2P52A

Mouse p53 dna-binding domain in zinc-free oxidized state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
publication title Crystal structure of the mouse p53 core domain in zinc-free state.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p52A00
2IOIA 5KBDA 2P52A 4G83A 4AGMA 3VD0A 5A7BA 2BIQA 3KMDA 2MEJB 4L0ZA 1CMOA 3Q06A 3WTWA 3D06A 3D0AA 5BUAA 3QYMA 1YCSA 1T4WA 3WU1A 4KVPA 5G4NA 4GUOA 2X0VA 1LJMA 4IBWA 2AHIA 3TS8A 1E50A 3EXJA 1TSRA 4QO1B 4LOEA 3Q05A 1GZHA 4IBYA 3Q01A 2IOMA 2J1YA 1CO1A 1HJBC 5AOKA 2PCXA 2GEQA 2FEJA 4A63A 4AGQA 1KZYA 3US0A 3WTYA 2ATAA 3D05A 1HU8A 3IGLA 2IOOA 5AOIA 4MZRA 4AGOA 2VUKA 4IJTA 4LOFA 2XWCA 4MZIA 3VD1A 1UOLA 4L0YA 3WTUA 5AOLA 3VD2A 3KZ8A 5LGYA 2WGXA 1H9DA 4IBSA 4IBTA 4IBQA 3D07A 1HJCA 4AGPA 1GZHC 3EXLA 3WTTA 2BINA 3IGKA 1EAQA 2AC0A 5AOMA 3ZMEA 2XWRA 4AGNA 2BIPA 4G82A 4AGLA 2H1LM 2BIMA 2J1WA 5G4MA 5G4OA 3US1A 2OCJA 5ABAA 2ADYA 3WTSA 2BIOA 2J6WA 3WTXA 2X0WA 2RMNA 4XR8C 4GUQA 1TUPA 2YBGA 3D08A 2J21A 5LAPA 2J20A 4IBVA 4IBUA 4IBZA 2J1XA 2J1ZA 1EAOA 4LO9A 5ECGA 1EANA 5AB9A 3QYNA 3D09A 3WTVA 5AOJA 4HJEA 2X0UA 1IO4C 4L18A
chains in the Genus database with same CATH superfamily
3ESUF 1SXNA 4KBPA 5DJ8B 3RL2B 4A2GA 3TN0B 3KYNB 2DQEH 5E5MB 5INCB 3TFKD 1ZV9A 4NZJA 1O6TA 3KXFB 4YGVA 2FECL 1HHKB 3V52H 3NEXA 4HEMA 3TWYA 5IFJA 1OW0C 5BZZA 3AB0C 4F1SA 3G5VB 2ALAA 1VADB 4C47A 3GMNA 2RALA 2HH0H 5DF0A 3IN2A 2EVIA 4Y4HA 2LAAA 2P5WA 4PJCF 2Q7AA 3I75A 3RKDD 1J9RA 2OYLA 1JV2A 4FNQA 5MERB 2L7QA 3INUH 4CMMA 3MZTA 4ZDHA 4N6RB 1UCTA 2P42B 4MVBD 1JK9A 1M7UA 2B4CC 4HQQL 2Y1ZA 3RWFB 2Q76B 2NY5C 4HUNB 2XT1B 4ODBD 3TNNB 1PKQB 4N2DA 3U46B 3QUZD 3K4AA 4TTDD 3SDXE 2BHFA 4GRMA 4OT1H 5EU7E 4UQ9A 2X2UA 4NPKA 3RWDB 4OAWA 4UZSA 2F6AA 2X3CA 3MKGA 2A77H 1SDYA 3TVMC 3UTTA 3S8GB 2F5BL 3QRFM 4KY2A 1UXMA 3SZ6A 3VFGL 4XP9L 1OZUA 1N4XH 3HNTL 3KLDA 3WIFA 3BUIA 3LNIA 2R4RL 3D39B 2YA2A 3CSGA 4WWKD 1AQKH 5D71H 5DK0A 4G7SB 1NGWA 2J5LC 3RZCC 5C2BL 2BSRA 4MKMA 2A1WL 3UTPE 3WXWL 3SB3A 4G70B 3CFJA 3DIVA 3RY4A 4HW6A 1IIIA 2IGLA 1AI1H 5AKVA 1ND0B 2EZ0C 3MFFA 2IWKA 2DQGH 1KT2B 4JM2F 4N2NA 3K3QA 4NZRH 4XCCL 1AR1B 2F8XC 1X5ZA 2B4CL 4HLZG 4GO8A 4XPTL 2NY5L 3KPRE 2I85A 1H5BC 3MLTA 4KDVA 4PWEA 3B2VL 3D5OF 3L5WB 1WIPA 1HZHH 1WWBX 1DBKH 4M5ZL 5DYOB 1VFUA 1NDMB 3GO1L 1MSPA 2HJLA 3EH5B 3L13A 1ZSDA 3CSYB 3S2CA 4N3TA 3SHSA 3VTAA 5IEHA 1EXUA 1GGBH 5CMAB 5EZIL 5CHNA 3TWCH 1MH5A 1NIFA 1ZAGA 4N8PA 2FNBA 3RP1A 3CX5J 3U2SA 3M7FB 3AVEA 3D85A 4EVNA 4PJFB 3V0DA 4NZTH 2AMUA 4UQEA 2EUWA 2WQUA 5JDSB 1ASQA 2ZKHH 3HI1B 4WNSA 5GRVL 3EFFA 5E4EC 3LEVL 1BOGB 3BLKA 2NCEA 2ZCHL 3GIZL 4XVUC 3U1SL 3KWVA 4XNXH 3TCXA 5D70H 1PS3A 4P57B 4FGMA 4PJ8D 4YVNA 4GKZA 1E2VA 1P4UA 3GYRA 5H2BA 3RGHA 1JPSL 1JPFA 4EDXA 2WXFA 1WRFA 4NO2A 2QGBA 4QHNA 4CMHC 1OOAA 2XNAB 4K2UL 4X4YB 5AKRA 4P5RA 3VXMA 2FO4A 3CFKA 2GC7C 1FG2B 3DHPA 4XZUA 2CR0A 5J12C 3FBKA 3ZE0E 2JXMB 1VDGA 4X8GA 4NCDA 4F7CA 3PWJA 3IJ7A 3V7MA 3HZYA 4B9CA 1I1AD 3CPUA 1LO2H 3QZWA 4N90E 1GKEA 4LLVB 1XGPA 3P3TA 3F7VA 1DBBL 4HU2A 1YUHB 3IFLL 4W68A 4IGBC 4X6DB 3SKJH 4TUJA 2QQKL 1CFSB 2R0LL 4LLWB 5GRXG 4K3DH 1H6EA 2H0FA 2FHFA 4CC1A 4X6FB 4JRXD 5HJBA 3VD1A 2IMMA 1F8TH 1QFUL 4JN1L 5ETUB 1U8HA 3EO0A 4HBCL 3M1CA 1KCVL 3OHMB 4NRZA 4YXKH 2V9TA 3QAZB 3B2MA 2OL3H 3U36A 1ZKAA 4GAYA 4LASL 1BPVA 3L17A 2Q9OA 2DBJA 3T2NH 4JFFA 2VDRL 4JFZL 1Q9WA 3U6XA 5CCKH 5F7WC 2EDMA 2BIMA 3PWNA 2KH2B 3Q2WA 3UYRL 1GZQB 1MWAL 2UUDH 5CU9A 1KGYE 2E7LA 1KJ2B 2Y23A 4AQAA 4Y1TA 3SE6A 3TBVA 1X5JA 4UT9A 2IH8A 1AGDB 5FO7A 1T5WB 2XVKA 2PNDA 4L4TA 3AU1A 5D1ZA 1T1ZA 1UOKA 1ONQA 5LO7A 4FP8H 4ZD3H 1Q1JL 3VFRA 3PU7A 4J3WA 3X3FH 1PAMA 1M7DB 3C2SA 4IHOA 4L8SA 5BZDB 4L8CA 2IC2A 4QDGA 5HGBA 2Y4SA 3AWGA 3DXAA 2Y5QA 2CWRA 1F3DH 3TTYA 4MDJB 2A6KB 3DX9B 2DEYX 1I1YA 4KZDL 3II1A 2VN6A 3IVKA 4QO1A 3SY6A 5FM8A 1F1AA 4WUKL 3VXUB 4G9DA 4HT1L 1FL6B 2NY3D 3MMEA 4TLTA 2V5YA 4FAAB 4UMGA 4GFTB 2C3GA 4WCYL 1X5KA 1DDTA 4P46D 4A39A 3F7KA 4DGUA 5IMKB 3WU1A 3FUNA 3OJMB 3QDGA 3PGDA 5FO8B 4OZIF 2VH5L 1G6RL 3Q0HA 2ZG3A 5GJTH 5FDYA 5ELIA 4OD1H 1L9QA 3B1UA 3WNLA 3II2A 1BWMA 4XN4A 3M45A 5FYKE 4GMTH 4KX8A 1WS7A 2I5YH 2ZPKL 1ZLVK 3VWKB 1OM3H 5I1IH 4WFEE 2WLMA 2V2TB 2X38A 2OSLB 3SBRA 5B39A 2WM0A 3EJZD 5KS9F 2WYHA 3PNWB 3FQNB 3L3OA 5L8KB 4O02L 2CUIA 1N26A 1PZSA 1T4KA 2QMKA 4J6RH 1AP2B 4OCYL 4V33A 1C5BL 1CLZL 1HT6A 2R56L 3WEMA 1GIGH 1XF1A 3SQRA 3FU3A 4ZYKB 4QUOA 2BS71 4LRIC 1UH3A 3B34A 3US0A 5BRPA 1SYVA 2JCCA 2ZWKA 3S2AA 4XPAH 5BXFB 3GS7A 4PJ5A 1P84K 2EYRA 1QATA 3GHBH 3O6FD 1AHWA 2FJGA 4MCMA 1P4IH 3GSRA 3MBWB 4POUB 1BECA 2JI2A 3SCMC 2VZ1A 2H2PD 3CN3A 3OKNB 4WO4B 3AXLB 3HVDA 3IS1X 3CFEA 4RFNB 1JNNH 2DV6A 4FXTA 4JNXA 1SJHB 5K9OB 4OF6A 4R0LA 1CICB 1EO8H 1ZV5A 4A7UA 2VQ1B 3NIFE 5E2TL 5H4ZA 4LDOB 4G8AC 4WU7A 2Z92B 2GK2A 4QHUA 3HBZA 3TBSA 1GGCL 1CVRA 5TTRA 1IKFL 4N0RA 2EEAA 4MXWL 2ZUSA 4KUZH 3ZDXE 3AAZA 1OHQA 1T2QH 3UO1L 4L48A 1VGKA 1IFRA 1HYSD 4WK4B 3OPUA 2HKAA 1I9RL 3SDAC 4YDVB 3STLA 3ZIYA 1QKZL 1HILA 4RNRB 4Z7WE 3SE4A 2X4SA 3ORJA 3ILQC 2VQTA 4AIZB 4AJWA 3GZOA 4PBDA 4CADA 1LXMA 1GSKA 3KR3L 3ISRA 