2P52A

Mouse p53 dna-binding domain in zinc-free oxidized state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
b'SFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Crystal structure of the mouse p53 core domain in zinc-free state.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p52A00
2H1LM 3D06A 2P52A 5G4MA 4L0YA 1KZYA 2AC0A 3D09A 3D0AA 3WTYA 5AOKA 4G83A 5AOLA 1EANA 5AOJA 4A63A 3US0A 5LGYA 2X0WA 3D07A 5LAPA 3WTUA 1UOLA 2J1XA 4GUOA 2J1ZA 2X0UA 4HJEA 2BINA 5AOMA 3Q06A 2J20A 4LOFA 4IBUA 1HJBC 4KVPA 3WTSA 4L18A 4MZRA 5ECGA 4AGQA 1GZHA 3WTWA 4G82A 2X0VA 1CO1A 5A7BA 1YCSA 1HJCA 2J21A 3WTXA 2J1WA 3WU1A 4XR8C 3VD0A 1IO4C 2IOOA 1GZHC 1T4WA 2XWCA 4IJTA 2WGXA 4IBWA 1E50A 3EXJA 4QO1B 2BIPA 4AGMA 3D08A 3VD2A 5BUAA 2OCJA 4GUQA 4LO9A 2YBGA 3EXLA 2MEJB 4MZIA 3KMDA 3D05A 4IBSA 3WTVA 2BIMA 2PCXA 2FEJA 5KBDA 2BIOA 3US1A 4L0ZA 2J6WA 4IBTA 2ADYA 4LOEA 5AB9A 1EAOA 2AHIA 4AGNA 2RMNA 3ZMEA 1H9DA 1LJMA 4AGLA 3IGLA 1TUPA 4IBYA 5AOIA 3VD1A 1EAQA 3Q05A 3Q01A 4IBZA 3QYNA 2IOMA 5G4OA 2XWRA 1HU8A 2IOIA 2J1YA 4IBQA 5G4NA 3WTTA 2GEQA 5ABAA 4AGPA 3QYMA 4IBVA 1CMOA 2BIQA 3IGKA 2VUKA 1TSRA 3TS8A 4AGOA 2ATAA 3KZ8A
chains in the Genus database with same CATH superfamily
4NP4L 5C0CE 4JVWA 4XVJH 2C3WA 1O6SA 4OR1A 2GK2A 3QXTA 1X6NA 4HMEA 5DK3A 3H3KA 3AU1A 4HKBB 4LCVA 5E1AA 5JUEL 5EDSA 4F8QA 1QR1A 2XQBL 4RZCA 4E9WA 4FTVD 3D25A 2F74B 3DX1A 4H25A 1KPUA 2WYHA 1UM6H 3QUZD 4H8UA 4OFPA 1LE5B 4BFGA 4JO4H 5KSBF 2CUMA 2QADB 1VKXA 4QCIB 5D4HA 5E8DH 5C2BH 3PCYA 5E00B 1FL5A 5FF6B 3VM7A 5DJYB 1OP9A 4AIEA 5CCKH 4LCCC 4U1IB 1Z9LA 3RZCB 2NDGA 2E46A 1QW8A 4YUEL 5HYSB 1EJOL 4ZO6A 4XGZA 4YQXL 1ACZA 3WIIL 4K23L 3AS2A 1E43A 1EHNA 3K2MC 5KZCD 4LEOB 3WXWL 3BKCL 3QZNA 1Y18B 1PZDA 4RQQA 4AQ8C 5F0JB 4TVPL 2PP7A 4DZBB 3AY4C 3QFJB 3T8XB 4U6YA 2ZP9A 3MGTB 5B8CC 1F8TH 3DJTA 3BFWA 1ORSB 2HLFD 1CURA 3Q1EA 3MX0A 5HPOA 4A2HA 4JPIB 3UJTH 5EOTA 5I1HL 5DO8A 2IBBA 2NXYD 4ZJ9A 1HKFA 1CXFA 2BO0A 2FEJA 3C12A 5FFOA 3KWTA 3KPTA 3KPSA 2ZIDA 3CFKA 3OAUH 4AQEA 1TKWA 1GJUA 4BK8A 3LQZB 3VFVB 4CDGC 1UA3A 3L48A 2GK0B 4L29A 1DQKA 1MWAA 1UZ6F 5FM4A 5L2KB 1G0YR 3NJJA 5GS3A 3WS3B 1E9QA 1DQLH 4QMEA 2Y1ZA 3HRZA 2DWDB 2OMZB 4WWPA 4KROB 1G9MC 4XC3L 4UTAH 2GJ6E 2N7BA 5IJKC 4JDZB 2VH5H 4PLJD 4MKMA 1CICB 4P5TD 4AKPA 2QV4A 3BT0A 1YN6B 1JDDA 1RZKH 5ILTH 1RJYA 3Q5TA 4NRYA 1P7KA 2XQYA 2P8LA 2OSXA 4L1DA 2H3XC 2JSFA 3QUGA 1M6UA 3RPIB 5GRZA 1V5JA 1XO8A 32C2B 3B9DA 1P9MA 5JYLA 5FYLH 1AC6A 2XZQH 2VJ8A 3X12B 4A37A 3LZPA 2GCYA 4Z23A 5BQDA 3F58H 4KXZH 1KCVH 3FAWA 3HUJF 4PCYA 1J5HA 1CPUA 1AS8A 1NMBL 3DPBA 4LVHB 4U6HB 4F37F 4KNSA 1QAWA 3EFDL 1F41A 1L7IH 5HHVH 3ZSSA 4D0CB 1C16A 3BUBA 1WFMA 4JZOA 2WSPA 3PDDA 4K0OA 5I1KL 2XWZA 3MO1B 2A2QT 1UWGL 3QIUD 3K74B 4XCEB 4N5EC 4PUBH 5MI0B 2JI3A 2OXHB 1IEAA 1NOFA 2FJFB 3ZBMA 1OSPH 1BBDH 4OCWL 3MRNB 5JHLL 4XZ4A 2NZ9D 2QHRL 3ARGA 3VFPA 2DQJL 4XNUH 1ZHLB 4MAYA 4XPAL 1NDMB 3CH1B 4ONOA 3J8F7 4QRBA 5C07A 4W6XB 1WBYA 3H4HA 4PJ7E 4PJHA 4NOFA 4RGOH 2BRQA 4I77L 4XVOA 3WFCH 1C5DB 3K4DA 3FUFA 4BKTC 2EIKB 2ZXEB 1RFDH 4XOEA 3Q6GH 1N0LA 1HSBA 3IVKA 3FUDA 3KHQA 3OKOA 2ARJA 4XODA 5CBEB 1DZBA 3OLGA 2JIXB 4U4BA 4HXAL 5AZEH 1CFSB 1A3ZA 1FSKB 2L8AA 4U1HB 5BUGA 4CSPA 1H8OA 4FX5A 1Q94A 3KXFD 3O3EA 3H56A 2ZKHH 3EG9B 3H53A 4KGLA 1MSPA 1CXIA 5IF0B 4I48A 5FUZL 5HI3C 2PP9A 5D5ME 2P3YA 4JGJA 3H3PL 2WCPA 5C92A 1YMHB 2D2OA 3F7LA 4EI5C 3HUJE 3E8UL 2EECA 1JPSL 4Y5YA 2DEXX 4N8VG 2ZSVA 3WJLA 5I5MA 3WMPA 1S7QB 3TO4A 1DVFB 2FGZA 5I73B 1BBJA 4FL4B 4H5SA 4MB4A 4K94L 3V6OA 1S3KL 1TZOA 3BP6A 4JFQB 4LSPH 5ESVA 4HIPA 2PCPB 4CVXA 5TDOB 4ABWA 1LP9A 4PJ9D 1PX4A 3O6KH 5B1JA 2JQMA 3MNWB 2EIJB 1KBWA 5HGAA 2BOLA 2DIJA 2GSGB 3KVQA 4LPWA 5BW7C 4XNBA 4QRUA 5KVDL 3I9AA 1T1XA 2P24B 3FHAA 3F85A 2AQRA 2Y2YA 5KN5B 2IGFH 5JORB 5E4EC 5KYUA 5D1XA 1UCBL 1XGUA 3EHBB 1KJVA 2ADFH 2CKBA 3RGVB 2OXGB 2APTA 3L9RB 4OCMC 3ZU8A 5LN4A 2AEWA 3ZDXE 1DLHB 4XVTH 1QLEB 1AO7A 5IP4A 3ROOA 1ZT7B 3QR1A 4GYBA 3C08L 1P7BA 2WWMD 4A2LA 3LOWA 3MV8D 3QRGL 1TVHA 4JDEA 2C34A 4HOXA 3A4AA 4MWFA 4HFUL 2I9TB 4Z95L 1MHPL 3DGCR 5HBBA 1JZ6A 5C2UB 3ARFB 5LBSA 3FUKA 4OKDA 4HEPA 4JQXC 4HUVA 1I75A 3MYJB 3QZMA 4N0CC 4C83B 4ZYKB 1R3IH 2WQAA 1U8PA 2O6CA 5B1BB 2EEAA 2XVBA 3PWPD 3F83A 2D4FA 5T1LB 2A9BA 1HJBC 3TTYA 3DX0A 5DFTA 1ZEAL 5TGBA 1A4BA 1U8NA 5IWLC 4APQC 3HB3B 2CHXA 4MNQE 3JWDC 4H0LC 5AAPA 4LHUB 3MLWH 1GZQB 3EO1B 3MR9A 2OM5A 2OL3L 4PJBF 1RVFH 2D2CC 1XB6A 4Q97A 5DVMA 4IQHA 2HMIC 1CGSH 3EGXA 3HNTH 3MROA 4ANWA 4ZUTB 1O0VA 2FBOJ 3EYOA 4HS6A 5DJDB 5DJ0A 1QZ1A 3BX7C 2CWRA 3BPOC 4HZLA 1BFOB 4MHHG 4APXA 4DKFL 4YPGA 1KFGA 3RZWA 4AH2A 4J23A 4PIBA 1XF5A 2B1AL 3QE5A 4N9GB 3A3YB 3UTTE 1R5VB 2FWUA 2NY0B 4P2QA 3FO2B 1F4HA 3DX7B 3KJ6L 2WKOA 3RURA 4ODWA 4NYLB 4PGDB 1CS6A 4KDTA 4H2CA 4I0PA 1CFVH 3UZVB 3BVVA 4S1QL 3TYFA 3CLFL 5EUOA 4BWTA 3E80A 3REVA 1TYEB 1GY1A 3L3GA 3IMWA 1Y0LA 1OB0A 4WJ5A 4UV7L 1DO5A 5F89B 1DDHA 4ELMA 3QUHA 5KYYA 7PCYA 2O6DA 2E7LA 1A2YA 2RH0A 1U3JA 1Z3GH 2B14A 4R2GD 5ADPH 2IF7A 4HIIB 3WLWD 3MLTA 3WIFB 1PF3A 1TJXA 2FLMA 3M88A 2B1HL 2X41A 4K2UL 5AAMA 5CEXA 3AXLB 