1WAEA

Crystal structure of h129v mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYVCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Observation of an Unprecedented Cu Bis-His Site: Crystal Structure of the H129V Mutant of Nitrite Reductase
pubmed doi rcsb
source organism Alcaligenes xylosoxydans
molecule tags Oxidoreductase
total genus 87
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2004-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1waeA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1waeA02
3GDCA 1ET7A 1GR7A 1XB8A 1AZNA 1ZIBA 3KW7A 1RZQA 2VM4A 4A2DA 1BYOA 3S3BB 1AIZA 5E9NA 1XMEB 1J5CA 4G70B 1GS7A 3NJJA 4A68A 2QDVA 2GC4C 4YSOA 2Y69B 4GY4A 1ASQA 2PP9A 2Q5BA 1E5ZA 1R1CA 4AX3A 1V54B 3ABLB 4WTQA 1KGYE 1J9RA 1MZYA 4E9VA 2P80D 2NRDA 1TU2A 4DPAX 2H5UA 1M56B 2CAKA 1BEXA 3H4HA 2BP0B 1KDIA 3TASA 1DYZA 1OCCB 2IH9A 4GYBA 3WI9A 5EHFA 4YVUA 2GI0A 1AANA 2GBAA 1E5YA 3EH3B 3OM3B 4K9JA 1E30A 3ABKB 4G72B 1T5KA 1AG0A 2HXAA 2XV0A 5I6PA 1JXFA 1IC0A 2W88A 3QJUB 1SF5A 3T6VA 4HHWA 2BHFA 5B7MA 2GHZA 3TA4D 1NPNA 4N4YB 4DP9X 1GS8A 4HAKA 2XV3A 3AG3B 5AZUA 3UGEA 1AR1B 4E9XA 2IDUA 2ZOOA 2OJ1A 5A7EA 4FAAB 4F2EA 2XUWA 1PZBA 3S3DB 1AACA 4W9ZA 2XU9A 1DZ0A 2W8CA 1MG2C 2YAQA 9PCYA 2IDQA 3OQRA 2YAHA 2JKWA 4UF7C 1XB6A 4YSRA 1PF3A 3NJMA 2I85A 3AZUA 1WS7A 3MBWB 1PZAA 2BP8A 1RKRA 4G7SB 5IY5B 2ZXWB 1BAWA 4QLWA 2YAFA 3QPKA 3D12B 3T6WA 2UXFA 4KNUA 3DIVA 3FU9A 3DKHA 1L9OA 1AZBA 2IWFA 4PAZA 3QJTB 5AFAA 1GY2A 8PAZA 1AZRA 1KDJA 2FT7A 5B1AB 1JZJA 2RACA 2CUAA 1AOZA 5FC9A 1ZPUA 4YSDA 2YXWA 2X87A 3ASNB 3NSFA 3WIAA 1JZFA 3QJVB 3QQXA 2XX0A 1M9WA 1TEFA 3FPXA 2FT8A 1PAZA 2XVBA 1OCOB 5B1JA 3NJLA 1A65A 1E65A 2HX8A 1HAUA 1NWPA 2WSDA 1AS6A 7PCYA 2IDFA 1IKOP 1ZDSA 3ERXA 3KW8A 4HZ1A 4HIPA 2QDWA 4GP5B 3PCYA 4G7QB 2XXGA 2BO0A 3ABMB 5I28A 5LDUA 4TXVB 1NIAA 4YSQA 4DP0X 2PPAA 3V9CA 4W1TA 1MG3C 1ADWA 2FNWA 3JTBA 5TK4A 2AVFA 4ENZA 1AAJA 4DP5X 5PAZA 3GYRA 4DP7X 2ZONA 2BP8B 2DY2A 4DP2X 5B3SB 2BZ7A 5I6NA 4BXSV 1JOIA 4HHGA 1GW0A 3IEAA 1PZCA 2A3TA 2BZCA 4AKOA 1OV8A 3FS9A 2YXVA 4YL4A 3FSAA 2HX9A 1IBZA 3ZX1A 5B1KA 5I6OA 2PP8A 2PPDA 3H56A 2JFCA 2AANA 2IH8A 4WKXA 4YSAA 3FQYA 2WO3B 4NAJA 4QKTA 3NJKA 1NPJA 3G5WA 5I5IA 4UAHA 2XWZA 1KBWA 3GXUB 1PNCA 3ZBMA 1CURA 1SHWA 4DPCX 4YSUA 3N2JA 1J9SA 1TKWA 2XV2A 2J57A 2YAEA 3QJQB 2CJ3A 1AG6A 4A2GA 1AZUA 3BQVA 2J5WA 4KOCA 2PPEA 3NYKA 2EIMB 3FSZA 3T6XA 3WKPA 4E9RA 3T6ZA 1V10A 2VN3A 4KNSA 2H3XC 3N55A 4KO5A 1AS8A 3OMNB 1OF0A 1XB3A 2I7OA 3SQRA 3S8GB 1W6LA 1OE2A 1L9QA 1OOWA 2VM3A 2AFNA 4YSCA 3QJRB 4KOBA 2P80A 2XX1A 3CVBA 1OE1A 2FTAA 1UATA 3FU8A 1IUZA 2IDTA 5I5MA 2FWLB 1W6WA 4BXVA 3X1FA 1F56A 2GB2A 3NJNA 4AI7A 1WA2X 2Y1AA 3OD3A 1URIA 1BQRA 3CDZA 1A8ZA 5AKRA 1RCYA 2UX6A 3FU7A 3TBCA 4AKQA 4A2EA 2QPEB 4AKPA 3DTUB 3IN0A 2XYBA 3C75A 4A66A 3T71A 2X88A 3HB3B 4EF3A 4FA7B 2GC7C 1BXVA 2UXTA 4HCGA 1JZHA 5I26A 2YAMA 3AG4B 1A4BA 3X2QB 1GSKA 4BWWA 1SNRA 2XLLA 4JKNA 3NJGA 1KCWA 1NIBA 4HCFA 1CC3A 2VW7A 1OCRB 4DP1X 3FQ1A 1CUOA 1BXAA 1MZZA 1PLAA 4YSPA 3AY2A 4JHVA 1NZRA 1IBYA 1JVLA 3QJSB 2J55A 3FT0A 2JXMA 2OV0A 5B1BB 3SBQA 3WNIA 1AZCA 3ASOB 1ZV2A 2VMJA 3HEIB 1WA0X 2BW5A 5D4HA 5PCYA 1FWXA 1KV7A 1ASOA 2VW4A 3MX0B 1BYPA 2FQGA 4E9TA 2FQEA 3NP3A 1JZGA 3PAUA 4G71B 5B7FA 5I6MA 5TK2A 4YSEA 3NSYA 1ILUA 1NIEA 1A4AA 1PY0A 1B3IA 4A2HA 3WKQA 3CDZB 1QHQA 3FU7B 4G7RB 1ID2A 2FQDA 3UADA 3PXLA 1NDTA 2CBPA 4KO9A 1OE3A 2PCYA 4UANA 1V55B 1GYCA 2VSKB 1MDAA 3SBRA 3FYIB 2B08A 3IN2A 1JERA 1J9TA 2DYSB 1SFDA 3ABGA 4N8UA 3UAAA 2MRYA 5I6LA 2H47C 4P5RA 2CCWA 4A2FA 1FFTB 1NICA 3AW5A 4GP4B 2PPFA 5F7BA 1CYXA 4M4RB 2DYRB 1HFUA 1CYWA 4BK5C 1ET8A 1GY1A 1SDDA 1NTDA 2VW6A 1JVOA 3IE9A 1WS8A 4YVNA 2GIMA 1J5DA 2MTAA 3PPSA 1NINA 1ZDQA 3S8FB 2PPCA 4CSZA 1ET5A 1N70A 3IBOA 1SJMA 1PMYA 2DV6A 2DWSA 2QPDB 3ZIYA 3NJHA 4E9YA 3FSVA 4KNTA 2HRGA 2UX7A 3BVDB 4BDVA 2EILB 3OMIB 2I7SA 1A4CA 1L9PA 4PCYA 2PLTA 2HZHA 3CZUB 3NP4A 4F7KA 2EIKB 1BQKA 2CALA 3UABA 4E9SA 3X1GA 3CG8A 1BXUA 2IWKA 3X1NA 2DWTA 2BWIA 4X4KA 5I5JA 2R7EA 3EH5B 3NJIA 1J9QA 1WAEA 1NWOA 3EF4A 1TEGA 4A67A 1BQ5A 1SFHA 1QNIA 4NERA 5B1JC 1EZLA 2J56A 1L9RA 3U25A 4HALA 3RYMA 2Q9OA 2AZUA 1QLEB 1SDDB 1X9RA 5ANHA 2FT6A 3EHBB 1JZIA 2TSBA 1JXDA 4L0PB 3AG2B 3FYEB 4DP8X 2FJSA 2IDSA 3FPYA 1PNDA 3SBPA 2HX7A 1WA1X 3S3CB 2B3IA 2GSMB 3EH4B 2YARA 1ZIAA 3NSDA 2YAPA 6PCYA 1RZPA 1SHXA 2WO2B 2HRHA 4RH4A 6PAZA 2EINB 4BDVB 7PAZA 4MFHA 3WG7B 1NIDA 1ETJA 3FSWA 3X1BA 4BWUA 3H4FA 1ASPA 1GS6X 1VLXA 3ZDWA 1A3ZA 3PAZA 4Q8BA 2R7EB 2UXGA 2PCFA 1OCZB 3UACA 3X1EA 3JT2A 3NT0A 4ZK8A 3TBBA 4CSPA 4Q89A 1NIFA 2YAOA 1SF3A 3PLYA 1AS7A 5D4IA 4GP8B 2BW4A 4F2FA 2LLNA 1JXGA 1N68A 4E9QA 1L9TA 2OCCB 1AQ8A 5I6KA 2N0MA 4P5SA 1I53A 3V9EA 4YSSA 5D4JA 4AZUA 1KCBA 2UXVA 4DPBX 2YQBA 2AZAA 3UAEA 3NSCA 3CVDA 2EIJB 4E9WA 2IWEA 2PP7A 4HCIA 1E67A 1PLBA 3NJFA 3PAVA 2BP0A 3FQ2A 4DP4X 1JZEA 4DP6X 3CVCA 4JHUA 2QT6A 3L45A 4YSTA 3T9WA 1KBVA 4M3HA 1X9UA 3OMAB 1L9SA 1M57B 2HLEB 5B7EA 4KO7A 2TSAA 2XXFA 3TU6A 1FA4A 4GXFA 1PLCA 1YLBB 4KO6A 2ZWNA 5F7AA 1ILSA 1EHKB 4NB7A 2BWDA 1PCSA 2FQFA 2IAAC 3AG1B 1KYAA 1HAWA 1W8EA 2VSMB 4BWTA 3WNJA 2E86A
