1WAEA

Crystal structure of h129v mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYVCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Observation of an Unprecedented Cu Bis-His Site: Crystal Structure of the H129V Mutant of Nitrite Reductase
pubmed doi rcsb
source organism Alcaligenes xylosoxydans
total genus 87
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2004-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1waeA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1waeA02
2R7EA 2CUAA 4YSPA 1A8ZA 3IBOA 3T9WA 2I7SA 2NRDA 4KNUA 3S3BB 1N70A 2XV3A 1NIFA 1OF0A 2JFCA 3ABLB 1AIZA 1NPNA 1OOWA 2ZOOA 3NJFA 2IDFA 2QPEB 4YSSA 2BP0B 1CUOA 5F7BA 4YL4A 3GDCA 2YAFA 1JZEA 2UXGA 2VW6A 4YVNA 1ET7A 3JT2A 3T6VA 5I6NA 3PAZA 3OMNB 4AKOA 2QT6A 4AKPA 2HX8A 1AS8A 3GXUB 3UADA 4KOCA 4E9SA 5B1JC 1E5YA 1SHWA 1X9UA 2YXWA 2UXTA 4X4KA 3TU6A 3FU7A 4JKNA 3NJNA 3PAVA 1OE2A 1J9SA 4WKXA 2PPFA 3FT0A 2BZCA 2BP8A 1XB3A 1W8EA 3FPYA 1TU2A 3PAUA 3FQ1A 2GC4C 4A2FA 3JTBA 3CVCA 1X9RA 3WG7B 2J5WA 3IE9A 4DPAX 1J9QA 1MZYA 1SDDA 2X87A 4KO5A 2XV2A 2CAKA 3MBWB 4FAAB 1AOZA 1BQKA 4F2EA 3NSYA 2IH8A 2GSMB 1ILSA 3AZUA 2B08A 1WAEA 1A4CA 4KOBA 3X1NA 2YQBA 1M56B 1E5ZA 1T5KA 4QKTA 2WO3B 3S3CB 1KCBA 1L9SA 3PLYA 5B7EA 5EHFA 4A67A 1MDAA 3AG1B 2IH9A 4GY4A 1ZIBA 1FFTB 1JZJA 3NJKA 2VSKB 3DKHA 3L45A 1NDTA 5TK4A 1XB6A 4E9RA 1A4AA 1ETJA 1QHQA 4E9TA 1AS6A 3BQVA 3UACA 4KO6A 3EH4B 1JOIA 2QDVA 4KNTA 5AKRA 4BDVB 3T71A 4BXVA 1JZFA 3NSCA 1CC3A 1CYWA 4Q8BA 1WA0X 1NIEA 1XMEB 3GYRA 2MRYA 2VW7A 3OQRA 2AFNA 4GYBA 2BWDA 4N4YB 3TA4D 4A2GA 1SHXA 1RZPA 4G7RB 2GHZA 1VLXA 2VN3A 1NWPA 2H5UA 3ZBMA 3CZUB 1PAZA 3KW8A 2LLNA 3IEAA 2VM3A 5B7FA 2XUWA 2HRHA 5E9NA 1E67A 2HX9A 5ANHA 3NT0A 4HHGA 3NSFA 1XB8A 2EIKB 4PAZA 1J9TA 3OMAB 2YAEA 4E9YA 1NIBA 2N0MA 1JERA 2HRGA 2FNWA 2E86A 4DP8X 4P5SA 1FA4A 1ZPUA 3NJHA 1BAWA 1PF3A 1AS7A 3X1EA 1SNRA 2XXGA 4KNSA 1L9RA 2HXAA 2ZXWB 2VM4A 1AG0A 4A66A 1NIAA 2XV0A 3ERXA 1SFDA 4CSPA 4RH4A 1IBYA 2PP8A 3FSVA 4DPBX 1A4BA 3CDZB 1URIA 2IDTA 2PP7A 2R7EB 1F56A 1JZHA 2AANA 2DYRB 3FQ2A 3FYEB 4YVUA 4GP8B 4AKQA 1HAWA 4ZK8A 1NTDA 5B7MA 4UAHA 2TSAA 1M57B 5D4JA 2J56A 1BXVA 2GI0A 4G71B 4M4RB 2J55A 3RYMA 2CALA 4DP0X 5I6LA 4A2DA 1ASOA 2FJSA 3NJMA 3PXLA 3T6WA 1AG6A 4PCYA 4F2FA 4KO7A 4FA7B 1L9QA 4E9VA 1GW0A 4E9XA 5B1BB 1J5CA 3FU7B 1J5DA 1HAUA 1L9PA 3FS9A 3NP4A 1KDJA 2P80D 4GP5B 4UANA 3IN2A 2BP8B 2UX6A 4YSEA 4DP9X 1ASQA 5A7EA 3EH3B 1GS8A 4G72B 4A68A 3HB3B 1SDDB 2WSDA 3CG8A 7PAZA 1E30A 1V10A 3X1GA 5D4IA 2AVFA 1B3IA 1L9TA 3NYKA 1A3ZA 2IAAC 2WO2B 1ID2A 1OCOB 4BWWA 2DWTA 3WKPA 3FU9A 3NJIA 1NWOA 2PPAA 4UF7C 1MG3C 3NJJA 2FQFA 4YSOA 2VSMB 4WTQA 3QQXA 3NJLA 3X1FA 2MTAA 3UABA 1NIDA 4AI7A 4L0PB 3WKQA 3H56A 4JHUA 1JZIA 1KYAA 1OE1A 3FU8A 1ZDSA 1L9OA 2DV6A 4YSCA 1ASPA 3PCYA 1PCSA 3TASA 1NICA 4NAJA 1PZBA 4M3HA 3ZDWA 1W6WA 2EIJB 1JXDA 2YARA 1OCRB 2PPDA 3TBBA 3ZX1A 5FC9A 1PZCA 2XLLA 4DPCX 4A2HA 3T6ZA 2BWIA 9PCYA 3N55A 3EHBB 4AX3A 4GXFA 1E65A 2BW4A 1GY2A 2CJ3A 4HHWA 4YSAA 1PLAA 2ZONA 1DYZA 5LDUA 3X2QB 1EHKB 1YLBB 2CBPA 3C75A 2PLTA 4G70B 1RZQA 2BO0A 2IWKA 2QPDB 3IN0A 4W1TA 1GS6X 8PAZA 1NINA 3SQRA 1NPJA 4KO9A 3SBRA 1QLEB 1IC0A 4CSZA 4G7QB 2B3IA 4HCFA 4DP6X 1AZNA 4HAKA 5IY5B 3EF4A 2IWEA 1PNCA 2XVBA 4AZUA 1N68A 5B1AB 1IKOP 2J57A 2Y69B 6PCYA 4HCIA 3S3DB 2PCYA 2VW4A 4N8UA 4YSTA 2OV0A 1V54B 3AG3B 1KBWA 4JHVA 3QPKA 5I26A 3UGEA 2A3TA 5F7AA 1AAJA 6PAZA 4BK5C 1DZ0A 2OJ1A 3G5WA 3OMIB 4YSUA 3QJRB 3ASOB 1GS7A 2FTAA 2PPCA 2I85A 3WNJA 2DYSB 3H4HA 1TEFA 3EH5B 3FSAA 3ZIYA 2Y1AA 3U25A 4DP4X 3FSWA 3WI9A 2VMJA 2XU9A 2XYBA 2IDSA 2W88A 2PP9A 2ZWNA 1KDIA 1PNDA 7PCYA 1MZZA 3DIVA 2FQEA 1I53A 4HIPA 3PPSA 2FWLB 3SBPA 3CVBA 2HX7A 1PMYA 1SFHA 2BP0A 1UATA 1W6LA 4P5RA 2PCFA 3QJUB 4DP5X 4K9JA 3D12B 2XWZA 5I5IA 3QJVB 3QJQB 1ILUA 1WA1X 3FPXA 2UXVA 4BXSV 4EF3A 2QDWA 1KCWA 5PAZA 1JVLA 5PCYA 1OCCB 4HZ1A 1CYXA 2BW5A 5D4HA 3AG4B 1AQ8A 2JKWA 2UX7A 2GC7C 3T6XA 5I6KA 1IBZA 1SF5A 2H3XC 2XXFA 1IUZA 1WA2X 3CVDA 3MX0B 2OCCB 3OD3A 2YAQA 4YSRA 1AANA 1BQRA 4G7SB 1JZGA 1NZRA 3FYIB 5B1JA 1ZIAA 1BEXA 2FT8A 1HFUA 5I6PA 1PLCA 1M9WA 1OE3A 3UAAA 3V9CA 4MFHA 4ENZA 2TSBA 3AY2A 1FWXA 1BXUA 2FQGA 1EZLA 3NSDA 3FSZA 1A65A 3S8FB 1KBVA 2AZUA 2IWFA 1CURA 1RKRA 5TK2A 4A2EA 3NP3A 1AZRA 2YAMA 2GB2A 2YAOA 4YSQA 1AZCA 4QLWA 1GSKA 5B3SB 3AW5A 3HEIB 3UAEA 3H4FA 5I6MA 2I7OA 1BXAA 1SF3A 5I6OA 5I5JA 1PLBA 2FT7A 2EIMB 1KGYE 3SBQA 4DP1X 1AZUA 1OCZB 2EINB 2W8CA 2H47C 5I5MA 3QJSB 3BVDB 1BYOA 2AZAA 1TEGA 4BDVA 4BWTA 2UXFA 3WNIA 1BQ5A 2IDUA 3NJGA 3ASNB 1AACA 3TBCA 2X88A 3OM3B 1JVOA 1OV8A 2RACA 1JXGA 2Q5BA 3DTUB 2DY2A 2HZHA 2XX0A 2FT6A 2XX1A 4YSDA 4E9WA 1TKWA 2GIMA 3N2JA 1RCYA 5I28A 1ET5A 3ABMB 1J9RA 1WS7A 1R1CA 4DP2X 4HCGA 1MG2C 1JXFA 1ET8A 1ZV2A 1ADWA 3KW7A 5AFAA 2JXMA 3X1BA 2YAHA 1KV7A 2BZ7A 4E9QA 5AZUA 3QJTB 1PY0A 2EILB 2DWSA 2Q9OA 4GP4B 2CCWA 3WIAA 1AR1B 3ABKB 1WS8A 3ABGA 3AG2B 3V9EA 4F7KA 2YXVA 4NB7A 5B1KA 1GY1A 3S8GB 2HLEB 2IDQA 2PPEA 1ZDQA 2YAPA 4HALA 2P80A 1AZBA 4TXVB 1PZAA 2BHFA 2FQDA 3FQYA 4Q89A 1BYPA 1V55B 3CDZA 1GR7A 4DP7X 4NERA 2GBAA 4W9ZA 4BWUA 1SJMA 1QNIA 1GYCA
