 3IXTB 4JM2D 3IFPA 5CP3A 4QWWC 4PRAA 5HGHA 4JRXA 3VWKC 4FQHA 2BX5A 2GKIA 5FKPA 5HI5D 2ZNXA 3NIGF 4P23A 4QRQA 1E28A 4TULL 3RDTB 4XI5C 3O81A 4KI5E 4QXUH 5IKCB 3VRIB 2XQYK 5ESVA 2DI8A 3MNWA 2MWCA 3QDGE 3OG4B 3BSZL 4L8BB 3T0EC 4XNYL 5E1AB 4Y5YC 5MEPB 1I9RL 1LEGA 1A21A 2VDRH 4LIQL 2AEPH 4WFFD 1W8NA 4XCEB 5EBLB 1F6LL 2J3SA 3M8OH 2BY2A 5I8EB 4DK3A 4DOHB 5B22A 4KRLB 4OFYA 1NEZA 1FL5B 4HPOL 1MWAA 4YHKL 5I6XB 4JZNA 1ZHLB 4PRBA 3F8UB 4Y4FB 5DDHB 2AXGA 4F15B 2ATKB 2RGSA 4KUCD 4KU1A 5I30H 1BQHB 4PGDB 4OQ1A 1MRDH 5IK3A 4AEFA 3CZJA 1QLFB 2NY6B 4OIAA 4KY1H 1D5BB 2W9EH 1FP5A 4MLSA 1MCJA 2BCKB 3MUJA 1C1EL 4FFWC 1IARB 4IOFC 1P7KA 1QRNB 4YIQB 3EDKA 5HHQA 4LPWA 2DQUH 4I5BB 3MACH 2A1WL 1KPRB 1MVUB 4ELKB 5IOPB 3I6GB 5I1AB 1N64H 4WW1A 1CF8L 5F8RC 4I3SH 4MVBC 1OSPL 3CIQA 5FHAH 5GISL 3V0WL 4XAWL 1EEZA 1QSEA 3UJIL 2GJ6A 3GSNB 5J3HC 1OB1A 3W9DA 5HHPB 3VG0H 2CDFB 5E5RB 2R29H 1I7TB 1TZIB 4JM4L 2DYPB 4P2QE 3TV3H 5D1ZB 2JCCB 1YEDB 1A47A 1ETZA 1IC4H 3C08H 3E0GA 1A64A 3O11A 3BN9D 4X5XB 2VE6B 5IG7A 4RIRA 5I76B 1VGEL 2I60H 3EUUA 4OTXL 3S37H 4YO0A 1LP9A 1BZ7B 4EOWL 4O2CA 4HJ0C 1SMOA 2ZCKL 5C2BH 3MLPA 1P4LA 2Z0BA 3Q2CA 4JFOA 2X4PB 1FIGL 3U7YH 4J6RL 2B39A 2VLJE 4RBPH 5D1XC 3IFLL 3KPLB 2DD8L 3GBNL 4JDZA 1MH5A 5D2NA 4M7KH 1DLFH 1FJ1B 3QAZB 2BSSA 3VFUA 2VLRA 3DIFA 5GGTA 1WC7B 3GB7B 1S9WA 3LV3B 4NT6A 3IGAB 2C3VB 3V7AG 5SWZD 4NJ9H 4GBXB 1N5YL 4J4PD 4X6CB 5D7JD 2IFFH 5DD1H 4F2MB 2IAMB 1S9KC 5TDOA 4OZ4B 4U2YA 3VXSA 3UTTA 3V4VH 1YC7A 2VDQL 4PJBE 2EIEA 1CFSA 5L9DL 4M1GL 4LKCA 5EUKA 1RZKL 4IIQC 1JF6A 3ARBD 4N9GB 4Z95H 2EXYC 3BKYL 3QH3A 3VDCA 5CIPH 4NZRL 1ZSDA 4FFVD 4DKEH 4KZEH 2Q76B 2C3XA 4HKBB 1J9CT 1WT5A 5J12C 4XNUL 4FQXA 1JV5B 1AGEA 4ZXBA 2CPCA 1FL6B 4LSSH 3P9LA 3ULVD 3DURB 1FGNL 4KQ4L 1DBJL 1FNGA 5E9DE 5AEAA 2F5AL 4OZGB 3IDYC 4TVPE 1G1YA 2ZUSA 4PJDE 4OGXH 4P3CH 5DEFA 3RVUC 4GW1A 3GNML 3F7YB 3QXTA 4XT1C 3G6JB 5BMFH 1JN6A 4WVRA 4L8CA 2HJFB 4AY0A 4XNXL 2DQHL 1X7QB 2X1OA 5ENWB 4H5SB 3SJVB 3RDTD 1IAII 5I74C 4F7MA 1TNMA 4Z8FH 4JANA 1AIFB 1CG9A 3QUZC 1I8MA 3I9GH 4KKAC 4LRNH 1RZ7H 4LPCA 2VL5B 1CR9H 2Z91A 5E56A 1TIUA 4P2CG 1DBAH 1H3PH 4WWKD 5F6HJ 5E8EB 3FOMA 4ZODA 1BM3H 5JW4R 4WUUE 4IOIB 4U1GB 4L9DA 5GRJL 2Y07H 3QDGA 3QG7L 2VRAA 2W65B 1NMBL 1U8KB 2Z8VC 4D9LL 3FRUA 4H26B 1EXUB 1EHLH 5E6IA 5H37G 3TJEL 3BMVA 4U49A 1IGMH 2AJXH 3UTOA 3QDJE 4PJIE 4KJYA 4URTB 3LKOA 3QIWB 5D1XB 2OI9C 5EU7E 1AE6L 4UBDD 3QFJA 1OD9A 4UIKH 5C08D 1HKLH 4JRYE 4ONOA 2DWDA 2UUDH 4DWHA 1J0KA 1PKOA 1WSST 4Y4FD 1EVUA 4PJXF 2FYYB 3P11H 2P8LB 4U6VH 5HI4D 1IQWH 4GRLC 4YAQB 3QNZA 4ZUVA 3NPSC 2WZPD 5CIPB 1KLGA 2NY6D 2NY4C 3ZSTA 3INUH 4NQUA 3QPQD 1FAKT 4JGMA 2HJLA 1ZTXL 5IB3B 4MAYB 5M95B 3WE6A 1CU4H 4XMLL 1QRND 5LGJA 2VZ3A 4YHOL 3REWA 3Q5YA 4ODHL 2OP4L 1U8IA 3LKNA 5TQ0H 1U8HB 2H2PD 4QF1B 3WHE0 5GXBB 5F93C 4BELD 1OW0C 1NCCL 1EEQA 1F90H 2I9LA 2WBJD 1CE6B 1RY7B 4G43A 3DETD 4KMLB 3B5TA 1T2JA 1W0YT 1EEYA 3BDBA 1MCFA 1R3HB 2Y6SD 1P1ZA 4LCYA 4GMSL 1F6AB 1Z9SA 3TO4C 3CAFA 2Y25A 5MI0C 5DJ6A 1QLRB 4WEBH 5TH2B 3KLHD 3BH8A 2VL4A 1KIRB 4ESKA 2AS5M 3I50H 4F57H 1BZQK 2EE2A 1KBGH 4U6HA 3NABL 2FATL 1JGUH 1LO2L 4NDMA 5SWSD 1MHCA 2Q20A 4ZUWB 4KWUA 4JO4L 4LCUA 1YPZB 4DZBB 1V7NL 2W9LA 3QUXB 5D2LE 1CDJA 3LRHA 2VLJA 2D31A 3HB3C 2E6PA 1ZWIB 5H94A 4HHAB 3S36L 4GRWH 2WUCH 2RR3A 2A9ML 4R96B 3ET9F 1RUKL 1ZAGA 1JNHA 2P5EA 4O2FA 4XP6L 1NFKA 3PWVB 2IAMD 5GRUH 3BPLC 2PR4L 5CJQL 4AG4H 3ARDB 1A22B 4L8SC 2VLLB 4BZ1L 4RBPK 5KSAB 3L3GA 4PGBB 3T8XB 4P9HL 4S0TD 5IVXE 2EYRB 5D7KD 2VC2H 4ZTOH 3GJEA 4K07A 1B0RA 1C5CH 3SQOL 4BFGA 3MGAA 1KEGH 3HG1B 4E42B 1XIWA 2ICWJ 4PJBA 4O02L 1WQVT 2VDPH 5F21B 2BMKB 2OI9B 2UZIH 3NN8A 5DI8A 5HHNA 4NN6C 1PSKL 3S5LB 3HPLA 3ETBF 5EN2A 4UT7H 2YD7A 4J3UA 4F7EB 1SQ2N 1UWEH 4NUGL 5HVHC 3MGOB 1AQKL 2CIIA 1QFPA 5C09B 2DLTA 3RIFF 1FZKB 3SKUD 1HIMH 2Z9TA 4JQIL 3HZVB 2E7HA 3PWUB 4J3VA 4LFHD 4WV1C 2WK2A 1A2YB 4BM7A 3EYFA 4G6FB 4PJDA 4XP5H 4OFPA 2LAGB 4I0PC 4LSPL 4Y8DC 1F4XL 2J4WL 1TTGA 3O6ML 2BRQA 4G9FB 3MRIA 2XICA 1XGUA 3S3SA 3TO2A 4ZD3L 1T21A 3BZ4B 2B2XH 2NTSP 1A5FL 3MOQA 4YDIL 4Z9KB 3U79A 4PTUA 1CIUA 4ONFL 4Z0XB 3RNKB 5IM7A 5TPWL 4U7KA 4M8QA 3OR7B 1SJHA 4LLQB 2EO1A 2N4IA 5LBSH 2IQ9L 