4WUKH

Crystal structure of apo ch65 fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYHINWVRQAPGQGLEWMGWIHPNSGDTNYAQKFQGWVTMTRDTAISTAYMEVNGLKSDDTAVYYCARGGLEPRSVDYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CH65 heavy chain
publication title Structure of the apo anti-influenza CH65 Fab.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wukH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wukH01
4AMKH 4I13B 2CMRH 1Z0NA 3QUXD 4X6EA 1E27B 3BN3B 5JPMB 3BRGC 1U6AL 1OY3B 1IRAY 3BOVA 4LVOC 3QEQE 3QO0A 3QXVA 4NC1C 4WWKB 1EDQA 4PBVC 4PJ9A 4YFLF 3EOBB 5IQ9A 4AEFA 4J3VA 3UYOD 2W91A 3VRIB 1QBLL 1H8SA 5DRZB 4HLZG 4XP6H 3ARDC 2D3VA 2L0DA 1TZGH 1OAYL 2BXZA 4YFDB 1YN6A 3S35X 1DZBA 3R4DA 3FCTB 4F58H 5CMAA 1W0VA 4M6ML 1P2CA 2AK1L 4K7FA 3Q3GA 1AE6L 1FFPB 1ZGLA 1MQKL 2FNBA 2DQGH 3GMMB 1T6WA 5F7UA 3FB6A 4XC1H 2XTJD 3U9UB 1A47A 1JPGA 5JPMA 1E27A 2FL5B 4JANA 4OCRL 4KJYB 1MQ8A 1H5BB 3KVQA 1GOGA 3PWLB 3WCYA 4WWKA 4L8CA 1ZEAH 4OUUB 1Z9LA 2ICWI 2APFA 1JN6A 3C8DA 3OQ3B 5DRZA 2X40A 3DVFA 1K8DB 4HUNB 3N1QC 2J5LC 1JZ3A 4TNVK 5DLML 2VR4A 2Q6WA 4LF3B 1JJUA 5CZXC 4XGZA 4LMQE 3QDJB 1FFPA 4G7VH 5EU7C 3TF7C 4Y1AB 3GMMA 3RWIA 1LO2L 3U9UA 1OTUD 2FL5A 3GKWL 5I73C 1GCFA 2H41A 4O58L 5HHMB 3CXHK 5MEOA 4U1IB 4OUUA 4R6UA 5T1KB 3WJLA 1A0QL 4X8JB 4NC1E 1INQB 3IRZA 4EN3C 3C09C 4XC3H 1NGXB 3F7QA 3UJJH 5ELIA 3EO9L 2IBZY 1OW0C 4LF3A 3P4MB 4DKAA 2QQKH 4JM2F 1EFXD 1EUTA 1PG7L 1A6VL 1IKFL 1QLEH 3H7LA 3KPSA 1YQVL 3L3HA 5I1DA 5FYKU 1N0XL 3MLUL 4FFWC 3D25A 2Z9TA 4Y1AA 4J3TA 2EE3A 3TWCL 2D7TH 2VO5A 3TV3H 4OM0L 5FGCB 1RUPL 3IDMB 3QEHB 5DUBB 1YJDC 2P44B 3MLWH 5C0CD 1JWUA 5T1KA 2HWZL 1GHFH 1INQA 1KLFA 4PRBB 4PY8I 4PRPB 1KCRL 2IMMA 3EHBD 4KH2A 5EUOE 4NGHL 5GGVL 2Y07L 5BVJB 2BVPB 3FB5A 1T22A 2VXTL 4ZFZB 4JRXE 4DUVA 2VUYA 1AXTH 1UKQA 3OG6B 2HVKB 3KPQB 3KPOA 1HQ4B 4OD2A 2O61B 4E41B 4P2CG 4U0RC 3X11B 1A6UH 5GGRB 5CIPB 15C8H 3MJ6A 1AY1L 2X6MA 3U4EB 5LGHH 5EU7E 2DMKA 1GL4B 2XA8L 5F6HI 5GS0D 4J2XA 4TVSa 5IFAH 1JYXA 4X6FB 4K71C 4L8BB 4RISH 1GGTA 4M93B 3ARZA 3WNPA 2DQIH 3B8YA 3UTZA 3IDMA 3QEHA 1I7RA 3S98A 3VDCA 4WWID 3BP4B 3IAGC 3V0VA 2H2PD 4PRPA 5D7JB 1Y6KR 3VWKA 2VLKE 3SGJA 3FQNA 4LHQB 3MPCA 4XMPH 2BVPA 2BOBB 4XP6L 3UROR 1FG9C 1CLYH 2XFXA 3KPQA 1TZGL 3ZTNH 1HQ4A 4HUVA 4X5WB 5E70A 4E41A 1M05B 5GGRA 4NSKB 5CIPA 4F58L 4ONGH 2FO4B 2PETA 1S8DA 1JPFB 4JPKH 4PJBA 4I0PD 2FX7H 4KI5D 4JPVH 3C60C 2A2QT 4P4RB 2DKSA 5DRXB 4Y4FC 2DQGL 4L8BA 3VCLB 4ZSOE 3BWUC 3PGFH 4XC1L 3QUYC 4PJ7A 2DICA 1ZXQA 3V79C 4QXGH 4R0LC 2CUHA 1ZEAL 4LLYA 4K3HA 5AD0B 4JKMA 1FGNH 1S5IH 1KCSH 2FZ3B 3RWEA 1UXWB 1QFWI 1Z9MA 3MOAH 2KL6A 1M05A 1XAUA 4N0CD 3VG9C 4LVHC 2OSLA 1BD2E 1JPFA 1OLLA 4G7VL 3QCVH 4P4RA 4JDZB 5DRXA 2BNUB 1RJLB 2OTWB 2R1YA 4YPGA 3SDAC 2OI9C 1WITA 3QEQA 4AL8H 1Q1JH 1U8HB 4FTVD 1BBDH 3BKMH 2FZ3A 4A6YH 3UTSD 4XC3L 3UJJL 1WZLA 4C4KT 3VGDA 4BELD 5DZLA 2QQKL 4HEME 3F65A 1QLEL 4NRXB 4BSWB 4OFVA 1EAPB 1TJIH 3VW3L 4HS3B 5ADOH 3OKMA 3QDGD 5E1HB 5JXEC 3OR7B 2D7TL 5EOCJ 3TV3L 4MAUL 4KTYA 1NFIB 1PKQE 5A1AA 3V0WH 4EBQH 5A2IH 3MLWL 3TZVC 2EE9A 3MLPA 1GHFL 2Z0BA 4DFHA 5E08H 2XA3A 1WBYB 4HD9A 4BFBD 1CGVA 4LL9A 3ARDB 5E7FA 1PQZB 3D0LA 5TJWK 1WZ1H 1NC4B 3N1PC 1AXTL 4G6FD 2EDKA 2IG2H 3BESR 3TBWB 3KLSA 3WNLA 4FQXD 3S3JA 2H3NB 4NRXA 4BSWA 3EDKA 1A6UL 4MWFA 1MWAH 15C8L 2X70A 4YGAB 4HS3A 3VH8G 5LGHL 1RVFH 3RHWF 1BHGA 5IFAL 3OR7A 4ERSH 4PJGE 4HV8B 5GISH 1OTTC 2YD3A 4RISL 3NPZB 2DQIL 2Q20A 1NFIA 1T80A 5I0DA 2JELH 1ND0B 3WIFB 2AJUH 1JFQH 3SDDD 4FZEH 5C0GA 1HWGB 4WW1A 2FWOB 5GRVK 5C0FA 1JZ7A 1N26A 1WBYA 1ZMYA 1MCWW 3ARYA 1G6RA 3KXFE 4LRNH 4XMPL 3ARDA 3LRSB 1J5OH 1PQZA 4HS6B 2ZUSA 1CLYL 2ARJQ 4NM8H 3ZTNL 1CGWA 1H3WM 2H3NA 4D8PA 2YK1L 3QT2A 5D1QD 2VZOA 1PDKA 3MBEC 4FFVC 4ONGL 3G5VB 1BZ7B 1FZMB 4JPKL 4K3JH 2FX7L 4JPVL 2A1WH 1MFBH 3ZYZA 4J4PC 4HV8A 1J12A 1IC5H 3PGFL 4M5ZL 5DJAB 2Z35A 1ND0A 3WIFA 1U8KB 5H2BB 2YD4A 3SKNB 4XNMB 2B4CC 1JF5A 3K1DA 3QFJB 4QXGL 4M7LL 2R2CA 2VLRD 3G6DH 2FWOA 1NH6A 2MTPA 3EJYC 3S37H 4EN3B 1MAMH 4ZPTA 1FGNL 1S5IL 1KCSL 5GGRY 2BOCB 4MJ5B 4HS6A 2NYYC 1ZHLB 3LKQB 4JRXA 3GSVB 3CX2A 4V1DE 1EAJA 1BF8A 3MOAL 4E42B 3HCVB 5TDPA 2V17H 5IR1B 2ZZUT 4MSWB 5HGHA 4EIGB 3G5VA 1YUHB 4JFEB 3H6JA 3RVXD 3VFSB 3V7AE 1NCDL 1CFSB 4NDMB 3G6JF 3QCVL 3K81A 5DVMA 4MD4A 4GRLD 1MHHA 4LKXA 4OF3A 1PYWA 5DJAA 