chains in the Genus database with same CATH superfamily
1JNHB 3ISYA 1OVZA 3KCPB 3ULAB 3US0A 2WAQA 1X7QA 5IFJA 4I0CC 4U6YB 1XF3B 3BWAA 1CJYA 3PWLA 1ZANL 3LPOA 3SHSA 3VG0H 4P59H 4G8GB 3WIHL 1X3DA 3R06B 3CBRA 4PTUA 1N8ZB 2CM5A 1UWXK 2YAFA 2IIJA 2VMCA 2HUHA 1S5IH 3JZ7A 4JO2L 2R29H 4KQ3H 4AEIH 4XNDA 4LPWA 5EU3B 3E6FB 4FYTA 5GRUH 1A6ZB 1EAQA 5DZJA 4AZ8A 3MVSA 2DRUA 2QHRH 1KJ2A 2BVPB 1EHNA 4LQ1A 5JO5B 3VX1A 1R75A 3WFCL 5EIIB 3HAEH 2WGXA 3P4OA 1WZ1H 5IJDC 3R8BB 2BIQA 4XCFL 2H6PB 1THAA 4UT9A 4X4KA 2E7LA 3O41B 4X7TA 1TITA 4KJWC 3T5WA 1T1YB 3VXUB 2GW5A 1WLHA 2VDNH 3W0WA 5DYFA 1U8QA 3DXAD 1KYUA 2V9QA 3AY4A 3BAIA 3QYNA 5EPMA 1IILE 3ZHNA 3BRGC 4Q2ZA 2RR3A 2J5WA 1V05A 2VZOA 2X87A 1E43A 4JPKL 4OT1H 5ERWB 3K6OA 4U6TA 5IMKA 3QEGL 4Y1AA 2WLIB 2QQNH 4KJYA 3Q2WA 2YK1H 1IGML 2CKBH 1R46A 2P8PA 3P73A 5KVGH 3KM1A 4FQCL 4WTWA 3NFSH 3LS4L 3UC0H 1X7SA 1QVOA 2XWJB 2A9CA 4LSTL 1YMHB 3NGBB 3ZYJA 1R3IH 1DANU 5LCVL 5ABDE 3L4WA 5L7XL 5FF6A 2GIXA 4DK6A 1JV5B 4ZMZA 3BW9A 3KLAB 5AW9B 3AG1B 1MCHA 2CXGA 2KUTA 4LDOB 2AI0H 1OAYL 2Y1YA 4S1SL 1IT9L 1QLFA 2Z4QB 3ZYOA 3IDXH 4H26A 4NKDA 4LSUL 5DS2A 5C70A 2FECI 3Q2CA 3E80A 2NCEA 4YDKL 1RZ8A 5EO0A 5HD8C 5I1HH 3UACA 2ZG1A 3EYFB 1BQHB 1NOFA 3DGCR 4JFDA 2ZP9A 2WLLA 2PYED 4MJIA 4RIRB 4UWQB 4RISL 3FB5B 1FE8L 1N9PA 2XACC 3WYRA 1MNUH 2VDML 3WS3B 3AACA 1XMEB 4LF3A 3T1FA 3M1OA 1GZHC 1SEQH 3JV5A 1FO0L 2EDHA 2L7JA 1T83C 4XNZB 5D7IE 1C5DB 2C26A 1NEUA 1RHFA 2AMUA 2Z8WC 3GRBA 4AYFA 5H4ZA 3FT2B 1YEFH 2W81C 1ND0B 3QPXH 1S9XB 3K71A 1IGCH 3E1ZA 4KXBA 4MX7A 3UJIL 2ZP0T 3I9GL 5IB4A 3V6FA 2NY0C 5E9NA 4LKCB 3HG5A 1GGTA 2CCVA 5HDOA 1MCWW 4PJ7E 2DQIL 1FN4A 1U8PB 3DX6A 4OTXH 4YDIH 2YAEA 2AQQA 4R83A 1JHTA 4POUB 3L3IB 5ITBL 5C7XL 1XIWC 4XMTA 2E86A 1U8CB 2Q7YB 1FA4A 4X9IA 3NJHA 3VXNB 3KYNB 2LTQB 4U1MA 2ESVE 5DUBA 2E27H 4LT7A 4S1QL 3E8UL 2BCKA 3X1EA 3QQNA 4OM1H 3W0WE 4I3GA 2IALA 1TZIA 2XV0A 5J9PB 2WBKA 1BVZA 3FUJA 2DQUH 2C3XA 1ZLSH 2P5PA 2X41A 1U8JA 3IAPA 4H5SB 5A3ID 4H40A 4JFED 3ZUNC 3D2TA 2M8XA 2FJGA 1OARL 1P84J 1W72B 3FJTA 1B4JH 2AK4D 3G5ZB 3LZRA 4FL4C 3PXJA 1QSFA 4HAGA 4WV1A 5GQBA 4I18C 4N9GA 2BSEA 4JO1L 1SN0A 1NCAH 4Z7UF 1UZ8A 1RK0B 1RZJH 3DOSB 1UURA 2XFXB 3HW7A 1IC4H 4UT7L 4K23L 4RA0C 1AC6A 4XZUA 2P52A 3D08A 3QWQB 4XBPA 1KELL 4AEHH 1KB5L 2OQJB 3PE9A 1SRDA 3ZL1A 1SOSA 1P4BH 5I6LA 1A4KB 2E59A 1A9BB 3BP6B 2NUPB 5K69A 1KXVA 3IAGC 4UDTA 2ZWYA 3CZFA 4KH9A 3L3OB 4F7TA 2W0LA 1G7PA 1BW8A 3VRIB 1CIUA 1RZIB 4JFDE 1ZSHA 2DQHL 2Y23A 3C6SB 4KI5E 1L9PA 5J8OA 2P80D 3ZRSA 5C0FA 3IN2A 3MLUL 1ADQL 4R7NA 5SWZD 4YSEA 2ZUXA 5JXED 4IRZL 5KZCD 3H2PA 2P7TB 2ZKMX 2FZ3B 1OAQH 4XPHH 1TEYA 5HJ3A 1BFVH 1LO2H 1MIML 3CFBA 3WV0A 3WFBL 4IKNA 1KC5L 3SE8H 2P9RA 3UFIA 1WRFA 3SDXA 1VKXB 1U2HA 2YN5A 4X7CC 5CIPB 5HHXH 3O3DB 1NWOA 4FG0A 4QRPE 5JOFA 1AP2B 5E2VH 5IWLA 1RZGB 1OTSC 1TG8A 3LNGA 3WFDH 3QIUA 5IEKA 3PJSB 3IKKA 4UTBL 3BAYA 2GIYA 4ODVH 5DHYB 2Y1VA 1JZ2A 1MCEA 2F5BL 2WLYA 2V6HA 5IBUG 1T04B 4ZQKB 4NAJA 3MRFB 3L48A 3FUMA 2YARA 3TBBA 2Y07L 4XNXL 4JZNB 5FC9A 3FCGA 1RZ7L 4NQED 4XR8C 4Y2DA 1FQ9C 4D9LL 4MAYC 1E28B 2PXYB 4XVUC 3D0AA 5D2NC 5ESVA 4F33A 2BW4A 5KVEL 3QR2A 4G42A 1PLAA 3HBGA 1UOVA 3WJJC 2IANA 3EO9H 1F3JA 1K3ZA 2J8UF 4RFOH 5H37A 1YQ2A 4Y4HB 1TVBB 1CGYA 5DHEA 4ZZKA 1OB1B 2BO0A 1BLIA 3IN0A 1KTRL 3REWB 2ICWA 4XWGL 1NPJA 3DX9B 2YEQA 4R8WL 1UA6L 4YLQT 4MSWB 4LBAA 3HR6A 4HAFA 3RVVC 4XO3A 3GDBA 4UQ2A 5HGHB 3V4VH 3VWJB 3GSNL 4R6UA 5C0RL 3PUUA 4UNUA 3NIGE 5DJ0A 4JG1L 5AL8A 5IT2L 2YFNA 4NCC2 1F6LL 3B9EA 1N68A 4M7LT 4AJYV 2IH3A 2PTTA 2ZCLL 4PJDE 1QPKA 5DURD 1ES0A 3MHZA 3EZJB 5AB2A 3IETA 3P40A 4BK4A 1G9NH 3TV3H 3FTGB 4XB8A 2X1XR 3K7UA 3LKQA 1YEKH 4ZAKB 2JQAA 1NLBL 4HIXH 4JDVA 3PP4H 1OT1A 3V4PB 2ZCKH 3UGEA 3D48R 4X7SH 4L4VD 4OCWH 4BK5C 1CXKA 2BNRB 2CGRH 5BV7H 3OMIB 4MD0A 5AALA 4IHOA 2PPCA 1V3MA 2I85A 3AJ7A 3FSAA 5FUOH 3RVUC 1HXMB 1JNHA 5KAQG 5DUML 3KCPA 3SDXE 5LN4A 2XYBA 4NFDA 3KGRA 4TULH 1O6SB 1MREL 2W92A 2P46B 1FCCA 1XF3A 3F84A 4U6YA 4KUCD 1I53A 5EDSA 3F7PC 1ESOA 2ZX9A 4GH7B 1X6LA 2XZAH 5HDQH 3R06A 2CO7B 4Z7VF 5DRXB 1N8ZA 2BS71 1UATA 1HHIB 2J88H 3QORA 1KN4H 2HN7A 4JFFB 4L4TE 2XWZA 3GT6A 3Q13A 3VRJA 1BM3H 4M4RA 5JO5A 3EJYC 3F83A 2BVPA 2J5LC 4FHKA 5JIMA 3U2JA 2XV6B 2IV9A 1DQKA 5EIIA 1HH6B 4NAQA 3NJXA 3U1SH 3O2WL 1X7TA 2B0SL 3D0LB 1F02I 3TS8A 2ZKWA 4K7PY 4OCRH 1OCCB 2H6PA 1CYXA 2BW5A 4BQ8A 3PV6B 4Z7WF 5DI8A 3NOIA 1T1YA 2BFVL 2JKWA 2Y5EA 3NA4A 3RG1C 3VXUA 5J12C 5I6KA 4R0LC 1IBZA 5DFVD 4LCIH 1R19A 1S7VB 3KVQA 1XDTT 4UI2A 3MX0B 4HG4J 1MCIA 4AGPA 3OZLA 3C6EA 2HA1A 4WAFA 5GHWH 2COVD 5CINH 1LJMA 4GMSL 5B1JA 3MLRH 5TPWH 1SQ2N 5ERWA 4NM4H 4O4YL 3WTXA 4JCMA 2VL4A 4ENZA 1JYXA 1JE6A 1MCPH 2WLIA 3ILQC 2WXIA 1BXUA 3GI9H 4U6VH 2YGNA 5ICXA 2WWMC 5D6DC 3LNDA 4JRXB 1RKRA 1SDYA 2VKXA 2XWJA 3MAWA 1YMHA 4G9DB 1EJOL 1XZWA 3NP3A 1N5YL 5BQDA 3AQDA 1AI1H 5ADOH 1JV5A 1N4XH 1UOKA 4CJ0A 3DX8B 4QLWA 3KLAA 3N0AA 4WNJA 1GSKA 2G5BB 4ELDA 2FX8H 5AWNL 5KBMA 3BN9D 2Z4QA 2IQAB 2Y72A 2VERN 2XQYA 4RAUB 3HC2A 2VMDA 3HNSH 4GRLB 1MRCL 3M45A 3EYFA 3QDHA 4KXZH 2W8CA 3CWGA 3F6LA 5LXVA 1WTGT 1UD2A 3FAXA 4RIRA 1UWFA 2UXFA 5F96H 3FB5A 