1OOWA

The crystal structure of the spinach plastocyanin double mutant g8d/l12e gives insight into its low reactivity towards photosystem 1 and cytochrome f
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VEVLLGGDDGSEAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Electron transport, membrane
molecule keywords Plastocyanin, chloroplast
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oowA00
5FC9A 5D4JA 2N0MA 1SNRA 5I6MA 2BP8A 1SF3A 2FQFA 3SQRA 4GP4B 1L9OA 1CC3A 3GYRA 5TK2A 3U25A 1AZRA 3AG3B 4GYBA 2HX9A 2HZHA 2YAMA 4DP2X 4KO6A 4NAJA 4YL4A 4E9YA 2XV2A 1V54B 3FSVA 3WKQA 4YSSA 4YVUA 4A2FA 2PCYA 5TK4A 4CSPA 2CBPA 1ASOA 4AKQA 1JZFA 1OOWA 1GYCA 4FAAB 2HRGA 4A2HA 1RZQA 2QDWA 3RYMA 4G7SB 3PCYA 1AIZA 3OMAB 2YAOA 3OD3A 3H4FA 1IBYA 2XXGA 1MDAA 4DP4X 2Y1AA 3ABLB 2HX8A 3T6VA 1EHKB 4WKXA 4P5SA 5D4IA 3MBWB 5B1JA 3NSFA 1SHWA 2W88A 3FU9A 4G71B 4KO9A 1WA2X 5I6KA 2BW4A 1ETJA 1GS6X 1IBZA 2GHZA 2VW6A 3AY2A 3FU7A 1PF3A 2BHFA 3BQVA 4BWTA 4P5RA 3EH5B 1N70A 2HX7A 3ABMB 2VN3A 4A2DA 1CUOA 4DP1X 2IWFA 4JHVA 1WA1X 4BXSV 2PPEA 3UAEA 5B7FA 2J56A 1ET7A 2FNWA 4AKPA 4HZ1A 5I6NA 2PPDA 3JT2A 2IH8A 3V9CA 2HLEB 5F7AA 2YAQA 2XU9A 2PPAA 3PLYA 2IWKA 2GIMA 4M3HA 7PAZA 3ZBMA 3WIAA 3CG8A 1M56B 1KDJA 1L9PA 2EIKB 2VSKB 3NJHA 1OCOB 1WA0X 2WSDA 2JKWA 3FQYA 3IBOA 2B3IA 1TEGA 2IDTA 3OQRA 4GY4A 2FT8A 5B7EA 4AI7A 1KDIA 1BYPA 2QPEB 4YSPA 2UX7A 1DZ0A 1OCCB 3CVBA 3UACA 2P80D 3CDZB 4GXFA 1E5YA 1KCBA 1HAUA 1M57B 2H5UA 4A68A 3PAZA 1MG2C 2EIMB 1ASQA 4N4YB 4YSCA 1AS8A 5I26A 2QT6A 3HEIB 1W8EA 1ZV2A 2BP0A 3QQXA 3PXLA 2IDFA 3DIVA 3ZX1A 1ZDSA 3NJKA 1BQKA 1AACA 3TU6A 9PCYA 3FSZA 2YAFA 3FSWA 3NJNA 1L9SA 2IH9A 2NRDA 1SHXA 3FT0A 2BWDA 1PLAA 4E9VA 3IEAA 1SFHA 1GS7A 2ZOOA 5I6PA 3ASOB 2QPDB 8PAZA 4E9QA 3TBBA 4N8UA 2VSMB 1AR1B 4BXVA 2YXWA 1GS8A 1BQ5A 4BWWA 1EZLA 1TEFA 1FWXA 5E9NA 4BDVB 2R7EA 1L9TA 2VM3A 3FS9A 4F2FA 5AKRA 2AVFA 1A8ZA 1W6LA 2IDSA 1KBVA 3NJFA 1AS6A 1NDTA 1KYAA 2DV6A 4E9XA 5I5JA 2YAHA 1X9RA 2OV0A 1E65A 1MZZA 1NIBA 1TU2A 1MG3C 2XYBA 3T6XA 2J55A 2FT7A 4GP5B 2YQBA 5A7EA 3QJRB 3N55A 3QPKA 4JHUA 1R1CA 1DYZA 1WS7A 2FWLB 3CVCA 1RZPA 4K9JA 3KW8A 2HXAA 7PCYA 2LLNA 3T9WA 2VMJA 2AFNA 1FFTB 5IY5B 3IE9A 1QLEB 1XB6A 1V55B 1SFDA 5B1KA 5ANHA 4YSAA 4TXVB 4YSOA 4A2GA 4BDVA 2PP8A 2FJSA 1PMYA 3H4HA 3NSYA 4YSDA 1ZIBA 2UX6A 1J9TA 1ET5A 3CVDA 1FA4A 3TA4D 1ASPA 1PZBA 3SBPA 3NJGA 1X9UA 2CALA 1XB8A 4BWUA 4F7KA 5I28A 1NINA 3FQ1A 1KV7A 3NJIA 4KNSA 3UADA 4M4RB 3X1FA 4YSEA 3QJQB 2YAEA 3IN2A 1OF0A 2H3XC 2J57A 2DY2A 4NB7A 1OE2A 2BW5A 1ZPUA 3WNJA 2RACA 3NJLA 1A4AA 4KO7A 2XWZA 2X87A 4KOCA 4YVNA 3ZDWA 1QHQA 1JERA 1AS7A 1MZYA 2IWEA 1NTDA 2GB2A 2PPCA 4Q89A 1IUZA 4UANA 3V9EA 4DP0X 2BZCA 4DPBX 1B3IA 3X1NA 5EHFA 2EINB 1M9WA 2XX1A 1A65A 2MRYA 3NT0A 2FQDA 3EF4A 4DP7X 1SJMA 2OJ1A 1QNIA 2XXFA 1L9RA 3PPSA 1ET8A 1PAZA 1BEXA 3PAVA 1AAJA 2B08A 1YLBB 3L45A 5I5IA 2J5WA 2I7SA 1KGYE 3FU8A 1SDDB 1BQRA 4RH4A 1NZRA 3FYEB 1AOZA 2GC7C 3D12B 1PCSA 5F7BA 1NPNA 1NIDA 2QDVA 1GSKA 3FYIB 2GI0A 2PCFA 3EHBB 3KW7A 3QJSB 1VLXA 1GR7A 3FU7B 4W1TA 4E9SA 3MX0B 2AZAA 3QJTB 4Q8BA 2XUWA 4A2EA 2IAAC 1J9RA 1GW0A 1HAWA 1NIAA 1PNCA 2PPFA 5B1BB 1JOIA 3C75A 5B3SB 1I53A 1ID2A 4DP9X 2XLLA 4E9TA 2GSMB 4UAHA 2DYSB 1CURA 5B7MA 4EF3A 3JTBA 3X1EA 5B1JC 2VW7A 3QJUB 4G70B 1JZEA 1BXUA 5PCYA 3UGEA 1JZGA 1XB3A 1OV8A 4DPCX 1ZDQA 1V10A 3T71A 5PAZA 4DP5X 2FT6A 2JFCA 2X88A 1N68A 1IC0A 1OCRB 1PY0A 3OMNB 4UF7C 3UABA 1RKRA 1PLCA 1JVOA 2CAKA 4WTQA 1OE1A 1BYOA 2E86A 2Q9OA 4A67A 1JXDA 4CSZA 1UATA 3NSCA 3AG2B 4E9RA 2UXGA 4YSQA 2VW4A 1ILUA 4L0PB 3OMIB 2H47C 1A4BA 2P80A 3H56A 4HAKA 1J9QA 1PZCA 2AZUA 3X1GA 5I6LA 1OE3A 2YAPA 4KOBA 1JXFA 1AG0A 1A4CA 1AG6A 5AFAA 1NWOA 3BVDB 4PCYA 2I85A 1NPJA 3AG4B 1PNDA 2EILB 1AANA 3S3BB 1URIA 1ZIAA 4AZUA 4G7QB 3WKPA 4HALA 2ZXWB 1BXAA 1KCWA 3NJJA 5AZUA 2PP9A 1ADWA 1CYXA 4G7RB 2Q5BA 4DP6X 3S3DB 1HFUA 4QLWA 1E67A 5I6OA 1RCYA 2DWTA 5D4HA 1WAEA 5I5MA 1JVLA 1TKWA 3AG1B 2BP0B 3ABGA 4E9WA 2YXVA 3FSAA 1AZNA 4QKTA 3ASNB 4AKOA 1AZCA 1NICA 1CYWA 2WO3B 3WG7B 4G72B 3X1BA 2R7EB 3T6ZA 2XV0A 2CCWA 3TBCA 1BXVA 2UXTA 3TASA 4DP8X 2MTAA 3NYKA 4A66A 3UAAA 4FA7B 4DPAX 2IDQA 2I7OA 1NIEA 1JZHA 3ABKB 2BO0A 1KBWA 4KNUA 1JZIA 2YARA 1GY2A 4W9ZA 2UXVA 3CDZA 4HCFA 4ZK8A 3OM3B 3GXUB 4KNTA 1A3ZA 3SBRA 2FTAA 1NWPA 4HHWA 4HHGA 2W8CA 1L9QA 3AW5A 1GY1A 4HCIA 4YSTA 2JXMA 2XVBA 1J5DA 3N2JA 1OCZB 1JZJA 2AANA 2PLTA 4PAZA 2GBAA 3S8GB 2GC4C 4ENZA 4X4KA 1T5KA 3EH3B 2BP8B 6PCYA 3G5WA 1F56A 3ZIYA 1E30A 4YSRA 2A3TA 2WO2B 2CJ3A 2XV3A 4NERA 3DTUB 2DYRB 4JKNA 1E5ZA 4HCGA 4KO5A 4HIPA 4F2EA 2BWIA 3S8FB 4GP8B 3PAUA 3FQ2A 2PP7A 5B1AB 2TSBA 3DKHA 3AZUA 1PZAA 2VM4A 1BAWA 1IKOP 2DWSA 2TSAA 2FQEA 3NSDA 3WI9A 2FQGA 1NIFA 4BK5C 2ZWNA 1AQ8A 3IN0A 4AX3A 2IDUA 3T6WA 3EH4B 3X2QB 1JXGA 3NP4A 5LDUA 1W6WA 2EIJB 3HB3B 1PLBA 1J5CA 3CZUB 2HRHA 1AZBA 3GDCA 1AZUA 1SF5A 3FPYA 4MFHA 3S3CB 4YSUA 3WNIA 1ILSA 1WS8A 1XMEB 2OCCB 1J9SA 3NP3A 1SDDA 2Y69B 2XX0A 3QJVB 6PAZA 3SBQA 2UXFA 3NJMA 2BZ7A 2CUAA 3ERXA 3FPXA 2ZONA
chains in the Genus database with same CATH superfamily
