2P52A

Mouse p53 dna-binding domain in zinc-free oxidized state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mouse p53 core domain in zinc-free state.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2p52A00
3VD2A 4L0ZA 3KZ8A 4IBSA 5G4MA 3QYNA 3WU1A 4IBVA 4L0YA 4L18A 2BIMA 2BINA 3WTWA 1LJMA 4LOEA 4LOFA 4IBZA 5BUAA 2BIOA 2BIPA 1HU8A 1TUPA 4AGLA 2GEQA 2OCJA 3IGLA 3IGKA 3KMDA 2J6WA 2X0WA 2WGXA 4IJTA 4XR8C 2MEJB 2XWCA 2AHIA 3WTXA 5LAPA 5AOIA 2J1ZA 4KVPA 2IOMA 3EXLA 4QO1B 4GUOA 1E50A 2IOOA 5AOJA 1TSRA 3US0A 1H9DA 5G4NA 5ECGA 5AOKA 3D06A 4IBYA 2VUKA 4AGPA 2J1YA 2X0VA 2YBGA 1EAQA 4AGOA 1GZHA 2P52A 4A63A 3Q06A 3WTVA 3WTTA 4G83A 3VD0A 3QYMA 1CMOA 4MZIA 4AGMA 2AC0A 2J1XA 3D08A 1CO1A 1UOLA 3Q01A 2RMNA 4IBUA 5ABAA 1HJBC 3WTYA 3ZMEA 3VD1A 2J1WA 2J21A 5AB9A 2ATAA 2PCXA 1KZYA 1YCSA 3EXJA 4MZRA 4IBQA 2IOIA 3D0AA 1T4WA 4IBWA 5LGYA 1GZHC 4LO9A 3Q05A 1HJCA 2J20A 5KBDA 5AOLA 2ADYA 1EAOA 4AGQA 3WTUA 3TS8A 5A7BA 2BIQA 4IBTA 4G82A 2XWRA 3WTSA 4GUQA 2FEJA 3D05A 5G4OA 3D09A 3US1A 2H1LM 1IO4C 4AGNA 5AOMA 1EANA 3D07A 2X0UA 4HJEA
chains in the Genus database with same CATH superfamily
4LPXA 3RNQA 4CN1A 5K9QI 2EVFA 4F1SA 1W0WB 3UCQA 3V4UL 4S2SB 1T1ZA 2YEVB 3R0NA 5DEJA 2Q10A 3AC0A 3G5ZB 3GGWA 4YAQB 2ZIDA 2H32H 2VISB 3PJSB 2I60H 4D0DA 3EO9H 5FO9B 3VCLA 2XIDA 4KRMB 4G8GE 1E9OB 2WWMD 4LBEB 2BVQA 3IJ7A 2C8NA 2CDGB 5DT1H 2ESVD 4JLRB 5TDPA 2J73A 4MAYD 5E2TH 1U3HC 1NAMB 4ZMOA 4HSAC 1MFDH 2P7TA 1TU2B 3DSNB 4PRIE 3D30A 4F33B 3VFPA 2YA1A 2Y23A 4PY7B 1D5BB 1M53A 1WC7A 3LVTA 4BEIA 1EIBA 4LZKA 2IG2L 4R97C 1S3KH 1TTRA 2L7QA 3C6LA 5JHDB 1WQVT 3JTBA 2XFXA 2JLLA 5HJDA 2XICA 1I7UA 1HI6A 3F7LA 3H42H 2N1KA 5TE6H 3I3BA 4N0YL 4NPYA 4PGCA 2D3NA 2ZONA 2DM2A 4FFVD 2YLHA 1DN0A 3HNVH 5JDSB 5JNYA 5F7DA 5F0LB 3LN5B 4U2YA 2C34A 4ISVA 3WL9B 7FABH 1F90L 2MTAA 1XH1A 5E4EC 1NEPA 1X6NA 4NI3A 1YMME 3BEVB 2PWFA 2XHNA 3FTSA 2AEWA 3QUKB 2BNQE 4FLHA 1L4IA 1QFHA 2GTQA 4I5BB 4YFLI 3UAAA 4D8OA 4EOWL 3T2NL 1KB3A 2R2HB 3CC1A 1QUPA 2XKUA 3MXVL 3X14A 3BQUC 1RJYA 4F91B 1A6TB 1ZSDA 1M7XA 1SYVB 3QUYD 2DQFB 3APDA 4XO3A 3SBWC 3R7QA 4JQIL 5FUCC 1Z5LA 4N8UA 2W9EL 3I6LE 2VLRA 2NY6D 1C5CH 2KERA 4MNGA 3MNMA 5AOZA 1WIOA 4V2BA 3O3EA 2YGQA 1EGJH 4D3CL 2IH3A 4GQPH 5JPNC 3FB5B 5GJTL 3ZE1E 4M7LT 2H3NB 2AJXH 1SVZA 1JGEA 2QADD 1U42A 5IVOA 2QVFB 2IV8A 3D50A 3Q5YA 3GSUA 4JE4B 4UYPA 3LRSA 5JXAL 2CKBL 5HYEA 2WLJA 5IY5B 5AWNH 3MZGB 4IBTA 2IWEA 3K2UL 2OW6A 5H35A 2HFFB 2QQLH 2BJML 4R4FH 2H1LM 1IJ9A 2CXKA 5CN3A 5CO1A 1EPFA 3VI3B 3FAWA 2NXYD 4OY9A 3DVIA 4MAZA 1I9EA 2CHNA 5FCSH 4EIZC 4XHJC 1VZHA 4QY8B 2X4QB 2EEXA 1GYVA 1AD9A 2E74C 3DHPA 3HMXL 3KHQA 3C2AL 4HIQA 3U1SH 2YN3A 1KENH 4HS8H 1DFBH 1NGPL 4IQHA 1MQKH 1H0DB 3BO8B 3UTPE 5IR1A 2BFVL 1F2QA 5E2UL 3G5XA 3FRPG 2VXQH 1BZ9B 3MGAA 2BS8A 4GRLC 4N5EC 4UILL 5E1AB 5E8NA 4ZXBC 3PP4H 2FB4H 2KLSA 2VW4A 4K9JA 2X9YA 5E4EB 3GMRB 4H8VA 3U25A 3K6NA 3CSTA 5F7AA 4MD0B 1WF5A 1CICC 3MRFB 5DZAA 3DTUB 1D9KC 1N68A 2HVKB 2DQDH 2W92A 4WTQA 1CXEA 4QOKB 3K6OA 3U4BL 1GSMA 1CL7H 1W91A 2XVLA 3HCVB 2IANB 2BFVH 2B9AA 3D69B 1ZLWK 3H3KA 4M6ML 3S3JA 2CHZA 3V4PA 4JQIA 4NN7C 3CMGA 5FXCH 3D4YA 4QT5A 4TSBL 3D39E 3OHXC 5IESH 1FL5B 2FJGB 2ZOWA 2OXGB 3CFCL 3CK0L 1KTBA 2ZSWA 3OSKA 3MRGA 1UXLA 1W0YT 4NP9A 4NO0A 1T5WA 2DQTH 4JAMB 1ZCRA 4D0BB 4V2CB 2E7HA 4HS6A 4D9QE 1D5IH 2LABA 4JY4B 2HX8A 1U3HB 2R0KH 1CFSB 2EUXA 3K5RA 3IAPA 4UQDA 1I8KB 1E7VA 4R2GC 1JPFB 4H8WC 4W4NA 4WI0B 5F9OL 5KSUA 4QNPE 3W38A 1DBKH 2NY5H 4JO1H 5KANI 1LE9B 5BRZB 2O5XH 4PGEA 2A9AA 5BQ7A 3OMAB 5K9OB 1WAAE 1H8NA 2Z4QB 4HK0B 5LXVA 2FWOA 2G5BA 4Z6AT 5E5MB 5DHVA 1WYJA 4S11A 3G08B 1MFEH 2HP4A 1AZZC 4U1HA 5I30L 1AGDB 1S9XB 1U8CB 4XNXH 1MY7A 4A04A 3MBEC 4PH8A 4YR6A 4Z5RA 5KS9F 3KPLA 4KKBC 4XCYB 2NQDA 3TEWA 3P2DA 1BXAA 3DURA 1A6UH 3AWEA 2QHRH 5DZLA 4KJQD 5BZWB 4W9IC 1PG7W 1Q0XL 1I8LA 2YPKA 3M88A 3UDWC 3T04D 3RIFF 2D7QA 3OQ3B 1K4DA 3VQ1C 4JFOB 4F93B 2AJUH 2X3CA 3O0RH 3KZ8A 5HHVL 3JYCA 4A6YL 2B20A 1MFCH 1UT1A 1E5ZA 3SDCA 4FQQA 3KPSD 3QRBA 1SJEB 3HRPA 3H9HA 3PV6B 2XQYA 5MP6L 5D1ZD 2P47B 3RL2A 4H2AA 4HPYL 2I7OA 4JNXA 2OR9H 3TA3A 4EE2A 1DQLL 4C4BA 1J8HB 1W80A 5G2NA 2Q2EB 4AQ8C 1U95A 4PP2A 5D1ZC 5F88B 1FHGA 5F7EL 2ZOKB 5C3LD 4CJ0A 4IJTA 2HXAA 4PSPA 2XRAL 2YQGA 2IADB 2R59A 3D2UB 3PXLA 4PHXA 1ZGLA 4J4PA 4PJCB 3WHXA 2IMNA 2BW4A 5GZNA 4OB5H 3LQAC 4IOIA 1MFBH 1P4IL 3H3BC 5F2FA 4BQ9A 4YWGH 4MXQC 3UAJC 4TOYL 1JD7A 4JGMA 1JYWA 4KKNA 4X2UA 1DBAL 3AJ7A 1G9MC 3VGEA 1AHMA 3F84A 5J6GB 3MNWB 5EO1A 1LEIB 1DJSA 4H8WL 3SIKA 4N1CA 2E0PA 5FYKH 5T1DH 3KLAA 3IE4A 2XBDA 3TBBA 2HVJA 1NGQH 1DVSA 3TWCL 2JMRA 1JGLL 3BFWA 4L4TA 3E6HA 3WO3B 3VD0A 2OMBA 1FG2A 1EJ6A 5FOJA 5DQDL 4ZFZB 1KPUA 1DEEB 2PYEA 4BZ1H 1X4ZA 5KVDH 4XMPL 4Q7DA 5F1SA 4J6RL 4ELMF 4MA8H 4WU5A 3BDYL 2JCWA 3GBLA 4A39A 1KT2B 3ULUH 3QC5X 2HH0H 1KPRA 1S8DB 3DKHA 3CHOA 4NHUA 3FQ2A 5D2LE 1KULA 3AWGA 5I73B 1I1RA 4JFFB 1ZHKA 4HWUA 1ZTXE 3II2A 3SPHA 3ZRFC 3E8UH 5IVXA 5K1NA 4F24A 2BSSB 5C6WH 3F58L 4L29A 1J8HE 2H4EA 1XB3A 3QK0A 3QUZB 4W9JC 4Y5VC 1A22B 3F05A 3VWKD 4R96A 4LLVA 4X8JA 2V7HA 3C8KB 3OGCB 