3IJ9A 4KY2A 1HL9A 5SV4A 4X4YB 5KG9B 3WS3A 2YD9A 4H4NA 2RACA 3N41B 1QQDA 4PBVC 3V6ZB 5KSBF 5L8KB 1C5DA 4LLDB 5FWQA 1S7TB 1TTCA 2OX5A 3FT2A 4G8GE 4IIQC 2P5EE 1S9XA 4Q4IA 2H3NA 3BLKA 3NCFB 4Y16C 2V2TB 3K3QA 4DP2X 2Y9RT 4ZOEA 2LU5A 2UZXB 4LKCA 1GVIA 3OG4B 1M7XA 1SYSB 4U1KA 5GZOD 4QAWA 4JRLA 2BNQD 1U8PA 2BZ7A 4X5QA 3UZVB 5HI5C 1AJ7H 2CCWA 5DRZA 1L7IH 5E6YA 5F6HJ 3DTDA 3L3IA 3LEXB 1U8CA 2XIBA 3VXNA 3KYNA 4AYEC 4AXWB 3BWZA 2XZQH 2M26A 3VQLA 4JRYD 4O5LL 4HALA 3FCBA 4MXVF 5AZEH 4JKPH 4POYA 4PJFF 3L2NA 4OLZH 4U1JB 5J9PA 5IBUB 2BHFA 3RIAK 4G6JH 4OZFH 4GIOA 3F8UB 4H5SA 1GR7A 2BHYA 2GTQA 4XPBH 5AKVA 5L0QC 3UCRA 1RERA 3WAJA 1W72A 3HNTL 3G5ZA 3VXSE 4DEPB 4U7MA 2AK1H 4NN6C 5CD3B 3UDWC 2DI7A 2AEQH 4N90D 2L04A 2FWSA 1RK0A 4H25B 3DOSA 2XFXA 1KEMH 1XH3B 1ZT1B 3LDBC 3D39D 4XC3L 3MI6A 2E7DA 2ZAIA 1KEGH 4Q6IB 4D7PA 3U9PL 3LS5H 3GDCA 2AQSA 2XWBB 3CIQA 2DLTA 3F65A 1E4HA 3MV9D 3O9WB 5GRJH 2OQJA 4G8EB 4NZRH 2DBJA 1AO7B 3FQXA 4PS4H 2YMTA 1CL7I 4G6MH 1ZTXE 4ZFOL 2CBMA 4APQB 1A4KA 4YO0B 3Q3GB 2CJUH 5DXWA 5I17A 2ITEA 1JGDB 3FH8A 2MHAB 4Z8FH 5DD1L 4RGNB 4LSRL 2BLFA 1YNKH 3L3OA 3L9YA 3VRIA 1RZIA 3TU6A 3C6SA 3PAVA 1HXYB 3UP1A 4M7ZC 3MNDA 4U3XA 4F7MB 4Z3HA 3U7YL 2P7TA 2MOVA 2FZ3A 3F85A 1MJ7L 5LDSA 4YHML 3ZRCC 3K2MC 3WEBA 5JHBA 3A6CH 4QEGA 1VKXA 3FO0H 2A5UA 4ZMPA 4DT2A 1ZWIB 4OF8A 5CIPA 3O3DA 2VE6B 1AP2A 1JWSA 3Q8FA 1RZGA 1XV8A 2YQBA 5FGRA 3HC0B 1OO2A 3DI3B 4QYAA 4LCUB 3PJSA 4R2GC 4K5OA 1G4MA 3PLYA 1MCOL 3K81A 4PJ5B 3U6RB 5JPNB 4K3EH 1NC2A 2VLME 3K4ZA 5DHYA 5L8JB 5J13C 1CVRA 2ZJSL 2VSKB 5F1KC 2VQ4A 1XB6A 1CTNA 1T04A 1ETJA 3EYQC 4GAJH 3MRFA 3QZPA 4RMVA 4ZQKA 1PQZB 4TVPL 2C34A 1ZVHA 4L3AA 3RDTC 4JZNA 2Z34A 3VFUB 3QHZL 3UEQA 2IDCA 4U7KA 3FOLB 4ZUSA 3F04A 1E28A 2PXYA 1J0YA 3Q1SL 5T8IA 3BE1H 1N26A 2D0FA 5MHSE 3VWKD 1M71A 1TVBA 2BINA 4Y4HA 4EBQL 1LO4L 1OB1A 3TA4D 1ZSDB 3POHA 3LHAA 4G7RB 3REWA 4E5XB 1CQKA 3VG9C 3D50A 2R56L 2ZPKL 4OD3H 5I1DB 3DX9A 3FB7B 3KW8A 1TSRA 4XO9A 3IDUA 2NW2B 1WFTA 1U21A 3CIAA 3WTVA 5HGHA 1G0DA 1SY6A 4QT5A 3VWJA 3CLFL 1QD0A 5IFAH 1T66D 3ZDYB 1A6PA 2ICWI 2V3FA 4J3UA 4POZC 1NAMH 3PIQB 5GRWA 4BQBA 5FHBL 3KWWB 4G43B 1B9KA 5EDXA 5JHDD 1ZK9A 1A7QH 2FNWA 2BY1A 2VMEA 4ZTOL 2AEOA 1MFMA 1LMIA 3C8HA 3MRQB 1CLZH 2H45A 3FTGA 4ABVA 3MGOB 1HOCB 2NT0A 1NBVH 2HXAA 5I66B 5CU9A 2H6UA 3BEWB 4HSAC 3GS7A 3V4PA 3ERXA 4P57B 1R3LB 2VRKA 3PF2A 3FTSA 2WM0A 4XBGB 4CBPA 2BNRA 1IC5L 3LRSA 1XX9C 3QNYB 2JKIS 2CO6B 4DGVL 1EX0A 4M48L 4EOWL 3ZN6A 3WGUB 3DMMB 4IGBD 3FYEB 3QUHA 3S98A 1NGWB 5BW7A 1HXMA 4YHIB 2FEEI 1D5XB 3DSFL 4YVUA 2VDOL 2CIKB 2D7PA 4G7VH 4MAZA 1O6SA 4MNQD 1RP9A 1FYHB 2R0LL 3DBXA 5D71L 2P5WD 5FCSH 2Y3AA 2QADB 2Z31C 2CO7A 3NZ8B 2AQ3A 2F54D 1HHIA 5EUOF 5FHAH 5J56B 3MOBL 2YKLL 4DP0X 2C9QA 3TEYA 4JFFA 1ZA3B 4TSCL 4NGHL 3B5GA 5CP3H 2DWXA 4PJ9B 4OB5H 1MLBA 5CILH 5LAPA 2BPBA 3C09C 4OF3A 4P2QD 4QRQB 2FECL 3VRLE 4R4ND 5ICYB 4HJJL 3D0LA 1QPXA 2MPAH 1VCAA 3I74A 3FH5A 5TGBB 4Z3JA 4HULB 3K91A 3PV6A 4RX4D 4L0ZA 1LE5A 3PHSA 2EKJA 2QVFB 4ZFGL 2FD6L 3MBED 4XP5L 1ACZA 4OZIB 1D9KD 2W59A 4FFWC 3HB3B 3MLZL 3MX0A 2N7SA 3FTWA 3ARSA 1DLHB 4L2YA 2A99A 2X4PA 2KPNA 3VXRD 4PCSA 1REIA 3TO4B 1A6UH 3HI1B 2C9RA 3RNQA 1YQVL 3WKMH 2X6AA 3FU9A 3LKRA 3NJIA 4E68A 3BYTA 4JRXA 4I9XA 5T5FH 1EJ6A 4N5UA 4QCIB 4G9DA 5GS2D 2EEBA 3SQOL 3P69A 4EZMA 3HN3A 3MNVB 2DW5A 4X7FC 5F1NB 1KTLA 3DX8A 4ZUWB 2XWDA 2G5BA 1T2JA 2I07B 4HGWB 2ISDA 1DO6A 2C3GA 1W8OA 3ZDWA 2IQAA 4XOCA 5F7LB 1JNNL 2FJHB 2BOCB 4RAUA 1IGTA 1MCJA 2JF1A 5CZRA 2B15A 2B77A 4TKWA 4GRLA 4B9CA 1QFUH 1CFMA 4M02A 4NQDA 3RI5F 2IH1B 2A9AA 4L8CB 1DBBH 4WUUD 4JG5A 4KKCD 3GTTA 5B39B 4X4YA 5CLXA 1G6RL 4G70B 5C07B 2R1YA 4LHUG 4CN4A 4H88H 2XPGA 8PAZA 2ED8A 1C7TA 3Q43A 4OLUH 4LLDA 4YXHL 3WFHB 4EKXA 4WI2A 1S7TA 2VDKL 3OPZH 5EU6B 2WBJA 4TL5A 2V2TA 1KPVB 4LLWB 4KQ0A 3L5IA 3D3VB 2OTUB 4JFFE 3SOBH 5IY5B 1X5ZA 3DJTA 1I75A 2UZXA 2ICES 4EE2A 1SYSA 3VGDA 3ML9A 4P0DA 2HJFB 3IK2A 5DFAA 4U31A 5F7UA 3UZVA 2DKUA 4XN5A 5B8CB 1AHWC 2E9IA 3ZJAA 1WBXB 3LEXA 4IDJH 2Q2LA 1KCVL 3P9WB 3ZDXF 1DJSA 4ZI8A 4WO4B 2CGZA 2A3TA 5MI0B 2WPGA 3IXAB 3BAEL 3PWVB 4UOZA 3S36X 4U1JA 4HLZG 4JN1H 4WENB 3E9UA 3GKWH 3ASOB 4BKLB 3H4HA 2BRRH 4KRPB 3MMEB 1QRND 3UTSB 1BZ9B 4OSUL 5GGRB 2ZWNA 1PNDA 2BVQB 5FO2A 1MJUH 1MZZA 5CD3A 3CXDL 4N87A 1ZT1A 1OAZL 1XH3A 4DK3A 5AAMA 3D51A 3NK3A 4RGMC 5CEZE 4OFDA 3PQYD 3F3HA 2XWBA 3U83A 3O9WA 3P4MB 4O58H 1JN6B 4M7KH 4N2NA 5F7WC 3QARA 1AO7A 2CJTA 5IROA 3D25A 3AU1B 3WNPA 4HIHB 4APQA 5AZ2H 2WSKA 4PG2A 1B4LA 2MHAA 3RPBA 4JAMB 2BDNL 4RWYH 4KJQD 4DHLA 1IIKA 2ZOTA 1TQVA 3QJXA 3TF4A 2JCCF 1HXYA 4HX1A 2ARWA 3KPRB 1U8OB 3V0DA 1UD3A 1BVOA 3RPKA 2UWEF 5BVPL 3VTAA 1M9SA 5T33L 3CVDA 1OGAD 2VXQA 4U7SA 4F7MA 1YSOA 5IQMA 1AANA 2DQTL 5D7LB 2C9XA 3D09A 3GMQB 1NZRA 4YZFE 4Z0BL 3X3GL 4MMZC 4JEGB 4M9OA 5LG6A 25C8L 3CHOA 4P2CG 2D7TL 4O2CB 1M9WA 3V9CA 4P2RE 5I9QC 4XZ4A 1QZNA 4U1IB 2R15A 2BSCA 3S8FB 1KBVA 3M8OL 2AXGB 5FW8A 3ZY7A 1ZWIA 3ESUF 2ZKHL 4HMDA 3WS6C 1KN2H 4OBRA 4FP8L 2QVMA 3NTCL 1QKZL 3L9EA 4QJ4B 4W9EC 1CGSH 4MQTB 4FEMA 4PJ5A 4HKXB 4N2GA 3TYFA 1NBZB 4KK6C 3UGUA 3ARDD 2R8SL 3RY5A 2APFA 