1OOWA

The crystal structure of the spinach plastocyanin double mutant g8d/l12e gives insight into its low reactivity towards photosystem 1 and cytochrome f
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VEVLLGGDDGSEAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
publication title The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Electron transport, membrane
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oowA00
5F7AA 2VSMB 1L9RA 1OCRB 1NWPA 1KCWA 4AX3A 1M9WA 2DWTA 3ZDWA 3WKQA 2XX1A 3OQRA 1AS6A 4BWWA 4AKQA 2MRYA 3NP3A 4E9WA 4YSSA 2A3TA 1PZAA 3WIAA 1GY2A 2ZXWB 4YSDA 1JXFA 4NERA 1E67A 1KYAA 2YAPA 3X1FA 4HCGA 2P80D 1KDJA 5D4HA 1WS7A 2HX8A 2UXTA 1SF5A 3T6WA 2BZCA 1JZHA 1WA1X 4PAZA 1L9TA 3TBCA 1YLBB 1KBVA 2CAKA 3EF4A 1RZPA 7PCYA 5ANHA 3NJGA 2PCYA 1IC0A 5B7MA 5I6NA 2Q9OA 3AY2A 1GSKA 3AG4B 2BHFA 4E9XA 1EZLA 3OMNB 4G72B 4DPCX 4M4RB 1ADWA 4MFHA 2WO2B 4DP7X 2UXFA 3ERXA 1JXDA 1A4AA 3ASNB 3IN2A 1NPJA 2YXVA 3UGEA 4DPAX 1J5CA 1M56B 1PMYA 3V9EA 2LLNA 1PNCA 1OCCB 1KDIA 3DKHA 4YSQA 2Y1AA 3FT0A 1AQ8A 1PZCA 1SFHA 4HAKA 2TSBA 2FNWA 2AANA 1OCOB 3H4HA 3NSDA 4G7RB 4P5SA 2IH8A 3D12B 1OE2A 3U25A 1NIFA 1JXGA 2VW7A 4L0PB 3PAZA 1V10A 2XXGA 4BDVA 1E5YA 1J5DA 2FJSA 4DP9X 2BP8A 2FQFA 4DP8X 2XV3A 3JTBA 1ETJA 3PAUA 3HB3B 4F2EA 1BXAA 4AZUA 3OMIB 1URIA 2VM3A 3FSAA 3QJTB 4A2EA 1KGYE 2IAAC 1ASQA 2FWLB 3G5WA 1WA0X 2FT6A 2GB2A 2ZWNA 1NIEA 2X87A 4YSAA 4W1TA 2R7EB 1DZ0A 1PAZA 4JKNA 2XXFA 1E5ZA 1W8EA 4KOCA 4EF3A 2GC4C 1AACA 4JHVA 4E9QA 2AZUA 1PF3A 2EIMB 2Q5BA 3PCYA 4W9ZA 3IBOA 2I7SA 1UATA 2XV2A 3ASOB 2QDWA 1X9UA 1BEXA 1PLAA 2HX9A 4KNUA 2BP0B 3FQ2A 4DP2X 1QNIA 3NJMA 3FSVA 4WTQA 3H4FA 4HHWA 1HFUA 2NRDA 1NDTA 3FQYA 5B1JA 3ZIYA 1NIBA 1VLXA 2JXMA 2IWKA 2UX7A 3UAAA 2PPFA 2CUAA 3L45A 1ZDSA 1SF3A 4YSUA 1PLBA 4YSRA 1TEFA 1IKOP 4DP6X 2UX6A 4E9RA 4YSTA 3TA4D 1AR1B 3FSWA 4Q89A 4QKTA 4YL4A 3AG2B 1NTDA 2IWEA 3KW8A 2IDTA 1J9RA 2B08A 3S8FB 3S3BB 2OJ1A 4KNTA 1XB6A 4WKXA 1RCYA 2DYSB 1TU2A 1BAWA 2VMJA 3T9WA 4HCIA 5AZUA 3GXUB 3QJRB 5TK2A 3GDCA 2OV0A 2CBPA 3CDZA 2YAQA 3NSFA 3QJVB 4JHUA 2IDSA 1NZRA 2WO3B 2XYBA 1I53A 2W8CA 1N68A 4A2HA 3SQRA 1SHXA 3C75A 3X1EA 1OV8A 3NP4A 2UXVA 5PCYA 3CVDA 1ID2A 4E9VA 1ET7A 1BYPA 1DYZA 1AZCA 3N2JA 3DIVA 3WNIA 2FQDA 1CYXA 1NIAA 3AZUA 1XB3A 1JZIA 1SDDA 2AFNA 2W88A 1L9PA 3NJKA 5EHFA 4AKOA 3BQVA 1A4CA 2GC7C 4E9TA 3IE9A 2PLTA 3HEIB 1OE1A 1AIZA 4A2DA 3EH3B 3UACA 2VW6A 4K9JA 5B7EA 2BO0A 1A8ZA 5F7BA 5I6MA 1GS7A 4HZ1A 4GP8B 5B1JC 3FU9A 3NSCA 3OD3A 5I5JA 1NICA 3SBRA 1L9SA 5I6KA 4G70B 1AZBA 2N0MA 1R1CA 4DP5X 3NSYA 2EINB 2CALA 1A3ZA 4A68A 4GXFA 3NJNA 5B1BB 3N55A 4FAAB 1XB8A 3NYKA 4BWUA 2QPEB 4HHGA 3IN0A 3SBQA 3FPXA 4GP5B 5FC9A 4AKPA 1PY0A 2PPEA 3ABKB 3FU7B 2PP7A 1M57B 3IEAA 1BXUA 3CG8A 3TASA 2YXWA 1JZJA 2AVFA 1E30A 4YVNA 1GS6X 5AKRA 2H47C 1AZRA 1AOZA 1JVLA 2MTAA 1V55B 4KO7A 3UABA 5A7EA 1BYOA 5AFAA 2GBAA 2XVBA 2BWDA 1AG6A 1AG0A 2JKWA 2BW4A 1ZIAA 4Q8BA 6PCYA 4NAJA 3MX0B 4NB7A 3EH5B 2DY2A 3ABLB 4G71B 4A2GA 2DV6A 2PPCA 3NJIA 3TU6A 1ILUA 1AAJA 4BXVA 4KO6A 2YAEA 2YAMA 1JOIA 3FYIB 4E9SA 1EHKB 1NWOA 3WNJA 2FTAA 3DTUB 3GYRA 4ENZA 3UADA 4KNSA 1OOWA 4YVUA 4GP4B 4A67A 4CSZA 4HALA 4YSEA 4M3HA 4N4YB 2QPDB 3NJJA 3BVDB 3EH4B 4UF7C 2E86A 1XMEB 1MG2C 2B3IA 3SBPA 1T5KA 1GY1A 5D4JA 1TEGA 1X9RA 4BWTA 2GI0A 1PCSA 1WAEA 1L9OA 5B1KA 1JZFA 2R7EA 4DP0X 4HCFA 2I85A 3S8GB 1IBYA 4KO5A 2AZAA 1HAUA 1QHQA 1W6LA 5LDUA 3T6VA 2HXAA 4DPBX 2DWSA 1FFTB 1BQKA 4X4KA 1GW0A 3ZBMA 1B3IA 1SHWA 2BP0A 1PZBA 3NT0A 5E9NA 3PXLA 3T6XA 3QJUB 1KCBA 1N70A 1AS7A 3FS9A 3V9CA 4A2FA 3TBBA 8PAZA 1A4BA 1L9QA 3PAVA 2XUWA 5I6OA 3FSZA 4QLWA 2YAFA 3H56A 1J9QA 2EIJB 2TSAA 1NINA 1CURA 3JT2A 4YSOA 4BDVB 4F7KA 1FA4A 1ZV2A 2GHZA 1J9SA 2BP8B 3CVBA 3UAEA 1ASOA 3S3DB 4P5RA 1TKWA 2H3XC 1WS8A 1JZGA 5B1AB 1SFDA 2VN3A 2P80A 2IDUA 2H5UA 2BWIA 7PAZA 1BQ5A 3X1NA 3EHBB 3X2QB 3NJHA 2HZHA 1GYCA 2FQGA 1J9TA 3PPSA 3MBWB 4E9YA 2IDQA 1SJMA 1JZEA 3QJQB 2J57A 4KO9A 1A65A 4G7SB 4A66A 2IH9A 2I7OA 2ZONA 4UAHA 1ZDQA 5I26A 1WA2X 2WSDA 4DP4X 3X1BA 1CUOA 4PCYA 1ASPA 1PLCA 1ET5A 1BXVA 3S3CB 2IWFA 3NJFA 2CJ3A 2BW5A 2ZOOA 1GR7A 4GYBA 3QQXA 2VSKB 4RH4A 4TXVB 2PCFA 3FU8A 2BZ7A 4CSPA 2QT6A 2YQBA 2FT7A 2DYRB 1MDAA 1IBZA 1OCZB 2HLEB 2Y69B 1F56A 2PP8A 3QJSB 1OF0A 3T71A 3X1GA 2XLLA 1NPNA 1JERA 2IDFA 2YAOA 2PP9A 3AW5A 2J5WA 5I28A 5I6LA 1CYWA 9PCYA 1KV7A 1RKRA 3NJLA 2XWZA 5TK4A 5D4IA 1MG3C 1E65A 1AANA 2VW4A 4ZK8A 1AS8A 2PPDA 2CCWA 1ZIBA 1JVOA 3OMAB 2PPAA 4YSPA 2QDVA 5IY5B 4G7QB 2GSMB 2X88A 3PLYA 4GY4A 4UANA 3ZX1A 1RZQA 1ZPUA 3ABMB 4N8UA 1ET8A 1FWXA 1CC3A 3AG3B 1IUZA 4FA7B 2XX0A 1GS8A 2OCCB 3FYEB 3CVCA 3AG1B 5I5IA 3RYMA 3CDZB 1SNRA 2RACA 2XU9A 2VM4A 2JFCA 3QPKA 2YARA 3FPYA 1MZYA 4KOBA 1HAWA 2XV0A 1AZUA 1ILSA 2GIMA 1V54B 1NIDA 4BXSV 3FU7A 2UXGA 2HRHA 2FT8A 3FQ1A 2J56A 1BQRA 1KBWA 3T6ZA 1AZNA 4AI7A 2HRGA 3WKPA 3CZUB 1W6WA 3ABGA 1QLEB 5I6PA 2YAHA 2EILB 4BK5C 5I5MA 4HIPA 5B3SB 2EIKB 3KW7A 1MZZA 3OM3B 5PAZA 4YSCA 3WG7B 2HX7A 2FQEA 3WI9A 2J55A 4DP1X 4F2FA 1SDDB 1OE3A 5B7FA 1PNDA 6PAZA
chains in the Genus database with same CATH superfamily
