2P52A

Mouse p53 dna-binding domain in zinc-free oxidized state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Crystal structure of the mouse p53 core domain in zinc-free state.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p52A00
5ECGA 4QO1B 4AGOA 3QYNA 3WTUA 1TSRA 4L0YA 5AOLA 4IBWA 2X0VA 2IOOA 4IBYA 2BIMA 2RMNA 3WTYA 3WTTA 3D05A 3WTVA 4AGPA 2GEQA 2J1XA 1E50A 2J20A 5G4NA 2J21A 5ABAA 2X0WA 2J6WA 1HJBC 2BINA 3EXLA 1HJCA 1HU8A 1TUPA 5AOKA 5LGYA 3VD2A 1IO4C 4IBVA 3ZMEA 2X0UA 4IBQA 4L0ZA 3VD1A 3TS8A 5G4OA 2FEJA 4LOEA 1EAOA 5AOMA 3D08A 4IBUA 4A63A 2IOIA 4IBZA 3Q01A 3US1A 2J1YA 2MEJB 3D0AA 4LOFA 1EANA 1UOLA 3D09A 1GZHC 3EXJA 4MZIA 5LAPA 5A7BA 4G82A 4AGNA 2BIPA 2XWCA 4GUQA 2PCXA 3US0A 4MZRA 1LJMA 3KMDA 2AC0A 4AGMA 4HJEA 4XR8C 3Q06A 3WU1A 2BIOA 1T4WA 1EAQA 3QYMA 5AOJA 5AB9A 2OCJA 2H1LM 5AOIA 2XWRA 2IOMA 3WTXA 2AHIA 2ADYA 2VUKA 2WGXA 4IBTA 4AGLA 4IJTA 1YCSA 4LO9A 2J1WA 5G4MA 4GUOA 2BIQA 2P52A 3WTSA 3KZ8A 2YBGA 4KVPA 3IGKA 5BUAA 1H9DA 1GZHA 3D07A 3IGLA 2ATAA 4AGQA 3WTWA 1CMOA 4G83A 2J1ZA 5KBDA 3Q05A 3VD0A 4IBSA 1CO1A 4L18A 1KZYA 3D06A
chains in the Genus database with same CATH superfamily
2ERJB 3W5NA 1XF3A 2IANB 5C3LD 3O6FB 1EHLH 1BV8A 5IB4B 3BH9A 1I1AA 3HNSL 2WO4A 1HQRA 3KEHA 3Q3GB 4KWUA 3RL1A 4M1CC 3VQ1C 1TSRA 4WI0B 1JYVA 4DGWC 2JH2A 4J8QA 5FFLA 4ZOAA 3OMZA 5IVXF 4KRLB 4LCWA 2JKXA 2QQQA 4LPXA 4MVBC 4Z3IA 3FRPB 1OARH 3GZQA 5AOZA 4H88L 4J3XA 4KNQA 3NACL 3OKMA 5CLYA 3IU4L 3T3PB 5E9DD 1KCUH 4EZMA 1QI4A 1YEEH 4DCQB 3MRRA 4BE6A 4LLWA 3V4PL 2Y7OA 4AE1A 5T3ZE 2VLJD 3TNMA 1DLFH 2BSCA 4PTUA 3S8WA 2E8ZA 5GHWL 4Y16B 1ZTXH 3OJDA 3BLPX 4K9EC 2C9UA 4OLVL 3SGJA 1XSOA 4I3SH 3HB3C 4DETA 4NQED 4UT6H 1UCTA 1SXSA 4X9BA 3DTUB 4HEPG 1KBPA 3OWRA 1BX2B 1JCKA 2F5AL 4J7RA 4MSWA 3S97C 3VI4B 4F58H 1MCKA 2KZKA 4TNFA 3BN9C 5DVLA 1GC1H 5HGBB 4WSKA 1JXKA 2K1MA 2ZKHH 3LIZA 4UT9H 3A24A 4Z7QB 3EXJA 1GXEA 4PW4A 1SN5A 3SDXF 4G6AD 3BKCH 1XV8A 2AMUA 4NKIH 2E8YA 2HFFB 2OL3L 1QOKA 4UAOC 4FJZA 1JUFA 1TJXA 4NM8L 1TCRA 2PUQT 3PWVA 4BKLA 5D93C 3VQMA 2VRKA 3GZPA 1HH9B 4B3VA 3CDCA 1D6EB 2CALA 4D0DA 3UL4A 3VH8A 4Z95H 2XRAL 2W81C 4Y19B 4BE5A 5BVPL 4XXWC 3AXLB 3MZTA 4LESA 4CN1A 4LLYA 3ZDYB 1JZ8A 1N10A 1RVFH 1UA6H 1QR4A 4XHJD 3RURA 1U95B 4E42A 1MRFL 1R3HA 3C5SB 5CZVH 3ZKQD 4UYQA 1BOGA 1WTLA 2X4QB 2V2WA 4PJHB 4DZ8B 3WBDA 4K7PL 3ESNA 5E6ID 1FVDA 1GVIA 5AVXB 2VO5A 4QNPE 3OMAB 3MRMB 2N7SA 5JXEC 3DOIA 1IFGA 3MRLB 4RZCB 1EJOH 2F9BT 2BSED 4JE0A 5DLLA 1A25A 4JRXB 2W60A 4OF7A 4QCIB 1U3HA 2J88H 2Y6TE 4WV1A 1HEZB 4GRLC 1IGML 5F9AC 1V5JA 1BREA 1NIAA 2CK2A 3FL7A 3MJ9L 4KV5E 3SZKC 4WW2B 2X6CA 4RAVA 3WIHA 5K9JL 2LVCA 3WTWA 3WFDH 3L3HA 2VLMD 3JUZA 3V9CA 4YSAA 5D4QA 4W9HC 4XPAH 1E9QB 3W9DB 5L88L 4JL2A 4QRQB 5EOTA 3P69A 2VWEC 3GB7B 4QO1B 4GO6B 4G6JL 1UB6B 5I18H 1WCQA 2NR6C 4R7NA 1FFNA 1OAJA 2EE0A 5CLXA 4AKOA 1LK3L 1UVQA 4G8GE 4JN1L 4KPHL 4IRSD 3LYRA 1YYML 3OMNB 1KB5A 3NZ8A 4ODUB 4K3EL 2RFXB 2GJ6B 4ZO9A 3DGDA 1BVNT 1JTTA 4YHKL 5CZXD 1OGAD 4TUKH 3S48A 2A3TA 3FQRB 4E9XA 3VXUD 3OG4B 5LBGA 4X7TB 1OAYL 3MRHA 4RMRA 2XWBA 5DHMC 5IIEB 2XTSA 4FQJH 5JUEL 1ZT4A 2F54E 4MD4A 3FCTB 3VXRD 4J3SA 3P11L 3ZR6A 4LK4A 3ZW3A 2K8QA 3BSZL 2Q76B 3ZU8A 4NRYB 1JK9A 4AZ8A 1U8PA 3P3YA 1ZIBA 2DZEA 2ICCA 1S9WB 5JXAH 5I0YA 4M8RA 2W1NA 5EIQA 3C5JA 4N2EA 2C9VA 1ACYL 2O5ZH 3DJRA 3ARBB 3MLZL 3FYIB 2AJZB 4P48A 4UZGA 3X12A 5I5MA 2E7LC 3CPLB 3MKGA 4R2GD 3IDYB 3ARGB 4BUQA 5FW8A 4L5FH 4IOSA 4YDVA 2WXJA 4TPRH 2W0KA 1NFIA 2B7DT 2WVUA 3FN9A 4RMQA 4CNIA 2ZUQC 4HX1A 3BP6B 4D0BA 1RCYA 1N67A 2VTFA 5FGSA 1F41A 1NKRA 5EU6D 1HINL 1E0OB 3QUYD 4HCIA 3UZVA 2EVJA 3VCLB 4WF7A 1NDGA 4EAEA 1M3IA 1PNCA 4OZHA 1O6SB 4ZXBC 2GBUA 4JPKH 2XWEA 4ZO6A 1KV7A 2DMBA 2OMWA 4OM1H 1CDHA 4XCYA 5E8EB 3ZIMA 1D7BA 2DJMA 3BWAB 4Q6YA 2VLRE 5F71A 5IB1A 1ZTXE 1YEHL 4EZLA 2ZOLB 1PZAA 1T3FB 1CGSL 5DJ8A 3M1CA 1FORL 4OV6F 1NJ9A 3WD5H 4FFYL 4LCUA 3HFMH 4FQIL 5IOKA 1RH8A 1C5DA 3AAZB 2QKIA 3QPXH 4W9IC 2R4RL 4MNQA 4M02A 3MGTB 3PQYD 1UCBH 3W9EA 3VRJB 3M86A 1H5BB 2NCEA 1QLRB 4XP5H 5E4OA 1LMIA 1KG0B 1KGJA 5E9DB 3ZHLA 4X5XB 3CQFA 1QFWL 1YAIA 5EWIH 3ABMB 4JM2C 1CFQA 2LT9A 4HHGA 1ZTMA 5KVFH 4YXKH 2Q7YA 5AW5B 2VLJB 3BEVA 4RBPH 4X0KA 3DMMA 3SBWC 1WA1X 3RY6C 5JHMA 4JQXC 1MVUB 4MYWB 3V5KA 1JPSH 1CTMA 3VVWA 3RGHA 5IK3A 1MOEA 4NQEB 4PJXA 4BXVA 4LLQB 1JPTH 4ZFGH 2W80C 2AP2A 3ES6A 2XG4A 3ROOA 4BYHA 1J0KA 4IU3B 3QORD 2KERA 3H7BB 1A21A 3QJHA 4AGPA 1ZCRA 2P28B 1OIOA 2LTQC 2X5PA 1ZKAA 2FBJL 4QNPF 3QZWA 2ITFA 1KXVA 2P8PB 3CBRA 5IWLC 5DHYA 1NGXB 2CNYA 4N2AA 4YPGA 4B41A 4Y9EA 3ZRCC 3L4YA 1XBRA 2GI0A 5DJXB 2AFNA 1KIUB 4NI6A 3C87A 2CM6A 1PZBA 4KV5F 3BO8A 4MD5A 3TYGL 4P2QD 2KMWA 3VWKC 1OT4A 1O7VA 1BVKA 1P53A 1KY6A 1WCBB 4YWGL 3ROLA 2Y5TA 3A21A 3MRNA 4CSTA 1JYNA 4GB9A 4PRBB 3G5ZB 3QDHA 5AL0A 2BNUA 1BQUA 2F08A 4H8VA 5KSAC 3WXVH 2GUYA 3E38A 4ACTA 4Z3GA 3MV7E 1V05A 2K7PA 1J1PL 2PPAA 3JWDH 5MEOA 2PYFA 4ORGB 2R8SL 2H1PH 4OZGE 1O7DE 1FSKB 1CIDA 4M3HA 2A6KB 5A7BA 5DTFA 3IETB 2QSQA 2WD0A 1KT2A 1MG3C 5TQ0H 3FUMA 3T6VA 2EDBA 4LU5H 3UO1H 4A7GF 5JMRA 1ZLDA 4OFQA 4BSWB 5DD0H 3WLWD 