2ZXDA 3A67H 1REIA 3W82A 4WK2B 1DQVA 3KH4A 4Y2DD 2EDQA 5JMRA 4Z7VE 2Q8BL 1W2KT 4JZNB 1T03L 1ACZA 2K3HA 1RY7B 3MRIA 5KBKA 4K3EH 1FNAA 6CGTA 2N7BA 2X38A 3KPLB 2HX9A 5FKAA 1RLWA 2GK0A 4D0DB 1JPGA 3C60B 2V5YA 3WDIA 2D2OA 5LAPA 1CG9B 1QYGL 2DICA 3NRQA 3GIZL 3LZRA 3TIDB 3BN9C 4EPSA 2XICA 3MUGA 5LDSA 1MWAH 2AJUH 4P8QA 3LN9A 5CUSH 3WKNA 1JSYA 3CC5A 3OPZH 1Q1JL 4IIQC 4PGBA 4J5VA 2K70A 3GMMB 4HJ0C 2BSTA 4ERSL 4BFEA 3NEEA 3PWUA 3US9A 3OD3A 2MOVA 1EHNA 4FNSA 2Y7QA 1TJHH 1KB5B 4JGJA 1S7TA 5HGBA 1ZT4B 3ULUC 5B22A 3QDJB 4GKSA 1KSRA 2VDOB 1XF4B 3WD5H 2QEJA 1G4MA 2FSEB 4FZEL 4HJIA 4Z7VF 5C08E 4BWTA 2ESVB 3CVHL 3OHMB 5BO1L 5DD0L 1DBAH 4Y1AD 4O2CA 1CFSA 4MAZA 2VDQH 3HZYB 3IXAA 4ZOCA 4I1PA 4PJ7F 1YECH 2WTRA 3MLYL 4JRXA 4AL8H 2EDNA 2QFRA 2W9EH 2Z31B 1RPQA 2DRUA 5IIEA 3PWVA 1DQLH 2YAQA 2X5PA 2V4LA 1E4WH 2GG1A 2EXWD 3PAYA 4HJJH 4M5ZH 5LCVL 7PAZA 3FOLA 4BGLA 3OKEB 5C09A 3LRLA 3MV9D 5E8PA 1XZ0B 3T3ME 3HBGA 1KDJA 2JKSA 3UTTA 3T3PB 1QP1A 5D7IF 2YR3A 3R06A 4XGZA 1RURL 4DGIH 3PQYE 4NAMA 2B3IA 5BJTA 3PHOA 5C8JA 1HESA 4O58H 4KROD 1QSEE 2BINA 4WVRA 4ICXA 2WNWA 1AGDA 4MKMA 4AE0A 1E9PA 3SJVE 2P80D 2BRQA 1JNNH 2IOMA 4NKOB 1JL8A 5I8OL 1FCCA 1IQWL 1DQDH 2OL3H 5F9JB 2J43A 3VI4B 1KCVH 4Z7OF 3KM2A 4XNMA 1F4WL 2XT1B 1SDYA 2ZUQB 3HG1B 4JM2A 3UTSA 1WIUA 4YSCA 5C2UB 4LLYB 4R84A 4CU6A 3DO7A 3VCLA 4DO5A 4QRAA 5AZ2L 1IB5A 1ZDSA 1E9QB 1I1FA 3Q6GH 4UM9B 3DLQR 4OCXL 5ICXA 3SCMA 4P49A 2VR6A 5EA0H 4BSVB 3RDTB 4MAYB 4OGAC 4GBXB 2FX8L 4OM0L 1MXGA 3DHUA 3WUZA 2XHNA 3MFFB 1KZQA 3FT3A 4QF1B 4KZDH 3TN0B 3ZTEA 3VWJA 1HVXA 5ACZB 5B4MC 1KCSL 3F7QA 3Q05A 4TNWK 2YEVB 3GT6A 1LD9B 3E8VA 3ISWA 4HKZA 3EH2A 4TL4A 5HD8D 3ZU8A 3W39A 4DZBB 5EC1A 1I1AA 2QPDB 3N1FC 4XRCB 3ECBA 4WFFD 4X7FC 1CICB 1HH9B 3FUMA 4BXVA 1XGTB 5EU5B 1F3DH 1KGWA 4N2HA 4U1NA 1E4KC 3GDBA 1WD8A 5FK9B 1Q0YL 5E6IA 5KANG 1E5BA 4FP8L 4QHMA 1A8ZA 2VH5L 4Z5RA 2XQYG 3GZOA 2PTVA 3D85B 3LOWA 1AS6A 5IMMB 4NRYB 2WJ5A 1MI5D 1T3FB 4GS7C 3B2PA 1NIBA 1R4XA 2NDGA 4JCLA 1QBLH 3BVWA 3BZFB 3ZLQC 1M2VB 2BNQE 3H9HA 4N2IA 3DOSA 4RISH 3T6QC 1I3VA 1MHPL 3GK8H 1BAGA 1WUNT 4TTGA 1EANA 3FB8B 3AXIA 1XGYL 3QJRB 5I1LA 2E76C 5KSVB 2FEEL 4JBSA 2LFGA 1SEBB 5DEFA 3BPLC 2XQBL 2DIAA 2R4SL 4PJFB 4F9LC 2NW3B 3DVGB 4OLVH 1I1FB 7PCYA 2HT3D 3GHBL 4W9CC 2VLMD 5F7UA 5JQIB 3T9WA 2BCMA 3GXIA 4N0UA 4WFHD 2IDCA 3VD3A 5JDSB 1P2CA 5E2UH 3UJTH 5IROD 4AWJC 1QLEB 3O41A 5I1JL 1UVQA 5ANHA 5I1CL 4RZCA 2FUTA 2V8LA 2Z4QB 4YSOA 4A2GA 5ISZE 4IOFD 5GRVL 5D1QB 1EVUA 3GLDA 3MCG1 1J9TA 5EU7C 1C5BL 1KB3A 4O02H 5CXPA 2NY0D 1R3JB 4C47A 2B1AH 1X9UA 2YPLA 2XACC 3VFUA 4OFIA 5IFJB 1L6ZA 3QE5A 4YBQC 4QHNB 2WCGA 1RAMA 3MJ9L 3R1GH 1YQ2A 3G6JB 2I60L 3HC3L 1AGFA 2H3XC 4X4XB 2DS4A 1RP8A 3ATFA 3WMQA 5F70A 3KXFA 2VE6B 1ZPUA 4ZS6D 1WCBA 3ARPA 3WNJA 3K4DA 5J56B 1A1MB 3P3SA 2ZOTA 4AITA 5I75B 3N91A 4Y19E 1NSNL 3HZVB 4RISL 3R7RA 1CL7L 1UWEL 4HUXB 3OBAA 3TZVD 3HKZA 4IMKA 2HT4C 4TL5A 2AJSL 3PP3H 5FDYA 2F54E 2XA8L 3U0TB 3WY3A 3M6DA 1QEWA 4DP7X 3T0DA 1IC7L 3PPSA 2WTOA 2NXYC 3BOVA 1EQWA 1S7RA 5DJ6B 4QRPE 5BS0D 2OSYA 3PAVA 1E8YA 3SPGA 2WKLA 5JHMA 5J1AA 1JK8B 1AGBA 4DO6A 1UA7A 3MJ9H 3R1GL 1XGPB 3GSWB 3MNZB 3TBVA 4HX1A 3KGSA 1E8ZA 4DN4H 1H8SA 4FNQA 4MAUH 3S0PA 4GRLC 4NJAH 5GGRY 4O02B 2Y7MA 4OFDA 3LB6C 3SZKC 5INCB 4ZX6A 3TNNA 1XEUA 4UB0H 4LP5A 2VITB 2QSCL 4MJ4A 1KCSH 3TYFB 1KB5L 5DEJA 4F7CB 5I1CH 4MMXA 2EIBA 2OTPA 1GA2A 2N59A 1EXUA 1U4FA 1I8IA 4FG4A 4KK8C 1WP6A 2QVTA 4BV1A 2FCBA 4OT1L 1RUQH 4XNQB 1CU4H 1LO4H 3APMA 3V95A 3VFWA 4ZX4A 3H9SA 1SOQA 3PIQB 5AZ2H 4ZTOH 3NCCB 4F5CA 2VLKE 2GIXA 1FBIH 1JZGA 2YHGA 4JG5A 4JMXA 3TTSA 2GY7B 3GGWB 4ZNEE 1YY9C 4Q74A 2JKLA 3DTDA 3M7OA 4WUKL 1CTMA 1HIMH 4KQ4L 4XT1C 1TQUA 2CNYA 1H5BA 2BPBA 1EFXB 2PCXA 2ZZUT 4FNUA 4G7VH 4M62L 4R7DA 2HP4A 4MS8C 3ZTDC 3OXSA 5CGYC 4ABUA 1VFMA 4HA1A 1KELH 4WTQA 4Y2DC 4JFZH 3FTVA 3W9EB 3S98A 1WO2A 1B2WL 3MFGB 2ID5A 4YNYB 1T0MB 1JZ3A 1BMZA 3L3JB 3SQBB 4R2GD 3EGXA 3F7KA 4DVBA 3K8KA 2VMEA 1PLGL 5DS2A 4GQ9L 4XVTH 1JHTB 4DZ8A 1KBGL 3BD4A 3T3PF 2YZ8A 2GPZA 3CN0A 3VX1A 1S7UA 1ZHBA 4FXGC 5BW7A 5F0MB 2XZCH 4PD4K 2DQTH 3ULVH 1CIDA 5EU7E 1T6BX 3I9IA 1YECL 5HHVL 2AK1L 2X40A 1KCWA 1A7QH 2PP9A 4IBWA 2H2SD 1U8KB 2R2BA 3QDJE 5T1DL 1M42A 1MCCA 3WJLC 4DP6X 2ZX6A 4HOMA 1KJVB 4FCHA 1JVLA 2WQRA 3REVB 1TENA 3VQ1C 2IAMC 2DQJL 2FAUA 2EDYA 4YE4H 2A9BA 3MCLH 3VSTA 5CCKH 2WC7A 2CDEA 1NGZA 2WQSA 1T7VA 1V7NL 5F9OL 4EIUA 4PSRA 1WZLA 2HT4D 3QJFA 4NRXB 1HQRA 4NO3A 4IRSD 1HQRB 1OO2A 5HHQA 4FG6C 1NCJA 1Z1WA 2VM9A 4F7MB 5ID1B 3LN5A 1ND0B 3B8YA 3QULB 1WG3A 1Q94A 2K0RA 3O2DA 3MV01 2I7OA 1NIEA 4R2GC 5I1EL 2GJJA 5D55A 4HOXA 3QI9C 1OB1B 3E80A 4QMEA 1JTOA 4AYID 1A3ZA 4FI8A 1U8LB 5F0PB 3SBRA 1KYOK 2NY1B 3SJVB 2WP3O 1BZ7A 3N1QC 5B39B 4LIQE 3EW3B 1S7VA 4FMFA 4C55A 2DQHH 4YC2B 5BZZA 3JUZA 3L3OB 3FTYA 1R3LB 4H8VA 4OCMC 3EH3B 3QWQB 2ZYIA 5CD3A 4FNLL 4L3CB 3BKCL 4GAYA 4JHAL 5J7CC 3O6FB 3QSKB 4Y1SA 5I1DB 3SPIA 3FFCE 3LNIA 2JTDA 3SGDI 3VUAA 1IM9A 2YD5A 3NPSB 4IHOA 4AY0A 2AABL 1S7SB 4W81A 2BVPB 4PRDB 5J12B 5CINH 1ADQL 5DHVH 1ACXA 5KYUA 1CVSC 4LOFA 5DRXB 1JUFB 3V4PA 1C5CH 4G9FA 2ZKWA 1DZBA 3SYAA 3M46A 4LCYB 3ZOAA 4LIQL 1E5CA 3AT0A 4BCXA 