4OFYA 3P0VL 3MXWL 4LARL 5JLZB 4YDIH 5EPMA 3ZZ1A 4PJBE 3IGUA 4PJ5E 2EKSA 4GO9A 5T3ZH 4X9YA 4OIFA 1G84A 1ROCA 1SZNA 3TPKA 2F2HA 5LWYH 5KTEL 4OQTH 5I17B 4E36A 4UM8A 5DMJB 1SDDB 2D9CA 2OMXB 2W95A 3GMLB 3KS0J 4N1HB 5EU6A 5TTRA 1LXMA 3CFCH 5IMKB 1YY9C 2XX0A 1A3LL 5C0AE 3TBSB 3B3IA 3DV6B 1JDAA 5T1MB 1CIUA 1HL4A 5C3LD 1ICTA 1P4IH 1VLXA 4ZPVB 3QORA 3CK0L 2UXVA 3GSNH 5IEKA 1E30A 1U33A 3C60C 1M56B 3D51A 3NJFA 4FYSA 3A23A 5ID1A 3WTSA 2X6UA 1ED3A 5CILL 2Y5TB 1DVQA 4TQHA 3RWGB 4OV5A 4OIIL 2Q87A 2XWJB 3BVWA 4G82A 3IRZA 1MY7A 1NGQH 1FGVL 3D18A 1SEQH 3ESNA 3FPXA 4MAYD 3TZVB 4K7PX 1N6UA 1MFBH 2JTDA 4QJ3B 4GQRA 2EDDA 4FHKA 3FL7A 3RIFF 3V7AG 1XDTT 4GBXA 4X9BA 5FW8A 5C07D 1JNHB 1Z3RA 2L04A 3TT1H 4A66A 2X05A 3FB8B 1F4XH 2WINA 4UAOC 1PAZA 4PGBA 2A4ZA 3U6RB 4XMZA 1YPZF 1OCRB 3HC3H 4DESA 2A73B 2DWSA 2H3KA 3QEQA 2PP8A 1BFTA 3U30C 4WI9A 1NIAA 2DI7A 3MFGB 4IBSA 3S4SA 2AEPH 4OLWH 3HLAA 4GI9A 4DGVL 2YKLH 4X9FA 2PPCA 3SD5A 1ZS8A 2PWFA 4NKDA 4OZHF 1MUJA 3VWJC 3KPQB 1T3FB 3CMOL 2Y22A 2L7EA 1UVQA 2PCYA 3FNKA 5ETUA 1INEH 1CL7I 2JJUA 3K6FA 3NGBB 3Q3GA 3ZVVA 4J1UA 1N2RB 1O9VA 5DVOA 2WQVA 1D2OA 1NL0L 3QGVA 1TQBC 4ZW6A 4Z6AT 5BOZG 4G42A 3BSZH 3WKMH 3TA3C 1TO4A 4Z7NF 4PJXE 1AFVL 3QXAA 4L8SB 3TO4D 1F90H 3Q8BA 2AANA 4CBPA 4FHBD 3E2HC 4TYUA 2NNCA 5DRXB 4M3HA 4G7SB 5AZ2H 1JMZA 4G70B 4DKEH 3ZT7A 3FT2B 2VZTA 5FO7B 3PLYA 4UTBL 1BF5A 2NY6C 3EYUH 3PHOA 1SHWA 4KVNH 2MQ3A 4OLXL 2XCMC 3MA9H 3MRHA 4RRPA 5D7IA 3V5KB 3QHTC 4W9JC 1JAEA 1S78D 3HFMH 2BJMH 1N3NB 2AQSA 2A6KB 3JXAA 4CNIA 2WBXA 4JFTA 5IG7B 1MI5E 2A74B 1IT9H 5FOBB 2YD9A 1U92B 4YX2L 2HJKA 1YPZE 4CSZA 2XIIA 1Z9PA 1BX2A 2PTUA 2MPAL 2R2HB 1N59B 2VDPL 4M8VA 3AG1B 1OGAA 3R0MA 1F1DA 5DZAA 4J3TA 2ADIB 1AO7D 4NQUA 3X3FH 3WTUA 3IDXH 3FQTB 3UBXB 1JK9B 4OZHE 3WUZA 2IANA 4WWKC 5GRVK 1GW6A 3KH3A 4QKTA 5C0EB 1CIDA 2J1ZA 4A7UA 4Q7DA 1FNEB 4LKXB 1A4JB 3GK8H 1LEKA 1J8HA 1IFGA 2VR9A 3WLBA 3PAVA 4JN2B 2VM3A 1WCBA 1VEMA 1Y1DA 2BHFA 3VDAA 3BDBA 3DIFA 2Q8BH 1XD1A 5SWQB 3FRUB 5ECGA 2EE0A 3FB7A 5FB8A 4Z7NE 4NKIL 3P4NB 5K9JL 3PGDB 2WQWA 1NH6A 4WO4B 4TQIA 1GH7A 3LZRA 5CLZA 5DJ2A 3UYRL 1WZLA 1U8OB 2ZUXA 3UC0L 5GRUL 3AQYA 1T4WA 5SV3A 1IRAY 1S7WB 3FQ2A 3KL0A 4GQPH 2CQVA 2EUWA 4G80A 4P3CL 2WYIA 4WAFA 4A6YB 1FF5A 4F9LA 1F13A 5BZZA 4N2BA 4S1SL 1J18A 4YFDB 4QHLA 4ES8A 3L5IA 5KBPA 3QCTH 3QUXB 3Q2CA 2R4RH 4UQCA 4F7MA 2ADJB 4GW1A 3SKNB 1RUML 1D5ZA 4PJ6A 5J0BA 3C2AH 4DFHA 3IJ7A 1KUMA 3B8YA 4HEMA 2ZCKH 2BMKA 2OZ4A 5KSVB 3VU1A 4A39A 1Q0XL 4M00A 4CGTA 3BP4A 3WN6A 3TBYB 5H4ZA 4E5XB 2CNZA 4JFUA 3AXIA 1U8KB 1EERB 5E2TL 5C71A 4U6VL 4X7FC 3K71A 3EYFB 1KYUA 2ZYIA 1JPTH 1JFQL 1FNAA 4HMCA 2UY7B 4AT6A 5LCVA 1DQJA 2GC7C 4I0PD 2R29A 3TBWB 1CG9B 2FD6H 1DJIA 4GRLA 1UA6H 4OF0A 4PW3A 4JPQA 3SE6A 5EEUA 4NZJA 4Z3GA 2C9QA 2X44D 5DSCA 4BFEA 4LLVB 2PPEA 3K2UL 3RWDB 5I1AB 4Q9QH 3IDNA 4WWID 3FSVA 3LIZL 4LSRL 5GIRB 1Q8MA 3FT3B 1HHJA 4OFVA 2H6PA 1FL6A 4M9OA 1S7SB 5D7JC 1U4FA 4HIEB 4TL5A 4U7MA 3B6SA 2QTVA 3OGCA 2EIMB 3K8LA 3VFMA 4OFYD 3F7YB 4NN6C 1PZ2A 2YD5A 4N85A 3S3JA 3KBHE 1OAQH 4YDJB 5GGRB 1A7OL 3OF6A 3B2XA 3ZUCA 1WWCA 1EUTA 4F93B 3L1EA 5CGMA 1JI1A 5ELIA 4AENB 2XPYA 4X6DF 4HHAB 3ULUL 3C5JA 3BN3B 1ZIBA 1ZWIA 1RAMA 5FW6A 3E6FB 5HYFA 1G7LA 4W93A 3VVWA 4J39A 5BVPL 1MH5A 4H1LA 4QHUB 3VD4A 5EU6D 5EF2A 5HVHC 4HXBH 3V0HA 3PQYE 2Z9TA 4FZ8H 1UJ3C 3PNRB 5EOCL 3VAEA 4MAZA 3IJYB 2YQ3A 5FM5M 3DOIA 3ARDA 5KBLA 3VDBA 5IY5B 2DQEL 3MMEA 3QZPA 3UTQA 4IRZA 3QORD 1VACA 4KTYA 3WO4C 1CI5A 2FGWL 4HKXB 4K3EL 1JZJA 2EYTB 3SYCA 2X4TB 2WGXA 2BWIA 2Y36L 4KXZI 4TSBL 2P5WA 4AGMA 4P23C 3LCYA 1WTLA 1L5GB 3X14A 4J4PC 4WNSA 3ECBA 5IQOA 1BM3L 1UJ3B 4ZPTB 3EH3B 4HGWA 1N4XL 4I3RH 3TESA 4GBXD 4X7CC 1BA9A 2GABA 4UNTA 4YHPB 3SDXB 5K59F 1MFNA 4YJZL 3IKCA 3O6ML 4X4ME 1Y6NR 2VABA 5EEXA 2NYKA 3OAWA 1NUFA 2FO1A 1D5XA 2XTJD 3DHJA 3QEQD 5JXEA 3A6BL 2PPFA 3RVTC 4OD3H 1BEYL 4E0RB 2OS7A 3K6IA 4TMPA 2APVA 3D9AH 1FH5L 2HAZA 3ENEA 3HC4H 3IGLA 1JBJA 3NFNB 1KG0B 2QVIA 3B7TA 1A1OA 4YHYC 2FWOA 4WUUB 2ZXDA 2YGQA 1I9IH 1VZHA 1N8ZB 4MJHA 5DD3L 1CLYH 1FRGH 4EUPA 3EZJB 3EIFA 1G9EA 4PYGA 4AW4A 1RURL 1UG9A 1A22B 3KPRB 1ZHBA 2JF1A 2ZXGA 4L9DA 4AC4A 1T1WB 4ZO8A 1C08A 4C57C 2OULB 2E4FA 4PRDA 3BN9C 1IC5L 3MRIB 4PRPE 4HUWA 3RVUD 4R7DA 2MH4A 4I7ZC 2CDEA 2F7IA 1TJGL 5EFIA 3LX9A 4LSTH 4J3VA 5ALBL 3RY6C 4GIPD 4Y9BA 3ZDZF 3V4PB 4FD0A 4G6ML 1QKZL 1OPGL 4ETQB 3G6AB 2V17H 4XHJD 3BRGC 5A43C 3SJVB 2OCFD 2EZ0C 3KL3A 3O6LL 1NAKH 4JFDE 1GPOL 2PW2A 5C08B 4URKA 4J3XA 4MXWH 4LSVH 2R0WL 3JWOL 3FT1A 4ORZC 3UG3A 3V4UL 2ED7A 1ONQB 5BS0D 5LGJA 1RZFL 1HHKB 3CLEH 2MCAA 3ZDYF 5J12C 5LQBH 2RA1A 3ZGHA 3AVEA 4WSJA 1OGAD 4TSCL 3UTPD 1PTZA 5EN2B 2QZ5A 4HVBA 4XP9L 2Q1EA 3MLXH 1E5ZA 3QDGB 3O3DA 1MJ8H 1G7HB 5F6IC 1RJZA 4FXGB 4N2OA 4RWYL 1YCSA 3P0YH 4XPGL 1JGUH 1NAMA 1J8HD 2GB2A 4N2NA 4U1MA 4CMMB 2LU7A 3MGAA 1RUKL 2WKGA 4G9DA 3VFNA 3U2SA 2B4CL 2L4OA 1E50A 4IGBB 1LDPH 2BZDA 3JT2A 2NQDA 4PJDF 4QRPA 3ESOA 4OM0L 4LLUA 4ODSH 2YD3A 3BJ91 4U33A 2FZ3A 1A14L 1E2ZA 1P69B 2AVFA 3F04A 3NJMA 4ZS6C 1KC5H 4MD0B 2X4OA 5IB1B 5D2LE 4CU6A 3OKYA 1CFNB 4HDIA 3TU6A 3ZDZE 4OI8A 