chains in the Genus database with same CATH superfamily
3TVMD 1GR7A 4YLBA 3SOTA 4F8QA 1LMIA 3SQBA 3UDWC 4NZUH 1CDUA 5D5MF 4K9EC 4S1RL 5JPNA 1CVRA 3CVIL 4HU2A 1X7SA 4PJIB 1KTDB 2QFPA 4HJIA 1R1CA 4LB8A 2IGFL 4U1GC 4EPSA 2BSTA 4M7LH 4U1NB 1SLUA 2WQ8A 3C5ZA 4GKSB 3QJFB 5FKPA 1KULA 4FFZH 5HYFA 1UENA 2BVOA 4J6RH 4G43B 4U31A 3HLAA 1KDIA 1MSPA 3B3IB 4WTWA 2VN7A 1WBXB 3ELAT 1R3JB 4YVUA 3T4YA 4OAWB 2NXYB 3J7HA 4XOEA 1CBVL 4K3GA 5DFAA 4G2AA 4I18C 1T5KA 3RVVC 1KB5B 3RX5A 4AGLA 4ZRGA 1IC0A 3CZJA 1CR9H 3MKKA 2VDNH 3QZWG 1SF5A 3T6VA 1ZJBA 2CSPA 5C0DA 1OWRM 4XNBA 4QRPD 4PWJA 3APMA 4MLSA 3UGEA 3L4CA 1PFCA 3D34A 1CFVL 2X4RA 1NBCA 4LRIC 1T22A 2ZE0A 4D8PA 5I30H 1F2XK 1RP8A 1VAHA 5D6DA 5KBKA 3HG2A 3AXHA 3K8LA 3VXUB 3H3KA 3FDWA 3O3BB 2FBJL 2R0KH 9PCYA 5ADPH 3U4BL 3TNMB 1NCWH 5GJTL 3LZQA 4PSRA 2CR6A 1PF3A 4HUUA 5DU7A 2CZNA 2DS4A 9CGTA 2JQZA 2MNWA 4OM0H 1FL5B 2D0HA 3DDFA 1TZHA 3NGBB 4NUJB 4ABVA 3HPLB 4UZGA 3UP6A 3BD5A 5FYLH 4EZKA 4MAYC 4DNLA 1XGQA 3FB6A 4NGHH 5JO5B 5L9DL 4ZQKA 1WTLA 3AT0A 2PKDA 4B5ZA 4K8RD 1ZVSA 4ZAKA 4ZI8A 1I9JL 2OW6A 2NUTB 2ESVE 4GRLA 5F3BA 1TTCA 3NFSH 5DHVB 1RZJH 4PJFF 4PLOB 1NLDL 4HGWB 4IBQA 5FYKH 5I1AB 5KVEL 3QEUA 2CUAA 1DDHA 3ARFD 3DGGA 3M1OA 3M07A 3NSFA 1KCUH 4LU5H 4DZBB 2DJUA 3QJVB 5CJOL 4PRPE 3VACA 5D5ME 1N7MH 3NFNB 3TO4C 2VJ0A 3L3OC 1OCOB 4A6YA 4AK2A 3MBXH 2BS8A 4MXVF 5J11B 4MBOA 1VKXB 5C0IA 3BAXA 1IKOP 1UGNA 4HZ1A 4XR8C 5F88B 4ORZC 1VCAA 2HPTA 5A2CA 4NLHA 4P46A 5C0BE 1MUJA 4YFLI 5F7LB 3STLA 1BVZA 4TSAL 1YVLA 1EAPA 3ZYJA 5L2KE 2PPAA 4POZC 3HI6H 3B2VL 1U58A 1NGZA 3ARBB 4ENZA 1FVCA 3QRGL 1BQLL 1EFQA 2E8YA 3VXME 2APXA 3QIUD 2P52A 2ZPKL 2AQPA 5I6NA 2OK0H 3R06A 1ZTXL 4XCCL 3WFZA 1EVUA 4DGUA 3AU0A 3INUH 2VDMB 4OQTA 3AAZB 4JDZA 1X6LA 1G7LA 2BM3A 5I0YA 1C8QA 2FO8A 2H32H 2D7MA 4Y16B 2VLJD 3N3EA 5IMOA 3OR6A 4AC4A 1UKQA 1ADQA 4MXWH 4LSSH 5IUCA 1HKLL 4IMKA 4P9MH 2XRAH 1PGRB 3O6FA 4JKLA 3B9EA 1CXFA 1TVHA 1B9ZA 1YNTF 2E7MA 4NZUL 3MI6A 4B96A 3A47A 1KB9J 1OAQL 1YEDB 2FJFB 4ABUA 3F84A 2IBGA 4JY5H 4N0UA 5HI3D 1CURA 4AC2A 2BK8A 4YSUA 2D3JA 3N2JA 5DHYB 4R2GC 5IK3B 3BT0A 1J9SA 2XV2A 4O2CA 1AZUA 2YK1H 2VO8A 4OZGA 4TTDC 5L8JB 2E7BA 2P7TA 2PPEA 2IEPA 2OMVB 4WK4B 1AD0A 3ETBJ 4P5TB 4ELMB 4AT6B 2WVTA 5EA0H 1KJVA 1W0VB 3IXAA 1U8KB 1MW0A 1I1AA 1KY6A 4XC3H 1ZLWH 4WGKA 1N64L 3DLQR 43CAB 3HZYA 1Q72L 2EIDA 1G7IB 3K81A 2VM3A 5EZLB 4Z7UB 2C1OB 2X5PA 3U9PL 5C71A 2VDPB 2QTEA 2AEQL 5ICZB 2V5RA 5DJ2B 3F6LA 1DQKA 2WBJA 2OP4L 4JDEB 5ISZD 4N1CA 1R24A 2OMTB 4U6HB 4J3TA 4UT9H 2EYSA 1KPVA 2EE2A 3BPLB 3IF1B 2BNQA 2EUZA 1NCJA 1T5WB 2X0UA 2CKNA 1IGJB 1MJUH 1NDGA 3H0TB 3I6SA 5HGDB 3ZYIA 3QFJA 2PTVA 3V8CA 1VACA 1CD0A 2EECA 1A7PL 2R0KL 4NO5B 1KENL 2QHRH 4LCWB 3N42B 3RVVD 4LO9A 1AKJB 4GAYA 1S8DB 4JR9H 4BWWA 2F5AH 1TF4A 1QW8A 2JCCB 2Y7LA 2RALA 4PVBA 1T1XB 3U83A 5HHMD 5GRYA 2WQAA 4LQ1A 4YSPA 4S1DC 1NZRA 2K70A 5B39A 4FHJA 4NPJA 3OKDB 1UVQB 2AGJL 5I1EH 4KFMA 1D9KB 3SBQA 5ID1B 1BGXL 3MJ6A 4ZMOA 1MCPH 1ZV2A 4CMMA 3VDCA 5JOPE 5B3NA 4BFNA 1N19A 3C8KA 4QRRB 4FP8L 5PCYA 3MLPA 1I7ZA 3MRHA 1UHVA 5FYKL 4WK0B 1WICA 5MENA 2WZ5A 2UV3A 3MODH 2ZSWA 5DRXA 3ARZA 2OL3A 3OF6D 1YAZA 1CLCA 3HS9A 4LESA 4C8XA 1EQWA 1FP5A 1MCWM 5C8JB 4BA0A 4MAYD 3TF4A 4ODXA 1I3GH 5IHBA 1XXFC 1JRHH 4MNQD 1Z6JT 4Y5XC 3WN5A 1V8HA 5D7LD 4UZSA 3PWNA 5DDHA 4NQVA 4QRQB 3QJXA 2H45A 4UANA 1KZQA 3C5JB 2CNZA 3ZZLA 4BRJA 1X5AA 3ZE1E 1CF1A 4BQ6A 3F7RA 4OZHE 3K3QA 4HMCA 1DVTA 2YD4A 1K5WA 5ALBH 4M3JA 3I9PA 4MMYA 2VLLB 2ZYSA 4KX8A 1Z5LB 3BLPX 3L5WA 2O5YH 3HKZA 2OTWB 2CCWA 3TO4D 3U9UB 1MCRA 2OK0L 2EXWC 4GAJH 3BH9A 4GP4B 4F2MB 4BZ2L 4Q0XH 4HGMA 5E00A 1TZIB 4C4KO 5AQ0A 1O5PA 4B53A 3GGWB 2J8OA 2XACC 3W11C 4XB8A 2CR0A 5FO7A 3FNKA 4UBDC 4KNQA 4QXWA 1J5DA 2DMCA 2DPKA 4POZD 4LNRA 1UD4A 1I7UB 3O2VL 5T1JA 4CSZA 3IBOA 5DVOA 1QEWB 4EQ2A 2C9SA 1BMWA 4UOW0 4PRHA 3MV8E 4PJ9C 1TT6A 3FSVA 1GYVA 5AUMB 2FYYB 1BG1A 3QO0A 5K9OB 2EILB 4I3RH 5KBDA 3SQOH 2H3KA 3FOMB 2NYZA 3PNRB 3NP4A 2NY5L 2W91A 2F8IA 3UYPA 5IVXB 1PBYA 3W9DA 5IROD 1THCA 2H6PB 1L0PA 2AQRA 3QP3A 5K1JA 1AD9B 3U36B 3V0WH 3BPCA 3N50A 1VPOL 4UINL 5H94B 1F1AA 2NNRA 4FKEA 4K5MA 1BAFL 2BWIA 5HDRA 5AOIA 4ZMWA 4Y2DA 1GZQA 4MQXC 1P9MA 4XC3L 1YYML 3MRGA 2VDOB 4UB0L 5HGHA 4XTRC 5TDNA 4HH8A 3O3EA 1KJ3L 2ZXQA 5EEWA 3RU8L 4JFEA 2J56A 2FEJA 5AD0A 5C86A 5J06A 1CG9A 4GIAA 3RRQA 2FX7H 4PJXB 2B7DT 3I6GA 2R56L 3BQUB 3RWCB 4JREB 2YFNA 1JUFA 4TTDD 3FYEB 1UD3A 2IAMB 4K9EH 2IDSA 4H26A 4CN4A 4KU1A 1WGVA 4W9LC 3K6FA 4G7YH 5C92A 1CVSC 1V5JA 2NY1B 4JGUA 4EDXB 2AV1B 4EIBA 4L3AA 3OHXA 1LHZA 3WSQH 2YOCA 4PRAB 5TQ0H 3J27A 1J0KA 1NAML 1TJMA 1R3HB 3V6OC 1BJ1J 3RKPA 3GI8H 2D7NA 3WAKA 2ZUYA 4HKJA 1FZKB 5HDOA 4ZOCA 3BFQG 2ZNWA 3H4FA 3LKSB 3Q44A 5KVFL 4NENA 2QKIA 1F6AB 4WFHD 5G2NA 1HHHB 4PJ5B 3F62A 3PJSB 2BY2A 1P2CA 3EGSB 2EYTA 3MXVL 5A2FA 1AR2A 1UWGL 2WO4A 5I1EL 1NFDF 4HC1H 4OD1H 1WFOA 3VFGH 4C4UA 5I76A 2G4EA 2YEVB 1SF3A 2YXFA 1EO8L 4O00A 4GP8B 3LRSA 1JXGA 3R0NA 3TT1L 3D07A 5DFWH 3ARVA 3QG6A 4HFWA 4IU3A 5CSBA 4K8RL 3LZRA 3QO1A 1ONQA 4GINA 1WZMA 5F0MB 5CEYA 5LVEA 5EUKB 5C07D 3QI9C 4KDTC 4KMTH 4NZRH 4HHAB 