2TSBA 1QEWA 4M29A 4I0PD 3TEYA 3VSVA 4ERSL 2F7QA 3L2MA 4I2XA 3M17A 4YSDA 2UWEA 1GS8A 1UYWH 3IK2A 2ZXQA 2WB7A 2Y36L 3TN0D 4ZS7H 1XIWC 3GMOB 4KWUA 1UXLA 1JXDA 3KXFD 2CD0A 1D7BA 4KQ3H 3CVHB 3BD3A 3O9WC 1UA3A 2FEDD 3CHSA 5DJ6B 5BRZB 4M02A 3ECBB 2YD1A 4K9EH 1PF3A 2MTAA 1WFOA 4QTHB 5C97A 3DX2A 3RNKA 4LLMA 1L7TH 3EHBC 4J3BA 1OQXA 1U95A 4IJ3C 4XBGA 2GB2A 4MMYB 3ARED 2NZ1A 3CZEA 4OGXH 1BWWA 5CEZL 3EBGA 3REVB 4GSDH 5A2FA 4EUPG 5E1AA 4LESA 3FFDA 4OGAC 4XH2A 5C07B 3QQ4B 2VLKB 5PCYA 2DKMA 3WHXA 2DLIA 1X9LA 3IDJB 3NZ8A 3PL6C 2NY0B 5LCVL 1I8LA 2NSMA 3SY0B 1HHHB 3L7EA 3QO1A 1ILUA 4I3SL 1UB6B 4LSRH 2BNUA 3QZPA 1XSIA 2J57A 3R1GH 1NL0L 4Z7UA 3ZSTA 2JMRA 4OTXL 1R3LB 2NQDA 4X99A 4Y2NA 3SGJC 1FO0A 5INDB 4DFIA 2VR7A 3QUMA 3IEAA 3FUMA 4RIRA 4LOFA 2HMID 3ALPA 3VJ6B 2XN0A 1Q38A 2VAAA 3GZKA 5E24E 2Z35B 5DHXB 4DVBB 1YMHB 3I6KB 4P23B 2GCYA 1J7VR 1MOEA 2EKSA 4HV8B 4JZOA 4L3CB 3EYOA 2AJXH 4QRQB 3T65A 3D39D 4NJAH 4J3OD 4XNAA 3P9LA 4F7EA 1CURA 1RUKH 3NFPB 4OU3A 5IQ7L 1NCTA 4OCLC 1KB5B 4PJ9B 2WXQA 3HC0B 4XC3H 1FVDB 4AYSA 3LTVA 1J88A 3G6JE 4HJIA 4RGNB 4UILL 1A6ZB 3CH8A 3QEQB 5KYXA 2YK1H 1AR1D 1ACYL 3FTWA 3AT0A 4DGIH 2XIBA 3GZQA 2HG0A 3OZ9H 3ALXA 4GQZA 3QP3A 4XMLH 3T2OA 3JT2A 3MBXH 1K5NA 2XYCA 4ELKA 2CO2A 1CDUA 3HLAB 1QBAA 3SOBL 2C9PA 4KDWA 1A22B 3HE7C 3IFOB 3KLAB 2I60H 3WIHA 3S3CB 2W8CA 1UM4L 4HMDA 5DO2D 1E9QA 5KVMC 4N2IA 4G8GA 4RZKA 4N1EA 2LTQC 4GRWE 1OE2A 5BJTA 2QEJA 2JB5L 2NPLX 1MCQA 2VTFA 3NCMA 1A0QL 3I02A 2XWDA 2V7HB 2LW3A 2V7NA 3CK0H 3LRHA 5EZOL 1IGCH 1HE7A 1UHVA 1FZOB 2G4GA 2IO5A 1AC0A 2WXJA 2XV0A 3OAZH 4YEEA 1JF1A 1EZSA 4JKMA 4FJ6A 1J0IA 2CBOA 4TRPH 2NW3B 1HXKA 3BOVA 5EZJB 4DTGH 4Y8AA 4YDIL 4MJ4A 3O3UN 3TIDA 2HPTA 2G2NA 3EGDB 3GEFA 4IU2A 4JFEE 2OTWA 3UTSA 3PQYE 4L5FL 3S36L 4OLZH 2YD7A 2DD8H 3MGAA 1YEHH 5HHOB 1TVHA 3A23A 1SJEB 4M9PA 1MFDL 1FNSL 4RETB 3RZCD 5I1HL 4H8PA 4U1KB 2J8HA 2HLAB 4HUUA 1IEAA 2H41A 3REWB 4HG4K 1WJ3A 3C9NA 3L1OL 2J43A 4ODWA 1F1DA 4DAGH 4JQXC 3BRFA 3GGWB 3BVTA 1TTFA 2GJZB 3HJ0A 4YK4B 1KTRL 4Y4FA 5DJYA 3QDJB 4FULA 4NT6B 3DI2B 3BAIA 3X14A 2MJWA 2IOOA 4FHKA 1F18A 3HE6B 4F8OA 1OF2B 2VN3A 4PJGA 4Q9CA 2CHZA 1VA9A 1M3JA 1CXFA 1H19A 2OXGB 4R7XA 2L7UA 4OI7A 3ZKXC 4PCKA 1B6UA 1DEEB 1IGFL 1X7TA 2ZONA 4NZFA 2FJHB 3DC0A 1I8KB 1GYUA 3RIFK 1J8KA 2VDOH 2OMBA 2J8UB 5DZNA 5TDNA 1NBCA 5DO8A 4H0GA 1KBGH 1KPVA 5FK9B 3JVGA 3OKYA 3WS6A 5D5MB 3TJPA 4QHLA 4AZ8A 1M7XA 5GIRA 5IB1A 1NCJA 3OWRA 4XPFH 4XPGL 2DBLH 4WI0B 5EOCL 5GSRA 4NDMB 1YPZA 3AG4B 1RURH 1BFTA 1DUYA 2UVEA 2O5XL 4LIQL 3LB6C 4O4YH 4R83A 1FVCA 1L5GB 2ADFL 3FCTB 2X9ZA 3EDDA 4KI1A 1NUFA 1PZBA 4WNQB 4IOFC 2MTPA 3C5ZB 3IWVA 1K6QH 3PXHA 3JTSA 2Q86B 4CC0A 2VERN 1JUFA 4LRNH 1B0GB 2DDQL 3LQZB 2ZOWA 2V0AA 5EG6C 4Y19D 1JHKH 1E90A 2W9DL 1WAEA 4JQVC 3GBML 5T3XH 1PLGL 1BAFH 2XBTA 4YSEA 4XO8A 4EZKA 2AK4B 1L0PA 4U1NA 4ODTH 1OAXH 2O72A 2OLDA 2X9WA 2J6EL 3KH4A 4WV1C 3ERXA 4L3AA 2I25N 1UA6H 4X80L 4PJDF 3VWJC 7FABL 1BQUA 4PJXB 3PRZA 1C7SA 4OIFA 2OJEB 4M61A 2AF2A 4LMQI 4XC1H 1HINL 1SQ2N 4K7FA 2HX7A 3QWQB 4Z7QE 3Q3GB 1PY9A 3K6NA 3KYMA 5EEWA 4OFPA 3P4LA 5T1MB 3EDKA 3GKZA 3PCYA 4UUJB 4ZAKB 4OD2B 3RWCA 1QLEH 4ODHH 3AY4C 1RZKC 1UEYA 2FX9L 4P4KA 3HA0A 4OI9A 3HI5L 5I26A 1I3VA 4NI3A 2DQDH 3OKLB 4HGWB 3VWKD 2JJTC 2O6EA 2R1WB 5F1IA 4JFDA 3UBXB 2X4OA 3D0LA 3KJ4C 5IESL 3T3ME 2OZNA 3L6FA 3PAZA 4L4VD 4OZHF 4AKQA 4BGDA 1UD8A 4ONGL 4FQ1L 4PJ7A 5FYJE 3TLRA 3N1FC 2VRQA 4DO6A 1BQHB 4JN2B 4ZPTA 5BZXA 3UAJA 1LMIA 4HPYH 5TF1L 4L8DA 3O8XC 2WWKT 3JZYA 3RURA 4OIAA 4U1GB 1S9WB 3ARDC 5DFVD 1QOKA 5SV3A 1P5UA 3W56A 4OD3L 5D93C 1ZLUK 2FDBP 4D94A 2BDNL 4PAZA 4Q2ZB 3RVUC 5AALA 2HSIA 3EYUH 4PRBA 1KIUA 4WO4D 1GY2A 2CXGA 1T1XA 1LK3H 1WBYA 2NT1A 3BYTA 1RZKL 5CP7B 4Z1PA 1Q9KB 2O5YL 5ADOH 3BAXA 3BUDA 3ESMA 5B1AB 2X7LB 3UBGA 1L9TA 2K9UA 4D8PB 5C0NC 1WAAA 3IDMA 4G80B 4U0RC 4XP5L 1DYZA 4OIIH 2E9GA 4JQIH 3OMAB 3OHXB 1OTTC 1IBZA 3MV8A 1OSZA 2WKGA 5I5MA 1OK0A 2ZCLL 3FN9A 4FMKA 3JV4B 3EFOB 4GT0A 4JGNA 3WLWD 3M8OH 5TGBA 4L2YA 2Y06L 1ADWA 1G7PB 3SGKC 4NPYB 4PYGA 2CDFA 4A38A 4B9ZA 5C92A 2NNCA 4YHML 2C7UB 3OJDA 4X8JB 1L9OA 3SEPA 4PI2A 4LARL 3IKCB 1MJJB 3OD3A 1EHLL 3CSTA 5IT2L 1MRDL 1WBZA 1N5AB 4ZFOA 1EZLA 4KHTL 3F7RA 3QQDA 4JKPH 4KK5D 5BOJA 2CLVA 4BGLA 4F8NA 2CBQA 5MEQB 4Y1SA 1ZVNA 1I53A 2IV8A 3DX6B 3HHRB 4PJIF 4ZTPL 2MH4A 5IFHH 3T6XA 4ODSH 3UG3A 1QSZA 5FKAB 3VB9A 2F54A 5C0RL 2FR4B 4DGVL 4C54A 5DC4B 2O61A 1TQCC 4HETA 3SCMD 4ZMLA 4PRPB 5BRZD 1OGAE 2O6DA 3FT9A 1URIA 2X6CA 3WKNA 3D52A 1UACL 1UD2A 3P30L 4KRPB 5F88B 2R0WL 1K2DA 2HJKB 3LPGA 5HDWA 1WCBA 3BVUA 4C57C 3O2VL 3BUPA 2N1TE 1CFMA 1MREH 1TJXA 2BP5M 3KS0H 5GGRB 3AS0A 4RBPH 5C09A 1YYCA 4NBXB 5I6MA 2FWOA 4ADIA 4TPRH 4OCRL 3EO1B 2VLKD 2ZNXA 1N67A 3CG8A 5CP3A 5E1GA 5GS2D 1KC5L 4OCSL 5JHDA 5BO1L 5JPMA 2XWTB 5E2UH 4GQ9H 1YDPB 4EQ3A 5CM1A 5KANG 1FL5A 4P9HH 4BFIB 3K6FA 1W72A 3KH3A 4E41A 4X5XA 3H2PA 3VDAA 5CEZD 3IXTA 4KXDA 1P7HL 4Y9GA 3VD2A 4OCWH 3DV4B 5F7LB 1BW8A 4A7GA 3LQMA 5DD3L 3WIIH 1MFBH 3CBJB 3G6DL 1PYWB 3VI4F 1ZHLA 4P5MB 1VIWA 4P23D 1ZLWK 3QCVH 3S35H 2VMFA 1NOFA 2IQAB 2YLKA 4OFQA 4YO0B 