2W0PA 3SO3B 2ZKYA 2Z6FA 1AHWB 4PCKA 1I9EA 3HI1B 1QASA 4WTXA 4G6FB 4G3YH 2BZCA 5CP7A 3UEZA 4YDLB 4ZBJA 2AGJH 3UPCA 4XTRD 4PLKC 1QR4A 1PS3A 1S5HB 1CTNA 4IRSB 4UCFA 5A2LH 3OGOE 4TNVF 3SN6N 4PGJA 1A7PH 3GIZL 3AWFA 3C6SA 3MV9E 2Z92B 3KJ4B 5FO8B 5EB9A 3QG6A 1GYWA 2MFNA 2FQFA 3NIFB 2FATL 1HK6A 1N5YH 1SF3A 1FZJB 4PWIA 5C9JB 3GXPA 1KBBA 2DIAA 3L7FA 4TS6A 3GJFH 5DGQA 1EEYA 4NFBA 2BVPB 1GC1C 1VFBB 4XP4H 4NZTL 2R51A 3AREB 3NT0A 3BPLB 3UX9B 3F5WB 3VQLA 1G1KA 2VXUH 3FHEA 4GRLD 4LEEA 4M6OL 5DEFA 4L1TA 3ARBB 5LXVA 5CIPB 1KZYA 35C8H 3EGDB 4FFZL 4GUPB 4BQBA 4A7GF 4DK5A 4ZMTA 4RAVB 2Z0BA 3G5XA 4X5XA 3ULSA 4LLWB 5HVWA 3QO1A 3MUHL 3I9GH 3V5HA 4FQHB 1XH3B 5A2BA 4Y4FB 1WAAA 5K33A 4L5FH 3ABGA 3CFTA 1W16A 5FUCC 2Q8AH 2VLJA 3VTTA 1M6OB 2DQIL 3WDJA 2NY3C 3FSOA 2UZXB 4JANB 1PSKH 4M7LT 1HESA 5GS0D 1FHNA 2CGYA 3E9TA 3OF6D 1WGOA 1LM8V 1DANU 1AHMA 3B34A 3GGWB 4Q6KA 4X9IA 3V4VA 5F7UA 3FSZA 2NY4B 1NGWA 1RZ8A 2IWKA 4MCYA 4TPRL 1FLTX 5DVKA 4AKQA 5ICYB 5IZ7A 4S0HA 1AGCB 5B4MC 4PJFF 4B41A 1UM5L 1YG9A 3ASOB 3P30H 2CAKA 1ASPA 2AK4A 4Q0XH 2YEZB 2QVKA 1AMYA 2WANA 1EAPB 4JPSA 3ETBJ 2XTLA 5TQ0H 3NJNA 3MUY1 3N1MC 1UA7A 4ODUA 4HWZA 4PG9A 2IXQB 3VXNA 4D7PA 3ARDD 1ZLSL 1CGWA 4Z7OB 2WLYA 1BQRA 5AW7B 3T2PA 2Q0ZX 4X8CA 1R3KA 5J1SC 3U0WL 3TH3T 1ACYL 3DETC 3OKDB 1P2CB 4FQXA 2BERA 2XRAL 3MLYL 5TFSL 1QLEL 1VEOA 1TZGH 2CPUA 3VJ6B 3W2DH 4OCSL 2JLPA 4JM0A 4JZJC 4LSSH 4XPBL 1KY6A 1CUOA 1SLWA 5MP6H 2EXWD 2Y69B 4WU5B 4OF6A 2ICCA 4KKCC 3HAEG 3SKUD 1ZGLA 1E4WH 3BMVA 3OL2A 4KY1H 1X5FA 2I9LA 3MRDB 3ZTDC 2ZAIA 2PCFA 3VXSA 2HRPL 5CKGA 1BZ9B 3F3HA 4DVRL 3QJRB 3LDBB 4JJ5A 5D6DC 1NCDH 2YAFA 3TYGL 4ETYA 4K3JH 5HHME 1ZHNB 2AJ3B 2V7HB 4G2AA 5E0QA 1DJYA 1IFRA 5TDNA 3SDCB 1O5DT 3IMRA 2DLFH 3KLKA 3UIZA 4ZX6A 4XNMB 2GBAA 4YOKA 2UX7A 3ISRA 4UYQA 3WELA 5GS2D 4RIRA 4BCXA 4BFIB 3FCTB 3NIDE 4KQ3H 2BOBB 3U36A 4X8JB 5EEZA 2X10A 1T7XA 4OKVA 2GT9B 1E6OH 4GO6B 3P4LA 1RULL 2XVKA 4JM2C 2E3VA 4PJIA 3SY0B 4LDLB 4PJEF 5ITBL 3N2JA 3QNFA 1FWXA 2X4RA 4G8EA 5GSRB 3OLEA 2HT4D 2BSTA 2OTWA 3PXJA 1NGPL 3HCVA 3UTOA 3G6JE 4MXQD 1RUPH 3QIWA 4H8QA 1YNTA 4G9FE 5T1DL 1KTRL 5TQ2H 1PY0A 2JV6A 4QHKJ 4Y9EA 3RUGF 1RPUA 3VXTB 3QNYA 4PRBA 3L3JA 4TSAL 1J0JA 2CMRH 3IDMA 3FFDA 4X0NA 1W72A 3QNXB 4XP6L 4PWFA 1R9FA 4JAMA 5JO5B 3J7HA 3SDDA 3TBVA 2XN9B 4ZMYA 2IH3A 4RSVA 1B6UA 2YPVL 4AJ0A 2WPGA 1IM3D 3LKPB 1JTOA 4XH2A 3C8KB 3N40F 3L4CA 3BKYL 3CUPB 3G6DH 1PKQB 2CHZA 4Q6IA 1LILA 4JRYA 3RVXD 2GTQA 5L2JA 2BCKA 1HHIB 5HVGB 4PH8A 2B5IB 3T2NH 3W57A 4XVUC 2WVSA 3UG5A 4FLQA 3BVNB 3BMWA 3PXHA 3NEEA 3BH9B 2V9TA 3EDKA 5F1OB 5FCUH 3DO7B 3N04A 4LNRA 2MTAA 2WWKT 3LKOA 3LXAA 4UDTB 5E9DE 2VLRA 4UZUA 3G08A 3PP4H 5CR8A 3RLSA 4DWHA 2YK1H 3VE0B 1P7HL 5JOFA 4PJEE 2VNCA 4MSWB 5FKPA 3DX9A 1EEUA 2ZAHA 3CZUB 1C9SA 3KMDA 2ZT9C 5CBAA 2G3ZA 1EXHA 1R46A 1GYCA 3K2KA 4YZFE 4GOSA 4NWUH 4ELDA 1M7DB 2W92A 4KK9C 3NVQA 4E41D 4W9IC 3VTMA 3H1ZA 2AXFB 4KKLC 4KHXL 2VZ1A 3FB5A 5D7LB 4Q9CA 1J1PL 4GQQA 3P3RA 4U6XB 2ZOKB 4F2ME 4JB9H 4XP1H 3RWCA 3LHPL 3Q1SH 3QR2A 3CDFA 1DSFH 3J2PA 4FNLH 4XZUB 1KIPA 1WITA 2ZUVA 2ED6A 3P4MA 4FXLA 1N9PA 2NXZC 5DJCA 3BAJA 2YPKA 4L2LA 5DYOA 1IKFH 4OZGB 1LK3L 4HGMA 4ZUUB 2J88H 4M3KB 1F4WH 1EO5A 2UYLA 1J05B 2NY2B 4JO3H 3KLHC 2HFGL 3GLDA 3SDAB 3I6GB 2V2XB 5E2WH 4WU7B 3UH8A 3VFUA 3NJXA 1MLCA 3RVWD 4ALAL 5IB4B 2D3VA 3SGDH 1I3UA 4NB7A 2F53D 5DA0B 4M1CD 2ZOUA 2YWZA 1EXUB 4FEMA 1D5MA 1FZMB 4DK6A 1J0HA 1ZGLM 3GMMA 4HPYH 4XPTL 3CFIC 2AJSH 4PJGB 3O2DA 1IQWH 2DWTA 2Z3FA 3MLZL 4QY8A 3GTVA 3O3AB 3SBRA 1FIGH 1MQKH 1PD6A 1YEEH 5BPPA 2V2TB 1FLRH 3DO3A 3FQXA 4YZWA 1UD8A 1LDSA 1QFWM 1FBIL 5C0IB 3WEOA 1NCCH 1QSFB 3JTSB 1X5ZA 1MCEA 4LQFH 1MCRA 3KLAB 3SBPA 4FMVA 4MQXD 3GM0A 2E9BA 3SE4A 1QPXA 1T2QH 3QCVH 1KCRH 2Y1YA 4NQSB 2AK1H 1XGPB 1YEKL 2VCOA 1KN4H 4L8BA 4EDXB 3KGSA 4JY4A 2WO2B 4BKSC 4F33B 3SZ6A 1J0ZA 2KYIA 5E6SB 3N3EA 4DOHE 3NZ8A 5KVEL 3VSQA 3I3EA 1FFOB 1KDJA 5AW5B 3P3SA 2QPEB 3VXQB 5K39A 2VDMH 1ND0A 1WA1X 3PNWB 2VLJD 4IKIA 1QBLL 3PP3K 3Q48A 1HJCA 2EDOA 3C6LC 3R06B 3GRGA 3T6WA 4L1BA 2YMXH 5FGBA 1QBAA 5LBSH 2WWNA 2DBLH 1GGCL 2K9FB 2RALA 1YNLH 5KSAD 4L4TE 3VGFA 2WQRA 4BFBD 1LE9B 3F12B 2AK4D 2ICWJ 2BX5A 3HZKA 5KSBB 4B9FA 5G55A 5C7XL 3TX4A 3T3PE 5DEGB 5JTWA 1K8DA 3MRLA 3NBNA 1FFQA 3SQOH 3PS6A 4H8VA 3FN0H 1HDMA 5EIQA 1NFDF 1PZAA 5KSUB 4HBCL 2CK0L 5IQNA 1JK8B 2NOYA 5KVFE 5FYJD 2JKXA 2YGOA 3HG1A 5CWSB 4LL1A 3Q2VA 1XGRA 3KDMB 4R9HA 4GY4A 4KHTL 3O6FD 2E75C 3CHQA 1WHPA 2H26B 1UXWA 3A6OA 4F7EB 5KG9A 2WXLA 2H3NB 1E9OA 3QWQB 2XWRA 3FOLB 1ZTXE 3RWJA 3MPCA 1EQWA 1JGEB 3G04A 4AKOA 2DQGH 1FAIH 2Q7YA 3RA7L 4K7FA 5JQ6H 4DEPB 1KTDA 4Z3EA 4JEGB 5LB1A 1T5WA 2BNRE 1S2EA 2CU9A 1OVZA 4UAHA 5E4AA 4UNVA 4MNGA 4J12A 2YJQA 3L4ZA 4N5UA 3QQ9C 2ICWA 3WN5B 4DP9X 4RBPH 5GGTL 2ICEC 3MJ7A 1KIQB 4KU1A 1QSEB 2HT3C 4OLZH 4YHMH 1L6XA 4A6YL 1UWEL 3H7LA 1UWFA 4JPVL 3BGMA 2XZAL 4X6CE 5AZUA 1B2YA 3GXIA 2YOAA 1A9EA 1KGUA 3F7QA 2JQZA 1ADQL 2BC4A 5HHOB 5CGTA 2OMBA 4Z1PA 1IC7H 4MD4B 1DFBL 4FG6D 1MCWW 4F5CE 2QL1A 3TIEB 4DQOL 1BVNT 3EH5B 3MLSH 4ZS7L 3CDCA 3CZKA 4I18A 5IHHA 4IM8A 3U25A 3IETB 4NQEE 1MIMH 