1OOWA

The crystal structure of the spinach plastocyanin double mutant g8d/l12e gives insight into its low reactivity towards photosystem 1 and cytochrome f
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VEVLLGGDDGSEAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, membrane
molecule keywords Plastocyanin, chloroplast
publication title The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f.
pubmed doi rcsb
source organism Spinacia oleracea
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oowA00
2IDSA 2XXFA 1R1CA 4HCIA 1AZNA 2P80A 1GW0A 3T71A 4L0PB 4HHGA 3ERXA 3PPSA 4Q89A 1BXAA 1SNRA 4E9WA 1ZV2A 2JKWA 1IKOP 1ZDSA 1BQ5A 4DP8X 1ZIAA 2PP8A 1CYXA 4HZ1A 2ZXWB 5ANHA 2AFNA 2OCCB 2XV3A 4YSAA 2UX6A 2BP8B 4MFHA 4YL4A 5I26A 3FSAA 1F56A 1XB6A 2BO0A 2ZOOA 4DP0X 1BXUA 5TK4A 4E9XA 3NP4A 1BEXA 1IBZA 2XWZA 4YSTA 3OMAB 3UABA 4GP5B 3JTBA 1ZIBA 1IUZA 2DWTA 8PAZA 1OCRB 1PLCA 1OCOB 2H47C 2UXTA 2PPCA 1PMYA 4BXSV 4E9YA 2YQBA 1OE3A 4P5RA 2FQDA 3FU7B 3NP3A 1NZRA 2VW6A 4DP2X 1M56B 1GS8A 4FAAB 3T6ZA 3FU8A 3FSWA 4HHWA 1A4CA 2AVFA 1W8EA 3ZX1A 4QLWA 1JZHA 1L9SA 2YAOA 1AANA 2J5WA 3UACA 4E9RA 4BWTA 3S8FB 2DY2A 1BXVA 1AAJA 2IWKA 3QJSB 4ENZA 1M57B 1ETJA 2EIMB 2IH8A 1PLAA 4YVNA 1OV8A 1AZUA 3NJMA 1NICA 1SFDA 3AG1B 1RZQA 1AZRA 1JXDA 4HALA 4FA7B 2VN3A 1BQKA 2GC4C 2XV2A 3N55A 3PAZA 6PCYA 4WTQA 1TEFA 2GSMB 3QJRB 2GHZA 1L9PA 1RKRA 3NYKA 4G70B 4KNTA 3X1GA 3UGEA 5LDUA 7PCYA 3G5WA 3S3CB 1KBVA 3ASNB 4KOCA 3UADA 2DYSB 1M9WA 3WKPA 4CSZA 1QLEB 5D4JA 2IDQA 1A4BA 1ID2A 4HIPA 2X87A 1OE2A 2QPDB 1J5CA 1OOWA 2PPEA 1OF0A 2QDWA 5I6PA 1KDIA 2HZHA 2BHFA 5B1JA 3FU9A 2BWIA 2IWEA 1JVOA 1N68A 2JFCA 1BAWA 3FT0A 2H3XC 3OMNB 2PPFA 3HB3B 1CURA 1GR7A 4YSEA 1WA2X 3NJKA 1SHXA 3CVCA 1HAUA 1JZJA 2DWSA 1AS7A 2UXFA 1OCCB 4A2FA 4AI7A 4DP1X 3FSZA 3PCYA 1KGYE 2QDVA 2CCWA 2PCFA 4A67A 2B3IA 3FS9A 1JZEA 4A2EA 2VW7A 1B3IA 5B1JC 1ILUA 1KCWA 1KV7A 1NPNA 1L9TA 2PP7A 4KO7A 2Y69B 1L9OA 1WA0X 3ASOB 4KOBA 2RACA 3CZUB 3QJVB 4YSDA 1SF5A 2IH9A 5FC9A 2BZCA 1JERA 3AW5A 9PCYA 4A2HA 1JXGA 4YSSA 2HLEB 1YLBB 3WI9A 2EILB 3IE9A 2GB2A 3EH4B 3ZIYA 4KNUA 4G7SB 5F7AA 4UANA 4BDVB 1ET5A 2MRYA 5E9NA 3KW8A 2CJ3A 2WSDA 1GS6X 1SFHA 2MTAA 2GC7C 1L9QA 1PLBA 7PAZA 1XMEB 1ASQA 5B1AB 5I5JA 4DPBX 1CUOA 1FFTB 1J9TA 2BW5A 3JT2A 2N0MA 4UAHA 1V54B 1PZAA 2XX1A 3ABMB 3CDZA 2I85A 3PAUA 1IBYA 1HFUA 1PCSA 3NT0A 1J5DA 3QPKA 3X1EA 2R7EA 5I6KA 1QNIA 1AS6A 2CBPA 5AFAA 4KO6A 3H56A 2FT7A 3FQYA 2IDUA 4DP7X 1AG0A 1ET8A 1SDDA 2FQEA 5B7MA 2W8CA 1HAWA 2VM3A 4AKOA 4N4YB 4JHVA 3QJTB 1FWXA 1BQRA 3AG3B 3GXUB 1MG3C 2Q5BA 5I5MA 5I28A 2IDTA 3BVDB 2QT6A 3EH3B 1GY1A 1URIA 4P5SA 3T6WA 3TU6A 1EHKB 2VW4A 2PP9A 3D12B 1GY2A 4YSOA 3AZUA 4E9TA 1DYZA 3AG4B 1PNDA 3SBQA 1PZCA 1NIBA 1NIEA 1GS7A 3NSDA 3TASA 3S8GB 3NJNA 2UX7A 2BP8A 1JZGA 2PPDA 2CUAA 3SBRA 3GYRA 2XYBA 2EIKB 1ET7A 1T5KA 3NJIA 2OV0A 4GYBA 1AIZA 4F2FA 2AANA 3FYIB 1FA4A 1CC3A 1ASPA 3V9CA 5TK2A 6PAZA 2HRHA 1X9RA 1WS8A 2PCYA 4G7RB 2Y1AA 1XB3A 3FU7A 2BP0B 2FTAA 2W88A 3IEAA 1SF3A 3DIVA 4GP8B 4A2GA 2TSAA 4KNSA 2WO2B 4YVUA 4G71B 2XU9A 2E86A 1JZFA 3IBOA 2CAKA 2CALA 4F2EA 1ZDQA 4DP5X 2YAPA 4KO9A 3TBCA 1NDTA 3N2JA 1OCZB 1BYPA 1KCBA 3ABGA 4YSQA 1OE1A 2P80D 3KW7A 3T9WA 1TU2A 1NPJA 3WNJA 3X1FA 4DP9X 3SBPA 1J9SA 5EHFA 3QJQB 3OD3A 1KDJA 3QJUB 4A66A 2BZ7A 3NSFA 4YSCA 3WNIA 4NAJA 1E5ZA 2YAFA 3IN0A 4NERA 1MZYA 1AR1B 2BW4A 1ADWA 4WKXA 5I5IA 2VM4A 3SQRA 3DTUB 4N8UA 1SHWA 2PLTA 2XXGA 5I6MA 3DKHA 2JXMA 2J55A 3GDCA 2HX9A 2UXGA 4JHUA 1RCYA 4F7KA 3H4FA 1ZPUA 2YXVA 4HCGA 2YXWA 3OQRA 4X4KA 4E9QA 2IAAC 2J56A 1AACA 4A68A 2J57A 1QHQA 3FQ2A 3ABLB 5B7FA 5I6LA 2VSMB 3ABKB 1NTDA 2FNWA 3PLYA 4NB7A 5F7BA 3HEIB 5D4HA 3V9EA 3H4HA 3T6XA 1TEGA 3MX0B 3NJHA 4YSUA 1NWPA 1E67A 2HRGA 2OJ1A 3T6VA 4A2DA 1JOIA 2Q9OA 1J9QA 3EHBB 3ZBMA 4PAZA 4BXVA 1NIFA 1AZCA 4CSPA 1A65A 1KBWA 2YAQA 3S3DB 1AG6A 1JXFA 4PCYA 1WAEA 4GP4B 1JZIA 3X1NA 4AZUA 4AKPA 5B7EA 3OMIB 4HCFA 2FQFA 3WIAA 4YSPA 1A4AA 3NJFA 2ZONA 4QKTA 4E9SA 3AY2A 1GSKA 2X88A 1A8ZA 3NSCA 3IN2A 3AG2B 2XUWA 3WG7B 2HXAA 4BK5C 4UF7C 1NINA 1J9RA 3NJLA 1NIDA 1EZLA 1PZBA 3PXLA 4JKNA 3NJGA 1E5YA 1PNCA 1TKWA 4BDVA 5AZUA 2QPEB 1NWOA 4G7QB 3UAEA 1XB8A 2GI0A 2IWFA 5B1BB 1RZPA 2XX0A 3NJJA 2XVBA 4M3HA 1L9RA 2LLNA 4Q8BA 2I7SA 1V55B 3FYEB 4ZK8A 5A7EA 4DP6X 2FT8A 3X2QB 1WS7A 2FWLB 2PPAA 2VSKB 2H5UA 2AZUA 3CG8A 4K9JA 1MDAA 1E30A 5AKRA 2I7OA 3NSYA 4AX3A 1SJMA 3UAAA 2YAEA 3X1BA 4TXVB 4E9VA 5PCYA 1IC0A 3FSVA 2XLLA 3ZDWA 2YAMA 1PY0A 1ILSA 3FPYA 1E65A 1MG2C 4M4RB 1CYWA 1GYCA 4YSRA 3L45A 3U25A 1PF3A 3TBBA 3QQXA 4W1TA 1AZBA 4BWUA 2B08A 5PAZA 1N70A 2IDFA 3CVDA 1A3ZA 1W6LA 1VLXA 4DPAX 3RYMA 1DZ0A 1V10A 1ASOA 2WO3B 3OM3B 5I6OA 3TA4D 1JVLA 3EH5B 2HX8A 2HX7A 2FT6A 3BQVA 3CDZB 2GIMA 3PAVA 2XV0A 5B1KA 5B3SB 2UXVA 2ZWNA 3WKQA 2NRDA 2R7EB 4KO5A 1MZZA 2VMJA 2AZAA 5IY5B 2GBAA 2YARA 2FQGA 1PAZA 2A3TA 3CVBA 3FQ1A 1I53A 4GY4A 4W9ZA 5D4IA 1NIAA 4DPCX 4DP4X 2DV6A 2FJSA 3C75A 1SDDB 4G72B 5I6NA 1AS8A 4GXFA 2EIJB 4EF3A 1W6WA 1AQ8A 4BWWA 1AOZA 2YAHA 4HAKA 3FPXA 3EF4A 2EINB 1X9UA 4RH4A 2BP0A 1KYAA 4AKQA 1BYOA 2DYRB 2TSBA 1UATA 3S3BB 3MBWB 1WA1X 2BWDA