1K3IA 5IJCC 2PTTA 1J5OL 1L9RA 4MHHI 4FMVA 5T33L 4RRPA 5EU4B 4FL4B 4HJ0D 5FM5O 5CP3H 1KIUB 4B53A 5FW7A 4ZUSB 4HUNB 4D9LL 4PBXA 2PXYA 3F01A 1B6UA 3X3FL 3WIAA 1GY2A 4ZW5A 4OM1L 3TFBA 3ZT5A 1JAEA 5D1QB 3FJTA 4YSDA 4NERA 1AO7E 4PJBB 4B0MB 5F8QC 1QUPA 3KLQA 4OLWL 3BVVA 1X7TA 2LHAA 1MCPL 2KC0A 4NM8H 4YBQD 3RIKA 4BRVA 3DXAB 4PJEA 1XH0A 4I0CC 4AITA 2VR9A 1JZHA 5AUMA 3RB7A 2CLZA 2FD6L 4H1LH 4YIQB 3STBA 2A9NH 3CZGA 5ANHA 4PS4H 5JIHA 5BOPA 4EKXA 4Y5VB 4LGPB 5EULV 1P69B 2I27N 4XX5A 5KZCB 3QE5A 3D3VA 4JPSA 1WFTA 3MODL 4KK6C 2OL3A 5D1ZD 3VXRD 5JXEA 1WZ1L 4F9LA 1KTLA 4NQVA 5GGVH 4NBYB 4GQZA 3ASNB 1KF9B 4LGSB 1YYLL 1D7FA 5A1AA 2BRQA 12E8H 1E9OB 3D06A 3ULUF 3OSVA 4ATTA 3RGVA 3EBHA 5AWNL 4YHYB 3MRJA 3L7EB 3H4HA 1ECZA 3HCVA 3VXSB 2OMUA 1P1VA 3HBPA 4PSRA 2HTLC 4DVBA 3CDFA 1FNSH 2BFVL 3QS3A 4IBQA 3QJFB 3SPVB 4RFNC 1V7ML 3RIAK 1EEYB 4BBWA 4KV5E 3FTVA 4H44C 4ABUA 1DJZA 4JCLA 1U9KA 3V0EA 2HB0A 1A64A 1J0KA 3P4OA 4Z9KB 1J1OH 2ZCKL 5KYNA 2XV3A 1UOKA 3DK2A 4M48H 3B9KD 2AXWA 3W57A 5EUOE 2ZXAA 4Q74A 2DJUA 1TG8A 1BGXL 5E24E 4XPHL 1I7RB 3ARGD 2A77L 2F7OA 4AUJA 1AQDB 3ILEA 4X9BA 5GHWH 4NCC1 2X28A 1MCNA 3MBWA 4I0PD 2CR3A 2Q7NA 2J88H 3QORB 2WXOA 3OJDA 5KN5B 2VWEE 4FZEH 1L0PA 3DTXB 1MUJA 2CKBH 2VDRH 4NC0B 4P23A 4V1DE 2K6YA 4E9QA 1CTOA 2D9QB 2VAJA 2G75A 5DJCA 4X5XB 4N8PA 3UXFA 3VWJA 1LEIB 5C09E 3ISRA 1I1RA 1HDMA 1A6ZB 4L3EE 1HH6A 4AT6A 5BV7C 4ALAC 1C08A 2FBOJ 4OFVA 4EUPH 2R2HB 4KROB 3KNBB 3QO1B 3R06A 4G8FB 3SYOA 5J9PB 1FYTA 2B7DT 4FNSA 4NM8L 4NKDB 3M1OA 3ESVF 2VITB 3LS5H 1OAZL 2W60B 3O9WA 4YSUA 4L8BA 2A9NL 4BUQA 4PS4L 5I8CA 5E00A 3B8SA 4DP6X 2WSPA 4IU3A 1HL5A 3LHPH 3QXDB 4XHQA 1BPVA 1YECH 3FSWA 3KEHA 1QZ1A 3EOTH 2UWEB 1FAIH 5TFSH 4UZSA 4U49A 4LRIC 1ZS2A 1TYJA 4JKWA 4W68A 4WKXA 1RCYA 5GGVL 1BAWA 5KYYB 3HE7B 1JGDB 1GYUA 4J6IA 4P2QE 3OJ2C 1KT2B 4NNXA 4FXLA 4JX0A 2YAQA 12E8L 2FZ3B 5DJZA 4WSGA 1RPUA 4X7EC 1UA3A 1CXFA 4JCMA 5FO2A 4X9FA 4DKFH 3BGFB 3P9LB 2EVFA 1U8HA 1H3TA 4YDLC 4XT1C 1AFVH 1FNSL 4FDWA 3KPRE 4Y19B 1OV8A 1UXSA 2UXVA 2JI1A 2GJ6E 1QKZH 4OCRH 5SV4A 3HUJF 4OJDH 2OR9L 2KL6A 4LKCB 1J11A 1VEOA 2Z4QA 2Z93B 3N2JA 4OF0A 3ZVVA 2EDWA 1MFBH 3IJSA 5A43C 2HH0H 1CYXA 1J1OL 3GXDA 1XB3A 1ZS8A 3LXAA 1X5GA 3QJHB 2Q6WB 3ZR5A 3HBQA 4M48L 2UYLB 3MRCB 3PL6A 4U3SB 3SJVD 2WBJD 1XCQA 3FCSB 3QEHA 2R0KH 2YEZB 2R4SH 3MLRH 3MZGB 5GHWL 1IC4H 2EKSB 5DS2A 1CDGA 1WIPA 4WI7A 3MDJA 1JWUB 1BJ1J 2BO0A 2J88L 4OJEH 1Q8MA 4FZEL 4O2CB 5B1JC 2CKBL 2VDRL 3A21A 2HPOA 3NEXA 2F53E 2OXGA 3QEQE 5I5JA 3C6EA 1AGCB 4UM9A 5LAXB 2BXZA 1KG0B 2NYYD 4TL5A 5DRWA 2YIHA 3MRIA 2YA2A 5KSAC 2Z1PA 2HUHA 1H5BA 1OEZW 3EYQC 1AXIB 2Z0UA 4HISA 5ABDE 5IOPA 3T1WA 3NJNA 2P8LB 2W91A 4FG6C 1CK0L 3FB7B 3T0BA 5B3JF 1FVEA 3FPXA 5FC9A 5HTSA 2P48B 3EG9B 4NXKA 5J12C 8FABB 2WNGA 2WWKT 3GMMA 4E0RB 3DETC 2XN9D 1L9NA 4OLYH 3TASA 2EDKA 3W81A 4RIRB 1I85A 1A6TB 1QLFB 3HS0A 4R0LB 5MEQA 4GI6A 4CMMA 3LS5L 4AYEC 4QF1A 5DJYA 3GTVA 2ZAHA 5EIIA 4UTAH 4MA1B 2IBZY 3PHAA 2GG1A 1Q9KA 3L48A 3P9MB 4HKZA 4KO7A 4MTMA 5HJGA 1GJWA 3DRTB 3LHPL 1M42A 1UWXK 5JPMC 1YECL 1JBJA 1Q72H 3EOTL 3MSPA 2X0VA 1EDYA 1FAIL 2CDFA 2JIXA 5DWUH 2WO4A 5TFSL 2I9TA 4FXGC 4YR6B 1TMCB 3LY6A 2NLJA 3I75A 3LXUX 5KUKA 1DQLH 3IDNA 3W37A 3IMBA 1RZ8A 1VFUA 4NNYA 3DX8B 3OLDA 1SPDA 1I1AB 2YAMA 4TUJA 4XGZB 3OB8A 1S9KC 4DN3H 3WNJA 4M8RA 3MRDB 3MTXA 3ULVH 3HNVH 5JORB 1GC1C 5GS0D 5JW5A 4DKFL 1XH1A 3LOWA 2VUKA 2AJZA 1UASA 4YSEA 1HYSD 3C9NB 5D7JB 1AFVL 3T0ED 3EH4B 4QR7A 1L7IH 2R27A 4CN4A 5IHBA 1H19A 4GQPH 4OCRL 1QKZL 1SUJA 1GKOA 5DZOA 1DJWA 3BIBX 2I5YH 2NY0D 5EIVA 1MFBL 2HH0L 2RQ8A 2YD9A 3T2NH 1X5YA 3QARA 4HCFA 3DMMC 1MWAB 4W9GC 4EN3C 3RFZB 5DJDB 3BYTA 3RY6A 5BZDA 3KL3A 2R0KL 3MLRL 2R4SL 3KPQB 2AV7A 1IC4L 5C0AA 5FYKE 1PFOA 4O2FA 5GGTA 2GJZB 3BGMA 1F42A 3VB8A 1R34A 1BZ9B 3CHSA 4RWYH 3MRRA 3PXLA 1KCBA 4GEIA 5I75C 3IFOB 2IIJA 1ZHLB 3IFPA 4DQOH 3F7YB 5D7IA 5A6LA 5DQJA 4N6QA 2ATPB 2F6AA 1FN4B 1ZTXE 1CR9H 4JE0A 4B41A 2NUPA 3EZ8A 3WEXB 2DQIH 5HGAA 2F15A 3D8MA 1DJHA 3DNKA 2XY1A 1S9WA 4FJZA 2P9RA 4JPVH 4AYFB 4OLYL 1JZ2A 2QKIB 2XKNB 2XVGA 3IGFA 5KYXB 3W3BA 2QQQA 1T4WA 4H7VA 3EYOA 1P7HL 5EUOF 4IHBA 4UTAL 3GLDA 3QJXA 4HKJA 3BESR 1RUMH 5MEPB 2AEOA 1QUNA 1Q72L 1UJ3A 5GZOC 5DMIH 1A9EA 5LLIC 3DGCR 5DWUL 5FUCE 3VQMA 4CSSA 5TDPB 1TTBA 1MCLA 1D2PA 4AVHA 5DHVH 5F7UA 1DQLL 4CMHC 4PD4J 1N5AB 4PW9A 1P7QB 1UYWH 1RY7B 3GZKA 1L3NA 3BOVA 4UBDC 1RJZA 5E8OB 3MRFB 4DN3L 1UM6L 3TVMC 3BZEB 2WIIB 3ULVL 3HNVL 1R0AH 4JRXB 3B7SA 2FECL 3ARRA 2E9WA 3HAEH 5FECA 2HLFC 3B3IB 3SQBA 3BWUC 4NFCA 1L7IL 4WV1B 4HH9B 4Z6AT 1ZXQA 2OZNA 5LKNA 3L13A 3AB0B 5J1SC 2I5YL 1KV3A 1URZA 2VTFA 2MWCA 3EJYD 4L8CB 3T2NL 5IGXH 4UQ3A 4JFYA 1SBSH 5MENE 3B3BA 2V3FA 3VQ2C 3OKOA 4DSYA 2CCWA 2LR4A 4HG4J 5C0BE 4YSPA 1PZ5A 3EFFB 1YNTA 4XVOA 3AITA 2X88A 1IGFH 4W9EC 5F6HJ 2JK5A 1MRFH 2NTSP 4NZJA 1X5HA 3RNKA 3B9KA 2YPVA 4YDKH 3BGAA 1EAPB 4YBLC 4Y9GA 1GS8A 4DIXA 3ARGA 1FZOA 3LPPA 4RWYL 1OZTG 1HAWA 5ID1A 4ZMWA 2DW5A 2NY2B 2C7FA 5K9QG 4I0PA 3IF1B 1NAMH 2UZIH 4K8RH 4MNGA 3KPNB 4B9YA 3QORD 4DQOL 1ZE3H 1W0YT 2GJRA 5FKAA 5HYQA 3SSGA 3SO5A 1J5HA 1CR9L 2P8PA 4LCCB 2DQIL 4HUXB 4M7LH 