1AOHA 2CO1A 3L4UA 4B27A 3ZL1A 1MHEB 3GJFH 4WFHD 1A7PL 3DX8B 2ZOTA 1H8LA 2GIXA 4P2QE 3VI3B 2FGZA 2MHAA 1T7WA 4HZAA 4PJ9D 4BSJA 1XIWD 4RGND 5DUML 2RMNA 4JK0D 2X4NB 3QC5X 1BD2A 4QGTA 4UT9H 1BP3B 1IGYA 4NO0A 1Q0EA 1DL7L 4OB5H 2R29L 1BHGA 1UEMA 1WBXB 3GXUB 3O9WD 3QEQD 1WC7A 5DMGC 5CBEB 1MCHA 1XB6A 1YN7A 5F3FA 1AZBA 2HWZH 4PY7B 3RHWF 4KROB 1T83C 4AQ8C 3VXQB 2GFBA 1ZA3B 3QRLA 3IJEA 5LHDA 3WNPA 5DJ2B 2IAMB 5TQ2L 1EJOL 3MRQB 4TOYH 4OGAD 4MNHA 1AZZC 5DVLA 5E51A 1QASA 1NGYA 5HYJB 1CT8A 4UAOB 5D7SH 4IBLT 3ZQWA 4AENB 4X5PA 2G3MA 2IH1B 2JJWA 1QQDB 4FYTA 4GUOA 4PP2A 3IU3A 1XCXA 3TYFB 1LE9A 1SYSA 1F86A 1NH6A 1TJIH 2IWFA 1VKXB 4FF9A 4F8PA 1I7ZB 1CTNA 2ITCA 2VOTA 3VXRD 4HJTA 1TSRA 5IHHA 5FGRA 2WTRB 3HCVB 2AEQH 5KVFH 3FQXB 4ZMYA 3MACH 3U4EB 3ZL2A 1KDIA 4NZUH 4APXA 1AVAA 2BVQB 4KKLD 5CJQH 4F2EA 2V3FA 5MP6H 5FOBA 5BNXD 3VFPB 1PKOA 5HHOD 5DWUH 4FCAA 3D8MA 2G2RA 1HEZA 2NZIA 2XV2A 1XF4A 2BP0B 3C75A 4LLYA 1N18A 3QORA 3TM6A 2WXRA 5E9DE 3U25A 3U79A 5AB0A 4KQ0A 2ZKXA 4AW7A 3P73B 4P9MH 4ZOBA 3ULUH 5AKSA 1ZGLP 1OB1B 2N4IA 4QRFA 1U8IB 3OMIB 1HKLL 1MFAH 1FNHA 2E0PA 4PGBA 1DLFL 1HESA 3MNDA 3LRSB 5A16B 3D2UA 3QQ3A 5C0EB 5KN5A 2XN1A 5IHBA 3QDJD 4JFHE 3P9MB 4ACPA 1EPFA 3HE7D 5C7ZA 4J23A 3HE6D 2Z31A 1MEXL 4FHBD 4W4OA 4XBPA 2J2ZA 5C0BD 3SDCC 2XTJC 2Z7YA 2D31B 3VO0A 1TENA 3HR5A 4QIRA 2UY7B 3PJSB 5HI3C 5B3JF 1UXSA 2YC1A 1YLBB 3LAFA 1T20A 3QFDA 3NFSH 3ZYJA 3WCYA 3MRMA 4BSVB 2BIPA 3LN5B 2AJVL 4Y4HC 4OY9A 2AABH 1C5CH 1G87A 1IFHL 1YEIH 1RUQL 4OZFH 5I0WA 4WEMB 3RFZB 2WXIA 4DUWA 2EADA 1E6JL 5D6CB 2CALA 4E9TA 2AXFA 3WNJA 1QYGL 2NXZB 4LOVA 3PIQA 4QOKE 3NFNA 1WD8A 5C08A 5BS0B 4FERA 3FZUC 1IM3A 3O4LA 3BDYH 3ML9A 5EUKA 1RU9H 4XRCA 1G43A 1IGML 3C12A 3EG9A 4U3CA 4UIKL 5DD5L 3AUVA 4HUXA 1H3XA 4PS7A 3FSAA 4N0CD 1KBBA 1TVDA 2X1XR 4QI3A 4JR9L 1FZMA 2JELH 3HNTH 2JJSC 1U91A 2NYKA 1XCTB 2QADC 2ZWNA 1XH1A 1VRSA 1OGSA 4HFUH 3HBGA 5F0JB 1A25A 3A47A 4FTVD 1YC7A 2RQ8A 1NJ9B 1DVZA 1CL7L 2A1WH 2Z91A 4JCLA 1S9YB 3TFBA 2FO8A 2H2SC 3QR1A 1ET8A 2F8VA 4JM4L 4XI5D 2AK4D 2EUZA 2D2CC 1J8HD 4ZX4A 4CNIB 1IEHA 2VN5A 2VW4A 4TF4A 2B4CH 4U1LB 4XPTH 2C9VA 2LABA 2AQTA 4X8CA 5I8KL 3WKMH 2G30A 3CFIC 4JVWA 1EA9C 5DRWA 1I4FA 3WG7B 5IFJB 3P4NA 1NBYA 3T71A 3GMNB 3PABA 4H40A 4UANA 2MFNA 4HUWA 2YSTA 3DETC 4BZ2A 3E6FA 2KZWA 3I75B 3MKKA 4YHNA 2D9QB 2FUTA 4Z78B 1JV2B 4PSRA 1AY1L 3D05A 3TO2B 4OF0A 2CBPA 4ZDHB 5J13C 1UJ3A 2YPLA 1QLEB 4JL2A 2G9KA 2W9EH 2WZ6A 3VFSB 5IJKA 1F58L 3QS3A 1UOLA 4A2MA 1UM6L 4K5LA 3T0EA 3ZRFC 1BJ8A 3L4TA 4GRMB 4AVHA 5C0AB 4HKXA 1KCWA 2EDWA 4ANWA 2VE6A 3IMRA 3U1SH 3FOMA 1G4MA 3DX0A 5B22A 1KTCA 4DP7X 3D07A 4DKDC 3UTTB 5FW8A 2EDHA 2QKIA 1NC2A 3KM1A 2A74C 4RH4A 2G0LA 4PWHA 2BNQD 2APWA 2NXYB 1JPSH 1FPTL 2IDUA 4Y5YC 3MPCA 4NKOA 3CDCA 3WSQL 3L5XL 2XQYG 4ZUTA 1AXSB 3ARFA 1OANA 5DK0B 4JDZB 3C60C 4P49A 1D5XA 3FUDA 5IHUH 2QVKA 3KYKL 4PWFA 1NGWB 3POCA 2CBTA 1SMOA 2BSSA 3VXSB 1T7YA 3VWJD 3CFJB 3GLAA 5BPPA 4K73A 4M1CC 4QRPE 4KMLB 4IBUA 4WO0A 5AZUA 2XG5A 4M8QA 4LO9A 4FQJL 4QTIL 1JTTA 5EEVA 2W5PA 3KEHA 3MTXA 2I7OA 2WQRA 1R6VA 1C1EH 1O7DE 4WWPA 3IFLH 1HHIA 3RA7H 4MJIE 4MQ7B 2R0LH 2QQKH 4D7PA 5I19L 1XGUB 3CSPA 3D18A 5JW4R 3T1WA 5B1CA 1QFUH 3DSFH 3HAEG 1R9FA 1ZSDB 4JN1H 1AH1A 1PX4A 5IEHB 5F3HA 2YSSA 1FLRL 1KYOJ 3IJSA 4NN5B 1CUOA 3A3YB 1GVIA 1I9IL 2F8IA 5KSUB 3QUYC 1IBBA 1MH5B 3RY6A 1IGTA 4Y16A 3PWPE 4BHUA 2X2HA 4WI5A 1ZA6A 3BIBX 2VDRH 2WOBA 3HZ3A 3NABH 3D85B 3LRKA 4KTDL 4EVNB 1GHFL 1H6FA 1MXDA 2QFRA 3MTRA 3UYRH 2P47B 2Q1EA 4H8WC 4HIJB 1MWAH 5JA9A 5K33A 3W11D 3EFFB 5J6SA 5EU5A 3QCUL 2UY6A 1SXZA 2WIMA 3CAFA 4X8XA 3R7QA 4AMWA 1MF2L 1X4YA 4X83A 2CIKA 4LCWB 5JLZA 1OIOA 5DK2A 5HI5C 3F6JA 4HWEL 5EBGA 3MJWA 4PRPD 1J0KA 2E7LC 1U36A 4I77L 3RTLA 3DO4A 2CO7A 4J12A 5H2BB 1JPFB 1RMFL 4KRPD 4GQPH 2D2OA 4EDXB 4NO2B 4AKOA 4IOSA 1UXWA 4LVNB 4OH2A 3IT8D 2AEPL 3CVBA 4QHNB 1E3ZA 2ZP9A 5DXWA 4GH7B 2K3HA 3VXMB 5AVVB 5EF3A 1QZ1A 3CFKB 4RFOL 3AC0A 4NRYA 4XZUB 5F6IC 3WFCL 4AEIL 2VLRE 1VPOH 4B7LA 2NTFA 4WUKH 5DHYA 4F7CB 3C8HA 4HT1H 3PWJB 1V8HA 1BZEA 4OF8A 4PWIA 4U7KA 1O7VA 4PM1A 3HZYB 3NIGE 1JNLL 2R27A 4YHYB 4IRZH 3BLBA 3ZT6A 2VH5H 1E3FA 1XGPB 3F7VB 3RJOA 3R8BB 1X44A 4NWUL 1CFVL 4KPHL 1CLOL 4H8WL 4R84A 5GRUH 3UAFA 1X5XA 4TUJB 1DE4A 4HS6A 5HPMA 2ICWI 2BFGA 2B59B 2QHRH 3B9VA 5JW4Q 1CU4L 1MVUA 4UYPA 3SDXA 5TE6H 2EINB 1OWWA 2ZPKH 5EO1A 3UZQB 4GYBA 3T3PB 1U8HB 3EO0B 5ISZE 2W9LA 4S1SL 1CLZH 1U3ZA 2DW5A 4NQCA 4GXVL 4UQ3A 3U36B 2R56H 1N12A 4GAYB 3SYPA 1RLWA 2E27L 4UDUA 4FQHA 4JFFB 3C8KA 1A7RL 1Q9WB 1PL3A 1WUZA 5F7MC 4HS8L 4KKAD 5J6GA 3V7AE 2IPTH 3VRLE 4AQAB 5SWSA 5JTWA 3TBVB 3V79C 2N7SA 3P2DA 3BN3B 3EJJX 4JRFA 5FO7B 1XGTA 4L4TB 5DI8B 3AU1B 3MV7E 1T1ZB 4XO5A 3UGXA 2NRDA 5FCSH 5HHMB 5JXEA 2ZUVA 4HC1H 4KJQC 3VFRB 3DA0A 5CSGA 4L8SB 4L8CB 4IHOB 4DFHA 3WNNA 5HGBB 5E2TH 1EHKB 1G0YR 3N1MC 3DXAB 4WHTA 2N7AA 4XCFL 3QUXC 1H9VA 4JO2H 3FTGA 2JQAA 3DHMA 4NQEE 1IKFH 4JKNA 2P28B 1I1YB 4MXWH 3MRJA 1Y07A 3ENEA 3IVKB 4QO1B 3ZTCC 5CGBA 1D5ZB 3G04A 1B6DA 3QGVA 3FQWB 3MMEB 1RVFL 4YJZL 1Z9LA 5DD0L 1I9RH 2OYKA 3D48R 4NHUA 3FH8A 3QDGB 3PGDB 1ZLEA 