3GMNB 2H7WA 2I5YL 3QARA 1ADQA 4OFYA 3VXME 4OFKA 2APFA 3VU1A 1T89A 3G9AB 2Q6WA 4HLEA 2VAJA 4PU2A 1GSKA 3OKKA 3LMJL 3ARGD 2BVOB 2FDBP 3VTTA 5HVFB 3D5OF 3EFFA 3BW9A 4ZX3A 4AYBA 2W94A 4IRJB 1OGAE 3MV9D 1LEGA 4HIHA 3PRZA 1G94A 4UNUA 1AOHA 4ZYKB 3CDCA 5LAXB 2ZF8A 1ET7A 3GI9L 3NP3A 1TR7A 4X6CE 5EN3A 3LCYA 1KIPA 2WBJA 3KXFE 3IEAA 3SDDC 4DZBB 2DQHH 2BIMA 3FU5A 4NN5B 4PJ8A 4LLYB 4F7TA 2B2XL 1KJ2B 3GBNL 4AEFA 5FGCB 1ZJAA 4FZ8L 3TN0D 3S3PA 3ZSTA 3BWSA 3DJZA 4NQUA 2Y2TA 5IW6B 1JBJA 4JG5A 1L9MA 5C0GB 3O6MH 2Y5TA 3O4LA 1A3LH 3HZYB 3QISA 2K6YA 3TT3L 1A6VL 1JXDA 2H32B 3IKCA 4P9MH 5AENA 3J27A 3WKQA 3QPXL 4R3SB 1IVTA 2CO2A 4XCFH 4GUPB 5ANMB 3FCBA 1WJ3A 4Y16B 1NMAH 2KZ1B 5EV7A 2F8OA 5EPMA 1KDIA 3V0VB 1NCOA 3KYNA 1GYWA 2P8LA 2HVBA 3FMGL 4QO1B 3E1F1 5HI5D 4BK4A 1R3KB 4F7PA 1XR9B 2FO4B 3ECUA 1WZAA 2HFEA 3MHZA 4WO4B 3MRMA 4LLYA 1EFQA 1ICTA 1PL3A 3AS3A 3CVIL 3DBXA 3OG6B 2BP0A 3D39A 1O5PA 2W0FB 3VSVA 1FZMB 2YD8A 3J7HA 4LVOB 2JF1A 5EN2A 3VFGL 1EHLH 3TGXA 1WWWX 1KTJA 5D7JC 4DFIA 5B38A 2D4FA 3AXIA 1P4LA 4F27A 1I1FA 4GKNB 1FIGL 4LF3B 4JPIB 3U4BH 2GJZA 2QVTA 2B4CL 3OMIB 5FB8B 3VB9A 3P0YH 2DM4A 1NIAA 3T0XA 4W9GC 4UOQA 4L1HA 5T1KB 1Y6MR 2A74C 3BWAB 3VTAA 4FTVD 3MV8A 2XCMC 3D0AA 2VLLA 3O45A 3QZBA 2J8HA 4M93C 4OZFB 5DA0B 5EUOA 4K9EL 3IVKA 4LCWA 4NQXA 1AGEB 3FQWA 2V5RA 5A40E 4PQXA 4QHKI 1N3NB 4P05A 2EEAA 1WIPA 1U8LA 4M1DL 3VG0L 5EULV 2JI1A 2M2DA 4XWOC 5GGVH 3ZSSA 4WWNA 5I6NA 2C3WA 3BH8A 1MHCB 3N9GL 5LWYH 2BVTA 3T1FA 4PJ9A 4UMSA 4GP4B 1KXVA 1NAKL 4F2FA 4PV9B 4P2RE 3LNDA 2FLMA 1Y7VA 2OJEA 4G43A 5A2IH 5JLZB 3BP6A 3HNSL 3K4AA 1DSFL 5D71L 3T6VA 1BWWA 1N59B 1U21A 3BKCL 3F64A 1W8OA 4IK6A 1XGUA 5DEFA 1ZLUK 5KS9B 3LQMA 1XSJA 5E00B 2YMXL 1ZJBA 1ITCA 3KGRA 1SDAB 4OV6F 2XWJA 5D2NE 1P5UA 2B8OT 2R7EA 1UWEL 2YZ1A 3GS4A 5T5FA 4N2IA 4RX4D 4N2KA 2OW7A 1GYCA 4POZD 1DQDH 3REWB 1MCSA 3GGWB 2EH8L 4O2CB 5AAMA 4YAQA 4CAGA 1P7HL 3G6JE 1MWAL 3IDXL 3N1GC 1JPGA 2AQQA 4F1ZA 1OSPH 1E5YA 2WLLB 1EFXB 4ONHB 3NUKA 2RB8A 3NRFA 3FSZA 5JXEC 5IROD 3N50A 3ZKQD 3WO4B 1TCRB 2VDRB 3BVWA 4AT6B 2V8LA 3JTSB 1L9QA 2AEPL 5CU9A 3L8QA 3BLPX 2ZUWA 4R5XA 1JNLH 3SGEH 1HNGA 5D9SA 1FO0H 2NRDA 4QXTB 5HYJB 3ZN6A 2F61A 3QFJE 4FHKA 3FQUA 4KK5D 1U4EA 2VXVL 5KSAC 4EI5D 5SX4H 4X6DF 2CIKA 3PL6D 1JF1B 1M9SA 3RY6C 4KVNH 3MGTB 3MV01 5I17B 4JR9H 4I0PB 4HD5A 1IBBA 1P84J 1T04B 4PGDA 1ORSB 4HKJB 5DUBA 3GS7A 4F33A 4K15A 1Q9OB 5D2LF 3HI5L 1VCAA 2X89D 2GQHA 4YWGL 4HCGA 5IB5A 2Z8RA 3IFLL 3AWFA 3O9WC 2GYSA 4CW1B 3RVWD 3G6JA 1D7CA 1OE3A 3VFSB 5BW7A 4GS7C 1ZTXH 3T3MB 1QYGH 3NGBB 4JGUA 3VXQA 4YR6B 4Z5RB 1U8IA 3FUIA 4HETA 4HWZA 4KTEH 4LEXH 4LVNB 5I24A 2IDQA 3EH3B 1I85C 1AS8A 2J12B 5EUKA 4MX7A 3S35H 1B4LA 3OKKB 5SWQA 2R23A 3N5AA 3KPNA 4OM1H 3ZDXE 3NVQA 4QLWA 5KYUB 3TOPA 5BQ7B 2OBGA 1RK1B 1T2JA 4QOKD 1NCGA 5FYKL 5T1DL 2Z1PA 1JZ5A 4JDVB 4UV7L 1QR1A 3T0WA 2E86A 1J0YA 4K2UL 4OH2A 3WENA 3OKEB 3OKDA 3QA3B 3ATFA 4M03A 3GSVA 1AFVL 2CO7A 2M83A 5KS9A 2VM4A 1U8KA 1MFBL 1P4IH 1EJOH 4S0HA 3AREB 3FNKA 2FX7L 5CLXA 4DQOL 4PLKC 1JHKL 3PIQA 4MA3B 1AR1C 5AOMA 1NCWH 4GBXC 2WXIA 2LGNA 1N4XL 4OJCA 1D5MA 1FRGH 2ZD0A 4H0LC 3LKOA 3V6ZB 4BE6A 3TURA 2GSMB 5MEPB 4AIEA 5LNDA 4FG0A 1DQMH 3SDCD 4G80B 3IF1B 4M00A 3QCTH 4MZ3A 2GAZA 3UC0H 1GYUA 1ZAGA 5IHUH 4LNVA 3R0MA 4HUWA 1ES0A 2A4EA 5DTFA 3WIFB 1B2WH 4FLRA 3MUY1 3E1ZA 5EWIL 3QEQB 4LRIA 4XVSL 1G4MA 2LW3A 1H3VA 5IW1B 4LL4A 3RURA 2VDLH 1UB6B 2GBUA 3Q43A 4KDTC 4GP8B 5IFHL 5D1XD 2Y7SA 3GDBA 4FQJH 1ADQH 2EIMB 4P9HH 1KJ3H 4HQQL 2VB5A 1LEKB 5EBMA 1NZRA 3F12A 3MOAH 3ZYZA 4JZJC 5C2BH 1M71B 5T3XD 4N86A 2QQKH 1UFUA 4Y2DA 2IOMA 3WIAA 4AM0Q 3ZL1A 2WHVA 1PNCA 4HUUB 4YIQB 1CR9L 1ID5I 4LHJB 2QFRA 3BVUA 4LL9A 1IM3A 3WNMA 3ZT5A 1MFEL 4HF5H 4LSRH 1VLXA 2OQJA 3H2QA 1FCGA 4WEUD 1BEXA 2F19L 2GSIB 2YO3A 2ZOUA 5E0FA 1TTAA 2R8SL 5GGSA 2GJJA 4OV5B 3MOBH 1GZHA 1E4HA 5LO7A 2W65B 4UQ9A 5DMKA 5CJOH 3DX6B 3SEPA 5C0FA 3FTUA 3HC2A 5C7XH 2RTTA 1CFVL 2VDML 4YLCA 2EO1A 4Q9RH 2J43A 1BVNT 9PCYA 4CC4C 4J3TA 1BFOA 3HMXA 5J12C 3B3IA 1RHHB 4X4YA 4NAMA 1CIUA 1UA6H 1RCYA 3HZYA 2BSED 4KROB 5FGBC 2NXYC 4MYPA 5IVZA 3WL9A 1R3IL 2HT3C 1CG9B 1D2OA 3P02A 2A9ML 4MASA 4WUKL 3T0EE 3DX9B 3GWJA 4KV5E 1ZA6B 5EC2B 1G7MA 1MXDA 2EC8A 1VACB 3MJ9L 3TVMC 2NTFA 4RDQF 3QEGL 1FYTD 1WTGT 3HNTH 1TLKA 3LZQA 2EIZA 3Q13A 4FTDA 4XP9H 2BDNH 1FNHA 4TVPL 4XH2B 4P2YA 3T3ME 1KTLB 4FXKA 1IILE 4S1QL 4JHAH 1FL3A 2VLME 4OCRH 4ZS7H 5EORH 1DJHA 3N42F 2EADA 1C5BL 2V2WB 4U3SA 3VRIA 5AEAA 3NK3A 5T3XH 5KSUB 1G9NL 4PEEA 5DS2A 5EF2A 3VD7A 5FYLD 1KFAH 2PXYA 3PPSA 1A6VH 3BEVA 4P9ML 4WJ5A 3VXNA 3E38A 4G6AD 5GGTL 2GI0A 3ZKND 3VH8G 2V6HA 4IRSC 4XNYL 4JL2A 3S2AA 3QCUH 4DP5X 1XMEB 3QPQC 3N91A 4JKLA 4X6FB 5FLUA 3TONA 3MSPA 1EHLL 5CNHA 3SGKA 5FWQA 4XN9A 2Y6SD 1MF2L 3V5HA 4L3ED 3EYOA 3SDYH 4XTRC 2ADJA 3FQXB 3ESMA 3U6RB 5TGBA 4ELDA 1BD2A 4ZTOL 3CE1A 3ORJA 3VMNA 2BMKA 2MEJB 3X13A 3JBG7 2RALA 1F42A 2P24B 4KJQC 2Z92A 1UD6A 2HT2D 3TNMB 4LT7A 3EKCA 1KG0A 3P4NB 4X4ZA 4FZEH 4OLVL 1TVBB 4FADA 1FLRH 3Q8BA 3QORC 5DRNB 5JXEA 3TBCA 3TT3H 5IMOB 3MBED 1PZ5A 4FCHA 5I66A 1UTDA 1JTOA 1BSIA 1GOFA 1XGYH 