1OP5H 3GSQB 4LLMB 2ORBH 4GLRI 3LZFL 3JV0A 2CDGA 4LCVA 3N44F 1ML0A 1F2QA 1J0JA 4JFXB 2FO8A 1HHIA 1L0PA 2FQGA 4RFOL 4U6YA 5J13B 3DIFB 1WC7B 4TTDD 3VW3L 3LHPL 2Y3NA 3QFDA 3MLUH 3O6LL 3GSOB 4CNIB 3VXME 1OGPA 1PLBA 3D87B 3WNMA 4MXWL 4X5WA 1AZBA 1FL3B 2C26A 1QQDB 3HE7B 3KJ4B 4PJCF 1R24B 4G1EB 3GBDA 1T4KB 4ZMNA 1T22A 1U8JB 4GG6B 4ORGB 1UD8A 2FO4A 3GHPA 4NJAL 4RMBA 3TA3B 2Z7ZA 3QYCA 4IU2B 1WFMA 3QJXA 2BFVH 1TETL 2JQAA 3PGCA 4IU2A 5DC4B 2CUAA 1HDMB 2ZCZA 5BS0A 2W80C 2JELL 4HV8B 4Q2ZA 5AAPA 2XC8A 2QSQA 1RH8A 4PJFE 5K9OA 4G6AC 4W9EC 1IAKA 5KSAB 1ZLUH 1G1OA 1F2XK 3NPZB 2GEQA 1GH7A 1PJWA 1UJ3C 2G3XA 2KERA 1BQHA 2GVYA 1NL0H 3HC4H 3ZRSA 4LESA 4D9QE 2AJSH 2CO6A 4JANA 1QWHA 4PY8I 3NABH 1WQVT 2WXNA 3BSGA 3M86A 4NQCD 4RAUB 5CIPH 1YNLH 4DOHB 5ICZB 2CG9X 4LRIC 4U1GC 1UKTA 2YLKA 2V5TA 4L0ZA 3OZLA 2OXHA 4MYWB 4D2NA 4DT2A 3KPOA 3WSQL 1FAIL 4U6TA 4KKAC 5I15L 2BSEA 5BV7H 5FGBC 5E6IB 2XG4A 5FK9A 1N5AB 4BH8A 2X9ZA 2CRYA 4DK5A 3ILEA 3MROB 5T5FH 1EBAA 1VIWA 4OCLC 3Q2LA 4L4TD 4ODHL 4M1DH 3LZLA 5E1GA 3GJFK 3UEZA 4F8LA 2CUIA 3EDFA 1NA8A 5B1JA 4Y19B 3ARBC 2VR3A 5I6KA 4PP1C 2NSXA 2VN5A 4OJFL 5B38A 4BE6A 2MQ3A 1CUOA 2VDNB 4NSKA 1X5YA 1CGTA 3CFTA 1K6QH 1PKOA 3CDFA 3QPQD 1WD9A 3HC0A 1B4JH 4YIQB 1F0LA 2EUVA 2V7NB 4LOEA 1BF8A 4PREA 4AG4H 4HUCA 2XN9B 5D7EA 1U36A 5EZOL 3LS5L 1JRHL 1BREA 4FZ8L 5KOMC 3DOIA 2LLLA 4FZ8H 3CFUA 4U6VL 1A9BA 2JSFA 4HETA 4LCWB 5IFAL 4RMRA 5EBMB 1RZ7L 3QUHA 5JW3H 3ZDXB 1IKNA 3VXMD 3KHQA 1JXJA 1A7OL 1FNEB 5HYJA 1BVLB 5DVOA 1E5YA 2FGWH 1M57B 3KYMA 2ZOKA 3MA9L 5D96B 3U30C 4XNZC 3IDNA 1DQQB 2XKNB 4RAHA 1AJ7L 4OTXH 1F6LL 5F7NC 1FG9C 3WO4C 1HX0A 3LPPA 3IGLA 2JIXA 4H2AA 1MNUL 3TF7C 1U3JA 3ZX1A 4XC1H 3V6BR 3IFLH 3NJKA 1TTCA 4PM1A 1LYQA 4QHKI 2QFPA 2J5LC 4HS3A 1BYNA 3US1A 1LO5B 1TT6A 4JQVA 2D03H 1KACB 1SVZA 2BSBA 2D8KA 1UUNA 4AQAB 4QYOB 3CFBA 3HZMA 4PY7B 3C2SA 1QBBA 5E1HB 4EI5A 4JRYA 4Q9RL 5KSBF 2Y25A 3LX9A 4KAQH 5AOJA 2P8LB 2CO2A 1SFHA 1NKOA 4FQLH 4JFOB 4N2NA 2GW5A 2CO3A 4DZ8B 1D7BA 1KJ2B 4AJYV 3FN0L 1UXSA 2X70B 1S5IL 3B7TA 3T77A 3QZNA 5IV2A 5L7XH 2C7FA 4LVNC 5FYLE 2B4CL 5F7EH 1EAJA 3G5ZA 4YHOL 5BZWA 3LV3B 1LILA 4AM0Q 1A9EA 5EOQH 3ULVE 1PIGA 3HC4L 3V0WL 5K39B 4HKXB 3K6SA 1L9TA 2V9RA 2DIJA 1W6LA 5TE6L 1TOXA 5L2KA 1IJNA 1FL6A 3GLZA 3UJJH 3C6EA 4N0UB 3HS9A 2KUTA 3UZVB 1HCYA 1EEQA 1QFWM 1DFXA 1J1XH 4U1HA 2G5UA 3MLZL 4OSUL 3KPSA 2PCPB 1JGEA 3HI6H 3HMWL 4AIZB 5F6HI 1DBJH 2ED8A 5A3ID 3L2NA 1GGUA 2LLGA 4A39A 2ITFA 1I7RB 2R1YB 4IS6A 3KPPB 4OF0A 4PTUA 3RTLA 4DKFL 3RAJL 1J87A 2CH8A 4P57B 2DQFB 2B2XH 2V8MA 3HZKB 3KJ4C 4M5ZL 5GGSB 4X4YB 4JFPA 2XWBA 4NFBA 1BX2B 3DVIA 4P23C 2LLNA 1UH4A 4QRRB 2C4FT 4ZW5A 4HJSA 2VMJA 3MVSA 3UBXG 3E7JA 1IX2A 1RXLA 3G08B 2YPVH 4LVOC 1ID5I 5GGVY 5FB8A 1A1OA 2Y6SC 1EZUA 1BQHG 1IZJA 1Q8MA 2I27N 3UO1L 4KK9C 4P3CH 4HS6B 4K3DH 2DLIA 3BRFA 2H0PA 1DVTA 3MLWH 4AEHH 1CBVL 2Z8VC 5JPMC 1NINA 1QBMH 1BM3H 3FQ1A 2A6IB 4M4RB 4YEEA 1T20A 1ONQA 2D3JA 3S3JA 3B34A 5HYSA 1S7RB 4KXBA 2ATPA 2J57A 1RIUH 4M6OL 4ERSH 1ES0B 5BUAA 4FADA 4FLRA 4N2FA 3DXAB 2GUYA 3OKLA 4BFGA 4F9PC 3OKLB 1BG1A 5BOPA 3V9EA 3MLXH 5MEND 2H6PB 3A22A 4Q6IA 1KCLA 4UQEA 4JFWA 2F54D 1Y18B 5AOLA 2R2CA 4IDLA 4PRIE 4JDVB 4YHML 4J8QA 1MHEB 3NFSL 1QNIA 2QGDA 4P57A 3V6FA 4DEPB 3GGWA 3D39B 4HT1L 4PTUB 4M3KB 2IWGA 3JWDC 4JRXE 3TO4A 1AAJA 5DMJB 3QXUA 5F9AC 1E27A 4YXHH 1SYSB 4F27A 3KS0J 4J3WA 3BPNB 4MXWH 1NZRA 4F7MA 3L4CA 5ID1A 2W59A 1C7SA 2GC7C 3FTXA 3KPRE 1SJVA 4KQ3H 2K78A 4X83A 2QDVA 1GSKA 1UB5B 3FYIB 4IKLA 3SKOB 2E0PA 4G6KL 5FDWB 3ETBF 1GR7A 4N90D 3I6KA 1T1YB 4HMCA 1PX4A 4Q8BA 3AJ7A 2G9KA 1SMDA 4PRBA 4X9YA 4PJ5B 3TEWA 4PJ9A 5HHMD 1HAWA 5DI8A 3AGVA 4WW1B 4WENB 2ITEA 3OAZH 4H8WL 1E4JA 4YDVA 3GJEA 4OM1L 3O6KH 5T8IA 3E9TA 5IB2A 4LVHC 4AQ8A 5LBVA 3BISA 2VABB 4GKLA 5D2NA 4RDQG 1LEGA 5D8JL 2ADJA 4JPKL 4N2AA 1GC1C 1IAII 2K3TA 3BAEH 5D7LA 4E41A 1HJCA 1D6EB 5CEZH 4X5XA 3BAXA 5ID0B 2AQPA 3EDDA 2R51A 2Y3AA 1GGCH 1LP9E 4QGYA 3T71A 1RURH 4DGIL 1UADC 3EO9L 1FO0H 4H2CA 5D7JB 1CVRA 2EACA 5GGQH 2WWOA 4JRLA 4GBXD 1MY5A 4PJBA 2Y7QB 5AQ0A 4LMQE 3D0VB 4TUJB 5F3HB 5EPMB 1ZSDA 4BSWB 2HT2D 4HSCX 2L4OA 1XD0A 3KPMB 1D7FA 4XVTL 3N41F 5ESVB 1RMFH 4KTDH 5FYJD 2OFQA 4A7TA 1PG7W 2OCFD 4HWBH 1AQMA 1PVHA 3MRBA 4ADIA 4PJ9C 1VERA 5FO9A 3QIBA 1J5OH 3ELQA 1EIBA 4JO1L 3CMOH 3NCMA 4IKKA 3N0AA 2WQVA 3RUGE 3EOTL 3D3VD 3OTTA 3BH8A 2XWTA 2EILB 4WHTA 4G7VL 1NFDE 3TV3H 1QSEA 3QS3A 4H8WH 1X5XA 3S8WA 3V0HA 4HIXH 4WQOA 5FYJH 4JZJB 2DMCA 4A2LA 3LPGA 1GYUA 3Q8BA 1KIUB 4XP1L 5IMOB 4X6CE 1JGDA 5CCKL 4NNPH 2KPWA 4W68A 1T6WA 2ICWA 4XNAA 3T04D 3DV6B 2OMYA 2YGNA 4XOBA 1AZNA 2RMNA 1G0XA 4P2OB 4KDWA 1G7QA 3V4VB 4PGBB 4MJ6A 5F9JA 1R3IH 3TEXA 5JLZB 1L7IH 1F1AA 1C8PA 3V10A 1E6OL 2IC2A 1MY7A 3AU1B 4IGBD 3KGRA 1N0LA 3CC1A 4PRNA 4X7SL 4OJDH 3FUHA 5IVOA 2N56A 1A47A 1FYHB 2ADGA 3ZKMC 2EDXA 1DBML 1CLYL 1OLLA 4ODXA 1Q4NX 3OLIA 4W9DC 4P06A 4TVPD 4NZ8A 4JHWL 43C9B 4GRLD 4ZK8A 3KPMA 1PKQB 3IGAB 4KXZH 1IL1A 2Q7NA 3AACA 4OIIL 1MVUB 2Q0ZX 4HHGA 2W8CA 5EU6E 3HBPA 3EG9B 2EYSB 5JPNC 4R26H 4UOW0 1JZJA 1QTYT 3CHSA 5I16B 4QY8A 5IB4B 4HC1H 5E9DE 3RJDA 1NFDA 1NFDF 