1WFUA 2EILB 3BLPX 4MZIA 2VLJE 3Q5YA 1IAII 1ITCA 3P0YH 4JPVL 3FNKA 1FNEA 1BZDA 1MNUH 2J5LC 2R0LH 3QUXC 5F6IB 2X4OA 3KBFA 4KKPA 4KROD 3DUHA 5F7AA 2AEWA 1DZBA 3SCMA 1I1CA 3ATFA 1LILA 5BQ7A 4MA8H 3ABZA 4GSDH 3ZDWA 3WKQA 1E8YA 2R51A 1RUML 2CXGA 3TZVC 1RK0A 4JFSA 4PFEA 3RDTB 4XNQB 5DMIL 2KPWA 4IRJC 4OZFH 1AO7B 1F86A 1A9BB 1DR9A 2ZXWB 3OZKA 4R6UA 2CH8A 1UYWL 4GO8A 5T3XD 1KDJA 1QATA 2IADA 4CKVX 1LD9B 3L9BA 1MCKA 3RVXC 1RIUH 4PG9A 2FK9A 1A66A 3HE7D 3U46B 4LBEA 1S9VB 4BFBD 1R0AL 5FYLD 4LHUB 3NJGA 2A6KA 2ZX8A 5IMLA 1GZPB 3ATAA 4MDRA 1WTGT 1G7MA 1H8NA 5I9QB 1UOLA 4MAZA 3ARBD 2X4TA 3S37X 1KFGA 1M7DA 1KIPB 1KYOJ 1SBBA 1EZLA 4G72B 3TBTA 3D87B 2NDGA 3OKLB 1U3NA 1TMQA 1HSBB 3U1QA 2IGTA 5DQ9B 2UXFA 2VOTA 3K71B 1SBSL 1RHFA 3VI4B 2XPGA 3V7AE 2HJKA 4FG4A 4NIKB 2C26A 3DKHA 1IGFL 1KCVH 2JJSA 3EJJX 1MRFL 4H88H 3AAZA 1Z32X 3GM8A 5CGYC 3VI3B 4R4BA 2CNYA 4GKOA 2Y25A 3RDJA 1DQJB 3E9TA 1MJ7H 1I7UA 3D4YA 1U8PA 1T5WB 2PABA 4PGCB 3SKOB 2F7PA 2VERN 1HL4A 2G4EA 3ZKNC 1EXUA 2X6AA 3SBWC 4IKLA 4FQCH 4E0RA 4M93C 3GC3A 4PRBA 2KLSA 4Y4FC 1T0NB 3VG9B 3GLZA 1NAML 1J0JA 2UZIL 4K8RL 2B8OT 3QUMB 4JFHD 1KBKA 3BDBA 4G43B 1LL1A 4OKVB 3NIGE 5EUOB 2IV8A 4M7LL 2E9GA 4AZUA 1NC2B 2MNJB 2ADJB 5DJ2A 2B0SH 4NM4H 1W16A 3U2SB 3P0YL 3RWGB 1MNUL 2R0LL 2ZE0A 3K6FA 2OJEB 4P46B 2PXYC 4X6FB 3PQYB 1NFDA 2RD0A 2QR0B 4QO1B 3OF6D 5AAMC 3L9RA 1K5NA 3A4DA 2EE9A 2XN9A 3BIAX 4NCDA 4ODHH 4E41E 3DSFH 3HW7A 4JHVA 3KZ8A 4D9RD 1OAKH 5C09B 4MA8L 4GSDL 1Q90A 1Q9OA 1AE6H 4AV4A 4QTHA 4KI5C 1IRAY 4X9HA 4BQ9A 4NQUA 1X5KA 2BC4A 4RMRA 4EKJA 1V05A 2WZ0A 4M8QA 4M5ZH 2R29H 2P7TA 3IDJA 3U0TA 1JV5B 4UAOC 1O5PA 4FA6A 4TUOB 3ULUD 1ZHKB 3VFMA 4FTVE 1CGUA 4QXTB 3DX0A 5C0IA 2IWKA 4PJXB 4PV9A 1RIUL 2KDGA 3HZMB 5AW6B 2B20A 5AW7B 3WUWG 3KPSE 1I1AD 3FT4A 2YLKA 4JN2B 2UZYB 4NI6A 2GVYA 3UTZB 2QSTA 2YD7A 5JLZA 3KGRA 5I1IH 1OGSA 4NC2B 4XB8A 1OPGH 2NY7H 2APBA 2V3DA 5DA0B 4XHJC 2P5EE 4R4ND 4Q9QH 3RVTD 1DHKA 3T0EA 2ICWJ 1HC1A 4PBWD 1O9VA 4LZKA 1VFOA 2YD4A 2DF3A 3BSZH 4RDBA 3HPJB 3MUUA 4HGWB 3S88H 2FO8A 3PRZA 2OJZH 3CDZA 4FJ6A 4HS3A 4H5SB 5DC0A 4K3DH 5E8PB 1KCVL 4H88L 4BKSC 1DJGA 4WEMB 3ZDYB 1MJ7L 2XYBA 3K2MC 1I53A 1TJXA 3SDCA 3VFPA 3ZKSD 5I66A 1TSRA 3QDJA 3ISYA 2GJ6B 1EAQA 3K2IA 3C75A 5C3LD 3NP4A 3GSQA 2X4UA 5FO7B 2F1BA 3F12A 4FQCL 3K4DA 5CP7A 4BZ1A 4WFHE 1Z1WA 1HHGB 3AQZA 4M5SA 4X5WB 2MOGA 5TH2A 3GSOB 4XP1H 2YSSA 4YPJA 3V0JA 1JPFB 4Q0XH 5J0BA 4N6RA 3TIDB 3I9IA 5JW3L 4DGYH 2X1QA 4DO4A 3BD5A 5HYJB 3VWJC 4CVXB 4MB1A 2B0SL 1OARH 4NM4L 2AXFB 1TCRB 1S6NA 1IGMH 3EJUA 5LQBH 1AHMA 3EH3B 2V5MA 5EU4A 5MHSD 3DJ9A 4U1NB 5HHME 3IWVA 3GJFK 4TUKH 4I7ZC 4ZUSA 3FQWB 4B9CA 1A14H 4YEFA 4ODHL 3VTAA 3DSFL 1G9EA 4K7PH 5C08E 4LE8A 1L9SA 1OAKL 5D1QA 3P3SA 3RWDB 1AE6L 5A3ID 4PJBA 2EZ0D 3CSGA 4YX2H 4PWIA 2BVTA 2OMTA 4FAAB 1JD9A 5FK9B 1FF5A 3DXAA 2WVUA 4JFPB 3TX4A 4M5ZL 2R29L 3KCPA 4QAMB 2HVJB 3UBXG 2DRUA 4FEMA 1TTGA 3P0VH 4KRPC 2F8XC 4TRPH 5IHZB 3CNKA 4YIQA 1EAJA 3NDZE 4FG2A 3MA7B 1PD0A 4K9EH 3NFPB 4HPOH 4Y5VA 4ZZFA 1VESA 1BX2B 3P3RA 4I18C 4MXVE 2QMJA 1ESOA 4N5ED 1SXNA 2KZKA 3IFLH 2YQ2A 5LGYA 3HKFA 3QHFH 3MV7B 2N7AA 4MAYC 5EPMB 3EYFB 4J4PD 4I3RH 5I1IL 4ORGB 1OPGL 2WXRA 2NY7L 1XAUA 2AP2A 3B2XA 3GO1H 4JRXD 2BWDA 4ZOBA 1QSEE 3H9HB 4XOBA 4D0CA 4H26B 1E9OA 4AJYV 4Y5YB 6PCYA 4Q9QL 2YR3A 3K6NA 1AHWB 4QWWC 3L7EA 3BSZL 3VXSA 1CI5A 4MJIB 4BXVA 3Q9PA 1LHZA 3S88L 5ISZB 3GRWA 4ZTOH 1TZ8A 1XFPA 2OJZL 3O2DH 4WW2A 4K3DL 1UKSA 3V7AG 2W59A 2FTAA 3QJFA 1IVTA 1L0QA 1EEYA 2GSIB 4YVUA 3PL6C 3PPEA 1ZTMA 2EADA 1NCGA 2QPDB 2P4AB 2QTEA 1JCKA 4HGKC 3K6DA 1R46A 5IOKA 2NY4C 1TEGA 4XP1L 1I7RA 1IC5H 4TLKA 2YD6A 4KY1H 4Q0XL 4B9ZA 2LU7A 4GUOA 1AQDA 4W6WB 4DGYL 2NY2D 2D7NA 1VFMA 1IQDB 1U36A 1B9KA 3QS2A 1BLNB 2MQ3A 3JWNC 4QXWA 1WBXB 3WN5C 3FT1A 3LKRB 5AENA 3QORA 1A1NB 5KN5A 2ILLA 1OARL 3DTXA 5EBMB 4NUGH 1IGCH 3LKNA 4L1DA 1BIIB 2DWSA 4Y4HC 4DPBX 1IGML 5LQBL 1LEIA 5F1SA 1D9KB 3UEZA 1A6ZA 4TUKL 3GUTA 4HU8A 4NN6C 2CXKA 1SHWA 4F9PA 2E9JA 3SE3C 3VGDA 1A14L 2R0WH 5E9NA 3QJUB 4K7PL 4JQVC 3V9CA 4A2FA 2VJ0A 3L6FB 5LDSA 3ZZSA 1I85C 5BW7A 3KNBA 1FO0B 3OBAA 3QO1A 4G8FA 4C56B 5JDSB 3GD1C 5J9PA 1PYWB 1R47A 2YAFA 4YX2L 3APDA 2EACA 1SVBA 4NKDA 1A1OB 1LP9E 5K9JH 3P0VL 2VITA 3OB0H 4HJUA 4TRPL 2HT3C 4CJ0A 1NJ9B 4YFLF 3HRZB 3RDTD 2F8OA 5K9QI 4K9EL 4HPOL 3B9DA 4JM2B 3S3DB 4AQZA 2KZWA 4LL9A 1AO7D 2H3XC 3QXDA 1BFOA 2WXQA 3NIGF 1BEYH 3Q48A 1ZV9A 2XSKA 3IFLL 2X3AA 3LEXB 3D48R 3X2QB 3FUJA 1S7UB 2VC2B 3QHFL 2FQGA 5K9KB 2DQTH 4PTUB 2ATAA 2WXIA 1PLGH 3HE7A 1JGDA 4I3RL 5KYYA 4ISVB 3SZKC 5EF0A 1AY1H 1JZEA 1BZQK 1KT2A 3GO1L 4LHUD 5CNHA 1IO4C 4HJTA 2FZ3A 4FABH 3Q8FA 5H37H 3GBNH 1YAZA 2WHVA 2XG4A 4BKTC 2QTVA 4OF7A 4JHZA 1UVQB 3ETBJ 3P9LA 4Q2ZB 1CUOA 4QRPB 1PLCA 2EE2A 4KJPC 1MFMA 2NNRA 2ZSWB 3WUWB 4ZTOL 2CJ3A 3O2DL 1WISA 4Y19A 4YO0B 3Q8EA 3K0WA 5D93B 4FYTA 3QQDB 2NNCA 4WW1A 4HLJA 4GAJL 4LAJH 3VFTA 5HI5D 2WCSA 2CBOA 3DC0A 1RK1B 5EA0H 1Z9NA 3QJHA 2Q6WA 3RY6C 1IE4A 1NPNA 2UYLA 2J5WA 3MRCA 1GYWA 4U3SA 5DYOB 3U4AA 2J43A 1OKEA 1HI6B 2BIHA 3FCSA 4O02B 1IC5L 2JB6B 4KY1L 1EXGA 5C0JA 1NGWB 2EKSA 5C0BB 1G9MC 2OSXA 5F88B 4TUUA 