1MNNA 2F5BL 4YGVB 2XG4A 3RX5A 3IMBA 2A0LD 4KFZC 5I66A 5D5MB 4XOAA 3Q5YA 1TFHA 1A1NB 1RH8A 4TUJA 2OI9C 4YIQB 2IQ9H 3SDDD 3HUJB 4EN3A 1R3JB 3FQNA 4OT1H 3RHWK 4GMTH 1SVZA 4PGEB 5E2UH 4OVUA 3UZEA 1KSRA 2FJSA 4TUKH 3H9SA 3B9KB 2WLJA 1TYJA 1D7BA 1XF3A 1UD3A 4JDTL 2CIIB 4XC1L 4JRYD 1G7JB 4P07A 5I0DA 3KWXA 2LTQB 4XVSH 5CMAA 2AEOA 1BPVA 1HOCA 4BXSV 2NW3B 2X4SB 2IAMC 2OK0H 5I16B 4JR9H 4ZUSB 2FDBP 1IVTA 4QXWA 1UCTA 2F18A 4YNYA 5B7EA 4CW1A 2CGZA 4DAGL 5I1IH 4OTXH 1EMTL 3D3VA 1HYSD 2XFXB 4XWGL 4GS7B 1I7RA 5C0GB 4JGMA 5FKAB 3VRJA 4B9KC 1REIA 4L4VA 2W07B 3CFBB 3F64A 4NM4H 2XZCL 5MENE 1AR1D 3IBOA 1ECYA 3NIGE 3T0EE 3RNKA 1JSYA 1C7TA 2AEIT 2O5NA 3C5ZB 2KH2B 4I9WD 3CSYB 4N0UE 5E8OB 3LS5H 1U3NA 3SPHA 1HQRB 4B0MB 4I2XA 2XWDA 3K6NA 3SCMB 5CGYD 2GBUA 1MN4A 3FU6A 3KS0H 4LVNC 2HX7A 4LF3A 2XQYG 3O2VH 4WI2A 4QXTB 3SDYL 1UB5B 3A67H 5D4IA 4Y16D 3P3YA 1FVCA 3MV7D 4U1SA 1P6FA 1W6WA 2ESVE 1S9VA 4LPTA 4OGYH 2XPZA 4DTGH 4ZMQA 1DFXA 1MFEH 1ZLDA 3I75A 2GEQA 4OBSA 1KZQA 4QOKB 4WDIB 4J3OD 1HKLL 2YAPA 4ODTH 4OU3A 5SV4A 5CLWA 1T1YA 4LSQH 1B0WA 2E7MA 4QR7A 1V3LA 2WP3O 4D0DA 2B15A 5JHDA 4XAWH 3DYPA 4PREB 5JHLA 3TS8A 2VAAA 2EDXA 2W9EH 4FTVE 5CN2A 2Y6SD 2H32H 3WL9A 3WY2A 5F7MC 3TCTA 3BYYA 2YA2A 2ZUQB 2WWKO 2DQDL 3O9WC 3WFBH 5LG6A 3QT2A 1P1ZA 5ANME 5CEZD 4QNPE 3FT9A 4MNQB 4CADB 3T2LA 4PB9L 1NCAL 1HCZA 2FHCA 2GFBA 5CO1A 1Y07A 4R4BA 2VLMD 4XBMA 4WKXA 4FQ1L 1YY8B 1YJDL 1KCLA 4FFVD 3MRKB 3RTQA 3NPZB 3GKWH 7TAAA 1SMOA 2LFGA 1YUHB 4H8WH 4DGWC 2OZNA 3IE4A 2FYVA 2NYZA 2WMPA 3HE6B 4IS6B 1CLCA 2XOTA 4Y5XA 3RDTB 3DSNB 5FC9A 4YLBA 2IMNA 3VWKA 15C8L 3WNMA 4CJ1A 3BOVA 3BKJL 4EEEA 1IBGH 4YEEA 1I7UA 2X1PA 1SXNA 2P5EA 4GXVL 2WQUA 3L3IA 3LVTA 3F6JA 3D39B 4MNHB 1XH1A 1THAA 3O8XB 4FQJH 3C5SA 3FKUS 4YXKH 3QJSB 5EZJA 4AQ1A 2FH6A 4NZDA 3DKHA 1RHHB 2CHDA 4U3HA 4NCC1 4PM1A 5DTFA 1QFPA 1KJ2H 1PKOA 2H5UA 1TTUA 4RFEB 2JTYA 4FP8L 3F84A 1VB9A 2KI6A 3IS0X 5C0BB 4B5EA 1NINA 1PX8A 2C3XA 1KGJA 1U8QA 2PR4L 3JZ7A 3V4PL 3RI5K 2W38A 3US1A 5LVEA 2Y07H 4W9LC 3CZLA 3ASNB 1NC2A 2WAQA 3IFOA 1B4RA 3CPLA 3QQ3B 4RDQG 2C8NA 1MVFA 1E5YA 2A9DA 1M9WA 3H9YA 2DDQL 4PJBB 43C9B 1AIFB 1W0VB 5D96B 4F3FA 4PJ5B 1EAQA 3CFJA 3TN0A 1URLA 2Y06H 2VERN 3WI9A 4DEUA 4K5OA 4UV4H 2V4LA 3P54A 5F7DB 1KB3A 3R8QA 2DS4A 4WW2C 3ZLQC 3HG1D 5M95B 5GPRA 2BDNH 3HEIB 1JJUA 1IGJA 2FYYB 2WNKA 1E27B 1VA9A 5CLXA 5IUSA 1ZANL 5I76A 5JW4Q 1YDPA 1AGBB 3RU8H 1OCWH 3UDWA 5TK2A 1MJ7H 5FDWA 3P3UA 1KCUH 1OPOA 5J9PA 3PWNB 1JXGA 3NJGA 4MDJA 1TETL 2BY1A 2ZJSL 4NLHA 4MDRA 2R1XB 5DJ6B 3WIAA 1U30A 1D5RA 4NRXA 4OGZA 5LCVH 4JLRB 4MJ5B 1ZK9A 5GRYA 5F3HA 1PEZA 4ABQA 4GIAA 2AAAA 1DQML 3D85B 3OKEB 3REWA 1SJEA 3CFEB 2SEBA 4D0BA 4LCUA 5LAPA 1QBMH 3CWGA 5SWSA 1MW0A 1OB1A 1THCA 2FWLB 5KAQG 3GXTA 4UU9B 4EO5A 4RAUB 2F9BT 3FPYA 5J13C 1HAWA 2QGBA 2DM3A 4BM7A 3E6HB 2GBVA 2DJ4A 3S98A 5I5RA 1ZS2A 2JK5A 4PTUA 4GKZB 1JWSB 2E4TA 3ARGC 2WZAA 4MAYC 2ZICA 3PAZA 3KXFE 3QG7H 3NCFB 4JO1L 3V52H 4AVKA 5GS0H 1G7QB 2MNUA 2J1KA 4GI8A 3E1F1 1I1AB 4AX3A 4GAYA 5TE4L 3GO1H 1TZHB 1OY3B 3CMGA 2EO1A 4FDWA 5KYWB 2BXYA 1VFAB 4JFWA 3OMZA 4KO9A 2VERA 3VXMA 3VGEA 2YUWA 2VW4A 4JZNB 1INDH 2IIJA 4YDVB 4OCLC 3O2WH 4YHOH 4D8OA 4H1LH 3FK3A 4LDEB 3ULAB 1WBXB 1O5PA 1QEWA 1ZSDB 1NJ9B 1RP8A 1TMQA 1OAJA 4HIXL 3CHRA 1WD8A 4PJXB 2O5ZL 1JE6A 2JKIS 3MRMA 2P80D 4G5ZH 4W9HC 5G5DB 5KOVC 1MFVA 4JFZH 4IRZH 4AXWB 2XIDA 4BSVB 5I9QC 1H0DB 4Y5VC 5I28A 3QDJA 3S37L 1BAGA 3WJLC 5JPMA 2F54A 4HG4J 1EHLH 2GUOA 3ZKNC 3IMVA 2X2JA 3FONB 5D71L 4OD2A 5DHVH 3PV7A 2QQNL 5KVGH 5LXGL 1DQQB 3D3VD 4XXDA 1MRFH 3ULVF 2PN5A 4DKDC 3BHBB 1NEZA 4MA8L 1FI8C 2YSSB 4L4VD 1ACXA 4AIZA 1JWMB 3DTXB 1T4KA 1YPZB 1FFTB 1H5BA 2F7RA 3MV8E 3JWNC 4TQ8A 4Y5VB 1JUFB 2BM3A 3CBJB 4J8QA 1ZE3H 3UPRA 1G6RH 1UT2A 3H6JA 5ABZA 3HR6A 1NLDL 3MRQB 2O6FA 2ZUSA 1TVDA 5D1XC 3U9UB 2NR6A 2X4PA 5GS2H 2APWA 2KBGA 5GZOD 2FSEB 4OZHB 2WBWB 4NO3A 2JI2A 5EDXA 3QJQB 2APXA 5L9DH 2P52A 2W80C 1SEBB 4ZTEA 3OKLB 5LGHL 4G7YL 5H94B 4KMLB 2DI9A 5B22A 1X3DA 1MHEA 1HIML 4PGCB 2XWTA 1T0PB 3GMPB 4R4NC 5JHDD 2FIRT 5KANG 2F8XC 1WJ3A 4Z7NB 4RH4A 1N10A 3AS3A 5A40E 3KYMA 4L48A 5I0ZA 5IIEA 2GSMB 3HI6L 1BJMA 3PFUA 5AG9A 3A4DA 3Q2LA 4PRIA 2NW2A 5J4MA 1A1MA 5B7MA 4G5AA 2QKSA 1VGKA 2G5BB 2FT6A 4V1DA 3D0LA 4WTZA 4PRHD 1XZWA 4PRNB 3SGDI 3BWAA 4ZXBB 4QDGA 4XWOD 1JHKH 1ZLUK 4AUYA 4XCFH 1MCJA 1YEDA 5CD5D 3CCHB 4MMXC 4U1LB 3WY3A 3PL6D 1XF2B 2QQKL 1CK0L 2HG5A 1ZT4B 3E1ZA 2MOVA 1L0QA 3RTQD 4AI7A 1DSWA 4XO8A 5MEOB 3CU7A 5ID0B 4WI7A 4UOZA 4QHNB 3VD2A 3T6QC 4L0PB 3DMMB 4X4YA 3QJOA 2DICA 1HXKA 1I9JH 3GHEH 4LO9A 3VWKD 4CU7A 4K5LA 5D7KD 5GISH 3TEZA 1CZ8L 2D7NA 2FRGP 2QZQA 3LEYL 1W8OA 5ESQB 1SXAA 3I6SA 5B3JF 5I30H 2IGTA 2NNAA 1F3DH 3EUUA 1A6ZA 1MDTA 5C0FB 5IHLB 3BSGA 3FFCD 3ML9A 1NAMH 2C9RA 4WTWA 4P2OB 1MCCA 4XN5A 2BVTA 3KPSE 3RILA 4UTBA 1U21A 3VI3A 4PG2A 4KDTC 1Y6MR 2ORBL 1U8MA 4RA0C 1L9SA 1E40A 1XR8A 1SHSA 1H3VA 1KGWA 4XRCB 1KTLA 3QRBA 3VGHA 4Y4KD 3ZTEA 1WBZA 1WLHA 3ARXA 4XX1E 2CBTA 1NC2D 3O3UN 2E7LC 1MCOL 4NN7C 5D4QA 1AYOA 1ZA3A 2HJLA 1ES0B 3OKNB 4S2SA 3SQRA 4G59C 4XMXA 1MIEL 4DP0X 4OGQC 2R0ZH 1EFXB 3MRCA 