5DD5H 2H2SC 1Y0LA 2HN7B 1A0QH 5A2CA 1JG9A 3JTSA 1N8ZA 1UZGA 4PGEA 4PP1D 3FW6A 1F56A 2OMZB 3RZCA 4U1NB 1G7MA 3VGHA 2BNRB 4X50A 1ZAGA 3MQIA 4PLKC 2D3LA 5ERWA 4M43H 1NCIA 3NCEB 4YFLF 2DYRB 2YKKA 3T0VA 5L4JA 1JMZA 2OMXB 2VZOA 1F4XL 1J8HA 5B1AB 1LLAA 5GS0L 2R8SH 3HC0B 2B59A 4ZUSA 5JLZA 1VB9A 1X44A 1G7QB 3V4VA 4FYQA 2WYIA 5HDBF 1NMAH 1GVIA 3HG1A 3OKKB 4JM2B 4QWWC 3SPCA 3STLA 4JUSA 5C2BH 4XWGH 2DD8L 5IM7A 1JGUH 1A9EB 2UWEB 4XWGL 1USQA 1E42A 3P0VL 2DM2A 3QI9D 3WI9A 1GGBL 5DUPH 2MNWA 4P2CG 3DVGA 3LMJH 2NW3A 1SLUA 3DRQA 3LKOA 3MODH 4PGDA 3B3IA 5ISZA 1X6LA 1BIIB 2E3VA 4OUOA 1JXGA 3X2QB 3DWTA 3SDXE 1FYTD 4OJAA 5GS1C 1ZA6A 4JO4L 3ZDYB 3MLZH 4OSUH 3VB9A 5BV7C 5D7IE 4LHJB 2H4EA 1MFDL 4NZTL 5DURB 5DZNA 1PJ9A 1A14H 1P4LB 1H3PH 2OK0L 2KMWA 1X7SA 2WVSA 1HSBB 4RRPG 1C5DB 1YZZA 4P2QB 2XX0A 1HXMA 1NMBH 4XP6H 1X3DA 3TXAA 2WLZA 5I73B 2BZ7A 3EJYC 3GMQB 4NKMA 3BDBA 4NN6B 2XWCA 3EUUA 2P8PB 3ERXA 1KIRA 5L7XL 4BFRA 3F58H 1RK0A 5E2VL 4PGEB 3PUUA 3DARA 2MWCA 4N28A 2WIMA 3NEXA 2XPGA 4R5XA 1FLRH 2J8OA 4WFGE 3QIWB 2JCCF 4O2FB 2GY5A 2K4WA 2PXYD 1GCYA 3QIUB 4GKZB 1BMGA 7FABH 1WWCA 4EIGB 4XNUL 4BUQA 3HC3H 1RL1A 4YL4A 4JO4H 4HS3B 4RQQB 1CB4A 4UQBA 3BLBA 4RLDA 3ZSTA 3HAEH 4QRFA 5GGVH 2ZXBA 4PTTA 3TO2B 2H26B 5I1KL 1GMEA 2ILLA 2JF1A 4F7PA 2VOTA 3WKYA 1NCBL 3RYMA 3LTVA 3NRPA 3T1FB 4Y5YA 1AIZA 2X89A 1D6VL 1UUSA 2YAOA 4B53A 3DX8A 4JY6B 1MHCA 2YMTA 3P2DA 1A6ZB 4ONHB 1TMQA 2R0KH 3L9EA 4JFYB 3UYPB 3SE6A 4B7IA 2P44B 4ZOBA 3RGVD 4KDVA 1MCPL 3K2UL 2VDRH 5H2BA 4LEOB 2XRAH 1DDHB 1KCUL 1QZ1A 2EE0A 2EECA 3FU7A 2X6MA 1BMWA 3VRLE 1P84K 1AI1H 4L8BA 3L4VA 1FCGA 1ODAA 1AO7E 5K1VA 3FQ4A 5B7FA 4O9HH 3A4FA 4N0CC 1G7IB 4QRQA 1CT8A 4OZFB 5I8CB 3L1OL 1KIPB 3B83A 4JQVC 3VQLA 3EOTH 3WDJA 2OYKA 1TZHB 4XVJH 4FKHA 4HJUA 2GIMA 3W2DH 2NUTA 4KPHL 5I6XC 1Z5LA 3ZBMA 1N0XL 1XH3B 3ZYIA 5KVDH 1N64H 4WUUB 3C5SB 4KX7A 3KPRB 3N1PC 3WFCH 4AMWA 3MV9E 3M1CA 4QCIB 1PEZA 4ISVB 2V3EA 4MS6A 1FFPA 5DA4A 4JHWH 3QQ3B 1B90A 2HVJB 1M6OB 4HFUL 3RNKB 3QZOA 5DUJA 4BM7A 3IKKA 1R47A 1RZJC 2W5PA 4ZFOB 5JQHC 3WNNA 4L8SC 3MACL 3V52L 1CL7I 1U8OB 1Q9WA 3WELA 5EO0A 5DHXB 1YCSA 4PV8B 4XVSL 4XXCC 5TH2A 2CBTA 5I0WA 1ZVNA 3JXAA 4Z7WE 1HYSC 2PWHA 3HMXA 1E6OH 2E7HA 4UV7L 5DD0H 3GZKA 3HG5A 3WEXB 1OANA 4JFOA 1GGCL 1Q9OB 3QNYA 5T33H 4GG6F 1QLEH 1DANT 3PP4H 5D70H 4HCRA 2IXQB 5KW9H 1BQKA 3WKMH 3ZDZF 3V0FA 5EZJA 2OSLB 3IJ8A 1I8AA 1U8NA 3ARZA 3X14A 3BEVA 3FT0A 2E7CA 4U49A 4L8BB 3GMRA 2WWNA 4NPYB 4A6YB 4M93B 1ZLDA 5C0AA 1E2VA 4WSJA 5J57B 4GXVL 1GGYA 5I6PA 4XNQA 3MUZ1 1E6JH 1MWAL 2AJUL 5CCJA 4WHYH 5HHOB 5DF0A 4YO0B 2B5IB 5DJZB 3T0ED 2L7JA 4NQSA 4BH7A 5EEZA 3KPPA 3L08A 1BQ5A 3SBWA 3RIAF 4NEHB 4ANKA 2W60B 2Z6FA 1FWXA 2R69H 3WFBL 5LQBH 5E9NA 5AYTA 2VM3A 3ZMEA 5MEOA 3IDIB 4NRZA 3ZE2B 3JQOB 5FKAB 3RZCD 4XO5A 1LQSR 2VKWA 3WNLA 2ZWZA 4C4BA 3H42L 2QTVA 4RSVA 4A6YH 2QJDA 1MW3A 5AAWC 2NT1A 4BZ2H 4X6CB 2A5UA 4OLWH 1VFBA 3ARGA 2VSCA 4L8CB 2C9XA 4GP5B 3G6DH 4GKNB 3CAFA 1E3ZA 2OZNA 1OGAD 3CBRA 4F33B 1FO0L 3T0EB 3QIUC 4NGHL 5I71C 4KTEH 4GAYB 3TC9A 3CIQA 4GIAA 3SGDH 1VFAA 3P11L 1DYZA 4TV3A 5C0FB 4OI8A 2QKIB 4YDIH 2E6QA 1OF2A 3NACL 5E8OB 1OF2B 4IRSB 2WSKA 3BGMA 4QR7A 3ZTJG 4XNDA 1XCTB 2OXGB 5CFAA 5IY5B 3MBWA 1I85C 2UVFA 3VXSE 4KRPC 3AITA 1S9VB 3MX0A 1CZ8L 1RFDH 2KC0A 4K3DL 4X0KA 4JFED 5JUEL 4PGJA 3HVDA 3TJEH 3ZT6A 4EI0A 5AW1B 4EVNA 5I1DA 4WGWB 4NGHH 5E1AA 2WIIA 1E43A 2P48B 3TA4D 1FA4A 4JEGB 1IQDB 1F3JB 5L8JB 4F7KA 3ZE0E 1X5JA 1PYWA 3B2UC 3UADA 5F3HA 4YSEA 4D7BA 4I18C 4F7TB 4TRPH 3QJQB 3BZ5A 5TE4H 5C9JA 4DGYL 5T3ZH 5F7WC 1U2YA 2H32A 5F7LB 1SYVB 2BW5A 1JZ6A 1YY8B 4KV5F 2BOCB 4HIJA 3DX1A 4JFDE 1IFHH 5EOCJ 1UKSA 3HE6D 2F68X 3PFUA 3W81A 2L04A 1I9IH 2O5XL 2F2HA 1GOGA 2BZCA 1MI5E 2IPUK 2PXYA 4XBGA 1LK3L 3EYOA 4WHTB 2EINB 4QRSB 1JHLH 2FQDA 3BH9A 3NT0A 5AW4B 4APXB 5L4FA 1U8LA 2NSQA 3UERA 3K7UA 2CJUH 3SKJH 4KI5C 4HV8A 1ET8A 4I0PD 2BDNL 3GSXA 2FYVA 4GIPD 5E7FA 3KYNA 1UOVA 5IM7B 1YLBB 3DV4B 3ULVF 4LLWA 3HNTH 4TUOA 2MJWA 3GRBA 4WSKA 1ZA3A 4YHOH 3NIFE 1G0DA 3VXRD 3L3DB 2UWEE 5DO2C 4QD2E 3WNPA 4BKLB 1OAKH 5FEBA 1MJJA 5IW1B 2R0ZL 5C0ND 1GSMA 4MNGA 4HUWA 3O45B 2G5RA 3MX0B 2YGQA 1BVKA 2AEPL 3W0WD 4L37A 1U6AH 3CZKA 2IPTH 4JPVH 4QHLB 2QPUA 3B2UD 5EZIH 3QZLA 5E6RB 4HK0B 3MLSH 5KYUB 5I9QB 1BOGB 1ACYH 5KSAC 4XP4H 4KUCD 4RAUA 1N3NB 4UT7H 2Q76A 3S34L 3VXOA 1WAPA 2ZICA 4GMTH 1S9WA 4Y16B 4PRAB 5E2TL 2ZG2A 2BIQA 4OLXL 2OXHB 3KLSA 1MAJA 2BIOA 4NQDD 1JF5A 1AP2A 2FHFA 3VI3F 1RZKH 2Q10A 4P05A 4FFZL 3IETA 1H6UA 4KFZC 1G9NH 1RKRA 4HPYL 2R2HA 1D5IL 1OARH 2CAKA 4L9LC 1TTUA 3FT4B 1A1NB 4B5EA 3D30A 3GMOB 2Q1EA 3NH7L 4UBDD 4XNBA 2XY1A 1MELA 4PCSA 4G1EA 4YSQA 2VW4A 3QRFM 3GXMA 3OMIB 4LSRL 1L9NA 1B9ZA 4MRBA 4NQCA 4XNMB 3RY6A 1BEYH 2WXLA 1A3RL 4HIEB 3VH8A 3D7PA 5DJDB 2IF7A 2NNFA 4KOBA 5TDPA 3FZUC 5F21B 2OMYB 3EFOB 3SPHA 2BP3A 1XGPA 4BSVA 2HTKC 1IKNC 4F8TA 3LIUA 4NZDA 3SCMB 3TH2T 2BLFA 3OMZA 1HINH 2F7OA 4JR9L 3RWFB 3JTTA 3IMVA 3FTGA 4OBRA 1O5DT 2EDDA 3P3UA 5DD3L 2EDBA 2EXYC 3TNNB 1B3JA 2QHRL 5HJDA 5M7QA 3U7YH 1VKXB 1E67A 4FE9A 4LVNB 5CJOL 4ZUWB 4RDQF 1WAEA 4HDIA 4DKDC 5HYSG 1I8IB 1Z66A 2GBUA 