4OIBA 1NGQH 1RD6A 5FUZH 5FUCE 5FFGA 1SF3A 2JI3A 4YDJA 1UM5H 2VR5A 4ANWA 1S7XA 1R4XA 2MWCA 3K46A 1NDMB 1BF8A 3LRHA 3FOLA 1CDHA 4I3RH 1FGNL 2R4SL 5E56A 2JIXB 4DGUA 4WEBH 2YGOA 1GYAA 3KYOA 4B27A 3NJGA 1S4IA 4IU2B 4XXCC 4NP4L 4NN5C 1ZSDA 3ZVVA 1LEIB 4E5XA 3S5LG 1AR1C 3E3QE 5DC9B 5I1DA 3O2VH 5E6IA 1IIIA 2XN9D 2WYZA 3FB7A 5I28A 3RVTC 3BJLA 3UC2A 1MAJA 1DVFB 3FU5A 3POCA 1HILB 3LN5B 1ZD6A 4JPVL 2Q3ZA 3WFEL 1KV7A 4NYLA 3PIQA 1JDCA 1CICC 2UZPA 1KGUA 4KX9A 2DWSA 4PJGB 4G43A 1D5IL 4V1DE 3NFPA 2HT4D 4RGNE 4FABL 2FE0A 4ISVB 1LWHA 3WIAA 3B37A 4OLWH 3L95B 3AG2B 3OJ2C 3MRQA 1U8IB 4PJBE 4UQAA 4P48A 3MGOA 5B1KA 1HOCA 3DHUA 4FTVB 4IKIA 5I66A 4BGDA 4W93A 3QDME 4JCLA 4P57A 1R3LA 2KI6A 1BYPA 3GTVA 3MRMB 4IK6A 2DIJA 4XBGA 2F19H 4ZJ9A 4X6BB 3QNYA 3BPLB 2CO6A 3HPLB 1KULA 5IMLB 3BUDA 1V7NH 3TA3D 4WF7A 3DMMA 4YSPA 4RMBA 3ZT7A 1NGWA 2R2CA 4YHIA 3GPEA 1CFSB 1VPOH 1Q4NX 2G9KA 4HV8B 3T0XA 2Y6TE 4W9DC 3IMRA 1TETH 3AM8A 4YHLL 3IRCA 4I0PB 4F8NA 3U4KA 4F5CE 1DJHA 4JM0A 4LHUB 5I1JH 3TF7C 3QNXB 2DQJH 1GYUA 5FYLL 4HT1H 3NPSB 4PJ5E 4I77L 1EHXA 3WN6A 3NJVA 5E99H 1AMXA 5BMFL 3UJTH 3ECBB 1ZA3A 5ID1B 1EUUA 1K9TA 1BP3B 3FHEA 3GXDA 4PJ9A 1TJIH 1SN2A 4Y4KC 3TVMC 2XN0A 3Q5OA 4LPYA 5ICYA 4QRQA 4A6YB 1I85A 2R1WB 4LDLB 3ESOA 1RUKH 5AG8A 3SY6A 5TGBA 4PJXF 3II1A 4XO8A 3OF6A 1IVTA 1NA8A 3I2CL 4LCYB 4EDXB 1QNZL 3EFFB 3EAKA 4W70A 4QO1B 2Y0SA 1PPIA 1QA9B 1X9RA 4X6DF 1P2CB 4ZX5A 3QXUA 5C0BB 3O3BB 3GSUB 4P4KC 4BZ1A 3L9BA 1D7BA 1DLHA 2XV2A 3FU0A 3CVHH 3THMH 5I8KH 1FNEB 1CU4H 3MV7B 4BINA 4N2CA 4JDEB 4B9KC 5CSBA 1FC2D 3TO4A 3REVB 3HI1A 5JIPA 5C6TL 4Y9CA 2OSYA 3AS0A 2WUBL 3DECA 4XCEA 3Q8AA 5ECJE 2CO4A 2GBUA 2VR3A 3EH1A 3P3YA 4QCIA 3O6ML 4GQ9H 4B9ZA 4OGAC 4AGMA 4IEFB 3SODB 5C6PB 5EHFA 3MNVA 5EZIL 2PO6D 3GSOB 1FAKT 2YHGA 4W68A 4Q9BA 5F1NA 1I7ZB 5CLZA 2NY4B 4ZUWA 1E4XI 3QFJD 5TK4A 3IYLW 3EHBC 3QS2A 4OQTH 3I9PA 4Q58C 4F57L 5IJVA 4X6CF 2I07A 4H8QA 4HGWA 5I1AB 3FQRA 2FJHA 1QUPA 2BOCA 4FJYA 4WWPA 3ATEA 1F18A 3S37X 2TRYA 1PJWA 3VGAC 3T0ED 2H32H 2IH1A 2VDQB 5JUEL 3NCYS 4F7CB 4L8CA 4GEJA 1ACYL 1QFHA 4U1LB 3B6SB 2OXHB 5B39A 2FGZA 4Z7VB 5JIQA 1WAPA 3DGGB 3WCYA 1MFAH 4H0HB 2MQCA 1ONQB 1DJZA 3MACH 1Q94B 4JDTH 4UMSA 2Q8AL 2AQ1A 3WFHA 3HZVB 5F9DC 5L9DL 1KGJA 2HTLD 5EU6A 2ZX8A 5E2WH 2ZOUA 4JM2C 4ZFQA 4OCSL 2EKSA 4GAFB 3D3VA 1JHLH 4AQ1C 4YZWA 2CDEA 4YHYC 2V33A 1CL7L 2OP4L 1I9EA 2QVTA 1G4RA 5E6UB 2HJFA 5CJOL 1U30A 2VLLB 2N0MA 4FZEL 5I2IB 1AE6H 1YNTF 1EA9C 1WBXA 2VITB 2XWTB 2QQLH 43CAB 1TTUA 2WMPA 4JQIA 2DZEA 2HRLA 1A14L 2DQ6A 4JL1A 3ZPDA 2F7OA 2WUCH 4WTZG 4M5SA 4DAGH 4I5BA 1RUML 4WO4A 3ZR5A 3C08L 5LWYL 4OZIE 3IXAA 3PWVA 5HGAB 4DPBX 1URIA 5M95B 1OXYA 3HE7D 1XCTA 4HDIB 4UTAA 4BKLA 4KITB 4NO0D 4KJPD 4OJDH 3T4YB 1WHOA 3VH8B 1HZHH 4AQ8C 2XQYG 5FKAA 1TQBC 2VDPB 3MMEA 5BS0D 4MB3A 2EECA 1BZ9A 3WENA 5GGRA 4KKNA 4Y19B 1TZGH 3VD2A 4FQCH 2ZWKA 1ECYA 4KVNH 3FC8A 2YC1B 4MAUL 4IIZA 5C0GB 4MHHG 1FDLH 3G5XA 4I89A 1JN6A 5L7XH 3FU3A 2JH2A 4FXKC 4L8BA 1D6VL 1FGVH 4JFTA 3AU1A 3IAQA 4OIFA 4XMVA 1ZOXA 2M1KA 3C60B 4G82A 1PD0A 4FQ1H 2GSIB 5L2JB 4JAMA 2EIEA 3NA9H 4S2SB 4HVBA 3MRJA 1C12B 3NIFF 4MCZB 1RAMA 4OUUB 1XSJA 3IF1B 4J4PA 3KPRA 3DV6B 3PAYA 3WD5H 4PWHA 2NSMA 4JHAL 2I25N 5DT1H 4L37B 3H85A 5JXAL 5C07E 1WBZB 5D7LA 2EYSB 1IV8A 3BAWA 2B59B 3GMQA 4GQZA 1X5MA 4MLIA 3NYKA 2M83A 3HUJE 5GJTL 3D9AH 1IFGA 4UBDC 1YEDA 2O4EA 5HVWA 1K72A 4KVPA 2ICEB 1QX1A 5H4YA 4U1IA 4F9LA 1T1ZB 1E9PB 4U49A 3X1FA 3MZGB 4HS3B 5FM8A 4ZSOB 4WDIB 4JHUA 4PJ8C 4PG9A 3DTXB 4KXDA 4XB7A 3T4AC 1N0XL 1KIUB 3IFPB 2R69A 3QJHB 1NBZA 4HKXA 1DDHB 1HQRA 1OTTD 1SXSA 1PAMA 4NM8L 4XBMA 3LNHA 5L2KB 1NICA 3G6JF 1PZBA 5EOQH 5ITBH 1PZSA 4JVPA 4LRIC 5GGQH 4KY1H 1U8NB 1M6OB 4RGOH 2OMXB 1JP5A 1VZIA 1VDGA 2UVEA 3GS4A 4B9IA 4FFZH 1SMAA 1TQCC 3QUXD 4HCRA 5C9JA 5JNYB 5CFAA 1NGXB 4KJWD 5LDUA 3Q0HA 3HLKA 1WEJL 2JIXA 2Q20A 4NQTA 5C0IB 4IBLT 3UTSE 2IBGA 4IU2A 3LRGA 4K7PX 4NSKB 2FEEL 1GS6X 3DI2B 4I13B 2HUEA 3BN3B 4UV4H 3MCKA 4ZFFB 1BA9A 4S0SD 4JO1H 1LEIA 3OR6B 3E2HC 4LARH 5IJKA 3F7YB 2P1YA 5E7BA 1A3LH 2NXYD 3VXOB 4Y89A 3VXMD 3OBAA 1RV6X 4K23H 4JFWA 1C16A 1R34A 4DP6X 1DVFA 2B9BA 3KMDA 1J0HA 3LD8B 1BHGA 3LN5A 4PIRF 1KELH 1TTBA 2A7BA 5G55A 5JW4Q 1QR1B 4BUQA 2RQEA 3QUYC 2ZD0A 3OWEA 1LGVA 3DURA 4HLJA 1I7TB 4PJGA 4AW4A 1CDUA 4YNYB 2XN2A 12E8L 1KZQA 4ISVA 4J3WA 1CN4A 1E2WA 1QWUA 3L95A 1Q0XL 3RY6C 1TMCB 4H1LG 1CR9L 3NCMA 3KPRE 3MRLB 3Q5YA 1MWAH 1DL7L 4M93B 2VISA 4F9PC 4Z3IA 5I1CH 4P23B 1T80A 3U9WA 3VSVA 3Q6GL 5HD8D 3MRMA 1I1YB 5CUSH 3QJRB 2FIRT 2DYSB 1S46A 2VXTL 3QIBC 4NKQB 2XTLA 3GMRA 4AENB 5IMLA 3QRBA 3ZIYA 2KZ1B 1MIMH 2NOYA 3SDAB 3S5ZA 1KC5H 4I48B 1IBHA 5JW5B 1CFSA 1T7YA 3N6YA 5T1DL 3FF7A 3EFDL 3PPSA 2FSEB 4ZPTB 3JWOL 5IBLC 4NPYB 3QNXA 3B9DA 2P49B 4OU3A 4K9JA 3WMSA 1C8QA 2OSXA 5TD4A 5EU7C 3GK8L 2NY0D 4HC1A 3QDJB 3FFCE 4NO3A 4D7BA 3QJQB 1ILUA 4JKKA 3KD4A 2F5BH 5PAZA 5HDBB 3KLHC 3EO1B 5INDB 1EDHA 4L3EB 5BNXD 4A6YA 2R1WA 5IOKA 1XIWD 4XNXH 3VAEA 5HYJD 1FVDA 2BVEA 1CO1A 5HJDA 5HHOB 1DFBH 1ZTXL 4D9LH 4F7EB 1KXHA 4LDEB 4LCYA 4EDXA 3EO0A 3EFFA 4FQLL 4PJHF 4R26L 4QO1A 1NC4B 2D4FA 1GMIA 4N25A 1QA9A 