1OOWA

The crystal structure of the spinach plastocyanin double mutant g8d/l12e gives insight into its low reactivity towards photosystem 1 and cytochrome f
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'VEVLLGGDDGSEAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
molecule tags Electron transport, membrane
source organism Spinacia oleracea
publication title The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f.
pubmed doi rcsb
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oowA00
1AZCA 4RH4A 2XV3A 1ZV2A 4KOCA 5I28A 1TEFA 3L45A 2E86A 2I7OA 3RYMA 2R7EA 2HX9A 3NSDA 3UAEA 4QLWA 1WA0X 1HFUA 2FT7A 3OQRA 3NJIA 4HAKA 2BHFA 3UAAA 1GR7A 1ADWA 3CG8A 4K9JA 1X9RA 2IDSA 2UXFA 1GY2A 4JHVA 5EHFA 4HALA 1JVLA 1IKOP 1GS7A 1OE3A 5F7BA 4HHWA 5TK2A 1ZIAA 5B1BB 2DYSB 1KDJA 5AFAA 1AOZA 1J9TA 2B08A 1BQKA 2CBPA 4A2DA 3H4HA 4G7SB 3UACA 3NJNA 4ENZA 4TXVB 4NB7A 4DP5X 2YQBA 3NJMA 1AAJA 4E9TA 1YLBB 2FQDA 1AS7A 1TU2A 1NINA 1BEXA 2EIMB 2EILB 5D4JA 3WI9A 2YXWA 1AACA 2QDVA 2OCCB 2IDUA 1BYOA 2UXVA 1SHWA 3QQXA 3OMNB 2GC4C 1BXAA 4YVNA 3BVDB 1T5KA 3OMIB 1AQ8A 3FQYA 2HXAA 4WKXA 4E9WA 3UABA 2XV0A 4UAHA 4M3HA 2GI0A 2PPAA 1V10A 4KNUA 1ET7A 1UATA 2H3XC 2Q5BA 2AZUA 3EH4B 4E9QA 3ZBMA 1E30A 1NWPA 3ASOB 3FQ1A 3S3CB 1KBWA 1SFHA 1AR1B 1B3IA 3HB3B 3ABLB 2IDTA 4GY4A 2PP7A 1N68A 1KBVA 2I7SA 3FYEB 3X1NA 1OE1A 1ZDSA 5I5JA 3NJJA 3G5WA 1SF5A 1NIEA 4BWWA 3FSVA 4KO9A 2GHZA 1ZDQA 3T9WA 5I6KA 1SDDA 1GS8A 1GY1A 1CC3A 4G72B 3CDZB 3N55A 3NYKA 4AI7A 4HCIA 2YAQA 4KO5A 3UADA 4BXSV 2YAPA 4CSZA 1V54B 3QJUB 4BK5C 4N4YB 3NT0A 1DYZA 1AG6A 7PAZA 1GS6X 3PLYA 3WIAA 4MFHA 3T6WA 1NICA 1ZPUA 3PXLA 1PY0A 1PZBA 5B7EA 2WO3B 1ET8A 1BAWA 1XMEB 2UXGA 3NJFA 1GYCA 4A2FA 1BQ5A 2HLEB 2HZHA 1ID2A 3AG4B 7PCYA 4G70B 5A7EA 2IH9A 5TK4A 3DTUB 1J9SA 1SHXA 3ZDWA 5I5IA 1EZLA 2JFCA 4A66A 1L9SA 2FQEA 2HRGA 2YAEA 5I5MA 4KO6A 4N8UA 2XU9A 1L9RA 3OM3B 3IBOA 1TEGA 1L9PA 3TASA 5I6NA 3PAVA 2J55A 3FS9A 1PMYA 5I26A 4F2FA 1NTDA 5I6OA 4DP7X 2BZCA 2Q9OA 4DPCX 3DKHA 1MZZA 5B1JA 1RZQA 3JTBA 3CDZA 1SF3A 3FSZA 3NJGA 3FPYA 1CYXA 4E9VA 2IWEA 2IDQA 1ASPA 3EF4A 1PZCA 5E9NA 3NSCA 1WS8A 2VN3A 3NSFA 4YSQA 1OF0A 2AFNA 2X87A 2GBAA 4DP6X 2DV6A 2PP9A 1W6LA 2BP0B 4GYBA 3SBRA 2N0MA 5PCYA 1HAUA 4YSDA 4W1TA 2OJ1A 4DP1X 2MTAA 5D4IA 3HEIB 2PCYA 1M56B 3FQ2A 3AY2A 2UX6A 2YXVA 4KNTA 2BO0A 4NAJA 1AS6A 1NWOA 4A68A 4P5SA 1L9OA 1J5DA 3WNIA 3ZIYA 4E9YA 1SJMA 4AZUA 2XXFA 3FU7A 4L0PB 5AKRA 3X1FA 1PAZA 1JVOA 2EIKB 2TSBA 3AG2B 3S8GB 3WNJA 2BW5A 4HIPA 1NIBA 1A4BA 3T6ZA 5B1AB 2X88A 2VM4A 2XV2A 2DYRB 4GP4B 2XXGA 2GIMA 2UXTA 3IE9A 4YSEA 2BP0A 3FPXA 4YSRA 1CURA 3S3DB 3SQRA 2XWZA 4G71B 1PNCA 2XX1A 3ERXA 4A2GA 2ZOOA 1VLXA 2P80A 2XLLA 3GXUB 4YSCA 1JOIA 4JHUA 4F7KA 3FSWA 2VMJA 4BDVA 2PLTA 2J5WA 4AKOA 4YSAA 1QLEB 3C75A 4A2EA 5AZUA 3CVCA 2DY2A 3D12B 4DP8X 4DP4X 4W9ZA 4AKPA 5B7MA 3H4FA 1PNDA 5I6PA 1WAEA 1BQRA 3CVBA 3QPKA 1KDIA 3NP3A 1MG3C 3X1GA 2HRHA 3MX0B 3X1EA 3TBCA 2H47C 4ZK8A 4NERA 1JXDA 2J57A 1ILUA 3PAUA 2FNWA 5B7FA 4DPBX 1JZGA 2Y1AA 1CUOA 2OV0A 3IN2A 1BYPA 1W6WA 2PP8A 2BP8B 5I6MA 1OOWA 1XB8A 2FT6A 2GB2A 2B3IA 3NJLA 5LDUA 2YAOA 2PPEA 3MBWB 2VW6A 4YVUA 5B1KA 3WG7B 5FC9A 2GSMB 4CSPA 4PAZA 2JXMA 3FU8A 1NPNA 4YSPA 4M4RB 4BWTA 1FA4A 1E5ZA 1AZRA 3QJQB 2AZAA 3S8FB 2VSKB 4PCYA 2WO2B 1URIA 2CAKA 2NRDA 2FQGA 2LLNA 2QPDB 2IAAC 2UX7A 4E9RA 2QPEB 1KCWA 1IUZA 3NJKA 4P5RA 3T6VA 4FAAB 3TA4D 2Y69B 1ASOA 1MG2C 2YAMA 1NPJA 2MRYA 1X9UA 2IH8A 1JXFA 2A3TA 2YAHA 3TBBA 2JKWA 1ET5A 3NP4A 1QHQA 4QKTA 4WTQA 2BW4A 1E5YA 1PCSA 2CALA 2FQFA 1W8EA 1A4CA 3AZUA 3CZUB 4BXVA 3S3BB 3DIVA 1MZYA 2AANA 9PCYA 2XX0A 1JXGA 2R7EB 1JZIA 1JZEA 1PLCA 2PPDA 1PLBA 2W8CA 1WA2X 4KNSA 1AIZA 1N70A 5I6LA 2CCWA 1KGYE 1OCRB 5B1JC 1M9WA 3PCYA 4AX3A 1OCOB 3EH3B 4A2HA 3QJTB 1J5CA 3N2JA 2FTAA 1XB6A 3QJSB 2H5UA 6PCYA 4FA7B 2VW4A 4G7QB 2XYBA 4YSOA 1KV7A 3CVDA 3PAZA 2GC7C 5F7AA 1JZFA 5D4HA 6PAZA 3FU7B 2WSDA 4KO7A 1KCBA 1GSKA 1AZUA 1ILSA 2PPFA 4UF7C 2QT6A 4G7RB 3ABMB 4UANA 4AKQA 3GDCA 1AG0A 1J9QA 2BWIA 4YL4A 5B3SB 4GP5B 4DPAX 2J56A 2BP8A 4Q89A 1HAWA 1NIDA 3WKQA 4F2EA 3BQVA 4HZ1A 1A8ZA 3V9CA 4EF3A 3AG1B 3OMAB 1GW0A 1AZBA 2ZONA 1XB3A 5PAZA 3EH5B 3H56A 2DWSA 4E9SA 1AZNA 3AW5A 4X4KA 1FWXA 1A65A 2I85A 2IDFA 4DP0X 1QNIA 1J9RA 4DP2X 1KYAA 3JT2A 1PF3A 1AANA 3X1BA 2EINB 1OCZB 1ZIBA 1OV8A 1OCCB 1WA1X 3ABGA 3QJVB 3X2QB 1A4AA 1ETJA 1NIFA 2W88A 2IWKA 1IC0A 1F56A 2P80D 3EHBB 3AG3B 4HCGA 4GXFA 2BZ7A 2TSAA 3U25A 1RCYA 1R1CA 2EIJB 3FSAA 1PLAA 4DP9X 2PPCA 1I53A 1JZJA 1IBYA 3NSYA 2CJ3A 2FT8A 2VW7A 3T71A 3TU6A 2VSMB 1L9TA 3KW8A 4JKNA 2YAFA 3QJRB 1SFDA 1JZHA 3IN0A 1WS7A 4HCFA 2ZWNA 3IEAA 1DZ0A 4YSTA 2ZXWB 4YSSA 2HX8A 2AVFA 1TKWA 3V9EA 2VM3A 3ZX1A 1IBZA 3FYIB 1JERA 2RACA 3FT0A 2DWTA 3GYRA 4GP8B 1EHKB 3T6XA 3PPSA 3WKPA 5IY5B 3ASNB 1CYWA 1MDAA 5ANHA 1ASQA 1A3ZA 1V55B 3KW7A 1E65A 1BXVA 4E9XA 4A67A 1FFTB 2HX7A 3UGEA 2XVBA 3SBQA 4BDVB 4YSUA 2BWDA 8PAZA 1BXUA 1SNRA 3FU9A 3NJHA 2FJSA 1RZPA 2YARA 1NZRA 1AS8A 2PCFA 1E67A 4Q8BA 2XUWA 3OD3A 1NIAA 4HHGA 2IWFA 1M57B 4BWUA 2CUAA 3SBPA 2QDWA 3ABKB 1RKRA 1SDDB 1NDTA 4KOBA 1PZAA 2FWLB 1OE2A 1L9QA