3PWVB 4FXGA 2QADC 3BGFB 2J7LA 4NJ9L 3VAEA 4Z7NF 3UAJA 1AO7B 1IRAY 5F8QC 3FSAA 1A6TB 5AKTA 4JFTA 1WJ3A 4C83B 4Q6YA 1P4LA 3IVKB 2YEZA 1XF5A 4AVIA 5KAQF 3ZHFA 1FI8C 1AHWA 2XZZA 5AVXB 4UNVA 4I48A 5E24E 4HGWB 4PG9A 4Y4HC 3WJJC 3MA9H 5LG1A 3TBCA 2YPVA 5CU5A 1KIRB 2FL5B 3FBKA 3QQDA 4TMPA 4TVPE 1V3JA 5GGRB 2V3FA 4DPAX 1IC5H 2BOLA 5CHNA 3HZVA 4PJGF 1CK0L 4KNUA 4UT9L 4NNXB 4J39A 1KJ2A 3QDMA 1XBRA 4EN3B 1G7HA 4NC1C 4YK4C 2W0PA 3JVFC 3STLB 4XX5A 1X9QA 2ZKHL 5FGBA 1GY1A 2MNJB 2PO6B 3B7RL 4Z7WA 2H3NA 1MXDA 1TTAA 3ISRA 4TUKH 5ESAB 1LL1A 3IWUA 4Y2OB 2EXYD 3B7YA 1JNHA 3DDGA 4IRZA 4WO4C 3TH4T 5IW6B 1NLDH 3ZIYA 2WXJA 1DCEA 2CJ3A 4XCEA 3G7TA 5FHAL 4RGMC 2WXRA 4YC2C 4X9BA 3MLRL 3GSNA 3RFZC 3ROLB 1CF1A 2C1OA 1VADB 3IPEA 4H0IA 3DTUB 1CGYA 2DD8H 3DBSA 1PX3A 1AHKA 4RA3A 3SIKA 3K3QA 4PJAE 1FGNL 2F5AH 2ZWKA 5FGSA 3F00A 2JWYA 2YPLB 4GRWF 1EEUA 5GSRB 3ZKXB 3S8FB 1EHLL 2ZD0A 4FLSA 4EI5D 3REVA 5I1IL 4UDUA 3Q8FA 1E2ZA 1NCDH 4H20H 2EQDA 1KGCE 4XCFH 4MJ2A 4HH9A 3MJ6A 2EXTA 3P69A 4LVEA 1N26A 2FQEA 5AD0A 1JP5A 4R7VA 4X80L 4O5LH 4F8OA 2WJ7A 3J8F7 3QVAA 5A6IA 3L95B 1MCNA 2OMBA 1X5LA 4NQTA 4AX3A 4LPCA 3NP4A 4NCDA 3SDYL 3KLAB 2FHBA 1I8MA 5JPMA 2ATKB 5J3HC 3DSNB 3LH2L 4NCC2 3QIWA 2NY0B 1K4DB 3SQOL 3TO2A 2C5DC 2PCFB 4XMUA 2WINA 1DLHB 2C9UA 4MFHA 5EO0B 1VFBB 3ARGB 4XAWH 3DX0A 1SLVA 4Z7UA 1ILSA 5IESH 1J8SA 2B9BA 1HEHC 2HG0A 2JKRM 4HUXA 2CR6A 3NGBC 4LO9A 1KULA 1PDKB 1U8CA 2V33A 1JFQL 4K15A 5DSCB 4WHCA 1JHTA 3BT2L 4ONFL 3D2UB 3LH8A 2EE3A 3C12A 4GAGH 3VRIA 2BVQB 5BOJA 2N0MA 4ETYA 2YBRA 4WY7H 1CYGA 5JW5A 5I17A 4KHTL 2C1OB 3FUNA 1I1YA 3HVNA 4PS8A 4XMZA 3ARFC 4JQIL 3SO3C 3SE3A 2CZNA 3CH1A 2GSGB 4PJ7B 4XHJC 4XMKL 2PCPA 4E9YA 3OAZK 3MUUA 5C0AB 3FSVA 4G6ML 2BVYA 1H3GA 2Q20A 3N04A 1AGFB 2OR9L 5D72H 3D09A 2ZX9A 4XPFL 1T2XA 1F90H 4YO0A 1MWAB 1KJMA 5DJZA 5TPWL 3PIQA 1OW0C 2V17H 4FAAB 3DX3A 2DMKA 2E9WA 4FXKB 1K4CA 1FL5B 1HNGA 1SGKA 1N59A 2X41A 2R39A 3S48A 1CFTA 4Z7VB 1FYTB 4Z3FA 2EUZA 4ZO7A 1NC4B 1IGYA 3ABLB 5FGRA 5ILTL 3JWDH 3MCLL 3T3PE 3ESUF 4A37A 1UKQA 1SHWA 1HHKA 5D7SH 4XBEL 2Y5TA 1CLOL 1JVKA 2GHZA 1HH6A 5DJ6A 1QSEB 3FO2B 2BHFA 4PWGA 2NTFB 3HB3D 4U4BA 5T1DH 3FUDA 4E5XB 5FCSH 4QT5B 3I3EA 4ABQA 3TN0D 1T4KA 1AIFB 4IK7A 4X8XA 3OJ2C 2ICEA 4EI6A 2X9YA 4WNSA 5BZDA 1S8DB 1ET7A 4OUUA 5GJTL 3D07A 1WTLA 3UGXA 2PPDA 4AGQA 2GUOB 3UAJC 2IH8A 4C58B 4DH2A 5JTWA 5DQDL 5CZXD 3L3GA 4GQPH 5C6TH 2LQRA 3E9UA 1RJYB 2FE0A 4GQ9H 4N3TA 5K5YA 1IVTA 4XC3H 4BSWA 1MIEL 1ZE3H 2V9QA 3FRUB 4WSGA 4W4NA 5AB1A 1XF4A 1Y07A 2WSDA 3WJMB 5LGJA 3IBOA 1P7BA 4I9XA 3CJJA 2ITDA 1WITA 5CEZL 4GY4A 2FT8A 1MCFA 2WMPA 4LSSH 1I8LC 4HAGA 4AYFA 3ES6B 3GI9L 3V4PB 1MOEA 1CQYA 1HAUA 3JWNC 1OTSC 4Q0XL 5EORH 2OM5A 4WK0B 5CIPA 2ZAGA 3TO4B 1MHHA 4DAGL 4Y5VC 2JK5B 1ASQA 1E5AA 1H0DB 5IB1B 1C16A 2OQJA 3PDOB 5HDRA 3W3BA 4G42A 3DIVA 3O2WL 1V7NH 1AQKH 1QI5A 2TAAA 4G6KH 4L9LA 5LN8A 5JIPA 1LO4L 1AYOA 4P46B 4X9HA 2J8UF 4NI6A 1UWGL 5J11B 2P5WA 4RAVA 5CSGA 1MCIA 1MUJA 4PJ9B 4PYHA 5FO2A 3ZKNC 3BD3A 3BDYH 3DX7B 2ZTBA 4FXKC 1J1OH 1TJXA 3K80A 5IBTL 2EIEA 3P9LA 1KIUA 4KK6D 2ZOOA 2A6IA 3NCJH 1HHGB 3OB0K 4OZHF 4XX1E 5F9WB 3Q1SH 2YXWA 1OT2A 4OKVA 5GQBA 2MCPH 5ITBL 1Q9LA 2JB6A 3MRGA 1GS8A 1U3HB 3QAZB 4LFHD 2D31B 1JFQH 2V7HB 4WU7A 5CS7A 4ELMA 4LKCA 3N40F 2EDHA 1I1CA 4BDVB 1FFRA 2XVKA 3D3VA 4Q97A 3SBWC 3V4LA 1L6PA 2C9QA 1S7SA 2Y4SA 4LPWA 4ETQA 4LRNL 4L1DA 2IDSA 2EH7L 2H45A 5A6MA 2WZ6A 1PAMA 3A21A 5E4EC 3BHBA 5C3TA 4LHQB 5AW6B 3B2VH 4TQPA 1VHPA 5CCGE 2Z31C 1PZ5B 4P04A 4XBMA 2ZUVA 1CL7H 5HYEA 2Q76B 4KZCA 4TSAL 2LU5A 2Q3AA 5TDNA 5K59F 4N0YL 4U33A 4X42A 3EYUL 5IF0B 1AZVA 3BWAA 3N55A 3IMUA 3O3UN 4NHUB 3JBG7 4OZHB 4FQ2H 4L5FL 4Y2DB 2Y7SA 3TNMA 2CHNA 2NQDA 2I60H 3RWIA 1BBJA 4KI5E 2HXAA 5EFIA 3BP4B 3I75A 5IHUL 3VGBA 2CKNA 4OZFG 1NGPL 3UTTE 3GBML 3ZRFC 3VRJA 1AE6H 2WBJC 3IF1A 5LUMA 3E2HC 4EZJA 3CFEA 1HEZB 2F5AL 2C9PA 1IBGH 4TQHA 4PBDA 4GSDH 3CLFL 3D4ZA 1EWHA 2QSCH 1ZSHA 3LZQA 4DETA 3IU3B 2LFEA 3VVWA 3AWFA 2VJ0A 5K9QI 3QEHB 3NJGA 3II1A 3DJZA 3PG2A 3BH9B 5BRZD 3NJIA 1NEUA 4XB3A 4Z7NE 4MQ7B 4QRPB 3CFDA 5BS0B 4MAYC 2ENJA 4LPYA 1IAIH 2GI7A 2NYYD 1A6AA 3VI4A 1I1AC 3MJ7B 4RGNC 2F74A 5TQ2L 1NOAA 2DQGH 1CE1H 1OQOA 3AU0A 4MB1A 4OZGF 1A66A 2XYCA 3VGEA 2VXSL 5F97E 3VD2A 1DVFC 1T1ZB 2X05A 1CFNA 1L0YA 4OVVA 3K91A 1CIUA 3U25A 1LE5B 1JGLL 5DD6B 1BA9A 5K9KB 3OLDA 1YQVH 3L7FA 3T4YB 1NGYA 2EVGA 4U05A 4GW4A 3QEQA 3F7YB 1IL1B 4QNPF 4UQIM 2FX9L 3TL5A 1SJMA 4ZUTB 4AT6B 4RNRB 4H0GA 4WWKD 5EU5A 4WHDA 4YX2H 3HAEB 4JFXA 1D5MB 5IB4A 4LZKA 5F0JB 4GMSH 1RZ8A 5FA3A 2WTPA 1MEXH 3FU8A 4U31A 3HN8A 4NO2B 3HG1D 3H7LA 1ITBB 3D12B 1KMGA 4DGUA 3FQTA 4MZIA 3MBXL 5MENB 3FQTB 3O8XD 4RQQA 3AMKA 1P7QB 4LE8A 4P5KB 3OKDB 5ISZD 4Z7QE 5AALA 2AJVH 3QJTB 4QYOA 4TQ8A 5JPNA 3M45A 5CF3A 3QEHA 2Q6WA 2AXFA 2RR3A 3SGEI 4NQED 1QKZL 2VNCA 4IK6A 4NC2B 2XWXA 3CVHB 3WN6A 2JJSC 1ZANL 5KS9F 5A16A 1G7LA 2VW7A 4MA8H 5D5MB 1JZEA 4P2OA 4ZUSB 3WHE0 2P8MA 3JWNH 4JJHA 5PCYA 4HK3N 4OGAD 3FTGB 3IYLW 3ECUA 1I82A 2VLKD 4MXQD 3PWJB 2D7NA 1JDDA 2HFFB 3UG3A 1IC0A 2EABA 1Q72L 2VZSA 1PLCA 4QNPE 1S7XB 5DT1L 1OTTD 3KPQB 1NLBH 5IW6A 