chains in the Genus database with same CATH superfamily
12E8L 1KZQA 1HI6A 3ZXAC 4NQVA 2RGSA 3O0LA 2V7NA 4HH9B 1HHGB 3OGCB 3V6BR 5DMGC 3CQFA 3LN9A 5FKAA 1M3JA 5C0EB 1QFWH 3ILQD 5BVJB 4W93A 2QADB 4B53A 4I5BA 1KPVA 3HLAA 2Y6SC 1T7WA 5TFSL 5HDRA 1KG0B 3OPZH 1VA9A 1X7QA 3ARDC 3SODB 2RR3A 3A4AA 2F54B 1DP0A 3IB4A 3E6FB 1S78D 4JN1L 4F15C 4FQXD 2HWZL 4AQ1C 3C6LA 3K0WA 1U92A 2F8OA 2XWZA 1VACA 4R5VA 1N59A 4WKZA 2CD0A 2BVQA 4JHWL 2XTJB 4EDWH 3APMA 5ADOH 1OCRB 1PLCA 1DQIA 1SQMA 4HQQL 4OF3A 3VFUB 2B1OA 2D7TL 3DSNA 1DVQA 2W80C 4FQLL 4K3JL 2NY2C 3PIQB 2UVEA 4DKEH 1W0WB 3FU3A 1B0GB 3KPNB 1INQA 1JWSA 2XTJD 3FSWA 1E42A 5DO2D 1AGBB 4Y1AE 2HJKB 3S7GA 4B5EA 3IVKA 4NM8H 1EO8H 4JUTA 1IBBA 4E9RA 3OSVA 4NZDA 4R84A 3L4WA 2IGFH 3U0TB 2RFXB 2Q10A 1NUNB 5K39A 3BZ4B 2DQHL 1N4XL 4WSKA 1LMKA 2W0FA 1WK0A 5IFAL 3NJMA 3EUUA 5LAXB 4FD0A 4RCAA 4XVTL 3WLBA 3P3RA 4NO2B 1JXDA 4HOZA 1RURH 4FKEA 2YXMA 2DRUA 3WFEH 2DYPA 3LD8B 4PWKA 2ZSVB 4OZFG 3DV6A 3GSOB 3A67L 3PUUA 1DSWA 1T22A 3AMLA 4WV1C 3KWUA 3WJLC 2NY1C 4S1SL 3CSFA 4PLJD 4UZGA 2EVGA 4PJEA 1J5CA 4LSSH 3QWNA 1EHLL 3K6IA 5F71A 2F5BH 2WLNA 2AJ3B 4ODSH 1Z9SB 3DECA 3D8MA 3V4PB 4BQCA 4JDZA 1JPEA 4IHBA 2BWIA 4UQ2A 4M1CD 1N68A 4K73A 3VFTB 1DBML 4Z7NF 4N22A 1GR7A 4OFKA 1TTAA 4TM9A 4DERA 4QD2E 3CVCA 5LJYH 4FCAA 4IIQC 2OTWB 2G5BA 1PEWA 1HCVA 1OGTA 4X42A 1MFBL 3FSZA 3C60D 1N5YL 1L5GA 2V5YA 3TA3A 4UM9D 4M29A 2A0LC 5EZPA 1U91B 4WFED 1IC1A 5HYJB 3B8YA 4MDIB 3AWEA 2NXYC 2VMCA 4YPGA 3QPQC 3HE7A 3LPWA 1FSKC 5GS2H 1MAKA 1ODAA 4UQCA 5IK3B 4Z3FA 5IMLA 4X6BA 5EC1A 3S98A 1WA0X 2IJ0C 4EIUA 5HYJD 2J1XA 1ADQA 3T1FA 3SDAB 4ZSOE 5MHSD 1BX2A 3L4UA 4R4NC 5BS0D 3S48A 3RVXD 3MOBL 2BMKB 4Z7VA 3V0IA 2GB2A 3RPIA 3NIFF 3NPZB 3SDAD 4KI5D 2ZOWA 4BFEA 1YJDL 4WFHD 2AEWA 2WINA 4N90E 1OAUH 1AIFA 1E9OB 1G0DA 1TQTA 2YFNA 3KEHA 4OCYL 3T0VA 4XBGA 1GH7A 4GQQA 2BP3A 5D8JH 3BEVA 5CD3A 5FDWA 2B1HH 2DBLL 3I6GA 3W2DH 1QRNB 1CMOA 2DQGH 2MMXA 3E7JA 1AKJB 1BZ9B 2YD9A 4U2ZA 1JZ7A 4MAZA 3LXUX 1A1MB 1OB1B 4ZO9A 3BWUF 4WI7A 1T5XB 3NVQA 2XX1A 5FUCE 1IGFH 3ABMB 2I85A 3PWPD 4PRNA 1F0LA 3KGSA 1QRND 4PEEA 3MVSA 3EADA 2Y5EA 1AKJD 1G7JB 1JGLL 3U4BL 2R7EA 2Z93B 4UTAL 5JTWA 2VDLB 4FXLA 4JN2B 1AD0A 3I9PA 4Q9RL 2DLEA 3QI9A 3AB0C 4FS0A 1AS6A 1MNNA 2PW2B 5FYLL 1MW2A 3U4AA 3VXQB 3QFDA 3QO0A 4FTVE 3SCMB 1A4KB 3EJYD 4AQ8C 1GYVA 4L3EA 4LOEA 4JFWA 2A83A 4I0KA 3QFGA 1KGWA 3D0VA 2N7AA 4EBQH 4LZKA 3ZZQA 5IJCC 1G7PA 5EBLB 3SCMD 5DEFA 4OLXL 2Q5BA 2ITCB 4FLQA 5KVEH 1RMFL 1IAIH 3SPGA 2ZOLA 4FL4B 2VO8A 3LZOA 4NBXB 1XT5A 4MMXA 3S4SB 4XVUC 1RZJL 3B3IB 4G11A 4XBPB 2FCBA 3N43F 4GSQA 5T1MA 4H8WL 4PJ5A 1KXTB 2PP9A 3D12B 4DZ8A 1LWRA 3B9EA 1B4RA 4XTRC 5FEBA 5B22A 2C3WA 4MD0B 3VXMB 1PDKB 3X14B 4DN3H 4X4XA 5T3ZL 2D7NA 3ULUL 3N41F 1EAJA 3GI9L 5DRXA 4XNDA 4NI6A 4KRLB 1ZTMA 1G6RL 5AZ2H 3TN0B 3B2DC 2E9BA 5DHVH 4P0DA 3VXMD 4DUWA 4WF7A 2BS9A 1BPVA 5KVFH 4A7GA 2BLFA 4LDCA 4KRPC 4P9MH 1QBLH 1XR9B 3ULVH 4EI0A 5D1XA 4PRHE 2W9DL 2A9BA 2YMOA 3FU5A 3QRBA 2HRHA 3TN0D 3JV4B 3CMOH 4Y5XA 3DMMA 2QPSA 5CZVH 2VLKE 4PWGA 3FB7B 3DV4A 3US9A 5HGHB 3ARFA 4YMPA 3DPBB 3QYCA 5I0YA 1XCXA 5I0DA 2Q7AA 3IJHA 2VLLA 1MXGA 3QZBA 4U1HB 5EIVA 1J88A 5HDBE 1BGXL 3S3PA 3W1ZA 4XAKE 1Y0LA 2P5PA 4JDEA 2WZAA 4S10A 3ME0B 2XBZA 4WJG3 1Q9LB 2NY2B 3RIFK 1MFCH 4IMLB 3TFBA 3EDEA 2ZCKL 1PZ2A 3UYPB 3FONB 4P4KA 2IPUG 3EO9H 3UZEA 1HE7A 4X5XA 5AYUL 3MLWH 5SV4A 1E9QA 4FADA 5EZJB 5LUMA 5IQMA 3WNIA 1T2QH 3BAKA 3QJHA 1MRFL 3FO0L 3QRLA 3BH9B 4MS6A 3PGDB 1MZYA 1PBYA 4MKTA 2BW4A 4TL5A 4QRUB 5LG1A 1WFJA 3K6SB 3CDGA 1IILE 2NNCA 1ES0A 3BUYA 4HWZA 2ZYSA 3K80A 2LTQC 5MP6H 3HZVB 3PL6A 4ZMYA 3FUJA 3NZ8A 3D4CA 1VCBC 5CBAA 3V6ZA 1NJ9A 1XIWB 1QFWL 4LOUC 4DKTA 3F7VA 3WN5A 4UQ3B 5D6CA 5LGKA 3U1SH 4LESA 3DVNB 3WHXB 5JXEA 4E0RA 5AB1A 2BC4A 4HWEH 1NTDA 3OPZL 5KBDA 1YEIL 1P9MC 3E8UH 3V9EA 2VXQH 2DIJA 1LO5B 5EEXA 5BZDA 3VTAA 1XIWD 5L88H 1DUYB 5HVGB 2J72A 2W0KA 4LB8A 1EH9A 3NJHA 4EDWL 2YGOA 4K5OA 1T3FB 3O3BA 5BVPL 4L18A 2C3GA 2X4OA 5E2UH 1NGZB 4PRIB 1SXBA 2YMXH 4NCDA 4Y8AA 4B9FA 2A6KA 4XE5B 2YAQA 2WWNA 4OJFH 5M95B 2LABA 1AO7B 3GMPA 5DRZB 3W9DA 3FCTA 4XNXL 4L1TA 4NM8L 4PRID 4E9SA 4UMSA 4PJAA 5D1QE 3E38A 1I3RA 1AO7D 2K7QA 2X9YA 2X1QA 4PCKA 1KCRH 1P7KB 1R3JA 4YL9A 2R1WA 5D2LF 5F8RC 4Z77A 3I74A 5FA3B 1UD8A 4PD4J 1PZDA 2HRPL 1CBVL 4PJ8B 5JHDB 3L1OH 4ZRGA 4L8BA 2MCPH 1ZANH 5DRWA 2K8QA 4G7QB 3DIDA 5J6HA 4HEME 1XB8A 4P46B 4KDTA 3C5JA 3ZHFA 3PQYE 2FIRT 4PJ8D 3UO1L 5JHDD 2N7BA 3U2SB 1LP9F 3L2LA 4F7EB 1WAPA 1YMHB 5TJWK 2VL4A 1FLRH 3WIIH 3Q8BA 1A0QL 1FZJB 4JFFA 2I7SA 2OJEB 1MCFA 4POZD 4P46D 2AXFB 3EYVB 3BHBA 1H3PL 3KPSD 3Q13A 2D8KA 2GFBB 1CT8B 2H5UA 1E4KA 3GSUB 4YHYC 1XF2B 4U6XA 4X99A 3WUWB 1ROWA 4KUCF 1JWMB 4NRZA 3HZKA 4PG2A 4A63A 4YWGH 1I1FA 1CFMA 4NKOA 2X40A 2AXHA 4AX3A 4TXVB 3P4LA 1O75A 1DBBH 1A6ZA 4JFDB 4BHUI 3TVMB 1I9EA 3FSVA 2NY4D 1JN6A 4HPHA 1NUGA 4UIMA 1CGWA 4PJHB 4EDXB 2H0FA 5IB2A 3ARGC 4M61A 5TDPA 2WXGA 1OLZA 2OL3A 3RFRA 1X5MA 2OMNA 4HDIB 2XETA 4LPYA 4JFDD 4OD1L 3WNNA 3TVMD 2EYRB 3H3PL 4GAFB 2Q6WB 1KFGA 3T3PB 3AREB 1I7ZB 3TBBA 3ZVVA 5AAWC 4S2SB 2GCYA 1DANU 3NGBC 4XO5A 4DPAX 4GRWF 3U36A 