4ODTL 2IQ9H 1IT9H 3D39D 2IH9A 3C08H 3RJDA 3UIZA 3B2UC 5JOEA 3NA9L 4UQBA 1PYWB 5EBWB 2B5IB 1AO7B 2FSEB 4MZ2A 4KKAC 1TEGA 3LKQA 4L1TA 2AGJL 3KVQA 2Y1AA 1E9QA 4PJ8C 4ADIA 4KRNA 2E56A 4Y5YC 1XGTB 4JKNA 2DPKA 2C1PB 4XVOA 3B2PA 4A68A 4KKAD 3ZRCC 1B3IA 3EG9A 3QVAA 1BZ7A 5DZPA 2FJHA 4BH8A 4BK5A 3S88L 3PHAA 4YQXH 2KDYA 5AL0A 2YHGA 5D96C 2NNAA 3M86A 3BPNC 2NUPA 4NLAA 1QLEB 3ZVVA 3QO0B 2WD0A 4LCWD 3DWTA 3T5WA 5C97A 2CMRL 4QHKJ 1EJFA 5L2JB 4N0UE 1MWOA 1BCIA 4Z7UF 4E41E 4UT7H 1GS7A 1FYTB 5E00A 4KMTH 5ENWB 2YOAA 2C1OB 3HRZA 3HRZB 2YFNA 4PBWD 3R06B 4S1SH 1K8IB 1EZVY 4NEHB 4HH9A 1O6VA 2IGTA 4P9HL 2HJFB 4PCSA 1DDHA 4GPVA 1RY7B 4GQQA 2AFNA 4QMEA 3LRKA 3CSBA 3ULVL 5D7LA 4AH2A 2FJHB 2YA2A 4XNUH 1TIUA 4NRZA 1MLBB 1XGPB 2Y6SC 4EEEA 1IKNA 3T77A 4FYQA 5FYJE 3UEZA 3GSRB 1UB6A 1G5GA 1IQDA 1YEFH 5DVNA 2G4EA 3CGTA 2ZCHH 4Y8DC 1CF8L 3L5XH 1YSOA 2Q20A 4G6AC 1SJHB 2XZQL 3D48R 4QI3A 4IRSD 1TQUA 3TIEB 3LYRA 4EKJA 1G6RA 5FM8A 1RPUA 1N4XH 2QSVA 5HJGA 3K80A 3A67H 1AXSA 1MQ8A 3PAYA 2NUTB 3FUNA 3VU2A 2B08A 4YDJA 3L3IB 4JRXE 3NBNA 4JO4H 3RUGE 3X11B 3NH7L 1E6OH 3UC2A 2C7UB 2CNZA 4HGKC 4DUVA 1KG0B 5IIEB 3AU1A 1ZLSL 4R0LC 3SZ6A 4XP5H 3ARDC 3TWCH 5FO8A 3AXHA 3BP4A 5EEWA 4WNJA 3L1OH 5SX5H 2FYYA 3RG1C 1R3KA 2KC0A 3TVMD 1JGVH 4HIJB 3KXFB 3OR6B 5TGBB 2OTUA 3X3FL 4JJ5A 1U2YA 2HT2C 1TYJA 5CP3H 2FBOJ 4WZ9A 2DOCA 5FV2A 2JH2A 5E1HB 3VFOB 3UJIH 3WTVA 1HXYB 3AG2B 3VQMA 4HBCH 1A7OH 2GUOB 3GO1H 2H32A 4XVJL 1A1NA 1KXTA 2YA0A 1NCDL 4PJDE 4W9HC 2BOLA 4XCNA 3P4MA 4X98A 3HG5A 3A6BL 1HJBC 2DQJL 2R0WH 3CLFL 3GKWH 4OJFH 2XA8L 5JW5B 4J39A 5HI4D 3ARBD 4FYRA 1SEBB 3NZ8A 1T3FA 4JHWH 3ARED 4M7KL 4X42A 1FA4A 1OP4A 1B4JL 3P9LB 4RGNB 4XC1L 2WXOA 4AKPA 4JG9A 3H4HA 2LVCA 4PJIB 4OQTA 5ITBH 1OTSD 4OCYL 4A1RA 3WY2A 4I0PD 4Q6IA 5LGJB 5HHVH 3IU3A 3B2XA 3NAAH 5IHZA 4NUQA 3SKNA 4QY8A 1W9XA 1BREA 2PYFB 2C3HA 1CT8A 2C3XA 3ZE2B 4I9XA 4OKVB 3CFNA 4WI8A 2A6JB 2Z7UA 3EFDH 4P2OB 1CTMA 1QASA 2KS0A 4O58L 5EZJA 1DQVA 4JO2H 4NNYA 4YHZH 2J1KA 1AD0B 3I02B 1MPAH 3BWUC 4B60A 5DJYA 2Y3AA 5KVFH 1UM5L 4K4KA 3UYOD 2YAPA 5C0DA 1GJWA 3J2PA 4M1DH 4RWHA 4AJWA 2EE9A 2W9LA 4JM2D 2D31A 2EYSB 2ZP8A 4CDGC 2F54B 4DEUA 5IEKA 3ZT6A 4PRPA 4NP4L 3QO1A 3E7JA 2XQYG 3MFFB 5J0BA 4HPOH 3REWA 3DJ9A 2YN5A 1SLXA 4I1NB 4IS6B 3VW3H 2LU5A 4LHUA 4U49A 1MI5A 3OHXA 1MRCL 4H88H 3KCPA 3L54A 2ZCZA 3OAWA 3U9PL 3VTMA 1UCBH 2BW5A 4UUJA 5C6PB 1EHNA 3QH3A 3ZL2A 1UJ3C 1EFXD 3F8UB 3WNLA 4Z7UB 3HC0B 4XPAH 5EBMB 3K4ZA 5LDSA 1CTNA 1CE1H 2FB4L 3T65B 4DN3L 1N0LB 2H3KA 1UB5B 3I6LD 1PFCA 4B9GA 3UAJA 1C08A 2M8XA 4NC1C 5D1QE 4OT1H 4HOZA 1JZ7A 2IAMC 1QATA 4K5LA 2DQDL 3ZPDA 4JREC 2PCPB 3T0EC 3VH8B 4GAYA 1H3WM 4HZ1A 3C9NB 2DKUA 4PJHE 1VB9A 2G9HB 2OPCA 4F7EB 5E2WH 2FT6A 3QIBD 4U1JB 4BA0A 3KGUA 4I3RL 4LP8A 2VXQA 3QEQD 1JP5A 1QEXA 2PO6D 4OCRL 3WTYA 4EIBA 2X87A 2AS5M 1VF5C 5IQ9B 5CSGA 3R19A 3PP3K 3A0OA 4GBXB 5CEXA 3FT4B 1JFQL 5FUOL 2VZTA 2YEZA 2X2JA 3GI9H 3AACA 1FCCA 3BPCA 4O00A 5DQ9A 4AYGA 3DUSB 1BZOA 5CBEA 4M7KH 1URLA 4K71C 3UBGA 1N2RB 3CDYA 5I1HH 3QI9D 4G42A 5FKAA 1QR4A 2YGOA 3FUHA 3QJFA 3II1A 2HWZH 3UYPB 1VKXB 2W9EH 1XIWD 2WCSA 3QIWD 3VFWA 4ZTPH 3V0VA 3W9EA 1OE1A 4Q52A 4RCAA 4J8QA 4FQHB 1MZZA 2FEJA 2IBGA 4DCQA 4DCQB 4DKEL 2ESVB 3WJLC 1I3UA 4YPGA 3C60D 3IJ8A 4FI7A 1U8IB 4HWZB 4C4KT 4WF7A 3FQRB 4UM8A 1YEGL 1ASOA 2IPKB 1ACZA 1AJ7H 4J12A 1K85A 3OJMB 4MJIB 4JRLA 32C2A 2N0KA 4W93A 4AVJA 1U3NA 4PS8A 1IAKB 2F19H 4LVNC 5AW7B 4PMFA 2BNRD 4LOUC 4MD4B 1MJJA 1X7QA 2ZWKA 3OKNA 1IC4H 4BCYA 2DKMA 1JV2A 1WAAF 1KYUA 4OTXL 1FC2D 3T71A 2WLIA 1KXHA 1S9VA 2VC2H 4LESA 3D85D 4OF3A 2VL4A 4K7PH 3V0JA 4IKJA 1HEZB 5DRXA 1CDUA 3GJFH 1VAHA 5E8PA 5GRJH 3AS1A 1QPKA 1SHWA 1CDHA 1TZGL 2QEJA 4UM8B 4HKXA 3MRBA 4U6HA 3H2WA 1NSNL 3ZTNL 1ORQA 4Q56A 3X13B 2CA4A 1NOAA 2OXHB 2UX6A 4Q8BA 4X50A 3CN2A 1EHAA 4TF4A 3KGSA 3MJ7B 3RWGB 2DYRB 4NWTL 1EAPB 4NC1E 5KJRL 2UWEB 5MENB 1WBZB 3H7BA 3RYMA 4L23A 2LAGB 3LJ3A 1X5JA 1YEFL 5CLZA 4HD9A 1ZT4B 3CX5K 5IQMA 5G5DB 3NIFF 4KZ0A 2EVIA 4XXWA 4NQED 5C6TH 5IVXB 3NSFA 4MQ7A 1C1EL 4XMTA 2BP5M 2IANE 5I6OA 1VSCA 1WZLA 5LJYH 2JIXB 4Y4HC 4XOBA 2LLGA 4HW6A 4ZUWB 5CEZL 4LLMB 4G8IA 4H1LG 3K4DA 4U3SB 2VT0A 4JO3L 2WPGA 2VTFA 3P77A 4NQVB 3B3BA 3GLEA 4LIQE 4PREA 1XAUA 1I1AC 4LSVH 4AIOA 2ZTBA 4AW7A 4IU2A 1GC1L 4RA3A 4A38A 1RULL 3Q05A 3RGVA 3ETTA 5DFAA 2EDMA 1IEBB 3QNZB 1RSFA 3O0RL 2VLKA 1HHHA 2IAAC 5ALBH 3B9KB 5CEZD 3ZUCA 3H4FA 4IIZA 5A2JH 3VYPA 3UBXI 3BFOA 3SCMC 5F7BA 1SLWA 2H1PL 5H35B 1HWWA 4EJ1C 4OZFA 3CVCA 4OGAD 2OMXB 4PB9H 3NACL 1S5HB 1FUNA 4HVBA 2HT4D 4RAVA 5E8DL 3WHXB 4LARL 3BVDB 1UQSB 4BK5C 1U8MB 4DPBX 3EUDA 1KPVB 4UWQB 5EB9A 1J11A 4TL5A 4XAKD 4PJEE 1SXNA 4AL8C 1RIVH 1YUKB 3L3OA 3WY1A 4B95C 4ZDHB 3M1CA 4GKNA 4TLTA 2OMZB 1NMBH 4K3EL 5AZ2L 4BCZA 2Z1KA 1INEL 1YEDB 3RB7A 1XR8B 2O5YL 3GRGA 3VQLA 4G6JL 4P46B 4AGLA 5HHOB 4PCTA 5AZUA 5B8CB 1KCRL 1YG9A 1F4XL 4H1LB 4FXGB 3EOAB 4PRBA 2QT6A 5CSZA 2ICWB 1YNLH 4NSKA 1FNAA 3HLKA 1K4DB 2D03H 5AAWA 5KSVA 4KJYA 1CZ8L 1GOHA 1K3ZA 4DIXA 1RL1A 2ZWLT 3BT0A 2VLJD 3MRLB 4FQ1H 3Q6GH 1MCOH 4MJHA 5EZJB 4JZJA 5K9KB 1X9RA 2BK8A 