4NERA 1M7IB 1MXGA 2FECI 4JAMB 2V2XA 4NKMB 1LD9B 4F80A 1N4XL 4UT7H 3FPXA 5F6HI 3FSVA 2AXFA 3OKLB 2XV6B 2PETA 2Q8BH 3EKCA 1SDAB 3HHSB 2GUOB 4PRNB 4HJIA 4Y8AA 3GBNL 5AZEL 1KTCA 4PJIB 2D3LA 3UO8B 1AR1D 1INDL 1FNEB 1KBGL 4IRSB 4UB0L 1N19A 2BP0A 1TKWA 3RU8H 3UTTD 3TBVB 2P8LA 1D5MB 2GBTA 2RH0A 4BM7A 3GSVB 4P2RE 4XP4H 2QPEB 2QMJA 4R4NC 1OGAB 4LMQE 4L5FE 5FECB 2DQMA 3VXUB 1FZOB 2GKIA 4HWBA 5C0IB 3EOYG 2VDMH 4G7VH 2BS8A 3VXRB 3QDMD 2BVPB 3MOAL 4UZSA 4AKQA 2EINB 4HS3B 2C1PA 5JQHC 5IHUH 3D85A 5KG9A 2V7NB 1H3VA 4HIHA 5AG9A 2FEDD 4BFOA 1FYTA 2M8XA 4ZUWA 4DERA 2ODIA 4YLQT 1SHXA 2LU3A 3OAUH 1S8DA 4LNRA 3GFUA 1KEMH 3TTSA 4XAWL 3FO2A 5F3BB 5GXBB 4R2GB 1ZGLB 5CN2A 1SLWA 5ILTH 4Y5XA 5KYXA 1NC2D 4PS3A 3VM7A 3GTVA 2X6UA 1R6VA 4J6IA 3T77B 4PGJA 3Q6GH 4HSCX 3BZDA 1XO8A 2ZXCA 5LXGL 1UJTA 4PI2A 5EDXA 5HVGB 2QZQA 4FLQA 1CDGA 4N87A 1T20B 3QUYB 5CGYD 3BD5A 5FM5O 4WJ5B 3IGFA 2JSFA 4OD1L 1MJ8H 1OCRB 1QPXA 2E7DA 3HRZB 4FQ1L 1PZUB 3GSNA 4NWUL 2AZUA 3CE1A 3IYLW 3Q5YA 3QEHB 4WO4D 4WHTB 3A67L 5DRXB 1ONQA 7PCYA 4TLSA 3EGDA 1PLGL 1NCWL 1AQHA 1X5YA 2ZP8A 1A6WL 5JNYB 4GY4A 1BFVL 2WNXA 3NPSC 4HH9A 4YSOA 1UWEL 3LZFH 3W2DH 4BQ8A 4PRDA 4GKSA 1SXNA 1WZAA 3A47A 1NLBL 2OZ4L 4KKLD 1NMAH 4B3EA 1SOXA 2P5PA 1SXZA 3ESOA 3PQYB 5HJBA 4F7KA 1CF8H 2P42B 1WZ1L 5E2WL 5HDRA 4XE0A 3EJZD 4TNEA 2P26A 3UJTL 4RWYH 1D5ZA 4AUYA 4FA6A 3UAEA 2CO6B 1S6NA 3P9LB 4BD4A 4LGPB 3AXIA 3B9VA 3BD4A 2JE8A 1FWXA 3RB7A 5H37G 3STZA 3BT2L 3VFGL 4HPYH 3SQBA 1OE1A 1JWMA 4M7LH 2AABH 3K71B 5AVZB 4QHUB 3FUNA 3PNRB 5B1AB 1SDDA 3PPSA 2YD0A 5EUOE 4I13B 4X98B 4CVZB 3FJTA 3QORB 4Q56A 5D72L 3MNVA 4KKAC 3SE9H 4HKXA 2A9NL 5DYOA 2OP4H 1I1YA 3AROA 4K7PX 3ZQXA 3P73B 4X4MA 2X38A 4OZGF 4UBDC 4X4YB 5J89A 3GJFA 4XP1H 4I1NB 2NSQA 5DGQA 4BQ9A 2XN9E 3OHXB 3U1PA 4M8QA 1HOCA 1IGCH 1CF1A 4UNUA 4GS7C 2IANE 2PF6A 3BAXA 4O5LL 4P2QB 1SY6H 3K6DA 2W07A 5ECGA 3U9PL 4F93B 5L2JB 1FP5A 1I7ZB 2YSTA 2B0SH 2K6WA 3ARSA 3GMOB 3MRKB 5EG6C 5D7LA 4HK3N 3VXSD 3BZ4B 1GYWA 1ADWA 3ZX1A 3U2IA 5CEYB 4FHBD 3K7UA 4U49A 4OI8A 5MEPA 3X3FL 1NMCB 2GHZA 2X2UA 3VFNB 3T3PE 1ADQL 3DVNA 2G2RB 1XF4A 2BIIA 4YEEA 5GZOD 1QWUA 3NJNA 4V11A 4CKVX 2GSGB 5EN3A 1MJ7H 2NZ1A 4OAWB 4PWKA 2YAPA 5DFVD 1R46A 4PJFA 1L7TL 2Z91B 1AIZA 3NFNB 2NMSA 1G1CA 4Q9QL 2EDMA 4U1GC 1RZJH 3MCKA 5DC9B 4YUEH 1QTPA 4RMSA 1CBJA 2XKNB 2A4ZA 4JQVA 1OW0A 4G72B 1QLFA 2Y7SA 5T33L 1HZKA 4H8PA 4PJCA 3VI4E 1KFAH 3GSWA 1MHHA 1K6QH 4J23A 1HEHC 1AR1B 1MLBA 2OXHA 2V9TA 2DAVA 4KU1A 2GTQA 4WAFA 1GAFH 2F1EA 3UTTB 1NBVH 3BEWA 3BW9B 5SX4I 3D69A 4PJAA 2MCAA 2APFA 5JZ7D 4DK6A 4WY7L 5KS9B 3ESMA 3L5IA 2PLTA 1M05A 2NNAA 4RX4D 1YO4A 2NZ9D 5DJZB 4WI7A 5DO2C 5HVHC 2NX5A 3UBXA 5C0JB 4Y4HA 1TCMA 5HHPB 3KEDA 3SPJA 3QDMB 2BIOA 4Y19E 1WT5A 2XY2A 4XCEB 2WV3A 5G5DB 3HN8A 1XTMA 3AGVA 1RHHB 3CK0H 3ZDYE 4J12A 1N6QL 2H1LM 2FT7A 1A3ZA 4HAFA 1ML0A 1UKSA 3R0MA 1QD0A 3VYPA 2X2YA 3UDWC 4M6NL 4PJHE 2IV9A 3IRZA 1RIUH 3OKKA 4E0RA 1RI8A 3DOSA 5JIMA 5CZRA 2XFGB 1XCXA 4PJDB 2A2QT 2EVGA 1L0PA 2AGJH 3CU7A 1VFAB 3NZUA 3JWOH 3OL2A 4NNXB 4QJ3B 1NC2B 1W0WB 2VO8A 4XRCB 3U6RB 1E4XI 3BMVA 3IB4A 3QQ4A 3TYFA 2E6PA 4OTXL 3S4SA 2Y25A 3QULB 2GY5A 2ZG3A 2RCSH 5MERA 4TUOB 5D5MB 4JMXA 4FHKA 4LEOA 3HLAA 2IEPA 2MOQA 4XNQA 1MCLA 3DXAD 2BZ7A 2BVUA 3E8UH 4WO4B 5C0CA 2GK0A 4JG0L 2CK0H 3ARPA 3WTUA 1HYRC 3M17B 3VQLA 1BQHB 2P24A 4UV4H 3ZYJA 3X3GL 2VLKD 3F58L 3GD1C 1LP9A 5TE4H 3QUKA 2R69L 2V2TB 5JPNA 2PCYA 5EUOF 1FGNH 5I6KA 5C0EA 1NOAA 3QJFA 3UP6A 2K8MA 5GZNC 5TJWK 3IDUA 2IH3B 2X0WA 1CYWA 4JBSA 4N5EC 4U1KA 1HQ4A 4R97B 4N2FA 1DYZA 4GQ9L 2OMYB 1Z9PA 4G59C 2PCPB 3MXWH 3DX8A 5H2BA 1NH6A 1NDMB 3SDYH 3T0ED 5LGJA 4HWNA 4Y5YB 1AGBA 3LKRB 3H42L 2DQHH 1MVFA 2FO4A 2FH6A 3L3IB 4IU2B 6FABH 3E80A 2WZ6A 4JM0A 1PYWA 4QHPA 4HG4J 1MLCB 3OVUB 4WRLA 1YQVH 2MEJB 1S5HA 3D30A 3B9KC 1UOVA 4K8RD 3DX9B 1UJ3A 5C92A 5HDWA 5CR1A 3FU5A 4XBPB 3B6SB 3ARYA 2FJFB 3GT6A 4P2YA 5EC2B 5DZJA 4UOW0 4KDVA 1AGEA 5FYJL 4E9QA 4XOCA 3QUXD 4OUOA 2Z34A 5D4JA 5K93A 2IG2L 1N7MH 4PJ9A 3P3SA 3T3PF 3B83A 2OQJA 2M83A 5DVPA 3LEYL 5D6CB 4JB9H 1VFOA 3VSUA 1MVYA 2ADGA 5GS0C 4A04A 1JFHA 4N20A 5F7EH 1BWMA 3DUUA 3FQXB 4KO6A 5EO1B 3OQRA 4N0FA 1D5XB 3BAEL 5FYKL 3VXSB 2WLNA 4G6MH 3ZO0A 1KZQA 5MP6L 1QBML 1FL3B 3VI4F 2OK0H 2BP8A 3DBXA 5LBSA 1NLDH 2CJTA 3MXVH 1T6WA 2YPLA 4XB8A 4F15B 5E9DE 2C9RA 2VXQH 3G5VB 3LEXB 1UC6A 3AQXA 2IQ9L 1CUOA 2MNWA 2Z8VC 2NY3D 2VLJE 1HSBA 4PJEF 5DJAA 4PP2B 3DARA 3G5YB 1ETZB 1G7PA 3RNKB 4TL4A 5GGVL 3UERA 3F04A 4AQAA 1EBAA 1EO7A 1U0QA 3BKYL 4NNPH 5E00A 5DZPA 2DI8A 2NTFA 3APNA 4OJCA 4LKCA 5GS1A 5FKAB 3VG0L 1K5WA 1B4LA 3ORJA 2W9LA 1ZSDB 3IF1A 4MZ2A 3BP5B 4EI5C 4N85A 4PJHF 4AENA 1WFOA 1T5KA 1CQYA 2E9GA 3FSWA 3HAEA 4TSBH 1EK3A 3NUKA 2VCOA 5F7YC 4KZCA 5JPMC 2WXMA 1CFNB 1UD2A 1QTSA 2C4XA 4FZ8H 4YOKA 1RJCA 3HA0A 1JK8A 1TZOA 2BRRL 4MMXB 4IOFD 1QW9A 3PJSB 3N43B 2LFEA 1DJHA 3HC3L 2D8KA 4WTXA 3QO0A 2ILLA 1TJIL 5KOMC 4FAAB 1XD0A 2ZT9C 3L95A 4L0ZA 1ZEAH 1D5BB 2DQFB 3CUPB 5IVXA 2H26A 5KVGH 4P9HH 4HXBL 2VXUH 3T0WA 1J7VR 2AQ3A 2JELH 2C3GA 2FGWH 3REWA 2ISDA 2J72A 2G2PA 4TNVK 3CSGA 2D7QA 4BWUA 2R0ZH 1KTRL 