1U3YA 1KELL 1E4KC 1U8KA 3GGWB 3SKNA 4XNMA 3FTGB 3QFJA 2WMPA 4PYGA 4AL8L 1Q1JL 3R8QA 5T3ZE 3ARUA 4YR6B 5DK0B 1BBDL 3BKML 2VLKA 1BZ9B 4EN3A 2YD2A 3O6KH 4A6YL 4NBXB 3H7BB 1MY5A 5FV1L 1T0MB 3G6AB 1ZHLA 3LKQA 4NQEE 3AS2A 4HWBA 4WFGD 3GSVA 4E42A 3HCVA 3QUZC 1OW0A 5IR1A 4MSWA 1YUHA 1J18A 4QTHB 1R5WB 1KCVH 5EU6E 1TJIL 4HUUB 4NDMA 5IB1B 5EWIH 1O7VA 5ID0A 4GAYB 2Q86B 5IM7B 2FR4B 2ZKHH 4RMRA 3FAWA 3OAYH 4OF7A 3GGWA 3QQ9C 2DRUA 4D0DB 3FTGA 3VXRE 1GIGH 1YMME 5HHXH 4EBQL 4YR6A 3C2AH 5DK0A 1WZMA 3NAAH 5C09B 1BZ9A 1MCKA 1F3RB 5BZWB 5EZIH 2ZG3A 4N90D 3PWVA 4EDXB 4G80A 3GMPB 4ODHH 4ZO7A 1RJYB 2CUMA 2V5MA 4HUXB 3U0TB 5E08L 1LE5B 2NTFB 2VZTA 2QKIB 3QYCA 5AUMB 4RA3A 3GMQB 1UH4A 3CK0L 1WZ1L 2JK5A 1OGAD 1F6AB 4WEMB 2IG2L 1FVDA 3GSNB 3THMH 1R5WA 4PP1C 2P5WE 4HUUA 4V2BA 1MWAL 4G9FB 4NBZB 5HGGS 1RVFL 2X4TB 4X83A 4GAYA 2BMKB 4ERSL 5GISL 1QNZH 1G7QB 3Q6FB 4D0DA 3B2UC 2FJFB 4H1LG 4NOBA 5HI5D 1J88A 2JELL 3VXMB 3CSYA 1A6ZA 2AJUL 1AD9A 4KRPD 5SWQA 5C09A 2CRMA 1HSAB 1JFQL 2R2HB 2F8OA 1VEPA 3PG2A 4G43B 4R0LB 3CDYA 5BZWA 2CDEB 2A77H 4EDXA 3GMPA 1LE5A 5FUCC 4HUXA 3BH8A 2NTFA 5ICZA 5AUMA 4LRNL 5DFVD 3GMQA 3DTXA 4LHUA 1J5OL 4LPUA 3OR6B 4NM8L 4U6VH 4K07A 4BZ2H 2UWEB 3GSNA 3KJ4C 1XCQA 4LVHB 3MNWB 2FJHA 1IKNA 3O3EA 1J05B 1P7QD 1U58A 3PABB 3C60A 3HZYB 2A1WL 1J8KA 2D0FA 2DKUA 4P3DB 4Y4FA 3AREB 3B43A 3LDBB 2FEDC 1IC5L 3I84A 2FJFA 1KEGH 3QUYA 4LSRH 2Y06H 4QXUL 1PKQA 4FQJH 2XY2A 3SDAB 2IAND 4RIRB 3MO1B 2R2HA 4R0LA 4U1HB 2NXZD 4JCMA 5DJDA 2H2SD 3G6DL 2VRAA 1ACYH 4JFDD 1SJEA 1UGNA 3RWHB 4I4WB 3S37L 4HFUH 1MAML 5SV4A 2I26N 1GZQB 5JMRA 1MCOH 4LCWB 3A6CH 3KPRE 3T3ME 3OR6A 1A6AA 4YO0B 4OZIB 3T4YA 2V17L 3T0ED 3BHBA 2HT4C 1ZKAA 3MNWA 2R1WB 4F2MB 1X4YA 1J05A 2IH1B 4R90H 3PABA 3HZYA 1FG2B 3KPPB 4MD5B 4PJGA 2AS5M 3KYNB 2QBWA 3IXTB 1WFNA 4XVUD 2N7BA 4KPHH 3N0PB 1KJ2B 3SDAA 4RIRA 2IAMB 4Z7VF 2VDRH 5IBUG 4U1HA 4YDIH 3B9VA 4OLVH 2JTDA 3TZVB 3RWHA 2WLZA 4NWUH 1F4AA 3KXFA 3O6KL 3H0TB 5KG9B 5FUCE 1IC7H 1EPFA 4OZIA 4J23A 4YO0A 1QRKA 1JI1A 4V1DB 1HOCA 3LHPH 5J1AB 5ABDE 4GAJH 1ZLSH 5JORB 2X89A 3FONA 2R1WA 4JY6B 1AHWC 1P6FA 2IPKB 1KCVL 1FG2A 1OP3K 4MD5A 2DJUA 3KYNA 4X9GA 5EWIL 5IVZA 5JXEA 5IMOB 1TCRA 4JHZA 3MV01 2YUZA 1KJ2A 2ZKHL 4RWHA 2IAMA 5HTSA 3TLRA 1JNHB 3WEXB 2YMXH 3QNYB 1RUQH 1GIGL 3KLHD 5F7LB 5HHXL 4S11A 3TZVA 3BZEB 4ORGB 3C2AL 3CFJB 3NAAL 3QBTB 3H0TA 5EZIL 5DQ9B 5KG9A 4ODHL 5EBLA 2R0LH 4V1DA 1QHPA 3JVGC 4XB7A 4TNVF 1TDQA 4D9QD 1FRGH 3TNMB 4EI5B 3QPQD 5JORA 1B0RB 3VD7A 3S7GA 2ZUXA 3THML 4K3DH 5BMFH 3MNVB 1S9KC 2HAZA 3PV6B 5HDBE 2GCYB 1BQLH 2DI8A 2YPKB 1Z3GH 3EHBC 5IMOA 1DFBH 3CSBA 5IUSA 1QNZL 4LASH 1J10A 2E7LC 5D9SB 4WY7H 3MRIB 5DJYB 1ZVSB 4Z95H 3UYPA 3CFJA 5T3ZH 3ILPA 1PEWA 5ITFB 1H3VA 5IB4B 4QEGA 3RBGA 2DIBA 3E1F1 1DLFH 3TNMA 2AV7B 2MNUA 3O3AB 4HULB 5IIEA 1B0RA 4U6VL 4LAJH 2VERN 5C08B 4LPWA 5IJKA 1F97A 1QBML 1LP9F 3MNVA 5EU6A 2P5WB 1K3ZA 3PV6A 5CP7A 2E6QA 4X4YB 4RGNB 3PDDA 1KTLB 5EDXA 2YPKA 3OSKA 4FG6D 4J4PA 1CGTA 4NCC2 1FNLA 4D3CH 1J8HB 1MCBA 2DAVA 4U2YA 3O9WD 1IAIH 1KEGL 3VXRA 3ARVA 1YMMA 2Y06L 4LSRL 5D9SA 4YE4H 1W2KT 4FQJL 3WUZA 5LQBH 2ADGB 2RQ8A 3NZ8A 3HA0A 4AY0A 2Y6SD 2VIRA 2ESVD 3VXNA 1ACYL 1F6FB 5B8CB 3ISWA 4HFUL 4I0PC 4HXAL 3GB7B 1MCOL 4FQQB 2AV7A 2G2RA 3A6CL 2PF6A 3O3AA 5D1XD 4ZFOA 1V8HA 4YQXH 4QHUB 4OCWH 2EKJA 3LVEA 4NJAH 5TQ0H 1GOFA 2P5WA 5C0CE 1KTLA 4P2OB 4UILH 4FFYH 5JHDD 3NFNA 5F1NB 1MEXH 1KACB 2NY6B 4KPHL 1E4KA 1U91B 3I3EA 2O26U 5GJSH 4XP9H 2HMID 3DGCR 2X1XR 4P23C 2VDRL 3MV8E 3PL6D 3FQXB 3L3OB 4OLVL 1J0YA 4NKDA 3B8SA 3ILQD 5T33L 4ZTPH 1FNFA 2DYPD 1X5AA 4NWUL 1NKOA 3K4ZA 4CADA 4JVPA 3GB7A 1IQWH 1IC7L 2XQYG 5DMYA 5HYEA 4FQQA 4YDKL 1RUKH 1KJMA 3HE6D 3VGEA 4QHUA 3DRTB 3LHPL 3ULVD 5JOEA 4GAJL 1ZLSL 2R0WH 5I18H 3KYAA 4PJCF 2ZNWA 2IH3B 5CP3H 4P5TB 1KIPB 5I75C 2W9EL 5HHOD 4S10A 5F88B 3UX9B 4Y4KB 1FC2D 5F1NA 2ITDA 1U91A 4P46D 4WGVB 2F53E 4RMVA 1FSKB 2YMXL 2LU7A 1EEYA 1RUQL 3L3OA 1HSBB 4LLQA 2XN9B 2ERJB 1YPZE 4MA8H 3U83A 4PGBA 3BO8B 1FLRH 5E5MB 1KLGA 3CDGB 4XNQA 4N5ED 4TULH 2UYLB 1HNGA 4OLXH 4MXVF 3KPRA 2R0LL 3DXAD 3BUYB 4KUZH 5FM4A 1FRGL 3RL1A 4MQ7B 1D6VL 3QUXB 4ETQB 5MEND 2IH3A 1KIPA 4K3DL 1O7SA 5BMFL 3IAQA 4QKXB 1CFQB 4HKBA 2J6EH 4OUOA 2PCPA 1BQLL 2E27H 4JVUA 1Z3GL 1DFBL 5F6IC 2J1KA 4LASL 3FO0H 1LILA 2EDLA 4PTUA 5DK2A 5DRWB 3HI1B 5A43C 3FT4B 