4P4KB 2O72A 4HWEL 4JX0A 2X70A 4Z0BL 3LEXB 3O11A 3KYAA 7FABH 4U1KB 2EDMA 5DLLA 3TNMB 4BKLB 4KPHH 1HXYB 5DFAA 4FXKB 1JZ3A 3L13A 3WNPA 1U3HA 3HMWH 1ZY9A 4JFFD 2D9QB 3NZHH 2A6DB 4P46A 2X9ZA 3OD3A 4M4RB 4Z77B 3PQYB 1FNHA 3MOAL 4YHNB 1UFGA 4AL8C 2OMWA 4HJIA 4FXTA 1V3KA 2OBGA 2VDKH 2VXQH 3KPNB 4NIYE 4P8QA 4X4ZA 4YWGL 3ZRCC 3MJ9H 4TOYL 2O93L 4IBUA 4RDQF 1IGML 1QWNA 1XTLA 4K9JA 1RSYA 1XR9B 4NC2B 3MVSA 4RNRA 1U4EA 4NKOA 5T33L 1I1YA 3FQUB 5C07E 5SWSD 4EQ3A 1CGXA 2AJVL 2Z31B 3L5WB 4JG9A 1BVLB 4PJHE 3TO2A 4G8GA 2EQDA 5JNYA 2YR3A 3H7BB 1HH6B 2XFGB 2F1AA 2WNGA 1W0YT 2X1OA 1BQHA 1OAZL 3HMXH 5SWZD 1FJ1A 3OKMB 4N0FB 2WB7A 3WEXB 4W6YB 2ADGB 4EOWH 2HTLD 1IILE 2MCMA 4Y4HB 4GKSA 4N0YL 2GY5A 4GBXC 4KBPA 1KBKA 4X6DB 3EXLA 1S9WA 4QT5B 1OXYA 2Z7ZA 5CJBA 1OE1A 4Y19A 5ITFB 3FOMA 3RL1A 1DN2A 2ZPKH 2X87A 5EU3B 5TF1H 3V4VH 3UJJH 5TH2A 4KZ0A 2FR4A 3WS6A 4JO2L 4G43A 5F3BB 4V2BA 3VXMD 3IJSB 1PCXA 1E6JH 5E2VH 1IGYA 3I2CL 1AZRA 1D5IH 1NSNL 3ARSA 4EZKA 5KAQF 1T89A 5IFJB 4X5WB 3V6OE 4LCWA 1QYGL 4BZ1L 3A22A 1QATA 2V7NA 2V5TA 5J1AB 1I3GL 3LIZA 4LPVA 1LP9E 4MMYA 2VN3A 1KEMH 4XXCA 4FERA 1BMGA 2EH8H 3MLVH 1A25A 3VA6A 2J4WL 2BS71 4BWUA 4QRQA 4Y2OB 3QDJD 3MJ8A 2I07A 5FYJH 1QG3A 5KANI 3JWNE 4MS8D 4ODHL 4QD2E 2FB4H 5AKRA 3JVFC 3BGFC 1OSYA 4UBDD 1MNUH 5JPNC 5ABAA 5D1XE 1YRKA 4Y7MA 1DO6A 4QRSA 4F57H 2KPWA 1AY1H 3L3HB 1N64H 3QUYD 4H88H 3TVMB 3MRJB 1MRCL 4TNWF 5LBVA 5G4MA 1SJHB 4N2LA 4YSAA 1OAKH 1D9KA 1AO7E 1PFCA 1O6VA 4DQAA 1U8JB 1QFWH 2F5AL 5K9OA 3EKCA 3X3GL 2WKOF 4E9SA 1QFHA 3GHBL 3IU4L 3QJTB 3RWEB 2YLHA 3W9DA 5IMLA 3NOIA 1JP5A 5DC2A 4TVUA 4M02A 1OAXH 3GSOA 3GSVA 3N9GL 1UB6B 3F00A 1FFNA 1FG2B 1NGXA 2VR8A 4P05A 3TH2T 1AGDA 3SY6A 5HYSG 4UT6L 3ARUA 1YQVL 3GDCA 2FEEI 3KR3H 2XT1B 2EINB 3KBFA 3QI9A 4NFCA 1QNZL 3WD5H 3ZKXB 3BQUB 3B2VL 4HS3A 5FM5O 5I1GH 1C12B 1G87A 5GQBA 5I8KL 3UACA 1CO1A 5AW0B 3PIQB 2R1YB 4IHOA 1C5CH 3BEWB 4PRID 1T6WA 5IGXL 1JF6A 3UOAB 5JIDA 4GKNA 4WEUD 2CR6A 3WY1A 2P1YA 3ZDZB 3S3PA 2OTUB 2EDHA 1GS6X 5GGQL 4HKBA 4HIJA 3IXAA 3RIAK 3CSFA 4MASA 4TV3A 2K0RA 3QJFA 2W0FA 3RNQB 2GPZA 3W37A 2JELH 4AYMC 1M7XA 1OQOA 2K1MA 3LNFA 4ZUVA 3MOBH 3QWRA 3UAJC 5IFHH 4ZUWA 2NY5C 1UFUA 3IPBA 2YOCA 4KUCD 3RAJL 5I1DB 2WLKA 4HWUA 4BK5A 5IVXA 3ZDYB 1NCIA 4P2QE 1A6WL 2YFOA 5I8EB 5DJYA 1KYFA 1HAUA 1Z5YD 3DHMA 4U1IA 3OPZL 4BH8A 3CX2A 3RZCA 4IBTA 4PWJA 3VXPB 4V33A 5EUOE 2CJTA 1AKPA 5DYFA 4MB1A 1SXCA 1LJMA 1X5HA 4HH9B 2CRIA 2X1WL 4GG6F 5CCJA 4PTTB 2JE8A 3S5LB 4ZW7A 2CGRL 2P42B 1RUAL 4PVMA 1KPRB 4LEOA 1Y18A 3C2SA 4DO4A 4ELME 3MSPA 4Z3FA 4RGNC 1AACA 4RDBA 3T1FB 4DZBA 3QFJA 1UOVA 2NYYD 4HLZH 1FC2D 4PJDB 3F6LA 2HFFA 3T8XA 3MGTA 3C09C 3B4NA 3PHSA 1EEZB 4MJIB 4RMSA 3RJQB 1CU4L 4AIXA 2VN6A 4IBVA 3HPJA 1P4LA 2J8UA 3OG6B 3QULB 2WIIB 1FAKT 3IJEB 2APFA 3DK0A 1CE1H 3TT3L 2H1LM 2YD4A 3THMH 3G5ZB 4J3OH 3RFRA 1AGFB 2CO7B 4B27A 4GRWH 4HHGA 3M8OH 1EH9A 4LL4A 5CJQH 4XCYB 3RTLA 3VFVA 1KV7A 5FECA 2GK0A 2BSRB 5CJOH 2CLZB 3IBEA 3JTTB 4LGRB 1TQTA 5L2KA 1F6AA 3OAZH 3WS3A 3PY9A 4KAQH 2DWDA 2MSPA 2OMZA 5EU6E 1NANH 3DIVA 5LDUA 3BUQA 1U3HD 4HS8L 3GBDA 3HKZA 4U1GB 5F21B 5F1SA 1BOGB 3ZO9A 3BZEB 3X11B 4UMSA 5F71A 5HI5C 1YN6A 4P46D 1L9TA 3IDYC 1DCEA 1FNSL 1YEFH 5CEZH 4UIMB 4N87A 4P59H 1A4KB 3O2DH 4PGZA 3OZ9H 5EU4A 5AOZA 4HLEA 3Q8EA 5DUBB 2GITB 5GRXG 32C2A 3FTYA 1ZHKA 3QEGH 3X12A 4ATWA 2YGPA 4OV6F 1BCIA 3W38A 2WXIA 2Z0UA 3A6CH 3CVIH 4OD1H 3ARDC 3WUWB 1BD2B 4JUTA 4WNQB 3ZE0E 5IJKA 5D7IF 5IESL 3S8WA 1QUPA 4D0CA 2BVEA 1VCAA 4QAMB 1L9OA 1U58A 2J6EL 1SJMA 2F1EA 2FLRT 3MO1A 3K6SB 4G8GD 4N6RA 4BJLA 5FPIA 3N40P 3EZ8A 3L1OH 4XCEA 4IK6A 2ZOLB 2OXHA 2FJFA 1KLGB 2XTJE 2Y2TA 3QEQE 5DR5L 2IFFH 3MRNA 5HHMB 5CSZB 3T1WA 2R2EB 4YDKH 1ZHLA 1A7RH 1N0XH 4Q6YA 4XMKH 3VI4A 4NJAH 2GJ6D 1NDMA 2CLRB 3CH1A 4XO9A 3VYNA 2X6BA 2BOCB 1DN0B 2VW7A 3FC8A 2ZX7A 4JPWL 1OOAA 3MCLH 2W1NA 2DLEA 2C9XA 1EGJH 1C5DA 1BGXH 3NIDB 4Y19D 5I75B 3MCKB 1MW1A 4NFDA 4PJFB 4AZ8B 4FQ2L 1QA9A 4H0GA 3M07A 3UGEA 5JXEC 2YAMA 2IPTH 2HH0H 3HC0B 1LWRA 5E9NA 2W60B 2ZCZA 5E6ID 1EO8L 4PD4K 4LCWD 1KTCA 4KTDL 3SKMB 2AV7A 5DURD 2ENQA 4WEMB 1YMHA 4NOBA 1TITA 2A6JA 1Q9LB 1VADA 1TNMA 3BPCB 2CHWA 4MA7H 2DQUH 3ESVF 4K9EC 2UX6A 4TQEH 2R4SL 5C0ND 2VUYA 1EEQA 5D7IE 2FNWA 4ANUA 1S7QA 4HJGB 3SKOA 1LEIB 5ISZA 1JOIA 4AV5A 4I1PA 2DN7A 4I0CC 1FC1A 3CDYA 4X7TB 1I7TB 2FJGA 2YPLA 3CFDB 3WFHA 4GAGH 1HH9A 5F1NB 2COVD 4MLSA 4NO2A 3JBG7 3S34H 1OM9A 3N91A 4M1GH 5EZIL 5FYKL 1E7VA 2GSGA 1C5BL 1OGAE 4YAQB 4EI5A 3AAZB 1INQB 5EUKA 3UTPE 5A16A 2XV2A 2JCCA 4M7ZB 3M7OA 3INUH 2P24A 4LOFA 3TJEH 2IANE 3IJHB 1IGIL 5EZOL 5JORA 1J5OH 4IDLA 2MCPH 1N7ML 2K6ZA 1J8HE 3RGVA 3GRWA 3GMOB 2OXGA 2GBTA 3L9RA 2L7UA 3VW3H 1T6BX 1F2QA 2VXSL 4PJEB 3WEAA 1DLHA 3C8DA 4P2RA 1XIWD 1A6AB 1RZQA 3VD0A 4UINL 2VSKB 3QPXH 4KRNA 5BW7A 1AJ7H 4OUOA 5I1EL 4ZMVA 4NNXB 3KE0A 4JHAL 4AK2A 5J6HA 2PXYB 5BRZB 3RUGB 2EICA 4QRFA 3BAKA 1CD9B 3BIKB 2XWBB 1UQSB 3ARFA 4QRTA 5BV7C 3S88L 1UH4A 4Y9GA 4AYDC 5FIEA 3GI8L 3MYJA 3O4OC 4C83A 1IGFH 2VISB 3DDFA 2KDYA 5T1LA 1J48A 2V0AA 1P6AB 1IEHA 4HEME 3WE6B 1BYPA 3EYQD 3IGFA 4GEIA 5D6CB 1WIPA 4JQIL 