3UAEA 5HVFB 3T3MF 4E9WA 2LU3A 1J5OL 3GJFA 1A6AB 1AVAA 4KHTL 1WUZA 3HZ3A 2WZ0A 1QFHA 3VXSE 5H2BA 1JGDB 3CVCA 1KYFA 3FFCE 3G5ZA 4W9CC 2CBTA 5AVZB 3VXQB 1AE6L 4PI0A 1UXSB 4LDLB 1JSYA 3P2DA 4LVHB 2HLEB 2DQUL 5HVGB 4L2YA 4KO7A 5L0QB 4G7VL 1G6RH 4GXFA 1YLBB 2O5YL 1RIHL 4DOHB 3UTZB 3O2DH 4GAFB 2BRQA 4FTVD 3J2PA 2YFOA 3CLFH 4F80A 5CINH 2ODIA 1JPSL 4KKLC 3KVQA 4M29A 5DS1A 3BPOB 3QWOA 4IOSA 1G6VK 4L8CB 3PWLA 4HIXL 4HKZA 3QZLA 1E43A 1WZLA 5CEXB 3T8XA 2PR4L 4GSUA 3OR7A 1I8MB 4FS0A 2WZAA 3G04A 2XCMC 3N40P 4UDUA 1M3IA 2F5BL 4X6DA 5JUEL 3E38A 4BSVB 2CHXA 3E8VA 3S88L 2V4LA 1UD2A 4XWGL 2IH1B 3BUTA 1JWUA 1RVFL 4MXQC 1J0YA 1KLUA 2EXWD 3K7UA 2ORBH 4HUWB 2A5UA 5BRPA 5HJGA 2YJLA 3HCVB 2GJ6D 2MHAB 4JQXC 4YBHA 3W11D 4GT0A 4JFFB 3JWNE 3I3BA 2LTQB 4Z77B 3Q5TA 4L1DA 5FIEA 2HT4D 4JJHA 4IRJA 4UBDD 5I8KH 3L7FB 2J4WH 2EC8A 1ZGLM 4Z7OF 3TGXA 3JUYA 3QDGE 3QJUB 1HHJB 1NFDE 1WSST 3D85D 3HBZA 4HD9A 1E9OB 4OLEA 2VLME 1S3RA 1NPNA 4N4YB 5EU6D 4PJ9D 4LPYA 3QXAB 3BDBA 1T0OA 4G6FD 2XG4A 5TE4H 2WLKA 3MUUA 4AIEA 4MJ6B 5JYMA 2W94A 4NIYE 1KTBA 1U8NA 4P23B 4ZX5A 1IE5A 1YMMB 1H3PL 3D39A 3IDGA 1D5XB 1OT1A 2F54E 1Z3GH 4UV7L 2FSEA 1P7HL 5CXPA 2IDQA 1Z2KA 3KLLA 4JS7A 5AAMC 4ZMYA 1XGRB 2BMKA 1U3NA 2FB4L 4M8VA 2APFA 1JHKH 1QX1A 1VCBC 1H8LA 4IKJA 4XTRD 5T1LB 5FECA 5IV2B 2CHNA 4PY8J 1XQ4A 4LASH 1LILA 2F53B 3B9KB 1DN2A 2DTSA 1VZHA 2GCYA 2BSBA 3O3DA 5C08B 3U4AA 3VE0B 1JV5A 2UWEF 3PUCA 2CO2A 5KOVC 4ZTPL 2HN7A 5TF1H 2C3HA 5JIDA 3RFZB 1HHIA 4WWKA 1ETA1 3GS0A 1AZBA 2IWFA 5FGBC 3TPUB 3UMTA 5DCCA 1BIHA 2AEIT 2BX5A 2ZSVA 4GSRA 4H8UA 2NTFB 4O2EB 4ODTH 4CJ0A 2IC2A 3S3JA 3MRMA 1ZLWK 1KGCE 5BOJA 4XCEA 1UM5L 4M8RA 4OCWL 4DKDC 4QYOB 1YN7A 2AK1L 4LARL 4C58B 3RA7L 3VXRA 2Y5QA 2R2CA 1RFDH 4NKIL 1KBBA 4Q2ZA 4UQIM 5EEYA 3WXWH 3SDYL 2XG5B 5C6TL 3FUHA 3G08B 4NNXA 4PS7A 2IQAB 2XXGA 2P5EE 1PG7L 3CBRA 3UZVA 3F6IA 4JKPH 3IBEA 1E5UI 2APTA 4AW4A 5T3ZE 3ZYOA 5DEFA 3LKQA 1KJ2A 2R0LH 2XIIA 1CQYA 3LS5L 2ZWSA 3UPCA 4DP5X 5EO1B 1KXQA 2VITA 1BECA 5GGVH 4DP7X 6FABL 2Z93A 2DY2A 3UCRA 1ESOA 2B1OA 4YGVA 3FB7A 5AVSB 2FEEI 4ZFZA 5CUSH 1OAZL 4YXKL 3DBXA 5KYXA 2IXQA 3QUMB 4Z7OE 2JKXA 1BVKB 3SO5A 3B6SB 3C2AL 2V7HB 2YXVA 1MVUB 3AXIA 2A73B 4AEIH 3QDMD 1IE4A 4IBZA 4U3CA 3U6RB 3QI9D 4MJIB 2CLVA 5AZ2H 1UUNA 3DV6A 5BQ7B 5DUMH 4WKXA 4XNUL 1ORSB 4NHUA 2WO3B 2HMIC 2X1PA 3EYFA 3MNWA 4DJMA 4S2SA 1MIMH 1U8PA 2FH6A 3ZBMA 3O2WL 3TC9A 2WOYA 4PGBA 4MS8C 1GKEA 5I1CL 2IAND 2I32A 3QJQB 4U0RB 1BF8A 4TN9A 4QUOA 2Z31C 4NT6A 2NY3C 1NCTA 4HZLA 3AMKA 4XGZB 3ZZQA 1P1ZB 4E9RA 5HGGS 2H3XC 2YQ3A 1IMHC 3BH8A 5FOJA 3BUBA 4R0LA 1A3RH 1DBKH 4JFDE 4MDIA 3TBTB 4FFYL 4QRSA 3LKPA 4L8DB 4F1SA 4HW6A 3H2WA 1RJYB 2Q8AL 2CRYA 4TVPD 4HPYH 4NOBA 4OZIF 3KPNA 1DSFH 3S34H 3QWRA 4XVJL 4BQBA 5I5MA 4O02H 1MCOL 3X1FA 3HS0A 4L5FL 4FZEH 3R19A 1PD0A 3PGFH 1KLGB 4MXQD 5K9QG 4WUUB 2XBTA 1FSKB 1JN6A 2EH7L 1UG9A 4QCIB 3BAWA 5AKRA 4XVUC 5HPMB 3MRKB 5CMAB 2KQMA 4HWNA 3D18B 3DTUB 3AC0A 4R5XA 2E7CA 3OKMB 4MCZA 3T8VA 4OFIA 3HR5B 5F1NA 1MFUA 3CFNA 1JZ2A 2N4IA 1SLVA 3MTXA 1ZLDA 4H8QA 4X4XB 2UVFA 4BGLA 2ERJB 3QQ3A 4M03A 2AF2A 4O5LH 1EAJA 4MD5B 4U1SA 4MZRA 2XLLA 4X2UA 3HBQA 5FFOA 3HC4L 3RPIB 1DFXA 4MDJA 4PRPA 3UZEC 5I17A 1KCWA 2Y7OA 4PJ7E 4TQEL 5D5MA 4LCCA 4WTZG 1WT5C 2NZ9D 3V0VB 4F9PA 1IBYA 1JVLA 2VR5A 3MC0A 2HH0L 3R1GH 3NCYP 4LBAA 1UQSA 2EDFA 4KJPC 5KZCD 1AZCA 1J5IA 1XEUA 4K7FA 5E99L 4GSDL 1WA0X 1I75A 4B50A 1KIQA 2BW5A 2YZ1A 4NWTL 1DQMH 4JEGB 2DAVA 3BO8A 4PJ8B 5C0BA 3O6MH 1FH5L 1HCYA 2CO1A 4TSBH 3FU0A 5L2KA 5IB1B 1BP3B 3ISRA 4GRWB 4PV9B 4WENB 2EIZB 3CBJB 2R2BA 3FONA 4IGBB 5JW3H 3VXMA 4Z3HA 5JOEA 2EUWA 4PW4A 1UD6A 5CBAA 4LZKA 1Q94A 1GGUA 3I9GH 3R7QA 3NQIA 2YGQA 3C87A 3ZGIA 4Z23A 1QA9B 3HTLX 3RIFK 3PV6B 4N2FA 3GTVA 3ZL4H 2B1AH 1F97A 4JM4L 2P8LB 2BXYA 1RULL 1XR9A 2HPOA 2B08A 5J9PB 5BJTB 3BZEA 1QNZH 4JZNB 4KUCD 4F3FA 3GSNH 3MUGB 2N1KA 4X5LA 5KW9H 2XWBA 3TIDA 4CC4C 2NLJB 2ZUQB 3AXLA 4D2NA 2YD9A 3CD4A 3BD3A 3QEUB 1RSYA 4PGJA 4L3EE 3VQLA 4OZIE 2DYRB 2VZOA 3DIFB 5AYUL 4Z3FA 5FCUH 4BK5C 5CCGE 3UTTE 3C5SB 2VW6A 1P5VB 1JDDA 3Q05A 1QFUH 3NPSC 1IT9L 2GYSA 4UAOB 3UTQA 1NMAH 4HAFA 3MLWH 1OGSA 2DI9A 3IKCB 3IT8D 5AZ2L 2MTAA 3UG5A 2E7LA 5B1CA 1HHKA 4AIXA 1FDLL 3QDAA 4FNRA 5GISL 4M1GL 4J4PC 5IB5A 3BGFB 1OD7A 1YA5A 1OSYA 4Z95H 3CLEH 3UJJH 3OAZK 5ENWA 4WEBH 1MJ7H 1I3VA 2VMCA 4L4TB 5E4AA 3GRWL 3J8F7 4TPRL 1A2YA 5EFIA 2QQLL 4A7TA 4GBXA 2XFGB 5KJ4A 3QJHA 3V0IA 4HA1A 4ZUWB 5CR8A 4Y1AD 3GXMA 1JGLH 3C5XA 5AW5B 3WTXA 4FQHB 2FE0A 1V7ML 3HG4A 2AJXH 1D6EA 2EDBA 4OJFL 4J3OC 2DN7A 2VMEA 2HMID 4D3CH 3GQFA 5DZOA 3RL1A 5I8CB 2NY2B 1LXMA 1BCIA 1RHHA 4LSVH 5AVTB 2QQQA 5GS2D 2E6PA 3H55A 4XOBA 4EI5C 2DQTH 3TYFB 2VUOA 4MS8D 3N44B 2XZZA 4LLUA 2VLKB 3B2MA 3NH7L 1JZIA 3OKKA 1AHKA 2Z31D 2NY3D 3AG2B 4L2LA 3WTWA 4WW2C 5C7XH 4G42B 3GXNA 4YDJB 3GZKA 5F7DB 2BIMA 2XXMB 4TVPH 4UQ2B 5D7JD 4PH8A 3O4LD 4N25A 1OT2A 2VN4A 4JRYB 4KHXH 6PCYA 2WUCH 3HVDA 5CCKL 2E27H 3CAFA 3BUPA 4FQJL 3HNSH 1GTNA 3WFCH 3N1PC 4EI0A 4ZS7H 4ZZKA 5DYOB 1Q0EA 5CZVL 1VEPA 1ORQA 1OB1B 3T0WA 1U3HB 1OARL 3PWUB 1G7JB 1N10A 2R7EB 4ZUUA 4N0FB 4QXVA 1H3XA 3DMMA 4JHAL 3STZA 