2KDYA 4NBZB 4AC4A 3HBPA 4TL5A 1DBAL 3ULVL 4PGEA 3NCEB 1JRHL 3ZRFC 4K3JL 1JNLH 3H0TA 2ZKWA 3CFEA 1D5IL 3CIAA 3KJ6L 4FQ2L 4K3HA 3BWUF 2O5XH 3TX4A 5J6HB 4ETYA 3P9WB 3PDDA 4KK8C 4U6VL 5A2FA 2ZCZA 2AC0A 5EZIH 3NK3A 1NAKL 3O4LE 2J6EL 2VLME 4YXLH 1NKGA 4P23C 4ZFOA 2BOCB 4XMKL 4FNPA 1YUKB 2OCCB 3GIVA 5T1MB 4A7QA 4B96A 4NCC1 1DCEA 4LFHD 3QCUL 2QR0B 3QNZA 1S9XB 3LRLA 5JHDE 2J43A 3DXAB 4D9LL 2V3DA 5LG6A 4NN5B 1TVHB 5JORB 2IBZY 4M62H 5CJXA 3JVFC 3SDXA 1U30A 2BZCA 4PJIE 4GG6B 1FCCA 5F7NC 3DBSA 4FQCH 2J1WA 3OM3B 4Q4EA 1EZVY 3QEUA 1D7CA 2VLKB 2YK1H 5AUMA 1RZ8A 2AJYH 1ETA1 5F6IB 1I8AA 3QJVB 1IGFL 1PZCA 2X2HA 3BCDA 4ZQTA 5BO1H 1OGAE 2JIXA 1V7NL 3UAAA 2WQSA 2XBTA 3ULSB 1C1EL 1FIEA 3R1GL 3RVVD 3B5HA 5C9JA 2YZ8A 3U7AA 1RKRA 3VXRE 3O6LH 4IS6B 3BD3A 4DKFL 2CZNA 2FO1A 1DBKL 5IM7B 4GP8B 4PJ6A 5C71A 1KN2L 1NUFA 1AACA 1B6UA 1AP2B 1FNFA 3TBCA 3WJMB 2VNCA 3O2WL 4F92B 1WE5A 1IC7H 1YNLH 2WINB 3KAAA 5E2UL 4PYGA 2QHRL 4CBPA 3IFNL 1NL0H 5DS2A 5IMOB 1HHIA 1MG2C 2GVYA 1RZFL 2O5YL 5LB1A 2DQTL 2HB0A 2BY0A 2IFFL 5HI4C 2IBZX 4W6XB 1S7TA 4DIXA 3ZHNA 1WRFA 1OSPH 4HIIB 5E6IC 4XCFL 4AV4A 5DWUH 1JZ2A 5I28A 3WFHB 4NPJA 2B3RA 5J11B 2D31A 1AZBA 1FLRH 5EBWA 4FKHA 4YL9A 3HJEA 1ILUA 3NSCA 4FI7A 2A9ML 3OJMB 1F0LA 1NOFA 3CSBA 1AIFA 1OALA 4YSPA 4MBRA 4F2MB 4ZUVB 1MHPL 4GEJA 2X9YA 2JJTA 2NY6C 3HNSH 1ZV9A 4PS8A 2W5PA 2WQWA 3IXTB 4PWGA 1Q94A 1M2VA 3ARFC 1V3JA 1L6XA 4AEFA 2XFXB 3FFCA 1ORQB 1AS7A 4XO9A 3DX7A 4H88H 1EHAA 1HXYA 5LUMA 3NACH 5KYWA 1S7VB 4HBQA 3O81A 2P5EA 3J2PA 3IU4H 2BLFA 2I07A 3KPRD 3P9MB 5CBAA 2WBJA 4WENB 4P3CL 4LCCA 4H13C 5CIPA 1HL8A 5DS1A 1TETH 2FHBA 1RUML 2EABA 3RX7A 1EV2E 3RY5A 3ULUL 4MKMA 4HLZH 4TMPA 3IJHA 3N06B 3EH2A 5GHWH 5J0BA 4QHNB 3RGVB 4OLVH 5TE7L 1TQBC 4WU7A 2FIRT 1SHSA 3EYFB 3RFZA 5FO7A 2F5AH 3LKPB 1FV1A 5I6NA 4QTFA 1BF2A 5KVGE 3K6SA 2WMPB 3Q5TA 2P80A 3PYCA 4APXA 5BZDA 1ORSB 4NM8H 2WVSA 3N1MC 4EBQL 4M6OL 3UGEA 1RUQL 1ZV5A 2AQSA 3EAKA 3WLBA 4C4BA 4KQ4H 3EBHA 1IAII 1R3LB 4F2FA 5DMGD 4NI3A 2XRAH 3UBHA 1J0JA 5BVPH 1AZZC 4MCYB 2GSIB 2A99A 2ADIA 4YMPA 1FJ1B 1Q38A 1XD1A 1GS7A 2VR6A 3N91A 4P2QE 4EZKA 4LAJH 1MRFH 2Y7MA 1JNJA 3PHAA 5T8IA 3QNFA 3HE7D 4JQVC 1K72A 2RA1A 2ZWYA 5LNGA 3GC3A 3L3KA 4K7PH 2GIYA 1MN4A 3CQPA 1XH3A 1V10A 5FA4A 1RK1A 2BIMA 1K8DB 4HK0B 3HCVB 4PJIF 3LS4L 2OMTA 2CM5A 2QEJA 4FYQA 1ND0B 1RZPA 3QDGD 4NIYE 1J8SA 1CGUA 3MJ9H 3IDIB 5K9JH 3FT4A 1HU8A 2ZCLL 4Y4HC 4G42A 2EE9A 2UYLA 5MI0C 1WT5C 1HIML 3SOTA 3UCQA 3ZMEA 4XNXL 5L88H 1I85A 5DUML 4KVCL 3DVIA 1FHGA 4LAQL 3RDTA 5C08A 2PWDA 4G6JH 1A4KB 1E5YA 2WIIB 1X9QA 3D33A 1CC3A 1HHJB 3UTQA 2VQ4A 4X7SL 2RD0A 3GJEA 4IIQA 4QF1A 1LK3H 1KENL 2CDGA 3ABZA 4I7ZC 4JN1H 1MCBA 4KPHH 2P7TB 5E1IA 2BM3A 4JZOB 3NQIA 3V52L 3ZR5A 4Z18A 4J3OD 4K3EH 4JFZL 3SGEH 5JW5A 1A9VA 1A1OB 3GSQA 1YEFL 4YHKH 4DVBB 5DFAA 1ZJBA 3MREA 3T4AA 4FQHA 5LAPA 4MX7A 3EYUH 4BH8A 1OAYH 5KS9E 2DYPA 1IM9D 1ET5A 1HZHL 5JUEH 4GMSL 1F4YL 1RULL 3P11H 5D9SB 3D2UA 3F7VA 3QDME 1DBML 3BSZH 5FYJD 5IKCB 1P5UA 1U58A 2PTUA 5LAXA 3VNYA 2C9QA 5I71B 3REVB 4ADIA 4MJJA 5GGVY 4V1DE 4ADGA 1PCXA 1ACYH 3ILPA 4J2XA 4BKTC 3LPWA 2J8OA 3MLZH 1KIPB 3I50L 4G8GA 1FAKT 1GTNA 3FTZA 4PLKD 2XZAL 4JQIA 1NCDL 2OMNA 3UEQA 3ZHDA 4PJDE 3EBAA 2Q3AA 2JB6B 1BZ8A 1JNHA 4L9LC 4QD2E 3LH8A 4TQHA 5ACLA 1OTTC 4A7GA 5HJDA 5FYKD 3TBSA 2EXSA 2GJRA 2Q20A 1L9MA 3BAIA 4OIFA 1KGUA 2AXGB 3AW5A 5ERWB 1EEZB 4ZMYA 1BFOA 1LEGB 2F54A 2XSKA 1IC5L 2CRYA 1KPVB 4ZS6C 1N0XL 4P46C 4YR6B 4JPQA 4JFHD 4BFFA 4HCRA 2CRMA 5D5ME 2XPYA 4DT2A 4K5NA 4YDLB 3OAYK 4LP8A 5C0GB 2HT3D 2P46B 4PR5B 3WFBL 5D1ZD 5E1GA 5CCJA 5IQOA 4PW9A 3U0PA 2UZXA 5B1KA 1G9NC 3MTRA 3WNJA 4Z6AT 1YEHH 1TQVA 3S3PA 1T1XA 3HE6A 8PAZA 1BQRA 4X6CB 5JHBA 4L0YA 3S98A 1YN6A 3NYKA 1FORH 4Y9FA 5JLZA 4FFYH 3U7YL 1JBJA 4FQIH 2P8MA 2APWA 4FL4C 4KY1L 4TUJA 2NYZA 2RALA 3GGWB 4Y4FA 2DKMA 3U30C 5HY9B 3BPOC 3PNWA 5EBMA 1KBWA 3IJ9A 2AKRB 3KPRB 4HGWB 3IGUA 1QFWH 2OBGA 3OJVC 2YRBA 5EBLA 1PG7L 2COQA 3HZMA 4PJ9C 1IAIM 4B7LA 4W9GC 1U6AL 2WBWB 3BWZA 5IHBA 1YMHB 2L8AA 1MWAL 2MQ0A 2VLRA 4NUJA 2WNWA 2X9WA 1XGYL 1G9MC 1FNGA 4N2NA 3V79C 2WC7A 2NUPA 15C8L 1UKTA 4UT6A 1AOHA 2DQIL 1KIRB 1GYVA 3CQQA 9CGTA 3NQKA 4QWWC 5JW4R 1H15A 2FBJH 4HS8L 1VRSA 5D7IB 2FSDA 3CLEL 3WO4B 1LDPL 2NY4D 2WLKA 4LDCA 4F3FB 3BPNB 3BP7A 5L4MA 4WHCA 3RVUD 3S3CB 3SDAA 4IDJL 4X9GA 3AREB 3TYGH 1EZUA 2EDWA 5E1AB 3MJGX 3QNYB 1A6TB 4Z3HA 1OGSA 1TJHL 3HE7B 4GW4B 4K8RH 4N0CC 1ZJAA 1CE6A 4KI5E 3UTPD 3DIFA 1DVXA 3VXSE 2WPGA 4JG9A 1UXSA 1J8HD 1E8WA 1UM4L 2XV0A 2YSSB 1J1PH 3BDXA 3LPPA 4ZW6A 3TIEA 4Z76A 5C6TL 2R8SH 1TQUA 4LKXB 1IC4L 2ZZUT 3G3LA 2I27N 5IQLA 1YQ2A 3II3A 4QTHA 4JKMA 3GSUA 4IRJC 1PLBA 3CZUB 3ME0A 4JANB 3QDGB 1Z9OA 1CZ8L 3WIFB 1SJXA 5KS9F 3O6ML 3O9WD 1MY7A 2VW6A 4MYPA 4ODVL 3CNKA 5EEYA 2NY1C 2R2BA 1NANI 4KVNL 1N4XH 5JHLL 4LVEA 2CGRL 3EYOB 2O6DA 4HK3J 3GBNH 3PLYA 5AZEH 4HT1L 1JHLL 2C7UA 1NGZA 1INDH 1MCHA 3F8UB 1KBGH 1X5JA 3MV7A 3NZHL 4UB0H 4BSVB 2RMNA 4F8LA 5JR1L 4ZW3A 4CADA 2IH9A 4YC2B 1HESA 3DTDA 4PJDF 4JFWA 1S7RA 3UH8A 1P4LB 1UB5A 3QUZD 1EAPB 5HGDA 1WAEA 5D1QC 1Z5HA 1KYFA 2ZOWA 4LSTL 