5DS8B 5E5RB 3UTZB 4NZUL 4ABVA 5I18L 4HUUB 3EJTA 1CD1A 1W9XA 5DMIL 3CC1A 5HDBF 3DOSB 4OM1H 1GJIA 4LHUA 4KJWC 4EI6A 1GZQA 4HCGA 1O6TA 4DO5A 1CR9H 3L8QA 2LW3A 4IOFC 2B0SL 3WIHA 2LVCA 2VO8A 4JQXA 1WD9A 4M1DL 1XSJA 3GSNB 4P9ML 4RGNE 4ZUTA 4AV4A 2ATKB 3HRPA 3BKMH 4G6JH 3RZCD 2EABA 3CX5K 4UB0L 5DJDA 1CTOA 2FO4A 4FJYA 2J1YA 4GW5A 3WTTA 1BFOA 4ADIA 1X9RA 4AWJC 3ABZA 4M48H 4APQA 4N9GA 1D7CA 4AV0A 2IEPA 1R5VA 1TOXA 4CKVX 3FO2A 3NRFA 1ITBB 1UZ8B 5DVPA 5GSVA 4NZ8A 3AY2A 1IAKB 5I8CA 4I3SL 4DVBB 1RHFA 4HT1H 2N7AA 3UZVA 4D9LL 4GQ9H 4OVVA 1QHPA 3QIBC 2DQ6A 4CKQA 4ZTOH 3KYKL 5LBGA 3QAZB 3GMRB 4YVUA 4DOHB 4OZIA 2AXHA 3K8MA 2Z4QA 1RIVH 2K6YA 4UDUB 1QOKA 4W4OA 4DPRA 1IARB 3ULVH 1NMBH 2BVQB 4DP6X 1MCPH 4EIBA 2X0WA 5I6NA 3OHXC 3L1FA 4BFNA 5JDSB 5DWUH 5D70H 1KTBA 3GBML 1L7TH 3ILPB 4X99A 5HJ3B 3T0XA 1KJ3L 5K1VA 4X9HA 4N26A 1J9RA 3TWCH 3IFPB 3WIFA 1Z1WA 5HDBE 1UXSA 4KMTL 3DWTA 1WUNT 2M2DA 3AXLA 3JVGC 1VEPA 3LN4B 5JLZA 1RCYA 4IRJB 1G1CA 2WVTA 4ODVL 2R7EA 4XPAH 1PCSA 1T03L 2NY1C 1RZJH 5D93B 2VR4A 4M7JH 2EE3A 1M3IA 1MJJB 1TCMA 4K5NA 3D4ZA 5GS1B 1XEDA 3VD9A 5I8OH 4LRNL 1I31A 4KUZL 4YSCA 3TPUB 2EIZB 4O2FA 1AC0A 1R0AH 2QSVA 3MBEB 3GNMH 4FZEL 4JM4H 5CS7A 3UMNA 5I17A 1J1XL 1GS7A 1QQDA 1Q9WA 3L95B 1SDDA 2OMXA 2D4DA 2DYPB 3GMLA 5IMKA 2AABH 2F58H 2P5WE 4JRLA 2R0KL 5CLTA 1PYWB 4H7VA 2Q3XA 5T1MA 5IJCC 5I15L 4ZPVA 5AAWA 1UUNA 1H8LA 1OW0A 2NY1B 1Q72H 3ERXA 4IKKA 4AEIH 1DQVA 2D0HA 1C8QA 4IEFA 5ENWB 3WGVB 4ZFGL 4FQXC 1FVDB 2QT6A 3F6IA 4X7EC 4UQAA 4JN1H 1P5UC 2CO6A 1B4JH 3OZKA 4ZDHB 1OZTG 2XWJA 3LQAC 2HVKA 4DERA 4K55A 4J3OG 1ZVSA 1T21B 2R8SH 2GHWB 3TZVA 2HUEA 1R1CA 2NSMA 4XCNB 3APNA 1UWXK 5LAXB 5ACZB 2HYMA 4FQIH 3NSJA 1HQ4A 2XG5B 1A6TB 3ETSA 3FB8A 1RZ7L 2XKNB 4KY2A 5AVZB 2EVIA 2L7QA 3US9A 1U6AL 4OLVH 1DEEA 3U6RA 5I71B 2DD8H 3EJRA 4A2MA 5SX5H 1F58L 2A73A 3ARTA 2LVEA 2G60L 4KC3B 4N5ED 3V0AC 4OAWB 2X6MA 4C4KO 3MTRA 2J2ZA 5C0AD 2I60H 4OCYH 2X38A 4YE4L 3UBXG 5L8LB 3ATBA 1NCHA 3KPQA 3HA0A 3NJVA 4XNZB 1PNDA 1NFDB 1T3FA 2GAZA 2EJ1A 2A9MH 5LDSA 2AI0L 5MEPB 1YECL 2KMWA 4QWWC 3HI5L 4OIBA 3BD4A 3D09A 4AUUA 5B1CA 1N2RA 4ZW5A 5JW3H 4F7TB 3BAYA 3CZFB 3K46A 2VMDA 4PJAA 2AJYL 2X89A 5FCSH 3QIWC 4OZFH 4X4XA 4L8SA 1LD9B 3MJWA 3NRPA 2IAAC 4NHCH 5ISZD 1A66A 2D03L 2WBJC 5GJTL 4D3CL 2A99A 5CF3A 5F7KC 1G7IB 2YPLD 3H0TB 5F88B 3ARYA 3VSVA 2WZ5A 2MNWA 4F20A 5HI3D 25C8L 3EH2A 4XPHH 5GGUA 3B5TA 1X7SA 3SDDC 3V5KA 4EI5D 2KKQA 4UM9B 1UKSA 1HWHB 4R8WL 2V3EA 2M26A 5I1LA 1N3NA 4YSEA 2A6KA 4B9IA 3UGXA 1MEXL 5FOBA 1CL7L 2LE9A 5IROA 5HHPB 1OM3L 3PWJA 4KGJA 1MJUH 1U92A 3RWHB 2AZUA 4UQ3B 1BQ5A 1AS7A 1F3JB 3GC3A 4M6ML 4QPEA 5J89A 5BZWB 1QFWI 2AMUA 4E41E 2Q76B 3VFWB 2NLJB 2R2HA 1N59A 4FF9A 2DQFB 2YEQA 1RU9H 5IREA 5I6MA 3BP7B 4LU5H 4KXBA 5I19H 3MODH 4P2RD 2ADIA 3TEYA 5EEVA 4QRPE 5GRJH 3T0EB 5C1MB 1FZOA 2OW6A 2HX9A 5JIIA 1HYSC 2AXWA 5AYUH 2OMNA 4WNJA 1AIZA 1OT1A 2C1PB 3DHUA 2QVFB 3NP4A 4LLYB 1N6QH 1WAAF 1B4TA 4PRAA 5E1IA 1FV1B 2IH9A 3DV4B 3I50L 1I4FB 5F8QC 2ESVB 3FRUA 5E8PA 2OKMA 3QEUB 1WEJH 4H40A 5C97A 3P4NA 2FBJH 4KKAC 4WK4B 1R5IA 4DN3H 2E0PA 2CO4A 4RISH 5CGYC 1I8IA 2XTSA 1SBSH 1M1XB 4AK1A 2V5RA 5T1LD 3LIUA 4ZX5A 1GA2A 2FO8A 3ME0B 5GGTA 5B39G 1S7WA 4AMWA 4FTVB 1NMCB 2YRPA 5IVZB 4F9PA 3OHMB 5I24A 1MI5D 1MFDL 1BF2A 2MOQA 3QUZB 4K3DH 1UKTA 2WXNA 4RMRA 4ICWA 4XNYH 3S35L 2NUTB 5DZVA 1H19A 1HEHC 2FX9H 4KOCA 2EAEA 1ADQA 2QKIC 5ANMB 3QNZB 2ADJA 2WSDA 4M5ZL 3SKNA 1PVHA 3HS8A 3CQQA 5KS9F 5LKNA 4N0CD 2CBOA 5DQ9B 12E8L 2N4IA 4NQXB 4K8RL 3TBYA 4E5XA 4KK8C 1CLOL 1NIFA 1YMMA 4YL9A 2WLIB 4APQD 4L23A 5KZCB 4G83A 3DJRA 2ZG1A 4G7VL 2OQJB 2HKFL 1DBMH 4IBWA 5E51A 3NA9H 1JPGB 4L9LB 4B9JA 2YWYA 5K9QG 5C0RH 3CSTA 1WAAE 2JNZA 3BAXA 2HMID 4XVJL 5C0JB 1SYSB 2M83A 1PLGL 1ORQB 2VLJE 3BJLA 1EBPA 4IU2A 1MCWM 2Z7UA 3S36X 3PP3H 5IEHB 3SE4C 4NKQB 4QHKI 4QUOA 3FT4A 3FULA 1KTJA 4H8PA 3U7YL 4LLVA 3V0VB 3WTWA 2NXYB 5D7SH 5I1AA 1M71A 1UM6L 2I32A 3LEVH 5GIRA 4MZ2A 3ETBF 4G8FA 2V33A 3A21A 3FT3A 4JO4L 4I88A 4ZAKC 4FA6A 5E8DL 2IOOA 4HIEA 4FLRA 3NZUA 3W5NA 5CCKL 1MLBB 2AK4E 2Y3NA 1AE6H 4PJIF 4YBLB 2BIPA 4YR6B 3VGAC 1Z9MA 1CD8A 4FA8A 1OGSA 4P5TB 3QPQC 4UMGA 4AENA 7CGTA 1IGTB 1B0GB 1NANI 5T5NG 1IGCH 1K8IA 1RLWA 1YNTF 2AJZB 3E6FA 4FFYH 5DQDH 3MLRH 2AS5M 3NCEB 4QHUA 4C58B 2YBRB 2X2YA 3N41F 2E27H 1F8TL 2FT8A 4NENB 5KJ4A 2W94A 4ANKA 5EIIA 3VXSE 4PI0A 1KB5H 5DEJA 1EPFA 3UJTL 1WO2A 2QQQA 4DCQB 1T20B 1E8WA 3OC5A 3CC5B 1KJMA 2EYTA 4QXUH 1NL0H 3OAUL 5ACLA 5BJTB 2X4TA 3LH8A 3QIUB 3HLKA 3P69A 3J27A 1SOQA 4JL1A 1MW3A 3KPMB 1GHFH 1L5GA 2VT0A 2X4QB 1DQLL 3IDGB 4O00A 2OYMA 4R5XA 1UJ3A 1YY9D 2DKUA 4CN4A 4UTAL 4G1MB 3EJPA 2WOYA 2QV2A 3T3MF 1RZKL 3GTTA 5ILTL 4N1EA 4CVWA 2UZYA 3SDXA 4PJIE 1NCNA 2YC1B 1KB9K 3C60D 4NQCA 4M8QA 43CAB 2OAAA 4TULH 4HALA 4ENEC 3BLPX 5D7HA 1QHOA 3HG5A 4J4PA 5FYLL 3RL2B 2XZQL 5JYMA 3QUKB 3HNSH 3LH2H 5CNHA 1WC7B 2R27A 3F8UB 3FRPG 3KXFB 1KCVL 1CJYA 1CGUA 3RJDA 5FV1L 2P8MB 3MRGB 2DM4A 4JRWA 1L7IL 2FECI 5HHVL 1R3HB 4J3OF 1A8JH 1CE6A 4GRWF 4YC2B 2XDHA 5IW1B 4XN2A 3KPRA 1H6TA 1G9NH 4FFTA 3R19A 1T1WA 1TQCB 4PUBL 1BZ8A 2CJSA 2KHAA 