1MN4A 4Z8FH 4O58L 2UXGA 4TNFA 3VD1A 4C54A 5I76B 2EUXA 2ERJB 2X7LA 2OW7A 3SDCD 3NK3A 5DDHB 4B3EA 5I16A 1P5UC 2AZUA 2CJTA 1NBVH 5LHDA 2YD1A 2YAPA 4OCYL 5C0DB 5DQ9B 1UYWL 3MXVH 3AXLA 5AVWB 4AENB 2Q3XA 4GW5A 1UT1A 2JNZA 3S3BB 1ZIAA 2O61B 1W0VB 3Q2NA 4PY7A 2F5BH 1HHKB 4HALA 1HL5A 2FJUB 4LFHG 3WYRA 4GOSA 3RDTD 2DI9A 4KZDL 2GK2A 2D7QA 1Q0EA 1XL6A 2JJTC 2MCPL 3VB8A 1DJWA 4H5SB 4QLWA 5I6OA 5KS9E 1L0XA 3LDBC 4YDVB 2XQYA 5F96L 2R0ZH 5JHLA 2VAAA 1OAKL 1X6NA 4K94L 3AT8A 4YHYC 4FQ1H 5BRQA 1U2CA 5MEQA 3VFVA 3G04A 4QI3A 1RU9L 2FECI 3Q13A 3U9PH 3VG0L 4KKBC 3QDGB 4FMVA 4X98B 4BFIB 3QQNA 4YR6A 3V9FA 4FA8A 3CH1B 5IOPA 3VO0A 1LO2H 5KVFE 2VMCA 5AVZB 1XGQA 5D2NC 4B41A 2YRLA 3NZSA 3MGAA 4LBEA 1GY2A 4XR8C 1MHEA 4MMXB 3ZGHA 4KNTA 4JDVA 1ZHLA 2MTPA 3WY2A 2Z8WC 3NIGE 3IDMA 2GSGA 3LD8B 4N20A 2ODIA 2X09A 5SX5K 4XZUA 4KUZH 5DYOA 4YGVA 4Y16D 4BQ6A 3H9SB 2GCYB 4ALAH 2IADA 4N2LA 5BNXD 4J12A 2Y06L 4KX8A 1T5KA 3W56A 5I8EA 1IU1A 1BOYA 5DJ2A 4I1NB 4LCWD 5D1ZC 3H2QA 4WV1B 5A3IC 3MV8B 5KSBE 4HFWA 1F1GA 3QDJD 4PR5A 4M48L 2ATAA 4MDRA 5D7KD 4OGXL 4JZJA 4K2UL 3S37H 2NW2B 4PRHD 3CU7A 3PPEA 5HPOA 5J8OA 4HCGA 4KO5A 1FZOA 2G60L 3CZLA 1YNKH 4MXQC 4QT5A 1LDPL 4NENB 3TP4A 3BW9A 3FQ2A 3FRPB 5I2IA 2TSBA 4KTGA 4PRID 2WINB 1J0KA 2P7TB 5BPPA 5HYSB 5CZVH 2ADJB 4E41B 3DVNA 5F7DA 1ONQB 1WAAF 1J1PH 3Q44A 1RD6A 4JFVA 1NAML 3LZPA 1VEMA 3FRUA 2UZIL 1AXTL 2OL3B 3OPZL 3BSZH 5EH1A 1K9TA 1I8LA 5AWNL 3PABB 5DJAA 1FVCB 3WNOA 5FCUL 3V6ZA 3RB7A 4WJG3 3X13B 2QMKA 3FDWA 3GXPA 3DHMA 1JGVH 3NESA 3VTAA 3O6FA 4A6YA 4JJ5A 2P24B 1JF6A 3BAKA 2WYHA 4PJ7A 1CFSB 1G5GA 4J3UA 1TTGA 1F13A 2IFFL 1MIMH 1MSPA 4JFFD 3RU8L 3K72A 5E03A 4HXBL 3CZJA 4XAKD 3HPLA 3J07A 2KZWA 3LHAA 5AOMA 1DUYB 2CO7B 3BUDA 3O6ML 4JY5H 1I7UB 4QRSA 1L9OA 4HUMB 2KQNA 4R0LC 3VFSB 5EO9A 3EJCA 5DI8B 4NM8L 1QRNA 1W91A 4YLBA 3AG3B 1B0RA 2VDOH 1BQUA 3VYNA 3TBYB 5EN3A 5IJVA 4ORGA 3RJQB 4DUWA 3OG6B 4ENEC 1JWMA 5G55A 1IMHC 3D5OF 4YHNB 4NBZB 1WZMA 3WKQA 4R8WL 2OMXA 3MUGB 1ZHKA 1HL9A 3MRDB 1UH3A 4XBPB 4NQEA 4F1SA 4FNPA 2WLHA 1JV2B 1OOWA 3HS0B 5E2JA 4D94A 3P9WB 3B1TA 2VJ8A 5ICYB 1A22B 3IDYC 4RZKA 4QTHA 4YXKL 1SMOA 1H3VA 2GQHA 2JJVA 2X4OA 4JKPH 3EFDH 1A4JB 2WLNA 2FB4L 4KQ0A 5EEXA 2DQTL 1F5WA 2XN9D 5A2BA 3QK0A 1P5VB 1A6UL 3O45A 4WEBH 3L16A 3C8DA 2EEAA 2O5ZL 4GT7A 5FWRA 1W72L 1XMWA 4GSUA 4LHUG 1ZXKA 1GS6X 5HVHB 3WN5C 1ZWIB 3QCTH 2FATH 2AK4E 1R5WA 1EZVX 4LMQI 4O5LL 4QTFA 3S4SB 3VWJB 5CEZD 5GRXG 1CFMA 2R0WL 3RPBA 1FJ1A 1CFVL 3CFNA 3VWKA 5LNGA 2BY2A 4H20L 1WVZA 2CO6B 4JANB 3UFIA 4G8FA 1H8NA 2OAAA 5B4MD 4HZ1A 3UMTA 2ZF8A 1KXHA 2FX7H 4J28A 2FSDA 2HRPH 3ILDA 4QJ5B 2W07B 1WZAA 4NNYA 3SPVA 4H88H 2W07A 4LARL 1MFAH 1ZVSA 1AKJA 3TBWA 1F00I 1L7TH 1FV1A 4YN3A 2X0WA 3TZVB 3BQUB 4AC4A 4Z7QB 2F58H 3QULA 1WBXA 4LGRB 3N06B 3LPFA 4XB8A 5I6XB 1SBBA 3BEWB 3TA3A 3F04A 5J13C 1S7QB 2IH3B 3FK3A 1M3IA 1VRSA 3P4MA 4UZUA 2RALA 4ODUA 2NZ9C 5DHVB 2N7SA 5DJCA 3RVXC 3KGTA 2FJFB 2H5UA 4JPIB 3V0AC 5EDSA 2YC1B 5E4EB 5IQ7L 3TBSB 5DTFA 4Y5VA 1P4UA 4WW2C 4NP9A 2BSRA 4JRWA 2EO7A 3FB6A 1HZHH 5E56A 2WCSA 2X4QB 1X5IA 3IJEA 5I1KH 3DX6A 4PBVC 3VDBA 3BGFC 1HQ4B 3LQMA 5EOTB 3GRGA 3X12A 3UC2A 4AM0B 2W9DL 1BVKB 1L9SA 3UBHA 3W1ZA 1GJIA 2WYTA 5I1HL 4X0KB 5BOZG 5KVEH 5L9DL 4PHXA 2ZUUA 4N0UE 3ZDXE 4P3WA 2B14A 7FABL 3PV7A 1U3YA 2IJ0C 4E42A 2ESVA 4UYQA 2APTA 3ZIMA 3IDYB 4N1HB 3HAEG 4LL4A 1AR1D 1FLRL 1WIOA 5ABAA 1DJZA 5GGTL 5T3XE 2VXQH 3EYQD 2KZ1B 1OAUL 4IOFC 1B88A 1EDHA 1OAQL 4JB9L 5I82A 1AKPA 4LNVA 3GEWB 1FE8H 4AYEC 3QDGD 2OTWB 3T2LA 2KPNA 1U58A 2I07A 4R7NB 1JPEA 4E0RA 1TEFA 4NO5B 1EJFA 4GLRH 4GXUN 4CVUA 5A6LA 4LSDA 5FLVA 1K8DB 4P4KC 3N9GL 3ARED 2DJMA 1FFPB 4FKKA 4G7YH 1KYAA 5IFHH 3QP3A 2OI9C 4FFZA 3EYFA 3LEYL 4K9EL 4ODUB 1T83C 5MI0B 3EBGA 2VN7A 5KS9B 5A40E 4KZEH 2ZSWA 1NDGA 4YIQA 1BF5A 5LLIC 4K5NA 5J89A 5JO5B 4ZD3L 1N6VA 3FB8A 4G9FD 2CK0L 3ORJA 4AW7A 2ZOLA 1R1CA 1VEPA 2C1PB 3DOHA 3TN0C 1KG0A 2HFFA 4FQJL 2FWLB 1U8MB 2FX7L 2UUDH 2ED6A 3CVCA 3IFPA 3UBGA 5FWQA 4XPHH 2O30A 2ZF9A 4HPOH 3H3PL 4XMVA 1G7PA 1YNTA 3EAKA 4GKOA 3DXAE 3HA0A 2EEXA 1EFXD 3RPIB 1RIHL 3UZQA 1XTMA 2EIZA 2VLRE 3OAUL 4KXCA 2WXGA 3IWVA 3BZEA 4RZCB 5INCA 1KTDB 4PJBE 3UJIH 1MVUA 2X2JA 1T7XA 1IE5A 1D5XA 1PMYA 1XGRB 25C8L 2NNAA 3QZWA 5CEYB 2QR0A 5H94B 2VQ1A 3QDMD 3IB4A 4K7PX 1JPFB 2E9IA 1XB8A 4LSTH 3PUCA 3PWPB 3C9NB 4AJ0A 1KV7A 2P49B 1YEJH 3MRCA 1OL0A 3Q06A 1AVAA 3FHEA 3QCVH 1CXHA 4IIZA 5DD5L 3K1DA 1GCFA 2EKJA 4BE5A 1U33A 2JLPA 2EO9A 1D7DA 4M7ZB 4UILH 3K8MA 3SYPA 3MLPA 4QXVA 3ROOB 2H7WA 4QRRE 2OR8A 3U6RA 2ZAIA 2IGFL 4PGCA 4LLAA 5FS5A 3QG6B 2P8PA 4E2OA 3WIHA 4WTZG 4DP0X 2QHLA 2A0LC 2X28A 5FV2A 4FHKA 1DBKL 1QPPA 1TJGL 2ATKA 4B27A 1QRND 4KH9A 3K0YA 3KL0A 4P23A 2XPGB 3QJHA 4HOWA 1SVBA 5F3BB 3UTQB 1F11A 4AH2B 2VDOL 4YNYA 4EEEA 2XPZA 2X6BA 1EAQA 2JJUA 1TZAA 1D9KC 3FFDB 3VXUD 5JR1L 3FQNB 5IVZA 5E99L 5EU3A 2N01B 4TLTA 1SDDB 2BVUA 3BKYH 5HPMB 4OAWB 4I9WE 2HFEA 3MGTA 3K74B 4FLOA 5C07B 5FFGA 3VXRE 1EJOL 1DO6A 3QUXD 3IKCA 9CGTA 3T0WA 2Z4QA 2XBZA 4ABWA 3FU7B 4W1TA 3BEVB 4QOKD 2RD0A 2DLEA 2WXHA 2B77A 3IGUA 4A2EA 1GZHC 3OF6A 1NIAA 1GW0A 1VADA 1Z7JA 4MA1C 