1OARL 3L16A 1J1XL 3NSCA 3NT0A 1ZT7A 4KY1L 1YECL 1YMMB 4HK3J 5J3HC 4OLWH 5DC4B 3VI4F 3MTRA 3CNKA 3EDDA 4NQEE 4BQ8A 5JZ7D 4PPTA 3TCTA 3W57A 2AANA 5B7MA 4BYHA 1OTTD 4M02A 3COOA 1XX9C 1Y1UA 3WDJA 4UBDD 5E2VH 3AABA 3D7PA 1UATA 1HCZA 5HHME 2CCLA 4MZIA 4UIMB 3HPLA 4PJIF 1UVQB 1XGQB 2J6EA 4UILH 3GB7A 2RMNA 3C8HA 3NFPA 4MS8C 4AQ1C 5FO9A 4G1EA 2F7OA 4ZS7L 3S3SA 2XZCL 4IMLA 2WLIB 3HG1E 2HAZA 5BJTA 1HOCA 5JMOC 2BDNL 4YDNA 1YCSA 5DD0H 1H15A 5EZOL 4YO0B 5LVEA 5JZ7C 5BO0D 1BZDA 3FT2A 3QR1A 2WWKT 2EDHA 4X99A 1XEDA 5I75C 1BVKB 2XJKA 1T0MB 3FQRA 2XBTA 5BZZA 2WQSA 2PW1A 4MMZC 5C08B 2VLJB 4RBPK 1GGCH 3MRCA 4BFGA 5J1AA 4BSVB 4LVHC 3ZL4H 4DP7X 3TBYA 4CJ1A 5IQ7L 1PQZA 3PGFL 1LNUA 2PR9A 5CN2A 2DWTA 1MF2H 3NFPB 1F6AB 2JKSA 5D93C 1HX0A 4TQ8A 2X4RA 1LMKA 1MJUL 4H7VA 1X7SA 1SHSA 2IPTH 5KVMC 1NFDA 2PP9A 3QIUC 2QQNH 2ZKMX 4H26A 4XGZB 5E8OB 4K55A 4KMLB 1PY9A 1KLGA 1JGDB 3RWIA 1BX2A 3QDMB 4IBVA 1HKLH 2ATKA 3SKMB 5BW7C 4JJHA 1PDKB 2FTAA 2H0FA 1FFOA 3AS2A 3WY4A 1VEMA 4TXVB 4X9BA 4GIPD 1U8QB 1XTMA 2HB0A 1SY6H 5KOVC 1CTOA 4HXBH 4LHUD 2AXGB 4YUEH 5CXPA 3UFIA 1YNTF 1DUYB 2JQAA 3DV4B 4YBQD 1HE8A 4F5CE 4PBXA 3VSUA 4OFPA 4GBXD 3NSYA 5LAPA 4AH2B 1EFXA 1UZ6F 3VXMA 5KEZA 1Z0MA 5GGQH 3K71A 3LHPH 5CZXD 2WV3A 3RGHA 1QVOB 2NY2C 1HH6B 1GGIH 4QRFA 3UO1H 1N67A 1TVDA 4GSUA 3FQTA 4UTBH 4BXSV 4FABH 3LDBB 3LRGA 3UAJD 1CDJA 1YYMH 4UQ3A 4MJ5B 1T21A 4YGVA 1J5DA 1YEIL 4ZOEA 4HOWA 2OSYA 3CC5A 4QR7A 4Z7OF 5ICYA 2VLRB 1PZDA 2PTTB 4MNGB 4Y9BA 5EU7C 5CILH 4JPVL 4IK7A 1SJEA 1YNTA 2EDKA 4CU7A 4HIIB 3SBRA 3ATEA 1FSKB 4OJEH 4KRPD 4IDJH 1VFUA 2EP6A 3R4RA 3RAJL 4KNQA 3U9PH 5LB1A 4U0RC 3OQRA 1JD9A 4JJOA 4CSPA 4K8RD 2XC8A 1Y07A 3MZTA 3Q7JA 4J8RB 3QRGL 5JORB 5HYSB 1WEJL 2F8VA 7FABL 1M7IB 4LCYB 2ADJB 4XAKE 1IE5A 2A6IA 5JW4M 1XSKA 1WICA 4JPWL 1DBAH 1RJLA 4AL8H 1MSPA 4LSTL 2EINB 1OSZA 4Y88A 1NFDF 4DPAX 4LEXL 4TTDD 5DYFA 3UPRB 1GY2A 1ZHLA 3GYRA 4OUUA 5DD3H 4X7TA 2W9DL 4WNQB 4GKLA 1NGWB 4AMKH 2YWYA 1KYAA 2EDWA 3HZKA 6PAZA 1EO8L 3MRRB 3HMWH 3VWKC 4WHCA 3VB8A 2R83A 1SMDA 1JZEA 1WP6A 1A8ZA 4R0LA 4YGAB 5BVJB 2QQQA 1ZVSB 4GFTB 3N6YA 2BNUB 3CHXA 1OP3K 4N0RA 2X0UA 4GMTL 5F96L 1BBDH 4NQEB 2NCMA 2WBJD 3VGGA 4LSQH 2JI3A 2I24N 2WQRA 4HJGA 3RX7A 1JF5A 1MCIA 2FQFA 4IKNA 1MCCA 1ETZA 2A1WL 5ADOH 3QUZD 4G5ZL 4N8CH 5I0XA 3V0WH 5I19L 3BCDA 4YSPA 1EUUA 2FX7H 1LNUB 1NCIA 3IS0X 5ERWA 3TN0A 1OGSA 1E8YA 2Q3ZA 4XHJD 5D7JB 4DGYH 2Y1YA 3ARFB 1M1XB 5GGVY 3A4DA 2VSKB 4KQ3L 3DV6B 1HHKA 3ZQWA 4AZUA 4GAGL 2NX5A 1HHJA 1E4XL 5KVFL 3FCTB 2AV7B 5HGHB 3SGDI 5D2LA 3AGVA 3K8KA 3CSFA 4OZFH 1A7OL 5ECJE 3MJ8A 2CJTA 2BVYA 2FH8A 4LCUB 4N25A 4LMQI 5BZDA 4Q58C 2QPEB 3DHUA 4MXQD 3KYAA 2R1WA 2EQDA 3QFDA 1EZVX 1XAKA 5DJZA 3NZUA 1VESA 5DVKA 2X6CA 4Z95H 1IM3B 2OMYA 1ILUA 1R5VA 4B3VA 2Z7WA 4R7NB 1KPVA 4ZTPL 1VACA 3O3UN 2WTPA 4CGTA 5H2BA 1QQDB 3IAQA 3QYMA 1DBJH 3IMBA 5LBVA 5J6SA 1MDAA 3LQAL 4HT1H 1R75A 3MJ8B 4GUCA 1A7PL 1BOGB 2YPVA 1TXKA 4FJYA 3BWUF 4U7SA 2ZXAA 5LNGA 1CU4L 4RH4A 3W2DL 2VZ3A 3CFBA 5I30H 4OGYL 2BY3A 2UXTA 3U7YL 5D5MF 1OCRB 4HOXA 3CLEL 3IMSA 4N0CD 4JCLA 1BECA 4ORGA 1J0IA 4YSCA 2V9QA 3DLQR 2DY2A 3L1FA 4UF7C 1FL6A 1HQRA 2VXUH 4XB3A 1MLBA 2A4ZA 2GAZB 3NCYS 4GJTB 1JGEB 1GGYA 4F58H 3P54A 3CVHL 1SLVA 3UX9B 2J8UB 3NEOA 1JGDA 2W60A 4K71B 3RWIB 3MPCA 4ACPA 2ZUVA 3FONB 4NPKA 3KDMA 2KHAA 4Y5VA 2K4AA 2ZP9A 4MB1A 1NPJA 4E41D 3L4TA 5H4ZA 1DJXA 4AKQA 5DDHA 5C8JA 3QG6B 4PG2A 4BWWA 2C1OA 3QGVA 2RA1A 1FG2B 4J7RA 5GRVK 3VSQA 2XLLA 4BUQA 5L4MA 1O6SA 3ULUD 1JWUA 4Z7QB 2FNBA 5JW4R 1GW0A 5E5LA 1KC5H 1HEHC 3T4AC 1NLDL 5HHMD 1JGUL 2Q9OA 4L2YA 4L4VB 3WN5B 1IGFL 2ZAIA 5I1KL 1F02I 1ASQA 1NICA 2BIIA 2D4DA 3KWTA 1MG3C 3QWRD 5ANME 4KVCL 3VD4A 1Q9KB 4HKZA 2H6PB 3BKYL 1BD2E 2EZ0D 1QRNE 2WTOA 5IROA 3NEXA 5IMMA 1MW2A 2J4WH 4WFFE 1QFOA 1NCBH 2XFXB 3MMEB 1NCTA 4EI6A 1X7TA 2Y72A 2DI8A 3OR7A 4ZZKA 1CDBA 5IB3B 2XNAB 5T1LA 1WUNT 4MCMA 2H2SC 1MQKL 4ZSOB 1NGPH 3L3GA 4BV1A 4JFHE 1EXUA 3PYCA 4KKRA 1UM4H 3POHA 5EA0H 5JR1H 2NT1A 3PWLB 4X9GA 1ZHBA 1V10A 1KJVB 2CDGA 1KN2L 1ACYH 1NA8A 4TS6A 5HJ3B 2CGRH 4PLOB 2VLKE 2DQIL 3FOMB 3HG0A 1VA9A 4Z7WE 2C3GA 5LLIC 4FZEL 2CH8A 1A14H 1C5BH 2P5PA 3I2CH 1OGAB 4NFCA 1IX2A 1GXEA 3DX3A 4Z0XA 1NCJA 3L48A 4YXHH 3DIFA 3P4LA 2BHZA 4G1MB 1NM9A 4S2SA 5CZRA 3VDBA 3KPRE 3RIAF 2WVVA 3QFJA 3GMLA 2AW2A 4P4RB 1H8OA 3T2PA 1K9TA 1USQA 1E4WL 1RZQA 1T6BX 4W6WB 4XBPA 3IPFA 5LGHH 4CC1A 1J18A 4V1DB 5FA4A 4OKVA 4RAHA 1JZIA 4DP1X 1N6QL 3HKZA 3TZVC 3IM1A 4OF7A 3QYCA 2HFGH 4P5KA 2WXRA 4N0YH 2G5BB 2QQNL 4JE0A 1JYVA 3OAUH 4ZW5A 2A6DB 2AKRB 3T09A 4LCUA 2XG5B 1DCEA 4NO3B 4MNQE 4R5VA 4AQ1B 5C0EB 1NCWL 5KJ7E 3RZCD 3W37A 1SM3H 5EU5B 2DKSA 1ASPA 1WS7A 3CQQA 5I71B 5HDRA 3VGDA 4TTGA 4POYA 3CLWA 2YARA 1XSOA 1PKQE 3VYOA 1FNSL 1R0AH 4GUQA 1XF5B 4K94L 3AG4B 3ZGIA 1HK6A 3AM8C 1WK0A 2B2XH 4F3FA 3SE4A 5E5UB 2PR4H 3PHQB 3BUBA 1M1XA 2DL2A 1MJ7H 3WS6A 5FOBA 1HXYA 1IEAA 3R18A 2RIKA 3EBIA 3OJ2C 3QQ9C 1DLHA 5FM4A 5IVXF 2H6UA 2OMWB 3MRLA 2HJKA 3D9AL 3T6QC 4UDUB 5E6ZA 3U9UB 5ID0B 5GGSY 3L5IA 4U1JA 3NIFB 5C2BL 4LOEA 3LEXB 4W6YB 4EDXA 1JAEA 1IC1A 2IH1A 3OAYH 4NQDB 4HQQH 