1IM9B 1NUNB 3MU3A 4YAQA 4MNHB 2IBGA 3W56A 4AYDC 3MOAH 1YMMD 1L9QA 2BY2A 2BRQA 3FKUS 2OI9B 5E94A 1AD0A 3UX9B 1YN7A 1FN4A 2J57A 4JFPB 4JO2L 1XIWD 1GOGA 2NXYD 5D5MF 4M6ML 4YO0B 3G6AA 3MGOA 2M26A 5CJXC 3POCA 4XAWH 2ESVD 5F3HA 1AZCA 4LOUC 1YEDB 2EYRA 1FFTB 1TVBA 4GO9A 1IEBA 5A3IC 1GGUA 1Q90A 2Y2TA 4QY8A 3V7MA 2H3XC 3L4XA 1AFVL 3OAZK 4P2RA 1RUAL 4POYA 5JOFB 3V0WH 1JGVL 5IHHA 5A16B 1TZAA 1S7UA 1XR9A 2FD6L 2ZAHA 4S2SB 1JPST 1AS6A 5LXGH 5IHZB 4LHUB 2B5IB 5A2JH 3IFPA 1W2KT 4NHUA 3K6OA 3OQ3B 4CU6A 4U1IB 1DJYA 3ESPA 4PGBA 4PWJA 1UWXH 1THAA 1FFOB 43C9B 4OD1H 2HX7A 4R3SA 1ID5I 4CJ0A 2IAMD 4QJ5B 4FQ1H 2ZUXA 4X6BB 1JPFB 5CBEA 4XC1H 3ULUD 2N59A 4NWUH 5JIHA 1F11B 1NTDA 2R1XA 3DXAE 3A67H 5D1ZB 1TQTA 4AQ1B 2V6HA 4XO8A 1JP5A 4S1DC 3T0AA 4D3CL 1PLGH 4PP1D 4MQXD 1P9MA 4WEEA 4GG6E 1NCWH 4LO9A 1NEZA 2VLKE 3EHBD 3PP4L 1A6WH 4OGQC 4UQ9A 4ELKA 1BFVH 4F24A 4B9PA 1MEXL 1P69B 1UWEH 1YZZA 2DM2A 3VXOA 1H9DA 3VRIA 4U1JB 1UWGL 4AM0B 1NLBH 2OZ4H 5HJ3A 43CAA 4X6FB 1C5CH 4NUMA 5BZWA 1WZ1H 5E2WH 1DSYA 2BSTB 1XZ0B 3AWEA 4PB0L 1HHKA 5DHVB 3UJTH 5F0LB 1EFXD 3M1BA 1U8HB 4OB5L 4BUGA 5I30H 3ZSSA 3GRWL 4R0LA 1YVLA 4Y7OC 4YFLF 3U0WL 2ETWA 5D6DA 1N8OE 2OSYA 3VFGH 4G80B 3BT2H 1DQIA 2NZ9C 1VHPA 3PV6B 1PU0A 3O3DA 5F89A 3VFUB 3CSFA 3KPPA 4HC1L 3GDCA 1ECYA 1FAIL 5ICZB 2ITEA 4F9PA 2HX8A 2XU9A 1IZJA 5CJQL 5J57B 3LZNA 4I88A 1HI6A 2V9UA 2IOOA 2QVIA 1L3WA 4DGYL 1T22B 5D72H 1A6ZB 3HHMA 4KI5F 5ETUA 3LSOB 3HBZA 3GKWL 1IKFL 2A9NH 2J1XA 2YUZA 1WZMA 1P7QD 2WKOF 4YK4C 3SO5A 2OKMA 2WBJC 4JY4B 4OKVB 4UUJB 3WAKA 1JN6A 2NY4B 3JBG7 1Q9LA 3NEOA 4N3UA 2XBDA 4F2ME 2B59B 2P4AB 3KPNA 4KJWC 5D2NB 1OWWA 1BF8A 5EO0B 4RGOL 4O5LH 2WB7A 2KS0A 4XNYL 4PG2A 4A6YB 3E9UA 3U9PH 4YN3A 4P2OC 1VERA 5AW2B 2CIKB 2DDQL 5TH2B 5KSBB 1OP5K 5EUOA 1OGTB 4QHKI 1MHEB 3BE1L 2A1WL 3CC5B 5AW6B 2BCMA 3PRZA 3UZQA 3GBLA 2NW2A 1SMDA 3UPCA 4CGUB 1NGWB 1J8HB 3S3BB 3HZYB 2NT0A 1ZWIB 1ES0A 3GI9L 2K6ZA 1ZA3A 4NO2A 3GZOA 3X3FH 3S3DB 1AG0A 1HNGA 1ADQH 4L8CA 2NLJB 5E6ZA 3T8MA 1DUZA 5FOJA 3V55A 1LK2A 3A6OA 3LZLA 1Z0MA 3DO7B 3HKZA 4RDBA 3JT0A 4JNXA 3AG3B 1F18A 1HCZA 2VQ1B 2XN9A 4A7VA 1G84A 1TU2A 3O41A 4F9LA 3DRQB 1L0YA 2Q10A 1L7TH 3WU1A 5EB9A 1NCOA 3N43F 3O6FA 1YJDC 1DJWA 1YNTB 2HJLB 3O9WB 5IB4A 4Q9QH 2WYZA 2GCYB 1LO5B 3HC4L 4NAQA 3Q3GA 4WI0A 1T21B 5B38B 4KZ0A 5T33H 3FW6A 2XKSA 3VNZA 3T0EC 3HI5L 3MBXL 1EEYB 3FQTB 2WSDA 3CN4A 1PY4A 2AQQA 4J3UA 5E70A 5EZLB 2XG5B 1MFVA 4WY7H 3DPDA 5IF0B 4DCQA 3QUZB 3L4UA 1HE7A 3CFCL 1F56A 3BYTA 3PWLA 1NCHA 4ODXB 3L7FA 4LQFL 1CICD 1YMMB 5J11C 1S9VB 4H0IA 1N6QH 1ACZA 2BY1A 3KGUA 3RDTC 3QUXC 1XIWB 4RGND 4GT7A 4M6NH 3VI4A 5C0RL 5FDWB 2H5UA 1PZ5B 5EDSA 2ESVB 1JZDC 5HGBA 5HXMA 2ZF8A 3GBDA 3ATBA 1J0IA 5TDOB 1MCWW 5GGSA 1FUNA 2P45B 4YSCA 1ACCA 1VGEL 2YJQA 2HFFA 3TNNB 4XE5B 1UACL 3ZE2B 3OR6B 3D25B 3T4AC 4PJEA 3K91A 1NBQA 2BCKA 1D6EA 2YRZA 1A02N 4M7LT 4OTXH 4JFUA 2RAMA 1HK6A 1Q0EA 2ATKA 3T3MB 3VXPA 4UQ2B 4Y19A 3B2UD 3IK2A 1H6TA 1OTUD 1VCAA 1SHMA 1MZZA 1JAEA 4D94A 1I9JL 1P5UC 1UKQA 4WK4B 3C5SA 3SDCB 4RMTA 3F7PC 1OE2A 4UCFA 2DLGA 5L6YL 2IAMB 2Z1PA 4UM9D 4BZ2L 1D2PA 2X4QA 4PJHA 1W0VA 4JG0H 1WV7T 5E4IA 3KBFA 5IW1B 2NY3C 1B4JL 1B0IA 1AKPA 4GBXD 5IB2B 3MRMA 3JYCA 1CK0L 5D7JC 3MRLA 3F58H 4RZCA 4MWFB 3X3GH 4F8PA 4KJQC 2YAQA 2YD2A 4NZRL 1NEPA 2R69H 3EHBB 1EANA 2VC2B 4QT5A 4QCIA 3OB0K 4WFHE 3LXUX 2WYHA 1PY0A 1ZAGA 4NQSB 1IV8A 2YZ1A 1HEZA 3FXIC 3CXDL 1JZ3A 1OPGL 3FZUC 1FZJB 4U4IA 3HUJB 2Z9TA 2XWCA 2FYYA 1N5AB 1TO5A 4B9IA 2DJ4A 3T6QC 1E9QA 4R4BB 4GQ9H 3W9DA 3JWNH 3KPTA 3OKOB 5IROA 1JTOA 1SBBA 3TT3L 4QRQA 5DD5L 2WANA 3GB7A 4QO1A 5T1LA 1U3YA 3EOTL 3QWQB 1UB6A 5EUKB 5FB8A 3C60D 4FFZL 2ICWJ 3H42H 4LDLB 4W1TA 5GJTH 4E9TA 4J3OH 3HE6C 3HNVL 1FVCA 1DFBL 2OXGA 3IMVA 3BRGC 3RZCD 2VXSL 3ALXA 2RFXA 4GUOA 1M1XB 3S2CA 3QIBD 4AM0Q 4BK4A 4M4PA 5IIEA 4NUGL 1JOIA 2D9CA 4LSUL 3IGLA 1P7QB 3FCTA 3OWEA 2WNGA 5FYJH 4C4KT 2F7RA 4A67A 3ZKMD 2VLLB 4JFFD 1AS8A 2IG2H 2Q76A 1FZMB 4NRYA 3C8KB 4IBSA 4TQIA 3X14B 4AUUA 3LEYH 4NQCB 1S9WA 4MNGB 5I1IL 3W81A 4QGTA 4BRVA 4K94L 4M3JA 3ARBA 3N9GL 2AJZA 4Y2DC 3CPLA 1SY6A 1IL1A 3IEAA 3ARGA 3PJLA 2UVFA 1S78D 4JKKA 4X6CE 3T71A 3BAEH 1HYSD 5FYKH 5IQNA 3M1OA 1MRDL 1NWPA 3WUWG 2XYBA 4QXVA 5MP6H 1QBMH 4G6FD 4JFXB 2NT1A 2X4SB 1AHWA 5ESAB 1F4WL 3HG2A 2XZZA 3DOHA 3A6CL 5BXFB 1XSIA 5DQ9B 4TSAL 4KX8A 3Q2NA 1EH9A 3KPRE 3VCLA 3WKPA 2IQ9H 4Q58C 2HFEB 4N8VB 1TUPA 4A1RA 3CVDA 3DETD 4TN9A 4WUUD 4FG2A 1KGIA 5GGVH 4XVOA 2YQBA 5E8EA 3E0GA 1JF1B 3BKYH 3N85L 4JG1L 3G08B 3KVQA 4KAQL 1AI1L 1CFTB 2ZOLA 5DJ2A 3VG0H 4BFEA 3D08A 3UIZA 1WWWX 5AB2A 4Z23A 4KO5A 43C9A 2EO1A 3L5XL 4F57L 3AAZA 1Y7VA 2PWFA 5I1EL 3PAVA 4QYAA 1JI2A 1FL6A 4IMKA 5DHVH 1H3UA 5HYIA 5D7IE 3QARA 1H5BA 3CX2A 1QLRA 1CLCA 3WELA 1KG0A 2OMZB 5E9DA 3QSKB 2BRRH 4HUXB 4LB8A 1XAUA 3HC3H 2AK4D 2VLJA 4MA3B 1TJIH 4FQLL 4S10A 3SE6A 3ARDB 4N9GB 3QIWD 1MVUA 1CICB 2J25A 2H6PB 4XPBH 5EU4A 2GAZB 1DDHB 3RB5A 3FH8A 5B8CB 5DZVA 4HXBH 3WFCL 3BRFA 4RGNB 4LLQA 1J18A 3CZLA 5H94B 4BRJA 4XMLL 4IU3A 2ZOTA 1ZVNA 3H7BA 4PMEA 4OF6A 1DBAH 3MHZA 3Q8CA 3ILQD 2VDQL 3UTZB 1RZQA 3CFKB 