4ONHA 4HIXL 4LSQL 4F2ME 1FNHA 2WIIB 3TT1L 1KJVA 5IEKA 4MZ2A 4IDJH 4MKTA 1OP3H 2W0FA 5B7MA 1ZLSL 4QRTB 1EVTC 1FO0A 5AL8A 5D1ZD 4AGOA 3DUUB 2DQMA 1B0IA 3C60C 1W0VA 4HGMA 4NQDE 3BE1H 4JS7A 4NZRH 2O6DA 5PAZA 5GS0C 2DH2A 2ADIA 2NY7H 1ZKAA 5DQ9A 2ENYA 2HVJA 3KEDA 4F57H 4ZAKC 4PJ5E 3OAYK 4ZXBC 4Z76A 2AV1B 1NBCA 2BIMA 2I32A 4A67A 5EUOA 5I2IB 5J6HB 1Q9WB 2JKXA 4FKEA 2YD4A 4MD4A 1DSYA 1T0MA 2GJ6D 2HLFD 3ZZLA 2HT3C 1RK1B 2W0LA 1YA5A 3IT8D 3O0RL 4KH2A 5CN3A 5GRUH 2BSSB 1NAKH 1M6OA 2FJGA 3QDME 4HXAL 1CLZL 1I3GL 4Y4FB 5TF1H 5B39A 3CU1A 3UPRA 4FRWA 4LHUD 3RWGA 1BCIA 3RA7L 4OUUB 1A4CA 5AFAA 1TYEB 2VDPB 4PS4L 5JXEC 4TQIA 1SJXA 2Q87A 1M3JA 4QYAA 4JDTL 1RUAL 5JW4M 3D85D 1F45A 4PWHA 4X6FA 3QXDB 5E8OA 5I30H 4OKVB 1TQCC 2AV7B 1GYAA 2FD6H 2ZNXA 1MCJA 5HHME 3I9AA 1BXAA 1FNSH 4N9OB 5C3IA 2A6KA 2WBXA 1N6QL 3ZHLA 3CXFA 3GI8H 4WJKB 4RGOL 1Q1JH 5KZCD 3NVQA 7CGTA 4OCRL 1A2YB 3THMH 5IGXL 4P5TA 3C8KB 3NIFF 3H3KA 4U7KA 3B1UA 4EIZC 5AENA 4QHUA 3A4DA 3VFWB 1NGZB 3ZKSD 2ZJSL 3HFMH 4KMQA 5E4IA 1XV8A 3RFZA 1KJMB 2YA1A 4KRMB 5FDWA 1IO4C 1YEGL 2EDOA 3V5HA 5C0BA 3FQWB 2ZKMX 4R90L 1LEIA 1U4EA 5MHSD 1SLWA 5TFSH 4OLYH 5T1KA 2LABA 5EUOE 3NTCL 5EZLB 1DUZA 5DS8A 3UTTD 1EJOH 1GPOH 4N9GA 1ICTA 1HOCA 3ZKQD 3ABKB 4FQXD 1JZHA 3MV8D 4X99B 1T21B 3AREA 3JVGC 1KBWA 3INOA 1TPXB 2VXTL 1UG9A 2OLDA 1KXQE 2E4FA 1RK1A 1BJ1H 5LAXB 4P9MH 5E99H 2M1KA 1FDLL 4KJQC 5MP6L 3AW5A 3D06A 1JV2A 3HS0A 3ISYA 5GRJL 4J6RH 3N2JA 1OCZB 3FNKA 2WBJB 4BUGA 1YAIA 2XJKA 1BFVH 1U91A 1ACCA 3MXVL 1S3KL 5KUKA 5C0RH 3BJLA 4IRJA 5IBLD 4ELMB 5CBAA 3GSUA 3JWNE 2C8NA 3D0VA 4TUJA 4NUJB 1CD1B 5IG7A 4K5PA 1BD2E 2CLRB 4PJXA 4S1RL 4A1RA 4LSPH 5AL0A 5FHBL 5ECJE 4ICWA 1F8TL 4Y2NA 5F1SA 3IXAB 2DQ6A 3WXVL 1VZIA 4KKBD 1DFBL 2HJKB 5IVXA 1TKWB 4KKZA 1ZLSH 2W0KA 4ZPVB 3M8OL 4M8QA 2AEWA 4R96B 4DKEH 1G6RB 3R8BB 5EO1A 4QHUB 1U8PA 3P4NA 5ITFB 3QR0A 3KPNB 4RX4A 1YDPA 4G9DB 1KGCD 2X4SA 5DWUL 1ZGLA 4FQCL 4G5ZH 5EC2A 1IAOA 3V5HB 4G42B 4L8SA 1BBJB 4MJID 2DM7A 1TJMA 2QQNL 2XSKA 5D9SB 2IVFC 2KKQA 4UINL 5IMOA 2FL5A 1QKZH 3TONA 1WBXB 4IJTA 4DGWC 2DQIH 2VZVA 3CFEB 3KCWA 4YDKH 5MENA 1ZJAA 3H0TB 1CF8L 3DI3B 3OC5A 4S1SH 3ZZSA 3UJJL 4WO4D 3MHZA 2IMMA 1HILB 4OF7A 2F8OA 1MI5A 3N43B 1K85A 3C5ZC 5HDLA 1U91B 2GBTA 4QXUH 1P4IL 3I3BA 3S7GA 1G6RH 2Z7UA 2ZPKL 4ZAKB 2NT0A 3BX7C 3CSYB 4RFEA 2MPAL 2HKAA 4U1MA 3FB6B 5HSFA 4JCWA 4BK4A 5I6MA 3FFCA 3GSUB 5IFHL 4WU7B 1SHMA 2HG5A 4IRZL 3CD4A 4OLZH 4U1KA 4W9IC 4L0YA 1NCWH 1E0OB 2J73A 3V0VA 1OW0A 3QUXA 5EBLA 1BZDA 4N2CA 4QRUA 3SDXB 4LT7A 4U6HA 4G8IB 3QUXB 5EBLB 3ZDYE 1TYJA 4N86A 4PJBB 3WEOA 3FL7A 5DEGB 4GUQA 4PJ9D 5TDOB 3WLWD 3QARA 3I6SA 4AYSA 1TVBA 5DRXA 3ZYZA 1NGYB 4WRLA 4P2YA 2JCCA 4YVUA 1TVBB 3HLAA 1JGLH 5CR8A 1BHGA 1JZFA 1HSAA 2OK0H 3IVKA 1MAKA 1RZQA 5LKNA 1FIEA 1IILE 3D18A 4UM8B 4DZBA 3UJIL 2EDKA 1RIVH 2QMJA 3WS6A 1IBYA 2ZCKH 5I1HH 3ARGC 5CP7A 2R69A 3QH3A 3BUYA 3MV9B 2X4RA 5I24A 4PV9B 1A6WL 4JFQB 3PGDA 2EYTB 4OIFA 3ULSB 5KBDA 3FU9A 1PTZA 3L4TA 2OSWA 2J12B 4F24A 2A2QT 2AXWA 2EAEA 3VD9A 2AGJH 4NHCH 3MBEC 5AZEL 2WNGA 1IBGL 4P59H 3NQIA 2IWFA 1TIUA 1O7VA 4X8GA 2J5LB 3WFHB 5DK2A 3EYFB 2BRRH 4WWKA 3DK0A 5I6NA 5E95B 4Z7WB 3HI1A 5LGKA 3U4AA 4HS8L 2PPAA 1KN2L 3CFDB 4WCYH 3PLYA 4H8WC 3IFNH 3HBQA 4XO9A 3WIAA 2ZCHH 4UBDC 4H25B 5DMKB 3QUZA 1IBFA 5C07E 1FH2A 1YPZE 2MSPA 4YDMA 2VSKB 1X7QB 1ECYA 1EPFA 3LZOA 4KK6C 4S1QH 1MLCB 2VLRA 4U2ZA 1QSED 5L2KB 2SODB 3QZMA 4Q58C 1HKLL 4XPTL 4XHQA 1KT2A 1LK2B 1MCHA 4YWGH 2ARJA 2GTZB 3WL9A 3L1EA 2QPEB 3QUMB 1FN4A 3AS2A 3GXFA 3GLEA 1NEZB 4MHHI 1KWGA 2HCZX 2A9NL 1DVQA 3DUUA 1N67A 5F44A 2EIMB 5DHDA 3S5LB 4KMTH 4C57C 3DX9A 5I75C 2ENPA 5I15H 4XPAH 4OQTA 2BHUA 2ICCA 5SWQB 3LKPA 1CWVA 1JI2A 1T83A 3GKWH 4WUUE 3MNMA 1A6UH 3E8UL 3N42F 5SWSB 1LE9A 3SOBL 1XHHA 3ZE2E 2QKSA 3NJNA 1YEDA 1OIOA 4DF9A 1SHXA 2Y2WA 1EMTH 5HYFA 1P5UA 3CFQA 3AUVA 4FQXA 3MV8A 1PLAA 2E56A 2NY4C 2AQ2A 3IK2A 1CPUA 1L6XA 1Y1UA 5J11C 5IMLA 2AAVA 2I5YL 2HMID 3CDGB 4JDZA 1EA9C 1HT6A 2GJ6B 3HRZC 2AAAA 1G7LB 2OI9B 1EX0A 4E9QA 3SDCA 5L2JA 4J7RA 4KK9D 1AR1B 1DQKA 3BO8B 4MJ5B 5EWIL 4AQOA 1ZLUK 4NUGL 1WICA 1FIGH 5HGGS 1V3LA 4HHAB 3MV7A 3G6JF 3PY9A 4MMXC 4HWEH 2YBRB 4KJWD 3U1SH 2R0LL 4AV5A 3FS9A 3D4GA 4WWNA 5AAMC 4DAGH 5AKRA 4QTIL 5E0QA 1IGML 4GQRA 4R5VA 3VXSB 1JK9B 1IKFL 1M1SA 4LEOA 1BM7A 1WBYA 2BK8A 1RUKH 1X9RA 2Z1KA 4MBRA 5DZAA 3VXNB 1MZZA 1F3DJ 3L3IA 1TNNA 5EU6A 4HJEA 1J48A 1MG3C 4BFFA 3DMMA 5SV3A 4CVZB 4F2MA 1BECA 3HHSB 4LEXH 2X1WL 2ZNWA 5T1LA 1O7SA 3ZE0B 4JE0A 4F8QA 3KLKA 3C08H 3UPCA 4UDTB 3LEXA 1H0DA 2VXVL 3QG6A 3GHEL 3ARXA 2O5ZH 3ZUCA 5CMAA 1RVFL 4F58L 1XR8A 4WO0A 4LSVH 3QI9A 3U48A 3KLQA 3LS4H 1FFTB 3QXTA 4AYGA 4GAJL 3REWA 3IE9A 4XWOC 4W9HC 3VVVA 1OT1A 1LNUB 2UZIH 3BPOB 1MRCH 1J8HE 4ZMLA 2LGNA 3H4HA 2FH8A 2IG2H 5DO2D 5FYJE 2FJGB 4E5XA 3UEQA 3K1KC 3CCHA 2FR4B 4FNLH 3TBYA 1XF3A 3VMPA 1F4YH 3T0EE 2AP2A 4WI7A 5EMYA 3NJXA 1SN5A 3O6KL 4OF3A 1OF0A 2E75C 1YNKL 3KCPB 4PLNC 1ZHKB 1E3FA 3N6YA 4NB7A 1IGFH 5IQMA 1CGUA 5IQOA 1WHPA 3CLEH 1P9MA 4D8PB 3FXIC 5H35A 3MYJA 4OR1A 3CSBA 1A4AA 1YN6B 4XPFH 3ZDWA 2DN7A 3W5NA 1WT5C 1DCLA 5CSZA 5CAYB 