5A16B 1P2CA 5C0BA 3O3BA 3LXBA 1F3RB 4NJAL 5C9JB 2WJ7A 1Z5YD 2J20A 3KJ4B 3HBZA 4UYPA 3DUHA 1AXSB 3MV7A 5FGSA 4JDEA 2MFNA 4MFHA 3UTQB 4DESA 4ZUUA 3HG1D 3K0WA 3NSDA 4K73A 2DN7A 5E2TH 4NBXB 4EVNA 3ALWA 5L6YH 3NG5A 3IXTB 1I1FA 3QDGE 4I1NB 2JVUA 2F9BT 3RUGF 3QQ3B 3MLTB 3GSNH 5DRWB 1NGZB 4ZMOA 2O1AA 4HPOH 5IJBC 2UYLA 5IT2H 3MLYL 4WJKB 2W9DL 3GSOA 3AW5A 1QSEA 3UIZA 4DKFL 1I7ZA 1A5FL 2ZUQC 3BPOC 3ROLB 2NZIA 3V0JA 1E90A 1R47A 2EIMB 3ARUA 4FTVE 4RFNB 5I1AA 4Y2NA 1MW3A 2VLKE 3R4DA 1NAKL 4NNPL 5IIEB 5DK0B 4ODUB 5C0EB 4BRVA 3ARFB 1BWMA 2YSSB 4XVJL 5C09B 2BCMA 3D4ZA 1E8WA 5L88L 3L6FA 3I3BA 4EIUA 3V52H 2Z0UA 5BJTB 4F7CA 5D1XC 4JZJB 4U1LA 3D4GA 2Y7NA 3B6SA 2OXHA 4M4PA 3ZTNH 4Z7VA 3PRZA 4LNVA 4KMTH 3DGGA 5DUMH 1J1PH 3ULUE 3O0RH 4Z1PA 3KWUA 1ONQA 2QKSA 3NABL 1RU9L 1MREH 1Q94A 4YX2H 3P2DA 1BFOB 3HZVA 1W72L 2HT2C 3UBXG 3UG4A 4HCGA 1YUHB 5IOPB 1MOEA 5D5MB 3NMEA 1ZV2A 2ZUTA 3NAAL 1WZLA 3LZNA 2CLVB 3FT3B 4GG8B 1IZKA 3BZ4B 4Z7WA 3RGVC 1FFOB 4GRMB 1OTSD 3N9GH 4PJIF 3TESA 1BECA 1SM3L 2VLLA 1CFBA 2E76C 4LK4A 2IOOA 4LOFA 3STBA 1HT6A 4NJ9H 3FUDA 4PSPA 4TYUA 5I2IA 2DM4A 43CAA 2XWTA 4LVOC 4NB7A 5DHDA 3O2WH 3TEWA 3QB7C 1ZDQA 3CV5A 4GUPB 5IB5B 2XXCB 4LLVB 3PJNA 5AW8B 5T5NF 1W16A 5G4NA 3U46B 3DXAB 3ENEA 4NERA 2GBAA 1ODAA 2L3BA 4NZTH 1N18A 4XVUD 3GM8A 3MV7E 3T4YA 4NQVB 3CPLB 2WYHA 2YBGA 4QRRD 1CTMA 3TONA 1NIFA 4JW3A 5KUKA 1OF0A 3MA7B 1BZ8A 4FLSA 4O4YH 3SKJH 1UG9A 1QABA 4PY7B 3E6HB 3L3DB 5F44A 3ZE1F 4TSBL 3RVVD 4IW4C 3P77B 1XGUB 2VW6A 2YC1A 3BSZL 2GITB 3GEFA 3IDYB 5I18L 5B38G 5JHMA 2X44D 5BQ7B 2QT6A 3DIDA 2D03L 1DE4A 5GSRB 1HC1A 3H3KA 1JRHI 1PSKL 1UXWA 3D2UA 4MJ2A 2Y7LA 4K71B 1WYJA 2GSIA 5L2JA 5SWQA 4LLUB 4NX0A 4OZGE 5LGKA 2X1PA 4G8IB 5J0BA 2Z8SA 3L4XA 2GCYB 4ADGA 2WZ6A 2YQGA 1C12A 3DARA 4KK9D 5AB1A 4MCZA 2LAAA 4OUUA 1MRCH 3WEMA 3CZKA 3IF1A 3MFFB 3RWGA 4RZCB 2PYEB 5E1HB 3UZQB 3CVCA 4HLEA 2W0KA 4L37A 2WXKA 1R5WB 4HQQL 3UYRL 3ZHLA 2EYSA 5JW3H 1S3KL 4GMTH 4NI3A 3MTRA 4Z7QB 3ZIMA 1U4FA 3T2OA 3OSKA 3RVUD 4Z7NE 4NOFA 4CAGA 5D1QE 4DN3L 4FFVD 1WAEA 2ICEA 4HJGA 5E9DE 1INDL 3SYPA 4GI6A 3U4BH 1E5ZA 4NFCA 1T1ZA 3H0TB 1E9PA 5FECB 4P49A 2ICWJ 3QK0A 2H1LM 1UFGA 4HS3A 4HJSA 4PWIA 4J3TA 5IV2B 4ZSOA 4WDIA 4I3SH 3U2SA 3DTXA 3MGTB 4UQBA 3IFPA 1KIUA 3QJHA 4KQ4L 5HHMD 1DDHA 2P48B 1SY6L 4MRCA 3EW3B 4LVNC 4N24A 3TTSA 5EORL 4Q9QL 2WIMA 5E4AA 1MFEL 1TQSA 3G5YB 3K0YA 4XN7A 4K3JL 1IL1B 2V5SA 1M6OA 1QEWB 2OMXA 3N44B 2HFFB 3WNLA 2BXYA 4X8JA 1KBPA 1WFOA 4OCMC 1UT1A 2YD6A 4GINA 1GZQB 4X6FB 4Q8BA 1BFSA 1HEHC 1NGXA 4YUEH 5CGMA 5DO8A 4P4RB 4AGOA 3ULVE 4JFEB 1RIHH 5C0IA 4NBZB 3FQUB 4J3VA 2AK4B 2IQ9L 3B9VA 5ESAB 4ZUTB 3V4PL 4NSKA 4Y19E 1GGUA 4L1HA 3MJ8B 4ZFFA 2OULB 2PW2B 2X6UA 3K1DA 4ODXB 5IHWA 5F7MC 1KGCE 3T2LA 3OR6A 4FNTA 3QUZA 3OJDA 5E5RB 1WUZA 3F7YA 3GC3A 3VXOA 4XC3H 3SE9L 3VMPA 1MQKL 3BQUC 4M03A 3U9PH 4H20H 4DOHB 1JFQL 1QR1A 2WWMD 1DBMH 3BDYH 3JVFC 2YPVH 4QKXB 2YWYA 1YEJL 2JCCB 3CLEH 3F7QA 3MA9L 3SN6N 3TN0C 2EUZA 3WNKA 4G1MB 4ZW8A 4Y9GA 3TJEH 3APDA 1I7TA 2O5XL 2FX9H 4ACPA 3O6FA 4IS6B 5FCUL 1L6XA 1TJHL 3TEUA 3MUGA 4Z5RA 2OR9H 5I8OL 2K7QA 4LSRH 4OV6F 3PXHA 1WFJA 4PIBA 4ZFZB 3J07A 1P1ZA 3MRLA 4MJHA 4TNWK 2NTFB 1LP9F 3RKDC 3H2QA 3FSVA 5SWZB 4UQ3A 5KZCB 3RA7H 1TTFA 1I1YA 1TO5A 2R7EB 2X42A 5DA4A 3P3TA 4XNAA 3SDCA 4JR9L 1AD9B 1OW0C 4U3SB 1MJ7H 3VI4E 4AENA 4RMTA 4TLUA 5J06A 4CC0A 4PHZA 3SDAA 4GP8B 4I48A 5JW5A 3GM0A 2CLZA 3ZE0B 4DVRL 2HRPL 4N0YL 5EBMB 2E7LC 5D4JA 1XHHA 3OC8A 1GIGH 1F4AA 4ZPTA 4NPYA 2JLPA 3N43B 1W91A 2ZSWB 1DJIA 4DK5A 2CALA 4FN0A 2CA3A 3AY4C 3C6LD 4QRPD 1J12A 1GH7A 4A2DA 4NPJA 1G1KA 3UYOD 5L2KE 1MCOH 2RTTA 3QDJA 1E4XL 4PS7A 2E56A 5FW6A 4IOFC 3DHJA 5GGSB 3MJ9A 5IVXF 5KBLA 2DMBA 3SKOB 5CEZL 2WXMA 5INDA 4L3EA 2OMUB 4LSVL 4UANA 2Z4TA 1NM9A 4TVPH 2DMCA 4NQEB 3W5NA 2G4EA 4KC3B 4HS8L 1L3NA 2OW6A 4PRHD 5C0NC 2AV7A 5HHOA 4K0OA 4KKBD 4NHCH 3T3PB 3VFRA 4F7EA 3HFML 2VR8A 4FQ2L 4O51B 3W37A 4ZTEA 1GC1C 5LGYA 2VO8A 5JHLL 3CFDB 1NC4A 3HG0A 5A16A 3JXAA 3LEVL 3OJVC 4PCTA 3QZMA 5CCKH 3BKJH 4AH2B 1AXSA 5D7HA 3UTQA 4BUHA 2R56H 1E6OH 1LNUA 4CMHC 1HCZA 1KCRL 3Q01A 2AEPH 4JREB 3WDHA 5E4EC 2EUXA 4TUJA 3NJLA 1RH8A 4N2MA 3QQ3A 3WSQH 2ZKYA 3MLTA 2X89D 4HJUA 1Z3GL 1NGZA 2I69A 5DRWA 3WKQA 5DZAA 2WJ5A 4ETYA 5LQBL 5D70H 2VJ0A 4N1EA 3D18B 4MZIA 4ZO9A 5DURB 5CM1A 2VZVA 1P6AB 3F2LA 4YXKL 3ROLA 2HVBA 1KBBA 4CVZB 5KJ7E 1PZCA 4R9HA 1MN4A 3QHFL 1U42A 5IIEA 5KOVC 5DK0A 4ODUA 5C0EA 1LE9B 4F15B 3FCTB 2ED9A 3ZL4H 4PJEF 2HKAA 3ARFA 4L4VB 2YSSA 1HTYA 2VC2B 3QBTB 1IC5H 4DGVH 5BJTA 4KV5F 1H15B 5GSVA 1E2VA 4JZJA 1QFWL 4GUCA 3KPNB 3V5KA 4BFNA 1NANH 1L0YA 1PTZA 4KRMB 1FG9C 5EUOA 1OEZW 1F11A 3SBRA 4WEEA 5HDRA 4O02B 2W9LA 5FYJE 1HH9B 5DEZA 2VSDA 5A6IA 1B6DA 1WHPA 1BFOA 5IOPA 2B3IA 1YUHA 3MRIA 5D71H 1ZE3C 2F58L 5D5MA 1FORL 2GQHA 2IWEA 2CLVA 4HHAB 4OGXL 4ZS7L 3SGJA 3WXWL 3FT3A 3KPMB 4ERSL 1UM4L 3TT1H 4GG8A 2VCOA 1G87A 2YKLH 5I19H 3BZ4A 4OVVA 1FFOA 3LYRA 3AUVA 4GAGH 4BJLA 3WO4C 3SDDC 4U1GC 4R2GD 4JHWL 4WV1C 4Y5YB 1KTCA 2K45A 4L3EE 5T1KD 4R84A 5KSAD 1UKQA 2OV0A 2R2HB 4FRWA 5BZWB 5CBAB 3TBVB 5E95B 2K4AA 2XA3A 1WISA 1O6TA 2ZCHH 4P99A 5IB5A 