4FLSA 2P8PA 4K3JH 3H4HA 4P3DB 3P77A 1MCPL 4K5MA 5ALCL 4KO9A 1D5IH 1NGXA 4FQ2H 4W4NA 4YE4L 1N2RA 3WS6C 4CJ1A 4U1MA 1A1MB 3BQUC 4U6VH 5LXVA 5DJXA 1KIUA 3FTVA 5IREA 2KLSA 1NAKH 1IBGL 5SV3A 2J6EH 1XVSA 4GRMB 2IV8A 5I6PA 3B2VL 1OM3L 3LN4B 4U6XB 4XMKH 1WCBA 5I5RA 3WIIL 25C8L 3PHOB 1AGDA 3QCUH 1A5FL 2XPZA 4UM9B 4PRBA 1T4KB 3G5ZA 3JWNE 2F8XC 3Q8EA 3HRPA 5JIIA 2QTEA 3JZ7A 1MRCH 2NNXA 1EFQA 3I3EA 4GBXB 3AVEA 3EFDL 3GPSA 1F3RB 1E8ZA 3VSTA 1MWAB 3RWGA 3AY4A 4C4UA 1PVHA 1MCFA 5HPMB 3FOLB 2A6KA 1IGFH 1T0PB 3IETA 1ZHNB 1IGJA 2HXAA 1V7NH 5EF3A 1C1EH 3TA3C 3HN3A 3C75A 3R1GH 3TJHC 3DX4A 3UPRB 1FFQA 3QC5X 4BSWA 2EDEA 3O4LA 2BHZA 1IX2A 2QVKA 3C5XA 1M7IA 4JAMA 3AQYA 2X1OA 2VYRE 3ARTA 2Q86A 2AMGA 1NPJA 1DBKH 1G7JB 1O9ZA 2GG1A 4DKFH 4ERSL 5FYJE 1R24B 1KN2H 4OFKA 1W0YT 5LQBH 3OKLA 4MA7L 5JHDA 2A0LD 3NVQA 3O2WH 5E2UH 2GUOA 1NCBL 2R4SL 4YFEA 3ABKB 2QHRH 3C60B 4PJIA 5DMGC 4C83A 1ZXQA 1FNEA 2BNRA 3B5GA 3IFNH 4KMTL 2P49B 3Q2CA 4PI0A 2O5YH 4QKTA 2DQTH 3MRGA 2R9HD 2OAAA 3OZ9L 3L5HA 2IFFH 3RZCB 5C0FB 4X6CF 3GSVA 5FUZL 2I5YL 1OGAA 5FECA 3C9NB 5FYKE 4C4KO 3PUUA 1PD6A 4XCFH 1MFUA 3T0BA 1E5UI 2HTKD 4FXKB 4LBAA 5GGUB 5C0IA 2PR9A 3VXRA 5L9DL 3KWXA 3RJOA 2DMGA 4HS3A 4PCSA 3US0A 1LO2L 2AW2A 4GXUM 2OR8A 4JFHE 2V7NA 4OCMC 2A9MH 4JFFB 2Z93A 3WIAA 1S7XA 2YAEA 4PGCA 5EHFA 2CXGA 1MHPH 4P4KA 1GCFA 5DDHB 3RDJA 1DBBH 2KKQA 3UMTA 3L5JA 2CR0A 4BKSC 2GW5A 4Y2OB 1R5WA 2RTTA 4MQ7B 1CDCA 2O30A 2A9CA 1ZGLA 4I1RA 3QIUD 4QRUB 5B39G 1R5IB 4WQOA 3HG1D 4XVSL 2VDLL 3WV0A 4G6FB 1P5VB 3IMUA 3T77A 5IHWA 1HX0A 2BS9A 3VGDA 3QB7C 4NKOB 4M1DH 4Y1AD 4HKJB 2OYLA 3KH3A 1HCVA 1BZ9B 2UXGA 4PQXA 1UADC 4P3CH 5D7IF 3QUYA 3W11C 2H8PA 1XGUB 1RUMH 3ULUH 5KBDA 4L8BB 1PEWA 5HHVL 2VXQA 3HRZA 3SPGA 1K2DB 4WUUB 2YMXL 2QJDA 2V37A 4WHTA 3BI9X 5TE7H 3X13B 4EJ1C 3ECUA 3WCYA 4DKAA 2HRGA 2VC2H 3G9AB 4CU8A 4TF4A 2AQ2A 1FC2D 5JNYA 1OP3H 3KR3L 2DLEA 3OAWA 3GMQA 4TM9A 3TU6A 1B9ZA 3QW9A 6TAAA 3UYOD 2VZTA 2I7OA 4U2YA 4E5XB 4RISL 3X17A 1RMFL 3K8KA 4WSJA 1CFSB 3ULVE 4L1TA 1X9LA 4EBQH 2BVOA 4M6OH 4I4WB 1BIHA 2EQDA 1S7SA 3FO9B 2CO6A 5DD6B 5JW4N 2JCWA 3PGCB 3IAPA 3KPSD 2AK4B 2NOYA 4N86A 4IHOB 5D2NE 3VD2A 1U36A 2Q5BA 1BVOA 3QIWB 2X0UA 3RWFB 2JKSA 3H9SE 1T03H 1NGYB 3IPEA 4M7KL 3L9EA 4P4RB 3K71A 1M4KA 4QHUA 4NRZB 5INDB 1L9OA 3NH7L 5KSBE 1DJSA 3FTXA 2QGEA 4CVZA 4X98A 3UTPE 4J1UB 4FI6A 3QORA 2NY2C 5B21A 1TJMA 2E7BA 4UQEA 3FN3A 1J8HE 1A22B 1TYEB 1C7TA 3LS4H 4L2LA 4MBOA 5L2KD 2JTYA 4WWKD 3P73A 1XL4A 5FFGA 4J3OF 4X4YA 4HULB 5FW7A 2X87A 3UZEA 1PFCA 1PAMA 2R2EB 3FOMB 4G7YL 2V4LA 3B5TA 5JYLA 5KBMA 2ZCLH 3OHXA 4JFQB 2WVTA 4AC2A 4QXGH 1HIMH 3L3OB 4WSGA 2LLNA 2LAAA 3BUDA 4P2QA 4XNXH 4KVCH 4AH2A 1S7QB 2R59A 4LAQH 1I7ZA 3UFIA 3MRKA 2I69A 2Q3ZA 3FBQA 4XMUA 3ARXA 4UZUA 4X7SH 3G04A 3BZ4A 4M7ZC 4X0NA 4AMWA 2COVD 2YGQA 1KENH 3B3IB 3V52H 5CEYA 5D7SL 3L9YA 2D3JA 1O6TA 3IMWA 3NCFB 4OZFA 3MRFB 5KBLA 4JFZH 3IMTA 1KJ3L 5KYUB 3C5ZB 1YEFH 1QUNB 4L0PB 2R56L 3VFNA 3ZPDA 3MYZA 3IWUA 4Z8FL 2G2RA 1ZE3C 5CGBA 3AFLA 4X50A 1U8KB 2GSGA 4PHXA 4HJ1A 1HZHH 2J44A 2W95A 3S5LB 3VWJD 4OAWA 3LPOA 4GMSH 4TLTA 1F4YH 1RULH 3OXSB 2V0AA 2Z91A 3NFNA 1SF3A 3OC5A 1DBMH 4JFDD 1YMME 1OXYA 5SX5K 3BHBB 3QQXA 3L17A 5CJBA 5I73B 4UTCA 5ADPL 1ECZA 2XKNA 5DJ0B 2VRQA 3BUBA 5KAQG 1G6RL 2MH4A 3EZJB 3I50H 5TPWL 3C09C 4H0LC 3S0PA 2EDFA 3WY2A 2XZAH 3GM0A 5IFAL 1NCDH 4AEHL 1GY1A 3UEZA 5FM8A 3L1EA 3CLFH 4RFNC 3BW9A 2JTDA 2G4EA 1OQXA 3FQNB 2JXMA 4IJ3C 4KKQA 4M43H 3ZE2E 3BFWA 1F13A 5I76A 1IARB 5KS9A 3NCXA 3KXFD 4LLMB 4GI9A 3CVBA 1N0XH 5HHPA 4Z0BL 4UOQA 5G5DA 1R19A 1GOHA 1RHHA 3RKDD 4XVUD 4KROD 1MF2L 1CU4H 2B9AA 5B4MD 5IROC 3SD2A 1JZEA 3ZZSA 1BZDA 4GKNB 1ODUA 4ELDA 4B9ZA 4V1DA 3GXUB 3VTTA 3WFBH 3ULUE 4OF8A 1QUPA 2DM7A 4JG5A 2ITDA 2XUWA 2WKLA 3TURA 1OAXL 4C59B 1FRGL 1HHGA 1R4XA 3B7TA 4PJDA 4IBUA 2VMDA 2B08A 4JO3H 5I74C 3VXMD 1I8MB 4WU5B 2AS5M 3U7YH 3UYPB 3DPBA 4NNXA 1NC2A 1W0WA 2PP8A 3GJFK 3HG1B 1PF3A 3C6EA 4KY1H 4XRCA 1O5PA 3U6RA 2YMOA 2LV4A 5IR1A 2OYMA 3V0VA 4P5RA 3HUJE 4RGMC 4Y1AB 4TLUA 1O6VA 3QULA 4JPIA 2Z35B 4RH4A 3ULVF 4I8DA 4LLDB 4TUOA 1PG7H 3OC8A 1EHNA 5D5MA 3RAJL 2WO3B 3PWJB 1TLMA 3I6LE 3V4PA 1A4JB 3KH4A 3EGXB 1MWAH 2LOEA 2CA3A 2VN4A 2VW4A 4ZNCD 2ZF9A 3BGFC 2VM3A 4L4VA 2UZPA 15C8H 2E9WA 2NY0D 4JPWL 2IWFA 4UTBA 2DQIH 2NXYC 5KSBF 3TT1L 5E5UB 3Q1SL 1AHWC 1ZDSA 4FXTA 4HS8H 1OF2A 3L2NA 3Q1EA 1DJZA 3D4GA 4XWGL 3DV4B 4ZO8A 5LDSA 3LKOB 4KHTL 4EOWL 2IH3A 3CLEH 2F7PA 1OOAA 1LDPH 1WBZA 5L7XL 2OL3A 1CDJA 4GOSA 1DEEB 3O2VL 5J9PA 2OMYA 1XB3A 4XCCL 5DRNB 4KKNA 1QBBA 1Q1JL 1NDMA 3KPSB 4IDJH 4NQCE 3I6KA 4JDTH 4MNGE 3I6GA 3IE4A 4Y5YA 1MH5B 5D96C 3ZZLA 3LKRA 2B14A 3MACL 3L3IA 5BZZA 4IU2A 3EJQA 1YNTF 1TJHH 2EDNA 2Y06L 1SHWA 1C8PA 3K0WA 2UWEB 3O4OC 4G71B 1MLCA 1EEQA 2Z92B 3DX9A 1M6OB 5J13C 4RMBA 1UM4H 4DFIA 4XBPA 3WDIA 4ALAC 4DN4L 5F72S 2NDGA 4TULL 3B6SA 3PU7A 4ZNEE 2FJFA 3RVXC 1IC4H 4MQXC 3MRDB 4DNLA 5L2KB 3LPFA 4JDVB 4WWKB 4ZK8A 5GGRY 4AIZB 5IJVB 1CZ8H 1JF6A 1NINA 4H1LB 3FCSB 2XN0A 3AG1B 3O6MH 5D6CA 3MJ9A 2FLRT 3OMIB 2EAEA 4ODVH 1CXIA 4H26B 1EQWA 5JHLH 3FQXA 5E9AA 5EO1A 2A9BA 