1MJ7H 5HVGB 4NGHH 3W5MA 5I66B 4HCRH 4TNWF 2ADIB 4ZSOB 1D5XB 4U6TA 5I1DA 2HFGH 2SEBA 4WUUA 1HINL 4ODBD 1JGEB 1Z6JT 3B9KB 4HZLB 5ACZA 4OAWA 4G42A 5IHZB 3G9AB 5FM5M 2VTFA 3QIWD 1UGNA 2F19H 3QDJA 4CN1A 5JPNA 4JPKH 2HN7A 2XA8H 4L8DB 2IQAA 4RMUA 3HAEG 1GVIA 3WKML 1IC7L 4XC1H 2IWGA 5CAYB 1GZPA 4ODVH 3TVMC 4LCCC 3ALWA 3REVB 3MOAH 4KTDH 2LU7A 4JRYA 1KLUB 1H8OA 1NGYA 4O9HH 3VE0A 4X9GA 5KZCB 2RFXB 4OGZA 4K9EL 5EC2B 4R2GD 2IMNA 3I3EA 4HIEA 1MIML 4RWYH 1B0WA 3ES6B 4MAYD 1D9KA 2JIXA 3LQMA 2AJYL 3CFBA 1JGLL 4TSAL 2D7QA 5JR1H 1JYVA 1I1FA 5T5NF 2OYPA 2VJXA 5JPMB 4L4VB 4OFIA 3B3IA 3LS4L 5J57B 1RUPL 5IB5B 1NCBH 4PJFE 4P57A 4QYOB 4RSVA 3G5ZB 5MHSD 2YA1A 1KJVB 4F8QA 3KHOA 1XF4A 5H35A 3DLQR 3G5XB 2QSQA 3IAQA 3MNZA 2IFGA 4XTRC 4MXWH 1OGAE 4HIIB 5ESAB 3DMMC 1JPSH 3U7WL 3BQUB 4YHNA 1CFVL 4BQBA 4K8RH 4QRPA 4HULB 4X4XA 3I2CH 3ULSA 1I8IB 4NQDB 5JOFA 3MMEA 1ZKAA 1MWAH 4QRRE 2AABL 3TC9A 1NCDL 2IJ0C 3DXAE 4M43H 4XP1H 2YXMA 5CCKH 2CRZA 4L5FL 2CIKA 1Q9LB 4OIIH 2GT9A 2IBZX 3OL2A 4ONGL 1WCBB 3ARED 2NY2B 3D18A 5JDSB 2AQ3A 3VFRA 43CAB 4Y19A 4GS7C 1JPTH 5C0IA 3IJYA 5D2LA 2HFEB 4HUWA 4Y89A 1AGCB 1I9IH 2E3VA 3OKNA 5HYSA 5ITBL 1CWVA 4BSVA 1KCRL 4XVSH 1AR1D 2BOBA 1RSFA 3TIEA 3QFDA 3ARDD 3OR6A 4PJHF 4GW5B 4OI9A 5L7XH 5KSAD 1CD8A 5SV3A 1M6OA 3IFPB 3LHPL 4PRAB 5HGHB 1QR1A 3ARWA 4JRXB 4FQHB 4JB9H 4M03A 5FKPB 5IVXA 4ZPVA 4LDLB 4N90D 4PBXA 5D72H 1MJJA 1M05A 4P23B 4QRQB 1CXEA 1E28B 4MNHA 1KCUL 1EGJA 2DLEA 1K8DA 4W70A 4XVUC 2OTUA 5DT1H 5ESVB 1JNLL 3NCBB 3MNWB 3K80A 3G04A 4X6BA 1AI1L 5EORL 5I9QB 1YMMA 3KS0H 3HZKA 2A9NL 2XY1A 1LEGB 2IG2H 2AJ3A 3VFGH 4HGKC 1I4FA 4F58L 3MJ7A 1HHJA 2R15A 4HH8A 2PYEE 2OJZH 3LS5L 4IRSD 2VR5A 4LLYA 4AEIH 4CAGA 5HI3C 5JUEL 1UACH 2OR8A 2X1WL 3MJ6A 1NEZB 4XPBH 4OZFG 1MHPH 1MWAB 2J8UA 5C3LD 4G9FD 1H3TA 4JZNB 1WT5C 5CD5D 4PRBB 5CLWA 5D5MF 4YBQC 4K3EH 2AXGB 3SOBH 4MNGE 2DI7A 1A6UL 1LILA 2H9GA 1FFNA 3ULVL 3DOSA 5GJTH 5IK3B 5M7QA 5F6IC 1CQKA 4H20H 1WBYA 4GKZA 1HWHB 4PJEE 1Q0YH 3GO1L 4XVTH 2Y36H 4M5ZL 1P7KB 4D2NA 5HYJE 4MQXC 2GJJA 5HHQB 4WI3A 4F37F 5TJWK 3N1MC 4JM2F 4L4TD 3U7AA 1DUYA 4RAUB 2IMMA 2AGJH 4WW1B 3J7HA 2MOVA 4OZHA 5IROC 4LBEA 1GGTA 4IRJC 4FZ8H 5TF1H 1EEZB 1L6ZA 1QSEB 2GJ6B 2IBGA 4NKMA 1OB1B 3U9UA 3W9DB 1S9XB 3CDGA 4WI8A 4ZS7L 3IVKA 4JO2L 3LD8C 2QSCL 1MCPH 3P77A 1NUNB 4JY6A 4W4OA 4TOYH 3FQRA 4K3HA 5AYUL 3RTQC 2VAJA 4NM8H 2EE3A 1GJIA 1ETZB 2GEEA 3MRQA 3O11B 4Y1AA 3GHEL 5IG7B 4RIRB 4W6WB 1KTRL 3MRCA 4YO0B 1T83A 1LP9B 4U1MA 3RX5A 1ACYL 4O2CB 5HYQB 4NCC1 4ZNEA 3WNMA 4YC2C 1BMGA 1P4LB 5IVOA 4HAGA 3IAGC 3WUWA 4JFOB 5E95B 2MCPH 1CBVH 3S36X 3VWJC 2W59A 4M7ZB 2XKNA 4HFWA 4JN2A 3UZEA 3LDBC 5T5NG 2KZ1B 3EOTL 4Z5RA 3W11D 5HXMA 4JDZB 1MH5B 5D2NB 4I8DA 1KJMA 5HD8D 4OF3A 2O26U 2YK1H 1A6VH 2BSSB 3THMH 4U7MA 4HUMB 3VFUB 2VLRB 3DIFB 5ACLA 1QLEH 3MV7E 5MENA 1S9WB 1CGSL 4I48A 4NT6B 4FFZL 4MWFA 3IDXL 3QNYA 4KUCF 1GAFH 5FUZH 2Y5EA 2ZJSH 3QQNA 4RMQA 4XC3H 3BQUD 4Y5XC 5TDOB 3SGEH 1TJHH 4N68A 3QPXL 3L95A 3VXSB 2ESVE 2VZOA 4MGXA 2ZUYA 4M4PA 3RVXD 2BDNH 3QI9C 5DK0A 5ANME 1SYSA 1OGAA 4HK3N 4NQDD 5GPRA 3UTTB 1LO4H 1AXIB 3TESA 3VXUE 1XT5A 4N0UE 3CFEA 5KN5A 1CFSB 3C5ZA 1F4YH 2LTQB 4LKCB 3G08A 4PJGB 5EUKB 4BKLA 1J1XH 4ERSH 1RUMH 4JG1H 1GC1H 4YE4L 3I75A 2J6EL 3QH3B 5T3XL 4HKZA 4R9HA 2VQ1B 1ZSDB 3CVIL 4LSDA 4FQXB 3HMXH 4KDWA 4PV8B 5BS0E 5BV7C 2V2XA 1S5IH 2LAAA 4LVOC 2EH7L 1W2KT 4F7PA 1AGEB 3CLFH 4OLEA 4ZXBB 3V4UH 3P9LB 4OSUH 4QXUL 4R97C 1FNGB 4ACPA 1JVKA 1YEGL 2YRZA 3CFDA 3DYMA 5DEFB 1P7HL 4GW1B 4XCCH 3K4DA 5EU6A 3IU4H 5EOQH 1FNAA 1JN6B 2WBWB 1HHKA 4L8CB 2DS4A 1SEQH 4JRXD 5F6HI 3NFPA 2VDRL 5EU5A 2AEPL 3MRJA 4FXGA 3FO1A 1JWMA 2Q8BH 5KG9A 4F7MB 3M8OL 4JANB 1CG9B 1I8MB 1U3HC 5HDQH 3ARGA 2X09A 2Z91B 1KC5H 2FLBT 3QRGL 5I8OH 3FOMB 1KNOA 3ZE2E 2VISB 1QBLH 1AJ7H 3QDGB 5A3ID 5D7IF 1LWRA 1MFEH 1RIVL 3FRUB 1MRDL 5E6IB 4W6XB 1LDSA 4KY1L 2HA1A 4KJYB 3LKOB 4H88H 2MFNA 3NOIA 4K8RD 3SN6N 3H3PH 2H3NA 1OL0A 5B8CC 1WVZA 4YDVA 3KJ6H 2PYEA 3OAZH 1YECH 4S2SA 3QFJB 2JJWA 2DQUL 1UB5A 3MACL 2DWDB 4LEXL 3QSKB 1QPXA 1PG7H 1Y6NR 1N64L 4I3SL 5FHAL 3QNZB 5E1HB 2BOCA 4ZUVB 5E2UH 3L7FA 1KLGB 3LN4A 3VG0L 3I6LD 5GSRA 3GMOA 3QWRA 2R29L 5ILTH 2HJLB 5DGQA 3WE6B 1UZ6E 