4FG6D 1OLLA 3CX5K 4GUPA 3AMKA 4LLVA 3U46A 4ODSL 1ZLWH 3DXAA 2FD6H 4XP5H 2K0RA 3EOYG 4J3OF 2PABA 4DFHA 1HI6B 3UP6A 1I8LA 2XG4B 4GW4B 4D9QE 3V0WL 1CPUA 2C7UB 1KXVC 2D8KA 5FDWB 3CPLA 4GNKB 4FULA 2NY1C 3C2AH 2FQEA 3MA7A 4XPAL 1E4WL 1OPOA 3L16A 4QAMB 1ZHNB 4RDQF 3L3DA 4OCNC 1SBSH 2OMYB 3P77A 1XGUA 2GITA 1L6PA 5I1EH 3SQOH 2B14A 3DNKA 4PJ6A 1ZGLP 3HN5A 4CVXB 1TTGA 3W11C 1P7HL 2XCMC 3LVTA 3PFUA 4POZD 3UMNA 4NZUL 4F58H 3T77B 4XP9L 1PGRB 5JYLA 4C56E 3AG4B 4LLUA 2J43A 5LBSA 1IEAB 1GAFL 3O4OB 4G8IA 5C09E 3FZUC 1G0YR 4WKZB 1PYWB 5IWLC 1HU8A 1SOXA 2E4TA 3MFFA 4RZCA 5EBLB 2PYEA 2NX5D 3VW3L 1JWMA 2YAQA 3I6LD 3UZQA 3DO4A 4HWEL 4X42A 2E46A 1NCTA 3PYCA 1NFDF 1P6WA 3SE6A 1R5WA 3X12B 5LKNA 1BEXA 2AITA 1CXFA 4QRAA 3H7BA 2WKGA 1JPSL 2APTA 3COOA 1BF2A 3VFOB 4KTYA 4GOSA 2VZSA 3VU2A 1TDQA 3WNMA 4F37F 4JNXA 4N5EC 1A1NB 2V4LA 4Y2DC 2VDKH 4GSXA 1VGEL 4RQQB 1HYRC 4DEWA 1T7ZA 3BUYB 2P5ED 1C9SA 2YAMA 4HD9A 3QQ9C 1U33A 3H0TA 4ELKB 5BUGA 5FECA 4GG6F 5IV2A 2BNQB 4HBCL 2AQNA 3GB7B 3MGTA 4W4NA 4Z95L 2W94A 4KHXL 5FDYA 7CGTA 4GEIA 5T1LD 1QI4A 4P05A 4AMKL 3G5YA 1INEH 3T0AA 3S88L 1IKNA 1IL1A 4PJCB 5E8OB 1QEWA 3WMQA 4JRYB 2HFFA 3U1QA 4KZEL 1RMFL 4NUPA 3H3PL 3WKNA 3BAEH 1FP5A 2OM5A 1H0DA 1A7OL 3SPVB 3GI8H 1YY9C 4J3SA 4P4RA 5GS3A 1II4E 3GFUA 4MXQC 3FQUA 5HVHB 5IF0A 2AK4A 4ZUTA 4GI8A 2P45B 3C5SA 4WY7L 3QIWD 2PW2A 4ODXA 4ZOBA 1X5FA 3SGEI 3VXSD 2WHVA 1J11A 1LEGB 4OJAA 3D39B 3E1F1 3HI5H 3GMPB 1VEMA 3ARTA 4PLNC 3MV9B 3D85D 4DGYH 1YPZF 1TZHB 4E9QA 3CN3A 5AZUA 2JCCA 4WLCA 4ORZC 2A6KB 2OMTA 2XWCA 2AQRA 2UWEA 2IMNA 4IS6A 4LCWD 4AIOA 5FO7B 4AWJC 4LPTA 1SHMA 2DLFH 4XCCL 1B2YA 3L5XH 1MRFL 4J3XA 1YAIA 1YYLL 1AZBA 2P80A 2PYEE 4MLSA 2NTFA 4IRJA 2AVGA 5SWZA 4L5FH 1O7VA 1BEYH 5JXEA 1OP5H 2VLRD 2AQ2A 2OMNA 5DUJA 5BVPH 1PZ2A 2NYKA 3HKFA 5T33H 3QORC 2R7EA 2YQ2A 4NEHB 4XPGL 2WXFA 4JCWA 5ABZA 1MY7A 3WEXA 1AD9A 3BGFC 4NQSB 3X3GH 4Z7QE 4IU3B 4X5LA 2FYYB 3S3BB 5FLUA 1ZGLM 4FA6A 2JFCA 2D7TH 4XT1C 3QT2A 3HS0B 4HIQA 3RIFF 3BH4A 4FXTA 1KYOK 2YWZA 4KAQH 2B2XL 2WZPD 4BRJA 5EBMA 3M8OH 5DQ9B 2ZKHH 4KH2A 1C1EL 2DDQH 2XN1A 3EFOA 1QBAA 3JT2A 3RWJB 2ZSWA 3ETBJ 4NKIL 2EJ1A 3BCFA 1CLOL 2ZYIA 4ZMLA 3GRWA 3JWOC 5B1JC 1E5YA 2MCG1 2VLMD 5AVQB 5GGSA 2Y06L 1U41A 3N40P 2I32A 3QXAB 3SKOA 2OMUA 1PZ5B 5F3HB 3VI3E 1C5CH 1DJWA 1KB9J 1XGTA 3PDGA 5ANMB 3QXDA 2G5UA 5K33A 1UA3A 3UX9B 1I1AD 1A7RH 4JFEE 2ZQKA 4L8DB 3NRQA 2R4SH 3O8XD 4O51A 2V7HB 2X4TB 2YQ3A 3CFDA 1DEEB 4KUZL 2QMJA 1GOHA 5K9KB 3WTYA 3VWKB 1KYDA 1FVCB 3NZHL 3U9UB 3TIDB 2NY7L 2A0LC 5MHSD 1LWRA 1U93B 2AABL 1ILSA 2B4CH 2MQ0A 5AVTB 1JPEA 3FO9A 3CFKA 4MVBC 3N1MC 1HSBB 1M56B 3QYCA 5IB1B 1G7HB 2CNZA 1UB5B 1KCBA 1NMAL 3GXNA 3LOWA 3NRPA 1OAJA 3WFEH 2X3CA 4TSAH 4LL1A 3D18A 3MLXH 2IGLA 2W5PA 1D5IH 4XN1A 1KLGB 5TJWK 4I2XB 2APWA 4ZXBD 3PL6D 4RBPH 5E5LA 4XNZC 4Z7OE 1AS6A 3ESMA 3V5HB 4CVZA 1XWVA 1NCBL 1W0VB 2W1NA 2F5AL 35C8L 4OV5B 3PY9A 1CK0L 1E6JL 1KJ2H 5I1LB 1T2QL 3FCTA 4W4OA 1RVFH 4L4VA 2Q7AA 3OAWA 1W80A 1SXBA 3LVEA 2RCSL 2OTWB 4JQIL 1NIEA 3MRPB 4NI6A 4UT9H 5LJYH 2DQMA 3OQRA 1H15A 2QSCL 3QVAA 3TCLB 4A2GA 2X53A 4IGBB 1SVCP 2H1XA 4YIQB 3KPNA 1E50A 2F8VA 1VLXA 1ZT7A 5D8JH 1H3GA 4DZ8A 3TNNB 1Z9PA 2EUWA 1OM3H 5E6RB 2EDEA 4UTAL 1PX3A 2LTQC 2VM3A 4MNQB 1A4JB 4X4ME 5B7FA 1HH9A 2GBVA 3BGAA 1NCDL 2DQGH 3NCJH 3N5AA 1UH2A 2P5WB 1B0WA 5AW2B 4YBQC 5FYLH 2B1HL 2F54B 4HHAA 3C87A 4I77H 1JRHL 5CNHA 4PJXA 1NIBA 5DSCB 2N7BA 4AGQA 2OYLA 3GJFB 4N22A 4Y5YA 1IO4C 4XNUH 4BZ2H 1YEIH 3I9AA 3OTTA 4P2QB 1SNRA 1GC1H 2R2HA 4KK6D 4NQEE 4QHLB 4TUKH 4X6DA 1L9RA 1YJDC 3HS9A 2A6DB 4NKMA 3GQFA 3ZLQC 5CBAA 2VDMB 2P44B 4JY4B 3S4SG 3LKSB 2PP8A 4AG4H 2H8PB 3I2CH 4PGDA 5IESH 3MBEB 4L1SA 2PWEA 1D9KB 4NWUL 4OLXH 4WFGE 2YA2A 2AANA 2DYRB 2X4QB 3FQ2A 3FB8B 1HI6A 4F8TA 5LXGL 2D3JA 2XG4A 3PPEA 2X7LB 5JW4M 3VXRB 5F7KC 4HWNA 1BOGB 1UWEH 2VXUL 4GLRI 5FDWA 5DJ2B 2D9QB 2ENSA 3B83A 5AAWA 5FB8B 3L3OC 4M43L 3DVNB 4NC2B 1QRKA 4ZK8A 1PZDA 1CFTB 4R5XA 2YD8A 1ZHNA 1BXVA 4G71B 1NDGB 1A6AB 5EFIB 5KVDH 1WZKA 3DUSA 2DAVA 1RZKC 2OMYA 4G5ZH 1ODUA 3UEZA 1WIOA 4FJZA 4CVXA 4PCYA 4F2FA 4OGYL 5GS0C 3FN0L 5KS9B 1WFMA 1CICD 3GXFA 4H44C 5B1BB 2WXGA 3SGKC 3T77A 3ZHKA 4MBRA 2WVSA 5HVGB 1KJVB 1IEAA 1EJ8A 2GG1A 4L4VE 2IPKB 3DX3A 5J6HB 3VD5A 1U2YA 4AGNA 4OW6A 2JNZA 4WKZA 1PYWA 4WW1A 2ZUSA 2BJML 2MEJB 3BZ5A 1OPGL 5EBLA 3RX5A 3UO1H 1CZ8H 4QXVA 4WUUB 3CG8A 1DQQB 4ELMB 1QZ1A 1V10A 1BFTA 1AXTL 3DJZA 4WJ5B 1MXGA 1ZE3H 4HCRL 3GMNB 1MPAH 4QTFA 5D2LE 2J6EA 3AS2A 2EAEA 4LGSB 3VFOA 1Z9SB 2ATAA 1WQVT 3K6DA 4AUJA 5AOLA 1A1NA 1QLEL 2MTAA 3PNRB 4G3YL 4LAQH 4RQQA 2PXYC 1GPOL 3BUYA 4Q0XH 2BC4B 4ODTL 4ELKA 1RUPL 5CEXB 3AFLA 1MY5A 2D3NA 3TC9A 4WW2B 5D7IF 1IJNA 3MRKB 2J8OA 4W6WB 5CJOH 3DK2A 4HH9B 4Y4HC 4DCQA 5I75B 4QDGA 2ORBL 4FZEH 1OCRB 1VGKB 4M1GL 3ULVH 4MCNA 1BGXH 5FGCE 4EI5D 4WCYL 3T6ZA 1TPXC 1WIPA 3LKOA 3F7VB 5B21A 3TVMD 4PJCA 2K6ZA 4KZDL 5E8OA 4AX3A 4K94L 4HSCX 4JRYA 4YSAA 4XP4L 3VWJC 3WLWD 2HB0A 2HH0H 8CGTA 2E75C 3GBLA 1YLBB 2FEDD 3U7WH 2EE0A 4C54A 4ZYKB 3HAEB 4WGWB 3RNKB 4AEFA 4AVKA 1CXLA 5TF1L 4RAVB 1QRNB 3QFGA 4P4KD 5F6IB 4DJMA 3FQNB 4J7RA 5CBEB 2MCAA 