4FG6D 3HOGA 3OV6A 5F3HB 4QTIL 2A73A 2DM3A 1PLGH 3TIDB 2V17L 3BWAA 1JNJA 1ED3B 4XWGL 3P0VL 5DJCA 2FEEI 2XZQH 1PW3A 1RIVL 2PTTA 4GBXA 1DP0A 4EPSA 5F8QC 3SOBH 3BP5A 2X6BA 5ABDE 2H9GA 3OXRB 3BPOB 4GW5A 2C4FT 1THCA 1FFQA 1J87A 1UA7A 1IIIA 2FGZA 4RDBA 2BNQA 2EZ0C 4H40A 1KB9J 4IRSB 4W4OC 1TSRA 3NZHL 4P5TC 1IM3D 5LCVA 3WNPA 2CZNA 5INDB 2E9IA 2CPUA 4DO5A 2V9UA 2Y7QB 4JFFD 2X42A 3MRMB 4RVBA 3EUUA 4WWKB 3T0AA 3UJTL 1XCWA 2C9UA 4GRLA 3ZOAA 2P8PA 2EILB 1XF2A 4JZNA 4JZNB 1AGEA 3LY6A 5K93A 4MA1C 2EIDA 4NZUL 5KS9E 2JKTM 4X8GA 1ONQA 5FS5A 3ABZA 1I4FB 3PUCA 5E6SB 1O6SB 3SDCC 3FN3A 4NIYE 4ZUVA 3B43A 5T5NF 4ZS6D 1IC7L 1BQHG 2OK0H 1EH9A 1DDHB 2WM0A 3ISYA 4GW5B 2P42B 1Z9PA 1I8LC 4PVMA 2V9RA 5ISZA 2GSIA 2F5AH 2O5ZL 1J8HD 2H26B 4NENA 4PJEA 3GLDA 3WEMA 4BQBA 5BCAA 1IU1A 2MCMA 3VXUE 5ISZE 5DO2C 5IBUG 1FYTA 3FK3A 5D1ZB 3UPAA 4DGWC 4J3VA 3KNBA 2WKGA 2BSTA 4MA3A 3A4FA 4X5QA 2DQGH 1XEUA 4YHOL 1NIDA 2EDLA 4Q74A 2G5UA 3F12B 4MRCA 4O2FB 2W0LA 3P69A 3VXOB 4RGMC 4LE8A 4GMSL 3N1FC 1FAKT 1CI3M 5E9DA 1DUYA 3DV4A 3PAVA 4M5ZL 1EEZB 4YE4H 4IRJA 1EHXA 5EBLB 1RZPA 1GCYA 1ZT4A 2EE0A 3DMMB 4X6CA 4GUPA 4Z77A 3ECVA 3HS8A 5D7HA 1IEAB 3MLXH 2X4NB 1CICD 2F7QA 2YAMA 3QUKA 2WZ6A 3UAFA 2PXYD 4HEPG 5CWSA 5HGHA 3FSOA 4FE9A 1CBJA 4G42B 5FKAB 5IEHA 2Z7YA 4WW2F 1BYPA 2FBJL 3C5ZA 2WNWA 3G5WA 3P30L 5ADPH 3CPLA 5KVFE 4OF8A 2AXJA 3QUZA 2GTWB 3SE9L 3TJHD 1QMUA 4CMHB 1RMFH 4MHHG 4DH2A 4QOKE 3S37X 1KZQA 5KSBB 1IBHA 1AHKA 1UWYA 3MROA 1A6UL 1MRFL 4G11A 4GKSA 1KV3A 3VXTA 3X1EA 3PIQB 2CCVA 4OD2B 3JTTB 4R7DB 1YZZA 1WVZA 4AQOA 3EHBC 2NQCA 1DO5A 4MA7H 5GS0H 3NSJA 4OZIA 3Q5TA 4KK8C 3WMQA 5KVGL 1KJMA 4HHGA 4UTAL 4JRXB 4UBDC 3UGEA 4V1DE 2A9NL 3B5TA 2EDYA 5C0BD 1OPGH 5C71A 1LEGB 4NCDA 1JK9A 5CU5A 3QUML 1XWVA 43C9A 3KPQA 2K3TA 1XB6A 2ADFH 1CGTA 5D6DC 3T0DA 4F7EA 4K73A 1GW6A 1B6DA 1SXBA 3C5SB 3EGDB 2Y69B 4JPWH 3SPJA 4C4UA 4NZJA 4NZRH 5JXED 1WA1X 3QIWB 1MZYA 2ED8A 2CA3A 3OX8B 4QRPE 1IGTA 4L8SC 4WV1A 3US0A 1KXVC 3QZWA 1ZRUA 4GRMA 4P5RA 2ENJA 4X9IA 2UZIH 1XF4A 1PZAA 1V7MH 1JV5A 3ARXA 1OAKL 2KLRA 3QHFH 4JFDE 4WY7H 2ZOLA 2X1XR 1QFUL 3MUHL 5GISH 1OCWH 1BAFL 4OIFA 1E30A 1I7ZA 1PKQA 2W81C 3EIFA 4NYLA 4WFHD 3UTTB 3CN3A 4BUHA 1ZDQA 3TO4D 3QXAA 4IMKC 5IFJB 2WTRA 4ONGL 4DGIL 1ZWIB 3MLRL 3PWLA 2WO2B 1KGJA 2BLFA 2DQIH 4YFEA 2FYYB 3CHSA 3C5XA 2BM3A 4M6MH 4R0LB 3H2PA 3RL1A 4FQ2H 1GPOH 3ESVF 1ODAA 2EO9A 4Z3GA 5F88A 2CCWA 4CVWA 3MYZA 2X4TA 3AZUA 1HEZA 3E6FB 3O6KL 4J6IA 4TSAH 4UTCA 5ID1B 3FFCD 2X2YA 1T1XB 1Z2KA 3MTXA 3WEOA 1FDLH 2ENQA 1YEGH 5TE7L 1A7RH 1EJ8A 3QO1B 3OPZH 1U8MA 2F74B 1OSZB 3SO3C 4KO9A 1QTSA 4TQPA 3JSSA 1UGKA 5KSAD 1ZLEA 2R27A 2NYZA 3DDGA 1BYOA 3BP6B 2PO6B 4KTDH 1ZS8B 3B7UX 2Z8VC 5CR8A 4NO2A 4F9LC 1IGFH 5I1KH 2F53E 4J8RA 3L5WB 3ROLA 1UOWA 5C2UB 3U1SL 1JGUH 2UZYA 4AIZA 1OLLA 2YUWA 3T3MF 2F7PA 3K6SA 4E9LA 1VFBB 1HL9A 2TRYA 3GHEL 4FQCH 1NCCL 3OC5A 2YK1L 2YQ2A 4RAUA 1XCQA 2X1WL 3VRJA 4Q9QH 2CR3A 4PJ6A 3I50L 1VFAB 2MMXA 4PJBF 1MAML 4KX7A 4NKDA 3U1PA 2YD4A 3NPZB 2EXSA 4B9IA 1KTKE 3N85L 5CZVL 3CDGB 5ILTH 3OHXB 3MXWH 5C0JA 2ZT9C 4WFGE 1RVFH 2VDNL 2V7NB 1YAIA 2WO3B 4PGJA 1UKSA 3IB4A 5K5YA 5AVWB 5IB4B 2XFGB 2IJ0C 4LLUA 4YHLH 1NDMA 3LEXA 4HX1A 4OZ4A 5B21A 3K6IA 5C09A 3EYOB 4I0CC 1N18A 3O3AA 4R8WH 1FN4B 1I9IH 4N1EA 4X4KA 5F1OB 1ONQB 4ODHH 3FBKA 4KUZH 3RIAK 1AIFA 3OLIA 5CD3A 5T3XE 2MTPA 2HH0L 3NJMA 1PIFA 2L3BA 3DUHA 1ACCA 2ENSA 5FKPB 2AJYH 3MA7B 3GXUB 5E6ID 3G6AB 2VUKA 5FYLE 2WVUA 4N3TA 5FFLA 3IDGB 2EEDA 4L1SA 2OJZL 4WJ5B 3VXNB 1A3RL 5CR1A 2Z35A 4A63A 5GXBB 4R5TA 2AXWA 3BAEH 1KCVH 4OB5L 1RJZA 4YO0A 2ALWA 2X09A 4UZGA 3D6GA 1CO1A 1BX2B 1OL0A 5I66B 3V0IA 5HXMA 5ESAB 3DX1A 1U8KB 5I15H 4RSVA 4MMYA 2OMNA 4ZNEA 1NFIB 1RUQL 3HE6D 2KKQA 2VDMB 2DAVA 5DLMH 2IBBA 3SE8H 1AYOA 1U92B 4MJIA 4Y4KB 2Z35B 1ZA6A 1GC1C 1UM5H 4OGAC 3S5ZA 5AKRA 4G9FE 2K6ZA 5AUMA 1QLEH 3V4PL 4D9RE 4FMFA 1F2XK 5GS0L 5GRYA 5AW6B 3SKUD 2OSLB 3RZCA 3KJ6L 2FEEL 3MUGA 4QD2E 4KI5D 2EKSB 2ICES 2VO8A 2X05A 2UV3A 1QRKA 1FFPA 4XMVA 1HYRC 2GC4C 2CD0A 4ENZA 4PTUB 1LK3L 4I89A 1FE8L 3US1A 1JFHA 1NFIA 4D9RD 1CGWA 1OW0A 1NC2B 1P4BH 1T0OA 2ZG2A 2PTUA 1A25A 3MRFA 3MODL 4M8QB 4EVNB 2APVA 4GSXA 4R96B 1C8QA 3GK8L 4NSKB 3EOTL 2AI0H 4CA4A 3UGXA 1OOWA 2YEQA 3U4AA 3ZRSA 5EOCH 1FI8C 4QRPA 3HE7D 3BVXA 1MJ8L 4PRPD 3BZ4A 3AU0A 4PS4L 1FZKB 4OBRA 4APXB 1KUMA 5CMAB 3EYVA 3HMWL 1YAZA 2H26A 3NACH 1NLBH 4NENB 4PJDA 2OSWA 2WIIB 3RTQC 2YD1A 2DD8L 5TE4L 1ZOXA 5TDOB 1Q9KA 4HKZB 1A3ZA 1IAIL 4TUKL 4NT6B 3GXNA 3ETBF 2FL5A 3MLSL 4Y2OB 3TXAA 1UUSA 5IM7B 1DQDL 3WTXA 4UCFA 1PS3A 5ACMA 4XPTL 5C09B 2IQ9L 2GG1A 1GY1A 4CL7A 2F5AL 2O5ZH 4MMZA 2NY0D 4FQIH 1J0KA 1WD8A 3BIKB 4XN7A 1JGLH 2DIAA 3QXDB 2XTLA 1UB5A 1EAJA 4Z3JA 3HB3D 3WIFA 2UUDH 3HFMH 5I0YA 2WUBL 3FYIB 4NXKA 5C07E 3V5DA 2R0KL 3KPPA 3CDGA 1W15A 4O2EB 3DETD 1INQB 3QJVB 1TZ8A 1JS4A 2XWXA 3KBHE 4HXAL 1HHHB 2VLKB 4JFFA 1Q1JL 1X5YA 1E6OL 4P5MA 2W65A 4XGZA 4E5XG 1J5OL 3ARFC 1Q38A 1KCUL 3L95B 5EEXA 2VDQH 4OW6A 1Z6JT 4RQQB 3ILPB 2YGVA 2AERT 4PJGE 3DJSA 4ZFZA 3DDFA 3NYKA 4KUZL 1MCLA 1TG8A 4PVNA 3LH2H 4G8IB 1CD0A 1TOXA 4Y2DB 4H25B 