2DH3A 2P3YA 1UD2A 4J3UA 4YBQC 3QORC 2AV1A 3ARED 3PWVB 1BFOB 4AEHH 2HPOA 1NMBH 5FKPB 5LGHH 4RX4A 5CILL 1FNEA 3SDDB 3QXAA 4PJ7A 1JHLH 4GRLC 1M7IA 2FGZA 2XN9A 5D7IF 3L5WA 3RKPA 1CD1B 5IT2H 3MNWB 1U8OB 3VH8B 4N2GA 1KIUA 4Z6AT 3GMQB 1QP1A 1LEGB 5I18H 4LCYA 1YUKB 4YO0A 1G7MA 4XNQB 4EN2A 4OZGB 5L7XL 3SDDD 4N5EC 5F7NC 1FNGB 1U8KB 1UWXK 4X6DE 1ETA1 5JIQA 4NZRL 4JJ5A 1X9UA 5D8JL 1LE5A 3OGOE 4JBSA 3ESOA 3MZGB 4U1GC 3U7WH 1HH6B 1UXWB 2BRRL 4NEHB 3GS4A 2P80A 5FR3A 1MCQA 3KLHC 2V9RA 3BVTA 3QZOA 1SXNA 5T3XH 2KDGA 5EU4B 5H2BB 3VFGH 5ISZB 3JV6A 4NZFA 1ND0A 3B6SA 4KZDH 4Y9BA 3JSSA 4J3OF 1IAKA 5FB8B 5A2IH 1A7NH 3KS0H 3GJFB 2OJZH 2E7HA 3L3JA 2EEBA 2AFNA 4FTDA 2CDGB 3IDJB 3L4VA 4PCTA 5ISZD 1H8OA 2FO4A 4X8XA 4YL4A 1PGRB 4UM8B 3QDMB 4FNLH 4JM0A 3IFNL 5DXWA 1JZ4A 2GSIA 5TK4A 1WHOA 1AXIB 3Q8AA 2J5LB 5C07A 1CK0L 2A9AA 5HGBA 3RWIB 4OGAC 4GMTH 2DQUH 1GYWA 1FGVH 1P0SE 3BFQG 3CX2A 4GP5B 1IUZA 3QDMD 3OMZA 3IXAB 3X12A 9CGTA 3LRSA 5KVEL 5EUKB 3IF1B 3OKOB 3BC9A 1LO3L 4YXKH 2P8MA 2CIIA 1DLHB 1OPGH 1FNLA 3VRIB 4Z76B 4PY7A 2XJLA 1GL4B 3CFCL 2JKNA 2X05A 1JHTB 3WELA 1W8EA 4YQXH 4QLWA 4QRTA 1AGFA 5IVXE 4DN3L 5G4MA 5DD3L 4UTBA 3EYOA 1HL9A 4DKDC 3H0TA 3I3EA 4FQQB 2UWEE 1FJ1B 3I75B 2WZ6A 1AAJA 2MPVA 4GAGH 5F1IB 5JW4Q 5KS9A 5AZ2L 4ENZA 2YPLD 3SE9L 1M57B 5EORL 3UAJC 1T4KB 4NZUL 3T3ME 3G5ZB 4KJYA 3HZMB 1QBLL 2FNBA 2DQJL 5D9SA 2F7IA 5EBMB 2J8OA 2MPAH 3WOVA 4PQXA 4HAGA 4E2OA 4OV5B 1TG8A 3H6AA 4ZFZB 3IGKA 5DVPA 2EC9U 3O3DA 1URLA 3AQXA 3D39A 2AK4E 5D7LE 2HN7A 1D7CA 4ABWA 1RI8A 1AZZC 3MRKB 4H1LB 4Q6IC 2JXMB 4CC1A 2ZP8A 3DX6A 4CSZA 3KPPB 4UUJA 4QXUL 2YS4A 4CMHC 2WTOA 8CGTA 2O61B 4X4YA 2QDWA 4RGND 1EV2E 2DJ4A 1KDIA 3NAAH 3O11A 4GW4A 4QRPE 4NGHL 4LCVA 5C86A 2JCCE 4B0MB 5JOFB 1UA6H 3BVNB 3KDPB 1JVOA 2JFCA 2QHRL 4LKCB 1KEGL 4U3SB 3RTLA 1CDIA 5DHDA 1WD9A 4GW5B 3BKYL 3MLWL 5D7EA 4Z7OB 1H5BB 1AS7A 3VXUA 1X5JA 1YPZA 1QATA 5D1ZA 5AOKA 1T2QL 4DP1X 1YCSA 3W3BA 1XH0A 4C54A 3B8SA 4NNPL 3QDHA 5D55A 3Q5OA 2XWJA 4FGMA 1UM5H 1P2CB 3HNVH 4UOQA 1DBKH 4K7PX 1ADQH 2Y69B 2Q20A 5JOEA 4JDVA 4HEPA 2BIOA 5F9OL 5GS3A 4RDQF 2VKXA 1ZA6A 4BCZA 3TBYB 4AUUA 4MCYB 5FC9A 4ANKA 4K5NA 4ODHH 4D0DB 3CHQA 3U1SL 1R5WB 4EXKA 4XCYB 2OCFD 3MUHL 2MKLC 3NACL 2G4EA 3F6IA 2VXQL 5D6DA 3MJ7A 4CJ0A 1MH5B 5A16A 2FEEL 3KPOB 1CTNA 3K6DA 5C09A 4WO0A 5SWQA 1DN0B 3VFRB 2ICCA 5GGRB 1IVLA 4WDIA 5E2UL 3VRLF 3QWQB 5J1SC 4FQHA 1G1KA 1PLBA 2OSWA 3U30C 2YMXL 5K1VA 1NCCH 3HUJE 4UT9A 2ROYA 4JL2A 3HVNA 1FFTB 3MJ9A 1ETB1 3CN2A 4EN3A 2DQCH 5IGXL 2YQGA 1HKLH 3MXWH 3MGTB 4UAHA 5LBGA 4L8SA 1IQWH 4IBYA 2F53A 3KLAB 4UQBA 3FFDA 3SPJA 2H2SC 4IU2B 5FO9A 3S37X 4BQ6A 1F8TH 4QF1A 1RZGA 2B8OT 1QSZA 3NFSH 3NGBB 5DJZB 4NSKA 5F6IB 4RFNB 4OZIF 4JFSA 2ZJSH 4MJHA 1U30A 4LLVB 3UYRH 4RISH 2XY1A 1KCRL 4JFPB 1MIEL 2IDUA 3H7BB 3UPRB 2KKQA 4KKRA 5SWSE 4JY6A 1Q72L 1KXVA 5I1AB 1FZKA 2W8CA 4KK6D 4YN3A 2NYKA 4JANB 5KANG 2ZG1A 2FBJL 3GXTA 4ZO7A 3HRZA 2C1OB 2O1AA 3ZDZB 2X7LA 3TGXA 2BFGA 1AP2B 2N7SA 3RGVC 1JGUH 1S8DA 3QWOB 3UOAB 1FLRL 1GY1A 1QBML 5EDXA 3WIIL 1RQ5A 4P5SA 3TU6A 2ZCLL 2IOMA 5DK0A 2CMRL 4R4FH 2CXKA 2J8UA 3BPCB 3C5ZA 4YSOA 4TVPE 2IMNA 3VWKB 1NEUA 2IG2L 4AGOA 4KTEH 1O6TA 1NIEA 1Q9OA 4LASL 4MNGB 4A6YB 1F6AB 2EDNA 1K8IA 3QUKA 2D2CC 1FRGH 4GW1A 4XOCA 5DZAA 3GXIA 4KI5F 5C0FB 2A77H 1DBBL 4TUUA 3GI8H 1AIZA 3VWKD 4FLSA 3QIWB 5ILTH 3ZN6A 2HMIC 2OYLA 1NCWH 1SMDA 2CA4A 1CFQA 1JAEA 4IBTA 4XHQA 3UTSA 2BFVH 2ZXDA 5AOIA 1I3GH 2H1LM 1D6VH 3JT0A 4UILL 3QIWD 4E42A 5EC2A 1K5WA 3SJVE 4QR7A 3KCPA 1MNUH 1J05A 1UKQA 1JZFA 2Y3AA 3CZGA 5FWRA 4G42A 3I3BA 3FTWA 3GTNA 3RDTB 1JZDC 3KVPA 2NZ9C 4DP5X 2B5IB 3HG1A 4LLYA 1HNFA 3VD3A 2EQDA 2X28A 4JRFA 2JELH 2FHBA 1IL1B 4FA8A 2ZYRA 3EFFA 3BO8A 1JHLL 3W81A 35C8H 4G83A 1NEZB 5E1AB 3W82A 3FO9B 4NQCE 3RDTD 3IKKA 3EGDB 4KQ0A 4YDVB 2TAAA 4HZLB 5I18L 1OIOA 1KT2B 5HYQA 1C1EH 2K6ZA 3V0FA 3T0EA 5K9KB 3F6JA 2W65B 4Z8FH 3VB8A 3ISWA 1ZVYA 5DUPH 3CLFL 3MRJA 3DVGA 1JI2A 4Z9KB 4HK0A 2A9DA 2Y5QA 2DQEH 2Q8AL 1WZ1H 2HT3D 4PTUA 4BKLA 2B14A 2EXYC 4CVXA 4PGBB 5FW8A 5EU3A 1UCBH 4AYGA 4XO3A 4P48A 1XH2A 4TTDC 4Y1AD 1BAFH 1TQCC 2EDHA 1YEHH 3B7TA 2NUTA 4Z5RB 1G87A 3Q6FB 1R24B 1KLUA 1DHKA 3VFGL 4DSYA 1I31A 5JW4M 2HFFB 3MRHA 4KZDL 1KIRA 2UY6B 2YXWA 2APXA 3C8DA 5H8DA 1F4HA 1FZMA 4BQ8A 2XFGB 3L2MA 3TLRA 1K4DB 4L23A 5T1LB 4HIXH 3L81A 2A9CA 3QNXB 4Q4EA 1JZ8A 5I6LA 1K3ZA 4CMHB 4XXCC 3AMKA 1J0KA 5TF0A 5FF6A 1ZE3H 3FUKA 4N2LA 3BW9A 3L9RA 1G9MH 2OM5A 4G7YL 4GMTL 2DQUL 4NZ8A 2R0LH 1HQ4A 1FYTB 1IGYB 2R56H 2VDOB 3A4FA 1TJGH 3G6JF 2CUMA 4HJJH 3GMMA 3QDGE 2WXKA 3P2TA 1A4JA 3IMVA 4QCIB 1XBDA 4PI2A 3SZKC 3B5GA 1U3HA 4G8EA 3PP3K 3T8MA 4YXKL 1JF1A 2Y22A 1VERA 2PF6A 5B3NA 1UWXH 1PZ3A 2R1XA 1OPGL 3IXTA 4Y89A 5F9AC 1NOAA 2YPVL 4HS8H 5B8CB 2C4FU 3FTSA 4GEIA 4AKPA 1DANT 1H15A 1RSYA 4TPRL 2ZONA 2F58L 5D4QA 1PG7L 1GSKA 1N64L 2DWDA 3NSCA 4N8PA 3N85H 4UOW0 2JE8A 1KTDA 4CDGC 2WUCH 1E4WH 3Q06A 1NIDA 3NFNA 1R3LB 2YGVA 3PXLA 1E5YA 4JGUA 5DSCA 2BNQE 1CICB 5C2BH 5JA9A 3U79A 2R0ZH 4P2QA 3ARWA 4K71B 1DFXA 1EQWA 3F85A 3KNBA 4IRJC 5E8DH 3KJ6H 43C9B 1JZ2A 5ICYB 3QCVL 4CW1A 1SEQH 3AQDA 5CU5A 2V5MA 4ZW3A 3L7EA 