4M9OA 4QTHA 3NGBC 4KXZH 3D85A 4OJFH 4PJEA 1IC4L 2VLKD 3C08L 5LGJB 4GG8A 2I60L 3MJGX 4JN1H 3REWB 3GKWH 4HGWA 3S37L 5K9KA 3EHBD 1U8IB 2H26A 1M4KA 5DRNA 5C2BL 1B2WH 1EH9A 2O61A 5HBBA 4LGPB 2GJ6D 3JTSA 2R2CA 1YYMH 3U7YL 4JFDA 4G6JH 4G43B 4L1DA 4NFCA 2E6QA 4YX2H 4K3JL 1EEYB 3S98A 4M7KL 1P1ZB 4LCYB 4LVNB 1MNUH 1DLFL 2XQBH 4TVPH 5IWLA 1TQBB 3DYPA 4R97B 5DJ6B 5EWIL 1T89A 1G6RH 3BH8B 1L9MA 4M6MH 4NJ9L 1MCDA 3D3VD 4U6HB 4HQQH 5DD1L 3QIUD 4PP1D 2ZG3A 1CDHA 4NDMB 3PXJA 1MHCB 1CIDA 1RPQA 3V4VL 4WDIB 1ZOXA 3X11B 2GYSA 4GJTB 4LCUB 4J3XA 5ECJE 3S9DB 2B1AH 3BEVA 3DYOA 3HNTH 4Q6IA 4X6FA 2VLJB 2D31B 1BD2D 1FCGA 3EIFA 5IW3A 4Z95L 5H94B 2XG5A 1U58A 1N5AA 1JHKL 4DKEL 1QO3A 2XZCH 4KZEL 1JNHB 1T0MA 4OGAD 2P5EB 1BGXL 5E8NA 3VFNA 3VXSD 4J8RB 2PETA 4XPAL 3UTTD 4Z77A 5GGSY 3L3GB 5IW1A 4LSSL 1X5KA 2ARJA 1U3JA 2J8OA 4HC1A 2W9DL 3LEXA 5ANMA 1ZHNA 4OV5A 3GJEB 5F9DC 1B0RB 3RX7A 4OGXL 1XIWB 4P3CL 4PJBB 4MYWB 5E2WH 4W4NA 3NN8B 1MHHA 5DI8B 5BMFL 5HHNB 3IS1X 2XQYG 2R69H 5D96C 3BIAX 3HPLB 4KHTH 5EN2B 1ZLVK 5DWUH 5HYFA 1CTNA 2UWEA 4ZXBD 4Z8FL 2VR9A 2CIIB 5F7WC 5BS0A 3N1PC 3TBTA 1QBBA 2JCCF 3I9GL 4LRNL 5GGRY 5AZEH 5B21A 1MJ8L 1RZ7L 1CR9L 1CD1A 1BWWA 1H0DA 4P3DA 1DBAL 4KHXL 3HC4H 3O3BA 1BM3L 4IDJH 2Y07L 5DR5H 5JIHA 3EYFB 4PJDB 3BIKB 3BPOC 2KDGA 3MRHA 2BVOA 2DMKA 1EHLL 3NAAH 1MRFH 1IGML 2AJXL 2J12B 1R5IB 3MRIB 1XGUB 5DSCA 3PQYA 3TO2B 1NEUA 2RHEA 1T21B 2RAMA 2W0FA 2JJTC 4PTUB 3BDYH 2E8YA 1AC6A 4BZYA 5IM7B 4M8QB 1SJHB 1GPOH 1HKLL 4KI5D 2C4FT 4NZUH 3P11L 2OCFD 1DEEA 3BD5A 4X6CF 4U6VL 3QDGD 5I1DB 1WCQA 2G5RA 4NM4H 5E6ID 2SEBB 4WUUB 3FQNA 1OAZH 5ACZB 1CCZA 3INUL 4OAWB 4G42B 3PNWA 1QQDA 4WUKH 1ITCA 3MLZH 4JZJC 3C6LC 5CGTA 3TFKD 5F9OH 4Y16A 1L7TH 1EZVX 4L4JA 5EPMA 1JCKA 3QDJB 5JPNB 2ZUTA 2HN7B 3MCG1 2IQAB 5F9WB 5AZ2H 4FQIH 2OZ4A 3DV4A 1GZPB 3C2SA 2VSDA 5TQ0L 2R1XA 1S7SA 4KQ3H 3O4LE 2F53E 3FQWA 5INCA 1F90L 4UOJA 4JRYB 2YSSA 4ZOAA 4P5KA 1NGYB 3VXRE 3BT2H 3VE0B 4EUPG 4NPYA 4NC1C 4XWOD 4HIEB 4OZGF 1D9KB 2DTSA 2JIXB 3BMWA 3QHFH 3CFBB 1Z2KA 4WHCA 1I1FB 4WEBL 4YDKH 1VACA 3B43A 2NXYD 3G6JF 3I50L 1CDIA 4F57L 2EH8H 1MFDH 3B3IB 1KBGL 1FDLH 4Y5VC 4P57B 3A0OA 1YQVH 3MCLH 2MKLC 4NUJA 4KRNA 5HSFA 5L6YH 4XVJL 1XF4B 5H35B 2YA2A 1J12A 2NMSA 3MNZB 2NNAA 2W1NA 3SGJC 2FJFA 3GRWA 4C55A 4PP2A 5ALCL 4YHNB 2HT2D 4D8PA 4QRPB 4K23H 3ULSB 4P2QD 3AB0B 1C16A 2WUCL 5JOFB 2HTKC 3MMEB 1J8HE 1NFDA 4FTVA 5EB9A 2EIDA 1JHTA 4XBGA 4B7LA 4AG4L 3RGVB 2CIKB 4P49A 3WKNA 2GT9B 3MUZ1 1HZHH 5IGXH 3CFKA 1VEPA 4CN6A 4ZTOL 3D18B 2VLJD 5JTWA 3KYMA 2XNAA 1WAAF 3BAEH 4PLKD 3U1SH 2YOCA 3VFRB 4Y19B 2VDPL 1UJ3C 1JMZA 5C0IB 1WIOA 3IJYB 5D2LB 1JRHH 4HUWB 3V5DA 1JTOA 3OKNB 4YBLB 5HYSB 1EIBA 4BSVB 4NN5C 4NZJA 2BOBB 2VIRA 4HK0A 5I75B 2HLFC 4UT7L 4KVNH 3TIEB 3QFDB 3LOWA 3OR6B 1UWEL 1BQHG 5DMJB 4P59H 1FNLA 1HDMA 4QRSA 1M6OB 3MBEC 1FYHB 1KIUA 3L9RA 4KK5D 1QR1B 1HIML 1S3KH 4YQXH 3KPNA 1LK3H 1XIWD 4YJZL 5IVXB 2CKBH 4ZPVB 3E8UH 2BVQA 1MJJB 4LCWE 5DZOA 4MNHB 4ZQKA 3P0VL 3CMOL 1K8DB 4KDTA 4IHOA 2OTUB 4LPXA 3K8LA 1XH3A 1WJ3A 1OY3B 3OG6B 2P24A 3G04B 1BVLA 2NR6C 4X6BB 1VEOA 5JW3H 1YMMB 2B2XL 4MA7H 1PBYA 3W2DH 3HZKB 1E4KC 3OV6A 4F3FA 3SGKC 2AJ3B 2I25N 5E9DD 1I4FB 1DBBH 1BAFH 1HHJB 3MJ7B 5LBSL 4DUWA 4Y4KA 1MJ7L 4TVPD 2VOTA 4LLYB 3GEWB 4HCRL 2F15A 1JFQH 2EICA 5A40E 3PF2A 3LQAL 2J8UB 5E03A 1Z9OA 4X5LA 4D9QE 4JO1L 3NA9H 3QQ9D 4N9OB 3NIDE 3MRBA 3PV7A 2XA8L 2H9GB 1FFNB 4JPKL 4JREC 5T1KD 5TDNA 3ZE0E 2CXGA 5I1EH 4XAKE 4XC1L 4Q9QH 3ARFD 1WBYB 4K7PX 4GKZB 4ODVL 2C26A 4CKVX 4ZMAT 3MOAL 1FH5H 4KTDL 1P2CA 1G7IA 1PKQA 3L7EA 3RWHA 3DARA 4O9HL 1NPUA 4WUUD 1HNFA 1WWCA 3VXME 4TUJA 2NYYC 1TITA 3PGFH 1DUYB 4GKOA 4FQ1L 2NQCA 1JZ7A 4OZHB 4PJ9C 4LBEB 3SBWC 5IP4A 3QDJD 3KPSE 1DL7H 5JZ7D 4ORGA 5JR1L 1AR2A 2WWKT 4NKMB 4M7LT 3T1FA 3U9UB 3MV9A 5K59F 3CDGB 3IVKB 1XF1A 1NCBL 3P77B 4JRYD 1KLFA 4JY6B 3FQRB 3VDAA 1P69B 3GHBL 1X4YA 2VABA 3MRQB 4JKMA 3O4LA 4Y1AB 5KANG 1JPGA 2R0WH 3MRCB 1E4JA 4MXWL 4U1MB 4RDQF 1JPSL 3LQZA 4D0CA 2F74A 4K8RL 3ROOA 3I2CL 3WUWB 1LO3H 4WO4C 5ICZB 4KDVA 2XKNB 4HFWB 1FO0A 4JN2B 4P4KA 3MO1A 5JXEA 3O8XA 2H2SD 4Z5RB 5BVJA 1KJMB 2FHBA 5KVMC 4M43L 4XP1L 2AJUH 1I1AA 5CCKL 4W6YB 3AY4C 1A6PA 3NH7L 1P4IH 1XF3A 