4PBDA 1JWUA 5JOPE 5DZJA 1CDYA 4GKLA 1PG7X 4ZX3A 2XI9A 1AD0B 1KJ3H 3F05A 4FQ1H 1IGCL 4NUGL 4UANA 1AGCA 1ZPUA 5CZXD 5LAXA 1KG0A 4N8UA 4UIMB 2CUHA 4A55A 1TYRA 1PL3A 3TIEB 1NC2D 4FA7B 4N28A 5D1XC 1G7HB 4R7DB 1GYAA 3K1KC 2R0WL 5DI8B 3I85A 3U30C 4GKZB 5BXFA 4JFDA 3DI2B 2A99A 3D4GA 3EG9A 1DFBH 3QIUC 4MX7B 4BCXA 8FABA 5DC4B 4R9HA 4UQEA 5DF0A 4L37A 1UD8A 1E6JH 1KCLA 1SUHA 4RIRA 1A6TA 1QLFA 1W6WA 4YBQC 5C09D 5K9JL 4NFBA 3NQKA 4KDVA 4GSQA 5BV7H 5HPOA 5MP6H 1UZ6E 2FIKB 4EZJA 2WQ8A 3BLKA 4I2XA 2B59B 2HX7A 4R7NB 3P9MA 1QLEH 3DRTA 4QHKI 2G30A 3FQUB 5IHUH 5HHOE 4I89A 1BEYL 4NQXB 3K0YA 4ZW6A 4BCYA 4W4OA 2IGLA 2HFFB 2ZTBA 4PCSA 2X6UA 4YR6A 2B9AA 3BAJA 4LIQE 5D1ZC 4G2AA 1YJDH 2DQTL 5CIPA 1PLGL 3DX8A 4CDHA 1AY1L 1I1AA 2QZ5A 1ICTA 1EANA 1U3HB 4GRWH 4FABL 4FE9A 2K1MA 1ZVYA 3MRDA 3GBNL 3JUYA 4KXBA 3TH2T 4B50A 3NSXA 4PJ7E 5JORA 1YEHH 3LEVH 1G9NC 2P80D 3FU0A 3C9NA 5D7JA 4M3KB 2BP5M 1JTPA 5IW6B 4NSKB 4UOZA 4IDJH 4P05A 2EDEA 1QACA 1TFHA 2P24B 3B5TA 4PY7B 3O4OC 3C8KB 5ECGA 5IROD 4HJEA 3ZY7A 7TAAA 5EA0L 4XPGH 5D7EA 1FL6B 1F02I 2BVPB 4TNEA 4X6BB 2HPTA 4G6MH 1P6FA 4MXVF 5KBDA 1MWAA 1QD0A 4K7PY 3RFZA 4GSRA 3B9KC 5DJDA 3RG1C 1F1GA 3ZKMC 3KPRD 3VH8G 4XCEB 2GJ6D 2AKRB 3KPQA 3QQ4B 3UGEA 4Y2LA 1R3LB 1RZ7H 2GJZA 3E8VA 4GG6A 1S9XB 3EJCA 32C2B 3IMUA 2A9AA 3H2PA 4I0PC 1BZ9A 4APXB 4M1CD 5CZRA 4RNRB 1INDH 5CHNB 1KJ3L 1G0DA 3IFOA 4FQ1L 1ZHLA 2DB8A 2FNWA 5JPNB 2AANA 2BY2A 3FUFA 1VGKB 5HYJD 4AQ1B 4AQEB 2NY6D 4HJJH 2ATPA 2Y2WA 1FN4A 1OSYA 3KJ6H 4PJCF 3VCLB 1AMXA 1MCHA 2DD8H 2EDLA 1XEUA 4OTXH 5HPMB 4FYRA 1DFBL 5JMOC 2PMZA 1O7DE 3MA9H 2IWGA 3N41F 2F53D 3NIGB 3QEQD 4AYFA 2X2JA 4UQAA 1E6JL 4DP8X 1P7KB 2QKIA 1MFAH 2XKNA 2OMZB 4N8VG 3IKCB 5FXCH 5KYXA 4K5LA 3SDDB 2IAMA 5FM5M 2A74A 4NNPH 5BV7L 3QJTB 4QRTB 2FWLB 1HU8A 4AENB 5MP6L 3MHZA 3FUNA 4EJ1C 3CVIH 3KEDA 1VEMA 1QLEL 4GNKB 1QPXA 3L54A 3R8BB 1U2HA 3TBWB 5IHUL 5MEPA 1S7QB 4XH2B 3NJVA 1AACA 4A2LA 5TDPA 2FJFB 2AQ3A 4DESA 2DAVA 5KEZA 1R3JA 2Q5BA 1YJDL 2IOMA 2J1WA 1LO5A 4K3GA 4ZO9A 2LV4A 2K4WA 1N5AA 4K3EH 4KK8D 1P7QA 1HT6A 3FONB 4G5ZH 5DLMH 1N0LB 3IGAB 3RX9A 1LNUA 5E8OA 3MRFA 1BXXA 3BZEA 1ZSHA 2WIIA 2YLHA 3QZWB 3H8NA 4JRXA 2ZXEB 1YEHL 2H9GB 1JS4A 3LEVL 1AXTH 3GTNA 2I24N 5CIPH 5EO9B 3B3IA 3QT2A 4BRJA 1YA5A 4OJAA 1FNAA 4HH9A 2J25A 2WTPA 1CXLA 3KPSB 2AK4A 3WEOA 5DCCA 4IDJL 5MERB 4MJID 3UBXI 4KX7A 1IKOP 4TQ8A 4ZDHA 2ITDB 1DTUA 4QHNB 3TS8A 1YYMH 4L8CA 3G5ZB 4NPKA 2VDNB 1GC1H 4XPGL 5AAWC 3S0PA 4G6ML 1QPPA 2JJSC 2VLKE 3TEYA 1HSAB 3P3UA 4HOXA 3C5SB 3ECVA 4KQ3H 5DWPA 4YLCA 3EFFA 3EDKA 3FT3A 1FFQA 1UUNA 2WBJC 3CLWA 2CBQA 3UDWC 4I9WE 3BE1H 3T9WA 4BFRA 3EW3B 1EAPA 4HD5A 1RZ7L 1KTDB 4X5QA 3WS3B 3ZE2E 3V6ZB 3SD5A 5IVOA 1XWVA 4LEXH 1WZKA 3LN4B 2EYRB 3VG0H 1INDL 1WCQA 1ZJAA 2XT1B 1GVIA 3CSYB 3BKYH 4G80B 2NYYC 3KPNA 3LZRA 3KYMB 4HJJL 1N59A 1EZUA 3BT0A 2BNQE 1MELA 3L2NA 3KJ6L 4ZSOE 4LCCA 4HUXA 4YHOH 5G4OA 2DD8L 4OTXL 1ET7A 1M6OB 2QMKA 1D9KD 4MZ3A 4ZOAA 4N26A 4UUJB 3Q6FB 3MA9L 4TF4A 2EXTA 1N67A 2WLYA 4XVTH 3QQ9D 1DEEB 1DJYA 1PZ2A 5D7LE 4GFTB 3SEPA 4H8WC 1IGIH 1FH5H 1OT4A 4Z78B 1XL6A 2X40A 1LGVA 3S5ZA 5AZEH 4NNPL 3NJKA 4C56D 2BS9A 3BEWB 1T1WB 1AMYA 4JREC 3CFTA 3EXJA 3CVIL 4YFLI 1AXSB 5DUBA 1J48A 2UV3A 2W0LA 2WXMA 3CDGB 5D96C 5J6HB 3RDTA 1TQBB 5IVXF 4YDVB 4XNQA 2OMWB 4ONFH 1ROWA 3QJZA 1AO7A 4JM2D 5DK0B 1S5IH 1VZHA 3SE8H 4G70B 1A7RH 4DP5X 2QADB 4K3EL 4XP5H 1LD9A 1JDCA 3DURB 4M8UA 1CL7I 1XH3B 4G5ZL 5DLML 3GBDA 5DFVC 3SE9H 4DTGH 3ML9A 3NBNA 5EEZA 3K4ZA 1S9VA 5CCKH 3STZB 1TLMA 4LHUA 2VR4A 4I1RA 4HIHB 1AXTL 4L8DB 1GZPA 1A2YA 1OPOA 5GPRA 3T8VA 4ZNCD 2XACC 4AG4H 2KMWA 3VACA 4N3TA 3ROLB 3T0EC 3OKLA 2ZOUA 2ZUSA 3ARPA 1G94A 4JEGB 1YYML 1UZ6F 2NY0C 1GC1L 2UUDH 5DQ9A 2JJTA 1XQ4A 3GMOA 3K71A 3S36H 3VI4A 5MEOB 1BOGB 4M29A 3KYAA 2JKWA 4KQ3L 2ZSVB 4Y4KB 1KGCE 3MX0B 1W9XA 3EH5B 4JO1H 3VI3A 3A24A 4HKBB 3BE1L 1KZYA 2K3TA 1DQJA 4GRMB 2VDOB 3HE6D 4B9JA 1T5WA 3SKOA 2P5WE 1HE8A 3GM0A 2EYSB 2LE9A 4K55A 4LEXL 3N5AA 3H3BC 3VG0L 3AXIA 5J8OA 4G8EB 1HH9B 5LGHH 5MEND 4FA8A 1MAMH 5C0BD 5C7XH 1T0NA 3OHXC 3BKYL 4LPVA 4PJ7F 3WJJA 1EEUA 2WN3A 3BP4B 4G43A 4OKVA 2X42A 1XMEB 5EUOA 3ILPB 3V6OC 3VH8B 4YHOL 4NZTH 1NC2A 2ADJA 1Y07A 4MCMA 1C16B 2HKAA 2XQ0A 1DQKA 2OK0H 4F15B 1QI3A 1E27B 5IQLA 3U2SA 2RGSA 4KMTH 4XVTL 5AB9A 1IMHC 4YHMH 3M7FB 2OJEA 2H32H 1IC7H 1DN2A 4P46A 1IGIL 1FH5L 4X6FA 4BQCA 3PQYA 1TQUA 3VYOA 4QO1A 2QR0A 1COBA 5AZEL 3KWXA 2FATH 3E2HB 2BSDA 4F58H 4K4KA 1PZUB 4ZFFB 3KL0A 5C09A 5DMKB 1P84K 5DURB 3ZKXB 1HXKA 4XMUA 4E42B 2BVEA 3VFNB 4A04A 3H9ZA 2D8KA 3HI5H 4ONFL 3RWFB 2P3YA 3T6XA 4LEBA 1AS7A 4MXQD 1UA7A 1R24B 4TMPA 5FM4A 1S5IL 2RAMA 3SE8L 1JV5A 4Y5VC 3OAUH 1A7RL 5IHLB 4TUOA 3WIFB 4N8VB 3SB3A 5C0RH 4XP5L 1ZHKA 3WHXB 1NMCB 3NIDE 4QXTA 1LP9B 4BQ6A 1XR8B 2TSAA 3LRGA 4PJXA 3SE9L 4DTGL 4EI6B 4YSOA 4BDVB 3HZMA 4PRHA 3AWEA 4YOKA 4J3OG 2X2IA 5CCKL 2BP8B 4GSXA 5FDWB 2WBWB 4JN2A 2UZYA 3VRLE 3QISA 5KVDE 4AG4L 1H6TA 3UTZA 3BDXA 4KFMA 4X9GA 1D5XB 4X6CE 4Q6IB 3OVUB 1WFMA 2P80A 3P3YA 1A6WH 3P4MA 3NIFE 4KKAC 1G87A 4XC1H 4YHYC 1HEJC 3WYRA 1F00I 4IM8A 3V4PH 1M71B 1K5WA 5J57B 3Q5OA 1SGKA 4WO4B 