3RZCB 3D18A 2WJ5A 1CICD 3BISA 4D94A 5DU7A 4ZMWA 3FFCA 4AC2A 3BAEH 1G7LA 5E9AA 3E1F1 3MA7B 2DM2A 2EICA 2FEJA 2MCG1 1TDQA 2BX5A 3FOMB 3RZCD 4NJAH 5D7SH 4MA1C 2IBGA 3K8KA 1JYVA 4KK9D 2O6FA 1T20A 1XBRA 1P5UC 3TYFA 2GJ6A 3UAAA 1DQQA 3U9UB 3X1BA 1JPST 1X5FA 2PYEA 2VCOA 5CEXB 5KTEH 1TYEB 4JPKL 1AOHA 5SX4H 2OL3H 3CGTA 2JCWA 1BZEA 1A3RH 3GSVA 4WW2B 4N90D 4Y9GA 2ENJA 2VDRB 5EU7C 1DJSA 4JG9A 8FABB 3JWNC 3MNZA 3FO2B 1OTUC 1QPKA 1RERA 4XAWH 1MG2C 5EB9A 2CXGA 3Q8EA 1ROCA 2AEQH 4OJDH 2NY6C 5DS8A 4IOIA 3BPNB 3ETSA 1FGNL 2FVNA 4DJMA 1ITCA 5HHOA 1RL1A 4U0QB 4XOBA 3JVGA 1VLXA 3HNVL 3QCTH 1CLZH 1DBKL 1ADQL 4D8OA 5AZEH 1NFAA 3SKMB 3VU1A 3IMWA 2HX7A 4JRXA 3CDZB 4CC4A 2GTWB 3BGFC 1N0LB 4F57L 1HZLA 2FL5A 2E7MA 4L9LC 1CFSB 2W0LA 2YEZA 2KL6A 4FTVD 4LEEA 1EX0A 1SEBA 5DURB 5B1KA 3KPRA 3HPLB 2VMJA 3TO2A 2OAAA 3RHWF 4QTIH 1T4WA 3NPSB 4L1DA 2E7LA 3D87B 1JK8A 4WWNA 4BSWA 4YXHL 3RWDA 1CDHA 4ZAKB 1F3JB 1JXJA 2P5EE 3K6FA 1BM3L 1OCWL 5DURD 4GXFA 1O5PA 1A1NB 2APBA 3EGXA 3LEXA 3LNFA 5I8OH 1M05B 3CIQA 4RWYH 5CXPA 4FI8A 4JVWA 5ALBH 4S1RH 4XP1L 3WAKA 2FSEA 1UM6H 4HUMB 1XGZA 4NC1C 3SBWA 4YJZL 4ZAKD 4R4BA 4MSWB 2EC9T 4ZJ9A 1BF8A 1NCCL 2IBBA 5CCKL 4QO1B 4JHAH 4WHTB 5E9DA 3HJ0A 3LKRB 4G9DB 3MXWL 2V2XA 1IQWL 1GGTA 1P7QA 1A6UH 3PABB 5IBUG 2JKWA 4L37A 3BUDA 4HZ1A 3Q05A 3C08H 5T5FL 1HEZB 2DW5A 1JGDA 4OIFA 3QAZB 1A7RH 3H9HA 3UYRL 4G80A 4MWFB 4QXGL 3QULA 1NCOA 2WQ8A 5CWSB 4GEJA 5ID1A 3B2UD 3NP4A 4LRNL 3EDFA 2H9GB 1QR4A 5EFIA 4H40A 1DBAL 5B38G 2ODHA 4AE1A 4HK3J 2UXTA 4BXSV 2GKIA 2FK9A 2HJLA 1EZUA 1R3KB 2EDFA 2PPCA 1OE3A 5CGTA 3LRHA 3P73A 4WTZA 4U4BA 3T3PF 1M56B 2ZICA 1VEOA 4JG0H 1HDMB 1JFQL 3QARA 4F9LA 2NXZB 1A4CA 2AKRB 4UTBH 4R4FL 2CLZB 3FBQA 2YAOA 3KBEA 3LQZB 3MRPA 5DJYB 2GTZB 1CL7H 4OIIH 4EOWH 3F7QA 3FTYA 4HIJB 2GBTA 4KJQD 2VXVH 3MRFA 4K3HA 1WC7B 3S8FB 2FZ3B 4LVNC 2BCMA 2K45A 2NXZD 1NCAH 2IH8A 1ETJA 3GI8L 4JS7A 3EOYG 2WUBH 1OTSC 4MHHG 1J10A 5GGTL 1CXHA 1N8ZB 4YHPB 5A2AA 2ZXQA 4QJ5B 4OZGF 5J57B 5KBPA 3LKSB 2GHWB 5I1KH 5ESQA 5F0PB 1I1AC 1I3GL 1TEFA 4L8CB 5ID0A 3L3DB 4G70B 4NHCH 3X1GA 1GCFA 4BV1A 2A74C 4KKAC 4Y88A 2IPKB 3MUY1 2YBGA 1Q0EA 1Q9KB 4P59L 1MNUL 4AIEA 5TF1H 3OXSB 5J3HC 3ZHKA 4BELD 1YECH 2IDQA 3APNA 1ID2A 3ATBA 3O9WC 4GUCA 5F3BA 4KITB 4GAYB 2F7QA 5CMAA 1ZXKA 1OE2A 5J6GB 4UNUA 3G6AB 2JELL 5AVTB 1N12A 2F7RA 2C1PA 4NQSA 3B5HA 3G3LA 35C8L 1UXSA 3VG9C 2ETWA 3N91A 3L7FA 1JYWA 1DQMH 1MHPH 2F68X 2ZQKA 4RAVA 4DGYH 2VXSH 1ZHLA 4JZJA 5I15H 5DFWH 4XP4H 4FFYA 1CTOA 2F1BA 5AVXB 3N44B 2YZ8A 2NTSP 4OGZA 1BLNA 5DUPL 1KGYE 4EPSA 1Q1JH 1D5IH 3X3GH 5D1QB 1UD5A 4HK3N 1F6LL 4JG5A 2O72A 1JZEA 3HR5B 2QQKH 1QTPA 2ID5A 3LRLA 2PUQT 4LCCB 3MLUH 1F11B 4YDZA 4TSAH 4N8VA 1S7VA 5CGYC 2VOTA 2E7CA 3WTSA 5F8QC 4AM0Q 3MRRA 5D1QD 2OZNA 2DJUA 1T03H 1CD9B 3ILDA 1JPGB 3IMBA 1T66C 4G1MA 1QNZH 2W9EH 5FS5A 2CHDA 1DL7H 4JCLA 4W6XB 1BF2A 1F13A 1I4FB 4RNRB 4PJIB 2B0SH 3AY4C 2FECI 3L9YA 3O8XB 1VF5C 5BZWB 3MV9E 5DJ8A 5F7FA 5ESVB 3HE6B 1LD9A 1TKWB 1P5UB 5BZXA 4AOFA 2Y7MA 4N68A 4ZPTA 1JK9B 3O41B 1IBGL 4P5KA 1ZLSH 1I8AA 2WPGA 4UT9H 4P4RA 3MJ9H 2HJFB 1L9QA 4L9DA 2UY7A 2ADGB 3HE6D 4KAQH 2UZIL 5I5JA 1RIUH 3K6OA 4UQEA 3VA2C 1B0RB 1LYQA 3WGUB 3FUIA 5DJAA 3LKNA 4HS8L 4I0CC 2VAJA 5BRZA 3S5LA 4ZFFB 1E0OB 5I1IH 3L9EA 5HHPA 2EE3A 3B2MA 2XQYG 4H8VA 3T0BA 2IWGA 3B2XA 1DJGA 1L9MA 3SYAA 1ZS8B 2CBPA 1Z6JT 4R7DB 3DRTB 2OSLA 2KLRA 1MVFA 5E5MB 5AAPA 2VDMH 3MJ8A 2PO6D 4Z0XA 1BJMA 3VTTA 4FLHA 1IZKA 4M7LL 1M1SA 4Z7OF 5JUEH 5C2BL 4UYPA 3SKUD 4FQ2H 4BUHA 4LCUA 3QJTB 1RZKH 4QRQA 5E8DL 5ABZA 2HKHH 1NL0L 2BY2A 4QAWA 4GG6A 3CMGA 3GMRB 3BZFB 2FIKA 3MCG1 2BDNH 2R23A 1PX3A 3RA7L 3UTTE 1S5HB 4I3SL 5E8OB 3BVXA 1A66A 5EZOH 3SGEH 3LJ3A 4K15A 2NLJB 4XXDA 5EO1A 3U1PA 5HYFA 2JKJA 5ERWB 3AZUA 2ENQA 4UDUB 4XR8C 4WUUB 1ZT1B 4M1DL 4B9JA 3S8GB 3MREA 3NJNA 4DH2A 1RUKH 4K5MA 1OAKL 3UERA 1UD6A 1F4YL 4UQDA 5KTEL 4M5TA 3HBZA 3NJIA 3SYPA 4JFEA 3IKCA 5J56B 4WUUD 5KYXB 3G08A 5EF2A 2NY3D 2XWEA 2I07B 5IB5A 3SO3C 3RVWC 3U0PA 5TQ2L 1N19A 2HG0A 1J1XH 1PX4A 3GZPA 1VGKA 3UBGA 1EZVX 4IBVA 1RU9H 1JMXA 2XQ0A 3UPAA 5AKSA 32C2A 2RB8A 3ECBB 2ZX5A 2W88A 3NESA 4HIHA 3EYQD 4CNIB 5H35B 4MS8C 5JW5B 4ZYKA 3CAFA 5IKCA 3STBA 4PHZA 3VNZA 4HXAH 2GG1A 3OV6A 5A2KH 3FQ4A 4M8QA 1N5AB 1ZWIA 3WAJA 1ZDQA 3S5YA 2EC8A 1WEJL 3H9SB 3BUBA 4KO9A 5KVFE 4Q97A 1XF5A 1ZGLP 4IHOA 1NGPL 1IBHA 2EIDA 5DHXB 2C4FT 3EJJX 2BNRE 5DUBB 3RFZB 3ULVE 3JWDL 2HG5A 3B2VH 1CXFA 1FVCB 3M88A 1UT9A 5F88A 5DD0H 4PJDE 2Z35A 1NPJA 1CGSH 3H9SD 4NKIH 3FT3B 5BV7L 4YFLI 5JO5B 3MLTA 4AUYA 2V9QA 1G7HA 1FUNA 1HYRC 1P5VA 2AQ2A 2IQAA 2VIRB 3P3SA 4KXZI 4N0FB 3AWGA 5I8OL 4GUQA 4RWYL 5ALBL 4PJGF 4IGBA 1JV2A 4S1RL 5SWZE 5IVXB 1U6AH 1T89A 3GMLA 1YNTF 3ZDZF 3ZE0E 4Z95H 4YGVA 1E2WA 1UQSA 1LNUB 2FBRA 2KBGA 3QJFA 1HN1A 4ODTH 3BDBA 4R7XA 4ZOAA 3ZL1A 1I8KB 2UXGA 4JHAL 2HTKC 3NIGE 1H3VA 1NAKH 3CZFB 3T3MB 1I1AB 3IFPA 4CMMB 3OKNA 2A74B 4ONGL 4HCGA 1GXEA 2J56A 1RK0A 5EIIA 3ARDA 3BGAA 2Y36L 4YFEA 2CLRB 4L2LA 5DD1L 2EEDA 2FWUA 1UEMA 4YIQB 3O9WB 5D7LB 4AQ1A 3CHSA 3O45A 4FI6A 4KMTH 2JKTM 2R69L 2VQUA 4JO5A 4Z7UE 4FFTA 4BZ1A 2WP3O 2EDTA 4U6VL 4LL9A 5D72L 2VJ0A 