1XL4A 3FF7A 4NKDA 3ME0A 2YSTA 3N0PB 4LIQE 1ULVA 2NNAB 1M7IB 1CLOL 4ADJA 2FIKB 4JZJC 4F2FA 2AKRA 4G5AA 1CDHA 4O51A 2FZ3B 4JRXD 4P2QB 5IF0A 4I0PC 4U1KB 2XN1A 3VG0H 3K5SA 2PYFA 4OZHA 1JCKA 4TSBL 4Y19E 2OYKA 1AJ7H 3S2CA 5JXEA 1GGBL 5JHDE 5D4JA 5GJSH 5IQNA 2P46B 3QC6X 4Q9CA 3DARA 3A3YB 5FA4B 4KTEL 4XPHH 2AHIA 3Q8CA 4Z7VA 2YBRA 3LNGA 4KJPD 5E70A 5JDSB 1ZANH 3RGVC 1L0YA 1M1XA 3D69A 3GRBA 2APWA 2Y1VA 4JHUA 1JWSA 1EZUA 1KBVA 2HP4A 4GG6A 2FL5B 5JIHA 1QBAA 1M57B 4HYTB 1CGSH 2DI8A 1JGVL 1IGTA 1RUML 1IX2A 4NI3A 5SWZE 5E8EA 4P4KC 1AXSA 1QWNA 1Z66A 2OTPA 2WD0A 3ZDYB 1DBBL 4BFKA 1I7ZB 2O6CA 1INEH 1IBBA 4HMDA 1L7IL 1OY3B 4M6OH 4Q9QL 5C2BL 3MV8A 1XD0A 4N2EA 3GUTB 3HHSA 4BSWB 2ZG3A 5AW3B 4WY7H 5LAXB 5TDOA 2Z8SA 1RUAH 1HEHC 3QR0A 4DFHA 3FCGA 2QQKL 1JNNH 1T04B 2IFGA 5IVZB 1NMAL 3RWHA 5MEPB 3VI3E 3BISA 1FORH 1RK1A 3B2XA 4ODHH 1MW3A 3HE6A 1ASQA 4QO1B 3ILQC 1E5ZA 3QZMA 3NFPB 5TPWL 3ABLB 4WTQA 4RWYL 4R5TA 1BYNA 3MACH 3UBXB 1WE5A 3RDTC 5I1JH 3UJJL 5L6YH 3QNFA 5CIPH 4AZ8A 1BM7A 2F74A 4LVNB 1GZHC 1MHPH 4RAVA 3VNZA 4IU2A 5FOBB 4OB5L 3AVEA 3HG5A 3WNOA 2HTLC 1LEKA 3G9AB 3PF2A 4JB9L 3ARGB 4NO0D 2VJXA 4GFTB 3W1ZA 2B9BA 3ZE2B 2Q20A 1UWFA 3A6CL 4OF0A 5HXMA 3CFDB 3G9VA 1EK3A 3CUPB 2COVD 3C8DA 3DX7A 2NW3B 3ABKB 4DKTA 5EF3A 3D9AH 4OH2A 3MOQA 3IDYB 3LH2H 1I1FA 3V4PA 2I9LB 3U7WH 4AL8H 4GMSL 2A1WL 1HE7A 3MRNB 2XKNB 4J4PD 1MFCL 3WJLA 1WQVT 3ZK0A 3V7AG 1CWVA 4PJCB 3EAKA 1I1RA 1URLA 2W07B 2ZKHH 3G6JB 1NJ9B 3HNVL 1O9WA 4QJ4B 5HVHB 2DQFB 3DX8A 4DKFL 4Z3EA 2QEJA 1W2KT 4JZOA 3QXDA 1JZ6A 1AACA 4N8PA 3HMXL 5A2AA 2OR7A 1LO5A 3QO0B 5C7XL 3EJSA 4AQAA 1M71A 1IC7L 5FYJD 2JKWA 2WB7A 1HVXA 4OLXL 2GIXA 4X99A 2ADFL 3S37H 1FNEB 2UZIL 1F5WA 1MFDH 1TQUA 2OZ4H 4J3OD 2EICA 2F58L 1GIGL 2WUCL 1SQ2N 2IH3B 1YQ2A 5FDYA 1AFVH 4ZMPA 5IJKA 2QL1A 4OCSL 5EBLB 4Z7NB 2X38A 4WUKL 1X6NA 4EI5D 4ZW3A 4XBPA 3NEXA 5D6CB 3DWTA 4NQEE 4F7CA 1B0RA 4FQ2L 1O7DE 1UTDA 2CRZA 3WY4A 4CU6A 2E47A 4P48A 2J1ZA 3X17A 1NEPA 3ZHNA 5C0CE 5GGRY 2FT7A 4A38A 2JIXA 4Y4KA 4KXAA 2VXVH 4H5SB 1I3RB 4LLWB 2C4FT 3IDIB 1C5DB 1QZ1A 2HCZX 2ZYRA 1MW1A 1JF6A 4QXTB 3WIAA 1WBYB 5D7IF 5AZEL 4AY0A 4DN3H 3CPUA 3ZL2A 3GSQA 2JB6B 4E42B 4G8IA 3HUJF 4YNYB 3I50L 4AQ1B 1ETB1 1SLXA 5JPNC 1E65A 2AJUH 3FAXA 5G4OA 4R7DB 4Z0BL 2Q8BH 2G2PA 5KWYC 3VTMA 5LBSL 5JMRA 1SJHA 3C5ZC 3E6FA 5I28A 3DRTA 5C0AD 5CU9A 3EO0B 3QFGA 4N2LA 4XVTH 1AAJA 2V17L 3V4UL 2UZPA 4PJEF 4ZW7A 3POHA 2LGNA 2CA3A 4WNQB 2QQNL 4NSKA 1U93B 5JIKA 32C2A 4MJ5A 1WTGT 3VFRB 4I0PD 2J43A 1MFAL 2OMWB 1W72A 1HJCA 4N3TA 4XC1H 1EVTC 4P2AA 4QJ5B 5AW0B 4GKNB 4MAUH 3BIAX 3GIZL 1FVDB 3WDJA 4X4ZA 1R75A 4H1LA 3RNQA 5JW5A 5AKSA 4HS8L 4M6OL 4NOFA 5T5FH 1XF2A 3FFOA 1OGAE 1ZTXE 4F15B 2ITEA 1MHEA 1FL3A 3IFOB 3RGVD 2XWZA 1KBWA 1XZ0B 2GBVA 1LEGB 1MRDH 2OMBA 3V5HA 2UYLB 1NM4A 4L8BB 5I9QB 1FORL 1S9XA 3QYNA 1QR1A 5EUOF 4C56D 1HEZB 2CBMA 3CVHB 2JI1A 1BQHG 4UIKL 4P4KD 3GTTA 1JPST 3MACL 1EMTL 1XIWB 3QDGA 4LLVA 1OIOA 1NFDA 2VYRE 3PHOB 3SGKA 4C83A 3SE4A 5I1JL 3GLEA 1AY1H 3GXFA 3H1ZA 3P4NB 1ZLUH 2OQJA 4HUKB 3K2UL 4XH2B 5HHQA 4OKVA 5HYQA 4ZAKC 1AO7D 4HWUA 2DIEA 2V33A 3JQOB 4GRLC 2BS9A 4YDKL 4F37K 4RESB 4OUUA 4FF9A 1NCIA 4TNVK 1ROWA 3BVNA 2DLGA 3QJRB 4OCMC 4S1SL 1KTCA 2F54A 2GTWA 3ZHKA 1QLRA 2J5LB 1YYLL 3FU8A 5D7IE 3MYZA 4YC2C 2FWLB 1NMCC 3FK3A 3ILQD 4BXVA 1LNUB 3UC0L 3HUJE 3SPVB 4E41D 3SZKC 3IJYB 1GGIH 4AI7A 3RDTD 4W70A 4RGNE 3AUWB 1HSAB 3DK0A 4I0KA 3SY0B 2H2SC 5GS1B 5ILTH 3O9WB 2UX6A 5C0NC 5EEXA 3O41A 4P46C 2XOTA 3MJ8A 2HTLD 1JWUB 3SEPA 1CDGA 4EEEA 2CD0A 2N1TE 5EG6C 3WO4B 5AB9A 2B1HL 5DRNB 5GGUA 2CGRH 3N9GL 4RX4A 3TO2B 4AJ0A 3D30A 3INOA 3RZWA 3VYNA 1JGEB 3V0HA 4ABQA 2JLLA 3D2UA 4PTUA 5AL8A 4Z7WF 1R3KA 1DLFH 1U8MB 4PJEE 4XN5A 5B21A 3IMSA 2YQ2A 4GO6B 3CZKA 4QIRA 1AQKH 3LN4A 2YQGA 1NIBA 1NGQL 2VW7A 4JRFA 2BNRB 3FTWA 1FCCA 5FYJH 3PDOA 1LO3L 1CF8L 1E8YA 4M4RA 3OAWA 1UA6L 1HWHB 4J3OH 3BEVB 1EEUA 5D1QC 4F7TB 3U7YL 4RZCA 5AVWB 2VC2L 1C5CL 5D96B 5E5MA 3P0GB 2XG4B 4I2XE 4IMKC 5I0DA 4XX1E 4EN3B 2P5EA 2IADB 1WFUA 1PX3A 1U8NB 5FYLE 1H5BC 3DHUA 3NP3A 4YOKA 2O6PA 2YGNA 1OANA 4PY7B 1WAAF 1F4YL 1KYDA 3HRPA 3QORA 4W6WB 4JGNA 4L1LA 1W9XA 2IIJA 3V6FB 1B3IA 3K4AA 3CDZB 4J8RA 2CO7B 2Z4TA 3FU6A 3S4SB 3WXVH 4XAWL 1E28B 3B9VA 1ID2A 4CVZB 2HVBA 3P30H 1FE8H 2Z8WC 1NDTA 1V27A 4PGDA 3MRLB 5FYKE 1NBYB 4ERSH 4KO9A 5EIQA 7FABL 5K9KA 1ACZA 3DX0A 3WEAA 2E76C 3BIBX 2DJMA 2IOMA 4U6XA 5EOQL 3QUXA 4LLYA 3VWJA 1S7XB 1S7RA 4KV5F 3SZ6A 1I1AC 1C08B 1DLHA 1J9TA 1SFDA 1LP9B 1CBJA 1IAOA 3D8MA 3EZJB 1R0AL 3V7MA 2DQMA 2ID5A 1RUPH 1JHLH 2VLRD 4JO2H 3WTUA 1G7PA 1M4KA 2JXMB 4X7EC 2E8ZA 2VERA 4B3VA 1U6AL 2Z91A 2X7LA 2WBJC 3WIFB 3GBNH 3OKYA 1JVOA 4FG6C 3VI4B 3C5ZD 3FAWA 3VXNA 1Z9LA 1S5IL 5EOCH 1CLVA 4N1HB 2GIMA 3VFPB 1CLYL 5J0BA 4YLQT 4KBPA 4BM7A 3K6SA 2BOCA 1BFOA 4B97A 1KBKA 1S7VB 3K6OA 1B2YA 5T5FL 1KPRB 1N70A 1T3FB 5L4FA 5J7CC 2ZCZA 5I19L 2DV6A 1QSVA 2CMRH 2VDLH 4L29A 4YXHH 5KN5A 4PJGF 5T3XH 2UX7A 4KMQA 3FCTB 4BDVA 4QNPF 3DBSA 3NDZE 4JFDA 3C60B 3BD4A 1JMZA 3HAEA 3F58L 4AUJA 4IIQB 4F7KA 4HLJA 4PBVC 3DO7A 2UZYA 5T33H 1CL7I 2IFFH 4PRIE 4ZODA 4N0YL 2IWKA 2IALA 3ATEA 1I7TA 