chains in the Genus database with same CATH superfamily
4J4PC 1QHPA 3WFEH 4D8PA 2WJ5A 3QVAA 3QC5X 4AJYV 5D5MB 3CVHL 2CJSA 4LCIH 4ZUSB 1KEGL 5C09D 4DKFH 3LZFL 2ADIA 3FT2B 4HG4J 1M2OA 3GRWH 4OLYH 2A1WH 4R7NA 2PW1B 1D9KD 3G3LA 3QFJD 1JK8B 3OKEA 1IKFL 1QKZL 1YVLA 2J7LA 4WKZB 2BVUA 4WHTB 1TETH 3N0PB 5BO1L 3FT9A 3W0WA 4BKLA 3WFZA 1YC7A 4HHWA 3MV8D 1INEH 1ZIAA 4H5SA 1TQCB 1QBBA 2F58H 2W91A 1R33A 2CDGA 5IHBA 3VI3B 3HC4L 2CBPA 2A6DB 3K46A 1KBPA 2H3NB 4XMVA 4AK1A 2EE0A 3LOWA 4OKDA 4YK4B 3FUDA 2Z35A 4XNAA 4G9FD 3F12A 3AREB 4M56A 3T4YB 1UHVA 1UQSB 2EILB 4XPFH 2VLRA 3BE1H 2A1WL 3MRNA 2G2PA 3GRWL 4OLYL 1XF4B 2DMBA 3OMNB 5AVXB 4EOWH 2PO6D 4GSRA 1AQ8A 2UZIH 5IK3A 2M8XA 2P3YA 5JW5A 5D70H 3AQDA 5BZDA 3CQPA 1KZYA 2CGYA 1E30A 5E4EC 3ASOB 1GTNA 2FECI 3CUPA 1KBWA 4JFDB 3TNMB 4NNXB 5IVZA 1I9IH 3HG1D 2ZWSA 1QYGL 5C0RH 5AVSB 4F7MB 3MSPA 4I9XA 4UMSA 4PW3A 4APQC 2APXA 2GJZB 1XR9A 3IS0X 4JE0A 1MLCB 4MKMA 3V6ZB 2A4CA 2G75B 3S5LA 2GBVA 4WWPA 2MKWA 3WMQA 4B60A 8FABA 3PQYE 4ZUTB 3CN1A 3DX6B 4U1HB 4WLCA 1Q0EA 1T03H 1MRCL 4JQIA 1ZD6A 4XNQA 5DUPH 1DQLL 2XRAL 3CN3A 4BXSV 1K4DA 1KPVA 3GHEH 4L3AA 4PGZA 5E2UL 2WKOF 4FG6D 2BCKA 1XR9B 1UWGL 5BJTB 1GC1C 4N4YB 3WEXB 2GJ6D 4OGQC 4YE0A 3H7LA 2PTVA 4AV0A 3K1DA 2HKHL 3EKCA 4HXAL 3O45B 2B4CC 4NUGH 5FGBC 4R90H 4HIQA 2CGRH 3F7VA 4X42A 1CI5A 4L29A 4BFFA 2E27L 5C3TA 3ECBB 1S7QB 4P23A 4X80L 1R3KA 5CP3H 1ID2A 4LP4A 3HKFA 1XXFC 2QGBA 4WW2C 1KXQE 3CFEA 4G3YL 1RLWA 5DGQA 3LZPA 3ZDWA 1MPAH 4HKJB 3RUGB 4ZFGL 2CM5A 3G6JF 4O2FA 4OCYH 2VDQB 2YPLE 2DS4A 3TONA 1I1AA 1L9RA 3MV9E 4KQ3L 4QNPE 5GRWA 1FZOA 4RAUA 3QUZA 2PN5A 3BW9B 1QSFE 2C1OB 4A6YH 4G7YH 4MXQD 1JVKA 5D72L 4G8GD 4PGCB 1TCRA 2C7UB 2YN5A 3KYOA 5F96L 1YHPA 3S88H 3LEYL 1FL6A 5DJ6A 1I7TB 3EYOB 4LSDA 4OLWL 4F57L 3NCFB 3U4AA 4EIGB 3STLA 3UGXA 2IWEA 3TWCL 4EN3D 4H13C 3PP4H 2YQGA 4GQ9H 4P9HC 2AFNA 2K4WA 2PR9A 1NAMH 5DMYA 2A4EA 5IQNA 1YNKL 1PTZA 3QNYB 5IJDC 1IGJB 4B3VA 1FL5B 4ZMVA 1K5NB 1LD9B 9CGTA 5CWSA 5F6HJ 4KJPC 3W11D 4LU5L 4HKXA 4Y5VB 1A1NA 3ATFA 2ADIB 3ZKND 5GGSB 4AJWA 3TIDA 4LL9A 4Q97A 4U6YB 1SJMA 4HWBL 1W72L 3V5KB 2GFBA 1WIUA 1LILA 3QDJA 4JDVB 3ECVA 3FT4B 1FCGA 1OAYH 5I1IH 3T6ZA 5IJKC 3GSNB 1BZ9B 5MP6L 1EEYA 4WI3A 3WY2A 1HT6A 2DYRB 1EUTA 3DTXB 4NQEB 2N1TE 2O6PA 1CXEA 2PWGA 3KPOB 2KPNA 3WNMA 5IUCA 5DO2D 3C5JA 4QR7A 3OAWA 5DD6A 2XLLA 4I13B 5DR5H 1EBPA 3PGDB 1SMDA 4JS7A 3FSWA 2QQQA 3HMXH 4X50A 4AKOA 2I9LB 3JWOC 4ZW3A 4JFQB 4K7PX 4NDMA 5D7LA 3TBSB 3KYAA 4PWEA 2VDKL 2GJ6A 2R23A 4P2AA 4Y16B 5I6PA 4BK4A 1WVZA 1XVSA 1WAEA 5IB1B 1NOFA 3QPKA 3L3JA 3MBWA 1JFHA 1QI5A 4X7CC 5DLML 4GQZA 3ZHKA 3OZ9H 3MRQB 4UZSA 3GMOB 1J9CT 1A6AB 1C7SA 2YKLL 1INQB 1ND0B 43CAA 2K9UA 4UINL 5JW4Q 1ACXA 1FFRA 1NBQA 1V7ML 3NA9L 4A2LA 1Q94B 1R4XA 3DETC 1JZGA 1JPGB 5K9JH 4LHUA 4YDNA 4ZX3A 4NRXB 1BOGB 4ABQA 3BKMH 3BN3B 3NJLA 4J3OG 3P4MA 2VDRL 4M8VA 5C07A 2EE6A 5DEFB 4GSUA 1RSYA 2H8PB 1J8HA 3MCKB 5FC9A 3SGJC 2VDKH 2CD0A 4L8CB 1FZMA 4AYID 3LPFA 4KI5C 4BWTA 3BSGA 3F84A 4LLVA 4RGMC 4QAWA 1SMOA 5GISL 2XN2A 4TUOA 3TIEA 3G5YB 4NWTH 3KHOA 5C2BH 1XH3B 3T6VA 2KYIA 3KGRA 1AOHA 3QZWA 1ITBB 4O2EA 4KJYB 1ZLSL 3LH8A 1B4JL 1NPJA 2IPTL 4N9GB 4Y9FA 4NT6A 3KH3A 2YAHA 1LHZA 3VRLF 1CT8A 4L4VE 2NY2C 5CIPH 2X40A 3NP4A 1ZVHA 3PABA 5MP6H 4DK3A 3IJEA 4ZMWA 5AWNL 2EUZA 2TRYA 4YC2B 5EEUA 4NJAH 4YBLB 3CFJA 1A6VL 3WE1A 3KR3H 3MAWA 2Z92B 3IM1A 4NOFA 4AVKA 1T3FA 4KK5D 3RDTB 2A9NH 3UTPE 3VB8A 4MAYD 2YPVA 4Z76B 1JZIA 2HP4A 3LPGA 3W2DH 3TBTA 5DLMH 3LEVH 4DAGH 4EDXA 2OR9H 3I85A 1SYSB 4WSGA 5KBNC 3GMLA 3NA4A 4MA8H 1L6XA 4OJEH 2IQ9H 3D85B 4N25A 4B9JA 5FB8A 4QF1B 5IVXE 3UJJL 2Q7YB 3WCYA 4BA0A 5JOPD 1YEFL 4C55A 1NANI 1T3FB 3RDTA 1A14H 2CBMA 4ZW5A 3TT3H 3EJYD 1L3NA 1EZVY 3ALXA 4LCCB 2UY7B 3PIQB 5E0QA 4D9QD 3LEYH 4PGBA 1E9PA 2QQNL 3V0JA 4HFWA 2WSDA 3L9RB 5DS8B 4IYKA 1DJZA 3OKMB 1MQKH 4K9EH 5IJCC 1RUKL 1JPTH 1PG7H 4YPJA 3REVB 5B3SB 3MJ7B 5CD3A 1MJUH 2IH3A 5TDNB 32C2B 4PJCE 1MHEA 5KYNA 4L8SC 4QI3A 4CU6A 1A8ZA 4QXTA 2R69L 2K6WA 1RURL 4BFNA 1E4XH 1P53A 3EDFA 4X5LA 3NEOA 3DMMC 4QXTB 3RVVC 3I02A 2ROYA 1DUZB 1KACB 4OCXH 5IBLD 2CGRL 4YHNB 1WFUA 5EBGA 4CKVX 4BUGA 1QO3A 1JYWA 1INDL 4JM2D 3REVA 5T1LB 3C6LA 2JB6A 1OWWA 4HXAH 3X1BA 4TVUA 1DBAH 1SOKA 4N8CH 1X5MA 2V37A 2P5WB 4OT1L 4NHUB 5DS8A 3R1GH 4IJ3B 4G5AA 3KPRA 2W38A 3DGCR 3FTZA 5GGRA 2I07B 1NIFA 3APFA 2W59A 1U8IB 3KWWA 4J3OF 3DROA 1XBDA 3Q5TA 1DVTA 4L8SA 5H37H 4FS0A 1U93B 3TURA 5F0PB 1PSKL 3AS1A 1SLUA 2A6KB 3Q1SL 4KK8D 1VFAA 1W0YT 3ARDC 2WXNA 1A2YA 4OZGB 1MF2L 1W0VB 1CIUA 4I77H 4PJHE 1A6UL 4G1EB 4ZTOH 5HHME 4CADA 3NGBB 4F33B 1QTPA 4C4UA 1L9TA 1AQKL 2F5BH 3AUWB 3B7YA 1UWXH 1DO5A 3H9HB 3ZOAA 5KG9A 5HJBA 2BJMH 4XXDB 3TS8A 1A3LH 2DM7A 3D3VE 2ZXWB 5GHWL 1F0LA 1JPEA 1RZGB 3UTSE 3CFJB 2BZDA 4QTIL 3D4GA 4IM8A 1A7QH 4LSUH 4H1LA 4HV8A 3D06A 1P0SE 3T6XA 3KPSE 3D2UD 5I1KL 5JA9A 3L4WA 5J0BA 2EDTA 3BE1L 5CCHE 1LE9A 1KTLA 1IT9H 3GS7A 4X6DE 3BPCA 4XO8A 3JWOL 3C60C 5C8JB 5JW4N 3VGHA 4ALAH 2YLHA 4UQ2B 4H88L 4AQAB 5CEXA 4HJJL 1KJ3H 2ZF8A 1NZRA 2A6JB 3I3EA 3TCXA 3VW3H 1AS8A 4CNIA 1MHHB 1G43A 1I75A 5BV7C 4YLCA 1HEZB 1N10A 1AJ7H 2CUAA 2HFFA 2IFGA 