4CU7A 1BHGA 5MENB 4OIIL 3MPCA 2ZUWA 4I48B 3ZE1F 4MWFB 2Q1EA 3QNYB 3KPTA 2DM3A 2BVUA 5DUMH 3V52H 1YEEH 1F45A 2AV1A 3L95B 3NCCB 3RIAK 5DK0B 1SYSB 1OGAB 4A6YH 1N8ZA 1I9IL 3CFEB 5KN5B 3RZCC 1XCTA 5C0ND 3C5ZB 4XVSL 4P2OA 3G08B 3VFOA 2APTA 3RVWC 3ARPA 4BKLB 2ZP0T 3RGVD 3EYOA 1J8HA 3I75B 1HI6A 3QCTL 5L7XL 3CZFA 1EFQA 2DL2A 4HKZB 3PL6C 2OS7A 1FPTH 2BVTA 2WSKA 4POZC 4JQXC 5J9PA 3CH8A 4JB9L 3UPCA 1SMAA 2EDWA 3QYCA 4M00A 2V2XB 4U1IA 5D72L 4OZIE 5FA4A 2DAVA 4UT9L 3S96A 1OP3H 4F7PB 5K9OA 3CSGA 1J8KA 3WUZA 5IWLC 4LHUD 4L1HA 4K7FA 3OGOE 4MDJA 5CS7A 1UH2A 3CFDB 1G6VK 4PYGA 1WV7T 3TZVA 5J13C 1MQKH 1JGDA 2Z8WC 3DO7A 5SV4A 1HHKB 2NY7H 4PS4H 1G7LA 5K9QG 2BC4A 3VG9C 1SY6A 2IG2L 5EU5B 3MRJB 1G9ML 4UMGA 3VFGL 4FXGB 4Q0XL 3FO1B 4MSWA 2ADJA 1JWMB 5EC1A 2D7MA 5KG9B 3WIHA 3DX8A 4S1QH 4JKLA 1UACL 3ARGB 4XPBL 1MHPL 4Q2ZA 3MQIA 3V8OA 4NQEE 3ZYIA 2JB6A 1PD6A 3P73B 4DGYH 3B9AA 1IEHA 1KNOB 4K3EL 3SOBL 3EFFA 4RA3A 3ZL4H 1F3RB 5EZLA 5GJTL 3MV11 1DVFA 5FGCE 4OUOA 1Q0YL 5J8OA 4XVTL 4J12A 1QTYT 2H3NB 4YDVB 2C1PA 3MRPA 2PYEB 5DRXA 4S2SB 1QKZL 3GBMH 1UB5B 4O00A 4QHUA 2OTWB 4BJLA 2DLGA 4P5TC 2AGJL 3KS0J 5GIRA 3UMTA 5DUPH 1JHLH 1GCFA 4K3GA 4Z76A 2WWKO 2BOCB 4FZ8L 5TF1L 4NHCH 5E8OA 3L7FB 4C54A 2YKLH 4NWTH 1T2XA 2QHLA 4LHJB 3O6FC 3LN4B 5I71B 1NCAH 1Y0LA 5GSRB 3GMOB 3RWFA 4GOSA 2DB8A 4I1NB 3W82A 5L8LB 1I3RA 1MCPL 1OWRM 4TOYL 5T3ZH 5I1CH 4QTHB 4FFWD 3D85B 4PJEB 1AKJA 5E00A 3VU2A 4GG8B 5JXAH 4HK3J 4WW2F 1VFMA 4RRPG 5K9KB 4HGWB 2FGZA 1NMCB 3MC0A 1T3FA 1ZMYA 4WI6A 3CC5A 4MQSB 1ZA3A 1IKFL 2H26B 3BKCH 5DRNB 4WI5A 3VXMA 5HYJB 4CNIA 3DVGA 15C8H 5F89A 4D0DA 2O61B 2W92A 1AC0A 1CBVL 3JTSB 5BJTA 5J3HD 4JFDB 4OM0L 4ZFZA 3KPSA 2D7PA 4J3WA 4IMKC 1CXIA 2VWEC 3ZDZE 4LSTL 1A6VL 3THML 1HQRA 1X5YA 3S5LG 1QLEL 2KPNA 1CICA 1NAML 3S88H 1DUZA 3SDCC 1GAFL 5FUZL 5ITFA 3Q5TA 4XC3L 3NTCH 1EK3A 1HNGA 1TDQA 3L5HA 1TJHL 3H9SE 5DJ8A 1ULVA 2UVFA 2BDNL 4RDQG 5A2FA 3D5OF 1LO4L 3GIZH 4RMWA 2QQLH 4MA1C 4BYHA 3BEVB 1PW3A 2R9HC 1TJGH 4Q6IB 4X6FB 1J1XL 1NCTA 4ERSL 1RUML 3W0WE 3AS3A 4JG1L 4LK4A 5TF0A 2WQ8A 4CN4A 1BIHA 1GC1L 1YEKH 2Z35A 3H3BC 1U58B 1N5AB 1QO3B 2BSRA 2X9YA 1T0MB 3ARUA 4F9PA 5E8NB 3BUYA 2ERJB 4KRPC 4PJ8A 5I1JH 1SEBA 3HMXL 3WN5C 1R5VA 3IF1A 4V1DE 3G9VA 3UJJH 1EO5A 4KROB 1OGAD 3HNVH 1CFTA 1RZFH 3CLFL 3SDAA 5IW1B 1CZ8H 3V4UL 4OI7A 4OSUL 2ARJB 3K3QA 2ESVB 3C5ZD 3OBAA 4GW4A 2FL5A 3LEXB 5ANMB 5EOTA 1ZHNB 2OZ4H 2AQ1A 1WICA 4OV5B 2B5IB 2EEDA 3RWIA 3JV4A 4QHNA 4QRRD 3KLAA 1FV1A 4XCCL 3DXAD 3OXSA 1MHHB 3IU4L 5EOQL 3BO8A 3FO9A 1SEQL 3IJHA 2G2RB 4MA3A 5K9QI 4G9DA 2Q8BL 2UWEB 3JZ7A 3TA3A 2YD6A 2NCMA 2CH8A 5BS0B 5HDQL 4K94C 3TBTB 4OZIA 1QPPA 2WUBH 4NWUH 1CD1B 1H0DB 4P3DB 5I8OL 4Z7VE 1MAML 3MRGA 3ILQD 3ZHKA 3O3BB 1FZOA 1LP9F 2NPLX 1R3JA 5KSBE 3LB6C 3KPRE 4AIOA 1QBLL 4G8GE 1AJ7L 3A6CH 3MRHB 1MFEL 2BVOB 3I02A 1QBMH 1X5AA 2V2WA 2DKSA 1LGVA 4HGMA 2BXYA 3GRWH 5DSCB 1SVZA 4H88L 4BZ2H 4JDVA 3H3PL 4LSVH 4R6UA 2GY7B 5E4EC 2W0FB 4UB0H 3ARGD 4AT6A 2X70A 1EEUA 1YECL 2JK5A 1SVCP 1MJUH 3OKLA 1PG7L 2APBA 3NZHH 1DEEB 4HJGA 1P53A 2NZIA 4XCFL 3MRRA 5D6DA 1Y6MR 3MRFA 3FQNB 3A6BH 3PNWB 1QQDB 5F7LB 5ILTL 5GS1C 2DLIA 4QRTA 1LNUA 5EOCH 2APVA 4Y16B 2ED8A 1WIPA 4PJGF 1BVZA 3BDXA 4OF0A 4TPRH 5EPMB 2PYED 4OJFL 3G6DH 4JHZA 4Q9CA 1XZ0A 4JN1L 3GKWL 3DV4B 4KDTC 2XZAL 2V9TA 3F5WA 2R1XB 5DFVC 1S7SB 3VXNA 4FXLA 5C6PB 2J5LB 1B2WL 3FQWB 5INCB 1OT1A 4KKCD 4MNQE 5IHUH 1U91A 2YSSB 1E27A 1DEDA 4P5KB 2BY3A 3K1DA 4X4ME 1T1XA 1YYML 1RIUH 3E1F1 4RGNE 5FM4A 4G6JL 2ITDA 3QWRD 4NPYB 4X4YA 4YX2L 9CGTA 2AKRA 3WIFA 2N1KA 3C09B 3PDOA 1MNUL 2XQBL 4TVPL 3D85D 3PJSA 4Y4KC 5IJVA 1QD0A 1OTSC 5EZJA 2CK0H 1VACB 2LFGA 1G6RL 4I13B 1V3JA 4GT7A 4M6ML 1IZKA 5HYJD 2FB4L 5DO2D 2PXYA 3RPIA 3MA7A 5L2JA 3MOBH 4GKNA 4NUJB 1XF5A 3O3EA 4HW6A 3ISWA 4M3KB 3S7GA 2X4RA 5J6HA 4ENEC 5D1QA 1H8NA 2B1AL 1JMXA 2NNAB 3HNTL 3DV6A 4RWHA 2FJFB 1T04A 3EYSH 4RISL 5JQ6H 3E2HB 3WDHA 4KJPD 4C4KO 2P43B 1VA9A 3BEWA 4PP2B 3TO4D 4D8PB 4KI5F 4H8WC 2X4TA 1NGQH 1X5FA 3STLA 2XZCL 2BHYA 4RMSA 1VEMA 4PBWD 1YA5A 2VYRE 1ND0A 4FTVB 4M3JA 1JHTB 4HAFA 4XBGB 3C60C 2VKWA 2AK4E 4XMKH 3SDDA 2G60L 1KGCE 4M9PA 3MLXH 3CFKB 5EBWB 4RAHA 5DMGC 4YK4C 4HDIA 3KYMB 2XNAB 