2W0PA 1IT9L 5G55A 1PL3A 1DVTA 1A9EB 1D5XA 3ZRSA 3VXSA 4HT1H 1JHLH 1A3LL 3TONA 1FL3A 3NZHH 2WKOA 3GLDA 5JR1H 3A6BL 5BOZG 5DQJB 5KUMA 3V6BR 4LIQH 4HQQL 1YDPB 1NEZG 3T1WA 3MV8D 3UOAB 2PR4L 2Y72A 4NO5B 1P6FA 3LEXA 2ZP0T 2N4IA 2GSMB 3Q44A 2CIIB 2DLTA 4LSTH 3ZE2F 1CLVA 4QUOA 3VWJB 3PUCA 4PP2A 1ETZA 4HA1A 3RNKA 2LQRA 4K9EL 1EDYA 5AAMA 4XR8C 4JFDB 1QVOB 2ED6A 2HPOA 3FF8A 2A4CA 2EDLA 4PB9L 4JO2H 5I75C 3TO2B 5AOJA 1AZRA 4OCXL 3BSZA 5ICYB 4M6MH 4RGNE 3CVIL 3EO0A 1H9VA 5KN5B 1ZSDA 2O93L 1D7FA 3EFOB 3OXRB 3BP5A 3PGFH 1L9NA 2CUIA 2YA1A 3U36A 5HHOB 3ULUF 1QFHA 1GGIL 2HT2D 5F0JB 1O0VA 1B6DA 5F1OB 3KLKA 1AFVH 3NJGA 1EHXA 2MKWA 1RUAH 3MVSA 4ZODA 5L8KB 4Q6IB 1JGVH 2CDEB 3DJ9A 2PPFA 5F0MB 3T8VA 3DUSA 3DVGA 2FD6H 2IWGA 3V4LA 3AACA 4RX4A 3T1FA 4Z7NB 1E3XA 5I8EB 3KXFB 4AGQA 2E27L 4WEUD 1RK0B 1I8LA 2O6PA 4YSDA 1OCCB 4MB5A 3HUJF 5F9JA 4ZFQA 2CKBL 1A64A 3V0HA 1D5BA 1FO0L 4KROB 5DRZA 2DQFA 1W8NA 3CUPA 1BVLB 3PP3K 1UA7A 2DLHA 4V33A 4FNTA 1JWUB 1P0SE 3FTSA 3K4AA 4X8GA 6CGTA 5I1KL 3MBED 3NN8A 5ITFB 2ICWI 1MFBL 2CAKA 2Y2YA 4XN2A 2F2HA 4KOCA 3BAKA 1NCJA 3PP4H 5DJYB 3VXMB 4PYHA 2E7CA 4ZX5A 3U4BL 1MEXH 1Z9MA 3P4LA 4BZ1L 4MXQC 5IJBC 1UWGH 4V2CB 1OAKL 3NDYE 5I17B 4HPOL 4ZAKD 4UIMA 3KYKL 2XLLA 3RIFF 2ZYRA 1SYVB 4PB0H 5JO5B 2XX1A 3U0TA 1MY5A 4OB5H 3QZBA 3QQ3A 4NQTA 4HJ0D 2BOCA 5HYEA 3K8LA 3GRWH 4H8HA 3U0WH 2WBXA 3DI3B 2XQYG 3HZ3A 4PW3A 3IPFA 1CD9B 3D4CA 2ZX5A 2QR0A 4P4KC 1S9XA 3DXAA 5TFSL 3QJQB 4EIUA 5JORA 1TVHA 2DQJL 3AU0A 2E3VA 1E4HA 4HC1H 3W5MA 2ZUVA 1FAIH 1JIBA 4P8QA 5GSVA 5D1XD 2VLKA 2MTAA 5CJQH 3QH3B 4NQDD 2NY0B 3IJYB 5IY5B 4DGYH 4WCYL 1KJVA 4X5QA 4B53A 4BWTA 2FLBT 4OCWL 2A74B 3GKWH 5ES4B 3F65A 3U1SL 1IKFH 4XBGB 3ULSA 2ZNXA 2P1YA 2XQ0A 2HT4D 3H3KA 2M2DA 4AOFA 4P5TC 1ID2A 2PYED 2WP3T 3KYAA 1X4ZA 4IS6A 1DANT 1EDHA 1XGQA 1ZLWH 2X70B 5JDSB 2HRHA 4U05A 5FF6B 4JFFE 5IM7A 3MRCA 1BSIA 4DKEL 2FIKB 5J8OA 3WJMA 4RGOH 4XNYH 1GMEA 4ODSL 3I9IA 3C6SA 5DRWA 1B4RA 1KSRA 4PS4L 3D0LB 1E2VA 1I8KB 2DDQH 2X4PA 5C2BL 5TF0A 5IMOA 3WTXA 1Q0YL 4XMXA 3BE1H 2A1WH 2LLGA 1BFSA 4NC1C 3PY9A 1P84K 3BAJA 3EZ8A 3I9GL 3OX8A 3D6GA 1LWJA 2XJLA 4L8SB 4HIIA 2HRPL 3GI9H 2OYKA 5IW6B 3QI9D 3CBKB 4EXKA 4QR7A 3W39B 3TA4D 1E5BA 1N64L 5HYSB 3QGVA 3ZJAA 3B2MA 3L5WA 4LIQE 2HTLD 4GQRA 4EUPG 4IKIA 4ZUVA 1D9KB 1A0QL 3NRFA 4WUUE 4FF9A 3F7RA 3HC4H 1NFDE 3CD4A 4BDVA 3TF4A 2XFXA 1I9RL 4P9HC 3VFWB 3LQAC 1BBJB 1ORQA 2YFNA 3HI5H 3MBXH 3MLWL 1E9PA 4YHLL 2QZ5A 4CA4A 5ISZE 4OIAA 3ERXA 1S7VA 1I7TB 2IDCA 4WZ9A 5E8PB 4HIEB 1ZVSA 5AW4B 3P9MA 4DO4A 5FO2A 3MV8B 3GSOA 2HLFC 3AQZA 4M61A 4FXGC 1IC1A 5DJDB 1Y6NR 4DPAX 3CFCH 3H56A 3QIBC 3SIKA 5TQ2L 3SE4C 5GGRB 5C7ZA 3A22A 5EIIA 5F9OL 4LQFH 2XVBA 3WNOA 1Q0XL 4QXUL 3TN0C 4QHNA 4IEFB 3IAGC 1FH5L 3RGVA 3VSQA 2G9HB 2OMBA 5KVMC 1I9IL 1ZK5A 1WITA 2CDFB 4H0GA 3MV01 3EYFA 4UNTA 3ZKMC 1USQA 4H2CA 1BAFL 4Q9RL 1WFUA 4M29A 3V6ZA 2EUZA 2A6JB 3IS1X 4X2UA 5AOMA 3A4DA 1LM8V 1PMYA 4WNQB 5C0RH 1JHKL 4A2GA 4XNZB 2DQ6A 3F5WB 3N1PC 1IVLA 4NQVB 3OV6A 1VGEH 2WMPA 3F7KA 4QRPD 3L4WA 5I16B 3O0RH 3RL2A 4K15A 5E4EB 1HN1A 1UACH 4HKBA 2IPKB 2NNFA 3IM1A 5T1KA 2VDLB 2EDOA 1KOAA 1NCUA 1R3LA 1IUZA 4MCYA 1FJ1A 1I9JH 1FBIL 2DEXX 2EEAA 4TTGA 4HEME 4N90D 1JG9A 5DHDA 5L6YH 1EAQA 3S36L 4DHLA 2DLFL 3PAZA 2YRPA 3FK3A 3M6DA 5IG7B 1RJYB 1Q9WA 3S35X 3W82A 3MBEB 3O3EB 4LOVA 3S8GB 2VMEA 3HPLB 3KS0H 1CK0H 1ET7A 2FQGA 4M03A 1K8DA 2MSPA 5GJSL 4NZRH 3HCVA 5L0QC 4L37A 5L4FA 2P5WD 3EDJA 4OI9A 4ZMPA 3K5RA 1ND0A 4G5ZL 4H1LH 5AYUL 3CXDH 3WG7B 3AY2A 1L0QA 4DP6X 3HZKB 2NSXA 1U33A 1TTCA 2C26A 4ZAKB 1KCWA 3HPJB 1ZPUA 2OZ4A 4DP5X 2GYSA 2WCGA 4UDTB 3ZSTA 1R47A 2BPBA 1P2CB 3F62A 2IIJA 3MMEB 4NZUL 2AVGA 4P06A 5CJOL 3MC0A 3ZOAA 1F97A 2BWQA 2EEFA 3PHSA 5DD5H 3TT3H 1UOKA 1A4KA 3OKYA 1H3GA 2WIIA 3EOTH 1HHJA 1B0WA 4FFZH 4GIOA 4KKCD 4NP4L 5DURB 3LH2L 5CN1A 3HNVH 4JZOA 2AJ3B 2JK5A 1DFBH 5D1XB 4APQD 4I0PC 1T66C 1W6WA 3GMRB 2VXSH 4ANXA 1EHKB 1DQJA 4WLCA 1A1OA 3IKKA 1EA9C 4IBYA 4NQDB 5D71H 4E9LA 4DVBA 4CU7A 1JXGA 2J8HA 5FDYA 3EJSA 2IBBA 1RJZB 3KPOB 4NUGH 2WP3O 1QFOA 3R8QA 1OSYA 4LSUH 4CDGC 5AG8A 4RA3A 3WOVA 2Z31D 5CJ5A 3FTUA 4BEIA 3G9VA 5D9SA 1SVCP 3LB6C 2K0RA 2PYEB 3KPMB 3C8HA 2ZYHA 4J3BA 4JK0D 2XXMB 5IKCA 2IWKA 2XA3A 4DQOL 4OV5B 1DHKA 3GRBA 3I6SA 3REVA 3MOQA 3AM8A 5I1IH 4F7TB 1F1AA 2H41A 4XMVA 3KPQA 1IE5A 3NFSL 5KVEL 4EO5A 2ZSWB 4NN7C 4OFYD 1KIPA 1G4MA 3MFFB 5I82A 1GGYA 2C4FU 2QBWA 4N8CL 2FLMA 4HDIB 4M1CD 1GS6X 2WLMA 2JB6A 4GYBA 1NFDF 4XPAL 1MRDH 3KJ4B 3SGKA 3HG1E 4MVBD 1F4WH 1PDKB 2AXGA 4MLSA 2HFTA 3LMJL 3QXWA 5ERWA 1EEZA 3A6CH 2EADA 5BV7C 2XQBL 3QI9B 2PW1B 3ENEA 5E5MB 3RNQA 4TSAH 2X7LA 2ALAA 4UDUB 4YR6A 4Y1AE 1F4HA 4F7PB 2Y1YA 1J5HA 4YFLI 2CWRA 4A68A 4AYMC 3IMRA 1ADQA 5FHAL 5C0GA 2AEQL 2HPTA 3CN2A 3VW3L 5IW3A 3N41B 2YR3A 1RAMA 5KYYB 4HVBA 1TFHA 1UUNA 3HG4A 3N85H 4JG1H 4KAQH 4NQUA 3RPIA 3U79A 1AI1H 5E03A 3HB3D 4X6CA 3L4TA 3GBMH 3NCYP 3RKPA 1XGTB 2P43B 1IKNC 2X1PA 3L5XH 3V0EA 4F57H 3BN9D 1G6RB 5I1EH 3WNLA 3V0DA 3DHMA 2EUXA 1IAKB 1MDTA 1KJMB 3CZNA 5HY9A 1IVTA 4QRTB 2EIZB 3MUY1 3OPZL 2AKRA 3KPRA 4HGWA 5B7EA 2R1YA 2LHAA 