5DHYB 1DEEA 5F1SA 3H2WA 5IW6B 3GM0A 1H3TA 1INEL 4OVVA 5C0JA 2P8MB 4WO4D 5T1KD 1QYGH 5K39B 4P2YA 1GJUA 1JZ7A 1UM5H 5A1AA 1EZVX 4HAGA 1SY6L 5FW6A 3FONB 3CFDA 3X14A 1DQJB 3RYMA 5C0NC 3BEWA 2OSYA 3QHZL 1RP9A 4LAJH 1A3RL 4ZPTB 4Z95L 3MKGA 3S48A 1EJ6A 3STLB 4FZEL 3BUDA 3UBHA 1H8LA 1Z9OA 2PNDA 4BCZA 5AW0B 3LNHA 4NAQA 5JIMA 1JI1A 2WUCH 3RGVD 1H8OA 4HCRL 1DQMH 4LLYB 5J9PA 3Q8EA 4Y4FA 1WIPA 4JY4B 3WDIA 3SKMB 4HALA 1KXTA 2WZAA 1IGCH 1GZHC 4EIBA 4MYPA 4P2RE 3KJ6L 4MJID 1F11B 3VXRE 2Y36L 3RUGA 3UACA 3GMNA 1U8PA 4QRAA 1QRNE 3KZ8A 4PJAE 3T4AB 1BVZA 1XR8A 3QPQD 4Q6IA 2NY2D 4PJ6A 4B27A 3EGXB 3ESUF 2CHNA 4LARH 5GIRB 2W0FA 1EMTH 2AK1L 2IVFC 3QNFA 2V5RA 4GNKB 5I18H 2F58L 4Y4KD 4XVUD 3GMMA 3N40P 1MWAB 3TV3H 3G6JE 1PZ3A 1A21A 3FZUC 4EZMA 3IJSB 1O7DC 5BOJA 1GTFA 2KL6A 2KQNA 3B8YA 2DWXA 4OF0A 1NOLA 2BNQB 3FQYA 2UUDK 1SN2A 2J1ZA 3L5XL 3J8F7 2HTLC 5GRUH 3TVMC 1ZLWK 4AQ1A 1UATA 3MV9B 4Y9CA 2PTUA 2R8SL 3HG4A 1S4IA 5F89A 3IVKA 4BZ2A 4TSAH 3QWRA 5IMMA 2ZAGA 4YHOL 4WWKC 1BBJA 2NY6D 3JQOB 4NUJB 2R56H 3HE7A 2R9HC 4KY1H 3WNKA 2OMNA 3BKJL 1FYTE 1EDYA 3ZGHA 4NFDA 5I17A 1F1DA 5C9JA 5IQ7L 2LW3A 1UXMA 2DH2A 2WJ7A 3MJ9A 5ACLA 4JFOA 1ZDQA 1QFWM 4GI6A 4IRSD 5SWZA 4KKCC 5LLIC 1WK0A 3FUJA 5JW5B 2YR3A 1E9QB 3SKOA 4M8QB 3GLDA 2KQMA 4U3SB 4NBZB 3TEZA 2OJZL 1AKPA 1GYWA 1N3NA 3GMRB 1HYSD 4UT6H 4B50A 2DI7A 1OSZA 4DCQB 4JFEB 4JO1H 4QHKJ 5IMKA 4XGZB 3GJEB 2VLRB 1BMZA 3VGAC 3DSFL 5LGYA 2YD5A 2Y9RT 3Q13A 4FQXC 4QHNB 3WTUA 5ITBL 2WCPA 2ZPKL 1VPOH 4GRWE 4WTZA 4L4VB 4MX7A 5IW1A 2HLEB 3PJSA 2DWYA 3VGAB 1G1CA 1PY9A 2B20A 3V5HB 1OEZW 4QKXB 4BQBA 1IL1B 4DCQA 1AFVL 1K8IA 2HRGA 3O6KL 4NYLA 5AVVB 2VZOA 3WKNA 3S8WA 2C3VB 2DWEB 2J73A 5E6IC 5GS0D 3UAJA 2J55A 4Y1AE 1VB9A 2HKAA 5FHBL 4YZFE 1JPSL 4WNSA 2BZCA 5EN2A 5C9JB 4H40A 1FGNH 2WIMA 2EIDA 2FE0A 5FYKL 3WJMB 3FO0H 3WNOA 5LKNA 2XG4B 3FSZA 4ZUUB 2ED6A 4F24A 3HFML 3M46A 1A9EB 5I19H 5CNHA 2KERA 5INDA 3NJXA 1PZCA 3S6CA 3K4AA 4IOFD 3FDWA 3KYMB 4U6VH 3S37X 1MKFA 2WMPA 5D5MF 1BG9A 4PREA 4OGAC 3RZWA 4KI1A 5FF6A 4LT7A 4PRID 2YUWA 3B2XA 3QRBA 4AL8L 2GJPA 2RCSL 3BPNC 1XFPA 3KYKL 2PCPA 4WI6A 4X5WA 2VC2L 1NFAA 2DMHA 4N24A 3S5LB 1PW3A 4AQ1B 3PQYD 5IUSA 5SV3A 1ED3A 1U3HD 1W0WB 3IGKA 1E8XA 2YXVA 1KLGB 2DOCA 3QISA 1X5XA 4KNTA 3N41B 5BMFL 1TITA 1WHPA 3TWYA 1NWOA 1KY7A 3BSZL 4XTRD 3ZT6A 5E1IA 2WUBH 3DVFA 1D9KA 2Z64C 1R24B 2JH2A 4LP8A 4E9YA 4N5UA 3FFDA 4M48H 1G7IA 3AG2B 2W60B 1ORSB 1OT4A 4WJ5B 2YRPA 3ZYJA 3QDJD 4G7VL 1HCVA 3TCLB 1ZE3C 3W9EA 3GI8H 5CN1A 1A3RH 1ZLVK 1YYML 4YSRA 1CTMA 1JGVH 1WEJL 1BLNA 1QEWA 2OI9B 3U4KA 1GMEA 2JKXA 4FFWD 2VR5A 3VFUB 4RFNB 3VWKA 2W60A 4WJ5A 3Q2CA 4MJJA 4YOKA 1TDQA 4ANKA 4LL4A 1HHGA 2FO4A 3E8VA 4K7PY 3VXNA 1L7TL 4MSWA 3H42L 5E0FA 3AQXA 3GSUA 3OLIA 2Y07H 2Q8BH 2AI0H 1U8JA 2OTWA 2WSKA 1IBFA 1ZT1B 4EVNA 3MOAH 3FBKA 4PR5A 3S3SA 3RVTD 1G0DA 1Z9NA 5EU5B 2CDGB 3VW3L 4Y4HA 1BQRA 3IFNH 4Y5XC 3CVBA 3ILEA 5EUOA 3NQIA 1HSBB 2AJYL 2EACA 1EUUA 2DQIH 3HRZC 3L3OA 4M6OL 5EC2B 3V0VB 2ADFH 2RIKA 1MW0A 4HH9A 4LL1A 3X1GA 4IKIA 3NCMA 2DBLH 4YHYB 3DETD 2XN9B 3HJ0A 5DZAA 4HC1L 5I0VA 1GPOL 4P5TC 4PJHB 1JXDA 4MA1C 4QRPD 1TF4A 4RGND 3TH3T 3UFIA 4BFRA 3JWNC 2FNWA 4A7SA 1G0YR 1J48A 4Y9EA 3QHTC 4Y88A 3A4AA 5BRPA 3F7QA 4P9HL 2G0LA 3W39A 1XB8A 5DD0H 4KTDL 3ZE1F 3OHXA 3ZYOA 5CEXB 1DVFB 1ZANH 2C3VA 5B4MC 2JXMA 1D5MB 2R0LL 5DFTA 4P2RB 4ZXBD 2XPZA 1MF2H 3NCWA 5H94B 3TM6A 1QLFB 4Y7MA 2VSKB 4GI8A 4OCRH 4EN2A 5GRVL 2QV2A 2DQCL 2BXZA 4PUBL 2LLNA 1VF5C 5IFJA 1PSKH 1MCLA 3MA9H 4NC1E 5KYXA 1T2QL 3NIDF 3ZL4L 1XQ4A 1P5VB 1FLRH 1D5ZA 4C59B 1CVSC 4KJWC 1MLBB 3BAXA 3P3SA 3ULVE 2P44B 4P5MA 6FABL 1KSRA 2AJUL 4XOCA 1ZGLB 2YD0A 5K1NA 4XGZA 3NPZB 1MJJB 5FUCC 2CDEA 2CALA 3ZIMA 1W8EA 3PHOA 4N8CL 3PDGA 1XH0A 1VFAB 1INDH 4ES9A 1JWUB 1S9WB 1W0VA 3L4TA 1RZIB 3UZVB 1B0GB 3D18B 1IRAY 1MFDH 2ZTBA 4MB3A 1PLBA 4B41A 1N70A 4WZ9A 2Q76B 1E4XL 1CFMA 3IXAB 4MMXC 5ADOH 1H3WM 1S7WA 5BS0A 1U93A 3EFFB 1NBCA 1U8LB 3GSNH 4ZQTA 4OGAD 2IWGA 4NM8L 2NXZB 4URTB 4OI9A 2F5AL 2I07A 2OPCA 4NZJA 2FX7H 3DX2A 1M6OB 2NDFA 4EQ3A 3K72B 3F65A 4TUJA 1FFPB 3MVSA 2V2TA 3B2UD 3CVDA 1U3YA 4JQXC 1LK3H 3Q8AA 3NZHH 3DX7B 2ZOWA 2ZZUT 3VXMB 1LO2L 4WW2A 5CLWA 3GRGA 2LU4A 2CLRA 2I69A 4AM0Q 4MRCA 3FUHA 3GRBA 4M1GH 2OLDA 1A7PL 4LZKA 5H4ZA 3QUGA 2BNUA 3KM1A 3VH8G 1FN4B 1OD7A 1FNFA 5HPOA 2DIBA 4MNQD 2HA1A 1L0YA 4GP5B 4A7QA 5I1CL 4MNGA 2NYYD 4QRFA 3EGXA 2IQ9L 2WVVA 4HZ1A 1RI8A 3MLUL 5HHNB 3VG0H 3VI4A 4FQIL 1I9RL 3V9CA 5GS0C 2HRPH 3L9RA 4Z3IA 3MJ7A 4GEJA 5PAZA 4F5CA 1FVCA 2V8LA 2EKJA 3UEZA 1AZNA 5LGHL 1FNSH 2EEDA 4XCNA 1QFWI 2I85A 4Q6IC 4MJ6A 4A7TA 5C2UB 1S78C 1ZTXH 4Z7OF 3TEYA 3MJ6A 1J9RA 2G30A 3GS4A 4ESKA 2DLFH 5SWSA 5B8CA 3VXSA 2NCMA 2WVSA 3H9SE 1F6AA 1P7QD 2XYCA 4PJ5A 5DD5L 1G7JB 2Q7YA 1I3RB 4I3SH 2GQHA 3UG3A 3U6XA 1CD1B 1OK0A 1EXGA 4M5YL 5E00A 4CSTA 3QG6A 5CLTA 2X4SA 1DL7L 4TVPD 1ZS8B 2A6IA 2FVNA 4BINA 1RUAH 3C2AH 4PS4H 4WHYH 5KYWB 3RUGF 1CS6A 3AQZA 5EBWB 4BSJA 5KBPA 5L88L 4KJPD 3W11C 3WTTA 5HI3C 5JOPE 1G9HA 4A55A 5C1MB 4MLIA 1OAKH 2GVYA 4JY6B 3RZCB 5ICXA 5C0AA 3NRQA 2FATL 1MCJA 1HKLL 2VT0A 3D33A 4YUEH 3QJRB 4LIQH 1WBXA 1KGCE 5GGVL 5FV1L 