3KHOA 2EE6A 2XN9A 3C6SA 4ZUWB 1JWMA 4HZAA 4Z95L 1IE5A 5T3ZL 4WTZA 2PXYD 2EDEA 2Y7QB 3FRUB 5I76A 3CU1A 1LO5B 3CDGA 4J8RB 2UYLA 3MZTA 1S9VB 3DX7B 5F7MC 4CNIB 3BUYA 4Y5YC 1DLFL 4RZCB 2HRPH 4DKEH 1CR9H 2XTJB 4G8FB 4MQ7A 4CDHA 3QUXA 4XBPB 5B39A 2VZ3A 4GQ9H 2IPUG 4UDTB 5EO9B 5EU5B 5JTWA 4PRHE 2GKIA 5HD8D 3TCLB 1CFQA 3KJ6H 4AG4H 3IF1B 4HWEH 5KJRH 4D3CL 2GAZA 4LIQH 3NCYS 1IAIL 3FT4A 2CKBH 5LQBL 2NZ9D 5F70A 2LV4A 3SJVD 4HIIA 1GYAA 5GZOC 2VWEC 5GRJH 2Y7QA 3FRUA 4BKLB 3V0AC 2A0LC 4JAMB 1HN1A 2SEBB 3WO4B 3V6BR 1S9VA 3G5YB 5AAWA 4OCMC 2B5IC 3DNKA 4H0HB 4WFHD 4G8FA 4YQXL 5ICYB 4XBPA 4OCWL 4ZFOL 4HMCA 1T5XB 4UDTA 5EU5A 4NJAL 5KW9H 2P48B 5TQ0L 2OZ4A 5LAXB 3TCLA 1WFTA 4OLWH 1WFOA 1LEGB 3W39A 5ETUB 2OP4H 3DLQR 4UILL 4FFYL 1MEXL 3JV4B 3OJVC 5GJSL 3ARFD 4HW6A 4RRPA 5CSGA 1CI5A 5FYJU 5K9JH 5GRXG 1EFXB 2WWKO 5FO9B 3K0WA 1U8NA 1INEH 2IADB 4ZTPL 3WS3B 3BH9B 2H1PH 5GPRA 4IRZL 1JNNH 1IQWL 1AIFB 4MA3B 4GRLC 4QO1A 1KCUL 4IHOB 5ICYA 1OCWH 4LDEB 3QB7C 5KZCD 3DGGB 2R0WL 5I18L 5LAXA 5C0CB 1LEGA 4CVWA 3N1MC 5ETUA 1DQMH 2ZCLH 1QFWM 2NY5C 4U1LB 3MREA 5I71B 1U3JA 2NY4C 3MV11 5HYSG 5GZND 2OJZH 1IFHL 2CK0H 5FOJA 3FB7A 4JVWA 1D5BB 1MHPH 3VGBA 4O5LH 3KS0H 5BW7C 1U8JA 1NCWH 1DANT 1T2JA 3CFCH 2YBRB 5E9DD 1A4JA 1EFXA 4R4BB 4X4ZA 2VWEE 4MA8L 3PDGA 3ZE1F 2Q7YB 3WS3A 4ZFFB 4YFEA 1FLRL 4BFGA 2NR6D 4TULL 1AIFA 1ZS8B 4MA3A 4AIZB 4OLXL 4XX1E 4MDJB 1T89C 4FZ8H 1VEMA 4KUZL 4LDOB 3SBWC 1UFUA 5FKPB 4R96B 5CJQH 5C0CA 3VXUD 5D7SH 2EDWA 2BNQD 2VLRE 3QDHA 1HHIA 4ZODA 4NZDA 2XG4A 2J6EL 3N1FC 2E27L 3KR3H 1D5BA 3EFFB 3RVWD 1I1AD 2E7LA 4NRZB 3FO0L 3L95A 1MCSA 4BH8B 5I8CB 3P9WB 3MV8A 2JIXD 3QHTC 4LLDB 3ZDYF 5B38G 4R4BA 2FO1A 4P9HC 2Q7YA 1QACA 2ENYA 3LS4H 5F1IB 3EGSA 1ZS8A 4I0PB 5F8RC 1KJ3H 2EEAA 4O2CA 3VGHA 4WNQB 1A1NA 2I9TB 4EDWL 2HRPL 5FKPA 4DKEL 1CR9L 1S7UB 4OCXL 1S5HB 4GQ9L 3IT8D 4R96A 2K1MA 1ED3B 3B9KD 3BP7A 5C92A 4Z7WE 4WCYH 1RIUH 4ZPVB 3KJ6L 2H45A 1U95B 1BFSA 4HWEL 1MUJB 3V5KB 5BXFB 3MFGB 3EFFA 1EH9A 1KIRB 3MRRB 5KJRL 3CCHB 3VI3E 3KYKH 4NRZA 2F53A 4LIQL 4BH8A 4WFGE 3QUKB 5I8CA 1OOAA 4S0SD 4I9WE 2CKBL 3IU3B 2BX5A 5E6YA 2WQ8A 2X4PB 1T3FB 3M8OH 1NEZA 3BGAA 5GRJL 3MROA 5LXGH 1N5YH 5BOZG 5F1IA 2Z4QB 4I0PA 1BVKA 1U8OA 3NCFB 1FO0B 3IDYC 1MCPH 3NIGF 3QWOB 1R3JB 1XGYH 2A6KA 5B3JF 4BZ1H 1S7UA 2BY2A 1S5HA 5FHBH 2M26A 4G9DB 1JF1A 1UQSB 2AQ2A 1CXEA 2NXZC 1BVLA 1MSPA 3UPAA 4FTVB 5GXBB 5J7CC 1L9NA 4OLWL 4LMQI 4U3XA 2OP4L 4JFOA 5J8OA 1U95A 4TUJB 3UTSB 4N90E 4MJIE 4W81A 3CCHA 3ZL4H 3O6FC 1EO7A 1R24B 2DI7A 2VITA 1V3JA 1UZ6F 3IU3A 5GGSB 4U7KA 4P23A 1OGTB 1OGAE 2D7QA 2X4PA 3RVUC 3T0EC 1ES0B 1T3FA 2XKSA 2YUVA 4V2CB 4BH7B 1ZHKB 5K9JL 4OZGB 2Y9RT 2Z4QA 1INEL 2B7DT 2ZOLB 1FO0A 5C0AD 3GMOB 4AK1A 1JNNL 3QWOA 3IKCB 2APBA 4Y7MA 3O2DH 3QDGB 1ZLWH 4YJZL 1WUNT 2ZCHH 4XVUC 2CLRA 1KB9J 1NDGB 4PB0H 1OAKH 3AFLA 3S97C 4E5XB 4G9DA 5GS2D 4L1HA 1OCWL 1UQSA 5DQDH 1XCTB 4PRHA 1MVUB 4Y8AA 3GI9H 2P1YA 4PFEA 1U8PA 1A7QH 4KXZH 3S4SA 5ALBL 1DQML 1F4HA 2ZCLL 4TSAH 2GITB 4TUJA 3T8XB 1NGZB 5IBTH 5JLZB 2OJZL 5CZVL 2CK0L 1R24A 5FKAB 1IZJA 1MHPL 5GGSA 4O5LL 3MCG1 3BDBA 1NCWL 4YDLC 5D2LE 1ES0A 4G6FB 3CFCL 4FQXB 5CCKH 4OZGA 3S8WA 2ZOLA 1YZZA 3OJDA 3GMOA 4C83B 2JJSC 1NDGA 4FZ8L 4Z7QF 4ZO9A 5E5RB 4Y5YB 5EB9A 4ELMB 2C7UB 4E5XA 5F9OH 1XCTA 3G08B 1MVUA 4CU6A 4YHLH 2CR3A 5SX5H 3KLHC 5ESAA 4QF1B 1BAFH 3CAFA 2WUCH 5CJQL 1BQHB 5D7SL 1KXVC 2GITA 4JJ5B 3SDDB 3T8XA 5F7HA 1G7JB 1SM3H 3FJTA 1NGZA 5JLZA 4M02A 3H3KA 4N9GB 3KR3L 4NKQB 4MB4A 5FKAA 4NNYA 5E2JA 1REIA 1DL7H 1NDMB 2FIKA 4CRPA 1MFEH 4PD4K 1Y18B 2R0KH 5I15L 4FQXA 3T0EE 5D1QB 1BVZA 2PTTB 3WXVH 3LS4L 3HAEA 5DEFB 1KB5B 4AIOA 3MFFB 4WENB 1KJ3L 3STZB 1IGIH 4QHKI 4PJFB 3T09A 4Y5YA 3MV7D 5A3ID 2C7UA 3RIFK 1TVHA 3G08A 4HCRH 1KFAH 4QF1A 3L3KB 3PWJB 5D7KD 1BQHA 1UEMA 1G7MB 3L7EB 4I3GA 5IVXB 3SDDA 4JJ5A 1RIUL 4WCYL 2J4WH 2VLRB 4OLEA 1G7JA 5F93C 4H8WC 3KPLA 5DJ0A 1L0XA 3RVTD 1PZ5A 3KYKL 1NDMA 1FP5A 4GAGH 5I1AB 2Q87A 4H1LB 1Q9KA 4DOHB 1Y18A 5DA4A 4P2QD 1KBGH 1YY9D 4YBQD 3M8OL 3CXHJ 2PTTA 3QIBD 2BSTB 1GGCH 5DEFA 1HDMB 3BMWA 1KB5A 2F74B 1JGDB 2ZUWA 4PUBH 5H37H 4U2ZA 4X6DB 1MCPL 5EPMA 3VA6A 3MRFB 4GRLB 5JPNB 5I16A 1XGYL 4FQCH 4HJGB 2B20A 3O9WC 3EYFB 4BZ1L 1UEYA 3MUGB 5FHBL 4UTAH 3L3KA 1R3KA 3NN8A 5HGBB 4K8RH 1WGOA 3L7EA 1G7MA 3B6SB 4K23H 5IVXA 2VLRA 4PGDB 5FA3B 3ZLQC 1SBBA 