2O5ZL 2VWEE 5CO1A 5K69A 1QKZH 1JS4A 1KYAA 4XPBH 3QXWA 1CJYA 1CI5A 2BK8A 4PJEE 5LWYL 5DC9B 5D7KE 5T3ZH 5B7FA 3B2DC 5AOIA 5D7IA 3KR3H 2DMBA 3S97C 3UTOA 5A1AA 5B39B 1S9XA 3PPEA 4MNQB 3L3OB 1T4KB 3EF4A 4FNRA 4HD9A 3QR0A 4HX1B 1NFIA 3O0RL 2X70A 1U4FA 2LLGA 1NMCB 4FYRA 2E6PA 4F9LA 4HCRA 2EIMB 5DRZA 2NY7L 5E94B 4GIAA 4PV1C 2Q8AL 3U82B 4HKJA 4FI8A 4OM0L 2B2XH 4FA8A 1YY9C 4PJ5B 2QDVA 4Y4KA 3UFIA 5HYSG 2PCPB 5AYUL 3FCSA 2Q3AA 3BJLA 1AHWB 3BPLB 2H32A 1NBVH 4PREA 3E1ZA 4GW1A 3I3DA 4Y2DA 1Q0YH 4K23H 1F6AA 5A2IH 1K9TA 4PRIA 1J8SA 3WY1A 3FF8A 2CK0L 3O2DL 1G1KA 4YBQD 4AKPA 4AIXA 3CFEB 2VXTL 4OF5A 3TA3C 4IS6B 2J20A 2NUPA 4R0LB 4I3SH 3QI9C 5I74B 5AAMA 2APTA 5T1LA 3TX4A 5I6OA 3F58L 5KSAA 3CXFA 1MCWM 4LPYA 2NXZD 1T22B 2J55A 4I0CC 4OTXH 4YXHL 1I8LC 5HD8D 1G6VK 3UIZA 4G83A 4N25A 4LCIL 5F96H 5D2NA 5ESVA 3NGBC 1M2OA 1FYTE 1C16A 1QR1B 3S98A 3STLB 3IF1B 4PUBH 1HILB 3FO0L 3NRPA 3BWUF 1PDKA 2X4SB 3TO4C 2EDLA 3LKSA 4YC2C 3VGAB 1CGUA 1IL1A 5FHBH 1ZGLA 5JIKA 2ZXAA 2HG5A 1JWMB 2EYSA 2OMXB 1QEWB 4HH8A 4JO4L 1M1SA 4U1HB 4LU5L 3VGEA 5A2KH 3I6LD 4I2XB 1JZDC 1O75A 3M17B 1ZHBB 3ASWA 2APXA 3CFBA 3GXTA 2WZAA 1L9RA 2FLBT 4TNFA 3SOBH 2XTJD 1HI6A 1QSFA 2LOEA 3F7LA 5A2CA 1UM4H 4WI6A 3B37A 4F3FB 4KO9A 1UWXK 4JLRB 4J1UA 4X6EB 4G7QB 4JFPB 4XOAA 2XQBL 3OWEA 2OMYA 3K6DA 4WW1A 3RNKB 4Y4HD 2P5WD 1MRCL 4XBGB 3SO3C 1Z5YD 1A0QH 2YEZB 3QUKA 1FO0L 3FQTA 5E1AB 2B14A 5EZOH 5ITBH 4XH2B 1T6VN 3WHXB 2IH3A 1XX9C 3QH3B 5L4FA 2CG9X 3L7EB 5F93C 4X7SL 4OV5A 1D6EA 4YDIH 4ELMA 3G08B 4S1RL 4PG9A 5TFSH 4LVOC 4V1DE 2HZHA 1QG3A 5EBWA 1NLBH 4X99B 2MIZA 1UQSA 3BWAA 4L5FH 5DLML 3QUMB 4XGZA 1KB9J 1GPOL 5FGCE 3SPGA 4HF5H 1MLCA 4IEFB 3UTTD 3ZVVA 5I30H 2VAAB 1RIUL 4LLQB 5CKGA 1MFDH 3SGEI 2GCYB 1HNGA 3ULSA 3EYOB 2NY4C 4XR8C 3T65B 2IEPA 3WFDL 4AVKA 1J8RA 5CZVL 2W1NA 3MRBA 3L1OH 2DEWX 1KCBA 4FMVA 3CNKA 4ZQKA 2QT6A 4JDVA 3VACA 2BP8A 3BP7A 2X4TA 1KLGB 2WK2A 3OG4B 3WXVH 3O41B 3SKMA 1V3KA 2D0HA 2VDMH 2KZKA 4FE9A 4ELKB 1K5NB 2V3DA 1MCBA 3B83A 3L3IA 3NSCA 2C3XA 5DLLA 4YVUA 1T6WA 4XP1L 3L5IA 2BIIA 3VRJA 5AL0A 3HC3L 4G8GB 4P59H 3ZK0A 1VB9A 2VXQA 5IVXE 3KDPB 1Q9LA 5BJTB 4KV5E 4DP4X 2LAGB 4KKRA 1P5VB 4I5BB 3TESA 1I7TA 1J5OH 1I3GL 1NCCL 3I02B 1HSBB 2FQGA 4OCMC 3HPJA 2V8LA 4MCZB 2V7NB 1LEKB 3MX0B 5FUZL 1JSYA 1BMWA 3D85D 1IAIL 2FJSA 4Q56A 3LXBA 1JF1B 4NQDB 1SQMA 4LIQH 3MV9E 5ALCL 3N1QC 3AGWA 2ADFH 2FL5A 4PJXF 3QNYA 3TIDB 1CVSC 2CM5A 4YHLH 4NSKA 2HFTA 4HJUA 5F7NC 3VB8A 4IU2B 1C5DA 2OTWB 3UTSB 1RK0B 2IQ9L 3ABMB 3MLXH 4UZGA 4PJAF 4XWOD 5J12B 1FA4A 3ZYOA 2EYTA 4D0DA 1YJDC 2W9DH 3C60D 1OLZA 3RWGA 1KIQB 3DK0A 3GHEH 1DQQA 4JL1A 3DGDA 4PJCE 1IEAB 2LU7A 3IGAA 2DWEA 2HTKD 4DGYL 3FONB 2DQHH 3VXMD 3JYBA 3SBQA 2W91A 4X80H 2Q6WA 5EO0A 2ZXBA 7FABH 1AYRA 2DQUH 2H0PA 2ICWA 2D7OA 4Y4FB 1YEFH 2N0KA 3DGCR 3P77A 4NI6A 3C5XA 2FZ3A 4PJGB 2DJUA 4N8UA 1AG6A 4Y1AE 1D7CA 2FX7H 2YJQA 4JAMA 4ZMTA 1V7ML 3ZMNA 2GT9B 3QR2A 3JWNC 4Z7NF 4PWKA 3V6ZA 3EOBB 3HI5H 3CIQA 2DQMA 3CFCL 4YBLB 1WZKA 3VMNA 2DQ6A 4P5TB 1PJWA 2Q7YB 1UJTA 2J1XA 3F7QA 2CGRH 4ZMPA 1YJDL 4NFCA 1RSFA 5AB9A 1N6QL 4P4KC 5IEKB 1KPVB 1BZ9B 2W38A 4B96A 2YQ2A 1QABA 2OKMA 2H47C 3ZTJG 1T1YA 2EIKB 2R69A 1T21A 1TCMA 4ONGH 4AG4L 5EC2A 1JNJA 3ULVH 2LU4A 2NX5E 5GIRB 1RULL 4LE8A 4BELD 4KNTA 5IB1B 4KXAA 4JFFD 3IYLW 3K6IA 4EUPH 5CN3A 2Y7LA 4O2EA 5TF1H 2YAOA 5FIEA 2BJML 4FFWC 3A22A 4LXFA 3L3DB 1DUYB 4MD5A 2K4AA 2Z1KA 1SLVA 3ATEA 2EP6A 2JKIS 1WWCA 4OD3H 2BW5A 1T7VA 3ABGA 3JTSB 5CF3A 3DYMA 3G6JA 3O45B 4JANA 2QSTA 2BMKA 5T5FH 2MNJB 5GGSY 5D1ZD 3AUWB 2DQIL 3O2WH 1S7QA 2J12B 3N1PC 4WLCA 5HHMD 3UIYA 4NAMA 1P5UC 3MRHB 5DMKA 4YX2L 1IFGA 4CBPA 3MNWB 1EGJL 2G9HB 4Z7VB 3ARBA 4J3TA 1FCGA 5E2WL 4U1NB 4G9FE 2FQFA 1KMGA 1FAKT 1NICA 1A8JH 2X3BA 3A0OA 3IM1A 3MBEC 4PB0L 4UBDC 3DXAD 1ZHKA 1AD0A 1AGBA 3SE3C 2EDKA 5JHAA 4AQ1A 4FNUA 3MXVH 1IAKA 1T2JA 4H20L 3U30C 2W60A 1XGQB 2BH0A 3LZNA 2F53E 4M61B 4PS3A 4ZSOE 2CR6A 2ZCLH 1RJZB 3LHPH 3LVTA 2AJYL 5KZCB 3ZKND 5BO0D 5CLWA 2XQYA 5KSBF 2Y06H 3BI9X 1IKNA 2C8NA 4W9FC 3KYMB 2PXYC 4YHMH 2H7WA 3QDGD 4MA1B 1P1ZA 4M6ML 2GJ6B 1ZLVH 2GTWA 4UTBA 1YNTA 4AJYV 1MFEL 5EEUA 5KVDH 4QRAA 1NEUA 2Z6FA 4X4XB 1PZ3A 5I23A 1CTOA 5GGUA 3F7PC 4KHTH 3GXDA 4B9IA 4I0KA 4NKDB 5D7JA 5F1IB 5FGSA 2YS4A 1WIUA 1IZJA 4JFEA 2X4OB 2PYEE 3PQYA 1I7UA 3L6FB 4PG2C 4ZTPH 2UXFA 1GAFL 2NYYC 1L3WA 2FBOJ 3CV5A 4Y5VA 3HZKA 4PJ7B 4YSPA 5AUMB 2PPEA 4DGVH 1S7TA 2EIDA 3STZA 3S4SG 4L8DB 3CIAA 5KVGE 2DMKA 2LU5A 1M53A 3RI5F 3HTLX 4NPJA 1UD5A 4PJ5D 4ZTOH 1ZPLA 3IBEA 3SBPA 3H9HA 3P30H 4HG4J 4KJQD 1MUJA 3O2VH 1VACA 2QPDB 2A83A 2AJ3B 4ETYA 2VM3A 2OTUA 5BV7C 3IDIA 5HHPA 2HRHA 2X4PA 3KVPA 2BO0A 4M7ZB 1R5WA 4LSSL 3MGTB 1T1XB 4OCRH 4P9ML 4MJ6B 1WBYB 3LRGA 4NQXA 3BDBA 5DJDA 1RJLA 4X7DC 3M1BA 4FQPA 2OJZL 2P7TA 3S36X 4WFGD 1SF5A 4XNZC 4DQOH 5AYQA 4KTGA 3RWHB 3IDMB 5DEFB 4GFXA 4KY1L 5JZ7C 4LP8A 2XFXA 1JBJA 1ZLSH 1NPJA 1K8IA 1J5DA 3CLFH 3HRZA 3BSHA 1OSZB 4JHBA 4CU8A 3P1VA 2XJLA 4O2CA 5L0QC 3TPUB 4XMKH 2IWGA 3P40A 2YMXL 5TGBB 2F9BT 4ZFOL 3I84A 3HJEA 3UZEC 3FCBA 3CFDB 3IETB 2WCSA 2LR4A 4R90H 3OJDB 3Q8EA 3CX2A 3DDFA 