3SDAD 4HCFA 1MCFA 3CE1A 4P2QA 3WFCL 1TKWA 4Q52A 1LM8V 3NCJL 4IRSB 4UNIA 5DJAB 5E9DD 3WKPA 2WXKA 2D7TL 4HX1B 4UINH 1ASQA 3C09B 1V55B 5BS0D 4PJAB 4JM0A 4GAGH 5F9OH 2KI6A 1J8HB 3MCKA 5BV7L 2FJSA 3GSXA 3OZLA 4U1MB 5DWUL 3AXLB 2NY0C 4I18B 4ZG1A 4IOSD 3EYUL 3VFOB 5AAWA 1R5WB 3QZLA 4FFYL 4LPYA 2IWFA 3MOBL 4MVBD 3MRCA 3UAJC 4DVBA 4KZDL 1JPFA 4JY5L 5KYYA 2H1PH 3L9YA 5DJZA 3QUMA 5AL8A 4OF6A 2FWLB 4AYSA 1PD0A 3LQAH 5DR5L 4JKWA 1A6AA 2AV7B 2H26A 1D9KC 3EOAB 4X5QA 4ANVA 3U0TA 3IDXL 2HTKD 3SPCA 1K2DB 1TQBB 1U8NA 4EUPG 4ADJA 2MQGA 2D4DA 4LIQE 3KWWB 1F2XK 4HK0B 3VJ6B 3EXJA 5FXCH 1BVKB 1I8MB 4YAQA 3BT0A 5J3HD 3QUYD 4KVNH 2J21A 3E2HB 2BX5A 1J1OH 1R5WA 5D71L 3RPKA 4JHVA 4P46D 4YDJB 3U1QA 4AJ0A 2XN9D 1IFRA 3MRCB 4Y4FD 4JFUA 5ABZA 4QJ4B 2OM5A 4PG9B 3EFDH 5C0IB 1XBRA 3RNQB 2VLKB 1THAA 1RJZA 1AOZA 3HC3H 3PGDA 1AFVH 2WB7A 3IDMB 5LWYL 4I18A 3QAZB 1BGXH 2UWEA 1N9PA 2NNCA 1NCAL 1YEEL 3MRGA 1NCBL 4JPKL 5HY9A 4IRSA 4HHAB 5IHZB 1BFTA 4PV1C 5ITBH 5GZOC 2YXWA 1PKQA 4AIZB 5E94A 1UXLA 1WBXB 3Q3GA 4UV7L 3U0WH 1D5IL 4I4WB 1N67A 2FYYB 2ZP8A 1QQDA 1V8HA 3L9BA 1H3XA 1M1XA 4GW4B 4JFFE 2DI8A 2GITA 5DMIH 5TJWK 1HU8A 2CMRH 5FGSA 3WKML 1BQHA 3OAYK 4IIQB 1DN2A 2OJZH 4QUOA 4AYMC 3EH1A 3QRLA 1VFBB 1PJWA 3MBEC 1A7OL 3KBHE 2ILLA 3LS5L 4AWJC 3PREA 2V7NA 5TDOA 1T7ZA 4PI0A 3LNGA 3DJZA 3QDMD 1AYOA 3BFWA 3EZ8A 3O8XC 2HB0A 1N6VA 2R29H 3ARFA 4QEGA 4TNGA 3VI4E 1F90H 4HCRA 4ODVH 2W07A 4R5XA 4QYAA 1CF1A 1NAKL 3HZVA 5DC9B 3TBVA 1DDHB 4MNGE 2Y2TA 3HZ3A 2MOQA 2CBOA 4OLZH 2P28B 2FLBT 3GXMA 5JHLA 3UZQB 4XB8A 2XXCB 1FZJA 4NUGL 1CC3A 3G08A 1I7TA 1XCTA 1HXMA 2YAQA 5E8OA 3GSOA 1CK0L 2RFXA 5F9WB 3VACA 3WIHH 1FORL 4CMMA 5DUJA 3NBNA 1MFUA 1RV6X 1THCA 3H0TA 4FQXD 2CHXA 3DXAD 5AALA 2ODIA 3BQUB 5LG1A 4NX0A 5DUPL 1HWHB 1VADA 1Z32X 2UWEF 3V0WH 1AY1H 4PIBA 3IDYC 4AH2A 3CFMA 1LQSR 3MNZB 4FN0A 2HKFH 1P84K 5EU3B 2HUEA 4E36A 5IQ9B 4I3RL 1FN4A 1UADC 2HZHA 3CZEA 1FH5H 2CJTA 1JGUL 2OL3A 3NRFA 4R4NC 2FH8A 5DMKB 3V4VH 2XETA 3ALWA 4I9WD 2ZWZA 1AGBB 3MJ8A 3HCVA 5TE4L 4RETB 3WEXA 4BFBD 1B4TA 1M7XA 4HUXB 4KDVA 4IU3A 4LF3A 3WEBA 1NEPA 2V2TB 1XF5B 3WNLA 2YPLB 3KPQB 5F0LB 1IGCL 1TVBB 1UZ8A 4N2HA 2V7HA 1Q9OA 1NTDA 1EDHA 3CQQA 4FHBD 2CLVA 5ESAA 1S9XA 2EKSB 1BAGA 1M6OA 3EYSL 3LY6A 3RURA 3QUKB 3S34H 5FS5A 5HGDB 2C9XA 1GRWA 5GGVY 3GPEA 2KT6A 3QHZH 1JV5B 1PZ5B 3NSCA 4LEXL 3Q01A 1CD0A 3NSFA 2IH1B 4XPFL 1SY6H 1RP8A 4EXPX 1LXMA 1G7HA 4X0KA 4GYBA 4M00A 3UC2A 1IC1A 1MREL 5PCYA 1TOXA 3UPAA 1HAUA 2E75C 4YSDA 3C6EA 5JPMB 3HG3A 4LSTL 5DD3H 2QPFA 3HR6A 1LO5A 4ZAKA 4NAJA 4WI7A 1OGAD 5BZDB 2X41A 1AJ7L 4A68A 4AYFA 1D2OA 4IDJL 3OXRA 1I31A 1RIUH 3AACA 1MFBH 3LN9A 3TBYA 1FIEA 3BGFB 3TCTA 4HYTB 1IQDA 4ZUVA 1M9SA 1CB4A 3WYRA 1E6JH 2IAND 5ITFA 5D1ZB 3V5HA 4ICWA 3T0EE 1GH7A 2OZ4A 4ZMQA 1GCYA 1UM4L 4OFQA 1A4BA 1NBVL 1IT9L 1F58L 2HMID 1QFOA 3LKPA 4S10A 1P5VA 4GP4B 1XGYH 1XSJA 1IAKA 4KMTH 3I6GB 1A7QL 2XX1A 3FO1B 1VKXB 2F53D 3VQ1C 2Y6SC 3FT4A 2VB5A 3MRLB 4QXWA 2FJGB 4JZJB 2XG5B 1FPTL 2A6DA 2EEFA 3V6FA 2HG5A 3QIBA 3ROLB 1IGYA 4O51A 3RDTD 5JHDD 2ESVD 2IDCA 3UC0H 1OP9A 3ARDB 1I3GH 4WENB 3I3DA 3F83A 3W0WB 4BKLB 3KXFB 4DP4X 4W9ZA 1RD6A 2FEJA 2EECA 4P05A 1OTSD 4NRZA 5I17B 5B1CA 4G6ML 4H20H 4RNRA 4ZUSA 1KDIA 3NP3A 4WCYL 2YOAA 3DPDA 3DVGB 4H1LH 1SJVA 4MKTA 2E59A 5TE6H 3ESPA 1Z2KA 5C86A 1PL3A 2R4SL 4XNUL 5C0ND 5JPNB 5ESQA 3SDAB 1M2VB 3I6KB 4MWFB 4EUPH 4I48B 2DLIA 4NQCA 3Q1EA 4MAYB 2OK0L 4BZYA 3IFLL 5JOEA 3PAUA 4UTBH 1FL6B 5DJ6B 2CHWA 3KHQA 1BSIA 3C12A 3P4NB 2ZKYA 4FEIA 3RWFB 4B0MB 2BP8B 4MSWB 5MHSD 1PPIA 1RK1B 1OZTG 1WTGT 4HISA 1ZS2A 3N9GL 4G6MH 4EVNB 2DLGA 3AT9A 3QT2A 4IRZH 4NQDB 2IO5A 2VLJE 4DZBA 1I1AB 1VACA 1MFCH 4H0LC 1D5XB 5ILTL 3SO3B 2BY1A 3TJEL 4FXGC 3ZQ9A 2VDPL 2EDFA 4PCYA 2WO2B 1F8TH 4QY8A 2Z8SA 3NIGF 4WW2F 2BVYA 4P23B 3S4SG 3NN8A 3SO3C 2DL2A 2NT0A 4FXGB 4PRPA 5DFVC 2LABA 2NXYD 3EJSA 5MI0C 1KG0A 4L1HA 5JIKA 3D09A 4OM0L 4Z7UA 1ZVSB 4KMTL 4LQFH 3GXFA 1IARB 3BD5A 1QLEH 3OB0K 1RL1A 3AZUA 1MCQA 3B7UX 4GBXB 4IU2B 4IBZA 5EIQA 5ID0A 4LCWA 1ED3B 4Z3TA 1JV5A 3QUXC 3LN5B 3G6JA 4IKJA 4PJ9D 5GRJH 3P4OB 4IMKA 1UT1A 3TEUA 4DKEH 3ARDD 3RLSA 5E6RB 5DZ9A 4PMFA 1P9MC 2VO8A 2F0CA 4UBDD 4HH8A 5HHOB 4OGXH 5I5RA 1JHKH 3D0VB 3U9PH 3TF7C 1RY7B 2HJLA 1DANT 3CK0H 4F8OA 4BQCA 3P9LB 4NS0A 5EH1A 1TR7A 4HIXH 4MRBA 1E2ZA 4ZW7A 4LKCB 4PRIB 1A9EA 1EQWA 4ZS6C 3W2DL 4PJGB 1O9WA 3KXFA 1WISA 4LMQI 4RMTA 5KSBA 1J5CA 1J8SA 5DVKA 3CDFA 1VEOA 3KG5A 5DK0B 3ZT5A 3QRFM 1G9MC 5D1ZD 1T04A 2GC7C 1JZFA 1M71A 1MCWM 2EYTB 2H1LM 4DH2A 4F7CA 6PAZA 3BVNB 2MNUA 1M7UA 5CGYC 2BVQA 3WY3A 3BH8A 2ARJQ 4L4VA 1AG0A 1J9QA 4WNJA 2BWIA 3BZ4A 3SGEI 3GZQA 3LKPB 5DO8A 1S9YA 4GUQA 3WKQA 5BQ7A 5FCSH 5F7HA 3BWZA 4CJ1A 4EF3A 4MD5B 2JJWA 2QGDA 2YD7A 4K5OA 3VD7A 1FZJB 1XB3A 3L3HB 4PJ7A 4AQ1C 1ZWIA 4JFPA 5HPMB 3UBXG 2QSCH 2K70A 1YEJL 1CE1L 3HUJA 4EJ1C 2ZX7A 4OSUH 2W07B 3MR9B 3NDYE 3O3DA 3NIDE 4P2OB 2CHZA 1CFQA 4HWEL 1HZLA 5CR8A 1HEJC 4I2XE 3BC9A 3X2QB 1B0RA 1J0IA 4XOEA 2X6VA 4ACPA 2DEWX 4Y2DD 5FM8A 2OYLA 1EVTC 1JHLH 2P80D 4LGPB 35C8L 3AG3B 4L4TE 5DZJA 4BZ1H 2GK0B 1DLHA 5L4IA 3OZ9L 2BNRD 3IDJA 1K6QH 1MJ7H 4OLZL 5GGRB 