3FB7B 1MUJB 4NC0B 1AS6A 4F57L 1S5HA 4LBEA 1SBSL 1EEYA 1AE6L 5A2BA 2YAQA 4WEMB 2FIRT 3ARUA 5I5MA 2SEBA 1KFAL 3D2UD 4QRAA 4KC3B 2FE0A 4L1BA 5AOLA 4AJ0A 5ID0A 4WWKD 5HD8D 3WFBL 3S8FB 4Z7NB 5CZVH 2HJKB 2YKKA 1D3CA 4BE5A 3M7FB 2VGLM 3GPEA 1CIDA 3SGJC 3QI9A 3QJHA 4R4NC 3A4AA 3FQ4A 4WV1B 4OFYD 4Q6KA 2L0DA 4NPYB 4PGCB 4K3JH 3UCRA 3QIWA 12E8L 4Y1AA 1HI6B 3BN9C 3ARGA 4HS8L 4XNMB 2F58L 4TRPL 1SY6L 5F9JA 1XF1A 1XF5A 1JN6B 4IEFA 4LKCB 4OTXH 3ZHKA 4IS6A 4ZX4A 5KTEH 1P4LB 1QTPA 2YUXA 4JM0A 4E9QA 1NFDB 1OWWA 1WBYA 3SKJH 4JCMA 4WY7L 3TT1L 5IP4A 4L3EE 2HUEA 4DK3A 1A8JH 3PNRB 3IJHB 4X9YA 4BIKA 3G7TA 4ETYA 3FTZA 4PS7A 1KIQA 1EXHA 3WD5L 3FT3B 3RVXC 5JPMB 3IGLA 3L45A 2F1BA 4PRIB 4GSQA 4XRCB 4YFLF 1UENA 3MOBL 4MDJB 5DI8A 2CK0H 2D3JA 5HBBA 4M7ZC 4MCNA 3HG1B 2CGYA 2ZCLH 3PL6C 1QFWM 5KBPA 3GXIA 3UIYA 3L5HA 43C9B 2BRRH 5D1ZI 5DZ9A 1HOCB 4MA7L 2XI9A 5H37H 4KV5F 4IMLB 2DLEA 2KQMA 3VFWB 5CMAA 5FV1L 5KZCD 2E27H 3CBRA 3QJFB 3HS9A 3OB8A 1ZXKA 3GHBH 3REVA 2F7RA 2XETA 1F4XH 4WTZA 1G7IA 5SX5K 3N41B 3QJZA 4LPTA 2YAFA 4XO9A 1EZUA 1ML0A 3KM1A 2O6DA 3JZ7A 4S1RL 3GMOB 4AGOA 4FQJL 4EQ3A 5T3ZH 3FW6A 4WWKC 3FL7A 5AW5B 4B9YA 3K2IA 3T8MA 3BZFA 3QDJB 1TO4A 4HJJL 4UU9A 2OI9C 3WE6A 4PYHA 4RFNC 4XO5A 3M8OH 1SY6A 2FX9H 3OPZL 5HHQB 3JUZA 1U8NB 1SQ2N 2UXVA 1ZT1B 1TMCB 3FTGB 3UZVA 4EZMA 1A1NB 15C8H 1S7SB 1LLAA 1E43A 5SX4I 2VXTL 4PJHF 2FX8H 5EBLA 5EC2A 5F70A 3BESR 1Z9LA 3U2IA 4IBQA 3OZLA 3FFCA 1IEBA 3QNZA 3ARYA 5JIIA 3FQYA 1NIEA 2CHWA 4YDVB 4ONHA 4GINA 5EUOB 1CFVH 4NQSA 4NUJA 3TBVB 1A4CA 3I75A 3ERXA 1EBPA 1T22A 3MXVH 2HVKA 2W8CA 2XKNB 1OGPA 3DPDA 3QXWA 1AANA 5FYKD 1M7UA 5MEPA 5KSAA 4L8CA 2YS4A 3O6KH 4H44C 4NBZB 5K39B 2HJFA 5JTWA 3DYMA 4G1EB 4OQ1A 4Z3HA 2VUYA 3IDMA 3MACL 3MRQA 2V2XA 2GB2A 2P5WE 4GKZA 5CUSH 1T2QL 5IBLC 1KFGA 5IR1B 4CU6A 1P7QD 1RJZB 3HNTL 3EFOB 1A7QL 1ID2A 1WFTA 2WAQA 5I1GL 2XZCH 1F45A 4OCLC 2GY5A 4P2RB 1RZ8A 1CGYA 1S7QA 3QIBC 3QUMH 1Z7JA 1IVLA 4XBMA 2EC9U 3HA0A 4OM0H 1LEKA 2N1TE 4ZBJA 4A2FA 4DWHA 4NQDD 4BZYA 1C1EH 1CGSH 3NFNA 3LSOA 3CQFA 4OAWA 1SYVA 2I26N 3SGKC 3PDGA 3TJPA 1X44A 1WFOA 2NW3A 1ETA1 3JWNH 4DTGH 3HVDA 1T20B 1SDDB 2ZCHL 2ZF9A 2AEQH 2AQ1A 2CLVA 4KY1H 1UJ3B 3UBXB 2K6WA 4PVBA 1WTLA 1B0GB 1F97A 2X4SA 4ZO8A 4QXVA 2ATKB 3SKMA 4XI5C 5DHMC 1HIML 3T8XB 4M8UA 3MODH 2FHBA 1GAFH 3PLYA 4RMSA 4DOHB 4KNSA 2BERA 2GI7A 3TA3B 4UZUA 4MDRA 5EU5A 1N6UA 1O6TA 1TQVA 3PL6A 4JHWL 1UGNA 3K81A 2J3SA 1MIEL 3ARSA 1KN4H 2YRZA 4D8PB 2A83A 1NTDA 1BG9A 3WGVB 1INEH 4WGVB 5GPRA 3DX0A 1ZVHA 2Z91A 5T8IA 2JB5L 3B7RL 2CO6B 4L9LA 5I2IA 2WTRB 5IFJA 5DWUH 3SE8L 4QXUL 4NGHH 3DI2B 4EZKA 2WBXA 3VXMB 4WW1A 5DJYB 5ITFA 1HH9B 1SBBA 4Y4HA 4EO5A 4X9FA 4ELKA 4P46C 3F5WA 3FS9A 3QC6X 4JFED 2R1YB 1NBZA 1KY6A 2XXFA 1IZKA 2LHAA 4YHNA 2WSDA 3MBWB 3MREA 1ETZB 4CVZA 4WEBH 3CFKA 3CN4A 5IGXH 2P26A 5FYJH 4JDEA 4GS7B 1IT9L 4RGNC 1SFDA 5EF1A 4WI0A 4ZFQA 2B4CC 5A7BA 1LE5A 3IJEA 3RI5F 2Y06H 1D5ZA 1P6WA 5E1QA 4YHYC 4WTXA 1UD5A 2CLZB 2N7SA 1TFHA 4S10A 2CQVA 5EU6B 1NKRA 3AXLB 3LV3B 2J44A 1K5NA 3M46A 2AQTA 1AIZA 2JQZA 3L3KA 1IM9B 2R56L 5DMYA 4MQ7B 4YHNB 3QI9B 3QJHB 3CU1A 1J10A 5I8EA 3FUDA 1MRDH 2VR5A 2R2EB 4O5LL 4A55A 1T1ZB 3L9BA 2Q8AL 3TPUB 1N0LA 1U8LB 3NDZE 4LOFA 3DO4A 3SO5A 2AQ3A 4XMWA 3RVVC 1T7VA 1U8HA 4MNQA 1HU8A 1UM4L 4AXWA 3NZHH 4IKLA 1G7PA 1KXQA 2WBJC 4ETQB 4Z77B 4GO6B 5AB0A 3VWJD 4F7CB 2YSSB 3MYJA 4X80L 5EG6C 3UP6A 5ACZA 2P44B 1JK9B 2AHIA 2NX5E 3MV8E 4M3KB 2P80A 2VYRE 3S36X 1JZ4A 2KDGA 3G6JB 2FX9L 1TJGL 4W9EC 2R39A 4FC3E 3G9VA 3SCMA 3UBHA 3D85B 4WI2A 5GZOC 1BDYA 3VXTB 1TNNA 3EGSB 4FQLL 5JO5B 1PLGL 1K8IA 4ANWA 1Z9OA 4IIQA 4UQ3B 2Y22A 2CUAA 2PKDA 3ULUE 1MRCH 1A1MA 1FQ9C 1IJNA 1WAPA 3P11L 4XXDA 4X7FC 3V5DB 5F7UA 1H3PL 2AV1A 4UI2A 5I1EH 5DU7A 4G3YL 4Z7WA 1N64L 2PCPA 3ILDA 4G6FB 3ILEA 4X7SL 2X4NA 5H37G 4JZJB 3K71B 3VE0A 3QP3A 3KLHD 1XD1A 3EYUL 5EO1B 1A6ZA 4FQHA 5DJ6B 1C8PA 3OF6D 3JTSA 3WIHH 1OQXA 3F04A 3W9EB 2CUHA 3G6DL 3JWNG 1VGKA 4GI9A 4K7FA 2QPUA 2KL6A 5FK9B 4PJCE 1JZDC 2P8PB 4NZTH 5AYTA 1FNGB 3VJ6B 1JTTA 1MFMA 1UJTA 4G8FB 1R5IB 1NBVH 4AYID 3UROR 1WZMA 2BH0A 3RQ3A 1Z3RA 2X2IA 1PCXA 4XNQB 3AGWA 3D2UA 3BAKA 2YEZB 1BFVL 1HHIB 4KAQH 4OD1L 1U36A 2JJVA 3N44B 2FWSA 1KLGB 4Z8FH 3OXSB 1PG7X 1ITBB 1TNMA 2XXMB 5FFOA 4AK1A 3RILA 3VD3A 4WW2C 3GSVB 3GI8H 3MV9B 3R8QA 2BP8B 1ZLDA 3Q1SH 1DR9A 2JNZA 3CFBB 4G7QB 1M2VB 2BP3A 1NBYB 5F89B 4Z1PA 3X3GL 2VQUA 3F58H 4I4WB 4GT0A 3HHSB 2OZ4A 4Z7NF 4M5YL 4FJZA 3GKWL 4TQIA 5KYUA 4OIIH 1ADQL 2I27N 4X7DC 1OALA 2FJSA 2CIIB 4MRBA 1IBGH 2G2NA 4J3SA 2WXFA 1K6QH 1CGVA 1MCKA 3HCVA 1TQCB 1UEMA 1FZOB 4N5UA 5J57B 3LXUX 5D70H 3N06B 2AZUA 4L3EA 3A23A 4BGLA 3DIDA 1PIGA 5KYYB 1BZQK 1X5KA 4KZDH 1BD2D 2NX5D 4M3HA 2R0LL 2WLYA 4A2MA 5CFAA 4UV4L 5F72S 2R56H 4ZUSA 4UNIA 5EORL 3VFGH 2LE9A 4GH7B 3GM0A 3P30H 1N8ZA 1IL1B 4ENED 3UEQA 4AV0A 3ES6B 3LKNB 3LKNA 2H0PA 1A7NH 2AMGA 5DO8A 2Z92B 5IMLB 3UTOA 1PVHA 1X4YA 1I1FB 1XCTB 1CFSA 2OV0A 1NGWA 4U4BA 5AOJA 1B0RA 3DPBB 4J2XA 3RWFB 5G4NA 3PAUA 5IVXE 1A4AA 4IRZH 5IGXL 3QS3A 1B6UA 1F1GA 5CGBA 1ZT7B 1BMGA 1DEDA 5C0IB 5D1XC 4HJ0C 1KJ2L 1TJGH 