2L3BA 2I26N 5DA4A 2O72A 4FQLH 2BH0A 3KPSE 5I0VA 2HMIC 3VD0A 1OKEA 1FHNA 1YMHA 4ZTOL 1CO1A 5D4IA 5ENWB 4JFYA 1N68A 1N70A 3WFCH 4X9HA 3ZHFA 2UWEE 2EIBA 2CRZA 1YC7A 4XMLH 1NIBA 1KIRA 1EVUA 1QEXA 3IDJB 4YHNB 3LPGA 4PJBB 2DF3A 2VDQH 1F42A 5D7IA 4QRPB 5L2KE 2F53D 3QIUC 2JQAA 4YE4H 2Z8WC 4DP7X 5FR3A 3MPCA 4GRLD 1U3JA 1QZNA 4B9JA 1VCBC 4HUUA 4OLYL 4R8WL 2IADB 3HFML 3NPZB 3MRIA 4JKLA 5FGCE 3AREA 1IBGH 4RIRB 1OM3H 3B2VH 2LGNA 3R18A 5I0ZA 1XCWA 3WIIH 25C8H 5IP4A 5I6OA 3FB8B 5DC4B 3STLA 2I9LB 3SPVB 4CILA 4GW4A 1RL1A 1A5FH 3UC2A 2J73A 4FP8L 3JZYA 3K6FA 2MCPL 4LASL 2BVEA 5KVFL 2NR6D 1EUTA 3PWNA 1BPLB 5C6WH 3EFDH 2ZAIA 2NY5C 2YSSA 3ABGA 3CBJB 5TDPB 4JL1A 3BUQA 4LKXA 2W65B 4UQDA 2AV7B 4G6KH 1K9TA 4BFGA 4QXTA 2P5WB 1FG9C 2R69A 4JDEB 5DZNA 1I7RB 3DSFL 3MO1B 5T1JA 2PKDA 4JANA 1UOWA 3MGAA 2F19L 3WIFA 2HVKB 4WWPA 1IQWL 3K0YA 3VG9C 4EIGB 5IOPB 1MIML 5DGRA 4JFDE 1H6UA 4G7QB 3U7WL 4ERSH 3V9EA 1Z3GL 1A9BB 4MA7H 1QFWI 3EYOA 3INUL 1AANA 4AE0A 1NCBH 2R4SH 2XWRA 2Q7NA 5TK2A 1AO7B 5HHOE 4BSVA 4KMTH 4DUWA 1CXLA 1FNSL 3NT0A 2BVQA 2EEBA 4APQB 1E7VA 2ZWSA 3OZ9H 4JEGB 3JV0A 3I02B 4B0MM 5FUZH 5ALBL 2I5YH 4KKBD 3EGSB 2AQPA 4U2ZA 1P4LA 5HHQA 3N6YA 1EAPA 5HHNB 3ATFA 3CH1B 3FU8A 3K2MC 4ODTL 3QO1B 3FPYA 1IM9A 4CN6A 2XWTA 3KXFE 4MNHA 2Z31B 1LO2H 4UI2A 1M42A 5EZJB 4OZ4A 2H1PL 3N50A 4BK5A 4JFPA 5FPIA 2AV1B 5AKTA 4PJ8A 3U6XA 2KHAA 4YO0A 4U7SA 3MODL 3WDHA 3QWRD 4H2AA 2RHEA 4OLXH 1ZRUA 3SKMB 4MAZA 2YAHA 3IFOB 4FQPA 1YEDA 3L2LA 3V8OA 1SJEA 2KZBA 3VXME 1PEZA 2VDLH 3CN1A 4HZLB 5A16A 2WGNB 2Q8BL 4GUCA 1JZIA 4HH8A 2WLJA 4S2SA 2ICEC 2YUXA 1H3PL 1NDTA 3Q9PA 3GSRA 4LHUA 5IHZA 5KVDH 2UV3A 4JM4L 2J20A 3V5HA 3TPUB 4U1IA 3RU8L 4C54A 1Y6KR 4ZBJA 4KFZC 3MNDA 1KTDB 3DUHA 4YNYB 1FFOA 3J27A 4JM2D 3WI9A 2Z3FA 3Q48A 3BCFA 5DVNA 5HHVH 3CJJA 32C2B 5LGYA 1JPFA 3GSXA 4IBVA 3V4UL 1J1XL 4AQ1A 2XPGB 4ZFZB 2BERA 3BP4A 1BD2B 2X88A 3HB3B 4B9GA 2GIXA 5IHUL 3OLGA 2CLZB 1VADB 4A63A 1OB1A 3KR3H 1E4XL 1U8LB 1EMTL 5HGGS 2UWEF 2P44B 4ZMTA 3TEUA 4UF7C 3V4VL 1JMZA 4JFEE 4U1JA 2SEBA 4AM0A 2PPDA 3SBQA 1UZ8B 4XN1A 2DWYA 4RISH 4Y0GA 1THCA 1RMFH 1RZKC 2NYKA 2Y7LA 3H3PL 3Q43A 4OZFG 5E6RB 2BSTA 1XZ0A 1JS4A 4UAOB 1Y18B 3D3VD 5DHVA 2DYSB 1BG1A 1JZGA 3QXUA 4G82A 1U8HA 4AX3A 4EF3A 2XXGA 5D93B 5CN3A 5FUCC 1GOFA 3LDBC 4KBPA 3W3BA 1JPGB 3HS0C 4QRRD 1V54B 2G5UA 1IGTB 2WXRA 1A6PA 1JDDA 1XGRB 3ETSA 3VGEA 3BH4A 2MJWA 5DZLA 1ZHKA 3VWKD 4S1RL 2IJ0C 4M7KH 4CAGA 3CVHA 3KLLA 3VFUA 4FA8A 1EXUA 5C07D 5CFHA 2W0LA 3E3QE 2CKBB 4I9WD 3U46B 1FO0B 3NH7H 5EEZA 2X6VA 4BWWA 1P1ZB 3B7SA 3GS4A 4IRZL 1T22A 1A6ZA 5KSAD 2J7LA 5D8JL 3VTMA 4Z7VE 1F2XK 3S36X 3WSQH 2LR4A 2F15A 4H5SA 2X6AA 3APMA 1BYPA 2F53B 2G9KA 3FT3B 2G75B 3IMSA 3JVGC 1EPFA 3C6LA 1BZQK 2EIJB 3QDJE 4G7YH 4U3SA 4GRLB 3FYEB 1NSNL 3W2DL 2WQRA 4IGBA 2B59A 2Y24A 4W9ZA 4J2QA 5D2NA 3GM8A 5GS0L 1S5IL 5EO0A 1QEWB 2HG5B 4DEUA 2H9GB 3H9SA 3SKOA 4CVXB 3FB7B 3QRGH 5BRPA 2J6EA 1NBZB 2FBOJ 4WNSA 2CIKA 5L4JA 1QFWM 5KSBA 2Y22A 3IVKB 1OGTA 4MD0B 2BSRB 1MHEA 3CC5A 4Y4KC 1E30A 5J3HD 5D7SH 2XTJE 1NGWA 3QJTB 2ZP9A 3VMNA 3HZYA 3WNKA 3FCBA 1F00I 1KJ3H 3IXAB 4YGVA 4J3VA 3LNFA 4OGZA 4D7BA 4BA0A 4ZX4A 2R56H 5CD3B 1IBHA 1OZUA 5E8DL 2EIMB 4LEBA 4Z8FH 1OM9A 2ZOOA 2VL4A 4PG9A 4FFVC 5J06A 5M94B 3MJ8B 3P0YL 1I3VA 4AL8C 4N5UA 4PJGB 1MCIA 1T2QL 1GKOA 4JO8A 3DURB 3DRQA 1HJBC 1L0XA 2VM4A 1GGCL 1YNTA 3GLEA 2HJLA 2O61A 2GCYA 5C0AD 2NNCA 3E2HC 5ADPH 4EZJA 4K07A 1R3IL 3VD1A 4ZUUB 2EYTA 1G6RH 5DEZA 4MRBA 2W9DH 1A7BA 3EG9B 5DF0A 5TPWH 4YHPB 3IJ8A 3H3BC 1EEYA 5IFAH 4NCDA 3U9UB 1G0YR 2XOTA 2K3TA 1YYLL 1CGXA 3NEEA 4AEHH 1KXTA 3FQTA 4RESB 5CXPA 5EZLA 2K70A 1F6FB 3T08A 2XG5A 1D2OA 1KUMA 3DHPA 3DYMA 4ZW5A 3FRUB 5IF0A 2CH8A 3QUZA 5HDBB 1D5RA 4ODXA 2ZUQB 4OKDA 1BECA 1C08A 1Z5YD 3ETTA 3I84A 1J0YA 4RBPK 4Z0BH 3VUAA 2CLRA 4AGNA 1AE6L 1YMMA 1HSAB 1S9VA 3QCVL 3S9DB 3OSKA 1MF2H 2H47C 4I5BB 4YDIL 1GR7A 1XIWA 2QGBA 1J5IA 2VSMB 4Z77B 5I66B 2V9QA 4LT7A 3RHWK 1R34A 5EZOL 4LP5A 1PZ5A 1OAXH 3K8MA 1FRGH 3VE0B 4XOEA 5TDOA 4HYTB 3V6OE 4XZUB 1TLKA 2VN6A 5HD8C 5EU3B 3OR6A 4OSUL 3D25A 3PABB 4PRID 4ZMXA 1CE1H 4HWBL 3VO0A 5I8OL 1KB9K 5IEHA 3ZIYA 1XSKA 4UQ2A 1PSKL 3QXDB 2W0FB 1GAFL 3SZ6A 1H3TA 1MCEA 1G94A 3RAJH 4JM2B 3SDCA 4B97A 2CO7B 4ES9A 1DUYB 2IAMA 4HUMB 3AM8C 5KOVC 3FUFA 3WN6A 4MCMA 3I3DA 2YD4A 1DLHB 2XX0A 5IW1A 5E2JA 4D9QE 5IB2A 4Y2NA 1VLXA 4MWFA 2XIBA 1GHFL 4LBEA 3BDYL 5D1XE 3DV6A 1BXXA 2KI6A 4IKNA 4JPWH 4TVPL 5F6HJ 1LEIA 4OJFL 3TT1H 3Q1SH 4MDJB 4NQDE 4RSYA 4OZIB 4NQSA 3TPKA 4KKAD 3GXFA 1ZHLB 1ETJA 1NCAL 2EE2A 5A2BA 2LTQB 3HUJA 4KHTH 1QATA 1SYSB 4Z7VF 1GYAA 2FWOB 5HI5C 4FJ6A 4FNLL 1R3JB 1CVSC 1JJUA 2Q8AL 5L7XH 1N5AA 4UBDD 3O2VH 1CXHA 3D3VB 4FZEL 1X5LA 2PYEE 1SDYA 2Z4QB 3A23A 1TT6A 2WYIA 3I75B 3OKOA 4XCCH 5FGRA 1C12B 1Q1JH 1E6OL 3VACA 4QRRB 2ZTBA 2TRYA 4GIAA 5EUKA 1IGIL 5CNHA 3VWKB 1F4AA 2Y06H 3FCUB 4WKXA 2E6QA 1ULVA 3DDFA 4JGUA 5C07B 3SCMC 2JLLA 4PBDA 3VFMB 2YN3A 2N7BA 1FVEB 4MDIA 3F6LA 1M1XA 4GUPB 5E99L 3G6JB 5AW8B 4E9RA 3BVVA 3W0WD 5KSAB 4EN3C 4DN4H 3US1A 4TULH 8FABB 4DW2L 3VX1A 3LNDA 3BJ91 2N0MA 3EOBA 1P7QA 4MAYC 