3EZJB 4UAOB 3FO9A 5I0ZA 4Y89A 1U8QB 3C08H 5I8EB 3ZL4L 3G04B 4J3UA 4KROC 5D1XC 4JG1H 4WW2B 3BYTA 1NUFA 3UC0H 4G6KH 2BSTA 3AU1B 2V7NB 2D0GA 4AH2A 1HDMA 5IGXH 1JGDA 4C54A 4D0CB 1S9XB 4K2UH 2J8UE 4Q9BA 3SKMB 3TBYB 1WTLA 1CDBA 4GRLA 2KH2B 1OWRM 3O2DL 1MJ8H 4LLWA 2ZCHL 1FNAA 3WHE1 3MUGA 4PB0L 3EJZC 1OAKL 5JUEL 3UBXG 5DQDL 5HGBA 2HMIC 3D1MC 4XWGH 1G6VK 3B6SA 4Z7WA 1F4WH 2ADIB 3GI9L 3PL6C 4HQQL 2X4OA 1A7QL 2KZWA 1DQQB 3VMOA 4TSAL 3QO1B 2NY5H 1U8QA 5CBAA 4NQCE 5IBTL 3G04A 5L0QC 4HX1B 5JW4R 3HE6C 5BW7A 3ULVC 3QEUA 1OGAB 2QL1A 2V7NA 2X4UB 1AGDB 5CCKL 2NZIA 4D0CA 1S9XA 3SKMA 2H32B 2GSIA 1ZT4A 5DD6B 1HZHH 3REWB 3GBNH 3NFSH 3GMLB 4UNUA 1T89A 4JR9H 3WIHA 3SBWA 4X7CC 1BREA 3MCKB 5F9OL 4YHOH 4PRAA 1JV5A 4YHLL 3DV4A 5GGTH 1YEFH 1BAFL 3O8XC 3NPSC 2WUCL 4KRPB 4WEUD 3QO1A 2HFTA 4Y5VB 5F89A 2ESVE 2WUBH 2UZXB 1SM3L 4MJIA 4DWHA 4N5EC 1QSED 9CGTA 5F7KC 4K9EH 1T4KA 3H9SD 3QCTH 2FLRT 1YMHA 5J06A 3PXHA 1MCEA 1OGAA 4GRWB 1DL7L 1MFEL 2AW2A 4X7DC 2R0KL 2X4UA 3O4LD 4PREB 5E6IC 4L3CB 3SE3C 5JW3H 4CUCA 5J11C 5J1SC 4Y2OA 2H32A 3DVGA 2AK4D 3WXVL 2BRRH 5DD6A 2VABB 1P7QB 3REWA 3NCCB 2AQ1A 3UTTE 3IDYB 3BVNA 4YBLC 1IGIL 4DZBB 4M6OH 2AEPH 5ISZD 5JHDE 3MCKA 4JZOA 4HG4J 4HK0B 3LAFA 4ZD3L 3MJ9H 4HCRL 1KFAL 2IANB 5AZ2H 1F00I 2X9WA 2NXZB 3GFUA 2PXYC 4Y5VA 1I3RA 2J4WL 1IT9H 4JFDB 5BJTB 5CKAA 2VDMH 3T1WA 4GT7A 1ORQB 3QH3A 4R3SB 4HAFA 5L88H 3ULVE 3TO4D 1KBGL 1M4KA 3T0EB 4M7ZB 3SQBA 2ITCB 1G0DA 3OV6A 4IMLB 4NIKB 4LDLB 3KYMB 5DS8A 4NN6C 3RWDB 1K4DB 1P7QA 5EOCH 3FQRB 3V5HA 4BUHA 4G6AD 1EZVY 1N0LA 4DZBA 1UWXH 1Z0MA 4FABH 3DBXB 4FQCL 2OTUA 4M61B 4LNVA 2DQCH 5DI8B 4UTAL 2YZ8A 4K8RD 2NZ9C 4K8RL 1HXYB 2BVYA 4K23L 3VGAC 4BQ8A 5FUOH 4JFDA 3VWJC 3UP1A 1OF2B 4PIRF 3C08L 3O6FA 3KPMB 1I7ZB 4JM2C 1ORQA 4R3SA 3IFPA 5JDSB 3DXAE 3UTPD 5FYKH 4YDLB 4JG1L 4OCYL 3T0EA 2ITCA 3S5LB 4IMLA 3UC0L 2H6PB 2YRPA 1K4DA 3M17B 5IGXL 3FQRA 1UM5H 3FHQA 4HH9B 5EBGA 2FSEB 1JGUH 1YECH 1NGYB 1IM9A 1T04A 3DBXA 3Q0HA 2HVJA 1MJ8L 4M61A 2IQAB 2Z91A 1GZPA 2JB6B 2CGRH 4DZ8B 5CZKA 3U82B 3DO7B 4XWGL 4K94C 1F4WL 4IRJC 2X4SB 1S9YB 1AI1H 1T0PB 4N8PA 5B21A 2NY5L 1NUNB 5KS9B 2ZSVB 4EUPA 3KPMA 4FMKA 3DSFL 4N8VG 1CFNA 4EUPH 5CEXB 1TJGH 5I1HH 3BD5A 5D6CB 2L4OA 3MRNA 5TF0A 3S5LA 2FH6A 1IAII 1DQJB 2D7PA 2J8UB 3T65B 3PWUB 5MEPA 1VGKA 4LU5H 1NGYA 1HZHL 2NPLX 1UA6H 4Q97A 4N68A 2JJSA 3NFSL 4XNZC 4JR9L 1NANH 1WAAE 1HI6B 5DD3H 5ALCH 4DZ8A 5EC1A 4YHOL 5DVLA 3SDXE 3DO7A 1MH5B 1SVCP 5GGTL 2E8YA 1YEFL 3RZCD 2EH7H 1S9YA 4ZXBC 3VRJB 2C4FT 4NHUA 2WUBL 5H37G 5KS9A 2ZSVA 4CN6A 4NC0B 5EZLB 3D0VB 5CEXA 3QCTL 1II4E 5D6CA 2VOTA 2EEBA 2VSDA 2Z31D 1XF4A 3DI3B 3L7FB 1D7FA 2YC1B 5JW3L 2J8UA 3LKPA 1T20A 3FO2B 1FL6B 1K2DA 2BRRL 5IKCA 1R6VA 2WSKA 4M6OL 3RGVD 2R0ZH 5CJXC 1HI6A 3I75A 2V5SA 4QXTB 5HVGB 4NO0D 3SGEH 1I1AC 3O9WB 4OI8A 5EOQL 4IBLT 1MH5A 4PJ8D 4JPIB 3VRJA 3GDBA 2ESVB 2GI7A 1IT9L 4NQCA 5DSCA 3A6BH 2VDML 3D0VA 2LTQC 4PJIE 3H9ZA 5L88L 3L7FA 2YC1A 3DWTA 3ULUH 4TPRH 2P49B 4KRNA 3FO2A 3NABH 1H9VA 5EOCL 5CEZD 5DXWA 4OZIF 4NQDB 5JA8B 4FABL 5JHDB 3QIWD 4QXTA 4DVRH 3O9WA 4XBGB 3O41A 1OWWA 3BFOA 3MLXH 4FXGB 2DQCL 2EIBA 1C5CH 4APQC 1L0QA 4JPIA 2YWZA 2ESVA 5DTFB 5FUOL 1XGUB 1AR2A 4ENED 3QWRD 4G8IB 1FCGA 4XAKD 3OZ9H 2VLLB 2F5AH 3B9EA 5L0QB 2BY1A 5TPWH 5MI0B 3SGDH 4L9LC 1I1YB 5D1XA 1I8MB 3HE6B 1AGFB 1QBAA 4E9LA 5FYKL 3HR5A 3PDOA 3WFZA 3PGCA 1HHHB 4KUCF 2VN4A 3IAPA 4M1DH 1JK8B 2WINA 3BPNB 1UM5L 3UTTA 3VXUE 3WKNA 5HHOB 4KC3B 1JGUL 1YECL 1HK6A 3VFUB 1KPVB 5JHDA 3RWFB 4XB8A 4XBGA 5C71A 3SGKA 4YHYC 3DUHA 5FO8B 4P46B 4X4ME 2OL3H 5HVHC 3PL6A 3T0XA 4GW1B 1OP5H 5DTFA 3F5WB 1XGUA 3DYMA 4PRID 2A38A 2DYPA 1AI1L 3C2SA 4XHQA 4G8IA 4KHTH 2VLLA 4PV9B 2EXWC 4EVNB 1ITCA 3VXQB 5DVOA 1I1YA 4XMKH 3HE6A 1TJGL 3DXAB 2UZYB 4TTDC 5I1HL 4MNGE 5FYLE 5MENB 1QYGH 4UT9H 3RWJB 5KANG 3W11D 1DN0A 3MUY1 5J11B 3MRQB 3ZKMD 1SEBA 3RDTC 4MJ4A 3W0WE 2EO1A 4LU5L 1KPVA 2IBZX 4WU7B 4UOW1 2A6JB 4YBLB 4HWZB 3GIZH 3WUWG 2BC4B 1X5XA 4YEFA 5DD3L 1W72A 3NA4A 5ALCL 1OAXH 1W72H 3O8XA 3PHQB 4TSCH 3BPLB 5ANME 5SWSD 3JTSA 1QFUH 2EH7L 2PXYB 3DUUA 4XI5D 4PV9A 1R3IH 3DHMA 5BVPH 1N2RB 4XMLH 4EVNA 1E4JA 3VXQA 3GHEH 1I1FB 4NBYB 3V52H 3VGFA 3DXAA 3VFMB 2ZPKL 1RSFA 5TDNA 1D5ZA 2BRQA 5D1ZC 4F8TA 1PSKH 5E6IA 5MENA 3SE3A 5IOPA 2I25N 1MELA 3BW9B 3QRFM 1TCMA 3TP4A 4NKIH 2A6JA 3NIDE 5FM5O 2BC4A 2R0ZL 