2P52A 2Z0BA 2ZSWB 5FHAH 4BHUI 5IB2A 4CGUB 5C0DB 4ZXBD 1AH1A 4M6AA 3QQDA 4N85A 5EOTA 3VFSA 4HJGB 5AL8A 4FQIL 3U4KA 2HG0A 43CAB 2Z31C 4GXFA 2OXHA 4HIJA 4GAJH 5GSVA 4JZOB 1CGUA 3B3IB 4J3OH 2IEPA 1S3RA 3PWUB 4PV1C 4HWEL 4AMKL 4HF5L 2C9XA 4LSRL 4KO6A 1JPEA 4CKQA 1OF2B 1RP8A 4I9WD 4EI0A 1OT2A 3PXHA 3I3DA 3JWDC 3E3QE 4WI4A 2IH3B 5KYXB 2VLRD 3W82A 1YN6B 1RUPL 1A7PH 2F2HA 3S3DB 5KBDA 3BMWA 3KW7A 5E94A 3TWYA 4JFFE 4A7UA 1ZPUA 1DUZB 5IKCA 5AVYB 1T66C 4YHYB 1I7TB 5L6YH 1KB5A 1VFBA 1TLMA 1WHOA 1T3FB 4KKPA 5I71C 1RJYB 3U7YH 3UTQA 2QGBA 3CFIC 4Y1AB 3BDBA 4ZMVA 3CFTA 4N0UA 4E41A 3ME0B 3LNFA 2IWFA 2YPLE 2EDEA 4OVUA 4XMLL 1QAWA 1QHQA 1X5IA 5D7LD 1WFJA 3BKJH 3QIUB 3ZTJH 1R5WB 2P5WB 3BW9B 2W95A 2V3DA 3RWCA 5F71A 1BQSA 2FZ3B 4QXGL 2XV6B 4WKXA 5SWZA 3L4YA 1IAIH 3VFVA 3WE1A 4PWGA 5LXGL 1P2CB 4H2CA 1AI1H 2IGFH 3K0YA 5GS0C 4JY6B 4PRHD 4WK4B 5TK2A 1PNDA 4KO7A 4DN4L 2YZ8A 1S7QB 2EXWC 3FCSB 3ZR6A 2XPGA 1IGMH 2KPWA 1I9JH 4K8RC 4XC3H 4JUSA 1MHHA 5ESQA 1S78C 5ID1A 4X5XB 3FH8A 2GBVA 4Z78A 5HHPA 4NKMB 3KL5A 1I3RB 1WH0A 3BKJL 2EE3A 1YQVH 2MPAL 5HDQH 3X3FH 1N26A 3IRCA 5AVZB 5LKNA 3L7FB 2Y7LA 4S1SL 5MP6H 3TTYA 3EOTH 4PLJD 3O3EB 3SE3C 1JGVL 5IESL 4RDQG 3S3CB 5IVNA 2ITCA 1KGCD 4WU5B 3L3DA 5JHLA 3T1FB 5CJQL 1CN4A 3ABGA 4OGXL 5GRVL 5BO1H 3OMZA 3VXRD 1UWGH 1E2VA 9CGTA 3LS4H 4JRYD 3F65A 3VD9A 5DVMA 4HPHA 3OKDB 3QA3A 8PAZA 5CEZH 3QEHB 4HFWA 3TVMA 4XBEL 4OD3L 3S4SA 4I13B 4FJ6A 3MO1B 2XPGB 4EXKA 3S88H 1NCHA 1SQMA 3C5JA 3QZWB 2Z8WC 2QV2A 4XNXL 1MVUA 3RNQB 1A7NL 4PUBL 4OM0L 3STZA 3QAZB 5IM7A 2GBTA 1AHWB 3PWJB 4L37B 3FO1B 4G6MH 5BRZD 1L5GB 2YPLB 4MVBD 4NO0D 4OGQC 3UTSA 3ZKSD 4FFZL 3IF1A 4YDIL 4U1NB 3VFNA 3CIQA 1ZANL 1U8NA 1PX8A 5D93B 4IOSA 1TEYA 3DTXA 3QFJD 1A7QH 1E27B 3D3VE 4LKXB 4O02H 5DK2A 1KNOB 1FZKA 4APXA 3MLPA 1XO8A 1XL6A 5IUSA 3GMMA 3VRLE 3KPRD 5DS1A 4C55A 1KBGH 5DF0A 4A2HA 3MACH 2LVEA 5I74B 4N24A 2J5LC 2Y2YA 4PY7A 3FU3A 5IKCB 3MJ9A 2GT9B 2P7TB 3DSNA 2C9VA 4G8GB 2CJUL 4X6EA 3IMWA 4DP0X 1MY5A 4IRJC 4N2DA 4HGWB 2UY6A 1AQHA 4FQXD 3EDKA 4TUJA 4ALAC 4H8HA 2XTSA 5MI0B 5MEND 5B1KA 2CBPA 1DVFB 3B56A 3FQUB 4Z3FA 3T0BA 3DYOA 3MUJA 4U0QB 3IWVA 2VSMB 2DQEL 4M4RA 4WSJA 4HZLB 3QHZH 1EEZA 4WUKH 3FFDA 4QRQB 3KDPB 4YJZL 1R17A 1HHKB 4HK3N 3IN0A 4LSUH 5EU6E 2X3BA 3IDYC 3APFA 5E4OA 1NGXB 4KAQL 5GGSB 2GT9A 3WIHA 5G4MA 5IB2B 2EDXA 1QO3B 3AAZB 3CTTA 5FO8B 1BLNA 2BSTB 3HS0C 5F9OH 1BF8A 1Q94A 3O8XA 2A74B 2XSKA 4WIQA 1RURL 5D1ZA 3W3BA 3PGFH 1PEZA 3RLSA 3MLUH 1WFIA 5IQ9A 4ZUTA 4MJ6B 1AQ8A 1O9ZA 3ALPA 1RV6X 4JPKH 4I3GA 3GHBL 2X88A 4WUUD 5DCCA 4FQCL 3VWJA 5CJ5A 3T0EB 2HT4C 4RGNE 5MEQA 2VDKH 3E3QC 4OCXL 4OSUL 1OEZW 2VQ1B 4W9DC 5CEYA 4HG4K 3D0VB 1G7MB 2DQMA 2XV0A 2P80D 4Y1TA 2JCCF 2AK1H 5ETUB 2IALB 4HJJH 1W6WA 2G9HA 3EGXB 5I1EL 1TCRA 4AT6A 5T3ZL 1B2YA 1HZKA 3RPKA 4L4VD 5KYYA 3S4SB 2P28B 4FXKC 4GI8A 4YXHL 1KYDA 2BNQD 4PRHE 4PRID 1UYWH 5CZKA 2VLRE 4MNGE 5TTRA 1G0XA 2VDLL 4UDTB 4UDTA 1BQ5A 3ARVA 2I5YH 4HEME 5A2LH 1DN0B 2E6JA 3WAJA 3LKOB 4L5FE 2ATPB 3CH1A 1N3NA 4DEPB 2XTJE 4JFWA 4X7EC 2JTDA 1C7SA 1MREL 2BXYA 4RRPG 4I77H 1G6VK 2DZEA 4DZ8B 2HX7A 3OLDA 2PYED 1YECH 3D87B 3UMNA 1JI1A 1KEML 2DTSA 2Z93B 5HGBB 1A0QH 4U1IA 3OF6A 3ISWA 1QR1B 5C09E 1PEWA 4M5SA 1BFTA 3IFOA 4PJXF 4Y16C 2NMSA 1KTLA 1O7DE 1PFOA 2XVKA 4FKKA 4RWYL 3RY6A 2F58H 4TRPH 3RDJA 4BINA 5KAQF 2V5MA 4KHTL 1EJOL 1FYTE 3B7YA 3HEIB 4JKMA 3OG4B 5E9DE 2C4FU 2GJPA 3QQNA 5SWQB 1N5AA 4PRPB 1M42A 4FQLH 5MEOA 1P9MC 3GPSA 4XNQA 3TO2B 3K7UA 2E9GA 4F15C 2DTML 4F9PA 5IEKB 4CDHA 2B14A 3SODB 2NR6D 1WZKA 3O3DB 1K3IA 1GGTA 1JPTH 5CCKH 4Y5YB 4RLDA 2ZWSA 1XIWA 3ZKXB 2BCKB 5TF0A 3AY2A 1MCDA 3OTTA 1AQDB 5DUPH 3ZKMD 1AD0A 2ZAHA 3I02A 4IRJD 2JVUA 2R1XB 5T1KA 2C4XA 3LOWA 1DQQA 4YH6A 4ZMXA 5DFVC 3DK0A 1CICA 4N9GB 1EGJL 3TZVA 5DMKB 4WEBL 4OFIA 2F9BT 3DECA 4Z76B 4OZGB 2DLFL 4ZS6C 4UT6L 4ZOBA 2EYTA 2VLJE 3LIZL 4KMQA 4PP1D 1P4UA 4FNTA 3BAJA 5EIQA 1K2DA 3CSYB 3L4CA 2Z6FA 3OKNB 5DD1H 4JPSA 2F68X 1OARH 4KFMA 2Q1EA 3INUL 1DTUA 5AB1A 1JK8B 1SOKA 2FBJH 3VDAA 2CRMA 3NABH 3GK8H 1FZJB 1KB5H 4LIQL 5DJ0A 1QI4A 3ARPA 3JT0A 4YSRA 5EPMB 3JVGA 2Y36H 3X14B 1AGDA 1S9XA 3IPEA 4YOKA 3WN6A 5B1JC 5J11C 1ORQB 2RAMA 3JVGC 3F6JA 1AG6A 1INDL 2DIBA 2WJ5A 5PAZA 5F3BA 2Q6WB 4QKTA 4U3XA 1E50A 4PJFA 1Q0YH 1EXGA 2ZWYA 4OJFL 3A6BH 2J56A 2YIHA 2R7EB 3AQXA 1UWFA 1XCTA 3D34A 4BFOA 4I7ZC 1HWGB 3N04A 5T1MB 3WS3A 1NFDE 1S3KL 1TPXC 2FSDA 3HS0B 2PABA 3DYPA 4K3EH 4J3OC 2IC2A 1ORSA 4Z7IA 1BFSA 5I1LA 1JCKA 2OZNA 3H0TB 3SGEI 3B9EA 3R1GL 4AL8L 1AOZA 4X0KA 4LCCC 1HZHH 2WBJB 4XPGH 1SGKA 5F1KC 1H5BA 1EMTH 3FO0H 4K3GA 4LDOB 4JR9L 5F7KC 25C8L 4KTGA 3UZQA 35C8H 5JMRA 3MRNA 3DIVA 5C0ND 1N9PA 4BSVA 5J1AB 3GUTB 4KH2A 4F8OA 4X6DB 2X70A 4U31A 5E70A 2HN7A 3DXAD 1KN4L 4FTVA 5JHLH 3TO4C 5T1MA 4PB0L 3IGUA 2X4QA 2Y5EA 4NKIL 4M5TA 1UXSA 3CFKB 2AJ3B 2EKJA 3HW7A 3VGFA 4QYAA 3O2VL 3SQOL 2X2UA 2Z65C 1JYNA 2ZKHH 2EICA 4PWKA 3O6LH 3DUSA 4FYSA 3VFVB 3GSRA 4OLXH 4MXVE 4MHHI 5ITFB 1ZSHA 3TBTB 3CN0A 1U3HD 1CLYL 4JRYB 2VL5A 4BZ2H 1BZEA 1RU9H 2FX8L 2PF6A 3GRWA 1F86A 1QWNA 3QI9C 3LZOA 4KI5F 5E1AA 3D25B 3VNYA 2WWKO 