3VG9B 5I8CA 4YSUA 5D7LD 1MFDH 2MIZA 4X5QA 2LU5A 1DVFB 4CAGA 1JD9A 1VB9A 3ZBMA 1OM3H 5TE6H 3VAEA 1WHPA 1S46A 2DWEA 1PZ5B 3RJQB 4BJLA 4KVCH 4N2OA 3S3DB 1BOGA 3Q2NA 1I1CA 3IJSA 1WAEA 2K4WA 1DVFD 1T1XA 4QRPD 4UTBL 5LO7A 2WBKA 5B3JE 3Q0HA 3O0RH 1CL7L 4OIIL 2DIAA 4EOWL 2KZ1B 2VXVL 3NK3A 2ZKHL 4FF9A 1NCAL 3ILEA 3WD5H 1UZ6E 4I0PB 3VNYA 3VXSE 1RLBA 1PFCA 2NW3A 5IHWA 1YJDC 1IGJA 1C08B 1FBIH 1T1ZA 2VR6A 3NZHH 5IEKB 5ITFA 1PJ9A 1QFUH 1X3DA 2M1KA 5DWPA 2DLFH 2BOLA 5CSBA 5FYKU 1S7WB 4GUPB 1OSEA 1ZRUA 2IDCA 1NCTA 5D2NC 2B1AH 4I0PD 3UAEA 5JYLA 4B95C 4AEIH 4WV1A 4BUQA 3WJLA 4NHCL 1MJ8H 2YUVA 3QHFH 3CV5A 3STLA 3KXFA 1ORQA 1S7QA 5IESH 4ABQA 1L9RA 2I26N 2Y5TA 3CSTA 1NGXB 4FQ1H 4WI3A 2CNYA 1ZEAL 2A9NL 3FYEB 4IDJH 1KC5H 2OZ4L 5LXGH 1UB5B 1MLBB 2VSKB 5DC0A 1NCDH 1Z7JA 3B9DA 3AT9A 5L2JB 1JVKA 2Y25A 4JFUA 1F4XH 5JDSB 4PY8J 1NAMB 4IIQA 1NC2A 3ZTCC 4L4VE 5EPMA 5MEQA 3GHEL 4D2NA 1MHPL 2VXSL 2VLJE 3MLVH 4BFBD 4GBXB 3CBRA 3BI9X 2D9CA 5LNDA 1B9ZA 3UJTH 5JORA 4ODUB 4XP6L 1N3NB 1MREL 2A6JA 2NYYC 3CVHA 1YNLH 4L29B 3FOLB 1Q1JL 1D5IL 2BK8A 4XHJC 2CK0L 4YDMA 5EO9B 5AW3B 1E8WA 4GBXD 1RZJC 1RZ7L 1JYXA 4GB9A 1DQDH 2FH6A 4H8WC 3IDGB 1N70A 2LR4A 3EFDL 2ILLA 1FL3B 2D31A 2QQKL 5DFVD 3KYMB 3GMOB 4DQOH 1RP8A 3MLUL 3KWTA 1DZ0A 3EZJB 4F7TB 1WBZB 1JTTA 1CWVA 1JCVA 2GJZA 3ARBB 5I17B 4OFYD 3ULUC 2A9MH 4NC2B 2FT6A 3BT2H 3MRQA 3RX9A 1GGCH 3JTTB 3KWVA 5IM7B 4E5XB 5CCHE 3NRPA 2JTDA 1QNZL 3DHMA 2H4EA 2CO7A 3WKQA 1DJZA 5CFAA 2FX7H 1MZZA 3ARBD 5T5NG 5CIPA 3TT3L 4L4TE 4JMXA 4NKQB 1JPFA 4D8PB 1SUJA 2DV6A 1SDDB 5J5EA 3O4LE 3I6KB 3EO0A 4OJEH 3N5AA 1AQ8A 2M8XA 3BZ5A 1B3JA 1ZLSL 1XCQA 3QUXB 4ZBJA 1G0XA 4UT9L 4A7TA 4AGQA 1LO0L 5BO1H 4JCMA 4KROB 2DYRB 4KAQL 3VGAC 4F5CA 1EO7A 3F2LA 3MBWB 5D5MA 1NGYB 1RIUL 2AAAA 4HT1H 2IDSA 1Y6KR 4TVPD 2R2BA 2VXUH 3QUXD 4HX1B 3CZNA 3CZJA 3G5YA 1Z9MA 4KROD 4P5MB 5F1KC 5AW4B 2OW7A 3BYTA 4O2EB 4EVNA 1AI1H 2C5DC 4LMQE 3F7YB 2XXCB 4QHLA 1ZVSA 1ORSB 3SDCB 1XXFC 4F33A 4PP2B 5JDJA 4RQQA 3SJVB 1UA3A 2VAAA 3P0YH 5GISL 4BSVA 3WN6A 3QWRD 4X7CC 2VDML 5KYWB 2NSMA 3SDCD 1NGWB 1K4CB 3MU3A 4WW2F 3S96A 1FDLH 4X9BA 4X5WA 4AM0A 5T3XE 4EIZC 3P40A 1NFIB 3CN1A 2CO3A 3SJVD 2HKHL 1OVZA 3T4YA 5LB1A 1GKOA 3DI2B 2YQBA 3CZSA 4ZUUA 3HRPA 5HTSA 2NNAA 1M7DA 4BCXA 2EIEA 2IPTH 3MRGA 1P4BL 4GIPD 3FB5A 2ZX6A 4G9FA 2AVFA 3BSZL 4KUZH 1II4E 1NFKA 3QQ3B 3UACA 2LU4A 3ESVF 1LK2B 4HU2A 4YHOH 3HS0A 1WZKA 2IWKA 2PN5A 4EZLA 2EIMB 2GPZA 2VR9A 1NM9A 3WLWD 3TT1L 4ANXA 1WBXA 5JPMB 5I1DB 5I1GL 1SFDA 1RZQA 1AZRA 1QOKA 3QXUA 1XGUA 4HALA 2KT6A 4FYTA 5IBUB 1R3IH 2P47B 4HG4J 1IKNC 1XH3B 4LRIC 2ZUSA 4U33A 1BQUA 1P1ZA 3BZEA 3VI4A 2ITDB 2XFXA 1GZQB 4XVJH 5AVVB 1KBVA 4OB5L 4RMSA 3WEXA 4HFUH 3INUH 3C8KB 2Q7NA 4NFCA 3P4NA 1HKFA 2QPDB 5F7WC 1I7RB 5K9JH 4JFXA 1VGEH 3V79C 4NNYA 4O51A 1T6WA 3N50A 3QDGB 4NP9A 2VSCA 5AD0B 1YEDA 2IWEA 3B2VL 1MCEA 3GFUA 3L5IA 4FFYH 1XL4A 2C8NA 2EE2A 1H6FA 1CGSL 1RZ8B 4NKIL 5A6IA 1U8JB 3S36X 5FYJE 3CXHK 3WO4B 3QDGD 1HOCA 4M6ML 5JXAH 3MUGA 3M17A 4PJEE 2IXQB 1U95B 2PABA 4HV8A 3UC0H 5HDBF 1MW0A 2VDQH 2DBJA 3QDJB 4OLWH 1YMME 3FQTB 3TNMA 1AHWB 5C7XL 3RBSA 2ADJB 4AVHA 2W1NA 1B3IA 4HOXA 1CE6B 2VZ3A 3DNKA 3I02B 1HIMH 4Y2DC 5BUAA 3MHZA 3QDJD 1MIMH 1YEGH 1NAKL 3MBEB 2P7TA 3UBFA 1UJTA 2BNQB 3VFNB 3QJVB 1MFEL 1E4XH 3D30A 2FDBP 1K72A 3VI3B 3VCLA 5KW9H 4S0SD 3K2KA 4ZQKB 2XPZA 3MBED 2BNQD 1KJVB 1HZHL 1TNMA 1OSYA 5GRJL 3QG7L 4EEEA 2WOBA 3CFIC 4APXB 2QLVB 2F7OA 2DJMA 3MODL 2E59A 1JIBA 1R5IA 1R6VA 2CKNA 2X4NA 4UANA 1ET5A 3NZUA 4JFHE 3D69B 4QJ3B 3IS1X 5DJ0B 5FO7A 1O7DC 4AT6A 1CCZA 4OF5A 3G5XA 5AVUB 3VXRE 2QGDA 3MO1A 2NQ3A 1SFHA 1CTMA 1IGTA 4WNSA 5I1HH 2ITEA 3ELQA 1GRWA 4Y16B 1BVOA 4CA4A 4DPBX 1MPAL 4GSDH 1JGVL 4KVCL 3H3KA 2QVKA 3IDIA 4ZUTA 4EI5C 1IT9L 2P48B 5ENWA 4BZ2A 2AJZA 1D6EB 4WEUD 2O6DA 4DO4A 3A21A 2YWYA 1FL5A 5MI0B 5C8JB 5E8PA 2BIMA 5I76A 4XPBL 4Y16D 4M02A 4JQVC 5LWYL 1NA8A 3OPUA 5IVNA 4F1ZA 2MTPA 5IF0A 4ZDHB 1K2DB 2BHUA 3WD5L 2ZX8A 5GGRY 5EU6B 1TEYA 2HVKA 5GJSL 3O6LH 3LNEA 1G6RB 1HAWA 2DB8A 1TCRB 4NQDB 4XPAH 2VTFA 1RJZA 4OFVA 3TJHD 1WVZA 25C8L 1R17A 3N44F 3SQOH 2V2TB 1NCJA 1I7TB 5EU6D 3RJOA 1KCKA 1F6FB 4CVZA 3WFZA 5C0AE 4WEMB 4NQDD 3QGVA 5C6TH 3VFVA 4L3EE 3UJIL 3SD2A 1QD0A 2N01B 5CFHA 1QI4A 5LXGL 4NRXB 5IW3A 4DAGH 5C0CA 1NCDL 3E6HA 4GMSH 1ZGLB 1X9QA 1R75A 2N59A 1UZ8A 1DBJH 1E3ZA 4DEWA 3I6LE 2F15A 4O9HH 4O4YL 4RWHA 4QTFA 4XWOC 3P3UA 3D85A 2BSTB 4O58H 1U2YA 2P5ED 3ARGA 1L7TL 1SXAA 2EKSA 5KAQF 1UCTA 1FG2B 3MLVL 4PJIF 1IQDB 3LCYA 2OBGA 3CZEA 3NEXA 4RLDA 1FA4A 5JQHC 5T33H 1A21A 3UJTL 4JFQA 3EDJA 4F9PA 2YJQA 2ADIA 4WTXA 5AW9B 1YNLL 4N20A 4JE0A 1WS8A 4K8RD 5CLTA 4K94C 3FU7A 4N86A 2FTAA 1WFTA 2NYZA 1RVFH 3ALWA 3AQZA 4LSPL 2J73A 2P5WA 1XZ0A 4A7UA 2XU9A 3PUCA 3EHBC 3QORA 2WWKO 3BP4A 2BVOB 5HGGS 4DQOL 4GQZA 4H0HB 3WFDL 1OL0A 2YC1A 4HJEA 4GO6B 3OXRA 2EVFA 1GGCL 3HNTL 1WWCA 3QZNA 5HGAB 3WIFB 3LZLA 2HRLA 5AB2A 2FX7L 2V6HA 3SKOA 5IR1A 2H45A 1A3LH 1MKFA 1TU2A 1MQ8A 4JE4B 3V0VA 1J9SA 2OI9C 2E27H 3PJNA 1KDJA 3ZK0A 4LSVH 3WFHB 4ZT1A 3DO7B 1EAPA 5K1NA 2PWFA 2X6AA 4OCMC 3F7KA 2BJMH 1SHSA 1G4RA 1ODUA 4G8IA 4KKBD 4WKXA 3TPUA 4M62L 