4GXUN 3FRPG 1T03H 3C6LC 3IDIB 2XWTA 3SDXB 2ED7A 3PHQA 3ALWA 5L9DH 4C56B 1KSRA 3SJVB 1WIUA 5CSZB 3W5MA 3VGAB 2PXYA 2B1AH 1BF2A 1T21A 1F3DJ 1B4JH 2AJYL 1TTFA 3IXAB 4L9DA 3BIBX 4H8WL 5ESVA 2EYSB 3A6BL 1P1ZB 5C0AE 1Q0YH 1IILE 4OB5H 4X9BA 4WHDA 4Z77B 4UMGA 4P2RE 5JNYB 2R2BB 2VDOH 4JY4B 3ULUL 2PW1B 4TPRL 3DETD 4HZLB 1QEWA 5DHYB 5FECA 1YYMH 3NABL 1YEEH 2W59A 2NNAB 2Z8VC 4POZD 1WAAA 4YHPB 3PUCA 3QHZH 3RVTC 4P49A 3IDIA 3SDXA 3H8NA 4P0DA 1BFOB 1C5CL 3ARFB 1YY9C 3MXVL 4OFYD 4YBQC 1RHFA 3QIBC 1MPAH 5E8OB 3EDEA 1MAJA 4XVSH 3QISA 1QUNA 3OZ9L 4PJIB 2F5AL 4ZDHB 5TPWL 1FFNA 2VLMD 4JM2A 1TVBB 2R8SH 4Z77A 5JNYA 2R2BA 4JY4A 1P9MC 3SE9H 3X14A 1JYNA 5KZCB 4HZLA 3V4VH 5GRZA 3VFPA 4F7TB 1PD6A 2NNAA 2F19L 1GOHA 3RIFF 2FJGA 1BECA 4YHPA 4G6JH 1VFBA 3FT3A 3GRWA 4B0MM 5B3NA 1ULVA 4Z8FL 3ALXA 4KK8D 2CH8A 2EC9U 5EU3A 3ARFA 1NBQA 2BDNH 2OL3L 3BUTA 1N3NA 3IKKA 4IRJA 5E9DB 2Q1EA 5J6GB 1I8IB 1FYTE 4NUGH 5JA9A 4KHTL 4PJIA 4RAUA 4F57H 3V6ZB 4ZDHA 1TFHA 3GIVB 4H26B 3CX5J 1TVBA 1IGTA 2DTSA 4UNTA 4MXWH 4ZAKD 1IM3B 4XVJH 1A3QA 2P5EE 1QR1A 1QYGL 4UT9L 4JO4H 1TLKA 3SKJH 5D7KE 3V9FA 4F7TA 3VXUB 3P0VH 1RUML 2BNQB 5M94B 2D03H 4UU9B 3GIZL 1XR8A 3AY4C 5KN5B 4IRSB 4YHMH 2I27N 1I1AB 3L5IA 1OAXL 4OQ1A 1W72L 4YIQB 1EJ6A 3LPWA 1TNMA 2JIXB 4TSCL 4MNQE 4P2QE 4F7CB 5J6GA 1QFUL 1I8IA 3C5JA 2YPVH 3RBSA 1MCQA 1R3IL 2E6JA 4XMLL 3DIFB 4H26A 4IDLA 3GHEL 5IB5A 1HKLH 2LTQB 3V52L 4Z7UE 5FM8A 4M03A 5EUKB 1IM3A 2H9GA 1E6OH 2P47B 4JZJC 5MHSD 4LFHG 2K3TA 1JP5A 1L6ZA 2AEIT 2ZUQB 2GQHA 3B9KB 3BIAX 1VPOH 5EZOH 1Z9OA 3VXUA 2XZAH 1I3GH 5BV7C 2R2EA 2BNQA 4LLAA 4XPBH 1VHPA 4F37K 3FOMA 4NKIL 1EVUA 4UU9A 4IOFC 4EI6B 1I1AA 3OAYK 4NO2B 5IMLB 1T03L 4X4MA 4YIQA 2BY0A 1JTPA 2JIXA 4F7CA 4MD0B 5HDBF 4QT5A 5ANMB 1QO3B 4KJWD 1KPRB 1MOEA 3TH3T 1QLFB 3WE6B 5F9WC 2B1AL 3GM8A 3OG4B 5ESQB 2ZCKL 1CDHA 1B4JL 1ZK9A 1RK0A 4IMKC 4KXZI 5LCVH 3DIFA 3ORJA 3G5XB 1OLZA 1Q0YL 1Q38A 5GS3A 3I6LE 4OB5L 1RU9H 4OZHB 3AS1A 4GXUM 3VE0B 5FFLA 5GS1C 3T77B 3ARBC 4YEEA 2VDOL 5FYLH 4G8GD 1WWBX 4LOUD 1HQRB 3W0WA 4C59B 5DJCB 1CU4H 1YYML 1YEEL 4NPYA 4XHJD 4ELKA 3PNWB 3PF2A 3B83A 2XQYK 4NO2A 2I9LB 3MACH 5I8KH 4L4VD 5IMMA 1GC1H 1Y0LB 4APQA 4MD0A 4NFDA 5F21B 5ANMA 4YAQB 4QHLB 3W81A 1J1PH 3BKYH 4HJJH 5ESQA 1MPAL 4JY5H 4U05A 5FEBA 1YC8A 4KKLD 3OKKA 3QR2A 5C0AB 4G6AC 3BQUC 1Y6MR 1FIEA 4L9LA 2R8SL 4ESKA 5C9JB 4FXKA 3VE0A 1WTGT 2AXGA 3SE9L 5DEGB 2J8HA 5A2LH 5I2IB 1N6QH 1A7RH 2BERA 3ROOA 3V4VL 2VC2L 2YEZB 3IS0X 5TE6H 5CAYB 4OTXH 4OCNC 3PNWA 4LCYB 4Y8DC 3ELAT 3IFLH 2Z93B 4G6JL 1CGSH 4EQ2A 5HY9B 1H0DB 1PX4A 1Y0LA 2M1KA 4DGIH 1EV2E 3FO1B 1IGMH 1MRCH 3WFBH 2BVUA 1LE9B 4QHLA 5EC2B 1U93A 4HGWB 2BDNL 2GTZB 3BJ91 5DYOB 4NUJA 3DECA 1S9WB 4P57B 4RWYH 1UC6A 5C0AA 5A16B 3OKLB 5K9QG 4F57L 4U6TA 1Q8MA 5C9JA 4UV4H 1DQLH 3RWGB 4MXWL 1ZHNB 4XVJL 3VG0H 5I2IA 3WFHB 5J3HC 4GBXD 3VI4E 2CLZB 2YEZA 3SKJL 4GQPH 3RDTA 1FE8H 4LCCB 3P0VL 3WDHA 3MBXH 2MKWA 4WRLA 4LCYA 1ZSDB 2Z93A 4HK3N 4JFFB 4LLMB 3LIZL 3Q5TA 2D03L 5HVFB 1BM3L 1ORSB 2CDGA 1H0DA 4Z7VE 1CN4A 4YHML 3FO1A 1LE9A 3UBXB 2GTZA 3ZE2F 1YY8A 5J13C 2IPUK 3K8MA 3F8UB 4NCDA 5DYOA 4P3WA 1TPXB 4KAQL 3LZFH 4G6MH 3OKLA 5HGAB 4FA8A 3KNBB 5J56B 2OJEB 1HKLL 5IESH 1OAUH 3G5ZA 3MV7B 1E6OL 4CMMB 1BJ8A 2CLZA 4JRYD 4LQFH 4AEIH 3WKMH 1VPOL 3RZCC 5EZOL 3V5DA 1X5FA 2XZAL 1I3GL 1LHZA 4KI5F 5DGQA 4Q9RH 4XPBL 2VAAB 1ZSDA 5D2NB 4LLMA 5HPMB 1IAMA 1MHCB 1ORSA 1JYVA 1RZIB 3C6LA 3VA2C 2VMFA 5DHVH 2UZIH 4Y2DC 5T1DH 4P2QB 3UTPE 1ZV5A 3DROB 3W2DH 5FOBB 4FHBD 3U46B 1FYTA 2RCSH 3QIBB 2AAVA 3P73B 2Q8AH 3HZVA 1DE4B 5E1AB 5LCVL 3NFPB 5HGAA 3KNBA 3MLYH 3K1KC 4Z7UB 4LPYA 1RU9L 5GIRB 2P5EA 2MHAB 1BFTA 3R1GH 4LP4A 3MRJB 4R9HA 5FYLL 4PJ8C 1CFTA 1CG9B 1QLRB 5C0EB 2OS7A 1JWSB 5JDJA 2DIAA 3KWWB 2VAAA 1CU4L 1TMCB 5JQ6H 1WC7B 1MHCA 2DLIA 1RZIA 3STLB 3MACL 4X6CE 5I8KL 5FA4A 3AMLA 1GC1L 4P2QA 5TFSH 2VNCA 3DROA 4FN0A 2YPLE 3U46A 4Y0GA 3QIBA 4LGRB 1J1PL 1CLOH 4QRTB 3BKYL 2A6IA 3P73A 4JY5L 4WI8A 1A64A 1TNNA 1DE4A 5E1AA 4EQ3A 3NFPA 1ZTXH 2HT2D 3VFVB 4Z7UA 3MMEB 4QOKE 5GIRA 2MHAA 5K9OB 3L9RB 3INUH 1FGVL 3MRJA 4P2YA 4P4KD 1CG9A 1ZT7A 4OZGF 3O3DA 5C0EA 3PIQB 1N6QL 1A7RL 2FB4H 5FXCH 3KWWA 3QUMH 3RTQC 1T7WA 5TE6L 1SMOA 2VUOA 4OTXL 4ENEC 1DUZB 2C3HA 5FCSH 3IFLL 1MCDA 1CGSL 4YXLH 1T1WB 3BPCB 3QIUD 4I2XE 4WU5B 4DGIL 2VXQL 4YUEH 1MRCL 1MLCB 3WFBL 