5T5NG 5D71H 1CDHA 3HPJA 3S36L 4BFKA 2GKIA 4HGWA 3W39B 4CBPA 1X5AA 1KELH 1CQKA 4H5SA 4UWQB 2P8MB 1MRDH 4LLYB 4M7ZB 5IROA 1JWMB 5E8PA 2ZONA 5F0PB 4AE0A 1IAKB 4JO1L 1CICC 4GBXB 4AJWA 1ZT7B 2ZXDA 4N2EA 1LQBC 3T0DA 1FP5A 4ZFOL 3DROB 1NCDH 2GJ6A 5A2KH 2ZAGA 4N2CA 5FO7A 3KXFB 5LGHL 1A8JH 2ALAA 1MAML 4J3OF 4X5WA 1BOYA 5C7XL 3GSOA 4M4RA 5DC2A 4AIOA 4HOZA 3VFUA 2E7MA 2Y69B 3QORC 3TIDA 3L4VA 1L5GB 4LDCA 3V95A 1OF0A 5JZ7D 1OIOA 4OZGE 5HYJA 4NZTL 2VL5A 3C08H 4CVXA 2BSRB 5AVVB 1RZKH 2OK0L 1MIEH 4LHQB 3DX7A 2AXFA 5JOEA 4CU8A 4KMTL 1TCRA 5JNYB 1Q0EA 4YHML 5ELIA 5J13C 1UTDA 1Z7JA 1IC7L 3NACH 1KXVA 5T5NF 4U1NA 1GTFA 2KLTA 5C8JB 4PJ9D 2FGZA 3CFMA 2FATL 1JK9B 2P52A 2BP3A 3FQWA 4KROC 4F3FB 3BO8B 4G7QB 5I0XA 5GS1C 2RH0A 2VDPH 4FP8H 2E8ZA 5IMOA 5KVGH 1KXHA 1NCOA 5EOQH 4J6RH 1MIMH 1J18A 2LAGB 3SDDD 4F8PA 2IDCA 4FLOA 3HI5L 2RACA 5FK9A 3ZE2F 1D6VH 3BRFA 4JFPA 2XV0A 2BWQA 3F6LA 2X89D 2HVJA 1V54B 1FG9C 1NIDA 4AM0B 4MRCA 3OAUL 5A2BA 5B39A 5IHZA 4JBSA 5C0RL 3C6LB 3MA7A 4HX1A 3NFPA 3C6SB 5B8CB 3RTQB 1BX2A 1TETH 2EP6A 1N6QH 5I6PA 2BNRB 2K7QA 5BRQA 3D7PA 3HE7C 1QFHA 3MV7A 1Z5HA 4OB5H 3NJXA 5M7QA 5EPMA 3EYFA 1NFIB 1OLLA 5F1NB 5HHOB 1YY9D 3ARBC 3LV3B 4TVPH 3Q43A 1A6WL 3H9HA 1L6ZA 4XXCA 1TKWB 4XC1L 3V0WH 1OCRB 1JI1A 3V4PL 1AHWA 2EIBA 1RZJH 3KPSD 1Z5LB 3OQRA 4YQXH 5D71L 3V5DA 4FF9A 2MRYA 4MJIA 4OF5A 4TL4A 4XMVA 1KIRA 4E9WA 4HD9A 5DZLA 5ISZA 1KELL 1MRDL 4BSVB 1OGAE 1BSIA 4CVWA 3MMEB 1JXFA 4HMCA 4WTZA 1E67A 2ORBH 4GKNA 4KDTA 2D7PA 5HGBB 2NY3C 1SF5A 1VCAA 1JIBA 1NCDL 1WA1X 3EUUA 1RJCA 3WFDH 3D33A 1HEZB 1PX8A 3RIFK 1S7SA 3E3QE 4BH8B 2JF1A 4M62H 1T66D 3HG0A 1OP9A 3OMNB 1BLNA 1WBXA 1C7TA 3LKRA 1LO0H 4BK4A 4UOW1 3C08L 4I8DA 4ZAKB 1RZKL 1T80A 2CDEB 2WXHA 3N1QC 4E5XB 4AQ8A 1ADWA 5EBMA 3ZHDA 1TIUA 3LVTA 4WFHD 3GB7B 1ADQA 1A4AA 4LOUD 1NPJA 3NACL 2K0RA 2XZZA 3MOBH 1M56B 4GQQA 1D9KA 4OZHB 3S97C 3SGKC 4FNLH 5FF6A 4IJTA 4MSWB 2EICA 2P45B 3FT0A 15C8H 2VDPL 4FP8L 5KANI 5C07A 2DQEH 5KBNC 5KVGL 4R0LC 4P4KC 5EOQL 4J6RL 1FO0A 1MIML 5JDSA 4C56A 2VXQA 4EVNB 5BCAA 1PYWA 3P77A 3U25A 4XBPB 1QFPA 4P04A 1OK0A 1D6VL 1NLBH 2Q76B 1A1OA 2XXGA 1E5YA 4U7KA 4BYHA 1NJ9A 3EHBD 3HRZA 4ZPTB 5C08D 5F9JB 3ULUC 3L4TA 4JM2A 3O6KH 1TETL 4W4OC 5E1AB 4NHUB 1N6QL 3DSNB 2XDHA 1DP0A 1WFOA 1X44A 2EDJA 1MH5B 4HXBH 3ZSTA 1I9JH 1S7UA 3RAJH 5ITBH 4OB5L 4PTUA 1HN1A 4GUPB 1I8IB 3W2DH 4ISVA 4TVPL 2ZX6A 5HHXH 2B1OA 4JKNA 4JANB 4MVBC 2VO8A 2GC4C 4I48B 3C60B 4Y9CA 3V0WL 4NC1E 5AOKA 4A7QA 1JN6B 4Z1PA 3RVTC 1MEXH 1RZJL 1UVQA 4L8SC 4YQXL 1ZD6A 4Q2ZA 4QRPA 3UAJA 1G84A 5F6HI 3F3HA 4KNUA 2ZSWA 4A7GA 3DYMA 2XRAH 5DRXB 4Y0GA 1S3KH 4YO0A 4F27A 5FGSA 1ERNA 3Q01A 3QQDA 2ORBL 3RY5A 2DQFB 4JGMA 1GGCH 4M7KH 3Q2CA 2AXGB 2JQZA 1SYVB 3Q8BA 1RK1A 3NIDF 3L45A 1BVNT 3NDYE 3HNSH 3L08A 2GTZB 3WFDL 5IT2H 3QAQA 1SF3A 1S5HB 5DYOA 2V2XB 4FQPA 4GMTH 1HI6A 2AS5M 4XAWH 4O02A 4F2MB 2UX6A 2JB6A 5ACZB 3O3DB 4M62L 3RJDA 1F3DH 3H7BB 2F8IA 2EO9A 2VLKB 4EBQH 3D85B 5C0BA 1CCZA 5F88A 1LO0L 1NTDA 4X6CF 2VDLH 2OJ1A 3NIFF 4Q6YA 1AD0A 4JFFE 3QIBD 1TU2A 4QKXB 1UD3A 4UIMA 3IXTB 3MOBL 1J8HE 1UG9A 4JY6B 4WJKB 1U8LB 4FNLL 3VGAB 4L2YA 1G7HA 1Q0XH 4R7DA 2BS8A 1SLWA 5DI8A 4GKZA 1WUNT 4L4VE 15C8L 5E5MB 4HEPG 2DQEL 2QKIC 2IG2H 4MX7A 2ARJA 1BQHG 4ODXB 4A2HA 5HHQB 2EZ0C 1CXKA 4BZ2A 1OP5H 1NLBL 1X3DA 3FFCB 1MW0A 5PCYA 1URLA 5DURD 1XAKA 5GZND 3LQAH 4WJG3 2F9BT 2WXJA 3KHQA 3PWPE 2B59A 2OI9C 1AD9B 4AC2A 1I3RB 3O6KL 4A6YH 1CGXA 5HDBB 3FQUA 4PLKD 1VPOH 5EHFA 2ZG1A 4NQXA 4OZGF 4N5EC 4HS6B 2HFFA 2O6FA 4HXBL 1I9JL 2APWA 4QMEA 5DLLA 3RAJL 4YZFE 4ZPVB 5ITBL 2ZCLH 3BAYA 1EJOH 3ETBF 3LZOA 4JW3A 3W2DL 3SE4C 4J4PC 5B7EA 2WKOA 5HHXL 3IM1A 3EBIA 1U3HA 2XIIA 4JJ5B 4CADB 4UT7H 1S78D 1MFUA 2G2RB 5DO2D 3SBRA 1H3WM 1MEXL 2ODHA 2KZBA 2GTQA 3UTOA 4WV1C 2X2YA 3Q1EA 3TT1H 4A68A 1CLVA 2EC8A 4LSUH 2K78A 5DHEA 1R19A 5E9DB 1KGIA 2XRAL 4OSUH 1FG2B 1S3KL 1XXFC 3SQOH 4NSKA 4KMQA 1KBGH 1J88A 4WO4D 1ZVSB 1I7ZB 3QQ3B 4X6DA 2P24A 4PY7A 4OV5B 1GGCL 4M7KL 3TBVB 3C8KA 2ESVE 1FL6A 1MPAH 3UZEA 3GIZH 2BVPA 3HNSL 4GBXD 5IT2L 3OZ9H 4L5FH 1ZLVH 4DFIA 3BCDA 2XBDA 4GMTL 4ANVA 4XAWL 1KTJA 4XCEA 2R1WA 3QQ4A 4OGZA 4HDIB 4EBQL 4ONHB 1IVLA 1R3LA 1S9XA 2NY2C 32C2A 3QUYB 4AEEA 5CSBA 2EECA 2IH3B 2VDLL 4APXA 1M05B 5T8IA 5CHNA 3ABLB 3ARED 1CFBA 3CQQA 3ESMA 5JPNA 2P5WB 3NRFA 5F44A 1ILUA 1VGKA 4OF3A 4LCCC 5EFIB 4AQEA 4ZYKB 2WKGA 4QY8A 1Q0XL 4I77H 4B7IA 3ZYZA 2YK1H 2UZXA 2WINB 2IBZX 5HPMA 3P9WB 2A5UA 5JOPD 3RHWK 2IG2L 4GRLB 1RSFA 1VEPA 4R5VA 4ZX6A 3LH2H 1P7KA 4XPAH 5CLYA 1LMIA 2OMZA 4LPWA 1JYXA 3IKCA 2ED7A 3HZKB 3WOVA 2Y2YA 2J71A 3LQAL 1DANT 3JV4B 4QRTA 4R2GB 4AENA 3RDTC 1Z0NA 4TLUA 1CQYA 1PCSA 2X89A 1R17A 1CG9B 4LSVH 4NO5A 1J7VR 4A6YL 3T4AB 3TBWA 3WV0A 4ZRGA 1S7QA 1VPOL 4XH2A 3ZQXA 1P1ZB 3C6LD 3S8GB 1M1XA 1YO4A 2JELH 3P2BA 1W80A 4KO5A 5AVSB 5SX5H 5BO0D 2FJFA 3T6VA 2HXAA 3BP7B 3RTQD 1HCYA 3QXTA 2VXUH 1NCTA 3V4VA 2IOOA 2ZCLL 5DDHB 3MYZA 4S1DD 3IGLA 2A0LD 1EJOL 4UT6H 2ICWI 3VXTB 4I3SH 3ZBMA 2ZUQB 3FONA 1N0LA 3IGAA 1ORQB 1TTUA 2Z7YA 1N70A 1HHHB 1XEDA 2UVFA 2N1KA 3CUPB 4UT7L 5HHOD 3QZWA 3PAVA 3LRLA 3W38A 2H9GA 1KGUA 3TT1L 3VFWB 