1FNHA 3HB3D 3BH9A 1NEZG 5E2WL 1G1CA 2RJMA 3V5DB 5GZOD 5JW4N 1Y6KR 3W0WA 5DTFA 1NKOA 3DVFA 3TM6A 2R69L 2VIRB 3MV7D 4HK0B 4KHTL 5DWUL 4OLUH 4M1DL 4OCXH 2L4OA 4XCYA 2H6PA 3SCMA 3WJLA 1HDMB 1U8PA 4QRSB 1NFIA 4OD3H 2ESVD 3NACH 5J4MA 3P0YH 5DJDA 5AZEL 3L9RB 3AS2A 2LVEA 1FFOA 3C9NA 3KPNB 3VXUD 2Z31A 4EI5D 3HC4L 2BVQB 3N1QC 3RZWA 5DR5L 4PJHA 4ZQKB 4OBSA 4IHOB 3NAAL 1MRFL 1I1CA 1XH3B 2FRGP 5C1MB 2P24B 2XOTA 1BVLB 2XTJC 4HS8H 4ZAKD 1IRAY 5ICXA 3D39E 5BS0D 1UM4H 3D9AH 4I9WE 4WWID 3BDYL 1S78D 2DJSA 2VQTA 4RFEA 1RZJC 4F3FB 1GPOL 3MCKA 3OJ2C 5F7MC 4PJAE 2HT3D 4NZUL 4Y4KB 5IEKA 2G75B 3PWPA 3SGDH 2AXJA 1H5BA 3E3QC 7FABH 3ORJA 1INQA 4I0PD 3ZKNC 4NM4L 5IR1A 3Q6GH 3T0XA 1AD0A 1OAZL 4UUJA 5FFLA 4WUKL 3DHJA 4XP9L 3MLZL 2V6HA 3U0WH 1FSKB 4DJMA 2NZ9C 3MRBB 5TDNB 2GSIA 4WI2A 5FUCC 2EYTA 4KKBC 3WL9A 4TYUA 1Q0XH 2E27H 4WENB 3ZMRA 1T7YA 3D0VA 3MXWH 3JWDC 5FDYA 4KQ3L 1B9ZA 4OCNC 5EO0A 2NY5H 1P2CB 1G7IB 5D9SA 1PKQB 3L7EB 3ME0A 3RWHB 2R39A 2GCYA 4XMPH 3AFLA 1J18A 3GSUA 3NZ8A 1INDH 1EO8H 4TUJB 2FX9H 1QFWL 2LU3A 4G7VH 2VDMH 3AROA 1QFUH 4Y16D 2VN7A 5BV7H 3QHFL 2CMRH 3CGTA 5HHOE 4PJBF 4ORGB 5DC0A 4YDKL 1U8NA 1CDGA 1TQCC 5A1AA 5B39A 4YK4B 3T1FB 3P4LA 3MV9B 3RA7H 2VWEE 1A9BA 1IVLA 2EH8L 3DPBA 1MFDL 3O2WH 4QGYA 4EDWH 1KYOK 2XI9A 2FZ3A 1RJCA 4DVRH 5DJXA 1YQVL 3QCUH 3MCLL 4JM2A 4DUXA 1QRKA 1FG9C 4XNZB 4QXGH 2VABB 1BP3B 3O4LB 1JPGB 3MLYL 1F4WH 3R8QA 2D0GA 1JZ4A 1A1NA 3WV0A 3LQZB 4D0CB 3F6IA 5JW5A 4P48A 2F74B 1CLYH 3ROOB 3EO1A 4K23L 1MELA 3WDJA 1AQDA 1FO0B 4P4KB 3MO1B 4AENA 4PJDF 4RMVA 3O8XB 5BVJB 4OFVA 4C56E 4M1CD 1UADC 1I1AB 2DQFA 1XF3B 2GSGA 1HZHL 2R4RH 2W07A 4HG4K 5IGXL 5B38G 1GGYA 3EDEA 3I6KA 6FABH 4CMHB 3BAEL 3DMMD 2AV1B 2R56H 2VB5A 3STZA 1JRHL 1N8ZB 3SE4A 2GHWB 3GGWA 4Z7QE 2EKJA 1XCTB 1IBGH 4P2OB 3VFOB 1FLTX 2XFXA 4GQ9L 5L0QB 4RFOH 3EYOB 1J8HB 1WFUA 4P59L 1CE1L 5K33A 3CZFB 1HEZA 3H8NA 1OTTC 4LPTA 2YRLA 4A2MA 2AK4A 3WNLA 5J9PB 1S3KL 4YQXL 4RMRA 3ZHLA 1LK3L 3RUGE 2D9CA 5CZXC 2IPKA 2CKBL 2VXTL 1R6VA 3E8UL 5FA4B 3S96B 2ADGA 5K9OB 5BCAA 3U83A 3V7AE 3TYGH 5T3XE 3O3UN 1YNKH 4K7FB 4MDJB 4X6DE 3V4PH 2YPLE 3ESUF 3TZVB 3ZYOA 1F2QA 5JW3L 1JGDB 3HNSH 4MA7L 4CVZA 3DO7B 2BVEA 5FHBH 3WLWC 1KPUA 3W2DL 1G7LB 1A3RL 4Q58C 4UILH 2BC4B 3KYOA 4MSWB 1BAFL 1D5IH 3BRFA 3OKDA 2ADJB 3V6ZA 5EC1B 1BFSA 3NVQA 3QO1A 3DX8B 1JFQL 3ELAT 5CJ8A 2RIKA 4G3YH 3DUHA 4GXUN 3NCMA 5AAMA 2JB6B 3IETA 3U4EA 1PQZB 3V0WH 1KXTB 3BPNB 3NA9L 3MLRH 3G5YA 5FO7A 3BRDA 3O2VH 2R1YA 3EFFB 3IAPA 1A1OA 5EZLB 1BEYL 1WZLA 5I1EL 2CRYA 1XGYL 3D39A 2VDOL 1DVFB 1YN6A 1Q9OA 2K9UA 1R3LA 1HQ4A 3HCVA 1WGOA 2X9XA 3BGFB 1FH5L 1CDCA 4G8FA 1IGFH 3HE7C 4WFEE 4M6OH 4EOWH 2C1PB 3MRPB 4J4PA 5DRXB 5D7JA 3EFDL 3PGFL 2QKIA 2EZ0C 4QHUB 1AO7E 3GZKA 4TRPH 5JLZA 4J6RH 5EULV 4QHKJ 5GIRB 4LOUC 4YBQD 5F1SA 1DL7L 4Z76B 3O9WC 1PVHA 5E8OB 1BF8A 3PG2A 3TPUA 5KS9E 5D2LF 2G9HA 1Y0LB 2DLFH 5GGUA 3RWFB 2A77H 2PTTA 3ARBA 5KSVA 1I3RB 1OGTA 2UVEA 3MX0A 4MXQC 1ZT7A 5B4MD 4TTDC 1IGIL 5DQDH 1AKJB 5FGBC 5E00B 4MJ4A 3DUUA 4PFEA 2R0WL 1C7TA 1KULA 1VFAA 1T3FB 3CC5B 1ZA3B 2CKNA 3T0BA 3VXMB 4CNIB 3DVGB 5F89B 4D0DB 5IVXF 2KBGA 4U6XA 1LO3L 5DJCA 5BJTB 4Z7NE 1RZKH 4ZFZB 3T0WA 3RIAF 3KPSB 1S7TA 1QHOA 3VFWB 4WIQA 3WFEH 4OB5L 4NZRH 1P4IL 4P4RA 1HQRB 3MLTA 3RTQD 2PO6C 3O4LD 2F53D 5TE4L 2WV3A 3VXPA 1CICB 1D5ZA 3VXRD 1DUZB 5ITFB 5HHME 4FRWA 3L3DA 4HJJH 3LIZH 3V52L 1YEEL 2WMPA 5DJ8B 1DDHA 2WAHA 4OF7A 3KDMA 1K3ZA 4A6YL 4ZFGH 5IBLD 5JXED 1QSFE 4WWKA 3RY4A 5I1LA 3O8XD 5GJSH 3DROA 1J1OH 1EPFA 1KIQA 3LKSA 4XNXH 2Z35B 2DQHH 2FEDC 1AH1A 3SKNB 3SKMA 2BSRB 2XACC 2CRMA 3BZDA 1T22A 3BUYB 4YUEH 4XBEH 4PJ8B 1SEBB 5LWYH 1NGWA 1R5VB 3IF1B 3DSFH 3SGEI 1DQDH 3U2SA 3SDAB 5C08A 3WXWH 1HSBA 4YGAB 4XB8A 4GW4B 4B5EA 4P2OD 2FL5B 2ZUVA 5EOTB 4JO3L 4R0LC 3RWIB 1OARH 3JV4B 3LKQA 1IGTA 4PGDA 4QHNB 3KLAB 1FV1B 1NMBH 1J8HD 3ARYA 1MQKL 3WJJC 2XXMB 3F62A 1PX3A 2XN9E 3QEQE 3RY6A 4OZHF 4HWEH 3BO8B 3FO9B 3S34H 5BRZE 3EOAA 3IJHB 1IEAA 3R1GH 32C2A 3TN0C 5D1QC 4NN7C 1KN4L 4MA3B 5HY9A 4G9DB 4HD9A 3TA3B 1P84K 3KAAA 4S1QL 3MBXH 3RAJL 3WYRA 4OZIB 1S7VA 1A6WH 4X9IA 4HKJA 2WBJA 4LAQH 4DGYL 3TZVD 4X7CC 4RGMC 3MRGB 2DTMH 4HXBH 5GSVA 1FZOB 4X6DA 1R3JB 3FRPA 3MYZA 3WSQL 