3JWDC 3W9EA 4WUKH 4YHKL 1Z5LA 4GS7C 1FL3B 4GXVH 1HYSC 1RZ8B 3R0MA 5TH2B 4RWYL 3VFVA 3WFCH 1DBBH 3MMEA 4QGTA 1SJHB 1Q9OA 1AKJD 1CIDA 3TIEB 4UV4L 5K9OA 1DQLL 3L9RA 1G0XA 1RZKC 3HG1E 2DQDH 3VG0L 4I48A 1OB1B 3MUHL 1FZKB 5BV7B 1FE8L 3MBXL 3OB0H 1DUZA 3W82A 4ELMF 1QSEB 1KTRL 5ACLA 5DVNA 1FZOB 1T1WA 3BPCA 2CD0A 1FVEB 3QQ4A 4F80A 3H9SB 1JF6A 1XZ0A 4WU5A 32C2A 1GVIA 1EEUA 2W0PA 1MLCA 3FL7A 1UB5B 1VCAA 4YBHA 2NW3B 3F62A 3O4LB 3MC0A 1FL3A 3VFNB 4HSQA 2AP2A 1KT2A 3LZFL 1RZ8A 4G6ML 5TH2A 3OJ2C 2AK4B 3FN0H 1IEAB 1SJHA 1WWWX 4AENA 3HC4H 5CEZE 2WIIB 5IESL 1OAUL 1MI5D 5ISZB 2YRLA 3U0PA 1CZ8L 1JPST 4JZJA 4PJCE 1OB1A 4B5EA 4PYHA 1FZKA 4LQFL 4AEIL 3WKML 3RNKB 5C7XH 4RAVB 4Q7DA 3CNKA 4Q9RL 1ACZA 4X7FC 2OX5A 4PJFF 4XI5C 1QSEA 3J8F7 1FZOA 2GY7B 1FVEA 2XXMB 4XAKE 1IAIM 4O00A 1UB5A 3HPJA 3W9DB 2UZIL 5T1DL 2K9UA 3T2QA 3O4LA 5IVXF 3TO4B 1MY7A 3W2DL 3VFNA 3GMNB 2RCSL 2DQHH 3SKOA 4MXVE 4IMKA 2Q8AL 4OF5A 5CGTA 3DV6A 3IJYB 3MLYL 3BDYH 2WIIA 1WJ3A 2BK8A 4X4XA 1FNEB 4HKJA 5F7DA 3EOTH 5ISZA 4OI7A 3JZ7A 4X8XA 1AQKH 5GS1A 3ARBA 3OGOE 3R1GL 1A4KA 1QHOA 3RX7A 3RNKA 2W9DH 4RAVA 2QTEA 2PW2B 4X6DF 3HC0B 1S7RA 4L3EE 5JQ6L 1GGUA 1AC6A 8FABB 4Z7VA 3MRGB 2VZVA 5FYJH 1KEMH 4GKZA 3VXPB 1KF9B 1BIIA 2D2OA 1F45A 3VXOB 1A7PH 3TO4A 1NANI 1T1XB 5TFSL 4FXLA 1XF5B 2W0FB 3DETC 4QRSB 1CLOL 4KHXH 4KGJA 1C12B 4KKBD 4X80H 3IJYA 1ZTXL 3VI3F 1X4ZA 2HTKD 1DBKH 3BQUA 1FNEA 4KMQA 5CGMA 4GMSH 3IFOB 4POZC 5CHNB 1OM3H 4WW2F 4DK3A 3FFCE 4MZ2A 3INUL 3BWAB 3BN9C 3LQZA 2AGJH 3OWEA 5TDOA 3RQ3A 1QA9B 4Z76B 1CDCA 3ESUF 2FB4L 3WLBA 4I5BB 2PW2A 1AO7D 4QRRD 2DJ4A 3QFDA 3BEWA 3CZFB 4JM4H 3IDUA 3VFWB 4UINH 3MRGA 2OR7A 2M2DA 4KJQD 4X6CB 4YXLL 4HIEB 2YKLH 3VXOA 1T1XA 4YUEL 1QSVA 1INDH 5J13B 3SGEI 1ROWA 4WUKL 5EIIB 2J88H 2W0FA 1BJ1J 4GXVL 1C12A 2FD6H 4F7PB 1X6LA 2A6DB 3WFCL 3U7AA 1DBBL 3GJEA 3V4UH 1EGJA 3ABZA 3SY0B 1UH2A 2EIZB 5IP4A 1SJVA 1ZWIB 2DQDL 5CBEA 4KZDH 4Z76A 4I5BA 1PFCA 5EO0A 3RZCB 3CZFA 2UY6A 4DN4H 4Q0XH 3T2OA 2EZ0D 4LSUH 4QHMA 4OGAD 4X6CA 5KVEH 1IGYA 3HN3A 4KVNH 5INCB 4YK4B 2CRIA 1A5FH 1T66D 2BP3A 3DMMD 4ZAKC 1G9EA 2YPLA 2Z31B 3ARED 4XCEA 4OGYH 2Y5TA 2VQ1B 3GMRB 3QG7H 4F7PA 1FQ9C 2A6DA 3F7VA 3FN0L 5HHQB 2YD9A 3P4NB 2Z8RA 3HC4L 4GRWF 5SWZD 1QSZA 3RGVB 1AJ7H 2VDLL 4J1UB 2EIZA 4NO0B 1ZWIA 3SGDI 5DZNA 2ICCA 4X7TB 3S88H 1J9CT 4PJ8B 1KYOJ 3RZCA 3TO2B 4QRPD 3LH2H 4YHIA 5C7XL 2F54D 1H5BC 2BJMH 1EFQA 5INCA 3CIQA 3LPGA 4UUJA 4Y2DA 3D39D 2Z31A 1ZT1B 2UV3A 5E95B 3WN5C 2FHBA 5GGUB 1JHTB 1IAOB 4X5XA 5LVEA 1CDUA 2DQHL 4OQTA 5C0DB 1G7PA 1BBJA 3UAJD 3ARXA 2G60H 3BEVB 3P4NA 5KSBE 1LO4H 1LK3H 1S7WB 3BDYL 5I1LB 3RGVA 1K85A 2D31A 3IS1X 3EOTL 1DLHB 3QIWB 1GXEA 4J1UA 2UUDK 1GGBH 4GW5B 1DQTA 1AQKL 2XNAA 4X7TA 4PJ8A 3RUGE 2NY2D 4ZO8A 4NFBA 3TO2A 3DOSA 4MS8C 4KJWC 1N4XH 2W9DL 2DLTA 5B4MD 1HNFA 1UYWH 5IROC 3EJJX 3OHXB 4CVZB 1IQDB 1FVCA 2HN7B 5GSRA 5FYJD 3A6OA 4I8DA 4WJ5A 2C26A 5FYJL 1KEML 5DURD 2D7NA 3FZUC 3PQYD 1A7PL 5GGUA 1JHTA 1IAOA 1MJ7H 3T3PF 2D4FA 2AJZB 2CIKB 5C0DA 1F5WA 4LOUC 4YFLI 2BVOB 4KHXL 3P9MA 5GRWA 4X80L 1IL1B 4DEPC 5I1LA 4XHJC 2KQNA 1JMZA 1DBKL 2WIMA 1DLHA 3QIWA 4GMSL 5T3XE 4GW5A 4PJCA 1OM3L 1FBIH 3IU4L 1LK2B 1VACA 4X0KA 2GSGB 2AGJL 1J0HA 4TVPE 1CXHA 4LSTH 1GGYA 3RTQA 1Q9LB 2V9TA 5EN2B 3MJGX 4PRIB 4JM4L 3O6LL 1C5DA 4CJ0A 1M6OB 3CVHB 4UINL 1FL5B 4WFEE 4NRYB 4XXCC 1HILB 2YKLL 2CIIB 3Q5OA 2LE9A 2VDPH 1NAMB 3U7WH 2J88L 2CIKA 4IJ3B 2BVOA 4X9HA 2QSTA 1J0ZA 3NIGE 1CK0H 2FD6L 5KS9F 4NKMB 3LV3B 3MRBB 2DBJA 1B2WH 1A7BA 3V4UL 1J0IA 2QQLH 3MRPB 3WXWH 1LK2A 3QDJE 1R3HB 2GSGA 1RZKH 2WP3T 4KZDL 4R4FH 2J8UF 1Q9LA 3KDMB 5BRZD 4XP5H 5SWSB 5LGJB 1S7QB 4AT6A 4J7RA 4M93C 1B3JA 4G42B 1RZJC 4ODTL 4DN4L 3CVHA 1QVOA 4Q0XL 3OMZA 1FL5A 4NRYA 1UZ6E 3GO1H 4LSUL 2IBGA 5HHME 1JRHH 5KTEH 1HHJB 4KVNL 4QLRA 3QJHB 3UO1L 5D7JC 1A5FL 4ZG1A 1I75A 1OTSD 2HG5B 3OB8A 4OGYL 4QY8B 3QG7L 3HI6H 3LV3A 4WI5A 1DVFB 2LU3A 4GW4B 1ZLWK 3MRPA 4RMWA 1JI2A 4OIAA 4D9RE 4RCAA 1AJ7L 3DVNA 2LAAA 1HKFA 2IALB 3AXLB 4IM8A 2EECA 2EKSB 2AEQH 3TYFB 3S88L 4LQ1A 3UPCA 5LGJA 1S7QA 2CLVB 3LH2L 4G42A 4XCYA 3HFMH 5ENWB 5L2JB 4MQXD 2BJML 2XY1A 3LEXB 2NCMA 4X5LA 5CSBA 3Q5YA 4OFIA 2HG5A 4PRPE 5E2VH 1G9MC 4P5MA 2NTSP 3VXSD 2V2XA 3JWOC 5HJ3A 4BQ9A 43CAB 1MF2H 4Z7QE 1WBXA 1WF5A 2G60L 4GW4A 4XPTH 2IGFH 4BQCA 1LK3L 4HC1A 4E41E 3RX8A 2JCCB 1GGBL 2IALA 