2E9BA 4JZNA 2DH3A 1M9SA 3QIWA 2Q8BH 4X5LA 1TEGA 3OMZA 4U1SA 4A7TA 5CSBA 1ORSB 5DZAA 3FB5A 5BV7L 2VUOA 5DUMH 3OL2A 3QQDB 4YR6A 1RZJC 3NSFA 1PNDA 2CMRL 2E75C 1Q4NX 3MRIA 3O6LH 3DV6A 2PLTA 4Z3EA 1LEGA 4BXVA 1PZDA 4Z3FA 4HKZA 1CFNB 2MCAA 4ZK8A 4Z5RB 3GRWH 3HFMH 3PXLA 4CN1A 2F54B 3LY6A 1NOLA 1BFVL 5E8EA 5AEAA 2O61B 1HQRB 4AGOA 1T80A 1E9OB 1RXLA 1EJOH 5TQ2H 2FWUA 2G2PA 3MHZA 3QULA 4OZIE 2VMCA 5A43C 4K3EL 1K2DB 1WCBB 1PX8A 3GSQA 2DQFB 4XP6L 4UF7C 2W0KA 4B7IA 1XZ0A 2DZEA 1IUZA 4ANVA 5C09B 4WJ5A 1CS6A 3J27A 4CGTA 5J56B 2FWOB 1TKWA 2J56A 3FW6A 1XF5A 2V9RA 3S34L 5KS9E 3S5LG 3N2JA 5JHDB 3AU0A 2IDQA 2CJSA 4OLXL 4NCC2 4I18A 5JPMB 3V7AG 1X6LA 3IE9A 3AS2A 2E47A 2PTTA 1W72B 3MYZA 3WDIA 4CU6A 3BEVA 3NH7H 1RZJL 4X5XB 4E41B 5IGXL 3LZPA 4I8DA 1KN4H 5GZOA 4NZDA 2BCMA 3QS2A 1OQOA 3A24A 5IJVA 4NGHH 3C6LA 4KITB 2UZYA 4IBZA 2P5EA 1N8ZA 1KIPA 4IM8A 4N9GA 4I85A 3WTVA 4UT7L 1R33A 4X6CF 2ZCKL 3GHPA 1GKOA 3KWXA 4HWBA 1HKLH 4KKBD 1HL5A 1ED3A 1QPPA 2BM3A 3QQ9D 4D8OA 1HCFX 2EECA 3M88A 4U4IA 2WZ5A 5A7BA 3G9VA 4UB0L 2A4CA 4TNVK 4MRBA 4GPVA 4APQC 4DOHE 7PCYA 1N0XL 3D06A 2WQ8A 3LQAC 3NJLA 3OKEB 4X4ZA 3BPNC 2VC2B 1YN7B 3ARGB 1V05A 2I32A 3VXTA 2YPVA 5E5UB 3WY4A 2D8KA 4WKZB 4OFIA 5E08H 1IM9A 4C56B 2UXVA 3GQFA 2GFBB 3QJVB 2VDMB 1GR7A 2Z31C 2I26N 4G8GD 4W4OC 4FA7B 1BAGA 3Q2VA 4IKNA 4KOCA 5TK2A 4MNHB 1IFHH 1RUQH 4KK9D 3QPXL 4RMWA 4LOEA 1NGYB 3L2LA 3VG0L 2BS8A 4L3EE 1CT8B 1E6JH 5GS1B 2GBVA 2ZYHA 3WEAA 4FKEA 4W93A 1MPAL 3NA9L 4NBYB 5HYSA 1E4XI 2WLIA 1A4KA 3IU3B 5EV7A 1GC1C 1ZPUA 2JI3A 3HNSL 4UTAA 4NO3A 3NYKA 3B5GA 2DY2A 1D5IL 5TDOA 4ODUA 1AGFA 1RPKA 2D7MA 2ITCB 8FABA 3OC5A 5IROA 3MSPA 4GG8A 1P4LA 3MUHL 1B88A 1SXSA 2VDKH 2DM4A 1UT9A 1T66C 1QBLH 4FZ8H 1YC8A 2I24N 4AM0Q 4URKA 5ID1A 2B1AL 1ZTXL 1JPTH 5IB2B 2NY4D 5L4IA 1A64A 1ZE3C 3LQAL 3UTSD 1U3YA 1AAJA 3FC8A 2IH9A 4PJ6A 3JXAA 5EBMA 3TYGL 2JLLA 2PR9A 4L1DA 4MQXC 1HEZB 4LLYB 3MR9A 1L3NA 4M1GL 3QORB 4GS7C 3ZW3A 3GNMH 4HK3N 4AEHL 1URZA 3QAQA 5H37H 1AO7E 2VDLH 4F2MA 3BT0A 5AWNH 1Q90A 3ARSA 5J1SC 5K1JA 3BZEB 3K91A 3QQ3B 2H32H 1LO5A 3QYCA 1EWHA 4Y4FD 4JFUA 3RIFF 5F7UA 2EC9U 3BN9D 1VFBA 5JXAL 2IDTA 1KYUA 4M7JL 4PV9A 5DDHA 5C0DA 4S1QL 1E4XL 1GC1L 3WO4C 4XBPB 1D5BA 1EH9A 1JZIA 1S6NA 5CEYB 3QFJE 4Y2OA 2V33A 1R3HB 1YEJH 4A2HA 5ADPL 2ICWJ 1EANA 1PAZA 1UXSB 4OCXL 2YC1B 3ZKSD 3EUDA 3QFDB 5EU6E 1MIEL 5I15L 3MRMB 1GGIL 4J8QA 3BZEA 1WT5A 5LBSH 5CFHA 3PHAA 5EEYA 2LLLA 3BFOA 3EDEA 4NAJA 1BSIA 1BVLA 4PJHA 4BK5A 2CHNA 2F7OA 3BUBA 4TVPL 5D1XC 2OYPA 5BCAA 4JPQA 1BZ7B 3CPLA 4IK6A 3GKWH 2AXFB 3QXAB 3CH1A 3Q5TA 1UJ3C 4BFJA 2UX6A 3PIQB 1YEEL 3WTWA 3V0WL 3NFNB 2V17L 1OP3H 3O4LB 1IM3B 1I1CA 5IJKC 4XRCB 4XB3A 2GW5A 3EG9B 2TSAA 4GMSL 3T0EC 1CXLA 2QGDA 4UT6A 5HVWA 3CZFB 2K1MA 2F7PA 3S48A 3UADA 4EUPB 2VZSA 3WSQH 5SWQA 1YECL 4X9FA 1U91B 3KPSB 3L5XH 3BQUB 5BUGA 1WS8A 1HZKA 3DI3B 2B9BA 2C5DC 4FQIL 1QA9B 2EDXA 1D7FA 1AYOA 3ZDZB 5D96B 2X1OA 1ZXKA 5JHLA 2VUYA 1BXAA 5AW1B 3SN6N 1HJBC 3DMMA 4FFYL 3MXWL 3UACA 1KZYA 2XU9A 4FQJH 2UXGA 2HT4C 2OMZB 4FFZL 3QDMA 4HJGB 1KBVA 4LPVA 5C0CE 5I1AA 4POYA 4IRSA 3NSXA 3H55A 3BRGC 3NJNA 1I4FB 2QQQA 4ZW5A 4CU7A 4JDTL 3P4NB 5CJXA 1NBYB 1SDDA 1IE5A 1JZEA 4EOWL 5FF6A 4PN6A 5DHVA 3FFCA 1KENH 4HUWB 4F7PA 1LLAA 1KSRA 3U6RA 5LG1A 1FLRH 4GQQA 1SXAA 3E6FB 5EUOA 4P4KD 1I9IH 3BW9A 4YHNB 4RSYA 2J5WA 4LGPB 2DQTL 4YNYA 2FEEL 2VMJA 1DBJH 1KGCD 4LB8A 2B5IB 1EAQA 3NTCL 5FYKH 4JY6A 3EH2A 1ACZA 4HJJL 5ACZA 1GHFH 1G7IB 1E8WA 3ARVA 4JFDD 4XE0A 1YZZA 2M1KA 35C8L 3INOA 3ZSSA 5I1KH 4F8LA 5IY5B 4HKXB 1MF2H 3FOMB 4QY8A 1ZLUH 3D08A 3DPBA 1J1XL 2AS5M 1NC2B 2QKIB 2EVHA 1FFNA 2XY2A 1E8ZA 1G1YA 4FQXA 3U0WH 1J1PH 5KJRL 4U0RB 3W9EA 1EVUA 4IHBA 5TQ0L 3ARFB 3B6SA 3FUJA 4RFOH 1D5XB 2VN7A 3V6OE 4AEIH 1EAPA 4HMCA 1T0NB 2BSSB 2PYFA 3QXDB 3ULAB 2OMUA 1Z0MA 2GUOB 1JHLL 2D3JA 3WGUB 4GBXC 3M1OA 4A2DA 4R3SA 1JNLH 2P48B 4YLBA 3LZOA 1UOVA 2WBWB 1MDTA 2Z7UA 1Q0XH 2YEQA 1DFBL 2IVFC 1DBML 4DIXA 5LXGL 1TQTA 1CLOH 3MV8D 3NZHL 4H8WH 1HHIB 2VLME 4LKCA 3PUUA 4LDCA 5B38A 3HOGA 4I3RH 4JGUA 4JS7A 4EMZA 3SE9L 7CGTA 4QRUB 4MWFB 4PHZA 1CG9A 3RVTD 2P24A 3MRFB 2CGYA 1CYWA 2RACA 2YSSB 3GSWA 5F3HB 4CVXA 5FPIA 3IJSB 4E68A 4Y9CA 5EDXA 1BVKA 1IE4A 4YSQA 1LO4L 4OJFL 1XH3A 1WITA 1Q1PA 4Y16B 2FX8L 1BM3L 1OE3A 5E99L 1ZA6B 5EA0L 4LGSB 5HGGS 3IMBA 2YJLA 4P3WA 1A7RH 4E9WA 3MJ8B 5C7XH 5JUEL 4X9YA 1U21A 3UO8B 1J1OL 3EOAA 2O93L 5JW5B 4E9LA 1IAIM 2XHNA 3NIDF 4PJDE 2A6DA 1H3PH 4QT5A 3TJEL 5A6MA 4WTZG 4KO6A 5EU5B 2UY6B 2F54D 3LKNB 4HFWA 4FI7A 2HKFH 4FKHA 5DQ9B 2VR6A 4DPCX 2BLFA 2FB4L 5DK2B 3DTUB 1EDHA 2WXLA 4JMXA 3THML 2HLFD 1AR2A 5LN4A 3BT2L 3RGVB 1OHZA 1ICTA 1DCEA 3N44F 4JMNA 4ONHB 1QFOA 5DT1L 5FXCH 1FRGH 3KLHD 4PD4K 5C09D 4EDWL 4NRYB 2H9GB 2AI0L 3VCLA 1N68A 5FYLL 2ICES 5IWLA 1XF2A 5MENE 1PY4A 3MRKA 5DHYB 4YSCA 4QRTA 4E5XA 3QSKB 5I75B 4WK0B 1N7ML 4OZHE 5DD0H 3ZYZA 3HS0B 4HPHA 2O5ZH 1FGVL 2NQCA 4E41D 5LAXA 2H1PL 2JCCF 2NQ3A 2WINA 3GUTB 2JIXB 3E6HA 3OSVA 2IF7A 3FQUB 4UV7H 2Q2LA 5KBLA 1DE4B 1JHTA 1LP9A 4HS6B 5HPMB 3ARRA 4PGDA 3T09A 4PLNC 5LWYH 3F65A 1MVUB 1HSAB 3SDXB 2R69H 2OSXA 