3ZL4L 3FFDA 1ZTXH 1IMHC 3I02B 2HMIC 1HH9A 3FAXA 2V2WB 1CFNA 1MOEA 2BNQE 4Y2DA 2XZQH 2Z8SA 4JDVB 4CMMA 3U30C 3E6FA 5FUCE 4B53A 2ZZUT 4ODHH 1JNJA 3EBAA 4AT6B 2X70B 1U3HD 4LCWD 5I1KH 2ZUXA 3HUJE 2JK5B 5KVGH 4O5LH 4PJFF 3OX8A 3GBML 3SQBA 3OKLB 5SWSA 4R7DA 5A16A 3TT1H 3BGAA 1AHWC 4LQFH 2F8XC 1TCRA 1G7MA 5DUPL 1JHLL 3KG5A 1F2XK 4HJGB 1BIIB 1L0QA 3MRRB 4RX4A 1EZVY 4KPHH 3MRFB 3IS0X 1DVFD 3P2TA 1LNUB 5E6ZA 1O7VA 5GRVL 5T3ZL 3HTLX 4Q6YA 2QQNH 4ZS6D 2EXWC 3NABH 1K3IA 2AK1H 3IFOA 3OXRA 1XZ0B 4X7SH 5BW7C 1DBMH 1CT8A 3TT3H 3BKCL 3F5WB 3VXNB 4P46B 1U42A 1AXTH 3IDJA 3KJ4C 1U91B 4D9QD 4I0CC 1E27B 4S1DD 2BSED 3ULUC 1T1XB 4KI1A 2D3VA 2ITDB 4X4YB 4UTAH 2AKRB 2XWBA 2ZUQB 3TF7C 5KS9A 4XAKD 2A9MH 3WIFB 3PDOB 5HYSG 3DGGA 2UV3A 1U3ZA 4LHUG 3PJSB 4LPYA 5EZJB 4AEEA 4KXZI 1S7XA 1A7NH 1IC5H 1A6AA 5GS0C 3S88L 2X2YA 4GAGL 4M8VA 3UTSE 4WTWA 2PXYB 3VXMD 3RPIB 3MA7B 5L2JB 3NTCL 4P9HH 1OP5H 1KSRA 2IPTH 1J88A 4GKNB 1XF5B 3FQXA 3O3EB 5E70A 5JDJA 3GIZL 2QQLL 4KK8D 3KPSD 3O4OC 2X4RB 5J6HB 2BZDA 5D1QB 2BP3A 5F7KC 5TE7H 3DV6B 1T04B 1T66D 1TJGL 1JZ3A 1HH6A 2NXZB 3BEWB 5H8DA 3AMKA 4O51A 5IHLB 2X4TB 1ZANH 4W68A 2AJZA 3K46A 3STLB 1CICD 1F3DJ 1URLA 1WZ1H 4NUGH 1ND0B 3EZJB 1AGDA 5JIKA 3UJJL 2V2TA 4BSWA 3ZYJA 3HNVL 3SDDB 1CZ8L 2EDLA 2EC9T 4GRWE 3HLAA 5J1SC 1EA9C 1HYRC 4HDIB 3U30B 1QSFA 3V6OA 3BH9B 1CXHA 1EDQA 2HTLC 2J4WH 4P9ML 2E7LC 3F65A 4JM2C 5DD6A 1JZ5A 3L5JA 3VFVA 3T4YA 3W0WB 5DTFB 4F9LA 1R24A 3C5JA 4M4RA 5HI5C 1CTOA 3MLVH 4YDIH 3KXFE 1CD9B 3VI3E 4XCYB 2H6PB 3SDAD 3Q6FA 3SCMB 1U8PB 1WAAA 2YN3A 2IBBA 1NFIB 4MX7A 4L3EE 1DANU 4YNYA 1X5JA 3VGDA 4LSRH 5DJDB 5J56B 3EOBA 2WUBL 4PJEF 5JOPE 4NWUL 1FFOB 3C9NB 4X99A 2Z31B 1I7ZA 2AEWA 2NY3B 4PJHB 4K9EC 4U4BA 5DQ9A 3N9GH 4KKNA 1QBML 4GAYA 3SY0A 3BYTA 3QEQA 4XPFH 3BWAA 4U3CA 4HBQA 3EDJA 3TA3D 4BZ2L 3OAYH 3WKMH 1MY5A 1IC7H 5ICXB 4LSVL 4TNWK 5F7EH 4UB0L 1CFBA 4OFKA 3IRPX 2FR4A 1UVQA 1U92A 4RFEB 1MJUL 4WY7L 3MCKB 1DQJA 1X5IA 4LGSB 1F3JA 1O0VA 4MLIA 3NZHL 5IEKB 1RV6X 2B1HH 3PWPB 2AXHA 1H5BB 1MIMH 1INQB 1IKNC 5IR1B 4LKXA 4Z18A 1AD0B 1QSVA 5DVMA 4UUJB 2BJMH 1IE5A 3K8KA 2V5MA 1CL7H 2HRPH 3RJQB 5EOCL 2EDEA 4K7PY 3KLSA 1I75A 4TPRL 2GSIB 2Y72A 3T1WA 4PRPE 5JHLL 2EYTB 2C9AA 3WNNA 3WL9B 4RGOH 2HVKA 3D0VB 3HUJA 4NQED 4NQTA 5EO0B 3KLDA 2OX5A 4JHBA 5IHUL 5D9SB 3TBYA 1QNZH 3S35L 2GCYB 4N8VG 5IJKC 4NNXA 3GSUB 3CDFA 3HZMA 3AREA 3NZ8B 1RIUL 4HUNB 1GYAA 4FS0A 1DN0A 1MUJA 1DZBA 1FBIH 1K5NA 1S9YA 3NFSL 2AABH 1NCDH 2CK0L 3BN9C 4PBVC 1U8NB 2WP3T 5B39B 5T5FH 5AG9A 4R4BB 1A9BB 1KYOJ 5GGTL 1ZLWH 4IJ3C 1EFXA 2ARJQ 1EJ6A 4P46D 4WNQA 2B4CH 2FZ3B 3LSOA 3BWUC 5DJXB 3P4NA 2X4QA 3MOBL 4UNUA 5DHVH 1CQYA 4PJ5E 4EXKA 1OT2A 1P6FA 1U8LA 1LK2A 1U2HA 3WS3A 5CEZE 2CGRH 1B90A 3EYSL 5JQ6L 4K71B 1BBJA 4RGNB 4Y4HC 3VGAC 1A1NB 5ITBH 5JW5B 4LPUA 1QACA 2FDBP 3EO1B 3HC3H 1NMAH 3T2OA 5ALBH 1AQDB 4MB4A 1NGQL 2VZUA 4R4FH 4AENB 5DFTA 4J4PC 2PXYD 2ED7A 5FO9A 1KB5H 1TPXB 1H3UA 4Y88A 3LHPH 2DQFB 3UTSA 4XMKL 3NCYP 3L5WA 2GSGB 1TETL 3N0PB 5F7HA 1ZA6A 4HG4J 3MLXL 4IRSA 5I1IH 3I6KB 2NXZD 4MD0A 4S1RH 3ARBC 1W0VA 3STZB 3T2NH 1FORH 1BF2A 1XGRA 3GGWB 2YD9A 4HS6B 4LAJH 5EORH 1DSFL 3QUYA 1UKSA 3ZE2F 4F33A 1CGUA 3UTQA 1T5WA 2W60A 3B9DA 2XFXB 1JWUA 4OLUL 1A7BA 4OCXL 4G8EA 2IH3A 3SDDD 1LDPH 1HEZB 3H9SD 3SO3C 3NACL 3P0YL 2YMXH 2AK4B 2OXGA 3O41A 4APQD 5CEXA 2ADIA 2OR9L 2IPKB 3LCYA 1RZ8B 2E9BA 2FO1A 3HFMH 2ADGB 4U2ZA 3W0WD 2FSEA 3B5GA 1JRHI 2NX5E 3TWCH 4L4TA 5CSGA 3GSOA 1PZUB 4KVCH 1MF2L 2HLFD 1DLHA 3O3AA 1G7PA 3MJ9H 4HS8L 3F7QA 3VFMA 1XGTA 2CJUL 4KTEL 3RDTC 4CVZB 1HWGB 1KJ2H 4V1DD 1UM4L 3D9AL 1OSZA 3KXFA 1KPUB 3BIBX 4LQ1A 3KYOB 4L3CA 2Z31D 1UZ6F 5EUOE 1OTUD 3OKDB 3V6ZB 1KB9K 4YLQT 1A7RH 3U0PA 3QO1B 4Q9RL 7FABL 1FVCA 5GZND 3Q6GL 4ZO6A 2E8ZA 3IETB 3U4EB 1UB6A 2NR6D 1MCIA 1B3JA 3ZO0A 5FO7B 3G5YB 3PGDB 2FO4A 4HS3A 4ZS7H 3T2QA 2R1YB 3QXWA 4UBDC 1A1OB 4L9LA 5I6XC 4JG0H 3D39B 3DI3B 3MZTA 1Q9OB 1Q0XL 2E27L 2GJZA 1R3LB 4Y4FC 1HQ4B 3HCVB 3MXWL 3VD4A 4F15C 2A6JA 2NY5L 4G8FB 2OSLB 1FFPA 4XMPL 1ACYH 3RL1A 1INDL 3KR3H 5D7JB 1EO8L 2NY6C 3KPRD 2FX9L 4G8GD 1R3KA 1HK6A 4FXKA 2QKIB 1FHGA 4G7VL 2VDML 4NQDA 5JLZB 1QFUL 5I19H 3ULUE 5BV7L 2CMRL 1J05A 2YEZA 3AGVA 2DQTH 1TLKA 