3GJFB 2EKSA 2XWJB 3TYFA 5SX5K 3MGTA 1N4XL 4OBSA 5ENWA 4LPXA 4MCZA 2QQQA 3BT2H 5E2WH 1I7TA 1HH6B 4BA8A 3LEXA 5IB3B 25C8H 4KJPD 4PG9A 3EKCA 1EXUA 4Y4KD 1Q94A 4L8SB 1O0VA 3EOAB 1QQDA 4U3HA 1MJ7L 5GGVH 2BHUA 2V5YA 4HGKC 2GJZB 4Q2ZB 43CAA 3DURB 3HLAB 5DMKA 2ZG1A 5KSBB 4XPGH 2KQMA 2CXKA 5J0BA 2JCCA 4DGVH 3ULVF 1N59B 1AXSB 3GJFA 1FBIL 4ONFH 2VQTA 2XWJA 1G0YR 5HI4C 2OL3B 3RUGB 4KKNA 1KULA 4LSTL 3S3PA 2J2ZA 4WI7A 1T1YB 1MLBB 4QGYA 1HH6A 2EH8H 2KDGA 4IOIB 4YDJA 2HT2C 3NBNA 5IB3A 2AJ3B 2BHZA 3HNTH 5DO2C 2VXVH 4AYFA 4ZAKB 2X1OA 3GSXA 4L8SA 2VDPL 4GLRH 1CD1A 3U7WL 4IS6A 5IF0B 2ZOKB 3QXDB 2EEDA 1EX0A 1QOKA 4L8DA 3DURA 3HLAA 2HLAB 1CK0L 2QSVA 5KSBA 5FK9B 1B2WL 2FYYB 2QQLL 2R4RH 1CE1H 3WXWL 4MNHB 4WV1B 4QYOB 4HXBH 3D3VB 1M71A 1X6NA 1L7TH 4XWOC 1RZKL 3RUGA 2P24B 2GYSA 3E3QC 1XT5A 4R4FL 5AEAA 4XP5L 5BZDB 2DLEA 2DB8A 1P84J 4IOIA 3X3GH 2JJWA 3ET9F 2WK2A 2HKFH 3GO1L 1J1OH 4LCIL 3UPRB 3TBTB 35C8H 5KTEL 1JRHL 5DR5L 4PJDE 2A74B 3EOBA 4ZAKA 2QQNL 3VRIA 3WDJA 1JHLH 5HYJD 3WNKA 4NQSB 4MCYB 3WN5B 5BOPA 1DN2A 3MODH 1EMTH 5IF0A 2ZOKA 3QXDA 1KGCE 4HFWB 3RJDA 3HI6L 1H3XA 3N85H 3GZKA 4GKSB 4R4ND 1T2XA 5JOPE 5SX4H 3FCTA 3O11B 5T3XH 2FGWH 3OF6D 3OXRB 2HFFB 3EYQD 5DC4B 4GKOA 4F3FB 1I8KB 2IC2A 4TVPH 2AEQL 1KNOB 2ID5A 5BZDA 5DJZB 5M95B 2FBOJ 3HFML 4JDTL 4KJYA 1H5BA 1WAAF 1LNUB 3UPRA 4KMTH 3TBTA 3PWLA 3SDXF 3FN3A 4XXDB 4L5FH 3ETBF 1TTGA 2E9JA 5JXAH 4F7EB 4W4NA 3WN5A 5E2VL 5DC0A 3QRGH 4G8GB 1K8DA 2V7HB 4HFWA 4GKSA 1DSFH 4DEPB 1MF2L 4XPTL 2IGFL 3O11A 1HH9B 1PAMA 3OXRA 3QDJA 4HBCH 3L1OH 2Z8SA 4L4VB 3VW3H 1I8KA 1U2HA 1KNOA 4KK6C 3VD5A 2O93L 5GJTH 5HI3D 3KLAB 3E3QE 3RKDC 5IROA 4OT1H 3BT2L 5E2WL 4F7MB 1LNUA 4MAUH 1DUYB 1OD7A 5CS7A 4U1IA 25C8L 4XXDA 2YA1A 1UM6H 4X8JA 4NKOB 3GSWB 4RDQF 3MJ7B 1ZVYA 3BD4A 4F7EA 1D5MB 1NGXA 4U1SB 2WWMD 5GRVL 1IEBB 4HJ0D 3VFRB 2V7HA 4Q6IB 1EVTC 5J12C 5E2UH 4PJIF 2C3XA 2A83B 3P4MA 1MCRA 4XPGL 3PHOB 3LD8B 5I6XC 4DGVL 3Q6GH 1NGQH 4ONFL 4FQPA 3DX6B 2GUOB 5I9QB 1WIOA 2BY3A 3KLAA 1PKOA 4OI9A 4Y19B 4PLKD 2VL4A 5C86A 2CO7B 2EH8L 4Z0XB 5HGDB 5DUBA 3HNTL 4XXCA 4FQLH 3QFJE 4PRBA 5DF0A 3MJ7A 4Z5RB 4RAHA 1D5MA 4PJ9D 1MI5E 2VXVL 4U1SA 3ZKXB 1DTUA 5BVJA 4GBXB 1ETZB 4LAQH 4ZFZA 2HFGH 4CAGA 4ODVH 2HVKA 5DWUH 3MLRH 1R3LB 2O61A 1MAKA 2YK1H 3ZYOA 2VSCA 4UBDD 3X11A 2GK2A 3P77B 2R4RL 1OHQA 1CE1L 4JFEE 1MCFA 5CIPH 4XPAH 3DX6A 1F3DH 4HXBL 2GUOA 1W0WB 3LY6A 3U4EA 1IKNC 3TT1H 1L7TL 5J6HB 4X6FA 3TN0D 5L8KB 1UH3A 1FFOB 3TH4T 3X3GL 4M5ZH 4WI2A 4M7JH 4OV6F 1F6LL 3BP4A 2HKFL 3QZWG 1J1OL 35C8L 2MWCA 4RMQA 4NM4H 4M7LH 1M7XA 3BPOC 5D7JA 1JHLL 3LSOB 4JZNB 3FOLB 2BOBA 5F3HB 3MODL 1EMTL 2EDFA 3DUSB 1ETZA 4JRYB 5IB2B 1MRFH 1ZE3C 3N85L 4X5WA 3OX8B 4NSKA 2FO4A 2N1KA 5T3XL 2FGWL 3EYUH 4OGAC 3OXSB 4P48A 1W0WA 1WVZA 1NCDH 1D9KD 4BSVB 4GAFB 5J6HA 4TVPL 3AREC 5IW3A 3VCLA 1FZJB 1U3HB 3LDBC 4Y5XB 1JZ6A 1KELH 2X1WL 1AH1A 4KMTL 2OBGA 1WCBB 1F3JB 4QRUB 4PJDB 1BWWA 3NCBB 5C09E 2BNRD 1NSNH 4L5FL 3LSOA 5AD0A 1E4XH 4P3CH 2D4DA 5D96B 5JXAL 4MVBD 3U7YH 3FOLA 3A0OA 3QXTA 3DUSA 3GBLA 1UXWA 3QRGL 1XH3B 2NY1D 3JWOH 3HE7B 4QRRE 1DSFL 3OX8A 4JRWA 4OZHF 3WL9B 4HBCL 1VENA 3L1OL 3KPSD 2ICWB 4BSVA 3TA3D 4G9FE 4JDZA 3OAZK 2BNUA 3J7HA 5GJTL 1RJLA 2OTWA 4F9PC 4OT1L 3NIDF 5HDQH 2IAMC 3UAJC 1F3JA 1ZA3B 4PJDA 3VXME 1U8HA 2ILLA 3LS5H 1HYRC 1UM6L 2R9HC 1KIQB 4U7SA 3S36H 4M7KH 4P4KB 3U4AA 1M7IB 1XH3A 3BP5B 3I3BA 4PY7B 5DK3A 3CK0H 4HWNA 5B4MC 5E2UL 2DMCA 4LNRB 5FF6B 2UWEE 5F9JB 5AYUH 2ICWA 1EAPA 3KGRA 4IEFB 1ADQA 3Q6GL 3BX7C 1NGQL 3QIUB 1G84A 1ADQH 2X2YA 1C5BH 1EO5A 3B3IB 3ARPA 4B53A 2NLJB 1ZA3A 3C5SB 5K33A 2DL9A 1AKJB 4FQLL 4MLSA 4NQUA 3SDCB 3UXFA 1KIQA 1OL0A 3VWKD 2P8PB 1GRWA 3BP5A 4PY7A 1G6RH 3DARA 2E5EA 2YUWA 4LAQL 4LCWE 4OZIE 2HFGL 1NC4A 4LNRA 4EI5C 4ODVL 3TBWA 5DWUL 5K93A 3MLRL 1YN7B 1HCVA 5F9JA 1F8TH 4L1DA 5IJKC 1H3PL 1FCCA 4NOFA 3QIUA 3AUVA 4XPAL 3GJFK 2RGSA 3PJSB 4WTXA 3TT1L 1TJHH 3MYJB 3B3IA 1CXIA 5IT2L 3RP1A 5D8JH 3BI9X 3PE9A 4QXUH 2NLJA 4JN1H 2Q76B 4M7JL 2VLJD 1NAKH 1ZLUH 2L7JA 2HTLD 1AKJA 3BISA 5GGQH 2MJWA 4NM4L 4R97C 5EH1A 1MI5B 5CD5D 2P8PA 4NFCA 1MIMH 1UM4H 4HIHB 3LRSA 1GPOH 1JGEB 3IDXH 1A6TB 1MRFL 4S0TD 5FDWB 2F8XC 4EIZC 3UJIH 4PLJD 1BZ7A 3D2UD 1LO3H 3EYUL 4CVXB 1CICD 1FZMA 2XT1B 4RGNC 3PJSA 4I77H 5CILH 1KXQE 3PQYE 1OP5K 3ZDZF 3WD5H 1OPGH 2LQRA 4KKAC 5H2BA 1PJ9A 3L5XH 4P99A 