5DFAA 5EO9A 3L3HB 4LSUL 1A21A 1SZNA 4V11A 1PS3A 1R5IB 3FU6A 4H8HA 4OSUL 3SQOL 1HWWA 1KBGL 2C9PA 4G8IB 5C92A 2FSEB 4PS8A 5FM8A 3FQRA 4KK5D 4D2NA 3NZ8A 2ITDA 4FKEA 2HWZH 4QHNA 3G5ZA 1C5BH 1KFAH 1WS8A 5HI5C 1MPAL 3GIZL 3NIFB 3OZ9L 4L5FL 1HSAA 5EU7E 3C5SA 5D2LE 1BAFH 2OULB 2MJWA 3BQUB 1EHXA 3L81A 3JTTB 4MCYB 3BH8B 3WS3A 1FC1A 1KTDA 2HRLA 4IRZH 1XGQA 2FH6A 3V6ZA 3KPLB 2QSQA 2OLDA 3LN4A 2EYRA 2I7OA 5CEZH 1GJUA 4OY9A 1WA2X 3CSYA 5CZXC 4G80A 3KYMA 4Y2DB 3NABH 5FV2A 1QFWM 4IGBA 2W0PA 4KXAA 4NENA 4PJDE 4I77L 4PRPE 1GR7A 1IEBB 3QQXA 4TSBH 2YK1L 3FUMA 3MQIA 1M6OA 3JUZA 3CC1A 1D7DA 1J8RA 4UUJA 3N43B 2QT6A 3Q6FA 4Q9BA 2VWEC 4JKMA 1VIWA 3LH2L 4MCZB 4J8RB 4XPAL 4LCWE 1T0MB 3QJSB 3DGDA 1G5GA 2C7UA 2SODB 2YAOA 2PP9A 3S96A 4OJCA 4UDUB 2OFQA 1O75A 3BEWA 1CYWA 1T1WA 1RKRA 2WNWA 1OO2A 2JMRA 4JFQB 3Q44A 3WL9B 3PDGA 5C0DB 1AXSA 4LSVL 5D4IA 3PDDA 5I6XC 2VW4A 4ZK8A 2IC2A 2HA1A 3CDGA 5J6HA 3GS7A 3W5MA 3R8QA 2OMWA 3TC9A 2JELL 1ETZB 3UX9B 5DK0A 1RZQA 4PRIE 2DH3A 2VXUL 3OAYK 1GZHA 4MD4B 1TZHA 1XTMA 4KH2A 1SJHA 4U6YB 1U2YA 2OCCB 1WV7T 3QB7C 1T1XA 4UT6L 3DURA 4I3SL 1XH3A 3ELQA 3HFFA 1UFGA 2GIMA 4IYKA 3ZQ9A 5EDSA 1NEZG 3STZA 1F11A 3WKYA 4HIHA 4L8DA 1R5WB 4ELME 5EC1B 3C60D 2WQWA 4LEEA 4JL1A 2EDYA 2UY7B 3ROLA 5L9DH 5F3FA 2EE6A 1OM3H 5B3SB 4LK4A 3FTUA 1W15A 5K9OB 1H6EA 3DX2A 3B83A 3GFUA 1G6RH 4J3OD 4K07A 2HWZL 5E5LA 3V0HA 4PIBA 1C5BL 1KFAL 4MMZB 1N2RB 5DJ8B 1ZVNA 3NMEA 1PNDA 3EKCA 3HLAB 5FFOA 2WCPA 1KXQA 2Y6TE 5MEOA 1BOGA 1BAFL 3M7OA 4MJ4A 2ZSVA 4Y4KA 5CILH 1WIOA 4YN3A 1T3FB 2FYYB 5ADOH 4HKBA 3L3OC 4YZFF 4IRZL 1W91A 2A1WH 4OQTA 3SGJA 4YSSA 2EYSA 4RAHA 1OT2A 5M95B 2JI2A 2OZ4A 5I0VA 5CEZL 2EDFA 1HH9A 3KBEA 4G8EA 4M1CC 2RCSH 2VLKD 4MMXB 2YRZA 4PP1D 1E5AA 3D85D 5I1HL 4CKQA 2P1YA 5T1JA 4RQQB 4Z5RB 3EOAB 2NT0A 3NABL 1SOKA 3BP4A 1ITBB 1F13A 3OR6B 2F7IA 4TQPA 4I9WD 2NY6C 2BZCA 1IEAB 3ILPA 4PLOB 4TSBL 4Y88A 4PAZA 2ZAIA 3VH8A 5LCVA 2GITB 3EF4A 2YRBA 2NY5C 1U4EA 3FL7A 3G5YB 3QIWC 4ZW8A 2PCYA 1C16A 1KXVC 4WFFE 3S37H 1E27A 3ELAT 1ZSDB 1Z0MA 4QXGH 3FQNB 2GEQA 1TT6A 4QOKB 5C97A 4YDMA 2BNQD 5JHLA 4ABQA 3MNMA 4ZFFA 1JVKA 2WUBH 3FFCD 5DMKA 4WWNA 3ERXA 5GZNA 2EVGA 4XMWA 1IBGH 1PMYA 1MCIA 1RPQA 2GBVA 5J3HD 3VFNA 3MGOB 2BXYA 3UO1H 5D7LD 1EJ6A 3RWFA 1KDIA 1U42A 4CUCA 5TGBB 1R24A 1F41A 4Z7QB 1B0GB 2O6CA 3ECWA 4MJ2A 1GCYA 4FFWD 3WIFA 3KLAB 4N8VA 4I9XA 4HP5A 4XZ4A 1P4IH 4KZCA 1F1AA 4KK8C 2FH8A 4WTXA 5CSGA 1LP9A 1YEEH 1NGXB 4PHZA 1XR8A 2BINA 4WWKD 4EI6A 4BDVA 4PJAB 3TN0B 3WS6C 2J44A 2BP8A 4YLBA 4M43H 5FDWA 3CMOL 3VXUE 3DYOA 3X14A 3GJFB 1GA2A 3RKDC 3RURA 4Y5YC 3F7QA 4Q6IA 3GZOA 5L9DL 1MFCH 2VM3A 4A2EA 3DVNB 4CC0A 1OM3L 2KLRA 3M1BB 4AK1A 2FUTA 5E9DD 5EEWA 4EO5A 1G6RL 2X87A 2NX5B 1M71A 3G5VB 4W1TA 4EI5A 5C9KA 4WO4A 1I8AA 4PS3A 2GK0B 4IKKA 1TJHH 4HQQH 2XHNA 3PWNA 3W39A 5CILL 2P8MA 4LLYA 4HHAB 4RGNE 1JWMA 1ZCRA 3QHZH 3QG6B 3ZTDC 3MROB 1IAKA 1ZT7A 3ASOB 5ADOL 3LZPA 4KX9A 5AVYB 5FGRA 2ZF8A 5KSBA 4PWHA 1N6UA 3DROA 2A1WL 2JWYA 2NUTB 2JJUA 4GUCA 3KXFA 3VXPA 1KJ2B 2RCSL 4ZXBC 5ES4B 3QUYD 1KGCD 3BPOB 3DX1A 5EOCH 4NFDA 4KKBD 2UX7A 4RISH 1VFAA 1L5GA 3J8F7 3UERA 4AQ8C 1PIGA 2OZ4H 2P5WD 4TNWF 3H85A 3QNYB 4PMEA 2BSRA 4S2SA 5JIMA 1M2VB 1D9KC 4X50A 3S37L 3KM2A 2J7LA 5I17B 5JNYA 1WK0A 4OCLC 1AR1B 3QQ9C 4QXGL 4Q89A 3AS2A 5C8JA 4GRLD 1SJVA 3TO4C 1JK9A 2IDTA 1DFXA 1XSOA 2DOCA 4X8JB 5LCVH 3BO8A 3HFMH 2CRZA 4U3CA 5D2LF 4NZ8A 3VE0B 1IE5A 2FWUA 1E8XA 2WUBL 4FFVD 3D3VE 5AZUA 1FZKB 1IBGL 4M7LT 1ZA6B 2ICEB 3ZE1E 4U1MB 5LUMA 2MHAB 3UO1L 2P28B 4R2GD 3HRZC 1G1OA 1UCBH 4F8NA 1D5RA 1MCBA 1NZRA 4JM2C 1HCFX 2ED8A 1KN2H 3C6LA 1P4IL 4LP4A 2VDQH 3C6SA 5B8CA 3RTQA 4HBCH 5F72S 5GS2H 2V9TA 2E56A 1QFUH 4PJDF 4NP9A 1VJSA 3BFQG 2BNRA 4D8PB 1DYZA 1AZCA 2F5BH 4CU7A 4M43L 5FUCC 2LTQB 4B95C 3PU7A 4FCAA 3AZUA 1C12B 2H45A 1NFIA 4OJFH 2DEWX 2E7CA 5HHOA 3SKMB 3IGUA 3ECUA 1E4KA 5E70A 2X41A 1MFCL 4K73A 3G04A 2ATKB 4MCNA 1KPRB 3DJZA 1MW2A 4A2DA 5ILTH 1Z5LA 1YPZA 3IJHB 5KG9B 2CQVA 1TJHL 4HQQL 1HCVA 5LBVA 2EVHA 1N10A 2H1LM 2W9DH 3QEGH 4XVSH 1NEZB 1WWAX 3FU9A 3MJ9A 3WHE1 4BSVA 3MMEA 3QHZL 4X6EB 3WO4B 1R5VB 1CFQB 3U79A 5HGBA 1H6FA 5DJXB 3HE6C 2R9HC 1SMDA 4APQB 3SBQA 2APVA 2WVVB 2ZOTA 2RTTA 1W72A 3MU3A 3ABKB 1J12A 4ZMYA 5DTFB 3K74B 3L3IB 1HEZA 1KLUB 3IEAA 5D6DC 3AU1B 5I82A 5IJVB 2Y5TB 1CD9B 1T6BX 5EOCL 4BH8A 4A38A 4RISL 2Z91B 1JZJA 4H1LG 4UQIM 2E5EA 5CJ5A 2IMNA 4AIZB 5AKRA 4HV8B 3FF8A 3KVDD 1JXKA 3O4LE 2CHNA 2OZ4L 5F97E 3P11H 4ZAKA 1FYTE 2F54B 3HI1B 1C7SA 4OFYD 4KKRA 2CDEA 4Y2DD 4E5XA 1KB3A 2NZ9C 3N44F 3T8MA 4QXVA 3GB7A 4U1IB 2IANB 3CZSA 4OZHA 4OUOA 1JYNA 3DIFB 1DN0B 2A6JB 3HC2A 1QA9A 4LQFH 2Q7YB 3UTSE 4MSWA 5LCVL 1F3JB 3BSGA 3JWDC 3MRPA 5DRZB 4GT0A 3HFML 2W95A 2BMKB 5AG8A 4LKXB 4GO9A 1J0IA 2A9CA 2ROXA 4EVNA 5CU5A 3BKJH 3NA4A 4AGLA 3ULVE 5F9WB 1JHLH 4XBPA 1TQCC 5LNEA 2AVGA 1VRSA 3FTYA 5FV1L 1UURA 4L23A 4DZBB 3DTUB 4E36A 1UCBL 5FCUH 3TOPA 4MXQC 4EIBA 3CHRA 4ZPTA 1KN2L 4CNIB 2VDQL 3CHOA 2X9ZA 2JB5L 4HBCL 4GH7B 4URTB 5E1AA 1QFUL 3D39B 4NHUA 3OKMB 3CSFA 4XX1E 2G4GA 3DSNA 5D4JA 2F5BL 1QSFE 1MH5A 3C5JB 1JYWA 3LDBB 5HVHB 2GYSA 3V52H 4UV4H 5FW8A 