4I18C 4MBOA 4TF4A 5HD8C 3H85A 5H37H 3QDMA 1OSPL 1BBDL 3MRIA 4QIRA 2IWFA 2WN2A 4XNUL 1E28B 4P9HH 3ZT6A 3OPUA 3HS0B 4JRYE 5F7YC 4BD4A 3UAAA 1XB8A 4GKOA 1NCUA 2AW2A 2ZCLH 3VWJD 3RVVC 2H2PC 4RGOL 4NUPA 3V4PA 3WFCL 2MQGA 2GTWA 1PD0A 2K7PA 2YXWA 4EN3C 3QK0A 4P3WA 1RFDL 4ETQA 3G6AA 3U9WA 3Q6GL 3W3BA 3GJFB 3WNIA 3SJVA 1IBDA 3UZEC 1BLNB 3T3ME 2VLRE 3EO0B 3Q7JA 4CN6A 5C08A 1OV8A 4F1ZA 5LNEA 4POZC 2DQHH 5AZEL 4DZ8B 3WHXB 1ET7A 1OTSC 4L3AA 2D73A 2KZBA 3AWGA 1HHKA 2ZKHL 3GT6A 3N1FC 2QPUA 2FL5B 2Q6WB 1NUDA 2BIOA 5HP5A 2XN0A 1SLXA 3BH4A 5F6HJ 3RY6A 5IB3B 4LOEA 1KACB 3HZMA 2NY6D 3FQWB 4LAQH 5FFLA 5EN2A 2ICWI 3IU3B 2OX5B 3PWUB 3MV8B 3AADB 5AVUB 5DK0B 2EVHA 3AITA 3PWVB 1IIKA 1PZBA 4K71C 4CMMA 4GG8A 3RBSA 4PRPD 2ZYHA 2VLKA 1S7VB 4LSPL 5JA9A 2H47C 2IGLA 1NPUA 4IGBA 4QRRB 4O2EA 4OZFG 4V2CB 4KTEH 1DHKA 3IFLH 4IU3B 2B16A 2UY6B 1L6PA 3MRBA 3O6KL 4H2AA 5K9QI 1JNNH 3LZFH 4MVBD 2OMUA 5EEWA 1O6SB 4O2CB 1IB5A 3PWPB 3X1FA 3T4AB 1QR1B 4MD0A 1KNOB 3TJPA 3TBTB 4WWKD 1KXQA 3T4YB 2D7MA 3MREB 2IGFL 4H25B 4JFDD 5CEZE 4N2HA 1ZT1B 2YMOA 5HGBB 3HI1A 4MYWB 4JKPH 2KC0A 2ADFL 3ZRSA 1B4LA 3ECWA 1VKXB 3B7YA 1S5HA 1FL5B 3IXTB 4IRSA 3C6EA 4XVTL 4MJ2A 5IHUH 1YZZA 3TASA 5BUPA 2Z92A 3QUMH 5FO8A 2AMGA 3NRQA 5I5JA 2Q7NA 3BEVA 3GB7A 1CF8H 3NCMA 4F37K 4I9XA 1FZJA 4PJ8C 1BVNP 1YMMD 1JERA 4XGZB 3ARVA 3T65A 1KCSH 5C9JA 4JY5H 2W0LA 4KITB 2ODIA 3OWRA 3L6FB 4RMTA 2UVFA 2BVPA 1JYVA 1VFBA 1R75A 4Y2DC 1R3IL 3AREA 1GZPA 4U6YB 4CMHC 3F5WA 5J8OA 1J1OH 3IN2A 2EACA 2FEDC 1HFUA 4Y5XC 3ARBA 2O30A 2P5PA 3NK3A 4UWQB 5CIPA 2RJMA 3VFGH 5DD5H 2B59A 4CVZB 5EOTB 4U0QB 4RAVA 4NIKB 4XN8A 5EIVA 1T80A 3OSKA 1WWWX 1S9XA 1H9VA 4DETA 3MLWL 4BEIA 3AB0B 4R2GB 5CXPA 2WUBH 3SPVA 3CFKB 1CYGA 4AQEB 4FQHA 1XH3A 2CCVA 4Y4FA 3ZE2E 2DIBA 4HAFA 1RVFL 3MXVH 1DBBH 4M93C 4K94C 1CGSL 3EDJA 3FQ1A 3HNTL 3N06B 1M6OA 4L29B 4UQ2B 1KENH 2WXPA 4JANA 4MB5A 3LPFA 3HRZB 1XCXA 4AQ1C 4LIQE 3HHSA 3MV9D 1KGXA 3S48A 1ZSHA 4MQTB 3IRPX 3T0VA 1U2YA 4MA1C 2R69H 4MRCA 4DGIH 4RA3A 1RJYB 1IQDA 2AFNA 4L37A 3VXRA 4MJ4A 5E4IA 3GMQB 4PS4H 1JCKA 2KLSA 3HG1E 1A6UL 2DYRB 4PEEA 1E7UA 5D7JD 1KLFA 1CFVL 3NPSC 3QS3A 1WS8A 3MBWA 1NIBA 3HPLB 4NQVA 1GXEA 1AGEB 3EJYC 3F65A 4HJSA 4JG1H 1ASQA 4I4WA 5J6GA 2IXQA 3PREA 2CIKA 3HBGA 3TN0C 3DPBB 4MA1B 3K4AA 4UIKH 3GBEA 1TYRA 1Z9SA 3CZGA 1KWKA 1Z3GL 4D8PB 5ADPL 5HI4D 4JREB 3KWWA 1BPLB 3IGKA 3VJ6A 4AJWA 4WWOA 3OB0K 4EZMA 4WU5A 3FMGH 2BVYA 4MNGE 2CR3A 1ZK5A 4Z78B 5F7NC 1AANA 3QQNA 3WKQA 5T5NF 4YDIL 3D0AA 2R15A 2VMEA 1BZ9A 2UWEA 3KYOA 2NNFA 5F7EH 4E9LA 1PLAA 3U4EB 1BZ7B 4F58H 5C07B 1Z9OA 5DFWH 2V7HA 5T3XD 5T3ZL 4N9OB 3SDCA 4OUUB 3NEOA 5ADOH 5LWYL 4WFFD 1E5AA 3DBSA 4OQTL 3QQDB 3H2WA 3K0WA 1B9KA 1N0LB 4NQCD 4XNMA 4BELD 1X5GA 5KUMA 4JZJA 2F8IA 2CR0A 2HN7A 3OKOB 4R7NA 4BFIA 3FCTA 3D69A 3HHMA 4WQOA 4X6BB 3VM5A 4P23D 2BOBA 2X9XA 3CFCL 3VVVA 2P7TA 4J4PD 1CC3A 2VITB 2WJ7A 2GT9A 1Q94B 1RZFH 2V5SA 4W9KC 4G1EA 1P4IL 4HPOH 1IM9A 2Y0SA 1EDHA 2MWCA 4MA3B 5D6DA 3JV6B 3GLAA 3GSNL 2MHAB 4Y9CA 1OO2A 1LGVA 5GSRA 4WK0B 1P1VA 5TJWK 3TH4T 3B56A 4HKZA 1R24A 1JZGA 4P2YA 3KPRD 1K5NB 4Y5YB 3NA4A 2HVBA 4X6FA 3R4RA 4NO5A 4BDVA 2FH8A 3TO4B 1IL1B 3H9SE 4LCYA 4C4BA 2OJZH 3QDMD 1NGQL 4H5SB 3VXTA 5I1CH 5D2NC 1SEQL 3OR7A 5DO2C 1F0LA 5DUMH 3TEWA 4XO4A 1MFBL 3QNXA 3FO9B 4CVXB 1LP9B 4JM2A 4CSSA 3ILQC 3KGUA 3TT1L 2XN9A 1F4XL 4GMSH 2PTTB 4GW4B 1JGVH 3HC3L 3C8KA 3D3VE 4OJYA 1QTSA 1TR7A 4QRUB 5EBWB 1PBYA 3CUPA 3TOPA 1G9MH 2PETA 5INCB 3U0PB 4HUXB 1Z6JT 3DJSA 1TZAA 4OLEA 3RE0A 1JHTB 1IC4H 4L4VE 5KYUB 3RWFB 2AEPL 1HHIA 4OLWL 5I0WA 3BN9D 1K85A 3LKQA 2YKLL 4HCRA 5LNGA 4URTB 5JPMC 1XSIA 3QZWA 1NCBH 2FSDA 1RY7B 1PIFA 1SUJA 1INEL 2D8KA 4I2XE 4Z7VF 4R97C 4HK0A 1AO7B 1U41A 4K7PH 3ROOB 4UDTA 5ACMA 1NBQA 1WTGT 3AGVA 1KOAA 3BSZL 2VDMB 4XNQA 2ZD0A 3WKML 3VE0A 3U7AA 2F68X 3T2OA 4MSWA 4G9FD 3QJUB 2EZ0D 4OGAC 4PPTA 1F90L 3OR6B 4MWFB 5GZNA 1JS4A 2BIQA 2B1OA 4Z3HA 2VLKD 5IT2H 1KPVB 2VR6A 5JHDE 3LXCA 5AZ2L 3ZPDA 1BP3B 4Y0GA 2ZOKA 5H37G 3BUYB 4DKEL 1J5CA 3E7JA 3VMNA 3GUTB 2E9JA 3EYUL 3VU2A 1U8PB 4KVNL 4XZUA 2Y25A 5CEYB 2NR6C 3PDOB 3RB5A 3MA9L 2E59A 4PBWD 3CN1A 2V3FA 1BAWA 4X83A 1DZ0A 2A9NH 3HFML 2BJML 5TGBB 1U8NB 3SPIA 2BP5M 5KJRH 2JLLA 4ZUUA 4XNAA 5D1ZC 2AEQH 3UXFA 4JFHE 3L4VA 1IT9L 2QSCH 1J05A 2CO3A 3M6DA 4X8GA 1LO4H 3I6GA 2V2XA 3MR9B 3SDAA 4LKCA 4N0RA 4WU7A 5IHBA 5IR1A 4KX9A 4MAUH 1V7MH 3EGXB 5IB4A 5I0YA 3F05A 3EYOB 3LZOA 3JV4B 2Q86B 3X3FL 4HUMB 5E9DD 3IDXL 1EXUA 5DJ0B 2J3SA 1ADWA 3ZHNA 1MZZA 3FZUC 1OALA 5DJ8A 5EBMA 4ZS6D 4AYID 4PJGA 4FQPA 3GK8L 2WO4A 4APXB 3GS7A 1QVOB 2WC7A 4AH2B 1WWAX 2DI8A 5D7KE 3VG9C 1XF5B 3MV01 2X6AA 3SKJH 2V2TA 3MJGX 1DTUA 1UYWH 4JW3A 1CGYA 5J7CC 2Q8BL 2WQ8A 1QI3A 2P5EE 1UXLA 3CN0A 2BLFA 4ODWB 5I1JL 1EK3A 1QSFA 4UUJB 1A3RH 1TJMA 1CDGA 4O9HH 4WJKB 4PLKD 4JFPB 1RL1A 2BNQA 1NPJA 4I0PB 5DD1H 4BZ1A 2FQGA 3KLAA 4KNUA 3QS2A 1ET8A 3S0PA 3O81A 1MZYA 3VD7A 1U91B 1RIHH 4M8RA 3REVB 3FCUB 1DJXA 4Y8DC 3RIFK 4NQSA 4YHZH 1XGPA 2FX8H 1E4XH 3GRWH 4WV1B 1UASA 3CZNA 1HXMB 2HSIA 3BAWA 5D1QC 1F6LL 3VD5A 4F33A 2WSKA 5KYYB 1A2YB 1ZLVK 2NTFA 2N1KA 3QCTL 2R4RL 