4L1TA 3UO1H 4XNXH 3NJIA 1JPTL 1NWOA 1AGCA 1ECYA 4J1UB 1I7RB 4FFWC 4AYDC 3PHQB 3VX1A 4UV4L 2DWXA 1FO0A 5HY9A 5BS0E 1V3KA 2DM2A 2EACA 2Q3XA 2WW8A 3FO2B 1CQKA 1MWAH 2X3BA 4E0RA 3RYMA 1F4XL 1RXLA 1OAKH 3HG1B 4N2IA 4FULA 4HUXB 1WAAE 2X4TA 4L18A 3L3HA 1EFXB 1MCFA 2CIIB 1EEZB 2ARJB 3HI1B 2BC4A 2FJSA 1EWHA 4QF1B 3FRPA 1TETH 1MJJA 1Y6MR 2BCMA 2SEBA 3WN5C 1XX9C 1OTTC 2H32B 3N1MC 5ILTL 4BH8A 4YHNB 3S5LG 1U8JB 4UILH 4N0CC 4ZAKD 4PJ7A 5EU4A 1HILB 5AVQB 5FM8A 4ZJ9A 5KTEH 4FMKA 4GRLD 3W5NA 1QBBA 2PWDA 4DIXA 6PAZA 5E8OB 3ULSA 4KV5E 3U46A 4JFOB 1CE1H 5JQHC 1NBVL 1FZJB 2EYRA 3P77B 2H4EA 4G5ZL 5IMMA 2QV4A 3MFGB 1YMHA 3UG4A 4CAGA 3POCA 3H2QA 2CDEA 3BFOA 1G0YR 5K9JH 2GHWB 3KMDA 4AVKA 1ZGLP 2Z9TA 3LQMA 5GGTL 3QCTH 2UXGA 1PZ2A 2F0CA 4OLZH 2HAZA 2H2SD 1XAUA 4QRPE 5E9DE 2Q10A 3EFFB 1E8XA 2XQ0A 3VM7A 5C0ND 4P46D 5DZVA 1HYSD 1XF3B 5ESQA 1LE9B 2WJ5A 3GIVA 5KVFE 5F21B 4AVIA 2LVCA 4FNLL 4QRUB 2E56A 2ED7A 2AW2A 2AQQA 4RMVA 1Z32X 3QA3B 4EMZA 4ZFOB 4Z3TA 3DVGA 3V9EA 5FHAH 2X89D 3GMMB 1J8HD 1KCBA 5LXVA 2FBRA 2QMJA 1LEIA 2ESVB 4DKAA 2DZEA 3TCXA 1LO2H 1CI3M 4Q6KA 5HP5A 3LPFA 3HRZC 3TLRA 1MJ8H 2GT9A 3Q6FA 1JF1B 3NJFA 4L3EA 5DEGA 4OZIA 2A83A 4OZFA 3LKOB 5D1QD 1I9RL 3U1PA 3UTTA 5D9SB 3R8QA 4Y2DC 5DQ9B 4POYA 3QXWA 1AGFA 5B7EA 4P2CG 1E8WA 1E4WH 2ZOUA 3IDJB 5DUPH 5IMKB 1MFBL 3L2NA 3DUSA 3EYVB 1TJIH 3TA3A 1OKEA 1ZJAA 1EHKB 4CKQA 1WZAA 3D7PA 4AMKL 2IAAC 3VGHA 3WFEL 4D0DB 1MVFA 2PCFB 5DUJA 1HAWA 4KAQH 4UU9A 3D50A 5B38A 2F7IA 3LIUA 1A9EB 1E9QA 4WJG3 2C3WA 4HV8A 4CBZA 2G3ZA 2W95A 4OU3A 1WCBB 3GKWL 3NJJA 2IO5A 4IEFB 4YSOA 3DURA 1I1AD 4GY4A 2ICEC 2KDYA 1G9NC 3OHXC 3V5KA 3FO1B 2H0EA 4D9RE 5JHLA 1V54B 3O45B 5IB3B 1TJGH 1TVDA 2WYHA 5AYTA 1HXYA 1KGYE 1M9SA 2VDQL 3VNYA 2OXHB 1SN0A 2HJLA 4J3OG 2A9CA 2QPSA 3H4HA 2CIKA 2XQYA 5EIIA 5I15L 2B16A 2WP3T 2WBJD 4E5XG 5KJRL 2YEZA 1KPUB 4JFPB 4PCTA 4K9JA 5DC2A 1KCSL 3K71A 3L6FA 4X9FA 4JNXA 2BNQD 1T20B 2EDQA 4G72B 4APXA 4BFEA 2VLJE 4W9JC 5FW8A 5IQLA 4R7XA 3BVTA 1NA8A 1TPXC 1YY9C 3QFJD 4YHZH 2N59A 2XZCH 5EEUA 4H0IA 1SN2A 2IPKB 2PW1B 3SYOA 2WVVB 3LAFA 2UZXB 5FFLA 1IL1B 1GS8A 3GMNB 2ENJA 5E4EC 5GQBA 5CP3A 5BUGA 1D6VL 3TCLA 4DEPB 3JV0A 3JV6B 1AR1B 5KYUA 3BAEL 1PVHA 3WY2A 2HJKA 1W0WA 3BAIA 4NDMB 5DT1H 3P0VL 1IO4C 3RWJA 1T7WA 1G0XA 3TZVB 4JVUA 4A7SA 1MELA 5ICYA 2BLFA 1I85C 4FQQB 4W9ZA 5D2NB 3QUZC 3NBNA 1RJZB 3N6YA 5KYYB 4ONHB 5IW6B 3GSXB 4PJFB 3T4AB 4M6MH 1R46A 5I8EA 3G6AA 4B9GA 5KS9A 2K7QA 2V7NB 3MJ9H 5IB4B 2X4OA 1U8HA 2D0FA 4FFWD 2EVIA 5MERB 4N2OA 3KJ6L 3MBWB 2HT2C 4W9IC 2D4FA 3BEWA 1BZ9A 4JG5A 5LCVA 3LMJL 3KH3A 2G75B 2EVHA 4IMLA 1AZZC 3FUEA 3P11L 5E8DL 1QPXA 2VIRA 3RJDA 4L4JA 3EOAB 2D7TL 5CGMA 3QJTB 2G4GA 5FB8A 3LXAA 3UYRH 4LGRB 4ALAC 4KQ3L 4Y19A 4P57A 5IHZB 5JHDA 1Q1PA 3L9RB 5ISZE 2A6IA 3JWDL 3DI2B 3TBWA 2XDHA 3OKKB 1CT8A 4N0CD 2ZCHH 1TZOA 5LB1A 4MQ7A 5D72L 2J6EA 5ESAA 1BPVA 4L48A 2XVBA 3SGEH 1T2QL 3KYKL 3K0WA 2HX8A 1EHNA 1FYTB 4IRZH 2EEFA 5FV2A 4HOWA 3BKCH 1AP2B 2IQ9L 3MO1B 4PG2A 4KKAC 4QWWC 2QMKA 4JGMA 2Z35B 3F3HA 4RMRA 2O4EA 3OKEB 5GHWL 3QZWA 2C34A 4GRMB 1T0MA 1TNMA 4NQQA 5KSVA 1IC5L 3BP7A 5SWZA 5TE6L 4BELD 1RY7B 4HXBL 5M94B 1NPUA 3CE1A 2AVFA 1MF2H 4APQC 2OSLB 3SDXF 4UUJB 2OXGB 3ARDB 4MDRA 2RCSL 1UT1A 4D7PA 3HE7A 1UT2A 2BZ7A 5DUBB 4JM2A 1YNTB 5F2FA 3M46A 4TUJA 4XNQA 2ICCA 4B9JA 4FXKB 3L3DA 1FGNH 2OJZL 1DBJL 4S0TD 3QIBB 4AV5A 3VI3A 4PTTB 2FAUA 4ELKB 1UD8A 1OLZA 3Q7JA 3LZLA 4AQOA 3S36H 3NOIA 4TL4A 2WLJA 1F41A 2VZSA 4KK9C 1JTOA 4XRCB 1I8LA 2KT6A 4BV1A 4IJ3B 2FWSA 3ASWA 4TQHA 2AXFB 2AXGA 1W16A 2G3NA 4PBXA 4BUQA 2EDNA 4DH2A 1X5FA 2W60B 5KVGL 4QKTA 3QT2A 3ULUH 3DX6A 5E8NA 3B2PA 1IBGL 5KSAB 4LPUA 1SXNA 5D7LE 4QY8B 1HSBB 4EVNA 4LSQL 3KLAB 4OTXH 1MY7A 4Y2DD 5LAPA 3N85H 2WZPD 3V6ZB 2NY4B 1UYWH 3OB0K 5DZNA 3T65B 2DWEA 3QBTB 1YNLH 1L9MA 4KX9A 4CSSA 1U4EA 4YDIL 2D9QB 1DQQA 4OLUL 3TBVA 4JFED 2FATL 4FQXB 3QAZC 2XZQL 3N55A 4OT1L 4KKPA 2A99A 4OLYL 1HWGB 3SQRA 3VH8A 4OJDH 2FLBT 5GSRA 2MCPH 2P80A 3P0YH 3QARA 1UFUA 4GOSA 1XR8A 5CN1A 5TH2A 4NQCB 2Z92B 2ALWA 4YIQA 1D5IH 2BIOA 1T66C 1MCSA 4Y4HB 1H0DA 2Y7MA 4M1DL 2X2UA 2YA2A 3T1FB 3VRIA 3UJIH 2DWYA 5KSBF 2Q3ZA 3U7AA 2WLIA 3KDMA 2Y1AA 1F90H 4NO2A 3SO3B 5F7KC 5BRQA 2PUQT 1R17A 3VJ6B 4A2EA 1Y6KR 3KPQB 1PDKA 3ZIMA 4NQEA 3EH1A 5BV7C 1JK9A 4L5FE 2OBGA 3SDXE 3TEZA 5C0CA 3WTVA 2X6BA 1UM4L 4KKCC 1IQDA 3GMRB 3QCVH 4GEIA 4F33B 5HYSA 1YY9D 3BGMB 3IJ7A 1FNSH 4MYWB 1ZLVK 2PWFA 4PLKC 4PUBH 4Z76A 4HCFA 4XP4L 3GHBH 5EU3B 5IREA 1T89A 3WHXA 2RB8A 2ZUSA 2JI3A 5D93B 5EF0A 5MEOB 4I77H 3VXPA 2W65A 2HFFB 1RIUH 1J12A 3QR2A 3CFCL 2GY5A 3BN3B 3QUZD 1B3JA 4UQ3B 3KGSA 4KROB 5LUMA 2FQGA 1V7NL 3F7YB 4DTGH 4UNVA 4KRPB 5B7FA 4CNIB 3OJDB 2LU5A 4A6YL 2HT2D 3NGBC 1BPLB 3MREA 3MBEB 4FERA 3AQYA 2Q86B 5KVDH 4GW1A 3IMVA 4G7RB 3W9EA 2A4EA 5JMOC 5I82A 1UCBL 4K5LA 3ZY7A 4GUOA 3L3IB 4J3XA 5HJDA 1DP0A 2G9HA 1IGML 4U3SB 3TV3L 3REWB 5DK3A 1A3LL 4P07A 1YEKH 3BZDA 1UJ3A 2IVFC 2NX5B 4L0ZA 4WFHE 5LQBL 1WIPA 4U1MA 5GS0C 2HKFH 3UPRA 1QO3A 1P0SE 4C59B 3GSRA 4P2RE 4YHLL 5FDWA 2R2EB 3KPLA 1OK8A 1ZV5A 2R1XB 5HI5C 2W9EH 2CKBL 3B9DA 3MLXL 1DL7L 3KL3A 3NAAH 2YPKA 4KTDH 