2YGNA 3EYSH 1NBCA 2AV1B 4GUPA 4OJFL 1I8IA 5B1KA 1QWNA 1D7CA 2N4IA 4JM4H 4U1LB 3MLVH 3UMTA 2O5NA 4JANA 5I73B 3WMPA 3C60A 3VSUA 2CCVA 3A6CH 2F74B 3A47A 3UBFA 4N2GA 5ILTL 1O9WA 3GNMH 4PV1C 5DD0L 1ZPLA 2R2CA 2W9DL 4RCAA 2HT2D 3QEGL 4XVSL 3DPDA 2DI8A 4TTDC 5CN3A 2LFGA 3N40F 1A4BA 3MFFB 2DQFA 4Y1TA 1ID5I 3UZEC 1XGPB 4HC1A 3C2SA 1RK7A 3CXFA 3IGKA 1SYVA 3TL5A 4EUPG 2OTWB 5E99H 3TV3H 4WNQB 3JT2A 2NR6A 2GTZA 3MJ9H 1ZV2A 2JKNA 1JFQH 4P5MB 2V2XA 4MAUH 4F2MA 3ETSA 1D5BA 1KPUA 5ACZA 2BZDA 3NH7H 3O0LA 3O3DA 2DBJA 3H7BA 3SPIA 1T22B 4ZW3A 1EA9C 5D2LB 1SFDA 2YC1B 2TRYA 3BSHA 5JZ7C 3CD4A 3HJ0A 3P11L 4O9HH 4QRSA 1W72H 3KMDA 3QPXH 3RWJB 4AQ1C 1GIGH 2FLBT 4YHPA 5A40E 2BLFA 4N90E 4TM9A 3D07A 3PPSA 2CKNA 1A3QA 1OD7A 3AQXA 5D9SB 4JY6A 4OQ1A 1U8LA 2QLVB 3BDYH 4LQFL 2UUDK 1E6OH 2OAAA 1NUFA 4O4YH 4PJ9C 1Z9SB 1AGDB 4MNQB 1Z66A 3E6HB 5CCGE 2BVUA 5E5MA 4BUGA 5I0DA 3O3BB 5I74B 3UPRB 4L0YA 1G7JA 3I84A 4PJDB 4QOKD 1BXVA 4PRPB 3BKJL 5D7SH 3SDDC 5HHQA 5I2IB 1JHLL 3DA0A 1CT8B 2O6DA 1UJTA 3FFCA 3K3QA 5HYIA 3WD5H 5FCUL 5AW9B 5CCHE 2ZYHA 3F7RA 2R2EB 3X13B 4JZJC 3T3PE 3SE6A 2C9QA 3U9WA 3UPCA 5IVNA 2DQGH 4WQOA 1RIVH 2DYRB 3O6FB 1AD9A 4HCRA 2HSIA 3BAEH 2XWCA 1TVDA 1I3RA 3T71A 1BFSA 3KYOB 3CIQA 4Y9FA 2IDFA 2FE0A 3RNQB 3F5WB 3FH7A 4Z0XB 1X6LA 4HS6A 3WY4A 4H20H 2GPZA 5GRYA 3V52L 7CGTA 4UV4L 1MXDA 1E65A 3EYSL 3DOIA 3FTGB 3TN0D 4LEOA 2Z4TA 1KB5H 4JM4L 1PG7H 5EBWA 3MLVL 2QGEA 5L4IA 1DVUA 1T7VA 1A9VA 3LIZA 3BH4A 1MLBB 5DJ6B 3A6CL 4JJ5A 2G2RA 4ANXA 4CSTA 3HC3H 4YBHA 2KPNA 4U3HA 4DERA 1E28B 3GNML 3MLUH 5D7HA 2I26N 3IMVA 1SNRA 3ZE1F 5E9DA 3GJEB 1UB6A 1PZ3A 1YEFH 3DHUA 5F7DB 5C0AE 3TH3T 3D1MC 3GSRB 5T3ZH 1ZVSA 2HRHA 1I7ZA 2PW1B 3QQ3A 4ELMB 3QCVH 4OV5A 1KBWA 1E2ZA 3TBVA 3US1A 1WQVT 2W92A 2HRGA 1JNNH 4MQSB 3TEXA 1NQBA 4C47A 1F6AA 5E99L 3TV3L 4RBPH 3H54A 2DKSA 5AW3B 1ETB1 3MJ9L 3N44B 3VJ6B 1JFQL 3KW7A 5AKTA 4MAUL 1KPVB 3HR5B 3WEBA 2IEPA 2OMVB 3MNWB 1MCEA 3NH7L 3RB5A 1DBKH 4HDIA 4ONHA 1T66C 3GPSA 3U82B 1F97A 1MCDA 1ODAA 1UWXH 3QUYA 4ZO7A 4ZD3H 4J2QA 5LJYH 1RUQH 4O9HL 1DLHB 2N01B 1W72L 1M05A 3QPXL 1GIGL 1JF1B 2VO5A 2HAZA 3VX1A 5FO8B 2EEFA 3U4EB 3ATDA 3VFRB 4LOUC 1IAIH 5AQ0A 2ZKYA 3BDYL 1E6OL 2H26B 2O30A 4JPQA 4O4YL 2DL2A 4FHKA 3IWUA 2FWSA 2WINA 4EQ3A 1AR1D 4KH9A 5BUAA 3X1FA 1PD6A 1Y1DA 4GRLA 4H1LB 3NPZB 4IMKA 4NRXB 5D7SL 4A7TA 2YQGA 4JFFD 3HZKA 3A4EA 3WD5L 5IHWA 3UBHA 3HZVB 3HOGA 1HXYB 5JIQA 4AYSA 2DQGL 3EHBC 1RIVL 2B15A 1QTSA 2QSCH 3BAEL 1CG9A 4U0QB 2Q10A 2GFBB 3KLDA 3T4AA 1RLBA 2EIEA 3KD4A 4N2MA 1P1ZA 5I8OH 5E8EB 4XX1G 5K93A 1GZHC 1WAAE 4W9JC 4A39A 4M61B 4N0FB 1BA9A 1IQWH 1W2KT 4H20L 1WYJA 4HZAA 2DQJH 3T65B 5DDHA 1J5CA 3V9EA 4ABWA 1YN7B 3MUY1 2F58H 4CC4A 3VXTA 1KB5L 2OR7A 1PG7L 3PJNA 3ZKQD 3G3LA 3VGBA 4V33A 3FTWA 1HHHA 1U2CA 3CQPA 1SFHA 3HC3L 4X7DC 1JZ3A 5IJBC 1U8OB 1MNNA 3MLUL 1LO2H 4U1JA 4G7RB 3FO9B 3NUKA 3D12B 3VFWA 1OE2A 3L3HA 3UYPB 3RUGE 3AUWB 2VW7A 4L0PB 3WNOA 1R5IA 3ULVF 1YEFL 5AYUH 4TNGA 4G8IA 3MXVH 2FSEA 3BWSA 1T89A 5T3ZL 2PO6D 3SDYH 3VXUB 3QCVL 1JNNL 2WJ7A 3JTBA 3WGUB 1NSNH 1N64H 4AV0A 4EZKA 3BFOA 3B9VA 3OMIB 5F21B 3QR0A 2VLLB 1BVNP 2CLRB 3BQUA 1RULH 4KKLD 2VCOA 3AVEA 2N0KA 3JTTA 2CKBB 2F68X 2VDRB 3LNIA 3OC8A 1NH6A 4MCYA 2VE6B 2BH0A 4APQD 1DBKL 2B4CC 3MRHA 2M1KA 3LKOB 4PREB 1CGYA 4BV1A 4XBMA 4ZD3L 3KPLA 4RGNB 5AYTA 1RUQL 5HP5A 1X5MA 2YA0A 2AZUA 2WQVA 5C0CB 1J1XH 4IBVA 2I7SA 2XICA 4EUPB 3GSXB 4ACPA 3QIBC 2OKMA 1OSZB 4Y2DA 1Z3GH 5FGBC 1IAIL 2F54D 4XO9A 2CJSA 2FR4B 5EIIG 5BUPA 3HN3A 1IEBA 2AJVH 4Z7OB 4WTQA 5BRPA 1M3JA 3MRGB 2IAND 1NDTA 3F84A 4PS7A 5GGUB 4DK6A 4KJYA 5EZJB 4RSVA 4ZFZB 2ZKMX 3WFEH 1WO2A 2JXMA 3GKZA 3IETB 3E2HC 5T1DH 4MCZA 4J8RA 1T0MA 2ERJB 3LS4H 2NYZA 3ES6A 4NRZB 3HS9A 1MRCH 3IJYB 1OT1A 2ZNWA 3BAKA 3ZKXC 4N2IA 5GZNC 4MJ6B 1UACH 5HHNA 4N2OA 4JFQA 3C5XA 4GQ9H 3WL9A 3CIAA 4QHLB 2QSCL 1J87A 4YSTA 3TA4D 2MPAH 4FHJA 3CXHJ 4YL4A 4AGPA 4L9LC 1I3UA 5I8OL 4NYLB 2OYLA 4PLKC 4FCHA 3A23A 4MRBA 5TE4H 1J8SA 3PGDA 2R39A 3D3VB 3WIIH 1BZ7B 1IQWL 1CJYA 4WNJA 2YN5A 1BAGA 3QK0A 4LVHC 2DMHA 2DQJL 4HCIA 5F7YC 5AVUB 3QJRB 2F58L 4HA1A 3AGVA 2FUQA 2XWJB 4AGMA 2D7TH 2CO3A 2IDSA 1M1SA 1QEWB 1YMMA 1E8ZA 4PGDB 3WTVA 5DO2C 2CUMA 1LO2L 1NCNA 2VUYA 1R5WA 3VXQB 1SHXA 4K15A 3RGVB 3OKYA 5D4QA 1N5YH 5FLVA 1QEXA 2UY7A 3QR1A 5AYUL 2C5DC 2WSKA 4JMNA 4X9IA 4IHOB 4E9VA 5EF3A 2ARWA 3LNGA 3MXVL 4WO4C 5K9OA 4ZX5A 3FCTA 3T3PF 2EXWD 4OI8A 2D3JA 2FL5B 3EAKA 3ZRFC 4MMZA 1N2RA 5DJ8A 1NSNL 2W88A 1G0YR 1N64L 3HLAA 3WFBH 4NKIH 1T6VN 4ECNA 4GBXC 1DQVA 4N87A 1CFSA 4GFXA 1RULL 2DIJA 4IBYA 2PLTA 4X5PA 1T3FA 2FYYA 1SYSB 1UD6A 3MRMB 5LBSA 2JKIS 1WGVA 4MD5B 2YA1A 3FF7A 1J1XL 1HYRC 1NFDE 4P0DA 3AREC 4P23B 1A02N 1WICA 2RJMA 4RQQA 1AKJB 1Z3GL 3EOAA 4ZUUA 1XB8A 5DJCB 3DUUB 3OR6A 4UNIA 1LXMA 2QPEB 4BWUA 1Y6NR 2X1WL 5F0JB 3IN0A 2JKRM 1IEAA 1IBHA 2AJVL 2BVQB 4HWUA 2GITA 3LRMA 4PUBH 3QZLA 2HCZX 1JZ6A 4FQ2H 3VFVA 3CG8A 3WFEL 5T1DL 3JYCA 1A7BA 4MNQD 1IFRA 4S1RH 2AVFA 3O4LB 1ZSDA 1JK8A 3LS4L 2H47C 3FQNA 1MRCL 4JY4B 1M53A 5HGDB 4QOKA 2COVD 2FJHB 2CHWA 2HKFH 3D50A 5JIDA 4PRPD 1UACL 3F00A 5LGJB 2GIXA 3X11B 4CAGA 3SY0A 3BT2H 2MPAL 