2VDNB 1LEGA 3D39A 4X0KB 4HETA 2XVLA 3WUWG 4LSPH 3GMPA 4QGYA 5GISL 3W57A 4HOWA 1FV1B 3PQYB 3MV9A 2BMKA 1SLVA 3OWRA 1KTKE 1TZHA 2QFPA 1XZ0B 5CAYB 3SKUD 2Y6SD 3B2DC 4HUVA 2J57A 2Y69B 3VDAA 1Q0YL 2AXHA 3TBTB 1OTUC 2I5YL 3ILEA 2A6KA 5JQIB 5JW4R 4WI8A 5BW7C 2CKBB 3MRGB 4B9JA 1V54B 5FO7A 4AJ0A 5EBGA 5ELIA 1DSFL 4XMPH 5K59F 3N1QC 1CT8B 5DZVA 3EHBD 4HC1L 4PRDB 4QRSB 3IU3B 1CI5A 3NH7L 4LL4A 1IKFH 4CILA 4BV1A 3EYOB 2ARJB 4JHAH 1OGAB 3HI6H 4A6YL 5JXAH 1K8DB 4P46D 3SO3C 1RZFL 3VO0A 4DP4X 1SJHB 3LX9A 2IPTH 4PUBH 4IU3A 2FYYA 2D7OA 1N6QH 4B9FA 3R7RA 3Q6FB 4HMEA 4KI5F 3F64A 3HS0A 1E3ZA 4P3CH 4MTMA 1GHFL 3II2A 5H37H 3WNJA 4YPGB 4P2RD 1SFHA 4XNMA 1W6LA 5EZLB 4K5NA 4EJ1C 1ZRUA 1J5IA 2XKNB 1GSMA 5C9KA 2BNQE 5DHMC 1BSIA 3RWJA 3QJVB 1KENL 5ACMA 1KTJA 1NMCB 3HVDA 4JM2D 2F2HA 1KT2B 1KYFA 3ARDB 2EIDA 3FPXA 5L4MA 3BZFB 1N64H 4NM8H 4R4FL 3UJJL 4EF3A 2XPYA 1ZJBA 4HZ1A 4OQ1A 4PJCE 3UG5A 3D1MC 1G9ML 1H9VA 5DZOA 3QXAA 5CMAB 4O9HL 4JS7A 5F3HA 3GSVB 1MJ8H 5ANMA 3UBXI 4ENED 1IE5A 5A2IH 1DZBA 4PV9B 3P3UA 1NKRA 4Y9EA 1JMXA 4PB0L 4L8DA 4G7SB 1JG9A 1WEJH 5MEPA 2P24B 2V7HA 1DEEA 1MXDA 3OAZH 3ARGA 1B6UA 2DIBA 3VWKA 4BFRA 4F24A 5K9KA 1FVCA 2Y2YA 3ZL2A 5T3ZE 3WIHA 3TIDA 3UPCA 2TSBA 4XH2B 3ABZA 2VDQL 3DV4B 4AUYA 3RURA 2A9MH 1U93A 2HCZX 3D39E 3L4ZA 3RWFB 4F1SA 3KYKH 2XN9B 4HUCA 4PP2B 4PU2A 3DYOA 5I73C 5AW0B 4GRLC 1HSBA 2LFEA 1G7HA 1UB5A 4M62L 5FLVA 4N1CA 4ZX3A 4KFMA 2B5IC 4D0DB 3HZKB 3UAEA 1WGVA 5K39B 3QQ4A 2FEJA 5KVFE 1KLGA 4I2XA 4V1DD 3OV6A 2VDRH 1U91B 5DR5H 1Z5LB 1GJIA 4GXVL 4OFIA 2VXVL 3V5HA 1OCZB 1CR9H 2EINB 3B3BA 1F58H 4OV5A 1UJ3B 1S7WA 1BYOA 1JTPA 1P7BA 1PW3A 4LRNH 2WBJC 4J12A 5I1LA 3NIGF 5E94A 4R7VA 5JORB 3IMUA 5HGGS 4CKVX 3WTSA 3EUDA 3QZWG 2Z1KA 1DR9A 3BSGA 3QDMD 1JVOA 5F7YC 4JE0A 3TA3B 1HDMB 2FT6A 4IGBA 3A67H 1I8IB 1H19A 4YIQA 1BJ8A 2WQUA 3TNNA 3OKEB 1ZV9A 3BVWA 3V6OA 3KPQA 1ET5A 1WS7A 1R9FA 1WCBB 4H8PA 3V0FA 3JWOH 1YNLH 1ZV5A 2P5WA 2XA8L 2VDPL 3DJSA 5EF0A 3EXLA 5ISZA 3SDYL 3UO8B 5BO1L 3PWNB 1QACA 1JGVH 2F54A 5KWYC 3QJTB 3BMVA 2XTJC 2X2IA 4HKZB 4J2XA 3SQBA 3SDXF 3M1BB 5DSCA 4YHOL 1U92B 2KHAA 3SYOA 3GJFA 3JT0A 2YXVA 4DEPC 4F7KA 5DTFB 3I50L 3Q5TA 5DJXB 3ATDA 4P2QA 4QHLA 3EYSL 4BH7A 3DOHA 3QPQD 2A6DA 1D7FA 2XFGB 3HHMA 4JY4A 3SB3A 4RWHA 4TNFA 1LEKB 3FT9A 3EJSA 1AYOA 5AAMC 3RHWF 4FQPA 2WP3O 2IGFL 3QCUL 3GSQB 4NLHA 3MBEA 2AXFB 3O9WC 1EHAA 1D9KA 1T1WB 3NEOA 4M1CC 5IROC 4DIXA 1BVNP 3FB8A 5I0VA 3U6XS 4NJAH 2X7LA 4TRPL 3VXRA 1BOGA 1HWHB 5DJ2A 3MNZB 3ABLB 1AIZA 1PY9A 5IW1A 4RGNC 3ZXAC 3GXMA 5FB8A 3DVNA 2BERA 1F4XL 5I0ZA 4DFIA 3V7AG 2W60B 1NDGA 1A6AA 5EFIA 1QMUA 3L3KB 3ZYZA 1EO8L 3I9IA 1J5OH 3BP4B 1FIEA 1IBGL 1P53A 5JHDE 4Z78B 3MLYH 1IMHC 3LKNB 2PO6B 2Q2EB 1H8NA 5AEAA 3DX1A 4LQFH 3MOAL 3QFJB 2HWZH 3WUWB 3IGAB 2ZXAA 4JRWA 5E5MA 1JV2A 3AXIA 5KS9A 1VRSA 15C8L 2YXFA 5I0WA 1FJ1B 3CN2A 3N85L 2ENPA 3AITA 3DJRA 1WE5A 3II3A 4N0RA 3V4VB 5J11B 1NAKH 1KJVA 1ZHKB 4ONGH 2IPKA 5FFOA 4EXPX 1A0QL 5G2NA 2GC4C 4QF1B 3ZKXB 3OJMB 3T0EB 2XSKA 4BUGA 5J6GB 3B7UX 5D7KD 3AS3A 1J9QA 4F8OA 4KO5A 4XODA 4WUUA 1CDGA 4F80A 3APMA 4ELMA 4OFYD 2GSGB 4JO3L 4AK1A 1FBIH 3NSXA 3UPAA 4WJ5A 3UBHA 1AOZA 1T0NB 3V6OE 4ADIA 4XPTL 3QIBD 2GVYA 3GMNA 1DVQA 4MNQE 1DQDH 4P5MA 1Z9SA 1ICTA 1KB5A 1MAMH 2EDKA 2ZNXA 3VFVA 4CU8A 3TL5A 5ICUA 3CHRA 4QHUA 1W72H 5BV7B 5CZVL 1EWHA 1ORQB 3L4CA 1P5VB 2X4UB 1QHOA 4MZRA 2BC4A 1YJDH 2I27N 5IBLD 2IH9A 4APXB 3BKCL 5BVJB 2ERJC 4PW9A 4UZGA 2K9FB 4M1DL 4WW2A 1FNSL 3MRKA 5J5EA 1SM3H 4ABUA 4HH9A 2FO1A 4Z7IA 1ADQA 4LDCA 1VGKA 3BQVA 3MGAA 1EMTH 3PWJB 4IRZA 2BSSA 1FLTX 2X6BA 4NHUA 5E6IC 1B3JA 1JYVA 5EO9B 3F7VA 3CHSA 2JKRM 5E5UB 2R29A 3KH3A 3ZGIA 3HE7B 1VFBB 2MRYA 1NGPH 2EH7L 4M6ML 3ASWA 5IK3B 4NO0B 4ZX6A 3HAEA 1RZPA 2F7RA 3RNKA 3JUZA 3BLPX 5BS0B 3NRFA 4RAVA 1QRNA 4WVRA 3ZBMA 3ZMRA 1RZKH 4ONHB 5HI4C 5C2BH 3VM7A 4D9RE 2WBXA 3FQNA 5F7HA 1TQUA 1CCZA 5FOBB 5K9OA 4JPIA 4N28A 4X0KA 4ZNCD 1VEPA 5GS0H 4WGVB 1XB8A 2ID5A 2G3NA 1JXKA 4TSBH 1FV1A 3PQYA 4R97B 3D4CA 5CZKA 1TF4A 4ICXA 3TT3H 1XZ0A 1T7XA 2E8YA 4P5SA 5KS9E 1EAPB 5CIPH 3T0WA 3H9SE 5FYJL 2HVKB 3DMMC 2Y2WA 3TBTA 4HFWB 1FFNB 2CWRA 2CKBA 4JQXA 2D7NA 1DQLH 3GO1H 1R5IA 1U3NA 3MRGA 4U1SB 3NCXA 1MHPL 3AT8A 5T3XL 3AM8C 1CT8A 4PGBB 5IKCB 4PRDA 2RD0A 4HKBB 1A6VH 1F86A 2ZKXA 4FYQA 4HEPA 1KY7A 1XGYH 1CF8L 3IU3A 1EQWA 1F90H 4NZDA 4L1TA 3MN8A 3Q8BA 4WUUE 1D2OA 2ZT9C 4N6RB 3EYOA 1W8NA 4ELME 5C2UB 2ARJA 4D8PB 4IMLB 1OGAA 5E0FA 1TJXA 1K8DA 1JK8A 3IDIB 3TWCL 3UYRH 1BREA 1SJHA 3TPKA 3WIIL 4DQOH 4Y9FA 5D1XD 5DHVH 1NUGA 3Q6FA 3QZWB 2V7NB 4BE6A 1I85C 5I30L 4G6FB 4GPVA 1XSOA 2JCWA 4FMKA 2J56A 4P3DB 4JGUA 3M7OA 4YPGA 4BSVB 3AADB 4X7EC 2A83A 3US1A 3BZDA 3DHPA 1YEWA 4Z7UE 2MNJB 3SOTA 3O3UN 1CE1L 2DM2A 4EQ3A 1KT2A 3ARDA 3BAJA 4DVBB 3BZFA 5KBKA 1ZCRA 1SY6H 4U1NB 1LILA 3RGVD 5I5RA 1F41A 2L7QA 1J5CA 2V8LA 5F7DA 1K4DB 1MFEH 2D4DA 3TO4C 2BP8B 4YJZL 3FONB 1EAJA 4K3JH 4TNEA 3QRGH 3GSVA 4MCYB 3KWXA 1BBDL 1XL6A 1PG7L 3QUXB 1Z66A 2V17L 3IM1A 4L9LB 1NBQA 1MLCB 3B1UA 3X1GA 1GGCL 3N1FC 4GUOA 2P24A 1QRNE 3ARBD 2ZXBA 3LZFL 2VZTA 1HZKA 1PFOA 1UD8A 2CQVA 4Z3GA 1DUYB 4XH2A 2WCPA 4XOBA 