4ACTA 2YUZA 2ZXBA 5D55A 1QSEA 5LBSH 3O2WL 2H8PA 3FCGA 2Q8BL 3OL2A 4YL9A 3L7FA 4LRIC 3QDGD 5SWZD 2VM9A 4L0YA 1KPUB 1JL8A 1FJ1B 2ZUYA 5T3ZD 4XODA 1RD6A 4RX4A 1V8HA 5DLML 3X12B 4PD4K 5DRZB 3LPWA 3CZNA 3UH8A 4FA8A 2HRPL 3FCSA 5DUPL 3LD8C 5DLLA 4WHTA 3RL2B 2NTSP 3V9FA 2ZSVB 3NTCH 4R7XA 5E6IB 4BKLB 1DQQB 5CUSL 1BF2A 3QZOA 3MNZB 2D7TH 4ICXA 1PZSA 1FBIL 4ODHL 3C2AH 1OZTG 2VDNB 2KH2B 3MJGX 4S1DD 2LU4A 1PJWA 2B0SL 3HPJB 1YEHH 3IVKB 1Z5YD 3QIUD 1BFOB 43CAA 3LRMA 2ITEA 2PWEA 2YD3A 3T6ZA 2K4WA 3MLUL 3TLRA 1SHXA 3QAZC 4PIBA 2NCEA 4IIQB 5I8OL 4U6VH 1D9KD 2JSFA 3WXVH 5L0QB 4GQ9H 2BY1A 4UZSA 3KPTA 5E2WL 3LNGA 5IJVB 1MI5B 1IAOA 5FO2A 4W81A 3V4VH 1QW8A 2WIIA 3QJQB 4FXGC 3FT9A 2X0VA 4OLUL 2MH4A 3HG4A 4P3CH 3EYVB 5DHVB 3ZL4L 4MDIB 5L4JA 2WW8A 4ZYKA 4U6YB 2ZCLL 4PJXE 4G83A 4FYTA 4N5ED 3V95A 1QLRB 4D3CH 5DSCB 2A74A 1KIUA 5B38G 1KWGA 3QIBB 4JRYE 3CBKB 4WO4A 1N8ZB 4YSEA 5TQ0L 4ZQKB 3RVUD 1AACA 4P2CG 3QNYB 1JHLL 5D7IE 3KPRA 2QPFA 5K1JA 2ATPA 4PJ9B 4BWTA 5BZWA 1LP9B 4FLSA 2ZKWA 4I2XE 4HZLA 2D9CA 5EUOE 1IGIL 4YC2C 3CXDL 2J55A 3BKCH 3T2NH 3RBSA 2D7NA 3ECBA 5ESVA 4ZXBB 1WCQA 3B2UD 3QJUB 2OXGA 5H37A 5CJXA 1SJXA 3QNXA 3ZJAA 2WYIA 2APXA 1DE4A 1MHPL 3OM3B 1K5NB 4DPCX 1B4RA 3BUPA 3IRZA 4M56A 5I6PA 3EGXA 5GZNC 4YZWA 2ZNXA 3BOVA 2VZVA 3I84A 3VXSE 2CSPA 4D7BA 3N41F 2YQBA 3ZZSA 4AVKA 2HRPH 3K72B 4DETA 4DT2A 3PE9A 3SO3B 4KX9A 1L6ZA 3D05A 4GRWH 1NUNB 3N0AA 2O6CA 5CIPA 4JPQA 1YMHA 3H42L 1HILA 4LCIH 3QCVL 4XP4H 3KWUA 2CIKB 1SPDA 3DRQB 5AVSB 4A67A 4NDMA 1BPVA 2G2PA 1XH3B 4QTFA 5KVEE 1CZ8H 1I82A 1KXTB 3IGFA 2O1AA 3KYKL 5E2TL 4YHPB 4QRPD 4EF3A 1TSHA 3RKDD 1A64A 3AAZA 3PAZA 4QAWA 3Q2VA 3HB3B 4G8EA 1QPPA 4MJJA 5HI4C 2V9TA 3LS4L 2F5BH 1SJHA 2ITDB 2XPYA 3NOIA 3WJMB 1M7IA 3IXTA 2ZG1A 4LCYA 4R4FL 4DN3H 4XNDA 5DJ8A 5TQ2H 3VXUB 3KXFA 3OR6A 1JUFA 4GW4A 3F62A 3CVIH 2MQCA 2IADA 1RK7A 4DP8X 3EO1B 1QBLH 4LQ1A 2A83B 4N2LA 1GCFA 12E8H 2JE8A 4U2ZA 5AZEH 5EOQH 3VXMD 3V6OA 4E9VA 1R3IH 4FFVC 2PWDA 4FXLA 1N2RA 1QFUH 1IV8A 5D5MB 1I9JL 1U3JA 1JSYA 3EJZC 4Y2DD 1AXTL 4KKBD 2IOOA 5E2VL 3WFBH 5HGGS 5CHNA 5M94B 3P3RA 3GEFA 5HD8C 5GRXG 1TYRA 5DD6B 1E8WA 4JVUA 3PQYB 4QF1A 3WIIL 4K5NA 2YRPA 1QSEB 2FK9A 1F3JB 1QOKA 2CDFB 4ZT1A 4ZX5A 4EIGB 5K59F 4APQC 3BUYB 3V0AC 3LRHA 5HVWA 2ZXEB 1OAZL 4B9JA 1AGBB 3K1KC 4MVBC 5HDBF 1FVCB 1GS6X 1L7IL 4K07A 2WNKA 3CFJB 3GSNA 1Z1WA 2BCMA 1DO6A 1J5OH 1OTUD 1G7PB 4ETQA 3C5JB 4M43H 5EF3A 1A6PA 2AVGA 1T03H 3ZKXC 3LN4B 4WI7A 4L29B 4IGBD 3JXAA 1ROCA 3PY9A 5DMGD 35C8L 1NCDH 4QWWD 4IOFD 3US9A 1AG0A 2ZE0A 3HR6A 3ARDA 1VERA 2ID5A 4N28A 4GW1A 1G5AA 2XIIA 3VDCA 3HB3C 2PYEE 1BBDL 2FR4B 5K39A 1GJIA 4QRTA 4NZDA 5HPOA 1KT2A 1Z5LB 3HZ3A 3B1TA 5FW6A 4Y89A 1DQLH 1I53A 1F6AA 4NN6C 4YVUA 2XTJB 4BH8B 2C9RA 1N59A 1DCLA 1HQRB 4HJ1A 3F2LA 3FB8B 1RP9A 2H2PC 4IGBC 4XTRD 2VWEC 3BPLC 4Y5XB 4L0ZA 4X8XA 2FECL 2GIYA 4P5MB 4N2AA 2FD6H 1NSNH 4GAGH 4AQ8A 3KPOA 1EHKB 3FU8A 1LO4L 4DP6X 1ETB1 3IU4L 4M7JL 4WGWB 3EZJB 4PJ5B 4FFZA 4UINH 2EXYC 2X10A 4MS6A 5A6MA 5A3ID 3WEXB 4QIRA 2RACA 1OK0A 1BBJB 5J12B 2Y25A 2HLFC 4MX7B 1IFHL 2WWOA 2ZPKH 5JDSA 4OLVH 3O4LB 4A6YA 2OCFD 3VGBA 3OKYA 2VDOB 3E8VA 3OBAA 25C8H 4JFPB 4WI9A 4ELME 1G7QB 2Z4QA 4HK0A 5DVLA 5I0ZA 1LDPH 4PGEB 1V7NL 4UUJB 4W4OA 1KIRA 1SXCA 4ZFOL 2N59A 2GTZA 1MXGA 3MR9B 1FNSH 3L2LA 2B77A 1H0DA 3BO8A 4F2EA 3EYSL 1QLRA 4AVHA 4PJDB 2FUQA 1H3GA 4XWGH 1AR2A 3TFBA 1RPKA 3WMPA 1FYHB 4FXKB 2V17H 3W81A 1UACL 1ZA3B 1NIBA 2A9DA 1FGVL 5I1HL 1FGNL 4R7DA 3D39B 3CXHJ 4JFDB 4JQXC 3JV4B 1OSYA 3QCUL 4L3FA 1IZJA 2CALA 4W70A 1NGYA 2B59A 4CSSA 1GZPA 1YA5A 4HMCA 4HPYH 4L4JA 3DX9A 1S7VA 4PBVC 3V7AG 5KJRH 4F2ME 3TCLA 5BUPA 4AYFB 2JKJA 2D0HA 4R26H 3ROOA 5AW0B 3D69A 1G7HB 3BIBX 1XIWB 4J1UA 2LV4A 4YNYA 2P8MA 2DLHA 2DQUL 3W9DA 2ZOOA 2ARWA 4NHCH 3U2JA 1BQRA 4KTDL 5EU4B 4U1LB 5B8CA 2ZQKA 1OANA 1UXWB 3BH9A 3CFDB 3I9AA 5CP7B 3UBFA 1LO5B 4Z3EA 4PJGF 4KUCD 2VR9A 4M4PA 2CE6A 3BPLB 5HJBA 4AJVA 4QCIB 4K7PX 3P2TA 2XWJB 4FKHA 5J1SC 4P2AA 3Q2LA 5DFTA 4JVPA 1HKLL 2ZXGA 4RMQA 1JMZA 5GS1C 4BDVB 5C0RH 4H8UA 1VFMA 3CSYA 3EYFA 4GLRH 4CSZA 3ARQA 1V3MA 4U1GB 2QVIA 1UA6L 4Y4FD 4MJIE 3WFZA 2G0LA 1GPOL 2Z93A 4JFYA 2BVPB 2LOEA 4X0NA 3QRFM 4QWWC 2HA1A 5F9DC 2O5XL 1TDQA 1QG3A 3M8OL 5C9KA 4HYTB 3MXWL 2OAAA 1QSZA 3OAYK 1K72A 4K3DL 5CCGE 5KVGE 4JG1L 3TZVB 3FO1A 3VI3A 4DAGH 4XE0A 1I1AA 1L0YA 3STZB 5AVUB 5GQBA 1BVLB 4YHMH 5IBTL 2XYBA 2NY3B 1I4FA 3W0WD 3IETA 2UXGA 3NA9H 3I6KB 1H6FA 4GT7A 2AXFA 3HNSH 3X17A 5CD3B 2C9AA 3ULUC 3GSNB 5DK3A 4HUWB 3IWUA 4J3BA 5DC0A 2AV1B 5IBUB 2Q7NA 2GEQA 1TJIH 1ANUA 2NW2B 2J57A 1FLRL 3UDWA 5JW4N 2DMBA 2EDRA 2KLTA 5FX3A 1U4FA 1FVDB 5IB4A 2GITB 3LEYH 4TNEA 4F7MA 1S7XB 4G6ML 4QF1B 4WRLA 4U3CA 3TH4T 4A66A 3CXHK 3POCA 5GS1A 1RURH 5ALCH 5IV2A 2YAHA 4QHLA 3ARDB 5T1LD 4NX0A 2K1MA 2EEBA 1ZSDB 5D2NC 4UOW0 3BYYA 1QD0A 4FNRA 5EU3B 3WGUB 3SDAA 5KSAB 2WQUA 1VFAA 1PAMA 2BP0B 2QSQA 2A6KA 4F58L 2BSRA 1I75A 4YHKL 3MLTA 4C58B 1R5IA 1YEEL 3PP4L 1ZV9A 1TKWA 2VDPL 1S7RB 1R3LA 4I0PC 2YAOA 5SWZB 3MA9L 3CLEH 1JZGA 4KK6D 1DFBL 1QLFB 1UC6A 3MFGB 3QQ3B 3O6FA 2OMWA 2VLMD 1TVHA 3G08A 1HCFX