3BXNA 4ILDA 2XTJE 5ANMB 3UTSB 5BPPA 4OIFA 1D7BA 2QZQA 3FULA 4IU3B 4BH7B 3HZ3A 2XWTB 3AWFA 3O6FD 5TE4L 2DWDB 2Y72A 3C6LC 2CHDA 4G71B 3WIIL 4UTBH 2DV6A 1GMIA 5B8CC 4PG2A 5IFJB 4NP4H 4S1DC 2A0LC 1P0SE 1CU4H 2EXYC 3FB8A 3ZK0A 5I1EH 1NGXA 4JKPH 4IKIA 3T3MB 2D7TL 2BVOB 2YD0A 3GYRA 3BPNB 4PJAA 3L17A 3TN0A 5I0WA 3KWUA 3WJLA 4A67A 1A6AB 1RV6X 1PY4A 5HGHB 4W81A 3W9EB 1JPEA 3SOBH 1N5YL 2HYMA 3LJ3A 3AMKA 3GJFA 4GEJA 3DO7B 1BVKB 1Z3RA 4LLDB 2YGOA 3TA3C 4XB7A 2DI7A 1QSFB 1GY1A 1BMZA 1OP5K 3MRBB 3DVNA 3M1BA 3RI5F 3QDJE 3AMLA 5GGSY 3LKPB 1LK2B 1J10A 1YEIH 2ARJQ 2NX5A 3G5VA 4GG8B 4PN6A 1VA9A 1QWUA 1YEDB 3WFBL 1JPGB 3ARFA 1ZOXA 4NKIL 3O3EB 1BIHA 2JJVA 2WK2A 4LSTH 2R1YB 1WAAF 3MROA 2WQUA 1U41A 5IQMA 4X4KA 1XCQB 5E4IA 5F0MB 1T5XB 4AYID 3UG4A 2NUTA 3QYCA 1QHOA 2V9RA 4QRRB 3ROOA 1KJ2A 4KVPA 1INQB 2PYEE 3ZZLA 5DZPA 4CVZB 4HKXA 4JS7A 1KC5H 1CURA 1YNTF 3GIVB 2FJGB 5D1QE 4GKSA 3ZDZE 4JVPA 4PJBE 1L6PA 4UM8A 5IOPB 2WGXA 4PUBL 5EU3B 3QVAA 4FQ2L 3QNYA 2FEDC 2YO3A 1PSKH 3ASWA 1M2VA 3DXAE 3MGTB 4LESA 4ODWB 2R69H 4Y8DC 5I17A 2CO7B 3WDIA 4S1RL 5IB1B 3NVQA 5T5FH 1BD2B 1WAPA 4AQOA 1AYRA 1PBYA 2HKFL 3HS0B 4N0YH 4X8JA 5F7HA 3RVVD 2I07B 2XA3A 3VE0A 4CMMB 1ZLVK 3KPTA 3N04A 5DHVB 1FFRA 4J7RA 3BT2L 2VSCA 4Y2NA 5EIIB 4N0CD 4WFFD 1ZA6A 2B5IC 2ICEA 1Q9KB 5FB8B 5MI0C 4U1MA 1CLCA 1O7DC 3N9GH 4UTBL 4P9HH 3ARZA 1BMWA 2NLJB 4AQAB 2IWFA 4PGBB 3HAEB 4XP9H 5AOIA 1CU4L 5CUSH 5I1EL 1F8TH 2E7HA 1FNGB 4JKPL 5JW4M 1CDIA 4R84A 3T3PB 3VXSE 3ZOAA 3IJ8A 4HSAC 1FIEA 5F9DC 1FI8C 1CZ8H 3VWKC 3QA3B 3IDXH 2ZF9A 1OCZB 3SOBL 1RFDH 1C12A 1PY9A 3DI3B 1ZEAH 3SKMA 1KCKA 5BMFH 2XLLA 3N42F 1SEBB 5E6RB 2YRPA 4OIBA 1UGKA 2AJXH 3JVGA 2FECI 2XWZA 1KPRA 2ENPA 3IDIB 3IYLW 1YEIL 2CSPA 1K6QH 1UEMA 1MG3C 1O7VA 4G11A 4J3OC 3VSVA 5B3NA 5KG9A 3IAPA 3IE4A 4OCNC 2ZUYA 3JV5A 3VXUD 4LP8A 5AOLA 1NEZA 4LSTL 2Y22A 4X6EA 1R5VA 2VLME 1DQDH 1NAMB 2B1HH 3RHWF 3OR7B 2MPVA 2GUYA 3QPKA 5DJXA 5C0AB 4APQA 2WVVA 3MI6A 4N8CH 4KKQA 1KY7A 4BXSV 2UXGA 5DTFA 1KLUA 3GRGA 3LZLA 2X4RB 3AU1A 4QHMB 5E5RB 5IJVA 4RGND 3QXVA 4TSAH 4MYPA 1KC5L 2WZAA 2Z91A 3VXMB 4AIZA 2WVSA 4HV8A 4MS8C 2VRQA 4PJ5E 4N2FA 2F54A 1PSKL 3HI1A 3OM3B 4YSCA 1AGEB 1UCTA 3WG7B 2J3SA 2R69L 5HGAB 5EZPA 3EBAA 3OKKA 4U1IA 4HSCX 2IANA 1F3RB 5T5FL 5B7FA 5K59E 5E6YA 1DN0A 2A6JA 2Q7YA 4N0YL 5DRZA 5A2LH 4OZFB 2BMKA 2YEVB 3PWVB 5FYKH 4BFJA 2GY5A 3MCKB 5T1LB 2VXVH 4LKXA 5D2NB 4GRWE 5TJWK 5T3XE 2RQEA 2XG5B 4AKQA 3WFCH 5BUGA 2APFA 4FS0A 5J3HC 4MDIB 1USQA 4DZBA 4YDJB 3B6SB 3N9GL 4B6ZA 4P9HL 2YGPA 4CN6A 4PJHA 1NFDF 3AT0A 4CNIA 3BKCH 1MVFA 4XP9L 5CZVH 5CUSL 1F8TL 1UQSB 2G5BA 3D3VD 4YHIB 5J6GA 1UHVA 3D39A 4KJQD 3OKMA 4WWKC 2VR8A 2YMOA 4YH6A 5B7MA 1CZ8L 1XBDA 3C5JA 3IDXL 4ZMXA 4X7SH 1W8OA 4JQXA 4Y19E 3AACA 5FLUA 1ETA1 2LW3A 1RFDL 4HWEH 9CGTA 1ZEAL 2V3EA 2AV1A 2YUZA 4XC3H 5BMFL 2B2XH 1OB0A 4TS6A 1WBZB 4NHCH 4U1LA 2BIIA 3CLEH 5FUOH 5J1AB 1I8UA 2YZ1A 2AJXL 1Z9PA 2XXCB 3EJRA 3RGVD 2F74A 4WI9A 3HG1E 2ALWA 2V6HA 1HQRB 2K4AA 1A3LH 3WIHH 3IDYB 1K6QL 2F8VA 1CI3M 2WLMA 3R7RA 3BRDA 1X7QB 3MLSH 4UQ3B 4MXWH 1CFNB 2C4XA 2NW3B 1R33A 4HWNA 3MFFA 4PWGA 5L8KB 3RUGB 1DQDL 3COOA 1HZKA 4JFHE 2B1HL 1DDHB 3U7WH 2OTWA 2AXJA 3WTUA 5HVGB 2XKUA 2B3RA 5IBTH 4WNQA 3JTSB 4HETA 4N8CL 1THCA 2Y9RT 3H42H 3H2QA 3BMVA 4DP9X 4P5MA 1H3VA 5ID1B 4TSAL 4Z77B 3QUYC 4OZ4B 4YUEH 3BYYA 4JFDE 3SD2A 4NQEB 4QLRA 2EE0A 4KKBC 4F2EA 2KT6A 5D2LA 3FTXA 1WLHA 2YC1A 2N56A 4AJVA 1QWHA 4P23D 1TR7A 1AKJD 4D9RE 1Q1JH 1NIEA 2LFEA 2IH1B 5CLWA 1UC6A 1EQWA 3O3UN 4YZWA 2VJ8A 3R4RA 4H8UA 5D9SA 4JDEB 4I2XE 1LVEA 5KOMC 4GRLC 1FSKB 1OTUD 2W80C 5HHPB 4MNQA 3E6HA 3HHMA 2Q0ZX 2VZSA 5FYKL 3IBOA 3O4LD 2CR6A 4AH2B 2VXVL 3GK8H 2DQCH 3Q05A 4U6VH 3O3BA 4FFVC 3UPRA 3RZCB 1AQKH 3WFCL 4PRPA 1VFBB 3CV5A 5I2IA 5H37G 3ECBB 3AS1A 3LCYA 3VD4A 1CT8A 3PGFH 4PH8A 2IGFH 3O9WD 4R2GC 4A37A 3UTSD 2LOEA 1XF1A 2R2EA 3FUIA 3X13A 4AL8H 3T4AC 3O6FA 2JCCB 3BKCL 5F1IB 2VN7A 1DQTA 3GS4A 4GSUA 5CZVL 3GMQB 1XT5A 3KYOA 1TTRA 5IBLC 4KTDH 3O81A 3ULVD 3RNQA 3F5WA 4PJBF 3II1A 3OHMB 4Z0XA 3IJEB 4LAQH 3WTYA 4X7SL 4FTDA 4JFEB 3S34H 4ZBJA 3IU4H 3F62A 3JWOC 3FTGA 4HWEL 4OUUB 4QKTA 4X7CC 4XC3L 2B2XL 5EZLB 3JXAA 3VYPA 4NHCL 3CLEL 1J9RA 5FUOL 1QG3A 2BSSB 3KS0J 1MLBA 5DJ6A 3TBTB 1TTAA 1FRGH 3WIHL 1H0DB 2DYSB 1A3LL 2H2SD 2VMJA 2VQ1B 5C1MB 4L29B 1E28A 3PIQB 2DEYX 2QVTA 5CM1A 1QSFD 3EFOB 1BWWA 1ROCA 4EXKA 5DSCB 2D4FA 4A7VA 1T89C 1CIUA 3MLSL 4L4JA 3BPLB 4MXWL 4M00A 2W81C 3FU5A 4FKKA 4GG6E 1V3KA 1FNHA 2PW1A 2AEPH 5H94B 4ELMA 1SY6H 3WNMA 3U0PB 2NSMA 3U7WL 4XWOD 3X1EA 5IBTL 3T8XB 3CVDA 5CLXA 3RQ3A 3H42L 2DYPB 3VJ6A 2VMFA 1A3RH 3RWHB 1KPVA 2COQA 1FGVH 3HR5A 4YUEL 1ND0B 4QRRD 3D34A 3MNWA 4WW2F 1RVFH 4QHUB 4JG1H 1KGJA 1EO7A 3H1ZA 5DD6B 3Q06A 3AS3A 2WWMD 5CP3A 1DLHA 1EJFA 4UM9D 1Q1JL 1VB9A 1TYEB 4AJ0A 4Y2DC 3DV4B 1D2OA 1JF1A 3PGCA 5DJ2B 2HMID 1II4E 1HZHH 2FX8H 2ZWZA 2VDMH 4LL1A 4NLHA 3EDEA 5FO8A 4AMKH 3U4EA 2QLYA 3VFRA 4EE2A 4YFDB 2H26A 2BY0A 4WDIA 4DQAA 2A4CA 1NFDB 4FFYA 4QRFA 1KBPA 4C57C 3WELA 4TKWA 2O26U 4N2KA 4P49A 3GK8L 2CALA 2DQCL 4H1LA 4U6VL 4YL9A 2ENSA 3QUHA 4NUQA 5EBGA 3NCYS 1AQKL 2W5PA 3CC5B