4BHUI 3Q0HA 4Y0GA 2EIJB 2Z3FA 1DSWA 3O9WB 4XZUA 1CDGA 5HI5D 1TCMA 3GGWA 5GS0L 2QQLH 3SE8L 4NGHH 1I3UA 2V7HB 3MR9A 3HOGA 1KF9B 1WT5A 2CJ3A 3GHPA 1QRNB 3LRLA 3MACL 1XCXA 4KI5F 4JKNA 4EI5A 3RILA 5BVJB 4UTBA 5DUML 3HCVB 4M9PA 1DBJH 2LHAA 4U0QB 3IEAA 2UWEB 2WP3O 4MD5A 1N6QL 3CMGA 4XP5H 3LIZA 4Z23A 3QFDA 3HN3A 3GO1L 4JPVL 1JERA 4GP8B 2D7NA 5EZJB 3RVVD 1HVXA 2VERA 5K9KB 2IH3B 4W9FC 4KTEH 4GW1A 3MRBB 1E65A 2KS0A 1I8LC 4FLOA 1QFUL 3BXNA 3KE0A 4G6AC 4P5TB 4LKXA 3FRUB 3MCG1 5DUBB 5LO7A 2XBTA 4UQIM 3JV6A 4Y4KC 3FU9A 4NXSA 2FJFB 5IB2A 3WAJA 3MRDB 5T1DH 3DI3B 4IOFC 4K94L 5DURD 4IBYA 4TS6A 1NCAH 1LEGB 2WLKA 3IJ9A 2BIOA 4L1SA 2NQCA 1JI2A 2R39A 1HXYA 1BGXL 1K2DA 2QHRH 4XC3L 3WE6B 3U0TB 1OGTB 1LWHA 3NAAL 5CSZA 4BFOA 4IGBA 3M07A 3FMGL 3X14B 1AZCA 3A22A 4MQTB 3FQUA 3A6BH 4K94H 3CVHA 4KY2A 2E9BA 3TTSA 5E95B 5KYYB 2XWCA 4FQQA 3OX8A 4P4KB 4LSQH 4DGYH 1NCDL 2GSIA 4X6DA 2ZOTA 3SJVA 5DYOB 1CFBA 3ATDA 2HX9A 3EBHA 3UTZA 3DHMA 5KVEE 4KTEL 1AGFA 4P8QA 3ETBF 1ZOXA 4OLWH 2ZQKA 2HFFB 1HDMB 2BHFA 3QCUL 4J3OH 4JAMB 3RNKA 3MC0A 3IDXH 5B38A 5CGMA 5D72H 3IJEB 1HEZA 2YPKB 3L3DA 2OMXA 3HC2A 4ODSL 3MRIB 1QBLH 2NW3B 4BSWA 2CU9A 1O9VA 4OTXH 3BPCB 3CSFA 4JY5H 5C8JA 4F8NA 3TFBA 1EAPA 3BHBB 1P4LA 4OH2A 3NN8B 2Y6SD 2YPKA 4NGHL 4ODUB 4AQAA 3RY5A 1YUHA 2O4EA 2WLZA 1PZDA 3V4LA 4J8RA 3RWGB 4XO3A 1J10A 2FGWH 1Z3RA 4NPYB 2R29A 1Z5LA 1NINA 1CQKA 4ZX5A 4XMTA 3W1ZA 3GRWA 2VMDA 3P77B 1Z66A 1GZPB 3QA3B 3RNQA 2VSDA 3APCA 2OMYA 5EOQH 4OFYD 3W0WE 5ACZA 3H9HA 2K7PA 1N4XH 3CFCH 4TF4A 3OMIB 4MXWL 1KOAA 3MGAA 4YDJA 1W8NA 4ZZFA 3MYJB 1DQQA 2NY6C 3ZTNL 1XIWC 2XV0A 3LIZH 4KROB 3LNEA 4D0DA 1TVDA 4IHBA 4X6BA 1OP3H 1CWVA 3PP3K 2AZUA 1Q94A 3W9DB 2P43B 2Q86B 3WV0A 3WMSA 2JTYA 2Y0SA 3N85H 3CZFA 3TO2A 3C60B 3UP1A 3ZBMA 1OGTA 2DQUH 3DARA 3P30H 1M2VA 4PJ5B 4B9FA 1N59B 2FEDD 2KLRA 4BH8A 3SE4C 3HVNA 4WFEE 1OAUH 1T21B 5ISZB 3P02A 2JI2A 3TZVB 2C4XA 4XH2A 3H9ZA 4V11A 2N7BA 4L1TA 1XF2A 1S7SB 1OLZA 3C6LC 4JHZA 4JQIL 3JTSA 1GS8A 3GJFK 4M3JA 4BZ1A 1E4HA 1AMXA 1XGZA 3MRBA 4B6ZA 1UJ3B 2DL9A 4HCIA 4PJIE 3RI5K 3VFRB 3GJFB 4QRUA 2AXJA 4TULH 4Z77B 4H26A 3LEXB 4HQQL 3T3ME 2A38A 3DLQR 5D7IA 1HCFX 1NCNA 3BJ91 2DQFA 1VKXA 3SZKC 3MNWA 1CD8A 2YBRA 5FR3A 1MFEH 2DD8H 2JKLA 3GIVB 3IT8D 5D93B 2XA8L 3X3GL 1N5YH 2W1NA 2D03L 3GLZA 5AZEH 3LEXA 2W92A 3NJFA 4OCWL 5IF0A 3HPJB 3GJFA 3OAZK 1U95B 3U9UA 4EQ2A 4BH7A 2IH9A 4A2MA 1AD0A 3JV0A 5FWQA 3X13A 4ZUVB 5T1JA 5T3XE 3FCGA 4QRRA 1XTMA 1AVAA 4NO0A 5E6IA 4N8UA 3X12A 3DWTA 2FL5B 4YQXH 4AEIH 4JANB 4CKQA 5IFHH 1L9PA 1D5BA 1U58B 5C7XL 1IAMA 1PD6A 4OUUB 1HOCA 4NZUH 3IDGB 3GMQA 2YQ3A 5JPMA 4DGIH 1WO2A 4YHPB 2IAMA 4PJ8C 4TL4A 2F8IA 4X0KB 4JLRA 3C60A 2XIDA 3SB3A 4IRSC 4E9VA 3B2VL 3FOMB 1U91A 2HRLA 3LRGA 2YRBA 4JN2B 4PTUB 3LZFH 1WS8A 1OOAA 1YPZE 2PWEA 5SWQA 4Y19B 1HHKA 4GEIA 4NQSA 1PGRB 2I25N 4PJ8B 3SBRA 1I1YB 2V33A 4NAMA 3L3HA 3EDKA 3OC8A 1HC1A 3EJYC 4FKEA 4AZ8B 5KZCD 4IIZA 3KDPB 3MFFB 2C7UA 2ZCLL 3RVWD 5FK9B 3HAEH 4LVEA 4EZKA 1J5OH 2Z92A 5DO2C 3E0GA 3BGAA 1I8AA 5T5NG 2K6ZA 2XQYK 4EUPB 3MRFA 4UOJA 5ACMA 2F74A 4GT0A 2FBRA 4KKZA 4R7DA 3O9WD 4NT6B 4AZUA 3RZCD 3VFPB 3CFEB 1LE5A 1K5WA 1R17A 4NQDE 4XCCL 2VLJB 3E7JA 3N06B 1GYUA 5EF3A 1U8HB 1QEXA 3RQ3A 4U1GC 1FLTX 4AUUA 2XXGA 4L29B 3IE9A 2BP0A 4PJGA 2ORBL 2QVKA 4N5EC 1VA9A 2J8UA 1PNCA 3RA7L 3O3BB 4EUPA 3PWVB 3SE9H 3ZDZB 1C9SA 3VWJD 4ELMF 3GKWL 1AE6H 2AV1B 5F21B 4CMMB 2AEPL 4KRMB 1U36A 4OZFH 2G9KA 5GJTH 4YGVA 4JHUA 2DI9A 4CVXB 4L23A 5C3IA 1BOGA 2DQCH 4JFDE 5C0EB 4NWUH 3G08B 5H2BA 3M7OA 3ARED 4NUQA 4W9LC 4U49A 5CR1A 1J12A 3ROOA 5CBAB 1G6RB 4LHUB 4FLRA 4F37F 2EVFA 4HJTA 3BVXA 1INQA 2OMUB 1BFOA 2SEBB 2J8UF 2N4IA 1ES0B 2XDHA 5EV7A 4OIAA 4I2XA 5EZLB 3ZRSA 3GNMH 2IGTA 4JLRB 3VFGL 2YJQA 4JO4H 1CVRA 1PYWA 2YLKA 1A6PA 1M05B 3U2JA 1R3JB 3SYAA 2VOTA 2YWZA 2KZKA 3KM2A 3MRRA 3UERA 4D7PA 1RXLA 5AW4B 3N04A 4UOW1 5HHOE 3UIZA 1QR1B 3BVUA 2VXSL 4AGPA 3S5YA 1U21A 3VFNA 1JWUA 2X1WL 4JCMA 3PXHA 4NQCD 5IT2L 4NENB 2OV0A 4XC1L 2KPWA 1W6WA 2NYYC 1MCHA 2EYSB 1IC7H 1OOWA 2OSLA 4U1LB 5G2NA 1Z9MA 2FT6A 3PHQA 4YDZA 1OAQL 3V9FA 5D1XC 3Q2VA 2I9LA 4PJGE 3K6SA 5EZJA 2QLYA 4I1RA 1EDQA 4EZLA 1N6UA 4G8GA 1SEBB 1DUYB 1UD4A 3T0WA 2E7MA 3FRPA 3VXSD 5LN8A 1H5BC 2YZ8A 1YEIL 4GMSL 1ZSDA 3C60D 3MFGB 1AXSB 4L3CB 2ENPA 1IUZA 1O0VA 5EULV 3UCRA 1KGXA 1UA6H 4CW1B 2X6CA 1T0MB 4GUPB 3FN0L 2X0WA 3BWAA 1CR9L 4H26B 1EO5A 4PRPD 5EZIH 3L3GA 5JIQA 1S2EA 1Z1WA 2JCCF 3FQRB 2CXKA 3P11L 1K72A 4HS6B 3R0MA 3H9SB 3T09A 4LVOB 4ODHL 2OSLB 3VD3A 5HGBA 5E5RB 4G7VH 3L6FA 4PJBE 2BIQA 2A74C 1NJ9B 4U6HA 1AQHA 2WTRB 4CBZA 4PP2B 1YAIA 2FZ3B 4G6JH 4TOYL 5JHMA 2XX0A 4JPWL 1QR1A 2Z7WA 2P8LB 3WHXB 3NFSL 3AQYA 4KKQA 4J4PA 4FGMA 3U1SH 4K7FA 1WA2X 2NY5H 1IGJA 3FN9A 1OARH 3HI5H 4P2OA 4WFHE 3H54A 5HD8C 4O02L 3UOAB 2XVLA 4NI6A 1B3JA 1MAKA 2VC2H 1TO5A 5JXAL 1DJHA 3H9YA 4U1IA 2CNYA 2VUYA 4I3RH 4C47A 2EXWD 5I74B 2H2SC 4LLUB 3HBGA 3JV5A 4QJ5B 4R4BA 3SDYH 4EIUA 1NLDH 3GINA 2ITCB 3BCDA 3VH8A 1MIEH 1KV7A 4DK5A 2DZEA 1NGQH 4S1RL 5E4IA 4PRHD 5GZOD 1EK3A 3B34A 3MLYL 4AC4A 2VH5H 3QUZB 2XNAB 4H8QA 3HS0A 2ZKHH 4AIXA 4PV8A 1KCBA 4FXKB 3OSVA 4UANA 1KN4L 