1SHWA 1LXMA 4WGVB 4JY4B 5E0FA 2DMBA 4OI9A 3DKHA 1NQBA 3NJVA 5HYSG 4PLNC 1G0YR 3DBSA 3SY6A 1CGVA 3NQIA 3E9TA 2B16A 4FXKB 4J8RA 2VXUL 3TO4A 2UZXB 4D0BA 3ZMRA 1F58L 2F19H 2OMTB 4DTGH 4FN0A 1CI3M 1U3ZA 1F4WH 1FLTX 4ONFL 5IVZB 4F58L 1UHVA 1AI1L 3QIUC 3QNZA 4FP8H 4DOHE 4TRPH 3RIAF 3PNRB 1QKZH 4LCIH 5ETUA 1QYGL 2WLMA 1TCMA 2B9AA 3CLWA 2PWDA 5FM5M 4BZ1H 1RK1B 2FNWA 3KVDD 4OLUH 4F8NA 5DJCB 3F01A 4HIIA 4KGJA 4P23B 3SPIA 5I1LA 4LVHC 2Q9OA 4ZFGH 3FUMA 1ZA3B 4K3GA 4LEOB 2P1YA 1LQBC 3V6FB 1A65A 4ZUSA 4P23D 1IEAB 2IPTL 3MRBB 4HJGB 1AG6A 1S4IA 3MLYL 5B4MD 4KZEH 2FUTA 2WW8A 4KUZL 5A3ID 3L4ZA 3G6DH 5DEJA 4MQ7B 4YSPA 3V0HA 1A4AA 1R3HA 4F1SA 1QUNA 5IFHH 4P5TC 1EZVY 2NT0A 4PS8A 1MXDA 1EERB 4YHOL 5HY9B 1KYOK 1HL4A 5I8KH 2CR3A 3KR3H 4AWJC 3HI1B 4BK5C 4H0IA 3TTSA 4R7LA 4BD4A 3BDXA 3PRZA 5D7JA 4GQRA 4I48B 2HT4D 3CHPA 2NCEA 4KY2A 2WLIB 2HFEB 1FZOA 1E5AA 1GW6A 4ENED 5IIEB 4NPYB 1IBDA 2EYTB 1EEUA 2VN5A 2E0PA 4Q6IA 1RZPA 3DETD 3OR6B 5IVXF 1N6QL 4RMTA 4M3HA 4N1HB 2H0JA 2ZXGA 2LGNA 4LHUG 5DZVA 2D3NA 1V55B 5CN3A 2ESVB 2PR4H 3DTXB 3QQDB 3ILPB 4YEFA 4AZ8B 2C3VA 2M2DA 3ISRA 2IH1B 3T3MF 2XKSA 5FECA 1YY9C 3RWGA 3Q1EA 4GXVL 4NI3A 1CXIA 2QQNH 3BX7C 3QA3B 1AQDB 2DL9A 4IOFD 1M42A 1SN2A 2XZCL 3NCFB 4KMLB 3MV9D 4L8DA 4FFYL 1U8QA 1OF2B 3QUGA 3FUEA 2FJGB 3CFDB 1PJWA 4X8JA 1KXQA 2EO7A 4JFFE 1MI5A 3CVHH 2IFFL 5GS2D 1UEYA 5D71H 2G30A 3DURB 4J7RA 3O3AB 1LEIB 4PGCB 3MV8A 3BGMA 5HGDA 2WCGA 3CHXA 4PLKC 3T8XA 1JUFA 1J8KA 4PRDB 2BIHA 2CGZA 4QTHB 3UC0L 1IM3A 1J8SA 1ZLUH 2IQ9H 1YEWA 5KANI 1C12B 1V3MA 3FKUS 2R83A 1UZGA 3QUYA 2QVMA 3TWYA 1HH9A 2JCCF 2WBJC 4R96A 1WD8A 4B7LA 3RWEB 4M8RA 4NKMA 5SX5H 4YHML 1HL8A 4W6YB 1MIML 1YEGL 5AVYB 2L7EA 3WCYA 1K5NB 3V5KB 2B4CL 2IALA 5FOJA 3UX9B 5CBEA 3PAVA 5CIPH 1CG9B 5F7DA 1F00I 4HKBA 3GLDA 5DWUH 3BUIA 3GSQB 5KZCB 3UTTB 2A3TA 3FQ1A 3L1GA 5GS1A 5BRQA 1QO3A 3ZDYE 3QEQB 1NIAA 2QQLH 2FJSA 4PRBB 1N2RB 4JR9L 5L4IA 5ITBL 4IK6A 4PJBA 4WCYH 5CEYB 4HJ0C 5DJDB 5DZPA 4WLCA 3UTTD 2XN9E 4N0UA 4GKSA 5L2KA 4F93B 4X8CA 5FW7A 3TFKC 4N6RA 1UG9A 1JS4A 3DJ9A 4O5LL 2XG4A 4QDGA 2WN3A 2FB4L 1QZ1A 4M3JA 3T71A 2HT2D 3M1OA 4AXWA 2CQVA 4QOKA 4B27A 2WM0A 2W60B 1WWWX 3ZUNC 2VITB 3RG1C 4JPWL 3ESPA 3M07A 1FAIL 4F91B 1NM4A 4N0CC 3SN6N 1Z0MA 5DQJA 1KF9B 2J2ZA 4FEIA 1WGVA 1IAOA 1VZGA 2ATPA 3L6FB 3HFMH 2QZ5A 3MRCB 5DJ2B 5EO0B 5TGBA 1ML0A 3SOBL 4Y4KB 3HUJF 3O6LL 3GBNL 5I16B 2XZAH 2QVFB 3DXAA 5DHVB 4HLEA 3RGVA 2C3XA 2BERA 3MPCA 3PGCA 5E4EC 3SQOL 3EJCA 1LK3H 4PV9A 2XICA 4U49A 3FMGH 3SDXE 3F12A 4E9YA 1CLVA 4NN7B 1QLFB 4Y4KD 4XNBA 3WJMB 3HZYB 3QUZA 2R2CA 5MEPA 3AU1B 4QHNA 4PJDB 5BCAA 2B15A 3IPBA 1RULH 5C6TL 4D9QE 5IJVA 3FHEA 2MNJB 4IYKA 2IAMC 1JZHA 3ULVD 3LKQB 4DAGL 1AANA 3IBEA 3CFBA 4JPVL 1EXUA 2HYMA 1NC4B 1J8HB 1QASA 3PWJA 1DBJL 5TDOA 3UZQA 4FYRA 1HWHB 3OJ2C 2ZF9A 2EDMA 5SWZB 1HJBC 2AMGA 1QSFB 2EABA 2GBVA 1UWEL 2NY5L 4WQOA 4ZUWB 4GT0A 3JWOL 5EF3A 3ZE0B 4EXPX 1ZLDA 4O58L 1VZHA 4PJXA 4YVNA 4X6FB 2OMXB 1FFPA 1J8HD 3LZPA 4LSQH 3M8OL 1NICA 3MLXH 5T33L 3NEEA 1C5BH 5SWZD 4MJ6B 5J13B 4RAUA 2GC4C 3LNHA 5KSAD 4AYFA 3BE1H 4WY7H 3ARPA 4YC2B 5A6LA 3UXFA 5IMKB 2ZWSA 3FF7A 2WBWB 5C0BB 5MERA 1RVFL 2KLSA 1YN6B 1XSKA 1BJ1H 2KHAA 4PJCA 5DI8A 3BWZA 3T2NH 4IBZA 3WXVL 1BZ7B 4AQZA 2B59B 4P57A 3UADA 2AEOA 3ZYJA 4AK2A 3MDJA 5I73C 1A4BA 4F80A 4MA8H 1RPQA 3VG0L 5C0BD 1LM8V 2YSSA 1OF0A 2V9TA 4HHAA 4ZPVB 4Z7NE 1RAMA 5HHQB 2WY3B 3ZRSA 4N2MA 2ENSA 2H3XC 3OMNB 3TWCL 4E68A 5CU9A 1A3LL 2H26A 5HJDA 4G1EA 1WISA 4NNXB 1FIGH 1S7UA 3FTGB 5C08A 2EDLA 4LSRH 3QQ9D 3TESA 3REWA 2BVPA 1GC1H 4LSVL 4QGTA 4QHUA 3TV8A 4YR6B 2C7UB 5E2VH 3OL2A 1HHJB 5DYOA 3J7HA 3B4NA 5IW6A 4FQCH 4IS6B 3LEVL 4PWFA 4A67A 2EUVA 2PTTB 4XCEB 1FVDA 5MENA 1OQOA 4ZXBB 4RIRB 1G9EA 4QYAA 3KEDA 4Z7WB 1RK7A 5KSUA 5I30H 5AG8A 2X70A 2A4EA 1OGAB 4IEFA 4HUKB 2JLLA 3FT4A 4RGMC 3LRKA 1BM7A 4ZTPH 3W5NA 2A99A 4ZXBD 2CNZA 3HI5L 4KKNA 4PJ9C 5DZNA 5EOCJ 3VXSD 3O6KH 4LCIL 4LKXA 2BSEA 4JAMB 4G5ZL 3EOBA 3UGXA 4BZ1L 4P05A 5E94B 1QQDB 1C16B 3ARSA 4FNRA 1A7OH 2RTTA 3HE7C 3GM0A 2BSRA 3CN3A 4H26B 2VMFA 4PJFA 5KYUA 4HKXA 1B2YA 1HHIB 2X4TA 4FFWD 4TV3A 3TL5A 5GGQL 3WTVA 5JHLA 4I7ZC 3L3GB 4BZ2H 1T5WA 4GKNB 2CLVB 4FQJH 4ODBD 2Y7QA 4QWWC 1O7VA 2VLJB 4KZEL 2PNDA 4MMZC 3VD5A 4UQAA 5F89A 1NDMB 3EOAA 3IGAA 3MMEA 3S2CA 3O6FB 5C09E 2FR4B 4LBEA 2I9TA 3GT6A 3CUPB 1HFUA 1DVYA 5GGVY 1ZHNA 1GJIA 4L5FE 2JKIS 2JMRA 3RIKA 2VLJD 1TZIB 3LSOA 3VSUA 4NS0A 1S7SA 4U4IA 4D7BA 1I8LA 3L5JA 1NEPA 3CSGA 3O6FD 5K9OA 2CDEA 3IU3A 4XZUA 4JO2H 4IRJA 2G9HA 4P3CH 3D07A 4OM0H 4LL1A 4ZMAT 3ZSSA 3CHRA 2MKWA 4MX7B 3FQNA 3TZVC 3T65B 2OK0H 2Z31B 4UWQB 1I8UA 3MGAA 4F8TA 1PQZB 3MCKA 1KULA 4OCXH 3X13B 4AGPA 3ZZSA 2IDTA 2VDNL 4RFOH 5B39A 3A47A 4HUXA 4ZUVA 1WGOA 1URIA 5HI3D 2HSIA 3DOSB 5ABAA 2Z31D 3DYOA 2B2XL 2RAMA 1F1GA 1E50A 1FE8L 1SDYA 5JW3H 1RP9A 1SJVA 1XSJA 4JRYE 4Y19A 3O4LB 1PNDA 3ZTNH 2DN7A 3HLKA 2VDKH 4Z7IA 5CSGA 2QQNL 4XX1G 4FERA 4G5AA 4L4TD 1KGCE 2YD7A 4QYOB 2OQJA 3GYRA 3BPLC 3VI3F 4QHMA 3R1GL 3BKMH 2O5ZL 1JV5B 1BW8A 3O4LD 1H8NA 5D71L 3FYIB 1FPTH 1MHHB 5CSZB 3VFWA 4MMXC 2VWEE 4TUKL 2ORBH 4K23L 4HLZG 1HCYA 2PCYA 4GSUA 