4B9KC 1WFMA 1I1FA 3GK8L 5HBBA 1IAMA 4LVHB 1V5JA 3EJPA 1TQBC 2OA9A 3V4PL 3O0RH 5I76A 5I66A 3GB7A 3F01A 4UDUB 3WI9A 2R2HA 2A9NL 4FQHB 3CFTA 1F6FB 4M5YL 3DHUA 3AG3B 1BD2D 3BH8A 3IDGA 2Q8AH 4NO0D 3SJVE 1Z9OA 4OM0H 4YL4A 3L3GA 1FBIH 4HKBA 4B95C 5J6GB 5IUCA 4K5MA 1I9JL 1SLUA 2XZQL 4I1PA 1Q72H 2C9XA 4JO8A 5SWSB 4F9LC 3BUTA 1B3IA 3HZMA 3AXHA 1XGTB 3IU4H 3PV6B 5GGQH 5I9QB 4AZUA 4ELDA 5B7MA 2OMVA 4G5ZL 1XH0A 5KJ7E 2VQ4A 4OGYL 3O2DH 3CBRA 2VXTH 4GW4B 3ESPA 3VD5A 3KPRB 4KO5A 4FQLH 1PZ2A 1TJGL 4G5AA 3FMGH 2CRIA 1YEWA 3S4SA 3LKRA 3EO9H 4WHTB 3IAQA 2X4RA 3TJHD 2BSCA 2GJRA 3FTGB 3RTQC 2CKBL 4ES8A 1TU2B 3UERA 4YXHH 2FLRT 4ZXBA 1NC4A 1Z9SB 3RL2A 2D7QA 4AW4A 3KYNA 2IJ0C 4FCHA 2FBRA 2UWEF 2DYPA 3BSZA 4PJIE 5EU4A 4NHUB 1P9MA 4Y9BA 3V6BR 1ACCA 2EXSA 3G5VA 3PWPA 3V2AR 4Q6IC 1VADA 2Z4QB 5LGYA 4EI6B 1EEYA 2KQNA 3FT2A 4YHOH 4BUQA 3ZRCC 3B7YA 5D2NC 1SHWA 3SKUD 1SUHA 3OZLA 2VDNB 1R3IH 1KY6A 2G5RA 4Q8BA 2BINA 2VDKB 1GYCA 4UQBA 1OTSC 4KFMA 5D1QE 3QORD 2O1AA 1S9XB 4LU5H 3HAEH 3JTTA 3FUFA 2NNXA 2Q76A 1NAMA 5DS1A 1NFIB 1C9SA 3JQOB 2X70B 3RG1C 3T2LA 2IGFH 3D2UD 5IF0B 1AHKA 1QRKA 1XF3B 1UFUA 2VDLB 1GS7A 3T8XB 5FOJA 2B9AA 1CLYH 4LFHD 4Z7UF 4Y4KB 2AXJA 2Z31D 3OMNB 2XIDA 1IBDA 2KLTA 3FCSB 3ZE0B 2VLRA 2H32B 3LDBC 1V27A 3RVWC 1X5FA 2ED8A 2WPGA 4Y2DB 4BRJA 4F37F 1W80A 4PRIB 5E4AA 3MLSL 4A67A 3DIDA 4E42B 3H2WA 3VI4E 1JGVL 5FV1L 5C6WH 4MHHI 1NBZA 1RIVH 4H2CA 2ZP8A 1IC5L 1W91A 2E7DA 2W94A 1VGEH 3SDDB 5A3ID 1YVLA 2NUPB 5JR1L 1L9NA 2P3YA 1JXKA 4X7SH 3TBTB 3FDWA 2APBA 5T1LB 4LBEA 5KSAB 4OQTA 4ALAC 1KT2A 1V3JA 4TNWF 2EDFA 5IQ9A 1P7BA 4PGZA 5C08D 2JJVA 1AKJA 1IM3D 1T66D 2YGNA 3CVDA 3O4LD 3EFDL 4RGOL 5DLMH 5F2FA 3SPVB 4E9RA 1GPOH 4DSYA 4IRJA 5GS0C 4PEEA 1RIUH 1C16B 4TVPD 4AMKL 4LEEA 5DYOA 1GZHA 1NDMA 2X09A 1MXGA 4H8HA 5IB3B 1O9ZA 2B39A 4ABWA 4MLIA 1NINA 1PDKB 1RPQA 3S5LA 4DKFH 3K2MC 3CSYA 2MQ3A 1V7NL 4LQ1A 5CMAA 25C8H 3DARA 1IL1B 1P53A 1MNUL 3VYOA 2K3TA 3U0TA 4ZFZB 1ZGLB 5AOZA 1RH8A 1QNIA 1X5MA 2HG5B 1CFBA 4MRCA 2EYSB 2KC0A 2YEVB 4AE0A 5EEZA 2HFGL 2K6ZA 4M43L 3CDGA 4PJFA 2HFFA 1RP9A 2JQZA 2D7PA 2VLJE 3CN0A 1A5FH 3GFUA 3JWDH 3N41B 4GP4B 2YRPA 4U4BA 2W88A 2EEXA 3E8UL 2GI7A 4JM2C 4P04A 4UOJA 1PU0A 3BKJL 4XP1H 4FNTA 5ILTL 4UQ2B 4ALAL 5CXPA 3AQZA 2XPYA 1BYOA 3HC3H 3UEQA 4L1HA 3KXFE 4PGEA 4LPTA 4NQEA 4HIPA 2Y5TA 4J1UB 4P57A 1I8MB 2DEXX 1MCEA 4WW1B 4NERA 1NCAL 3B43A 5GS0L 2W80C 4K15A 5B4MD 4LP5A 5ITFB 1OP9A 1I3GH 1NCCH 2I7SA 5CINL 3B8YA 5GGTA 3OXSB 3SGEH 3QUKB 3TBWB 2NYZA 3VX0A 4X4YA 3FQTB 2PUQT 4KK6D 1DR9A 2Y24A 2YPLD 4J6IA 2IH3B 4W9KC 4Z7AA 2E4FA 2MCPL 3MLWH 2CH8A 3QHZH 1A6WL 3T0ED 4DK5A 5JW3H 3FAWA 4P2OB 4FXKC 1BBDH 5EBWB 3E8VA 1M1XA 1OT1A 2LVCA 5IHWA 1UQSB 3BWAB 4MXVF 3VTMA 1OAZL 1OAYL 4XGZB 4BIKA 1JFQH 1NZRA 1Q8MA 1YUHA 1NC2D 1IQDA 4WVRA 2JKLA 3ULSB 1PG7W 1TPXC 3P11H 5B3JE 2CZNA 3MODL 4DGYH 3ARFD 3MRBB 3NCEB 1J87A 5HYQA 4B0MB 3GI8H 4Q9RH 4ZQKB 4M03A 2HT4D 2XACC 3MOAL 5DC2A 3GPSA 2BP8B 3BP7B 5F97E 2AHIA 4FYSA 2MPAL 2X4TB 4UQCA 4AK1A 5DHMC 5JPNA 4QHKI 2VXVL 2VXQL 4I7ZC 3SKMB 1KEGL 1AS7A 4LEOB 3H9ZA 3SYQA 2VERA 1T0MA 1GZQA 1YPZF 3CWGA 3LMJL 1QLRA 1DBAL 4ZUUB 2A4ZA 3SBWC 3D4GA 3NIFB 3UJJL 3FPYA 1S7UA 3VRJB 4KJPC 4POZD 3L5JA 3W81A 1Y6KR 4H0LC 1OKEA 1IC7L 1Q9LB 2MKLC 4B60A 1YJDH 3ZDXB 1YMMA 1N6QH 5FLUA 4HWUA 1I7TB 2AERT 4TQ8A 1N64L 5AVWB 3SE8L 4RSVA 2EDDA 4OFYA 4Y16D 2HTLC 2UZPA 4BUHA 1RULH 1LHZA 1GCYA 2ENQA 4MDJA 1AE6L 3QWRA 4Z7WB 3GSNA 3BWSA 1CGVA 4P3DA 4FZEL 3VXUA 2DPKA 5AOLA 1SBSL 4XBEL 3QNYB 1NFDF 5T5NF 1BLIA 5E6IA 4NSKB 5AVQB 2XCMC 1C5DB 5DGQA 2DQIH 3WDJA 3P3SA 3V5HA 5KVGL 3RWGB 3PDGA 2JKNA 4B9PA 3UBFA 2HLEB 2RGSA 4YDJB 4DO5A 4P2RE 3US1A 2MPVA 4G8IA 1GS6X 4S10A 5E2WH 1DN0A 2H26B 4IOSD 4AJ0A 2V2TA 4X0KB 2OSLA 4IKIA 5HGAA 1AQHA 4UQIM 2GHZA 3PNWA 2SEBA 1AP2A 1C8QA 5EO0B 2WP3T 5ABDE 3N91A 5D7LE 1EZUA 4CSPA 4IBVA 2ICWB 3ARBC 4ZFQA 4EO5A 2WUCL 3MJ9L 5AVUB 2ZUQB 2AJYH 3VQ2C 3P77B 3GZPA 5DRNA 2RCSH 5DA4A 4XHJD 2ICEA 5BXFA 3D4CA 4AQ1C 3JWOC 4MX7B 4K8RH 4JAMB 1FSKB 3ZE1F 1KY7A 2BSTB 3HUJF 4M6MH 4NNXA 1I8IA 1G9NC 3V6ZB 5FYLD 4GKSA 5HP5A 5F0PB 3MUY1 4A6YA 5LLIC 4E2OA 3MBWA 3WE6B 3LIZL 5L4MA 2IDCA 2WV3A 1IVTA 3ZR5A 4UMSA 2E76C 3NRQA 3H9SA 3L1FA 4V1DA 1QHPA 1VCAA 4NEHB 1SJMA 5EB9A 4GAAA 5JORB 5KUKA 1JRHI 1V54B 1SJHA 1CICA 3CVIL 1T1YB 2GTZA 3SD5A 1T21B 1JZGA 1GAFH 4NQCD 5EC2B 3PGFH 4OGZA 1KCKA 1QI3A 4U3SA 3EJSA 1NEZG 1RKRA 5CCGE 3T4YA 3R8QA 1WAAF 1RK1A 3WFBL 3RWEB 2ZQKA 3VVVA 2NNAB 3HMXA 4Y5VC 3BP5B 5TK4A 5SWSD 3EH4B 9PCYA 1BXUA 5J11C 4Z23A 1FORL 3G6JB 2BMKB 1S8DA 4RNRA 3JWOL 3KJ6L 3ZRSA 5B8CA 4PLKD 5JXED 2WBJB 1RZFL 3X1EA 1AQMA 5DMKB 1G9NL 1SEQH 2VZ3A 3CFUA 4Y19E 4Z0XB 1KXTA 3WO3B 1M56B 2A7BA 3UDWC 5JYMA 4XAKE 1ZHKB 4MA3A 2V4LA 5E4IA 1DJXA 4AYMC 5T33L 4WGVB 3NUKA 4GRWB 2W60B 2VDQH 1OB0A 1JRHL 1ROCA 3BH9A 3GMOA 4WEBL 4CN6A 4Q4EA 3BP4B 1SMDA 3BMWA 4U6VL 4MA8H 2Z7WA 1WO2A 2JI1A 3RDTC 4CN4A 1KYFA 1UCBL 2WLNA 3VM7A 4D0CB 1P1ZB 2F18A 1DANT 3HMWL 3TZVC 4QTHA 2PMZA 3VNZA 4FD0A 3MV9A 5CLYA 3REVA 3A6BH 4CRPA 5D7JB 4IQHA 4JFEB 4QXWA 5DK3A 3PQYB 3IDJA 2PN5A 3NP4A 2OYMA 1I7UB 