1JCVA 3QEGH 4JG1L 1ETZB 1ORQA 4PJEB 3E38A 4EDXA 1IM9D 5JW5B 2ESVE 3RDJA 1SXZA 4QRBA 3RURA 2OMWA 3LKSB 5H4YA 1MIML 4AIOA 2OJZH 1AQDA 5ETUB 3R8QA 2OBGA 3V4PH 2ARJQ 2F1AA 4FABL 4KHXL 3RFZB 4GBXC 1LP9F 4AW4A 1G7JA 5HHOA 1KGYE 1QLFA 4IBSA 4LU5L 3QORA 4L4VA 4KROC 1RHFA 1WFJA 5F7BA 1NPNA 4I13B 4GW1B 3BP4A 3ASWA 1LO2L 1RSFA 3MTRA 5KVEE 3ULVD 3TIDA 1N2RA 4Y5YC 3PQYB 1KBBA 1UXWB 3HS0C 3T8XB 2X4TA 1D9KA 5E8EA 3LQAH 4BZ1H 1YMMD 4XN5A 4IIQA 1N19A 3RGVA 3KS0H 3SQBA 3QEUB 3O2DL 4NPJA 3C75A 4BHUA 3CCHB 2APBA 4NENA 4Y8DC 3UO8B 3VDCA 4QTHB 3HC2A 3RGHA 5LWYL 5JMOC 2XCMC 4UIMA 1CD8A 1K2DA 1H9DA 3MLWL 4AEHL 3MRDA 1XR9B 4XBPA 3TVMC 5IW1A 1U92B 2WZAA 1IEBA 1YEWA 2L0DA 3VWJC 3C5ZD 1WWBX 2AXJA 4H1LA 5IK3B 5FO8A 5C0FA 3CDYA 4LLWB 1NFAA 1S7UB 1ZHBB 1GIGH 2G3ZA 3RVVC 3WE1A 1PPIA 3FB7A 3KAAA 3OJDA 2AK4A 3P40A 4HGKC 4CGUB 5F9WC 5ANMA 1Z6JT 4YHLL 4K5OA 4JFZL 3TEUA 4UM9A 3KYKL 3O4OB 1TVHB 1W0WA 2VLRD 3OX8A 1FGNH 1JXDA 2EH8H 3LKSA 1TZIA 3ECQA 3IJSB 1QFUH 3BXNB 1JNLH 3U2SB 2LR4A 4AK2A 4H44C 1GZPB 3EJQA 3MLRH 3K2IA 2H41A 2DTML 2VUYA 3SKUD 3QUML 4FFWC 1PZCA 4J3BA 5CGTA 4CU8A 1DLFL 4XCYA 5GS1A 2H8PA 1VPOL 2K8MA 3IETB 1NWOA 5IHWA 1HHHB 1VSCA 1R3HA 2NSMA 3ESMA 2XTJB 2DBLH 3QJFB 4FNTA 4NRXA 2I5YH 5TE6H 4L4TB 3IDJA 2YGOA 2ZXWB 3NJJA 4BBWA 4AMKH 1Q9KB 4J2XA 3DIFA 4JE4B 4ADJA 5KVFH 4UOZA 4R83A 3MCKB 2X9XA 4UAOC 1UEMA 1ADQA 3ZTNH 3VD0A 2CRIA 5AW9B 3N85H 4LPVA 3ME0B 4IHBA 5JW4N 1XF2A 1WE5A 1MNNA 4M1GL 1P4BL 1U9KA 1ZTXL 2YN5A 5F7DB 3WIFB 4XNXH 4U1SA 3S2CA 3QR2A 2C3GA 4UI2A 2F08A 4P9HL 5HGAB 1HXYB 3ASNB 2J8UB 2W92A 1AFVH 2VR8A 4PJXB 4AKOA 2PWDA 4M6AA 2FBJL 4RIRA 1JD9A 4HJGA 4HYTB 3CFJB 4I77L 1KCRH 5IROA 1DQJB 4IRJB 1TTRA 3GZQA 5HGBB 3L1GA 3B3IB 1DN0B 1RULH 5ISZB 5EOTA 3D8MA 1DN0A 4HUWB 1GGIH 4L2YA 1AHMA 4F37K 4ETQB 4UTAH 3RNQA 2QHRH 4FTDA 3TA3D 5T1JA 4HUKB 4ZFZA 3HZYA 4BCZA 5F1KC 2FTAA 2CSPA 2HVKB 4BK5A 1MFUA 2Y07L 2HWZL 4HCIA 3RUGA 1ZTXE 3NCYP 4XCYB 2IOOA 5T1LD 1ZLEA 3K72B 3G6JE 4E9LA 4NN7C 2Z93A 2NMSA 1A4KB 3IDXH 1HXMB 2F53A 2NQ3A 4CBPA 5JDJA 3C9NA 3V4UH 4JFHD 4JO2L 4IKNA 3CDCA 3FCTA 5E4AA 3ARBD 4HISA 4CC1A 2CWRA 3LDBB 1UWFA 4NHUA 1QQDA 3HE7A 1HHJA 3LNHA 3PYCA 4X4XA 1XDTT 1JRHH 1KLFB 4P59L 2BNRA 5F72S 3G6AB 5FX3A 1KGJA 4LK4A 3TZVA 3X3FL 2DF3A 4YHYB 4BFNA 3G9AB 2E9BA 1LO0H 3EJYD 3WFHA 4BZ1A 4JFEA 1Z9SB 2GABA 3I84A 1JPSL 3SDAA 1T3FA 3KYKH 3WGUB 1ZANH 3E1F1 5DD1L 5KYWA 3FO9A 2AJYL 1JN6B 1COBA 5FYLH 5D6DC 3NSDA 2JI2A 2J21A 3QCTL 4HIHA 3VH8B 3QDGA 2UUDK 4BK5C 3D69B 5JNYB 1HNYA 2EDLA 1RPKA 5D96C 3D6GA 4DHLA 4ODXB 4MCYA 5B1CA 2RA1A 1UD5A 2QADB 1IGIL 4YS4A 4S0SD 2HKFL 4XNYL 3NN8B 4OV6F 3V0VB 5L0QC 2BNQD 3KMDA 3T3MF 4IBZA 4YXKH 4GUOA 1GXEA 3QZWB 3GNMH 2F9BT 4XE0A 4DQOH 2V2XA 1C1EL 2GJPA 4JAMB 5BO0D 1S4IA 4JO3L 4U0RC 5C70A 4ODVL 3S5LA 3LNGA 5FA3B 5EN2A 5DDHA 35C8H 3NJMA 2CM5A 4ZT1A 2R23B 1NEZA 4K7FB 4JFPB 2ICEC 4NM4H 1LDSA 2LOEA 3EGSB 3VTTA 3VGFA 3U0TA 2CUMA 2EJ1A 3T2OA 2DQDH 3WEBA 2FBJH 1NUDA 2EXWC 3RWCB 1E7UA 3KVPA 3VFPB 2A4CA 3LEVL 2YBGA 3BI9X 2NPLX 2VXTH 4H1LG 1UD2A 1LK3H 2Z35B 4D8OA 1V54B 1HYRC 2AEIT 5D6CA 5KYWB 1ED3B 2AXHA 1AZZC 3R18A 1A6AB 3X17A 1O9ZA 2HTKD 4WK4B 5FYKU 3HHRB 3OKKA 4PV1C 3VXPA 1ASOA 4OLYL 5D5MA 4EAEA 1T7ZA 1NFIA 2HRGA 4W93A 3GSRA 5FA4B 3CDGA 3WTSA 1QD0A 3IMBA 3AMLA 4AMXA 4LPXA 3TYGH 5ALBL 3S5LG 4BFIA 3QCUL 4DP4X 3T77B 5DMIH 3V7AG 4AC2A 1JNHB 1TXKA 4IMLA 3V6ZB 4NWTL 4G2AA 1XL4A 4R4ND 5AB9A 1A7RH 1MJ8H 4A7VA 4TOYH 4PJ7E 1WA2X 1VPOH 1BDYA 4O02A 2DWEB 4MA3A 2PWFA 3NIGF 3LZFH 1J7VR 1KJ2L 1AGCA 1CZ8H 1RFDL 1UURA 2NX5E 2D7TL 4QRPD 4B9FA 1PQZA 2YKLL 2VDMH 1TEYA 3AB0C 2WVVA 4NZUH 2VDQB 3F6JA 2ZT9C 1CGWA 5GZNC 4YH6A 4JDTH 1C12A 3JT2A 1MW2A 2HLEB 4NFDA 2XU9A 4MX7B 3TO4D 4B0MB 4Z7VA 2G60H 3QI9B 5EUOF 3VFTA 5G5DB 4FTVE 5CMAB 4XMXA 4J6RL 2AABH 3EGSA 3U6RB 1Z5LB 1I3UA 3PV6A 3VQMA 5TF1L 1M56B 4HGWA 4PG9B 4EUPH 1BVNP 4ONOA 3NA9H 5KBPA 4P9ML 5BO1H 1WFIA 3FH7A 4JFSA 4M9OA 3IDIA 4NRZB 5JPMB 1KEMH 1H5BB 3BP5A 1Z3GH 4APQA 4DVBB 5B7EA 3K5RA 2I24N 3HN3A 4J23A 4Z7UE 4YSPA 3LRSB 4D3CL 4NKDA 5C97A 3F7VB 3BW9B 1KENH 4M02A 1H8LA 4M3JA 4OW6A 2W1NA 3GS0A 15C8H 2LW3A 2MIZA 1RZJL 4JDZB 3RZCC 5D1ZA 3KR3H 2LVEA 1TQWA 5ALCL 2VLLB 3B2DC 3LQAL 3LPWA 2IDFA 3KD4A 1OAXH 1A7RL 1MJ8L 3GUFA 5DUBA 3D2UA 3VRIB 43CAB 5EEUA 4LDOB 4CMHC 3UBXI 4OCRH 3O41B 1DTUA 1H9VA 2IH9A 3JV4B 4RGOH 2C4FU 1WGOA 2AV7A 3GSNB 3KWVA 3LXAA 5BMFL 2MH4A 4A7QA 4C4KT 4JK0D 1BV8A 4YGAB 3MREA 4HP5A 1R5WB 3IDMB 3IBEA 4NPYA 3A3YB 3BZ4A 3FONB 4LSUH 5KOVC 4AXWA 2OJZL 4C56E 3GI9H 3CX2A 4YBHA 3HPLB 3MLTB 4TTDC 3GQFA 2VR9A 2FWUA 3HRZA 5F88B 1JYNA 4ZMWA 1JXKA 2A74C 4OZHE 5F1IB 5KJRL 3WUWB 4N85A 4Z7AA 4K0OA 4FQXC 3LH9A 4K9EC 1ZV5A 2XTJE 3HRPA 5F0LB 4AL8C 2AERT 5D93B 4L4TE 3LKRA 5ADPH 1AC6A 3MACH 1GHFL 5L4IA 1QEXA 2CHZA 4RRPM 2GJRA 3B56A 3L5IA 1JWMB 4KBPA 3C2AH 4ZFOA 1K2DB 1KEGH 5I74C 1E90A 4X5XB 2CGYA 4U7SA 5CCHE 1NBYA 4LASH 4PJCE 4BZ2A 4BZYA 3WEXA 3B9KB 5BS0E 3P9LB 2NDFA 3D3VB 4NT6A 4Z8FL 3SDDD 1BD2A 2IAMA 4PJXE 2A9MH 1BVZA 2K1MA 5K9JH 4HBCH 3IJEB 4J3OD 4M62H 3L8QA 3SHSA 5ID0A 2BY0A 4CRPA 1FFNB 2X1XR 2E47A 4GO9A 4GKSB 4KVPA 4YDLB