4EKJA 2E56A 2HH0H 1M71B 5JHAA 2YEQA 5EWIH 3I2CH 1ZEAL 3MDJA 4LHUG 4Q89A 1LO5B 2DAVA 5DZLA 2X3AA 1LE5B 1ORSA 4ODVL 3V4UL 4O4YL 3LXCA 4XMKL 1C5BH 1ZSHA 4PS8A 1KCRH 3OKNB 4PWHA 5FYJD 4YR6B 1ROCA 2NSXA 2RB8A 2X3CA 3BAWA 1WWWX 1H9DA 2X38A 1VEPA 3RFRA 2WBJA 3CHQA 3G5ZA 3H6AA 1I1CA 1NA8A 1S6NA 4LHUD 3UPCA 3I84A 5IEHB 3HBQA 4DP2X 3UTZB 4MVBC 5EO1B 1MCPL 2C3XA 2DLHA 3UAJD 3D39E 4QGTA 3V4PH 2ESVA 2FIKB 4XCEB 2Z6FA 5ANME 1HHKB 1TTCA 1NEZG 5DMIL 5DMGD 5IEHA 1WD9A 1YEDA 1IC0A 2EAEA 1CFNB 5AAMC 4KKCD 1TQCC 4E9LA 3FUNA 1G7JA 5C08B 3RWIB 4HS8H 4NCC1 3QDMB 5IESH 1RCYA 3KGUA 5IQ7H 5DQ9B 4PJDA 4KY1L 3RRQA 4HXBL 25C8L 4P0DA 3HC3L 4OD3H 2Q0ZX 5CCJA 5D8JL 3KW8A 4GRMB 4ADIA 2K6YA 1L7IH 4ILDA 1XWVA 4FULA 1FE8L 2OSWA 2N1KA 5GJTL 3RX7A 1E4KC 1QLRB 2RQ8A 4YHZL 4B9KC 1U95A 3U9UB 1WSST 2HX8A 1J1OL 3FJTA 4MD0B 3F12B 3B6SB 5DEZA 3ET9F 2B4CL 3GTVA 4WI5A 1WAPA 3B5HA 1UQSA 2QVTA 2WLYA 1NGPH 5CZKA 5ANHA 3QJFB 1FJ1B 1TXKA 1X5LA 3B4NA 5FV2A 4TVPH 1P4BL 4MAYC 2OA9A 3CC1A 5F1OB 3SBQA 1BD2A 4BDVB 4DVRH 8PAZA 1E0OB 2AK4E 2KKQA 3E6HA 4MNHA 1SNRA 1AR1C 5FFLA 1NFDF 4BQ9A 1SM3H 4WHTA 4DQOH 3PL6D 3D05A 4LCUA 4Y5VC 4BWUA 5LXGL 4LESA 4HU8A 5CEZL 2WTOA 1KBGH 1HL9A 1OE2A 3NK4A 3EYUH 4YDIL 4XB7A 3F00A 1ZA3A 3L6FB 3GJFH 5DWUH 1T7WA 3E9TA 1DEEB 3ECUA 3IXAA 4Y8DC 5BV7H 3TX4A 1DQML 1XDTT 3P2TA 3JTTB 4X99B 5J89A 3ISWA 2FSEA 4IRZA 3KPTA 1TJGL 3SYOA 1NGZA 2A9BA 4PIRF 2YJLA 3OQ3B 1PKQB 1NEZA 3QFJA 2FJGA 1JYVA 1JYNA 2APTA 3HN5A 5HDWA 1N12A 3S4SB 3RWHA 5C0GA 4YHLH 1PVHA 1UM5L 1J8KA 3I6GA 2V2XB 1WGOA 2XVGA 1JGIA 4K4KA 5DJ2A 4JZJC 2Z7UA 5TK2A 1OE3A 1GS7A 3UZEA 5I0YA 3IB4A 1R3HB 1MWAL 3CMOL 4HGWB 3F5WA 4BD4A 1T1YA 5EBMB 4DHLA 1TQUA 1NM9A 3MLRH 1MWAA 1UB6B 5D1ZA 3CVIL 2H6OA 3JWDC 1P5UB 3HE6D 1TLKA 4PGEA 2J2ZB 4TXVB 4JO3L 1E90A 4JJHA 3RZCC 3CX2A 4OCWH 3BYTA 3FT3A 3V4PB 2DRUA 3A5VA 3BVNA 1T83C 5IROC 3BHBA 4YHYC 4G5ZH 3WI9A 5D4JA 2GI7A 1AO7E 2J25A 2WLIB 4TLSA 4UT9L 1MELA 3MLZH 4AQZA 4BK8A 1R5IA 1MFEL 4K3EL 4I3SL 4QRTB 1QSZA 3MXWH 3DGGB 1E43A 2C9PA 2EXYD 4MA7L 3Q2WA 4XPTH 3UABA 4J2QA 2Q10A 3UZEC 2YC1B 5I8CA 4ZFZA 2DWDA 1ZPLA 1YN7B 4KVPA 2M83A 2WQWA 2ARJA 1IQWL 1FNHA 2H3XC 3VD9A 3F8UB 3ZQXA 3BPLC 3VG9C 2XN9A 1FHNA 3S3CB 3ZLQC 4BGDA 1UD3A 2PYEA 1Z3GH 4HWZA 1CZ8L 1BZ7A 5LGHH 3EYQC 4I77L 2I7SA 3V0VA 5F6IB 4LOUC 4JO3H 3AXLA 2H6PB 4HIEB 1HSAA 3AGWA 4GLRH 3G5WA 4BWWA 4BFEA 4GMTH 1E3ZA 3I6LD 1HH9A 5AB1A 4JFFA 3P30L 2D2OA 3CMOH 5DHYA 3INUH 4M29A 2NYKA 1B9ZA 2Q3AA 3D3VB 3WNNA 5LNDA 3LKRA 4HKZB 1KG0B 4YHLL 5DFVD 4LLWB 3QQDA 1HZKA 1JP5A 4Q0XL 1KIPB 1KY6A 4PV9A 2O1AA 1DBAL 5M95B 1FH2A 2KUTA 2R51A 1PAMA 3BN9C 4AQ8C 3RDTC 3LZLA 1NFDE 2F5AH 2QKIB 1BQ5A 4PLKC 1HIMH 4J4PD 4S2SA 3ILPB 1R3HA 1G7IB 3ZKMC 3R7QA 1TZHB 2X4UB 1ZT7A 3RWIA 1Q1JL 3UZQA 2D31A 3PWPB 3FRPG 3QAZC 5I5MA 3ECQA 1KTDA 2ITFA 2XU9A 1S7RB 5J12C 1H15A 3S2CA 4ZI8A 3LZOA 2XKNA 1KNOB 1OALA 1SM3L 3HPLA 1RVFH 1G1KA 4K9EL 4F2FA 5CP3A 4GO8A 2XFGB 4M7LH 3H3PH 4ZS6D 4AMKL 1SDAB 4X99A 2QQNH 5J12B 4G43B 1AP2A 3WXVH 3CDZA 4OM1H 3T2NH 5SWSB 3DVGA 1VFBA 1XGTB 4P04A 1ZLUK 5A2CA 2F68X 5E6UB 5TDPB 1F02I 1ASPA 1D5BB 1MCRA 1U58A 2YFNA 3QXTA 2VXQL 1DO6A 2LFGA 5JW3L 5CLXA 3HHRB 5FM5M 3MLSL 3WJMA 4XVJH 5B39G 5LBVA 4PP1D 2ZX8A 1UYWL 3ZZSA 1IBHA 1USQA 4PCKA 4Y2DB 5I0DA 1DANU 3ZJAA 3MZGB 2W0KA 4X9YA 4KUZH 2VN4A 1XGPA 2HVJB 4QOKE 4XP9L 1RIVL 5IJVB 5FYKU 2XG5A 4O2EB 4FFWC 3LEVL 5HGHB 3HW7A 5KSUB 4H8UA 3SPIA 4JDEB 1C08A 2HPOA 2D7MA 1ZWIB 3MJGX 4G9DB 4JFPB 2YQ2A 2YMXL 3LMJL 3RJOA 1A7BA 1F5WA 1QSED 2W81C 3ZL1A 1OSPH 1PD1A 4K3DH 4HIPA 2B5IC 5IFAL 3DX9B 4FDWA 5F7EL 4E68A 3II1A 4MMYA 2VXTL 5B1AB 4MA3A 1QACA 32C2A 4ODTL 3TPUB 3W5NA 5EA0L 1C5CL 1H0DB 2F19H 1IQDB 5AVYB 2L7QA 5GRZA 3MRJA 4FTVE 4ODBD 2DBLL 3ZHFA 1NBZB 1C1EH 3HVDA 2ADFL 3DDFA 2G3NA 3WD5L 1BVKA 3U30C 1T04B 3UX9B 1Z5HA 3O6FC 2W80C 5A2BA 1U2YA 1UENA 2WXJA 2B2XL 2CO6B 3IFNL 43CAB 1RZKL 4XRCA 1G9MH 1NKRA 3DX1A 4AIOA 5CZVH 4G6KH 2YMOA 1RJYA 1T6BX 4N2CA 3ZVVA 5FO8B 2JIXA 5K69A 4KRLB 1I9JL 3VXUA 4Y2NA 4S1QH 5BVPL 2D73A 4RGNB 4RZKA 3SSGA 5HGBB 1TENA 2HJLB 2I32A 1T20A 3IU4L 4HUNB 2GW5A 3NZ8A 1Q4NX 3H9SA 2BVPA 5D2NA 4F7TA 1G9EA 2OYKA 1GC1H 4PBXA 1KV3A 2VDRB 4TNEA 4BZ1L 4L1DA 4LFHG 5E5UB 4RGNC 1UD2A 4QXUL 4J3TA 2IG2H 4JO2H 2VDPB 4IKNA 3U7AA 3GXPA 4QXGL 1SXBA 2WQ8A 1FGVL 5FO7B 3IN2A 4KV5F 4X8CA 5HJGA 1I1FA 4NLHA 3VD0A 5A7BA 1HK6A 5I8OL 5DMKA 1NC2B 3ZKXB 3MBEB 4MXVE 5I82A 4P57A 2Q2EB 5DJAA 1UASA 1BEYH 1BM3H 1ONQA 4MB1A 3LHPL 2WUBL 5C08D 1AZRA 2HN7A 4PRPB 3QZWB 2W0FB 2ZYSA 4ZTPL 4Q9RL 5BMFH 2EDXA 5FM5O 1IFHL 1OTTD 3UYOD 1JCKA 1I1AC 2VCOA 3SQBB 1ZT4B 3E1ZA 1U33A 3HI5L 3QB7C 3ULSB 4ERSL 4N2GA 5JYMA 4JJ5A 1I4FB 2Z4TA 5HYQB 4J3XA 5GGSA 3HG0A 4AL8H 5F3BB 3LS4L 3ZE1E 2AJVL 2NSQA 1OHQA 5ICXB 5C0AB 3CGTA 2CIIB 3P73B 4G8EA 2J5LC 1MVUA 4M93B 5F9WC 2IPUG 3IMUA 5F1IA 5L9DH 2O6DA 4V33A 3U46A 5BZXA 4YS4A 3MQIA 1UKQA 1DJIA 1CU4L 3E2HC 4UBDC 2IPKA 2X4SB 4JFDD 3ZXAC 3BQUC 3GLEA 4DK6A 1JPSH 2A83B 5L0QB 1A66A 4MAYA 5GJSH 3HZKB 4HDIA 3L7FA 4L4TB 9PCYA 1LWJA 1CR9H 4HT1H 4XPBH 5HI5C 3BEWB 2DQGH 3FCUB 2GBTA 1JZEA 3HA0A 3K2UH 5GGUA 4N2LA 4PG2C 5I24A 3OF6A 