3SY0A 4CC4A 1HHHA 2XN9A 5JDJA 3QJHA 4RDBA 4XNUL 4XVJL 3L48A 2QSCL 5EPMB 3KWUA 3ZO9A 3QZBA 4HJEA 2JWYA 1S7TB 1QPXA 4L4VE 1HL8A 4PJCA 3VYNA 3HAEB 3STZB 1HIML 5CSZB 3FT1A 5INDA 3S37H 1AZCA 5CCHE 3LKOB 4Y4KD 3H4FA 4G6KH 4JZJC 5J0BA 4M6OH 1Y18B 1E5YA 3H9HB 2W65A 4NB7A 4PMFA 2B7DT 4FLRA 2XV6B 1GMIA 1MUJB 4K3EH 4ZUVA 4A7GF 1QLFA 4XP6H 1C12A 4Y2DD 1VACB 2JB6A 2A83B 3MYJA 4WF7A 4HV8A 4PRID 2VIRA 2OTUB 3B2UC 3IDIB 4LLAA 3PJLA 4QRQA 1R5WB 3LXCA 2VXSH 2YUXA 3S6CA 2ILLA 4N90D 4Y1AA 3E2HB 4IIQC 1XGYL 4NQXB 2R23A 3V0GA 5DJDB 4WTZA 3M1BB 1CBVL 4MA7H 4Z8FH 4OLXH 1HL9A 4M9OA 3HC4L 1FVDA 3RJQB 4AXWB 1GJUA 3UROR 5T1LD 2W0PA 4LL4A 4PW4A 1EFXB 5KSAD 1UT1A 4EI0A 2XFXB 1EHXA 1RZJH 2EEBA 1K8IB 1UKTA 2GQHA 5IGXH 3BGFC 1D9KC 4WGKA 2VZUA 3QPKA 2Y0SA 2YD3A 3FSOA 3HRZB 3T6WA 3VFMB 4I18C 2FRGP 3HLAA 4H88L 4O2CB 4R97B 3CHQA 4DNLA 3NPSB 1TTUA 3NCFB 3VMPA 4R7NA 5ABZA 4N8CL 2NOYA 2OV0A 4JO5A 3PAVA 5GZOC 4UT7H 1IKOP 4NQTA 3QIWB 3V0FA 1PG7H 4BFKA 4M3KB 1HVXA 4BZ1L 4HISA 3RHWK 3LVEA 4UB0H 3F6IA 2ZAHA 3N40F 1SHMA 3MRLA 4YR6B 1FZOA 1UTDA 1N0XH 3MDJA 4N5UA 3DRQA 4D9RE 1D3CA 2BVYA 3HB3B 4HIQA 2CKNA 2AK1L 3GBNL 4HKZB 1OLLA 3ZTJH 1BPLB 2EDEA 3ARZA 1UWXH 4Z7IA 1LQBC 5E8EB 4ANUA 3EJCA 4A04A 1QSFD 3H1ZA 4OUUB 3OKKA 1A6PA 4PBWD 2Y6TE 5FUOL 1G9MC 3M46A 5K39A 4DVRL 3BVXA 3QULB 3I9PA 1MCLA 3QPXH 1JXFA 3VG0H 3GSQB 4NN7C 3EH1A 4EI5A 2OP4L 1Z9NA 1U3HA 2HLAA 5KW9L 3COOA 1MPAH 4WJ5B 1UZGA 3REWA 3QNZB 4HJ0C 1CWVA 1DVFA 2X2IA 1TKWB 2PPAA 5CUSH 1XF5B 3U4KA 2FIKA 3Q43A 1GCFA 2Y3NA 1D5IH 2GJZA 3MCKA 5DFTA 2VLKE 1MQKH 3CFQA 3H7BA 4NT6A 1IO4C 1LNUB 5GS0D 2VN4A 1INEH 2DF3A 4NRXA 2PTTB 2H6PA 3BEVB 4K3JL 5GRYA 4BZYA 3TFKC 3PF2A 1ZTXH 4WFED 5F7FA 2XXFA 2DM3A 3LQAH 1KUMA 4W1TA 4R7VA 1KXHA 4B5EA 1R5VB 5IJVB 3T3MB 3FUHA 3LPWA 3TYGH 1X4ZA 5CEZE 3C6LB 5HHXH 5IMMB 1F11B 2UZYB 4M3JA 1N8ZB 1CYXA 1DVYA 1KIPB 2PF6A 4M1GH 4N9GB 5D9SA 3ZDYF 5CGMA 1P4BL 1P7QB 2VXUL 4AEHH 4RMRA 4UM9B 2J8UA 4GKNB 1G9ML 3KPOB 4F27A 1B2WL 3CQFA 3RKDC 4DP0X 2IBZX 2YPVL 5FK9A 3F00A 2ENPA 3HRPA 1EZVX 4XXCA 5D5MA 5H35A 2AJUL 2HA1A 3Q1SL 4WFHE 2K6WA 3Q2LA 4MVBC 3VGBA 5JXAH 4JUSA 3MA9L 1DQKA 1UVQA 2VMEA 4BH7A 1E4XH 4NDMA 4JB9L 3NQKA 3T1FB 1JDCA 1DQLL 1EVTC 4F20A 2OL3A 5T1DL 1JZ2A 3QUZC 5BVPH 4JPVH 4WENB 3VXTB 2D03L 3LZRA 1XB3A 2CXKA 4HHGA 3C5ZA 3OZKA 1IM9B 5ADPH 3N0PB 4PCYA 4HOXA 4MD0A 2OX5B 2YUVA 5H8DA 4L29A 4L9LA 4XO9A 4EKJA 4I1RA 5J9PA 1ZE3H 2CGZA 1QTPA 1IQWL 4TV3A 5IBUG 5EIVA 1QUPA 2C3VA 2ICCA 3QO0A 3X13B 3WNMA 3RE0A 3QHFH 1WT5C 5HYSB 1YEEH 2CBMA 3V0WH 2WLIB 1A4KB 4M7KL 3V8OA 4AC4A 4NO3B 2IFFL 2NY2C 1DQTA 1FZJA 5EIIG 4AGPA 4KNQA 1AGFB 3EXLA 2MNWA 1BXXA 1OV8A 8FABB 2RH0A 2F58L 1F90L 3S88H 2PR4H 1P4LB 4GG8B 3Q3GA 5L6YH 1YECH 5T1MA 4PGJA 1AZRA 3VG9C 2IIJA 1DJIA 4N0YH 1RZ8B 3DOSA 4JKLA 4ZAKA 5FW6A 3M6DA 1EO5A 4FQIH 4WUUD 5ABAA 1VESA 2ADYA 2F5AH 3R19A 5DC0A 3QRGL 3QZMA 3O4OB 2ZX7A 1TUPA 4A68A 3LCYA 4FFYH 1Y1DA 4GI9A 4NYLA 2P8LB 3OKLA 3MXWH 4QXUL 5G55A 2YXMA 4RA0C 2YAMA 3BXNA 4PW3A 4XODA 3ECVA 3ETBJ 1XCWA 3UBXA 1ZV2A 4G1MB 3LH8A 2NR6A 1II4E 4FFZH 2BRQA 1DVTA 5JIQA 4E9YA 4R96A 2YQ3A 5HDLA 4OZIA 2WMPA 3QVAA 3W38A 5I18L 3T9WA 2G60L 1LO5B 4WK2B 1HAUA 4KNUA 1FFOB 1ZANL 4RMUA 4JDTH 4JCMA 5DDHB 5C0DB 1UKSA 3FN0L 4KJPD 1D5BB 4EOWH 4N2KA 1KG0A 4IRSC 1LDPL 4KKCC 5KS9A 4Y2OB 3L81A 2FO1A 2OR9H 2DWYA 3UABA 1CC3A 4B53A 3IJHB 5I8OL 5C0BE 3FK3A 5CU5A 4AK2A 2ZSWA 4U3XA 1RZ7L 2HTLD 2ZX8A 3GM8A 4WTXA 4ZX5A 1BVLB 3ZJAA 3AW5A 2FIRT 2JE8A 2X41A 2FWSA 3FQ1A 4TXVB 1N70A 4XT1C 3JVFC 4I9WD 3TGXA 5B3NA 35C8H 5IVNA 3H6AA 3CPLB 3NN8A 4M93B 3VXPA 4UQDA 1EXHA 3Q05A 4OZGF 1UGNA 1S3KL 4G80A 4NQSA 1LE5A 2WXPA 2PP9A 1A9BA 2YAHA 1EERB 3Q8BA 1A1NA 2V37A 4I87A 2GIMA 2QZ5A 4BE5A 4P2QB 4BD4A 3TT3L 4DWHA 1WV7T 1ZGLM 1MHHA 4GQRA 1YRKA 5SWQB 4ZOEA 4PRHE 5J3HC 3TH4T 2AEWA 3CMGA 2C7UA 4ZOAA 5IMLA 3I9GL 1CDYA 4JE4B 4X8JA 1DQVA 4KGLA 2A4EA 2QVFB 1CGSL 2KQMA 3IKCA 5JHBA 1JHLH 4MDIA 4WDIA 5EO9A 5LDUA 3DMMB 5ENWA 3ARBD 1N5AA 4FTVE 4MMXB 1BX2B 4GRLB 2OW6A 4LIQE 3PHOB 2F1AA 3QZLA 5MEQA 2AK4E 3LZQA 2FYYA 3DX6A 1J8HE 1DFBH 1HWGB 1DBMH 5I1AB 5B1JC 1QP1A 1TOXA 2J44A 4JJOA 5FKAA 1ETZA 2EC8A 4JE0A 4KNSA 3I85A 1FL3A 2FR4A 2H1LM 2J72A 2PTVA 3MOQA 4PJXE 1UZ8A 1SDDB 5IJBC 3CHOA 2VDQB 1IBYA 1JGEA 5DHVB 1OAUL 2Y7SA 3FFCB 4OZFG 5FF6B 5LXVA 3KM2A 3U6RB 4PJAE 4XHQA 5F88A 2KKQA 5EUOB 3S7GA 1ETJA 1LO4H 4OJFH 4KJWC 2Q10A 4Z3TA 4FG2A 3H3PL 4BCXA 4YNYB 4NOBA 2FX8H 3LEYL 1BM3H 3VFTA 4Z0BL 4YHZL 4JRYE 3ARQA 1RHHA 4JPWH 2V3EA 3DVNA 4JY6B 3S8FB 3N9GL 4TNEA 1E8XA 4F93B 5D7JD 3HVNA 5JUEH 1CFTA 4XAWL 1J1OH 3PQYD 5FGBA 1BYNA 1TZOA 1IJNA 1FH5L 15C8L 2E7BA 2WVSA 2EH7L 5EN2A 3TJEH 4P99A 3UCQA 3US9A 3S8WA 4AM0A 1QHQA 4IDJH 1YDPA 2J71A 5M94B 4BFIA 1PFOA 2O30A 3RWIA 2KDYA 4H8VA 4QY8B 1DVUA 4JHVA 3HZVB 2FB4H 1AO7A 4M6NH 2FH6A 3DV4A 3DPBB 4B0MM 3GLEA 1FFNB 5KYYA 1T1WB 1VENA 5K9QG 4FQXB 1OO2A 5AVSB 3ZU8A 3VD3A 1AZVA 4Z7NE 5FO9A 2WKOA 2Y69B 1E42A 5DT1H 4YDZA 2BNQE 4K5NA 3B6SB 3Q6FA 3ZT5A 2AI0H 4YO0A 1NCHA 1MHEA 2E3VA 4G72B 1TQUA 1R17A 2MCG1 2OMUB 3IDXL 4NUGL 5D4QA 3BZ5A 3UZVA 5SWZA 4UOW1 