4MJ6A 3EOTH 3TPUB 3BD4A 35C8H 2G9HB 3NCEB 2X1PA 5GGUB 2A6DA 3CU1A 3O2WL 2PTTB 4HCRA 3ARBB 4EDWL 1Q9LA 2DQDL 5C9JA 5FB8A 5KSVB 4PRPA 4QHMA 4DVRL 1OGTB 3NIFE 3QCUL 5EDXA 1ZT7B 5DC4B 2EEBA 4YDLB 1WCBA 4QXGL 3MXVH 3DUUB 3QPXH 3OTTA 5JW4Q 1YN7A 2NYYD 1ZE3C 4U31A 4OCSL 3CD4A 3DETC 1VFAB 4UT6H 1KUMA 4NBZB 1F4WL 2Y6SC 5F96H 5D1ZC 1I9JH 4PJ9D 3R0MA 2DIAA 1CLYL 5FIEA 1IM3A 3DX7A 4U6XB 5DJCB 2NLJA 3KLHC 5DURB 4WHYH 3BVNA 3C8KA 4K94H 1A6TA 1S7TB 4DUVA 2J6EH 5HHXH 1U9KA 5C6WH 4WW2A 2ICES 1IAKA 2R23A 1QUNA 3CVIH 1X5GA 2ZWLT 4U1KB 1LE9A 1OWWA 4P4RB 3BISA 3MLTB 1K85A 1UCBH 1L0YA 4JPWH 1P5UA 2R1WA 4MNQD 2R4RL 3VXPB 4OI8A 1D5ZB 2EH7H 3O2DH 1IQDA 1JP5A 4RGND 3L3DB 1K9TA 6FABL 5LXGH 3QAZC 5JORA 2I24N 1UQSA 1DDHB 2R56L 1X5LA 3KDMB 3BP5A 1YEGH 5F72S 1PFCA 3K0WA 3LPFA 4FNLH 5E5MA 3EJZD 4GBXC 4WWKB 3BGMA 5I1LB 1IBGL 2IAMC 3DROB 4OT1H 4BH8A 1KIQB 1DQLH 1HCFX 1JIBA 3EYVA 3LKSB 4RFOL 3QO0B 3UTPE 5C0BE 1KACB 3SKMB 1D6VH 3RWCA 3ZTJG 1T22B 2IF7A 4OIBA 5J11C 3N1GC 3P30H 4F7CA 2Q3ZA 1NGWB 2YS4A 3U2SB 3QRGH 2D0HA 5C08B 1HSBB 4TTGA 1IJ9A 1UC6A 4ZTPH 3TYGL 4E5XB 1YNKL 3MA9H 1ZLUK 4JZOA 1PGRB 3V4PL 3LKQB 3OJMB 3VJ6A 4WFHE 1IGTB 1ZGLP 5DEGA 1RIVH 3HNSL 3K8MA 1EAPB 3BYYA 2X1XR 5FHBL 4AL8H 1X5XA 2AK4D 1I3GH 3EOAB 4POZD 4UILL 1KGCD 1IEAB 4KTYA 1ITBB 32C2B 1ORQA 4OLYH 1D5IL 4TSCH 5HY9B 2VLKA 1P84J 1F8TH 4NQVB 3RUGB 4IOSD 3JSSA 4LEXH 5DLMH 1T03H 2ZNWA 4G3YL 4GAJH 3AS1A 1S7VB 4RAUA 1A1MA 4Q74A 2P45B 4HKJB 2WBJB 3AM8A 5GSVB 3RBSA 1E4XI 3MLRL 1ADQL 4X6DB 1S9XA 2QL1A 3O2VL 2NY1B 3FFDB 2PKDA 2FHFA 1HH9B 4H0HB 1CFNB 5FOBA 4Y2DB 2DIBA 5FUOH 3B2UC 2YXFA 4U1GC 4WTZG 1UWXK 5F3HA 1T6VN 1ZVHA 1MHEA 1VDGA 4CMMB 3E6FB 1IGFL 3OAUH 4K7PH 3VH8G 1OPGH 3NPZB 4M6OL 5EUOA 4ELME 3FFCE 3S35X 3D3VA 5HYQA 3QIUA 3VI4E 1J0IA 3OX8B 1FFRA 5SWSB 4R7DB 5A16B 4TRPL 3MRDA 3Q5OA 2KZWA 1TCRB 3QIWC 1G7MB 4JR9L 3JUYA 4K3JH 2AW2A 3D39D 5I1GH 4I9WD 1BD2A 2DLFL 1RULH 4HEME 2A77L 4EN3A 5EWIH 1N26A 2XY2A 4D94A 3OSKA 4Y7MA 3FO2A 2H32H 4PRNA 2XG4A 5BZWA 3T3ME 5DQDL 4EIZC 4F7TA 3RWGA 3IFOB 3OXRB 4R2GC 4PY7A 1CT8B 1RFDL 4MAYC 1MLCA 3IDJB 3DECA 4ZOCA 1JZ8A 1MCEA 2VXVH 3PDDA 4PLJD 4PJGA 1T4KA 5J11B 4HWNA 1CN4A 3UYPA 2XWBB 1FRGH 5KS9B 3WFEL 1JHKH 2VQ1A 5I18L 2Q3AA 3LPGA 3DGGB 5C71A 1BGXH 1QFOA 3QR2A 4ZFFA 3QIBA 5HPMA 1S7XB 4PV8A 4Z6AT 2IPUK 1A6AB 3V9FA 4XPAH 1S8DA 4GRMA 2DQEL 3CXHJ 4HJJL 3ARTA 3LIZL 4CADB 2X40A 2ZG1A 4WI9A 2Y9RT 2W9DH 3QXAA 3FQXB 4HF5L 5DURD 2ZKHH 4ZFGL 5FV1L 1G84A 5HHOD 1LO5A 5GJSL 4NOFA 4D9RE 1YEJH 1J1OL 1NH6A 1HH6B 2Y7QA 4HH9A 3C87A 4O51B 2APFA 3QBTB 4LMQE 3LKRA 2AJZB 2M8XA 4Z7WE 1VKXA 3QUXC 3D25A 5B38A 2CUMA 3ESVF 4YUEL 4XBEL 2DBJA 2BHUA 5LWYL 4N0RA 1AGDB 2BY0A 3DSFL 5CGYC 2V2TB 1MJ8H 4BSWB 2EIBA 1DQDL 4IS6A 4XNMA 5HHMB 2WLYA 2WWMD 5MEOA 2G5BA 3WXWL 1LE5A 1G9NC 4KHXH 1OF2A 3HLAB 1AR1C 3M07A 4FG6D 5GRYA 5F7DA 2GAZA 2R9HD 5FKAA 1OARL 2VISA 3ARDC 4ZG1A 1QSFB 2I27N 3JWDH 1INEH 1F4AA 5KSAC 1JBJA 4C56D 5DD6B 4NFBA 2C3WA 3E6HA 3QUMH 4HWEL 3TIDB 3VFVB 3T4YB 3S34L 4U1SA 2EO9A 1R24B 3C5JB 3R1GL 3JXAA 2KH2B 3NIDF 1NUGA 3VXOA 3RWEA 1N0XL 3ZE0F 1W72H 4G6KH 3Q6FB 4MX7B 3MBXL 1RK1A 4YNYB 1CLCA 4CL7A 1I85A 1A6WL 3EOBB 3RNQA 4X99B 4LAQL 1AY1H 1Z0NA 2DTML 4HXBL 1I7ZB 5GGVY 4EVNA 4CU6A 5DYOA 4R2GB 4NRXA 4ODWA 1P9MC 3HMXA 5DQ9B 2DQCH 4GAYB 3SY0B 1GGUA 3IDMA 3QEQB 5GGQH 4BK4A 3BWAB 2D7TH 2XZQL 4GUPA 2CUHA 4O2EA 2UZYB 5KTEH 1RURH 5F9JA 1DFBH 5KVDH 5I1KL 2FR4B 1UVQB 4YPJA 5KVGL 1U92B 4K55A 4O5LL 4HFUL 4BFIA 3FB6A 5E99L 4OF6A 5T3XD 1DR9A 1DQJB 1FE8L 3TT1L 1F3JB 2Y06L 5ICYA 1J0YA 4LQFL 2YR3A 5LVEA 2YPLD 2NY1D 1IL1A 4KZDH 2VERN 4KPHL 4LKXB 4X98A 3WXVL 3UJTL 1BQLH 2ZSWA 5F70A 3HAEH 4Y2DD 5EA0H 1NAKH 4DEPB 4P2QA 3WBDA 4BQ8A 1OHQA 2H41A 2QQNL 3B9KC 5FYLE 3L1OL 2AK1L 4X7SL 4LF3A 4ELMA 1KFAH 1DBML 3FFCA 2HVKB 3EKCA 4WDIA 4XVJH 3TT3L 3X11A 3HUJB 3WEXA 1AXTL 2EDDA 3TBYB 5CSBA 2DF3A 4RX4D 3SHSA 4ZFOL 2P46B 4NNXB 3HZMB 3AREB 4PG2A 3QXDA 5ALCH 3T2PA 1JGVH 5AYQA 4UTAL 1XF2A 1BREA 1DN0B 1MUJB 3P4MA 4RZCA 1CK0H 1K5NB 1S9YB 3ZSSA 1RAMA 1Q9KA 1A7NL 1IC5L 1J5OH 4J8RA 4WFED 1HXMA 3L3KA 1KCSL 2YD2A 1A3QA 1EFXB 4WNQB 2ZPKL 3LSOB 2IPTL 3P4NB 4P3WA 2X4QB 5HGGS 1AO7D 2ATPA 1RMFH 3IU3A 