5J11C 1XF1A 2D03H 4OQTL 2BIIA 1ET8A 2F2HA 5BO1H 3HS0C 1SDDA 5EZOH 1KXHA 1DJXA 4UM9A 1NC2D 1ROCA 3ZZSA 5AG9A 3NTCL 1F45A 4JFZH 5KSBE 3BRFA 3FTUA 4OZ4A 3DV4A 3NZ8B 2Z7WA 4U7KA 3VXSB 5KAQG 2Y7QA 3FFCB 4JPIB 3WMPA 1YG9A 4I48B 5HHOB 4APQD 3ISYA 5I71B 1LE5A 4J39A 3ARBC 5I1GL 2R15A 2QGBA 1DO5A 4NPKA 3WUWA 5HDBE 1U8CA 1FLRL 1EBPA 4X8XA 5CN2A 1JP5A 2GFBA 1QBMH 1GOFA 2K45A 2K9FB 2WBWB 5H35B 3UTPD 4G8EB 4MMXB 4HWEH 1NCAH 1MFEL 4JANB 4MNGE 3LRGA 4HULB 5KANG 3CH1B 1KIUA 1RD6A 3PDDA 3FB5A 1S6NA 8FABA 2GBUA 2BNUB 1ED3A 4XMLH 2CDGA 1VGEH 1UFGA 2ED8A 3VD5A 2EJ1A 3HUJA 4F9PC 2DQIH 1TG8A 3MLUH 1LVEA 4FFZA 2YRZA 3U1SH 3VDAA 4BQ9A 2XI9A 3W2DL 1IAKB 1Y1DA 4FTVE 1I8IB 2D0GA 1E0OB 2ITFA 1A7NH 2WKOF 3UL4A 4X9BA 4RISH 3QEHA 1SYSB 5D1ZI 3Q6GH 1WH0A 5EIVA 4BGDA 1DHKA 5CGBA 1P4LB 2A6KB 1O0VA 4HIQA 1RUQL 4YDVB 1ZSHA 4R4ND 4Y4FB 2BOBB 2CLRB 2BVTA 2YWZA 4Y9FA 1W8NA 5LGHH 3SKOA 4PJAF 5TQ2L 4RMQA 1UOLA 4PJEA 5FLVA 3U4EB 5I1LB 1J05B 2WKGA 3EO9L 4JY6B 4Y2NA 1G9NH 2CRMA 4X6CF 1Y7VA 3AACA 4XB3A 3KYMA 5CLXA 3SSGA 1AC0A 2BCKB 3BXNA 3DPBA 3F7VA 5CGYC 4RH4A 2EINB 3TIEA 2JQMA 1Z0MA 3EGDB 1FFNA 5EO9B 4LMQI 3MXWH 1WYJA 2GJ6E 3K1KC 5A7BA 4DQAA 5AOLA 3BDYH 4XMZA 4XT1C 3ZDZE 3FSWA 1T1WA 3RG1C 2YWYA 3LY6A 4I2XA 1PD1A 5EF2A 5BW7A 1FNGB 3T77A 1FNSL 1MN4A 3RKDC 4GI8A 3PFQA 3UX9B 4HIHA 4BBWA 1L6XA 2CJTA 1B2WL 2VDRH 1KCVL 2L3BA 3IMUA 3BPLC 3U2SA 3T3MB 5EU6E 3JXAA 5GRZA 4AQ8A 4G6ML 4Q89A 1NIFA 1RK0B 4Y5YB 4CW1A 1OAXL 2XZAL 3JYCA 3MOBH 4HUCA 4IRSA 4P8QA 1PZ5B 4QOKA 4CC1A 3GI9H 2D73A 4QPEA 4AE0A 4HSAC 4N26A 3WFHA 3ROLB 5J13B 5FUZL 2N0MA 1NGXA 4KKCD 4MWFA 1A4KB 4FQCH 4HMEA 4AZUA 5ADOH 1TZGL 4PLKD 3OHMB 3QH3B 5F71A 1TSRA 3QDJB 1ITBB 3RY5A 4M00A 4AEHL 4BH7A 5IFAH 1TTAA 4YHIA 4V33A 4QT5B 4G8FA 1UOWA 1X9LA 3SDAB 1BFVH 4UYPA 1JXJA 1PFOA 1R5VB 4LF3A 5C0RH 1F42A 3VXUD 1L5GA 3IGLA 3PE9A 3V0DA 1IAII 4OD3H 1UH2A 1N3NA 2J8UE 2XPGA 3QFDB 5IWLC 3U0WL 5BQDA 5DVKA 4JL1A 4IIZA 1P4BL 3HA0A 4WO4B 4ZX4A 4YBQC 3JBG7 4GUPA 2HKFL 1ZKAA 1MNUH 4GAGL 4ZFGH 1WCQA 5F7AA 1JV2B 3V7AE 4NB7A 1Z7JA 1DEEB 3FQNB 4UT6H 2DDQL 2BHUA 2O5XH 3QG7H 4FXTA 3GB7A 3IAPA 4XNYH 5BNXD 4TV3A 3VGAB 4JQIL 1GSMA 1HE8A 1UB6A 1XEDA 2H8PA 2VM4A 3QNZB 1INQA 1ZEAH 2QVIA 4LCYB 4PJAE 5E9NA 4JQVC 5LN4A 2DQCH 4JFZL 1J5CA 2H3NB 4UOZA 5CJQL 5DZJA 3B4NA 1M3JA 1YEFH 4PRIA 1ZT1B 2Q6WB 4OCNC 1CFNA 2PP9A 4LHUB 3QJOA 2VQ1B 4DQOL 4AX3A 2W9LA 1V3MA 5DYFA 2ICWA 5DQJB 3SE8L 5B39G 3CCHB 3FCBA 4G8GE 1C12A 3WMSA 4Y9CA 4XPAH 2CO6A 2YRLA 4I3SH 5E6ZA 2F1EA 3QB7C 5E2WH 4FQPA 5HI5D 4HS6A 2LAGB 5BS0A 3QWRD 2J6WA 4R97B 3FO9B 4IHOB 1J1OH 3TVMA 5I1DB 3TASA 2P1YA 2YPLE 1HCVA 3HMWL 1A1NA 4F24A 3KM2A 4JPWH 2AVGA 1QYGL 5ACMA 1W8OA 2DLHA 1QSFA 4A55A 2VSCA 4YXLL 3DMMC 2ZWYA 1FLTX 1HQ4B 2HXAA 3A6BL 3MLUL 4GW4A 4LSDA 4AENB 5LDSA 3KYNB 4F8LA 1Q9LB 1X5GA 1ZSDB 3T2QA 1QVOB 2O6EA 5AOJA 3BKMH 1SY6H 3GSWA 4P2OB 4DP9X 3ESVF 4OF8A 5CHNB 2NY6C 4R3SA 3F01A 3ZZ1A 2GAZA 3MRRA 4FZ8H 4KGJA 4W4OC 3EF7A 1GMIA 4ELDA 2XWDA 1BG9A 2P5WE 2ALAA 1KGWA 2UWEB 1H6TA 3MAWA 3M6DA 4JG1L 5C9JA 2IANE 3MR9A 2XU9A 1KCRH 1TYRA 2JCWA 4MBRA 4R26H 4UT9A 4GXUN 4X7SH 3WJMB 3MNVA 4K3JH 5E0QA 3WO3B 1OP4A 2R1WA 1IEBB 2P45B 1T7VA 3HN8A 4JKKA 4F58L 5I1IH 4WKZA 4E2OA 3L1OH 5J1AB 2K4WA 2XIBA 4QRPA 5E9DA 4NQSA 2BP8A 5EEZA 1TU2B 3FL7A 3HPJB 4KUCF 3RX7A 4GKZB 5DJZA 3UP1A 2FR4A 4HJGB 3BDYL 5L2KD 1SUHA 3Q01A 3BVUA 4FL4B 4DCQB 1O6SA 1L9OA 2R39A 1K8DB 1J88A 2EO1A 2R4SH 4J3WA 4JREC 4TVPE 3BE1L 2MCG1 3C6SB 4JVPA 3QQ4A 1CL7H 1YECL 2IAMC 3PWVA 3Q1SH 4BRVA 5TTRA 3EJTA 1AKPA 4AYMC 1Q0YH 4DVRH 5KYWA 2V2WA 2Z4QB 1PEWA 1QD0A 4G1EA 4TOYH 1FG9C 4X4YA 3WE6B 1IAIM 4Z7QE 5CGYD 3WHE1 5C70A 2PO6B 4UMGA 5CWSA 2R1YA 2QADB 2LAAA 1HAUA 4QTHB 4YHKH 1KWGA 1ZDSA 2VDKL 3BVWA 2QDWA 3N43F 5K59E 1XSOA 4GW5B 2A74A 5F9DC 2BO0A 4MB5A 3CU7A 2QPFA 1ID5I 4I1NB 4PD4J 5CBEB 1A7OH 2X3AA 1ADWA 1IBHA 2BINA 5TK4A 2YZ8A 3PRZA 3L4WA 2C9XA 4PSPA 3T5WA 2YPVH 2WXJA 2ZX9A 1KXTA 5DJCB 2BXZA 3UPAA 4M61B 1FAIH 1S7UB 4OCLC 3ZQWA 2ZQKA 3MLYH 3S35H 2BJML 1AXTH 1KFGA 1KTJA 1YEGL 3UZQB 2IBZY 4K2UH 5L88L 4YL4A 2F18A 3FSAA 4LCWD 1IBZA 3TYGL 5F9OH 4LCIH 2PCPB 1AKJD 1CXLA 4S0HA 1P4IH 2NW2A 2PP8A 3SD5A 4XCNB 4YX2L 3X11B 1WEJH 3BLBA 4K3EH 4ALAL 1QATA 2AANA 4ADIA 1GC1C 3E9TA 1FYHB 5F9WB 1QPKA 3MRBA 2CHZA 1J1PL 2JJTA 2GPZA 2VQUA 4NXSA 1GH7A 4OM1L 1CGVA 3MV01 2OX5B 3LEYL 2HRPL 3ZTDC 4ZPTB 3MMEB 4PJBF 5SWSB 4WVRA 3UXFA 4RSYA 5L0QC 4FG4A 3RUGB 1WC7B 4YBQD 2JTDA 4EI6A 2VLJA 4KTGA 5JORA 2ZCLH 3ESPA 4ISVA 3NYKA 3VMOA 3OKNA 2WLZA 4AYFB 3BUQA 3SIKA 5BVJB 3FQRA 2HYMA 5DHVH 1BIIA 4JLRB 3H9YA 4KO5A 3T3PF 2XPZA 2CBQA 2YKLL 3EOTL 1S9WA 2X4NB 1RU9H 4JFUA 5F44A 3QC5X 5GS0H 3BPOC 1BEYL 1E27B 5LGYA 1TVBB 4OGAC 2A9NH 3X12B 1EGJH 4U3HA 3VD0A 4Y4KC 3OSKA 3RIAF 1KTLA 3BZFB 3KXFB 4W9EC 3X3FH 3GNMH 2P8MA 3QVAA 1G94A 2SODB 2WM0A 3ES6B 1HK6A 1UATA 3L5IA 1MLCB 2QBWA 3MNMA 3NIFE 3MX0A 3QHTC 4IBLT 1CCZA 1II4E 2BPBA 4BCYA 1OSZB 1F56A 4FJ6A 3SJVB 1ERNA 2CNYA 3QUKA 2ZWKA 1GJWA 4AGMA 4YHYC 5JOFB 4RFEB 5LWYH 5LG6A 3B2UC 3LKNA 5CD3B 3HNTH 1E9PA 3H3PH 5F1IB 1H8NA 4Z0XA 1XGTB 1RCYA 3TJEH 3FU7A 2W80C 1P7BA 3EJZC 4BKLA 