4ONHA 1NCGA 1JDDA 3Q5YA 4AE0A 5AVQB 3BIBX 2FX9H 3CNKA 1HHGB 1SJEB 3ETSA 4L3FA 1EJ8A 4GMSH 5F1IB 1UURA 5AVZB 3PDDA 2FJFA 5IB2B 3ULUE 5A43C 2ZXEB 1CL7L 4YXLL 1N5AB 4MJHA 5E51A 4ZXBC 4FLQA 2Q6WB 1QSVA 1OCOB 2IGFL 4Q9QH 3QJTB 3QUML 1X5HA 2GITB 5GRJL 1ZE3H 4P3DA 5K9KA 4A7VA 4FJZA 2XYBA 3V6OE 4EDWH 2WXOA 2CDFB 4JZJA 4JO1L 4WY7H 2Q3ZA 1NC2A 2R2HA 5AVTB 1A25A 2Z8WC 1G0XA 3QEUB 4HD9A 4MXQC 5D96B 2MCPL 3UYPB 2ZKWA 4AOFA 5E1GA 5BV7B 4Q56A 1I1FB 1U3NA 5KS9B 2F54B 3KWVA 4RWYL 4F2EA 1XSOA 1S5HB 1SHSA 5DI8B 3RPIA 3HTLX 4OLUL 1V3KA 2W5PA 1GOFA 2CNZA 3CBRA 3MJ9H 1AZBA 1I1YA 5I75B 3DX6A 2G5BB 3V5KA 2ICEB 1WH0A 3AW5A 3BAIA 1U6AH 2E27H 2G5RA 2WKLA 3WO3B 3VFNB 2CO7B 1TJHL 3DJ9A 1DVSA 1S7WB 2A6KA 3QUYC 3C6LD 3C2SA 3KPNA 2FUQA 1CFTA 4KH2A 3QJVB 4NN6C 3APDA 4KITB 5I15L 1TLMA 1MIMH 5AKSA 1A3QA 3PWLB 3VMOA 2WO4A 3MNMA 5TE6L 5I1EH 2BZ7A 3WJLA 4NHUA 5E70A 5C0EA 1R1CA 5D7SH 3RKDC 3A67L 3VFSA 1YPZF 2WNXA 4WWKA 1MAJA 4N2AA 4AE1A 1TVBA 1S9YB 2XVKA 2C1OA 5C0RL 1IBYA 1QNZL 5C97A 1I9IL 2YSTA 4KGJA 3T77A 3V6BR 1EJOL 1J5IA 3HG5A 3MA7B 4CC0A 1WS7A 4KRNA 5HGHA 5HYJE 5IMKB 4F7CB 1V5JA 5C6PB 1KXHA 1U30A 2UWEE 3CFBB 2NY5C 1J8HD 1S78D 3AS2A 3FT0A 3VXQB 3OHXB 1GGBL 2N7SA 4N2OA 1HYRC 5DGRA 1JZ6A 3ZZLA 2V17H 3V8OA 2F53A 1FV1A 1UA3A 4YSUA 4ALAC 1UM4H 2LLLA 2BWDA 4UV4L 5DHVH 1URZA 1I8IB 5G55A 2PW1A 3ARXA 2WBXA 6CGTA 2YARA 3H55A 1MUJB 5ISZA 4OZHB 4IBLT 2MFNA 4B97A 4XMZA 1JN6A 1RIUL 3VAEA 4AYDC 5LJYH 1WHOA 4NNYB 2CSPA 4FYRA 3CZFB 2I5YH 3IVKB 3HZKA 1ZS8A 1AXIB 2UVFA 4HDIB 3P4OA 5GSRA 4CDHA 1SXCA 5DDHA 1NDTA 1JWSB 4BGLA 1A47A 2O26U 1V3LA 4GQPH 2OMZB 4QRSB 5CCKH 1UWEL 3QR1A 5BO1H 4IU2A 4RGNE 1TETL 1A02N 1NC4B 1U2CA 2YEZA 2X4UA 5F1NA 4OV5A 3MPCA 1KPUB 3QDAA 1V3MA 5FHAH 3PWPA 5L6YL 5B8CB 2HLAA 5L2JB 4TRPL 4Y16D 5DJDB 3JVGC 2UV3A 1KJ2H 1PX4A 4Z3EA 1J18A 2VLMD 4I0CC 4C57C 1EIBA 3IWVA 1SXZA 4P49A 3CVHH 3CG8A 5KWYC 5HHPB 3UPRA 1YUHB 5B21A 5J6HB 2WLNA 5CHNB 1OAXH 3PABB 5EC1A 1P4LB 2YEVB 2XC8A 3IJYB 4MDJA 3VXUE 5JHBA 4YDKL 1G84A 3LXUX 1HQ4A 1I7ZA 2OYPA 3ULVL 3BUQA 2ATPB 2WAHA 4UQCA 4YBQC 2ZJSH 5JUEH 4M43L 2A2QT 3RWJB 5TE4H 5FGCE 3EGDB 1FDLH 1GXEA 1BQSA 2YPVH 3MBEA 4MJIA 4WAFA 5ESVB 4ZTOL 1IGMH 4ORZC 4PJAF 1JGUH 3FUMA 3NJNA 4L9LA 4YZWA 2ZUQB 2OKMA 5J8OA 4ZO8A 4KHTL 5MEOA 1OAUL 1CDUA 4WEMB 4UWQB 3GF8A 4IS6A 2DQFB 4AGNA 3HRZB 1MOEA 4DGUA 4JFTA 4F2MB 4TPRL 2LE9A 5ISZD 4WWID 1AACA 3FQTA 5F1KC 2E7HA 1Y1UA 4RFEB 3B2MA 4WO4B 5T1KB 2X6BA 1CDCA 4PREB 1A4KB 1GZQB 1XF2B 3F58L 2ZP9A 3PUCA 4GKZA 4AK2A 1FAIH 1TZGH 1JK9A 2OR8A 1X5KA 2XG4A 2ZG1A 5IW6A 4PTTA 5EF2A 1XCWA 1R19A 3BMVA 4PJ8D 3RTLA 3ARDA 5G4NA 1ZHNB 1IBGL 3CSPA 3QWRD 5HD8D 1T7YA 5JMRA 4RGMB 5TPWH 3EOAA 3HR5B 3IRZA 4OJFL 3Q8BA 5SWSE 1ZDSA 3MJ9L 4QOKA 2OW7A 3WIIH 3B9KB 4G8FB 3W9DA 3AXHA 4K2UL 5AW5B 3ZU8A 1SEQL 2P9RA 2GHZA 3BLPX 3QUMB 3T9WA 2PYEE 5FYLH 1TYRA 1A7OH 1GY1A 3F7PC 4HJIA 3TPUA 2CDEB 5EPMB 2QADD 1XL4A 1CMOA 1F2QA 3B9KC 4MA3B 2WTPA 3QG7L 4R5VA 4ZD3L 2Y72A 2BOCA 1IILE 2IOIA 4CSZA 1MLBA 2A9MH 3BN9D 4N1EA 4ZQKA 1FO0B 4DETA 5JR1L 3WKMH 3RI5F 1KEMH 3IGAA 1MCOH 1WZAA 4GRLB 4ZX6A 1AG6A 3Q8FA 1DFBL 4JDTH 1FBIH 5IBLC 2EQDA 3GPSA 3H3BC 5D6CA 2K9FB 4PJAA 3ULVF 5ICUA 3CH1A 3DMMA 1NICA 1QRNA 4UIKL 4F33A 2WBJC 3TF4A 1SZNA 2AXGA 3D87B 3GGWB 3Q6FB 5INCB 3S4SA 3OJMB 3WN5C 3WO4B 2YSSA 3LV3B 4MS6A 3QIUC 3IRCA 1AO7D 2CO4A 2VJ0A 4N5ED 5EORL 1DDTA 1DCEA 2GFBB 5I5IA 5I1GL 3ZGIA 4BV1A 2XACC 5SX4H 1R3LA 3G7TA 1DJXA 3IJHA 4QTHB 1T80A 5TDPA 5TF1L 1WIOA 2P52A 4Q9BA 3TL5A 4XPBL 1NCHA 2GABA 4EBQH 1N8OE 2BIMA 5HGDA 1GYAA 3O6LL 5GJSL 5ABDE 4KX9A 1CF8L 1BZ8A 4NJAL 2BCMA 2EXWC 2BNQD 2R15A 1VGEH 4R8WH 3EO0B 2BSSA 1D6EA 2FWOA 4K23L 4NP4L 2JB6B 1KNOA 1SF3A 3EYVB 2R69A 1JAEA 2APVA 1NC2D 1WZKA 2W9LA 3E6HB 4K5LA 5HHMB 5I2IB 1NL0L 2LGNA 1YN6B 4WK4B 3IETA 1QWUA 4ETQA 1RZJH 4FZ8L 5BW7A 4GQQA 5CSZB 1XIWB 1DVFC 2DV6A 2I60H 1TZHA 2NUPA 3KPPB 2OL3B 2G2RA 1JIBA 3IPFA 5C0CA 3D4YA 5JQ6L 2AEQL 5DUMH 1TCRB 5GS1A 2PXYB 4X7EC 4RMBA 3AJ7A 1FZOB 4MJIB 4XVUC 4KZDH 4PSPA 1FIGH 1U0QA 4IQHA 1U92B 3ZIYA 3CJJA 4Z3HA 4XP4H 4Q6IB 1M3JA 4I3GA 3UG4A 3EXLA 1WFOA 2F7QA 5KJ7E 5KBMA 1IFGA 3VD2A 2L7UA 4HFWB 5AKRA 4ZSOA 4P4KC 4F80A 2EIKB 2AQSA 5J6HA 5E1HB 5J4MA 1K6QL 1T1WB 4KXZH 1DQDH 4PBDA 5J1TC 2CUIA 3RFZA 4F8LA 3HE6B 1JHLL 2JB5L 1G9NC 2P8PB 3F7VB 4G9FB 5I73B 2NR6A 1QD0A 3LQAC 2WWOA 1HCYA 4Y4FB 3RGVA 3S3DB 1JGLL 1CURA 4LEBA 2YKLH 4J3UA 3FB7A 1VZGA 1GC1L 3WUWG 4H8HA 2IXQA 4LHJB 4AMXA 2X05A 3U82B 3W82A 5GGVH 3L95B 3TN0B 4ZDHB 2J5WA 2P26A 4K3HA 1IZJA 3PGFL 4TVPE 5FO2A 3E3QE 3RAJL 4TMPA 4U1HA 2ZKMX 2WINB 2V5SA 4KPHH 1PG7W 2JLLA 4FKHA 4G6KL 5FF6B 3IKKA 4IBQA 5K39A 2GK0A 2L7EA 5H35B 5MEQB 3G5ZB 5JOFB 1MLCA 2NUTA 4MAUL 3B5GA 4JR9H 1X4YA 5BS0B 5IR1A 1OT2A 4UTCA 5AAWC 5E7FA 5E4OA 1XAUA 4XNXH 1KGCD 4RFOL 3US1A 1LP9B 1RZIA 3UZVA 1LLAA 3B8SA 1OTUC 1ETA1 1R34A 3ZYIA 5L4MA 3ARWA 5J11B 4HBCL 4FQHA 1KTCA 3THMH 2OXHA 1KIUB 1R0AL 2G4EA 2HFGH 5D7KE 2XNAA 1X44A 5IROA 2VW6A 4HUKB 4PAZA 4WHDA 4OI7A 1OP5K 1NAMB 1SJHB 1WFNA 4JFYB 3L4VA 3BCFA 4YSPA 3A6CH 4WK2B 3TVMD 3K80A 5H37A 3P4MB 5I1GH 2HYMA 2BSEA 1Y18B 2NRDA 3IPEA 4F8PA 3VB9A 