3EO9H 1U8LB 1LK2B 5ETUA 1O5DT 3WS3B 5TE7L 4OZIF 3GJFH 1NUDA 25C8H 2APWA 5EO9A 5HD8C 1BBJB 8CGTA 3WFBL 2I26N 2DL9A 1NGXB 3SE3A 5F88A 5ERWA 4FQCH 1ZANL 4X6CE 5GRZA 5C3TA 2VXSH 5I8CA 3T0EE 3W9EA 1WZ1L 5BVPL 1A6ZA 1UH3A 1YDPA 5FO9B 5KSUA 3BQUC 2CDEA 2DMCA 3RVXC 1NJ9A 1T80A 3KVQA 3UTSB 1KG0A 3L5WB 1V3MA 1ZA6B 4GFTB 4DTGL 5E9DA 2LE9A 4ENED 4IRSB 1PZ5A 2YRPA 4MD0B 3BIKA 3P0VH 3CMOH 4NNPH 1L7IH 4XP4L 1G6RA 1W0VB 4DGVH 4TUKH 3P9WB 1GRWA 1JI1A 1XGRB 1R5IA 1KN2H 2NY2C 3QUYB 4F33B 3MLVL 3UTQB 1T5WB 2W60B 4NC0B 1JWUB 5HHMD 4G8EB 2IH3B 3C60D 5CLTA 5T1KA 1YEHL 4LLUA 2FBOJ 3ARFA 4LSRL 2OL3H 3O41B 4HUXB 4YPGA 3WDIA 5CEXB 1QSFD 1I7RA 4GRWB 3FT4A 3LQAH 5ADOH 4WFGE 4WW2C 1CLOH 2HKHH 4Z7UE 2FSEB 4X8XA 4L4TB 1WK0A 4JO1H 4B7IA 3GSOB 3N9GL 3SJVE 3D0LA 4XPFL 1DLHB 2C5DC 3O3AB 2VITA 1G7PB 4P23C 4PJIA 3QRFM 3VFMB 1XGTB 4X83A 2GITB 4S1SH 3KXFB 1OSZB 5F7EL 2FEEL 4GQPH 4L3CB 3PIQA 1MVFA 4M6NH 5BXFA 5L2KE 3GJFB 4OZFH 4K3DH 1KB9J 3CVHL 5I9QC 2DIJA 5C0CE 2B1HL 3U0PB 3UPRA 3ZKQD 5A3IC 1LEKA 1FVCB 3G6AA 2XN9D 3QEQD 5DHYA 4FQ1H 3B5HA 2VSCA 4JGJA 1EX0A 3HC0A 4UAOB 1FG2A 2BJML 5BRZD 3L3IA 1BOYA 1UB6B 1N59A 2D4DA 3ZTNL 3U4BH 1CL7L 2J8HA 2HRPL 4K8RC 2UUDK 5CEZH 4HS3B 2FO4B 3B9VA 4L9LB 3DX6A 3HE6A 4OQTH 3ZDZF 1RI8A 2GJZB 3GHBH 4RGOL 4DN3H 1MCHA 1EERB 2A6JB 4LARH 5IB2A 4PREA 1QNZL 3SGDI 5HVFB 5IMKA 1FFPB 1ZS8A 3RL1B 3ZKND 1OAUL 3GMMA 4MMXC 1R3KB 5DJYA 4FXKB 2QR0A 1Z5LA 3EO0A 1FBIL 1CVRA 2BNQD 1J05B 2YEZB 4LVHB 4MJ6B 3TBSA 4W81A 4AK1A 5T5FL 2OL3B 3RGVA 3NH7H 3EHBC 1D5MA 2A6DB 2X44D 4KJQC 3WFCH 1F13A 5C9JB 5FB8B 2B4CL 4PRPB 4QHMB 3S4SA 2OK0L 3WHXA 1O7SA 2XPGA 2HH0H 4NP4H 1QR4A 2R0KH 1YN7B 2CGRL 4Z7OE 4B0MM 1NLDL 5KBNC 4R8WH 4MJIE 4LHUA 4KRMB 1NLBL 4Q7DA 3EJYC 1IM3B 3DX7B 1NMAL 3HC3L 5ALBL 2NLJB 4TNVK 3BVNB 3QWOA 3C8KB 4R4FL 3SDYH 3BJ91 1A6TB 3TJHD 3RWJA 1EFXD 3QCTH 1KB5L 4WW2B 4F8TA 1IAKB 1U8JA 2R23B 4U33A 3WMSA 1I1YA 1YPZE 4BQ6A 1LE9B 1OAXH 1X5HA 4M7ZC 3VWKA 2R1WB 5E2VH 1QEWA 2FH6A 1E4WL 2FX7H 4UT9H 5D2NC 1IQDB 1E6JH 5I1IL 2R8SH 1FNSH 4HC1L 4S1RL 5JORB 2J88H 1UQSB 1B0GA 3BP5B 3T2NL 1FORL 4I0KA 4CVXA 5F3BA 4OGAC 5E5MB 3BGMB 1C08A 4U05A 4FQLH 5EO1A 4BH8B 5KSBF 3EYVB 1YYLH 3T0EA 3BOVA 4AQ1B 4YHLL 3UTSD 3QEGH 3UO1L 2K1MA 4OM1L 1LDPL 4Y5YA 1G9MH 5IF0A 3SEPA 3W39A 3HG1E 4Q0XH 4BQ9A 4GG6E 3UAJC 3C5SA 3GJFK 2LTQC 2YMXL 1X44A 3RWCB 2COQA 5J06A 3OKMA 4M5YH 4F7CB 5K59E 1S7UA 3CX2A 3HFML 4HWBH 5DUBA 3TWCL 2BK8A 3V2AR 1A4JA 3QUYD 4FQXC 4KVCL 4JZOB 1EAJA 5C09E 3MJ9L 3Q3GA 4X4ZA 3VJ6B 3I85A 5KVEH 3T04D 5DEGB 4ZXBC 3GSQA 3U46A 1OAKL 5GGVH 3Q0HA 1KJ2L 2Z92A 3GSVA 3ULUH 1OTTD 5DF0A 3IJSA 1FCCA 4DAGH 3I3DA 3G5VA 1ORQB 4I3RH 3TLRA 1F58H 5J89A 3MRMA 2VLKB 4U0QB 3MRNA 1A7RL 1QKZH 3GKZA 3TCLA 4NKOA 1CYGA 5LQBH 1A1MB 2QADB 5GS0H 5IMLA 4Z7UA 5JIPA 4LCIH 2JLLA 1MEXH 1QBAA 1Q9WA 2WINA 4UI2A 5DVLA 3KXFD 3ARSA 4HLJA 1C5BH 1P6AB 2CKBA 3PHOB 1VSCA 1F97A 4JG0L 4AEHH 4KI5C 4L3ED 2WW8A 1FNEA 7CGTA 1DQTA 1WISA 4X8JA 5FOBB 5JOPD 5F3HB 1MHEB 4POYA 3T0VA 5L2KA 4GSDH 4I2XE 2X1QA 5EUOB 2FH8A 3D3VB 5E6IC 1IKFH 4PRHE 3KR3L 5JMRA 3QIUB 2JJUA 1NC4A 2CO7B 5DRZA 4OBRA 5FYKU 5ICZA 3MRDB 4BK5A 1HCVA 2NY0B 5I19L 4OM0H 3GMLB 2QBWA 4WJ5A 2DQTL 3SDXE 3HMWH 3OB0H 2X41A 1MCSA 1NANH 1C12A 35C8L 1BD2B 4LSTH 4EN3B 1I85C 1D7FA 4PJFA 3VFTA 1U93A 2AQ2A 3FO2B 1NAMH 4PRNB 5BZWB 4DN4H 4N8VA 3UZVB 1KEMH 3MGTA 4KV5F 2X5PA 4F7TB 3MXVL 3RWGB 3WNKA 2XKSA 3OF6D 4QOKE 4XWOC 4PY7B 5SWQA 1GZQB 4UT6L 5HDOA 1AGFA 4NCC2 5F96L 3CX5K 3EDDA 1MLCB 1I9JL 4L4VE 2D0FA 5T3ZE 2FX8H 1YEFH 2VXUH 2NXYC 1T4KB 4KMTH 1UM6H 4K94L 4BUHA 4IIQA 1N4XH 4QRRA 5ADPH 4KUZH 4U1JA 5HHXL 4PRPD 1UT9A 3DXAA 4ODSL 3QISA 4KK6C 5HTSA 4L29A 4ZFFB 5B3JF 4TTDD 3WFDH 1UCBL 4JPWL 1CDYA 3QIBB 4MCZA 5HPMB 2ITCB 4AM0A 4X7EC 1WFOA 1S8DB 4GRMB 5A2LH 3WNPA 3O2DL 4G80A 4LVNC 3TGXA 5LXGL 1TQBC 2HT2C 1HILA 1GIGH 3BKJL 3VMPA 4UNTA 3QXAB 2EECA 4J3OC 4JKKA 4FNLL 1OVZA 4MJIA 2W0KA 1YUHA 1LO5B 3LPWA 4GAFB 4YR6A 5FK9A 1JYNA 1MCRA 4OT1L 1DQLL 2HAZA 2Y7QB 4XZUA 2HWZH 4HH9B 4NO0A 2VKXA 2PO6D 2MHAA 3B83A 3LKRB 3TCXA 2P42B 2FJGA 1VKXB 4JAMA 3D25B 5C0AE 5B38B 1D6VL 3MSPA 2EE9A 1HYSD 4PJ5D 4FP8H 2R0LL 3P30L 4PLKC 4YZFE 1GGCH 3QUZA 5CEZD 1QYGL 4IS6B