3VG9B 4M6NH 3UDWA 5M7QA 3DOSA 3EGXA 3JTTA 4KDVA 5A3ID 1K4CA 4R26L 4CDHA 4NBZB 4HOZA 3RI5K 3S3PA 2JVUA 3SKJH 4G9FE 3DMMD 1FN4A 1IFHL 1WK0A 1N6VA 2JV6A 1FIGH 1FNAA 4Y1AE 4B9IA 1CFTA 4TNWK 3L2LA 3LPGA 2VDMH 5I1IL 1DVSA 5ISZA 3X2QB 2A9ML 2KKQA 4CBPA 4DKEH 2AJSL 4UT7H 5J12C 1RZFL 1KF9B 1FPTH 1QLFA 3W38A 1Q8MA 2NY6D 1NEZB 2H9GB 4JHVA 2OSWA 1N6UA 4KRMB 4XCYA 4K3HA 4ONGH 3OPZL 4EO5A 3ASOB 1YCSA 4U1LB 4I9WE 4JK0D 4XZUB 5HTSA 5LGJB 2P49B 3I9AA 5FHBL 5HHPB 5AB0A 1CL7L 2VW4A 4I18A 3C08L 3QCUH 3ZE0E 4X7DC 4GQ9L 4HC1A 1EBAA 1XF5A 3V52L 3D48R 3PABB 4V1DB 3B7TA 3FHQA 3O4LE 4PJBE 4U1HB 4YBLB 5DRWA 3JWNC 5E6RB 1I8KB 5TDPA 3N91A 5K39A 1U2HA 3G6AB 3OWEA 4LRIA 3G5YA 4QRTA 4DESA 2QV2A 2CBPA 3VWKA 4F57H 1CD1B 1DFBL 1V55B 1RURL 3BEWB 3SGKC 2XQBH 3DXAE 2J73A 2YR3A 5AWNH 1GYCA 2FUQA 3FYIB 5BV7L 1KJ2L 3RNKA 3T3PE 2IAMD 2WYZA 3OF6A 3FUNA 3MGAA 1C5BL 5D55A 1MOEA 3IJSA 4KZEH 1KB5L 2KLTA 1S7WA 1UWYA 4P4RA 1ZHKB 4WRLA 3I2CL 1RH8A 1FFTB 3HKFA 3S35X 4MAYA 4NUGH 3EOBB 3L2MA 3ZTNL 4M5ZH 4O58H 2JKSA 3S35L 4Y89A 4K2UL 2P42B 4RMTA 5F1KC 1FZOA 1G6RA 1YZZA 4PJDA 1KCLA 3WYRA 5E8PB 1A1MA 1Q9WA 4GNKB 3O2DA 3SKUD 3N5AA 3CQQA 1UWXH 1WEJL 4FQLH 5I24A 1HIML 1BBDL 4KQ4H 4YUEL 5AW2B 2VM9A 4NNYB 1YUHA 4EIZC 3LH8A 5DR5H 4WTZA 4AH2A 2DWSA 2QPDB 1JNHA 4AUUA 1GPOH 1ZT7A 1S78D 2BIPA 1N0LB 3EFDH 2VRAA 1M6UA 4J3OF 1RHFA 1F4WL 1L9PA 1E4KC 1WWBX 2AI0H 4XVSH 1FJ1B 2EIKB 1QRNB 3ULVC 3ARXA 2CALA 3BWUC 5T5NG 2K3TA 2ZCLL 4OFVA 1Q9OB 3FQ4A 3RWIB 1WD9A 3V8OA 2OA9A 4X4KA 4BQCA 5DEZA 1EEYB 4PR5B 1H15A 1IEHA 1F3JB 4W6XB 4Y2OA 4WW2F 2N56A 1LQBC 3BUYA 3KCPA 4FFYA 2XFXB 2NSMA 4NERA 3SOBH 5B1JC 4BEIA 3BRGC 1XGPA 3EDJA 2F8VA 2H1XA 5EC2A 5HSFA 4HALA 2GJJA 3BP6A 3BUDA 2YD7A 3KWTA 4HSCX 3QORC 2M2DA 4HD5A 1ZGLB 5DI8A 3SDXA 4L0PB 3KWWA 4U0RC 1I4FA 1SYVB 4ZTEA 1AGBA 4YFDB 2FX9L 5FX3A 1BLNA 4ZQTA 4C47A 4PREB 1YPZF 3P4MB 5HDWA 1RZPA 1Q9KA 5DJ0B 3QUXC 3KYOA 3L3GA 1MI5B 4OGAD 5IOPA 4MFHA 4KKBC 1UZGA 4Y4KD 1T5XB 1VFBB 3HN3A 3W0WB 4OSUL 3GMLB 4PVMA 3GZOA 5DWPA 5EB9A 3GZQA 3AREA 2XA8H 4MCNA 3P2BA 2F7OA 4HF5H 5E6IB 4JY4A 4JAMB 3FFDB 3B2UD 5G4MA 4RGMB 5F7MC 3I02B 4YHML 4ORGB 2XWJA 1VHPA 1OPGL 2OZNA 4XP9H 2YD3A 3EO1A 3FT4B 3FQTB 4CVXB 15C8L 4LDOB 3PLYA 3VYOA 4DO5A 4OV5A 1C16B 1UKTA 2ZF8A 3DTXA 3OLEA 4JFFD 3OGCB 3FN3A 1QRKA 2OJEB 4HJJL 4JFYB 2Y7NA 4LXFA 1G4RA 1NBZA 1ZA3A 4R8WL 2BSSB 4WGVB 3FTXA 5FYJE 1KNOA 3VSVA 2ERJC 2R8SL 1U91A 2WTRA 3D4GA 4HT1L 4LPVA 3NSCA 3CVDA 2EIJB 4P2RA 4EIGB 4DN4L 3KPOA 5ACLA 2KPWA 1U21A 3RBSA 1HH9A 4BZ1H 1PLBA 3H7BA 4FYQA 1GOGA 4CJ1A 5CFHA 2VDOH 2EADA 2EE9A 4IKIA 1FCGA 1K8IA 3CTTA 4PRDB 5EWIL 1BOGA 4DP6X 5CP7A 3OXSA 3BP4A 4X5XA 1T0NA 3MA7B 2ZX8A 5KSBA 4CN6A 4PJ8C 2AEOA 4D0BA 3TESA 4F27A 3GK8H 2Y7SA 1CFQA 2XSKA 3CSYB 3PDGA 3W39B 1A5FL 3DYPA 1CGTA 1HCZA 2VDPL 1ILSA 5C3IA 2JK5B 3A22A 1R5IA 4IW4C 2D31A 2ENYA 4ZXBA 2X2JA 4PD4K 1YC7A 5AALA 5CCHE 4CADB 4IGBC 1A1OB 1YEJL 4M7JH 1F02I 2F53D 3KPSB 1KLFA 3LD8C 3VFWB 3EDDA 3MLTB 2E6JA 3PL6A 2FLMA 1SMDA 2F7QA 3QDGD 1XMEB 4MNGA 1IFGA 1WFNA 3LNIA 2WINB 2QPUA 1RSFA 3CXDL 5HHXL 2VLMD 4NRXA 4JN1H 1NFKA 1CE6B 3ARTA 1VENA 1HOCA 3GTNA 1YPZE 5C0AE 2GK0A 4AIZA 2FJGB 4HXAL 1B0GA 5K1NA 1YJDH 3I6LD 3CDGB 2ZYHA 2ZUQC 3RWDA 5BMFH 4FTVA 4KJYA 3DHJA 2F54D 4LL1A 4DGYL 1ZVYA 2H5UA 1NCHA 3GRWA 1REIA 5IM7A 1L7TH 2BVPB 3JV5A 3Q48A 1BEXA 4Y5XA 3FT3A 2P47B 5E1HB 1IGFH 1M53A 2RMNA 3NACL 2FHBA 2Q7YB 1OGAB 5DGQA 2WIMA 4K71C 2Y2TA 5EZIL 2GKIA 4LOEA 4UAOC 2WCSA 4N2MA 2XV0A 5T3XE 1B4TA 2DEWX 4C4BA 4AJWA 4Z78B 2YMOA 5HYEA 3Q2LA 3LRLA 1YY8A 4N86A 1SMAA 4NKOB 1FFPB 1SXCA 4FFTA 2E4FA 3BW9A 4KVNL 1ODAA 5ESVB 4HX1A 4UM8B 4ETQB 5LXGL 2MPAL 4W81A 4NWUH 3D2UD 3MV7B 1JBJA 1CK0H 4O02A 2GJ6A 2ZOLA 3ULVD 4NCC2 5IFHL 4N2AA 5ICUA 4IOIB 1Z5HA 1U8LB 1KGCD 2YAQA 3ECBB 5CCJA 3ZT6A 3GC3A 1GHFL 1AHWC 3C9NB 4GXUM 4FKKA 1X5KA 3G6DH 3EYUH 3MYJA 4H0HB 4NJ9L 3ZDXF 1WS7A 5D7IB 3FH5A 1PQZB 2EEBA 3PXHA 1R33A 4PLNC 1AO7E 2NY2C 1PLGL 3H3BC 3HUJB 1UEYA 2P5ED 1EJOH 1KT2B 4PI2A 3IDMA 4ZDHB 1IM9B 1A6PA 4FG2A 3VFTA 3TA3C 3QORD 1FVEB 3IGAA 3IU3B 4YK4B 2RIKA 1B9KA 5D2LE 4D94A 1IGIH 2YSSB 5TE7H 2WLLB 1T21B 2YGOA 4Q97A 3C6LA 4E41E 4WV1A 2ZCKH 1KACB 1TO5A 1XCQB 1S9YB 4HCRH 5KBLA 4P99A 3HFML 1DJYA 4CMHB 5HGBA 1U36A 4N2KA 4XO5A 1JYVA 1WITA 2BRRH 3C09C 5JHMA 3GS7A 4XPFH 3QUXD 3O8XB 1WHOA 3B7SA 4KKBD 5FKAA 4ZUTB 3QULA 2IDFA 4XBEL 3E2HB 2G30A 3B83A 3MRQB 3MA9L 1D5ZA 1MWAB 2J8UA 4OGXL 4HJTA 1G1CA 1BJ8A 3ML9A 4TXVB 4H8HA 3VTAA 2DQGL 2EKSA 1ZHBB 4DT2A 1HQRB 2F15A 3V9CA 2WKOA 1LDPL 1UACH 1YEWA 3JTBA 2BSRB 2FGWL 5DXWA 2X9ZA 1B4JL 2ZONA 4NN5B 4HIIB 4P5KA 3TN0B 2GI7A 4RNRB 4EZMA 3WDIA 4QD2E 3GHEH 2RFXA 1E4XI 2CDFB 4JPKH 1IVTA 5INDB 2G2RB 4H8WC 1WGOA 3GSNA 1OF2B 1EXHA 3FQXB 2VN6A 4BYHA 2P24B 1JGUL 5DMKB 4PRNA 5EUOB 2FO4A 3ZX1A 3NIGF 1SVZA 1OAUL 4DGIL 3SCMB 2NSXA 5KAQF 4JFDD 4RRPM 1XHHA 4YSAA 1MHCA 4U4IA 1DUYB 2HG0A 4G8GA 3DX9B 1J11A 1OM3L 1JL8A 1H8SA 5F9JB 3Q5OA 2W38A 4W93A 3BRDA 1CFSB 2W0LA 4MMZA 2YPLA 1K6QH 3VA6A 3GEFA 3KWUA 3WGVB 4ZMNA 5E1AA 2WK2A 5A6MA 2DM4A 4JG0L 4HDIB 4PJ8D 2DQHL 3Q8AA 4LSRH 1F6FB 5E24E 4QHNB 3D25B 4KXZI 2CH8A 