4P2OA 2VRKA 5FGCE 3T08A 1Q1PA 4LLWB 1ZV9A 2R9HD 2X53A 5I6XB 3V55A 4YHLL 1E5CA 1OT2A 5LQBH 1HI6B 3BD4A 4L9LA 4NQVB 3UDWC 1P4UA 2EECA 1RLWA 1OXYA 3DHPA 3UTSE 5EN3A 5FKAB 4OSUH 4YXLH 3GHPA 4UB0L 5EBGA 3N2JA 5J1AA 5JLZA 4R8WH 4NJ9L 5D1XC 1A6VL 1ESOA 4I5BB 2ED9A 1AXTH 1KPVB 1WTLA 3HLAB 4NWTH 4PS4H 5AVSB 2ZXEB 4FABH 4Y5XC 4I1PA 1X7QB 1FCCA 3QJQB 1ACZA 3OD3A 3OVUB 5T3XD 3H7LA 3HG1E 4MHHI 3C6LB 1U92B 1SHMA 1VACB 3D7PA 4HF5H 1AR1B 1N59B 2RCSH 1D2PA 4QAMB 2BVQB 4WKZB 3GPEA 5EOTA 5LCVA 2KYIA 2VL5A 1PY9A 4PHXA 1IIIA 3MV7A 3NUKA 4N87A 4XB3A 3WE6A 3DSNB 4BQBA 4E36A 3A6BH 4N2IA 3C6LD 4YDLB 2HX9A 1AR1D 4NQUA 1INQB 1JWSB 4NQEE 3M46A 3T0EE 4V1DE 3ZQWA 4X4KA 2LT9A 2VLRA 4XOEA 5K39B 4BH7A 3L4TA 3FZUC 1TYRA 2I69A 1KJ2A 5C0RH 1TZOA 5CAYB 2W0FB 3II1A 3MFFA 5C6PB 1ZY9A 3N1QC 3W39A 2H3NA 3WLBB 4HEPG 4KKCC 2XZAL 4X6CA 4NENB 5ESAA 2C3HA 5KVGE 2E46A 2HAZA 4HUVA 3T6VA 2DYPB 5EU5A 2PR9A 4DQAA 1E43A 3PL6C 4DFHA 3AJ7A 4Z7AA 3DV6B 5I1JH 2UUDH 1T22B 4MCMA 1XHHA 5ANMA 3OLIA 2ENYA 6CGTA 1LHZA 3KVQA 2DTML 2M26A 3NCYP 2WXPA 3S3SA 4APQB 3GK8L 5JXEC 1KBGL 2DYPD 4BFKA 3R0NA 1T0MB 4PJEB 1ZLEA 4XMLH 1R46A 4ZNCD 1A7PL 1BECA 4CU8A 4EIGB 5D2LE 2BRQA 3AG2B 4B9CA 4JDZB 4ETQA 4UQ2B 2WIIA 2QQQA 3BKCH 1SY6A 5FYJD 4APQD 5JNYA 2JSFA 2YHGA 3KD4A 4ZOBA 1BOYA 5E95B 4Y2OA 5IQNA 1IBFA 2G5BB 3WIHL 4U6TA 1QFHA 1NUDA 1OGTB 1M6OA 4DVRL 2G60H 1H3TA 1WZAA 4FQXA 1L5GB 3TA3B 4YE0A 3LDBB 3JUZA 4MBRA 1NKGA 4YPGB 4NLHA 3T2NL 2R8SH 3HE7B 2LLNA 4NBZB 5E6IC 2Y7SA 5IMLB 3TA3D 4X6BB 1FO0B 3CC5A 5EC1B 4LLMB 1YAZA 5E6RB 4P2QE 2OSYA 2YK1L 2XG5B 2PXYB 1NCHA 3JVFC 4FHBD 3T1FB 3D06A 4DGUA 3AXLA 4G8AC 4M5ZH 3PHAA 1UD3A 4Z7VB 3EKCA 1I9JH 3VD2A 4KDTC 3V4VA 2XLLA 1FIGL 2PXYD 1HXMA 5IVOA 5JZ7D 2EXWD 3RPIB 4L3AA 4BRJA 2HJKA 3IMRA 2PTUA 3VXRD 3TH3T 1KWGA 1GC1L 4JFOB 3UG5A 5I1EL 2WINB 4K3DL 2OMUB 1AIFB 2V7HA 4YSRA 4FQCL 4XBGB 3ZKSD 4H8PA 3ZR6A 5CEZH 5I9QC 2ZUQB 2Q87A 3BEVB 5FDWB 2ZAIA 5CD3B 3I6GB 3CVDA 3GSWA 4OQ1A 1MWAA 1V10A 4AGNA 4Y2NA 4Q9QH 2EH7L 4TKWA 1X6NA 1QFWI 2LQRA 3C2AH 4HS3A 3CFEA 1PYWA 1EZSA 4WSGA 3UJJH 1L3NA 3BQVA 4PRNB 5D7IE 1U3NA 4Q6KA 2GIMA 3C6EA 3FT1A 5DVNA 2R7EB 4QXTB 1OP5K 4OJCA 1AD0B 2LAAA 4FNPA 3QI9B 3QEUA 5IY5B 4LGPB 4IBWA 3QO0B 2AQQA 1SLWA 4L3EB 4Y5YC 4JRWA 1LE9A 4KK8D 1ZLVK 1A7OL 5D96B 1YYLL 5IP4A 2Z8WC 3D0VB 4OZIA 4LDLB 1W0VA 3QI9D 2C4XA 3FPXA 1SJEA 1G7PB 5GHWH 2WYHA 5DEFB 5C0AD 1L0PA 3SE6A 3SYQA 3C60A 4L3ED 3PG2A 5CO1A 3ATDA 2TSBA 4D7PA 1UATA 4UM9A 2ZOLB 4XNZC 4U6YA 3KWWA 4BZ2L 4FQJL 3SO5A 1NLDH 2IADA 4F7MA 5T1MB 1B4LA 4PJ5B 2ZOKA 3J8F7 4IJ3B 4DZ8B 4PH8A 4JGJA 3ALXA 3I6LD 4XVSL 4EZMA 2LU7A 3FF8A 3JWDC 4Q89A 5HDQL 2ADYA 3F7LA 5F7LB 1BQ5A 1U91A 2JJSC 4NCC2 4X4XB 2WTRA 4HU8A 3FQRA 4A37A 4YSAA 3SGDH 2R2EA 5FCSH 5DRXB 5EEZA 5BV7C 2N1TE 3BPOC 5BS0A 1OWRM 3EIFA 5E8EA 3WFBH 1JRHL 3PHQA 4OBRA 2X3AA 1MCDA 1T04A 2ZX9A 5IW1A 5D1XB 5EOQH 3TH4T 3OMAB 4K5LA 4OLYH 1OCOB 4ZMVA 4MVBC 3DMMB 2VABA 5EF0A 1CFNB 4OCXL 4NM4L 3DV4B 2EE9A 3NP3A 3DJRA 3U0WL 4RFOL 3ARFB 1CVRA 2BSCA 2Y6TE 3SDYH 3IJHB 3UTOA 1COBA 2VLLB 3DTDA 3FU8A 3HC2A 4G8GA 3JZ7A 5JW3L 3DMMD 4OVUA 1Y0LB 4JDEB 2BCKA 1I8MA 3ARFD 3MKKA 4JY5H 5CINL 4UBDD 3PWPA 4MMYB 2HKFH 2DY2A 1ZKAA 2X4QA 4KPHL 5E08H 4P4KB 2EVHA 4P2RA 4PGEA 3BKML 1ZTXH 4X5XB 4NHUA 4YDKH 2BPBA 2WWMC 1E9QB 1H6UA 4PB0H 4Y1SA 4CJ1A 2ARJA 3BFWA 1V7NH 2H6UA 3GSNL 3KJ4C 3QJHB 2X4SA 1BQKA 4P4KD 2Y1VA 2VUYA 3DIFA 5E6SB 5F7EH 3QJRB 1IEBA 4XP5H 2GHZA 3EO1A 4XMKH 4DOHB 3CDGB 4N8CH 1ES0B 5GZOD 3G5WA 3BUYB 1PL3A 4HWZB 3MBXH 4W70A 1UH4A 2CSPA 4MJ4A 1F90L 3ASNB 3KLDA 5FUOH 2WQWA 3GSRA 5LQBL 3CSYA 4BE5A 4OM1H 3PL6B 1J87A 4ZTOH 1KGXA 3MNVB 1T7YA 3NZ8B 4OSUL 4XCCH 4J1UA 2R4SL 3MV11 1MVUA 3FU9A 3V6ZB 4E41E 5CBAB 1NJ9B 4QHKJ 3F7VB 3WN5B 4R5XA 5D6CB 3K8MA 4YSEA 1AXTL 3OX8A 4E0RB 1OP9A 2BC4B 1SLVA 2F54E 4PS4L 2DWSA 1OCCB 4MJ5A 1NGQH 4ZMPA 4W9IC 4ZS7H 5BZDB 2XWBA 4N0RA 2VH5L 3P30H 2MQCA 4V33A 3D3VE 4UAOB 1KPUA 4XNMA 1GKEA 1WCQA 3A24A 3EBHA 3O3BB 4GS7C 2X4OB 2PCFA 3Q9PA 5DRNA 3OAUL 5K69A 1MFVA 2VW7A 3DJZA 3P4OA 4HJSA 4W81A 3ULVF 2A6KB 2BIQA 3A6BL 3G6JA 5T1DL 1L9TA 3UCQA 2EH8H 4PJDF 5IB4A 3UP1A 3TXAA 4IM8A 1MHEA 3FCTB 4PG9A 3HBPA 3B3BA 1X5ZA 2P43B 1HTYA 5FHAL 3W9EB 4A2HA 1CR9H 1VHPA 2Y07L 4PJAB 4KTGA 3WEMA 3IMTA 5D1ZC 1YLBB 1I3RB 3VFPB 2F8VA 3QAQA 5DVMA 1R3JB 1VEPA 4Z77B 3I9AA 2R1WB 4TN9A 4R0LC 5C0RL 1ZHKA 4XN5A 3ZE0F 2NR6C 3VMOA 5FO8A 4LSUL 1MAMH 4Q14A 1FC1A 4NO0A 4W9HC 4L8BB 1R47A 4YHZL 4M4RA 5DRWB 3VRLE 5CGMA 5B38A 5JHLH 5GRVK 4CSSA 5J6HB 3D33A 4DW2L 2XQBH 1R4XA 2V8LA 3C5JB 4UV4L 1X44A 4ERSH 2D7OA 2WXMA 3IJEA 1UM4L 4JFFB 4LARH 3BHBB 3CDYA 4X4ME 1BIIA 1BQLH 2SODB 3V10A 4XMLL 4LP8A 2GQHA 4U6XB 3D2TA 4GIAA 4P3DA 4W9LC 4X99B 4B60A 4NRZB 1ZXQA 3HZKB 2DQFA 5D6DC 3HNSL 1E2VA 1I1FB 4JFFD 4NKOB 3VJ6A 1I9RL 2IH3A 3BKCL 2ZCHL 2O6PA 4CU6A 1A6ZB 1DDHA 2C9SA 1MCHA 2GI7A 2QKIA 2OMBA 3H2WA 3HKFA 4FNQA 3HZVA 5DMKA 1E6OH 1SXSA 5D2NA 4Z3TA 1HX0A 1JN6B 1CF8L 1WFMA 4UIMB 3RNQA 3ZMNA 5BRZE 1OAXL 5GGSA 4X7SH 5IB2B 1KCUH 4M61B 3QSKB 1D5MA 1N67A 3HMXL 2OL3B 5AVQB 2G60L 4X5LA 5TDPB 1BQRA 3AG3B 3VQMA 1BVLA 3TEUA 4KHTL 4OLZL 4ZMTA 3CFMA 