4MQSB 5EIIG 5EIVA 1KCWA 4P5RA 3KPMA 4TUUA 5KTEL 5TE7L 1NEZB 3QFJB 2B1HL 1I8MA 1UJ3C 4BHUA 1OP4A 4QRQB 1ZHLB 1Z9LA 4UIKH 2IQAB 2PO6A 4TQPA 4WUUB 4M1GL 3S7GA 1BQHG 3U2SA 3T2NL 2C1PA 1QMUA 5IHWA 4H2AA 4JFHE 3CZUB 3SE3C 3DVIA 4R0LB 1YDPA 2BFGA 2I27N 3NCEB 4PJBB 1RAMA 3ARZA 5LBGA 3IAPA 4L2LA 1OT1A 4NKOB 2J4WH 4OM0H 1MZYA 4G6FB 4UYQA 4XTRC 3TBSA 4NPKA 2PPDA 1NJ9A 1CDHA 2ICEA 3FQRA 1MCBA 3W81A 3L3OB 5EC2A 2CCWA 1E7VA 3MRLA 1WBYA 1S9KC 2VUKA 2Y5EA 4CW1A 3LN5A 4N0RA 4DF9A 1BF2A 15C8H 5C0BA 1YNTA 1M7IB 4WGWB 3G04A 3QHFL 1MFCL 2WCGA 3QGVA 5D2LA 2DBJA 3FFCE 3QEGH 1E50A 4LEOA 3WFBH 4HX1A 2BWQA 2P48B 3QJSB 4WQOA 4XX5A 1F4HA 1AXSA 2CKBB 2YS4A 4TV3A 3V7AE 2DICA 4HIHA 1ZSDB 3F64A 1JD9A 1MHEB 2EDHA 2YBGA 5CN2A 2IALB 3K6SB 3OLDA 2OK0H 4ZMTA 5GIRA 1CLVA 4ZW8A 2OYMA 5T3ZE 2VXUH 2EH7H 5AW3B 2QT6A 2NY0B 4I18C 5F7WC 4L9DA 1ZLUH 4AKQA 1EO8H 3RP1A 4JRXD 2R4SH 2AAAA 4XNUH 1IU1A 5DJYB 4XI5C 4JM4L 2HPTA 1X6LA 4TPRH 4QWWC 4E5XG 3MA9L 1AKJA 3LKQA 5JDSA 3FUKA 3Q05A 3QDMA 2FR4B 1NC4A 3QNYA 3SKMA 6TAAA 2QMJA 3VFWB 3RVXD 1FWXA 1H5BB 2NPLX 4Z7VA 2EUXA 3LH2H 1ZANL 1KB9J 5JUEL 5HVGB 1J1XL 1MAMH 1SVBA 4OZ4A 3DXAB 1TZIB 2IGLA 3QUKA 1KYAA 1YEGH 4FABH 1TJIL 2EINB 2X1XR 2UZIL 4GI9A 1G6RA 5JPNA 1R3IH 3TLRA 1WWAX 2X5PA 4ZX4A 3QEQD 1FCCA 1EAJA 3MXWL 1ETJA 5DRXB 4JK0D 2V5YA 4EOWL 4J1UB 5HI4D 3P73A 2XWBA 4UUJA 4DW2L 2XFXA 2JWYA 4ZUUA 4ZBJA 4QCIA 2QJDA 2P4AB 4LOFA 4PHXA 1X4XA 2EDKA 2OCFD 2PTTB 4JPIA 3ELAT 1BMGA 3NIFB 5EDSA 2H7WA 1S7QA 4JG1L 4L3ED 1UGNA 4XAKD 2YRLA 5IWLC 4IDJH 2XI9A 4KJWD 2GUOB 3VXQA 4TLKA 4HF5H 2LU5A 3TU6A 2ZUSA 1A9VA 1OK8A 1A1OB 4ODWA 3E1F1 4MBOA 5HYIA 4TUOB 1IL1A 1WT5C 5DRWA 5EEWA 2YHGA 4TLTA 5J7CC 3PJSB 4P4RB 4MMXA 1MVYA 2BCKB 5BJTA 3Q6GL 4J1UA 1WLHA 1SBSL 1QVOA 1CDJA 2V17L 2DTMH 4ZMPA 1FYHB 1KJMA 4EAEA 3S34L 4E9XA 4BFIA 3HKZA 5CP7A 3RL1B 4BJLA 4R4FH 3ARFB 1I7UB 4FXKC 4OIFA 2XICA 1A2YB 4B5EA 4UB0L 3IDIA 4FNUA 4OGYL 3WFEL 3I9GL 2Z4QB 3O8XB 1H5BA 4P5TD 3VGEA 1NSNH 2CO1A 2R1XA 2OMVB 1EJOH 3FOMA 3OTTA 2CRYA 3EJUA 1WQVT 3GMQB 3RX5A 3PUUA 4OFYA 3CFKB 2EO7A 3FNKA 3L3JB 4JFOB 1TQBC 4J6IA 4HEPA 4JANA 1UH3A 2YZ1A 1AKJB 4W9JC 2IFFH 1RZFL 3IDIB 3HNTH 3SD5A 3HE7B 4OCMC 3ARVA 3SDCB 3KDMA 3OJDB 1E3FA 5I8KH 1QQDB 2CE6A 1TIUA 3CBJB 4HS6A 1SN0A 2EKSA 2WOYA 5HHXL 4U6VL 3MRJB 1HKFA 5LUMA 2X4TA 4QO1B 4JM2F 4UAOB 3VXPB 3ZDXE 2CK2A 5I0ZA 3FO0L 3MV9A 1B4RA 1EXHA 4OCLC 5I15H 1QWHA 4AENA 1NMCC 4PJXE 5DD1H 5FDYA 3L5WB 1QPXA 4N2IA 2WAQA 3BP7B 3HNSL 1LVEA 4NZTH 1CK0H 2NCEA 3MRGB 4JMXA 4XCFH 1GY2A 2BOBB 1WTLA 4OZIB 2YXMA 1IKOP 1FE8H 3G04B 5D2LB 5CUSH 4JVPA 1C08B 3KPSA 5BCAA 4GINA 4ODWB 5IB5A 1KDJA 5D8JH 4BE5A 5AFAA 4GXVH 4Z5RA 4XNDA 1NAKH 2JE8A 4P3DB 3QDJB 1SLWA 2YO3A 3UTSA 3P9MA 4ENZA 3OKYA 3MBED 7FABL 3LRHA 1TNMA 4Z77A 4XOAA 2MKLC 2ZF9A 1TZ8A 5ICYA 2PTTA 3B9AA 3OVUB 2C9QA 2ZPKH 3D69A 4Y2DA 1KCSL 2NY7L 3GMNB 3QZWG 4RWYH 1BJ1J 3MLPA 4ZXBB 3QIWC 1P5UC 4HKXB 4NNPL 4R7NB 3QFJE 4Z3GA 2XFXB 4OIBA 1N5AA 1NLBH 3E38A 3HLAB 3QQXA 2RQEA 2X6UA 3AREC 4IW4C 4N22A 1HILB 1T5KA 5D5MA 2WKGA 5C0DA 3QIBC 2DQTH 2FB4L 4JY4A 1T21A 5C6TH 4WUUA 2L0DA 4UAHA 4POYA 2GT9B 2B9BA 3MREB 1HNFA 2XJLA 2ZG2A 4LDCA 3VDAA 1NLBL 4MMZA 1JPFB 4ZPTA 4MLSA 2JK5A 5E1QA 2CJUH 4Z7IA 2WK2A 3FQ1A 2OMYB 1S7RA 4W81A 5LBSL 2OTWB 1AR1B 1G5GA 1RMFL 5BZZA 4PRNA 3ETBJ 4ZS7H 3VFWA 4Z76A 1KCVL 2WB1A 3K8MA 3GSXB 4FI7A 5ACZB 2JELH 1S3RA 2GTZA 1N7MH 2XV6B 4S2SB 3LKQB 5LWYH 2J12B 5EIIB 2K45A 3FO9B 4Y5YC 2GSGB 2K3HA 4N0UE 1OIOA 4OJYA 3MLWH 1GL4B 4GW4A 1EAPB 4AI7A 2GKIA 1KIUA 1KN4H 5FDWB 4X6DF 4NKIL 1SBSH 2GG1A 1V54B 4Y5YB 5DD1L 2LT9A 3Q6GH 4P57B 3VFPA 4P2RD 3VI3F 4P59H 3MLYH 4UM8A 5AG9A 4KUCF 7PAZA 1ONQB 1MFAL 3EJPA 1PDKA 3OKDB 3FH8A 1XD1A 3MRIA 3QJOA 4NN6B 5E2VH 5FUOH 1VHPA 4MFHA 1J7VR 2XTJE 4AM0A 3SDYL 3D51A 2O5ZL 2WO3B 3QIUD 4V1DE 3CZJA 1FZMB 5HVFB 3N42B 3P1VA 3L3IA 4PG9A 4ZOAA 5IG7B 4NO2B 3CPLB 4IEFA 2VL5B 4NIYE 8FABB 3C8DA 1ZJAA 2H1PL 3UBXB 4MNQB 3UL4A 1OARL 2QZ5A 2Y36H 3UAFA 4FA8A 4ZDHA 4FI6A 4G1MA 2R0WH 4F7TB 3COOA 4PTUA 1M4KA 4JM2A 4W4NA 5FUZL 4DW2H 1YPZB 5IM7B 1MCWW 1RJYB 4FNLL 5LHDA 4V2CB 3KL3A 3P4LA 3FB7B 4NN7B 3QUXA 4PJBA 3VVWA 2EEBA 1BXXA 3QUZC 4ZFZB 2E7LA 4WDIA 3LKOB 4B0MM 4EI6A 3STZA 5JXED 4ELKB 2C1PB 2BPBA 1HOCB 1EHNA 4PI2A 1ITCA 1HXYB 3ZO9A 2O6CA 3QZMA 5I1JL 4XRCB 4QXUH 4KC3B 5CJXA 3EF4A 3RFZB 5BRZA 3ESMA 4QRRB 1ZHLA 1NFIA 2EYRB 3BEVA 4MCYA 1JUFA 4MGXA 3NCJH 1FYTD 4ZSOB 2PP9A 1W6LA 5EBLB 4XNYH 3V4PA 3T3PB 2YPLD 4M1CD 3PU7A 3OKLA 3AY2A 1JZ4A 4HF5L 1BREA 4U1MA 5LQBL 4G8GE 5EOTB 3C5JB 4MMYB 1NAMA 1SJHA 4LPVA 4U1KB 2G2RB 5BUAA 1KJ3L 1HYSC 1JDCA 4OI8A 2XXFA 4L0PB 3UJTL 1KENL 3WD5H 1QG3A 3C2AL 2PABA 4X9GA 1NIBA 2J8HA 3QUHA 2V3FA 4IMKC 5I2IA 2BRQA 5TDNA 3KEDA 3K91A 4LSPH 2HT2D 3ESNA 5C07E 2J6WA 3TFKD 3WS6A 4WWNA 1X9QA 2CRZA 4FOMA 1FRGH 1YMHB 3ERXA 2Z1PA 4WNQB 2PWFA 1N26A 1VLXA 2F15A 2VXTH 2P80A 3AXIA 3E80A 4ISVA 5D6DC 3TZVA 3VMPA 4ZMYA 5IR1B 4XO9A 1U8LA 1GGIH 1J0KA 3BKYH 1J0JA 5LDSA 3TO4B 3HI6H 2Q76A 4F7KA 4DZ8B 3WTXA 4I5BB 4L4TD 1YMHA 5I0WA 3EFOB 3AITA 3QIBD 4LPCA 3CDCA 2WWKT 1S7XB 3O2VL 3OKOB 3I74A 2DY2A 3HPLB 1CFQB 4DEWA 4LRIC 1