3DV4A 2CHDA 3RWFA 1VA9A 2VSMB 2NXYB 4YSOA 4PP2A 3LB6C 2RIKA 3UBFA 4RSYA 3VXMB 1LK3L 1CLYH 4OZFB 1M7DB 2H9GB 5EUKB 3TH4T 2WN3A 2X3BA 2CMRL 5GGTH 5K9JH 2EH8H 3P02A 3QNFA 3WJMB 3UTZB 1YEJH 3HZKA 4IRSA 4K8RC 4D0DA 5HHPB 2EDWA 1M7UA 3G9AB 2BSBA 5K39A 5KVGE 1AZZC 3KBEA 4NO5A 2EIJB 3I6GB 3ZHDA 1MCRA 3E8VA 3CZLA 3DETC 3WO3B 4KPHH 1U91A 1Z5LA 2G60H 5DFWH 1X9QA 4YEFA 1TJGH 3D8MA 1KUMA 2GYSA 1KY6A 3NESA 4ZBJA 5FYKH 3SSGA 1UJ3A 1EHLL 4HG4K 1TVHB 5GGVH 1L0QA 2ZONA 1DYZA 1M1XA 2W65B 4C8XA 5JORA 1EHKB 1OANA 4KK5C 1JGEB 2EZ0D 2HFGL 4MDIA 3LMJL 4JR9H 3AT9A 3TA3A 2XBTA 2E0PA 4AOFA 3CFUA 1I8IA 2Y7QB 4ZPVB 3CDCA 2VYRE 2BVOB 3WTTA 3JYCA 2K4WA 3C8DA 5EWIH 4YR6B 4CSZA 2PTUA 1F8TH 2J8UE 2NY6D 3IJ7A 3GBML 3SY0A 2R2EB 4Y5VA 1DDTA 5IUSA 4WO4C 5D1ZD 3QEHB 2A2QT 1WCBA 3EF4A 1MFBL 3MUY1 4XVTL 5HVFB 1RSFA 2R27A 4TPRL 3PWNA 3FBKA 1UA7A 3S35L 4HKZA 1K3IA 2NY0B 2R1XB 1EGJA 1NPUA 3G6AB 4NN7C 1HXKA 3M1BA 4KRPC 2XICA 3HLAB 4YSTA 3FFCD 1KBWA 4JHVA 4KKRA 5G5DB 2NNCA 4YDZA 5I26A 2DEYX 5DJXA 1UWGH 4MA8H 1FZKB 1XIWB 3CZGA 5HYJB 1ETA1 5IQ9A 3UTTA 1FH5H 4HWUA 4ZMTA 3CU7A 3EOBB 4CN1A 2PW1A 4BSWB 3BZEB 1G5AA 3GSQA 4X9BA 2AXFA 5LBSL 4M56A 4B0MB 1T1WA 3ZKMC 1V27A 1J0ZA 5LHDA 2VUOA 3QZLA 3RBGA 5IHLB 3VRLF 2MPVA 3B34A 4JO4L 4UOW1 2WQWA 2V37A 3MNZA 2XN9E 4EO5A 1ORSB 2QHLA 3QUKA 2XRAL 2A6JB 2NY3D 3HG1B 3VACA 4I18B 5EF2A 2ITDB 2WWOA 2K9UA 3WHE0 1MFDL 2AJVL 43C9B 4S1RL 4Z77B 2W60A 4J4PC 1D5ZB 2N1KA 3P3RA 4PP1C 4TTDC 3O2DA 3ZZSA 4Y8AA 1MW1A 3QDGD 1T0MA 3BP4A 3TIEB 4YEEA 4GKOA 3BQUD 4Z78A 3LKNA 4X80L 2QDWA 3QFJA 1CF1A 1JVLA 1P9MA 3IGAA 5I6XC 4YXKH 4OH2A 4U33A 4HIEA 3MDJA 1MQ8A 3I6KB 1K2DB 3MRDB 1XF4B 1CG9B 2UX7A 1BQLH 3OKNB 4XAKD 4GSUA 3V4VA 1ZHKA 2Q6WB 4F9LC 2VLKD 1NAMB 3IPFA 1DVYA 4QF1A 5DEGB 3T0EA 5J6GA 3RKDD 1HKLL 1OAUL 3ATBA 4D0CB 3TFKC 1HOEA 3HE6A 4N2LA 1G9HA 1P5UC 2JJUA 1QFWH 4X0NA 4CUCA 2XYCA 1QSZA 3P0YL 1T0NA 4KROD 2FATL 1IQDB 2FQGA 4FYSA 1I8MB 5DD6B 5F7EL 4AGLA 3ULUD 5I1KL 3BAKA 2IADA 1Z2KA 2HMIC 4ZFOA 4OF6A 2WQAA 2EE9A 4TNVF 1ORQA 1P5VA 2X4UA 5GJSL 1ZS8B 3WXWH 1K4CB 4ERSH 5B3SB 4APXA 1KGIA 4N0CC 5E8DH 3WEOA 1F2XK 3FDWA 2NR6D 1SJEB 2EDOA 4W9CC 3CUPA 5EOTA 4HUXB 1OT4A 1DJYA 1HWGB 3PWJA 2WLJA 3HR5A 4IOFD 5IJKC 2H47C 5EO9A 1KCKA 1DVFC 1XQ4A 2QJDA 3TV8A 3AGVA 1MVUB 1A22B 1DBJL 1PG7W 3FUHA 4ODSH 1VFBA 4LLQB 4AQZA 2YRPA 4K9EC 1J9CT 3P4NB 4HZAA 1VB9A 4NO0A 2KLTA 4DGIH 4MMXB 1LVEA 4BFIA 2AJXH 4FQHB 4MNHB 4K94C 4QRRB 2Z6FA 5BS0A 2XZCH 4JM4L 4WWKD 5C0AE 4ONHA 1HHKB 2V2WB 4LASL 2VXQH 1E4WH 3EOAB 3IRPX 5FOBA 3RILA 1ADWA 2SEBA 2J7LA 4LFHG 3VFGH 1DCEA 3CMOL 4JE4B 4Q97A 4B3EA 1PY0A 4W9IC 3T0BA 4U4IA 2N1TE 3QEQA 3HC4H 5TE4L 3BPLC 4JFYB 3ETBF 1B2WL 1EAPA 1QYGL 2HVKA 1Z6JT 4HFWA 2YGPA 1GZPB 1GY1A 4U1SA 5JIDA 4QY8B 2YAPA 2PPEA 4EEEA 1DVZA 2BIHA 3GUFA 3GRWL 3T0EE 5IKCA 4HKBA 4LAJH 4Q89A 2YJLA 3IVKB 4W9ZA 4BWUA 1SJMA 3FTXA 4A39A 3FB6B 4S0HA 2EDQA 2FGWH 1OHQA 4IMLA 3KR3H 4ZS6D 3IDIA 1A66A 2FVNA 4KNUA 2XV3A 3KAAA 4PJFE 5JR1H 1T5WA 3FN3A 3FQWB 4J6RL 4XAWL 4I4WA 3D06A 4P3DA 4YL4A 5FO8B 5F93C 3MTXA 4WUKH 5D1QD 3PGFL 4JJOA 4N0UB 4BSVA 1CS6A 2GFBB 1DVTA 3S36H 5E9DD 4JQVA 2HX8A 1BPVA 4FQQA 4R96B 3V10A 1A9EB 4TQEH 3ZZLA 4UM9D 4PJ7B 4RESB 5HHMB 1U2CA 2FIKB 2NY5L 4DVBA 5AKSA 1JPGB 3OKKB 4AQAA 1I3RA 4U1NA 2BS9A 3KXFA 3BRDA 4K07A 2WANA 1OE2A 1WPCA 2VUKA 2PPFA 3NSJA 3SDDD 1QSFD 2J5LB 2BP8A 5TE7H 4XN4A 2NDFA 3NN8A 3P9MB 5AG9A 4MCYA 1RIUH 4CGUB 5ALBL 1OF2B 1G94A 3H3PH 3QUXA 2XI9A 3WG7B 2AP2A 4D3CH 4ZNEA 3RZCA 3VFTB 4L9LA 1KMGA 1G9MC 4PCKA 1MLCA 4K5MA 5BS0E 4R0LB 3LHPH 3ULVD 1ZA6B 1IQWL 1GGIL 4MBOA 3ZYIA 1BQKA 3WTWA 4P3WA 3APFA 4ODHL 3L5HA 3W56A 3QG6B 2GPZA 1DUYA 2VC2L 3GIZL 4X9HA 3IRZA 5KYYB 5AYUL 2DQDL 1R24B 2AQPA 1G7QB 4LPCA 3X1NA 3V8CA 2NY1D 3D69B 1KGCD 4K2UL 2EC9T 3VXMA 3MROA 4OZFA 1I82A 4HOZA 2P47B 2Z7YA 1C5BL 1U4EA 2OI9B 3P30H 4AJVA 2WXRA 4PLJC 3BYYA 1ZIBA 3QDAA 4O02L 1A6WL 3NJKA 3WJMA 4EIGB 3UTZA 1NDTA 3MRCB 4QYOB 5HHPA 1QHQA 4EPSA 2EQDA 4DN4H 1MUJB 3I6GA 5DJCB 4LNRB 1GGBL 1OCWH 4JMXA 3W11D 4YHZL 1T03L 5JOPD 4IM8A 2QGBA 3HIZA 3T71A 3VA2C 1WA0X 4B3VA 2W65A 3FZUD 3R18A 3B1TA 4BCYA 4DW2L 3HCVB 1JTTA 3BCDA 4CDHA 4XPGH 5D7JC 3SE4C 1GYVA 4L2LA 1CFVH 1NGYB 2ZYRA 5DD3L 1WAAA 4C57C 2FO8A 4ZPVA 3R0NA 2BVOA 3ARVA 2NNRA 2IO5A 5HBBA 4YR6A 1YECH 2FX7H 4BZ1H 3IMBA 2W95A 2R2EA 2JXMB 1K6QL 3BGMB 1CXIA 1DLFL 1C1EH 5C08E 4IIQB 4XNYH 3UMTA 1KCSH 4NKIH 3C6LB 4QRPB 4Y2DD 2AHIA 1F97A 3X13B 5JZ7C 2R1XA 3B9KC 3QQ9D 3G6AA 2EVHA 1EAOA 4M6OH 4HWBA 3HLAA 2IAND 2N3JA 4HGMA 5KAQF 1X4ZA 3J27A 1J1OH 4HK0B 4URKA 1JI1A 4V33A 4PRHB 4G7YH 4M29A 4GRWH 2H2PC 4ZNEE 4TNGA 2F6AA 1G6RA 3MODL 2IDTA 5D6CB 4DO5A 3EOBA 3LIZL 4OFKA 4QXUL 3S96B 1WZMA 4BSWA 3BZEA 4ONOA 1ED3A 1UYWH 3QC5X 3A6BL 2JELL 1F3DJ 4JKMA 5AW7B 1QATA 2RHEA 4AIZB 2GK2A 2WVVB 4Q7DA 1WT5A 1YY9D 4UILH 5DD5L 5DEFB 3SO5A 5L0QB 2NY7H 1WICA 1ORSA 1DN2A 3VXME 3HG1A 3UERA 2RGSA 4K8RH 3FO1B 4N8VB 1NCWH 2HJLA 4NN6B 3B8SA 3PFQA 3MLVL 3F5WB 5DK3A 3X3FL 4Z77A 3IDGB 3LDBB 3BP5B 2FJSA 3KL0A 4AJWA 2AJYL 3TIEA 3V7AE 2O30A 1GXEA 3BPNC 4EN3D 1L9QA 2VH5L 4E9VA 1LYQA 1IM9D 4FHJA 1NL0L 1SOQA 4Q52A