4MA7L 3RURA 2J5WA 1KEML 3EBHA 2QHLA 1SBBA 5IBUB 4KDTA 1S7TB 1T1YB 2ZIDA 4HPOL 4IGBD 2WXQA 3EOYG 1AS8A 4HK0B 1FG2B 5T1MA 1QKZL 2VLRE 4L1SA 2DOCA 1N8ZA 1OE2A 4TF4A 5FO9A 1RV6X 4NJAH 2P5WA 4G9DB 4GS7B 2FJUB 1NKGA 2BH0A 4HG4J 2AFNA 4HZAA 5IG7A 1N18A 2G5BB 5ITFA 4YR6B 5ANME 2H8PB 4EUPG 4ZO6A 5DC9B 1TR7A 1T1ZA 2AEWA 2IDTA 1G1YA 4HIEB 4U05A 3V4PL 4Z7WB 3K8KA 3S5ZA 1IAIH 3BT2H 5FGRA 4TULL 3VQ1C 1BZOA 2B59A 3M1BB 4K23L 4RQQA 4EBQH 3GXIA 3H9SA 3ZTJH 4ZUVA 3HZKA 3PGDA 1FRGH 2DLIA 1GC1L 4AKQA 3UBHA 3VD7A 2JQAA 1OM9A 2VXSL 4LVNC 5IMLA 4DFIA 4U1IB 5EOTA 1Q0XL 3RPBA 2XETA 2GC7C 1S5HA 3A23A 4R4BB 4X8GA 2Y24A 1MQKH 1BXVA 1MCCA 1UWXK 1PKQB 4WI0B 4AEEA 1FGVH 4A7QA 4J23A 4ZMAT 3TONA 3IFNH 3MRIB 3QUMH 3B7YA 1AGEA 1SXZA 3HE7C 2WN3A 4AGQA 3QEQE 1ACXA 1FZMA 4JM2C 4TSCH 4Z3IA 1E6OH 4X98A 5G5DA 4XO8A 1K5NB 1RJLB 2KLRA 1P7KA 3FQ1A 4IHBA 1WZ1H 2DKMA 3WU1A 1QFWI 3S48A 4EDWL 4IDJL 2V2TB 2Q76B 3WNIA 3V2AR 4YFEA 2YA1A 4JQXA 5EU5A 1E5AA 1SEQH 1MCKA 3HEIB 4KVPA 3NIGE 5FYKU 2PTTB 3MCKB 5E7BA 5TE7L 3VXTB 1UEMA 4ZMQA 3UJTH 4ONFH 3IVKA 1BQHA 3PIQB 1NL0H 5H4YA 4JDTL 5EBWB 3QHZH 1MIEL 1ZHNB 3RJQB 3HBPA 4QTFA 2RQEA 4L3ED 5I6MA 4NHCL 3RTQB 2VKXA 1NGYA 2O61B 2D3VA 1LGVA 1TOXA 3WKQA 2WBXA 5E6UB 4GMTH 4FDWA 1NCDL 2EH8H 3P9LB 3VW3L 3IETA 1NAMB 4MJ2A 2WQUA 2VUYA 3TA3D 4PWGA 5F1OB 2DKSA 2VLKD 4NQSB 5DQDH 4URKA 1IARB 5DD3L 3A6OA 2VSKB 3GLZA 4PP2A 3WKML 1U92A 3RVXC 4AXWB 3F85A 2MKLC 1LWHA 5C7ZA 1NAKH 5FA3B 3NMEA 3CFKB 3WY3A 5TGBA 2HVJB 4AQ1C 4PJGB 3BESR 4D0CA 1CYXA 1EDYA 3GFUA 3VDBA 3IPBA 2VR7A 3L95B 5GGRB 1W72L 5TFSH 1GY1A 1ZS8B 4GJTB 5ECJE 3BSZH 4UTCA 3FOLA 5AOZA 5FGBA 1AYOA 3FTGB 2Y5TA 1Z9SB 4NM8H 5AVRB 5DRZA 4XNZB 1JVKA 1G7QB 1J8HE 1IB5A 4G82A 3EYSL 1N5AA 2E9WA 3RIAK 4D8OA 4E9YA 2YUZA 2MOQA 1S9VB 4HWZA 3MKGA 3ARFB 3FN0L 1PSKH 5D4QA 4UCFA 1A4CA 3PGCB 5D1QE 1GVIA 2A7BA 3EDFA 4P2QD 5DFVC 1MH5A 4NFDA 1E2VA 5HJ3B 2P26A 1OP9A 2OR9H 3DVIA 1Q4NX 4K4KA 4E9SA 1HCFX 1F1GA 4KVCL 3VFOA 3D5OF 3LEVH 1N59A 3LRKA 4O9HH 3KG5A 1A7QL 1BQ5A 4F15C 4L05A 1A7BA 3Q2VA 4EIUA 5DHDA 4AG4L 5C09B 3KPRE 4GRWH 3FQWA 1NH6A 4XAKE 4Q9RL 1VADB 4JFXB 3ZPDA 5I9QC 4NBYB 4IM8A 3IFLL 2FT6A 2YD2A 5EN2A 4DW2H 5IQ7L 3QIUB 4G9FA 2Y0SA 1NOLA 4YJZL 3S9DB 3RAJH 2F61A 1CLZL 2OMYA 4WI6A 4Y1AA 1QFWM 3W5MA 1FF5A 1ND0A 3L1FA 1XIWC 4LHQB 4X8JB 4PVNA 3D3VB 2VE6B 4D9LL 5EH1A 4PS4H 4E36A 4PFEA 3U82B 4G8AC 4UNUA 2ZT9C 1SHXA 3VGGA 1K3ZA 3KPPA 2WIIA 3TEUA 3BYYA 3TNNB 3DVNB 3CHSA 3AM8C 4FADA 5SX4I 1XTLA 4DZ8A 3DROA 2J5LC 1ACCA 3WLBB 4IS6A 2C3VB 1MCBA 1ZHLB 3NIDE 4H1LG 2OZ4A 2AV7B 1GS6X 1AYRA 2BNQE 4LLMB 1S4IA 3ULVL 4HJEA 4I1RA 2WAHA 1SVCP 2ZX7A 1IC1A 5AOKA 1A6VH 3QFJE 3CJJA 2B8OT 5DMYA 2HWZH 4B0MM 1NC4B 2NUPA 1OAYH 2NSQA 4MA8L 4Y9GA 4CC0A 4PJBA 3N1QC 3O9WC 4YE4L 1DVYA 4PQXA 3SGDI 3S2AA 3JWNG 2B39A 4FYSA 2NDFA 4Y1TA 4G6KH 4N8VA 1NCOA 2RH0A 3T08A 5DSCB 4C54A 5EZJA 3WO4C 3DXAA 4XXDA 5DMIL 1YEEL 1ZLSL 2VXTH 4E9LA 1UH4A 2YD5A 3HE7D 3Q3GA 4FABH 4JM2D 4ZW5A 3VFMB 3FH8A 2IMMA 3EYOB 4YHPB 3NCMA 2CK0H 2IOIA 5H37H 4TUOA 2ROXA 5SX5H 3T2OA 4HIJB 3PWPE 4Y7MA 5IBLC 1E67A 1FHGA 4QXUH 2Y3NA 1OZUA 3DSNB 4EXKA 3CU1A 4DP4X 4U49A 4M3HA 1DVXA 1O5DT 3OMAB 5KG9B 4R7NB 5D96C 1ADQH 4EN3C 3CGTA 1JK8A 3L9EA 5DK2B 4BIKA 5J6HB 1MFVA 4A7GF 1EXUB 3CPLA 4GPVA 1G87A 4NRYA 3MUJA 3S5LA 5LKNA 1J10A 3VRLF 4X0KB 1T4KA 3JV4A 1SVBA 4AQZA 3UZEA 1F4HA 1TFPA 3MV11 4FYRA 5I1HL 4I5BA 2JKJA 2DLFL 4YWGL 1BYOA 2ZWZA 1J87A 2YN3A 1GTFA 2CA4A 1R3IL 2VISA 5HHMB 3T0EB 1MWOA 1PG7W 1HI6B 1YQVH 4KKRA 1VFAB 3OL2A 5T5FA 3MUY1 3RVXD 1DUZB 5EPMA 4WEEA 2A9AA 2XN9E 2QLVB 4GIOA 4CN1A 1WBZB 3BP5A 5AW9B 4LKCB 1BM3H 3OZKA 2WB1A 4WAFA 1FFOB 2P80D 1G7HA 2DKUA 3SDAC 2DYPB 3DO3A 1ES0A 5D1XE 4PB9H 4I4WA 4P5MA 1IGCH 3S96B 1DYZA 1KG0A 3QUYB 2QGCA 3BGAA 2XN2A 4O2FA 4FXGB 2OAAA 3LV3A 3PWJB 1E30A 4MNQB 4WHCA 3NZUA 5D7LB 2HJFA 4H8WH 4AQ8C 4RFOH 4CC4A 3VRJA 4IRSC 2XN0A 1FO0L 1DE4A 1QUNA 4M7ZC 3G5VB 4QKXB 1XD1A 2XWEA 2NXZC 3C60C 2I07A 2NPLX 5C9KA 3ARPA 4DW2L 5DFVD 4PJHA 3TO4B 3L3OB 4GSQA 4NUPA 4N20A 4H2CA 1JPGB 4PRBB 3ZMRA 3FQUA 3MLSL 3UMNA 4LVOB 2B4CH 2KMWA 4HG4K 3DJRA 4XOCA 3SBWC 2EDOA 3OKLA 2BIHA 1A6UH 3MRDA 4PS4L 4J4PA 3GSOB 1HXMB 4KFZC 4LEEA 2X09A 5GSVB 3QQDB 4PB0L 1RZ7L 4XI5C 3AU1B 2ZXWB 4QLWA 4X6BA 2YAFA 3DA0A 2YUVA 4OVVA 4P3DA 4M43L 5JNYA 2HLAB 1GGCH 1GAFH 3L7EB 3FU9A 2OL3H 4XBGA 4CU8A 2EVFA 1JPFA 1RUKL 2L8AA 3VRLE 4X6DF 5GGTA 1ZK5A 1BA9A 5FC9A 4GKLA 3IJEA 3ASNB 5JIIA 4WFGE 2NY7L 4XPBH 1M9WA 2BZDA 2DQEH 3KNBA 5E95B 2FT8A 3BN9C 5HHVL 4U6TA 3HAEG 3FT2A 3LHPL 1QFPA 3PS6A 4OCRH 4X5WA 4EI5A 4E5XA 5IQOA 3GMQA 4PWKA 4ENEC 1NWPA 2WSDA 1JIBA 4PGEB 3ERXA 5D70H 5EMYA 1LD9A 3TEYA 4M5YH 4QHMA 4LKXA 4WCYL 1MRCL 4I0CC 2DMGA 2WWMC 5FGSA 2BVQB 3MLZL 1UXWA 3O11B 3DRQA 3LNHA 3NN8B 2AITA 1TLMA 2FNWA 1XV8A 1KJMA 4PY8I 5F6HI 3NK3A 1Y18B 3EJJX 3S98A 5PAZA 4UM9D 3O9WD 3HC3L 1QBLH 1MRFL 5B8CA 5EU7C 5F0PB 1TQCB 2Q7AA 2X70B 4U6YA 2B5IB 2X53A 2A3TA 3MGOB 3T2NL 3IRPX 3FW6A 3EDKA 3FS9A 5IB2B 2FJHB 4H25B 3MV9B 2ARJQ 2HVKB 4RLDA 2ADJB 3KR3L 1XGUB 5GGQL 2AJZB 4JFQB 1H19A 1YPZA 2PPDA 2I5YH 4P3CL 5C0AA 1A9BA 1AI1H 1IQWH 4M7KH 2ZZUT