2YWZA 5CJOH 1W2KT 5HYJE 2EDXA 1G5GA 2F2HA 3BVDB 5LLIC 4UTAA 2BOBA 3ZKNC 3DUUA 2GCYB 3U36B 1EHKB 2CM6A 1UZ6F 4EKJA 3O4OB 3FO1A 1AKPA 3RWCB 4PW3A 4GRWH 4I85A 2AV1B 2CRYA 3H42L 2DQ6A 4XNZB 2HVJA 4KI5E 1IC4H 1FVEA 3EG9A 1JNJA 4GRMA 3EYUH 3JWNH 4N2BA 4GG6E 2EUZA 1FNEB 1KXVC 3QXAB 4PJ7B 5BUGA 3IGLA 1M7IB 2XN9B 3L5WB 1YYML 2X0WA 2I27N 4MDJA 4WTZG 1KIUB 2OV0A 4F2FA 3CLEH 1AO7A 1AE6L 1TXKA 1YHPA 4JB9L 4LCYB 2X6BA 4YO0B 1G7MB 1UACH 3V9CA 1N7MH 1PG7X 2XN9D 4ZX3A 3D34A 3S36H 4TS6A 1X9RA 3VSQA 1G84A 3LIZL 2Y1AA 4B6ZA 2H6PA 2O93L 4LIQH 1AHKA 2MH4A 3C5ZC 5LBSL 1LE5B 1QRNE 3B2PA 4FG6C 4J8QA 2VMDA 1XSOA 3II3A 4YVUA 2FJFA 3CPLB 3IK2A 3JYBA 3WENA 5JHDA 3US0A 1NCBL 1H3GA 5CF3A 1OHQA 1WLHA 3DSFH 2V17H 3C2AL 4OCNC 3UBXG 3GO1H 3JV6B 1ND0B 4HAFA 3B6SB 4PVMA 1IAKB 1JP5A 3KPSA 2DH2A 3E0GA 3L3JB 5HI4D 1KCBA 3ML8A 3SDXB 1HSAA 1MUJB 1NMCB 1QLEL 2P80D 5JIKA 2Q8BH 2FO4B 1E5BA 3OKEA 5IROC 1ACYL 3GINA 2GSIB 2VZTA 3GS0A 4XPGL 5TTRA 5LCVH 1EO5A 5HGBB 2WLYA 3SOTA 2XN2A 3KL0A 1E5ZA 4WI0A 1JWMA 4JDTH 4C4KO 4MCZA 3X12B 5GHWL 4QT5A 2VM4A 3LRSB 7TAAA 4G3YH 4U7SA 1S9KC 2P8MB 3QE5A 3RL2A 2CIIB 2NDFA 1CLYH 1NLDL 3BN3B 4HUWA 5DEZA 4EDXA 4F7KA 1XF3A 4N0YH 4NN6C 4FMKA 5I75C 4QRTB 1AGFB 2YKKA 2XQYA 1IRAY 3MOAL 1KJ2H 1TIUA 3EYOB 1OP3K 1C5CL 4NZTH 3H0TB 2J57A 5DTFA 1QHQA 3QFJA 1GJWA 1S9XA 3DGGA 2Q1EA 4M5YH 3O2WH 4U1IA 1WICA 1X5GA 5DUML 3WFBL 4YZFE 3VVWA 4KJYB 4N8VG 3N40P 1BFOA 5D9SB 3VMNA 2AEPH 4N2NA 5GS0L 1INDH 4P9HH 1UWGL 1BFVH 2QGBA 2WAQA 3O3DB 4J3VA 1OARH 1YY8A 4XN4A 4B0MM 1AZCA 2HN7B 1ZLVH 1XGTB 5EZIH 2WZPA 5CP7A 3DX6B 4GLRH 1ONQA 3D0LA 5B7EA 1RIVH 2YEQA 4UUJB 4F37F 1CXKA 4X4YB 1SY6H 3F64A 3RHWK 1OTTC 5KVMC 4GW4B 3O11B 1PSKH 1YRKA 2VB5A 2XUWA 1HYSC 4HS6A 4YHKL 5E08L 2XNAA 2QVIA 1J9RA 3MLZH 2EUWA 1OEZW 1S9VA 2J71A 1UVQA 4UT6L 2JIXA 4YDKL 2BWQA 1IKNA 3VXUB 4LRIA 4PB0L 2ZG2A 1YPZB 2R15A 3LB6D 1V7NL 1N0XH 5D1ZB 5G4NA 4CDHA 5J9PA 3LXAA 2GSGA 2YQ2A 1B9KA 2X9XA 2JB5H 2JB6A 2AJVL 4FYQA 5F7EL 1NH6A 1ACCA 2GVYA 3DRQA 3NJJA 4R2GB 5AWNH 2NUPA 2NSXA 1KB5B 1BF5A 1GVIA 2BIPA 1WG3A 2O6CA 5DLML 5FUOL 4XRCA 1HNYA 4ZFOL 1WS7A 1V05A 4JDVB 3CWGA 3GDBA 4ZTOL 1XTLA 1ZA6B 4R2GD 2D0GA 1E30A 5A2CA 1A64A 1X4XA 4QXVA 3V4VH 5F1NA 3HG2A 2ICES 4E9VA 2YD4A 4TNWF 1DEDA 5A3IC 3EOTL 3TEWA 5FYKH 3CHOA 3V9FA 2ZNWA 3C09B 4FLRA 5D70H 3GIVB 4BIKA 1NGQL 2YPLA 3L3OC 5KN5B 4ZS7L 1OAYH 1VJSA 2C9RA 1PY0A 3MJ7B 5A16B 2PTVA 1D5BB 2X4UA 2ZSWA 5C09B 4LPWA 3SPVA 4OI7A 3L45A 3WY1A 5SWQB 4LPCA 4UNVA 2HT4C 4Y2DA 4WDIB 1MWAH 4Y4FC 5F1IA 4W1TA 4FQHB 2WNWA 4TLUA 1SOXA 3DARA 5F2FA 1OM9A 3WDHA 5C09D 5KVGL 4XNUH 1ASOA 1NSNL 4EN3B 3WTXA 2ICEC 2EH8L 5E70A 4WHCA 1TZGH 1WF5A 3PWLA 4L8SB 1GSMA 4XT1C 3GUTA 5C0NC 1ZJAA 2FJUB 3BIBX 1XGYH 1NBZA 2F53B 3FFDB 2Q7YA 5FO9B 2X3BA 2XV0A 2QL1A 1RZGB 4PJEF 4QF1B 3U9PH 3F65A 2ZWNA 5T1JA 3LZQA 5BOPA 3VE0A 4IKIA 4EN3D 4NSKB 2QVTA 1TPXC 5CZXC 4M8VA 4H1LA 2J4WH 3PJSA 1NBYA 4JKKA 4A04A 2F53D 4GY4A 3P9LA 5LXVA 4JY6B 4LSTL 5E00B 1FZKB 3JVGC 3TJEL 4Z23A 4WO4C 5E56A 4OD2A 1UYWH 2VDMB 4HAKA 4HKJA 3W37A 1TZAA 3HRZB 2ICWA 2X7LB 2H32A 3KLQA 4HETA 4HPOL 2ZNXA 3S3BB 4TSCH 1S8DB 5L8LB 4HCIA 3DPDA 2AJSL 2ISDA 4NN5B 1ICTA 2EAEA 4X9YA 5DK0B 3N1MC 4L0PB 4LARL 1YZZA 3Q1SL 5F44A 5TQ0L 2J8UB 2JNZA 2RIKA 1FH5H 1B2WH 3C5ZB 4JRLA 4XVOA 3GJFK 5CD5C 1KGCD 4OTXL 1IKOP 1KB9J 5JR1H 1Q9OB 1SOSA 2ZXWB 2OCCB 2EZ0C 2NMSA 1CQYA 4W9EC 1K8IB 3QUKB 4MFHA 4XMXA 4GW1B 5FGCB 5D5ME 1F5WA 4B9ZA 4G6AC 12E8H 5DD6A 4QHPA 4PJHE 4Z7VF 3V7AG 5T1KA 4BINA 4PVBA 5GRUH 2D7MA 4WVRA 1CFQB 3JXAA 5C0GA 3UTSB 4CILA 3ECVA 5EIIG 4OFIA 5CJOL 3VXPA 1J18A 2TRYA 3RVTC 3K3QA 3CZKA 1GGYA 3EZ8A 3JBG7 3QG6A 5EC2B 5TFSH 2ATKA 1B6UA 2E47A 3UTSD 3KM2A 4G42B 1XD0A 3AGWA 4URTB 1TSHA 1VIWA 4JN1H 3ZX1A 4PCSA 5C0IA 3NN8A 3HG1B 3OAWA 4LLYB 2J5WA 2AEIT 4JHWH 3VQLA 5FFGA 4HQQH 2OKMA 3EFFB 2WHVA 2D7TH 4FQLH 2K6WA 5TH2A 2QKSA 3QJSB 4K3JH 3IDXL 3WE1A 2JJTC 4RMRA 3HG1D 5I75B 4N1EA 1CDBA 3FCBA 3MGTA 3SPCA 4G9FE 4OZGE 5HYQB 3IU4L 1UACL 3T0EB 2VN3A 4OZHA 2XV2A 3EDKA 1SN0A 1Q9WA 3DVGB 3ZLQC 3ULSB 4F9LC 4HK0B 1T2JA 3H2QA 2Q3ZA 4M7KL 3IDNA 2DQHH 2DZEA 4CVXB 2HCZX 4NQED 2VERN 1CZ8H 3ABZA 5EU3B 5FWQA 3S3CB 3T0ED 4CKVX 2IC2A 4J6RL 2NUTB 4XPHL 5KEZA 4NYLA 3WKPA 5KVDE 4PJGA 4XVTH 1DVZA 2L8AA 1URZA 2VMEA 3OKDB 1YNTA 3MRHB 3T09A 1KIRB 1M1XA 1WZMA 4PR5A 1T7VA 5E1HB 1IE4A 1FZMB 5C70A 2CRZA 3VI4E 4BFRA 3A67H 5J7CC 4ACTA 2Q8BL 3FAXA 4M7LT 3RNKB 1SHXA 5FV2A 3IGFA 4MB4A 4S1SH 3MOQA 5FF6B 2ZKXA 3BW9B 3L9RB 4XMZA 1HQ4B 4A7GF 1EHLH 1J0YA 4PGDA 1XD1A 3P3TA 4J4PC 1DVUA 3CU7A 3GMMB 1OQXA 1A4JB 4JQIL 3UFIA 5LN4A 3HIZA 2ZPKL 1U3HB 2DM7A 3S34L 4D3CL 1DBMH 4G8EB 1ZT4A 1JF1B 3OSKA 1DN2A 2X9WA 2NZIA 3THML 4KO7A 1CLYL 2R1XB 1CDGA 1TFPA 3R4DA 4PV8A 3IXTB 3QIUA 4M93B 2F6AA 1U3HD 1H15B 5FIEA 4JZJC 2EADA 1N5YH 1GOHA 2BM3A 3FAWA 2MHAB 2DWDB 1KJ2L 4Q74A 5C0JA 4QLRA 1HE8A 1KTDB 4GQ9H 2VN7A 3O2WL 2VXTH 4O02L 3RDTA 3NFNB 5AYQA 5DSCB 3O3UN 1PD0A 4DGVL 2MRYA 1QEXA 2AEPL 4P2QB 2V5SA 3KNBB 3GSXA 4P9HL 1GS6X 2ZUTA 3ZE2B 2XA8L 2MTAA 3D1MC 3DUSA 1ZPLA 4CW1B 3L7EB 3D18B 4GIOA 2KUTA 1MCRA 3QR1A 3OZ9L 4YHNA 3EJSA 2EYSA 1OAQL 4P2QD