3ECUA 4E9VA 1BOYA 1WZ1H 4FQCH 5E6ZA 4NZFA 1SJVA 3C2AL 3ZE1F 3IE9A 2ZCKL 2VDRH 5EPMB 3OJMB 2IOMA 2YARA 4PG2C 1XCTA 2B20A 1KWGA 3V95A 1V27A 1NKGA 3CXHK 1F45A 3HBPA 3M86A 4LLMA 4E42A 1P5VB 2D7PA 1JPTL 3VXRD 2KL6A 4P48A 2BH0A 2ZOOA 1N67A 1RZIA 2LHAA 4FYQA 2AJUH 4UM8B 4JJOA 5EU6B 2JMRA 5KSBA 3ZW3A 2FD6L 2HLAA 4LE8A 2NY3D 5DEGA 1UA6L 2G9KA 1CI3M 3C6LA 4UT6A 5F9WB 3FB6B 3FCGA 5IHZA 3OQ3B 1JZ7A 5EBLB 4QAWA 3WIHH 2NSXA 3QORB 3QJVB 4Q9QL 1JK8A 5IEKB 2D3LA 2PKDA 5ID1B 5CWSA 4GG6B 2IPUG 4QYAA 2DV6A 3KDMA 4XCCH 4RLDA 1F11B 1HN1A 3CAFA 1R33A 5B4MD 1ZLWK 2H9GB 4ZX4A 5B1KA 1KYOJ 4D9QE 1PDKB 4NC1C 3R0NA 4OV5B 1QPKA 5HGGS 1HOEA 2CA3A 3SSGA 1NKOA 4F7EA 4U0RB 5SWSE 2H3NA 3ECVA 2VSMB 1JGEA 1OAQL 3JWDH 1FYTA 3SB3A 1QW9A 1U8IB 4LT7A 3L7EB 4P4RA 3ZE1E 3PABA 2DZEA 1H6EA 3T6VA 3BZFA 2WINB 4L4TD 3PJNA 3DETD 5AL0A 2NZIA 2NTSP 5JDJA 3WN5A 2AQQA 2XTJB 3QEQB 4A2DA 1KIQA 4Z7WF 1QSEA 1BZEA 2RQEA 4HXBL 2DWEB 3OBAA 4KKCD 4HWBA 4M6NH 4FZ8L 3HLAB 4LSDA 4LOVA 3ZZQA 2C7FA 1ZLEA 5BUAA 1BVKA 4NKDB 3BPNB 3DURB 1MUJB 4NWTH 4EZLA 3VXME 1IM9D 3OAYK 2EDEA 5ETUB 5HHOA 5HHXH 4KFMA 1WQVT 3GTNA 1EZVY 1BJ8A 4OZ4B 4HC1A 1TPXC 2H45A 4G42B 2QFRA 3AGWA 2H32B 3ILDA 3WNNA 3W5MA 5CUSH 3IETA 3QXAB 2ICEA 3L3OB 4KRPC 1X6LA 4HLJA 4YGVA 3VXUD 2VQ4A 3P02A 1RUQH 3SPCA 4R90L 3QDJE 4I3RL 4ZSOA 5I5IA 2F54E 1R5WA 4JM2D 4YIQA 3HUJA 5J11B 1T89C 1R3JA 2BNRD 5BNXD 3IFNH 3QYNA 3N0AA 2WLHA 5D7IB 2Y23A 4PS3A 3KEDA 2PPAA 1J88A 3B9KA 4LPXA 4XO3A 5HYJA 4G7RB 1HZLA 3FQYA 4OD3L 3QWNA 5CAYB 1RD6A 3WG7B 1JHLH 1KGCD 1LYQA 2NCMA 3D9AL 2LLNA 3HC4L 5BS0B 2HJKB 3ABLB 2X1QA 2NW3A 1ZXQA 2EXTA 4FGMA 3GS0A 2X4SA 4LK4A 4ZUSA 1I9IL 2N59A 3GZOA 1OGAB 1CLYL 1FRGL 2EXYC 3AU0A 3L9EA 4S0TD 5AL8A 3IKKA 4Q2ZB 2Q2EB 4YN3A 2PABA 5ECJE 3UYOD 1IEBA 3ULUC 2W07A 5B7FA 2ZOTA 4UILH 4PJCF 1J8HB 2I69A 1WYJA 3VB9A 4NQED 1L0PA 1JV5B 4FKKA 2KLRA 1OSZB 1D9KC 2N3JA 5I6XC 1WCBB 4EMZA 1KJ2B 1PQZB 4G6AC 1DBKH 3C5ZA 3TM6A 2JJTA 5E8OA 4ORGA 4JHVA 1HQRA 4LSTL 4XVUD 2QQLH 2OJ1A 2R1WB 4LASH 5A2CA 4QXTA 3VFTB 1UB5A 2B9AA 1XD0A 3NDZE 3HZYB 5DJ2B 4PRIE 2F19H 2BRRH 2V17L 5BQ7B 2CXKA 3WDIA 1T7WA 4QOKA 4YSTA 1NAKL 3CSGA 4V1DE 4G80B 4MXWL 4LSVL 2I25N 2JJSA 4IOSD 3QI9C 4ZK8A 4PREA 2AKRB 1OL0A 5KBKA 3CLEL 4KK9D 2ZG3A 5LQBL 3MJ6A 3EOTH 4KKLD 3OXSB 1D5ZB 4UT9A 4NI6A 1UOWA 2ZNXA 3MLXL 2X2UA 1MJ8L 3BP4B 1MG2C 2ZUYA 4CADA 3P0YL 2NXZD 2QLVB 1JGUL 3BDXA 3UZQB 1VHPA 5MEND 3K71B 1JMXA 2V9QA 4BUHA 4BXVA 5GJSH 3LZNA 3QEHA 2FCBA 1T0NA 4F15B 3PUCA 3KLHD 3BFQG 1LDPL 1YY8A 3N85L 3MRKA 1UHVA 4AT6B 5HPMB 1DQJB 1YUHA 2BNQD 2EE2A 3BWUF 3JTBA 4ODSL 4IS6A 3W0WA 2QADC 1Q0EA 1WH0A 2YJLA 4BK5C 4GRLB 1OE2A 4GEJA 4KI5D 1KC5L 5EBGA 3UTSA 3L3KA 3QZBA 3VI3E 1HL8A 3I84A 4KKRA 2QPFA 3QH3B 4JY6B 3RZCC 5DSCB 5DU7A 4HBCH 1RMFH 3VD1A 1T7VA 2VZ3A 4I87A 2OSLA 5E5UB 5ERWA 4G3YL 2ZF9A 4RX4A 1HHJB 2AGJL 3D39A 3HS9A 4MNHA 1OP3H 3O8XA 4ZO9A 3W39A 1E4HA 3B6SB 3T8VA 3OGCB 1F4YH 3NSXA 3VFMB 1RHHA 3QQ4A 1A7PL 2EIBA 1GGBH 3W56A 1OOWA 1AQDB 4RFEA 5DHMC 3ZKMC 2X40A 1N5YL 5C0BA 3S8FB 2WTPA 4H20H 4W9FC 2ZWNA 4DKAA 3MUUA 4TRPH 2NDFA 3GXFA 1SFHA 1JD7A 3BAEH 3BE1H 3C5JB 4M43H 5F1IB 4IBLT 2JWYA 5HDBB 3II3A 1G7LB 1F2XK 3CHXA 3JWOC 3S5ZA 4AJYV 1OGPA 4H1LB 4XP4L 3WBDA 4NC1E 5AOJA 2EUZA 3H9HB 43C9A 3U0TB 2EH7H 1DUYB 4HD5A 2VXUL 1AIFA 3KL5A 3C6LD 1UH3A 4JFXB 1GGUA 4WLCA 2QSQA 4WVRA 4MTMA 2XZAH 2H8PB 2UXGA 4JFOA 1WCQA 2IFGA 3UTQB 35C8L 1QTPA 4NHUA 3P2BA 4KROC 3OX8B 4RMBA 5HGDB 5F7DA 3N50A 3I9GL 1CICC 1ZD6A 4L5FL 4RGMB 2MOGA 3UEQA 3PF2A 5DC9B 5DHVB 2Q8AL 1E27A 2B4CC 5H35B 3V79C 3X14B 4TNGA 1PSKL 2VR7A 3KHOA 2F5BH 3ECBB 2J1WA 4JHBA 4G8GE 4TQPA 4PN6A 4JE4B 1FYTD 4NXSA 3EFFA 1JIBA 5EZLB 1URZA 2R1XA 5DJ6A 4PJ7F 1BYNA 1T2JA 1HL9A 2OJEB 2WLLB 4JLRA 3OLDA 5AWNH 5IVNA 1A21A 4HCFA 4CAGA 3IKCB 1L3NA 1Z66A 2CBMA 3D85A 1G6RB 2VABB 4WW2A 1J0YA 3P30L 4LVHC 5E4OA 3CFEA 3BT2H 5IQMA 1DE4B 3VYPA 1BIHA 4Q0XL 4CRPA 4ZFOA 2N56A 4P57B 4D9RE 4O58H 1XAUA 4UU9A 3PG2A 2YD1A 4Y19E 5TQ0L 4DT2A 2D7TH 3BXNA 4UQBA 5HDQH 4K5MA 5MI0C 1ESOA 1NZRA 3E6HA 4R0LB 3IDJB 1A1OB 4GKZA 1JWSA 4J27A 2YGVA 5D5MF 4N24A 3MRPB 1ACCA 5HHOD 4AGNA 1YYLH 1GGYA 1XF4A 2ZXBA 1OCOB 4PY7B 1TZGL 4AE1A 5F7LB 1UOKA 3ECQA 4LCWE 3W2DL 3ULVL 4LSSL 5MP6L 1ZHBB 4FQLH 2VO5A 1MCIA 4JFYB 4CBZA 1Y6KR 3QQ9D 1C08B 3LNGA 5DZPA 1E4WL 4KY1L 4XNXH 4Y1TA 4PRDB 2J5LB 5FUOH 1VFAA 2HT3D 3CXDL 1R3LA 2Q20A 1PJWA 4FYRA 5D8JH 3E38A 3L5XH 2XZZA 1KCKA 2FJUB 1MF2H 5EFIB 1NCDL 1FSKC 3T0BA 4K3JL 1U95B 3BGAA 4TNVK 4F2FA 1WBXA 2BSCA 1OAUH 3H42H 2DLFL 1NJ9A 1IM3B 4ZFFB 4M7KH 3EF7A 2Y1VA 2JI1A 5GRWA 2EDLA 5HYJD 2VOTA 3ULUE 2VSCA 5G5DA 4DSYA 5IB2B 4AXWA 4BSVA 1H3WM 3SBWC 4MXVE 1VPOH 3D48R 4NN5B 2DF3A 1E6OL 2P44B 5MERB 1FE8H 4EN2A 5IVXF 1SM3H 4Q9RH 1DVFC 1BW8A 5I73C 4FL4C 3US0A 3FONA 4XN9A 2ZTBA 4O5LH 3ZDXF 1WISA 2O1AA 2VZSA 4FADA 3UJIH 1IZJA 2UV3A 4QKXB 3O3DB 4ANXA 1TSHA 1RJZB 1RUPL 1LEGA 5DJAA 1JWMA 5FX3A 2ITCA 3DTXA 3EO9H 4D94A 3B2MA 2FTAA 5TQ2L 4U1MB 2VDOH 5T3XH 3UCRA 3P4OA 3V6ZA 3CQFA 4Y5VA 5FFGA 1JUFA 1U8LA 4G9DB 5E8NB 2CMRL 4E41B 5DD0H 3C5ZD 4TKWA 4DK3A 4XE5B 3U2SB 3CJJA 4QJ5B