3K8LA 1N7MH 2BCKB 3WNOA 1K4CA 4D9LL 2X4NA 2XRAH 5C3LD 1R3JA 2X88A 5EU6A 3RIAF 4F8TA 2PCXA 1WBXA 5KYUB 3H42H 2H1PH 3NESA 3DX7A 3OTTA 5CBEA 1WUNT 4Z7OF 4QXGL 2FSEB 4LKCB 3N85H 3TXAA 4B9JA 4CSTA 4N2FA 4PY7A 1NWPA 4CVZA 1ZA3A 2AGJL 3APFA 2VW6A 3DDGA 2Z9TA 4QOKB 1CG9B 2IAMA 4QWWD 3O6FC 2P24B 1PZAA 4CVXB 1MVYA 3GSWB 2JK5B 4XCNA 1BIIA 3ZX1A 1BVKB 3V4PH 4JBSA 1XH3B 5HYJA 2H45A 4IBTA 5HVHC 4AENA 5BQ7A 2IH1A 2A9NH 3V4LA 1QQDA 1CDBA 3VXRE 2QQNL 1M4KA 3DUSB 3GMRA 3TYFA 3ZN6A 2C4XA 3EOAB 3KLLA 3TCLA 3ZE2F 3VU1A 4LL1A 1I9JH 2XZQH 1I7ZA 4QT5B 4JHWL 3GIVB 2Y25A 1WZ1H 2WTRA 4HEPG 4AVJA 2VNCA 5KSBE 3SODB 5IW6A 5IMOA 2DB8A 2XKNB 2QTVA 3OAUL 5IBTL 3BIAX 3LIUA 4FKKA 1PZCA 3L9BA 3VFPA 2XKUA 2X4UA 3BGMA 5C0CA 4TQHA 5SX5K 1TJGH 4MLSA 4MMZC 2F1EA 1JJUA 3T4AC 1NEZA 2E46A 3MLRL 1KIRA 4MQTB 5BMFH 1RP8A 5K5YA 4RWHA 5D7IF 4WW2C 2CKBH 4BQ8A 1WWWX 3WYRA 4NUMA 3HNVL 3P73A 1AIFB 1JWUA 4YN3A 1XF2B 5I0YA 4JHAL 2FE0A 3MRKB 4K7PL 4XOCA 1ZT7A 3CXHJ 1ZEAL 4QF1A 4YWGH 5C0EA 3LRSA 4I0PC 3WUWG 1WWAX 3GMQA 3O6ML 3P9MA 5FW7A 5JO5B 5A6LA 3UJTL 4JCWA 5F1NB 4MYPA 3MU3A 4O2FA 3ZTNH 1BYPA 4N8VG 1F2QA 3TN0C 5I1GH 2BOBB 3EJYC 4O5LH 1PSKL 4QAWA 3E6HB 1Z3RA 5GZOD 5F89A 4N3UA 3PG2A 4ILDA 4W6WB 3QG7L 3Q2CA 1JHTB 4PGDB 4XX5A 1DQJA 4HWZA 1P9MC 2Y1AA 3C6LD 4FG0A 2FEDC 2OI9B 3FUKA 3TEXA 3VSQA 2P5ED 1MIML 1SFDA 5E9NA 5FYJD 5IREA 1I1FB 4FQ2L 5DURB 4O9HH 4N2GA 3RL1A 3X3GH 1BZQK 4WQOA 1A8ZA 1IJ9A 3RFZA 2CJUL 1ZT4A 1A21A 4W9IC 4M3HA 5D6CA 2FECI 4XMWA 2XZZA 5EFIA 1U6AH 1WA1X 2R2HB 2TAAA 3CMOH 4EBQH 1S78D 3C5SA 2JCWA 3IDGB 5BS0A 3GC3A 2LU3A 5FR3A 1ULVA 3L3GB 4HKBB 5I17A 4ISVA 4UINL 3V6OA 4DPBX 5ICXA 3KYAA 3D3VE 2J1KA 1QI5A 4Z3IA 3FQRA 1NIBA 3P9WB 3VQ1C 1B4JL 4K71B 3MLSH 4K9JA 2Y22A 2VZTA 1IM9D 4QRPB 4PS4H 2JKTM 3ARTA 4Q14A 4YEFA 2OMVB 1FG9C 3FQ2A 4G7VH 4KVNL 2HMIC 3F62A 1WFTA 4HJ0D 1FGNL 4NN6B 3EOYG 1ADQH 1IVLA 1RUPL 5I73B 4EZLA 4AVIA 2VJ0A 1MAML 1E0OB 3IXAA 4S2SA 2V2WA 4ABUA 2EDBA 2WD0A 3RUGA 3TBYB 1NUDA 2B0SH 3S4SB 3LKRB 3TP4A 1JN6A 3WKYA 3T6QC 1KLUB 2X4RB 1MCPL 1XCQB 2V6HA 1U93B 3OKDB 4J3OC 4C55A 4Q89A 4ZXBB 1NC4B 4OLEA 4RGOH 4U1LA 1EJFA 1AGEA 2DYPB 1H3GA 1DDHA 3CDYA 5EU4B 3N1GC 4JDEA 4AMKH 5IROD 5L8LB 1AR1C 3NCJL 5AFAA 3PWPB 4BFGA 1EEYB 3I6SA 3FT2B 2Y7QA 3OLIA 4FFVD 3TPKA 1V7NH 5K9QI 3FH5A 2R39A 5FLVA 3OR6A 4JG5A 5DO2C 1MNUH 4Z78A 1FP5A 5I6NA 3TO2A 4X7EC 1XL6A 1F3DJ 5EH1A 4YUEL 1O9WA 1J18A 3ZZ1A 3JTTB 1DQIA 2WSKA 3R06A 1T7XA 4DUVA 1NAMB 3VFSA 1Q94A 1FNGA 1JD7A 4YPGA 4KX9A 1XD0A 2WNKA 4MASA 2O6PA 2NDFA 3BKJH 2FUQA 1R5IB 4FNSA 5LGHL 5C0AA 4ALAH 4ELMF 3AG2B 3DVFA 4PWGA 2PP8A 4OLYL 1CTMA 3TF7C 4UOW0 1JVLA 4XE5B 1U8PA 4HWNA 1KBKA 4UNUA 2EXTA 2R2BB 3B9KA 1THCA 3BISA 4RMTA 2VLRB 1WYJA 3CSFA 5FHAH 3VFUA 5JQIB 2YXFA 3FTXA 5MENA 5GISH 4O51B 4Y7OC 1YEDA 3FB6A 2HP4A 3CN4A 3DYOA 4EN3B 5CINH 2YA0A 2ZXEB 1AXSA 3NIGB 4RFEA 5KTEL 1NBZB 4XN7A 4JDZA 4Y88A 3DRTA 1PX3A 4ZJ9A 3HBPA 2YQGA 5EORH 5CJBA 3VXSA 1BA9A 1EDYA 2NY2D 3U0PB 4X6CE 1A6WH 4Q0XH 4LBEB 5AOKA 3A4EA 3ABZA 4XTRD 5IQ9B 1A4JA 1IX2A 1N2RA 3BWZA 5F8RC 2JTYA 1AKJB 2M26A 2WQVA 1N59A 3BAKA 1TMCB 1E6OH 3Q6GH 1KCLA 4IRJB 5ISZB 1ANUA 2EDTA 4PPTA 2X1PA 4MQ7A 3F12B 4NXKA 2AITA 1BF5A 1SMAA 1XGUA 2WXKA 1HL4A 2XZAH 3GTTA 5DD1L 3NIFF 4HIHB 4JQIA 4BINA 3MODH 2PETA 3S5LB 3SJVA 1H0DA 4IU3A 4EIBA 4LPXA 3DURA 4XNYL 1ZS8B 4C8XA 5IR1B 3MOAH 4KK8D 4KTEL 1GOGA 4DKAA 3PHSA 3EBIA 2CJ3A 5KSUA 4NKMA 3U0TB 4AQZA 4C4KO 3CZNA 2MPAH 3IJ8A 2XXMB 1MJUH 1NMAH 5AZ2L 2R2EA 4HXAL 5AOMA 1A6TB 2VXVH 3ZMEA 1KEGH 5TPWL 3CDGB 3MV7B 2HFFB 1E5ZA 2PO6B 1Y0LA 2X3AA 4F7KA 4PY8I 3NVQA 3QDMD 1UD6A 4FXGA 1BVNT 3D25A 3QAZC 4HIJA 4NWTL 4G6AC 3LMJH 4UM8B 5GJSL 4IRSD 4LSTL 3O6KL 4KKCD 4GG6F 1KELL 1CLCA 2AQSA 2BSBA 4KKPA 5HDBF 4LCWA 4U6HA 1TO4A 3D34A 2XTJE 2EQDA 4PGEB 5D8JL 2A73B 2ESVE 2E9WA 3B7RL 4NQEB 2Y5TB 4HEME 1KF9B 3FFCD 5IQLA 3K74B 5D4HA 4HOMA 2R1XA 2ZUXA 3EYQD 4HULB 1N64H 3SE8H 3F85A 3RDJA 4KJYB 2P5WE 4CKQA 1EMTH 4XN1A 5LQBH 3N3EA 4QRSA 4ES9A 4LL9A 1WE5A 4ZODA 2ERJB 3LN9A 2Q7NA 1SBSH 3L4VA 3BKYL 4PJEB 4XBEH 5E8NA 5AAWA 3WJJC 4BFRA 4HAFA 1YEGH 4KVPA 5F7KC 1M1XB 4J3UA 5D1QA 3NT0A 4PGCB 5E1IA 1LK2A 3QWOA 3X11A 2OMWA 5J3HD 4CVUA 5I6XB 1NGQH 2WO4A 2ORBL 4JFYB 4DW2L 5KVGH 4GBXB 1IQDB 2IBBA 1IEBA 2J73A 3T77A 3ZQXA 3OB0K 4LCCA 4FQXD 2B59A 2VDPB 2P9RA 2H8PA 3B4NA 3KL5A 3KVQA 5J57B 1IC4H 3DTDA 5C0IA 3ZLQC 3DSNA 3UZQA 4R26H 1PLCA 2DJ4A 5EIIA 3Q01A 1KJ2L 4N5ED 3GUFA 1TJHH 4N2OA 1EBPA 5I0XA 2WUBL 1JGLH 3MJ9H 2D7TH 4YDKL 3CLWA 2FHCA 4GOSA 3VWKC 5IBLD 5KG9B 5JPNB 3RNQA 3L45A 4EN2A 3VI4A 3GJFA 3GTNA 2X05A 4QJ3B 2C1OA 5J1TC 1AOZA 4XN5A 5ESAA 4XVTL 1T0MB 4N2LA 4TSAH 1QLRB 5AENA 5DZPA 3BGAA 2G3NA 4ETQA 1KCSH 1S7UB 3EAKA 1XDTT 4KJWD 5DI8A 2K45A 1KCRL 2BNRE 2X9XA 5DFVC 3HLKA 1VZHA 3K2UH 1YMMB 2D7NA 3RZWA 3CVIH 1M2VB 2VCOA 3K46A 1FYTB 5HVFB 1V3LA 4WO4C 4RFNC 4IIZA 5JIHA 4JO3H 3GSNB 1DTUA 1E5UI 1SVZA 3BFWA 4P3DB 5CJOL 5FDWB 1CICC 5D6DA 1WD9A 1EIBA 4BBWA 1D5ZA 1BG9A 3BQVA 3MNVB 2HX9A 3FQWA 2K6YA 5MI0C 2IANE 1KACB 2QV4A 5ESQA 5E6IB 3B5HA 2W0FB 3C2AL 1FORH 1P0SE 5L2JA 1IGIL 2ZP0T 3P0GB 4Z95H