4EKXA 2IDSA 2BJML 4HS6B 1J11A 3KVDD 4J8RB 3MZGB 5CD5C 4YQXL 3EJYD 1FZMA 1V3KA 3C8KA 1LILA 3X14A 1IZKA 4G8FB 3TBBA 1I7UB 4NQCA 2CGYA 2HJFB 2X1QA 4MNGA 5CKAA 4AEEA 2GPZA 4H0HB 3NEXA 4X5WB 3CH8A 1DDTA 2JNZA 5KJ4A 3UG3A 1M7DB 3OAYH 5J7CC 4G70B 1NIEA 1R1CA 3MJWA 1WO2A 4UQCA 3MXWL 1I1CA 1A3LH 1FCGA 2X4SA 4JFXA 4YL4A 3E7JA 2DMCA 4NUPA 4OD2B 5ESAA 3WN5A 3A6BH 1KLGB 5DFWH 3S3SA 4ZNEA 4FYSA 4PM1A 1N5YL 5BJTA 5BXFA 4HQQH 5DQ9A 1A2YB 2PR4H 1E42A 3CFDB 5EU5B 3RIAF 3GS0A 3TO4A 4HHAB 4N8VA 1MJJB 3VXQA 5DO2D 3IGAB 3VD4A 2A5UA 3A4AA 4K9EH 3WNPA 3NZSA 1GZQB 1UH3A 2QSCL 2HT4C 4YHZL 1JF1A 4PB9H 2Z0UA 5C0AB 1DO6A 3QEGL 2VR7A 5DQDH 1CFTA 3CVIH 4TRPL 4WUKL 2VJ0A 4LEXL 1RXLA 5AZUA 1GGIH 2FR4B 2C9AA 1LE9A 4JB9L 2YUWA 4OGYL 3JV4B 2ZKXA 4PJBE 3H85A 3QFGA 3MV9D 4YVUA 4CC1A 5DZOA 3ZYZA 1X4XA 1X5IA 4QRPE 2YUVA 2C9PA 3D4ZA 5CU9A 1BJ1J 1VZGA 3T6XA 5H37H 4HUXA 2YD9A 3LY6A 3WE1A 4MA3A 2VE6B 2E27H 5FYLD 3QC6X 3ARDA 3RWJB 4N9GA 3AG2B 5F7KC 1CICA 3EXLA 2H6PA 1ZLSL 3MA7B 4O58H 2CKBH 1DDHA 4GEIA 3ZKNC 1FO0H 4YBQC 3TBYB 4G8IB 5B8CA 1IO4C 3UG5A 4DP0X 3AB0C 2D4FA 2UY6B 3DRTB 4N90E 4XNDA 1G7LB 4BFJA 2HTLC 2APTA 3SSGA 4B27A 5I1KH 1QHQA 1XX9C 1MFBH 1DEDA 4LPTA 4JY6B 2PPCA 2ZOKB 3ARZA 2K6YA 3WEXB 1MCCA 3KLQA 1MIEL 4Y1SA 1V3LA 3UTZA 3CFKA 3U4BH 4P3DA 3EYVB 5AYQA 4HUCA 3PXHA 2P5WE 3NPSB 4O2FB 3AABA 3WKMH 1IAIL 1OAKH 4PRIB 2IXQB 2YWZA 4HPOH 1A1MA 1T0MA 3KYKH 1P7HL 5GZND 4PPTA 3L45A 4AK2A 4N5ED 3M46A 1HILB 4NJ9L 1L9TA 4DN3L 2XIDA 1JV2B 3LN4A 2OX5B 4U6XA 2GITB 4BK5C 1T04B 4LGSB 3OGCB 4W9JC 1I31A 2Q6WB 1OV8A 4PJ8C 3FAWA 1G4RA 1PTZA 5TFSH 1HAUA 1T4KA 1XF3B 4RMWA 1SVBA 1FNAA 2DQJH 4L4JA 4M48L 4WHDA 4GBXA 1Z7JA 1AO7E 1KWKA 2UXFA 3RL1B 1MWAA 2APBA 3D34A 2HLEB 3D4YA 1KYAA 4DGVL 4BA8A 5ACZB 1ZEAL 2YIHA 5K1VA 1F3JB 5HPMA 4WCYH 3LHAA 4BFNA 4OCWH 2CR6A 3CGTA 3KYNA 2WN2A 4GT0A 4KI1A 4WTZA 1ZHNA 4RNRB 3SKNB 3U1SH 4ABUA 5HYFA 1U8IA 2JJVA 4YSRA 4FEMA 3F7QA 3OKMB 3UPRA 5IJKC 2D2OA 2R83A 1DVZA 3MTXA 2GTZB 3RTQC 3GWJA 1F1GA 1FE8L 1G7JA 3EO9L 5C0DB 3IRCA 4F27A 4F7CA 1R24A 1TF4A 1JNLL 2J1ZA 4DKEH 3Q05A 3DMMD 1TZHA 1CQKA 4LDEB 1DQLL 2X4RA 4ODSH 1Y0LA 4GS7B 4KH2A 3JSSA 3C60A 5EIIG 5KANG 3S5YA 5GS0D 4PS4H 1OK0A 3BPLC 5LN8A 4QIRA 3IRPX 1Q0YH 3VGFA 5GGTL 2DL9A 2CD0A 5FV1L 3RZCA 5C0FA 2HKHL 3SY0B 3O8XC 4HF5L 3I9GH 3U2SA 3C9NA 1XCTB 4LSRL 3W0WB 1E28B 2HRPH 2EDHA 2A73B 2GFBA 4KNUA 4FXKA 5GGUA 2NTSP 2YA0A 5LNDA 2D7OA 2RQEA 3WJLC 3OAZH 4HAKA 4S1SL 1N64H 2YK1L 3LQZB 2YXWA 1TCRB 7PAZA 2FJGA 1JRHI 4JFFA 1CURA 2FT6A 1JXJA 5K39A 3FU7B 4L29A 1A0QH 3WNMA 1G9NL 2J8UE 2R0WH 2X2IA 5DDHA 5A6MA 1SJMA 5HJGA 4PUBL 3K3QA 4U1GB 5ICXB 4MQ7A 3TH4T 5CWSB 4E42B 5FOBB 4OCSH 1BD2E 4FQXA 1N59B 1TTRA 3O6LL 4M5ZL 4QRUA 5JHLA 1R5IA 4G11A 4JS7A 1I9RH 1MQ8A 1RFDL 3MLWH 3MROB 3V0JA 3P0VL 1P5VA 1BG9A 4R7LA 4YHLH 1Z6JT 3D0VA 4F8NA 1MCDA 4J4PC 3VDAA 1YNLL 5T1DL 4F7EB 4MAUL 5JHAA 3D09A 3QAZC 3ULVC 1YUHB 3ISYA 4NKOA 3P4NB 4HKJA 2B3IA 1XWVA 3C6LC 3HC0B 4U1LA 3BH8A 2B4CC 4L8BA 5TQ2H 4IGBC 3P2BA 5F9OH 5HVHB 1BJ8A 1Q0XH 1K2DA 3FUHA 3L3HB 3L9BA 4WUUA 3D9AL 1FH5H 1KLUB 1OLZA 2GEEA 1E27A 2CXKA 1I9IH 1LVEA 1G9ML 1NFDA 4RMUA 3KVPA 4U31A 1JXFA 1PY9A 1BAFH 1UASA 2GBAA 2VDKL 4A66A 5I2IB 3BGAA 4Z7UB 4Y9GA 3F2LA 3SYOA 2WXOA 1JHKH 4RRPA 3V7AG 2ADYA 2BC4B 1MUJA 2ARJB 2WGXA 4O51B 3N44F 5ISZA 4Q89A 3ZK0A 4L2YA 3LKNB 4E5XA 3MV9B 3NZ8B 1QI3A 4PV8B 5IJDC 4KK5C 1CFSA 3BIKB 5IB5B 3OHMB 2E7MA 4H8WC 3UAJA 4I4WA 3L6FB 1MAMH 2F53E 5DD6A 4FNUA 1HDMB 4L1HA 2XWBB 3H9HB 3PGCA 3GBEA 4KK8D 4NRXB 4Y1TA 4ZS7L 4MD4B 3PGDA 4IHOA 4U4BA 1EJ8A 2VDPL 3FSZA 1FBIH 1M71B 3QIWA 4QOKD 3RWFA 4KXAA 4S1QL 1NGYA 2XZCL 3VFVB 1G7MB 4P23D 4P4RA 1FYTD 1KZYA 4W4OA 3S36H 2DLFH 1BZEA 2NRDA 2VWEE 1TETL 1HFUA 4P0DA 4DO5A 4J1UA 4M4RB 1WLHA 4M7JL 4AGOA 2L7UA 5E4AA 5FC9A 3RX9A 5GJSH 1TQCC 3JXAA 1W91A 4WEBL 4MMZC 1DR9A 5I19L 1DP0A 2XZQL 3H54A 4TVPD 4JO5A 4G5ZH 1FZKB 2MIZA 5AYUH 5FAAA 3FOMA 1IFHH 2IC2A 3TVMC 4X6DB 3V4VB 4PMFA 4K71C 4PJGE 1CD1B 1JGEA 4HX1B 2AAVA 3QBTB 4DGUA 3DO4A 3L3OA 3ZKXC 4NZUH 2J56A 5CJOH 3BKJL 4HEMA 4Q14A 1S7QA 1E4KA 2CJ3A 3P3TA 4PV9A 3MLRL 4DOHB 2QADC 3GRWA 3D8MA 1IAMA 1TQSA 4A7TA 4NP4H 4KQ4L 3AJ7A 4UV7L 3LH2H 1AYOA 1B2YA 1AXIB 2KPWA 2DIBA 5AVVB 4FX5A 7FABH 2A83B 2DH3A 3MRFA 2H1XA 5KYUA 4HC1A 4YJZL 3C5ZA 1XGPA 1QUNA 2F61A 1NJ9B 3B9KB 5HI4D 3ZMNA 1ZT1B 2YS4A 4FN0A 4A38A 5AAWA 3AMLA 1U8KA 5HDBE 2Y69B 1UD8A 3S5LA 1E67A 3D51A 3OXSA 2GTWB 4FABL 3BHBA 4DQOH 5LCVL 4MS8C 5B22A 4UILL 2V3FA 3BEVB 4RZKA 1CN4A 3IBEA 4IMLB 5ITBL 5ESQB 3NFSH 5EPMB 4OCRL 3VQ2C 5KVEH 2FE0A 4XOAA 5AVSB 1VFBA 2NY6D 4W9LC 3CCHB 4N8CH 3PL6C 4NO3B 3RWHB 2J8UF 3ARFD 5IK3B 1ANUA 3CHPA 2EXWC 3SGDH 3GEWB 3ZL4L 2ZWKA 3B1TA 3ROOB 1HWWA 4AZUA 4I0KA 3LMJH 3HR5A 5BOJA 5J6GB 2XQBH 1PCSA 2BDNL 5F44A 1V7ML 3TASA 2YA2A 2AEOA 1CXKA 5DHYB 1PD0A 5F7WC 4FTVD 4YPGB 3BVDB 3CDGB 5FHAH 4GKNA 2AEQH 3DI2B 2NUTA 3VW3H 4AYID 5IQMA 3EYUL 2JFCA 3VXNB 1F90H 2OMXA 2J1KA 3MLYL 1HWHB 4J6RL 2R23B 4PRHD 3ROLB 1AZUA 2FBRA 3X1NA 4TXVB 3K4ZA 1I8MA 4WU5A 3K1DA 2WZ5A 3PIQB 2R29L 3UYPA 2YJLA 3H2QA 1X44A 3HG1A 1QZ1A 3LRGA 4X