2BVQB 4M4PA 4YLQT 3QEQD 1MI5A 1NSNL 4ZS6D 5B8CC 1E4XL 1JTTA 2LFGA 4P3CL 2BOCA 3U7YL 1U2CA 4MJ5A 1NGPH 4PJXB 5CJ5A 1A6TA 1JGLL 4HWBH 5J12B 5FDWA 4Z7UF 3JWOL 3GHBH 3TT3H 2P42B 4JFEA 5I6XB 4CVXA 4JQVC 3VFSA 1CFSA 2PN5A 3D18B 5E8EB 4P2OC 4G8EB 1T0NB 1L7IH 4TSBH 3SQOH 3LKOB 2NY6C 3O0RH 1V7NH 4HKXB 4KI1A 5HDQL 2EDJA 1DEEB 1ZHBB 1YJDH 3LS5L 1SMAA 1GGIL 1I8LC 3CPLB 3H7BA 5KOMC 2B8OT 1AP2B 3VDAA 4PJXA 1T0MA 3G6AA 4M7KL 3S36L 3X13B 3QUMB 4QCIB 5BRZE 1S7VB 4M48L 1AO7B 5AYQA 4QRRB 2HA1A 4S1DC 4OZFB 5C08E 4HMEA 4QTHA 4N0UB 5AYUL 5EBWB 5IBLD 3HB3D 4ETYA 4P5TC 1CE6B 4KJPC 1ADQL 5E8EA 4RGNE 4PLOB 5IB1A 4G8EA 2MMXA 1T0NA 3MLTB 4Y4KC 1G9NC 1H15B 2Q86A 2FR4A 5IM7A 1H3GA 1C5BL 2X9XA 2Y1VA 3IDGB 3ARGD 3LKOA 4HT1H 1J8HE 4HKXA 3S6CA 1FSKC 1DEEA 2R56H 4PRNB 5CWSB 2ERJC 1T2QH 5HHVH 3VD4A 3RI5F 3BPOB 2Y72A 2XG5A 1XGQB 1RJYA 1AP2A 3U0TA 1UB6B 2X4RB 4WVRA 2QKIA 4QCIA 1S7VA 2BSRB 3B9DA 1G6RL 3CC5B 1AO7A 4M3KB 4NQVB 4QRRA 1RPQA 4ONHB 5E8PB 1F6AA 4OZFA 5AG8A 4XCNB 4I3RH 5I8OH 3QUXC 2VR9A 1QBMH 4N0UA 1F8TL 5E2TH 3RY5A 4NT6B 3GSNH 4OLZH 1CQKA 1OT1A 1A9BB 4G9FA 1I1RA 5IVOA 2X4TA 3DMMB 2OQJB 1H15A 3RY6C 1TJHL 2BMKA 1D5XB 2DDQH 2WV3A 1P4IH 3UTQB 5D8JL 3WJJC 1G7QA 3Q6FA 2IPTH 3S37X 4JN1L 3VXSE 3IB4A 5C0BD 3VXMA 4PRNA 5CWSA 1NAKL 1HSAA 3O2WH 4G43A 5GGQL 2CDEA 5SWZB 3SEPA 1YYLH 1XGQA 3P9LB 1UB6A 3F7PC 2RIKA 4HXAH 1MIML 1UM4L 2BSRA 1GPOL 3IDXL 4JRXD 2W60B 4ONHA 5E8PA 2DLFH 4QRPB 1CD9B 2XTJC 4ODSH 2UWEA 3UJIL 1X3DA 4NT6A 2F54B 3ARQA 5CZXD 1ERNA 1RQ5A 1LO3L 4L4TD 2OQJA 4I77L 4JPWH 3VI4F 3D39B 4P3DA 1D5XA 4H0GA 3AREA 5CILL 3ZKSD 3P2TA 4FOMA 3WD5L 3QULB 1P5UA 1OPGL 5C1MB 4IOSD 3MO1A 3L5XL 4R4NC 2FHCA 2V5TA 4RFOH 4WO4D 4Z78B 2XN9E 3TPUB 5SWZA 2APTA 1NEUA 2P8MB 3P9LA 3LKSB 5T33H 1EHLH 4I4WA 1C8PA 4LVNB 3EYQC 2VLKD 3VGGA 3WO4C 4N1HB 4UTBH 1GZQA 3K74B 1NGPL 4NC2B 4YDKH 4LCWA 2NY2B 4HWBL 1G7HB 3ZYJA 1OTUC 3GHBL 1PZUB 3MOBH 3TT3L 5FIEA 5DFTA 1YNTB 4F2MA 2IH1A 2W9EH 4FFWD 4HK3J 3KPPA 5DURB 3O2VH 3D39A 2X05A 3PQYB 2HKHH 1L7IL 3IXTA 4TSBL 4WI4A 3SQOL 4L4JA 4F9PA 3QULA 3O4OB 1NMBH 3IVKB 3O0RL 1CWVA 1V7NL 1KJ2H 1T7XA 1K6QH 2ARWA 1LEKB 1YJDL 2P8MA 4OKDA 2CK2A 3ECBB 1JRHI 3ROLB 4XNYH 2ZSWB 1NCCH 1XR9B 5HI3C 3BGFB 5J1AA 3WLWD 3UZQA 1S7TB 1D6VH 2XTJE 1O5DT 4RFNC 4JY6A 1YNTA 3QJFB 2IPKA 1BD2D 2DWDB 1A6PA 3CSGA 1A21A 3PQYA 2DQJH 3DSNA 5I71C 3ARWA 4CW1B 3LRHA 4FQ2H 5BQ7B 5HYJE 3IVKA 4HT1L 3O3BB 1JNHA 3WEXA 3QNYA 1F2XK 1KG0B 3P4OB 3LCYA 4X6CF 2R56L 3X12B 4ORGA 1Z2KA 1LEKA 1VERA 5GHWH 1T2QL 3BZEA 1WWAX 5HHVL 3ECBA 4R97B 5DZOA 4MDIB 1IZKA 5DQ9A 5E8NB 3ROLA 2NY3D 3IDJB 1T83C 4YGVB 2E9BA 4S2SB 1MHEB 2GTWB 2OR8A 4B41A 2ZSWA 1XR9A 2ED9A 4UT7L 5GS0C 1DP0A 5BRZB 1ZLVH 2BSSB 4EI5A 4PLKC 1S7TA 2AKRB 1LGVA 4PGJA 1WCQA 4I3RL 4AEEA 5I8OL 1MFCH 5CD3B 5CFHA 2DWDA 3BAEH 5E2TL 3GSNL 1FPTH 4OLZL 1QSFB 4Z7NF 1T6VN 2GCYA 2H2PC 3C60D 1CGXA 4OKVB 4CW1A 1ZAGA 5BQ7A 2DDQL 1RAMA 2AXHA 4Y4FD 2ARJB 1OT2A 1P4IL 1KG0A 2IPTL 3GM0A 3QUYD 3P4OA 4E0RB 4N0YH 3MRIA 5DJYA 2N4IA 1ZVSA 4KTEH 1V3MA 3O2WL 3ZHLA 2B4CH 5ITFA 2I07B 1DCLA 3C8HA 5IB4A 1YYLL 1JYWA 1LP9B 2YN3A 3IDJA 4XPFH 4S2SA 1MHEA 4HPOL 4KI5C 3MRHB 1NQBA 2AXFB 4HLJA 5LG1A 5BRZA 3VD3A 3TN0C 2BSSA 2UY7A 3NCEB 3OTTA 5A2KH 2DLFL 2AKRA 4ODSL 5C08A 5CD3A 4JHBA 4X7EC 2X9YA 1FV1B 4XPHH 4X4YA 3U2SB 5KBNC 5F96H 4JPWL 1M7DB 4NQDD 5C3TA 2XKNB 4U7MA 1J8HA 2C4XA 5FM5M 1BLNB 1C08B 4RMSA 1NCAL 4E0RA 3VXSB 1A02N 4ZUUB 1N5AB 2ADGA 4LKCB 1DBAL 4H88H 3CUPB 4N0CC 2APXA 4RFOL 2BZDA 2I07A 2CKNA 1V5JA 1EHLL 5B8CA 2MKLC 4IRZH 3KXFD 1D9KC 2AXFA 4UTBL 1I7UB 3T0DA 3UTOA 2HH0H 1VB9A 2N56A 1KCUH 4GLRI 4PGEB 4QHNB 1GAFH 2IMNA 2IJ0C 2NY7H 3MOBL 1BZQK 1FV1A 4JQVA 3IJHB 4KTDH 4XTRD 3U2SA 1BJ1H 3ZE2E 3V4PH 3ZKQD 1M7DA 4P2OA 3O2VL 4DCQB 1X5IA 2HKHL 1IFHH 4LHJB 1BLNA 2D9QB 4XVTH 4IIQC 4LHUG 1NMBL 3BKJH 3HHRB 4ZUUA 3VXSA 4CDGC 3MRMB 4LKCA 1KJ2L 3N50A 1K6QL 3FQXA 4F9LC 2C3VB 2OMNA 1I8LA 1LD9B 1B0GB 3TA3C 1I7UA 2E7CA 4NN5C 4XNYL 4KQ4H 4KI5E 3MNZB 4PGEA 1NCCL 4QHNA 3WDIA 3DRTA 5EFIB 4X6BB 3NIFF 3ULSB 5C6PB 3IJHA 4P5TA 3ZE0F 4K7PH 5SX4I 5F88A 1X5JA 4DCQA 4NZJA 4WEBH 2DQJL 4Y4KA 1B90A 4FQ2L 1VADB 5EO1B 2YD8A 4XT1C 1OTTD 4NNXB 1Y6NR 3MRMA 3H2WA 2DQEH 1W8NA 2OTPA 1HSBA 2C3VA 5T3ZD 4FQXC 3BRDA 4KV5E 5GHWL 2P45B 2DQTH 3BO8A 4RMUA 5E5MA 1B0GA 4JB9H 3MRCB 4P5KB 4ZYKB 4NQED 2ZG2A 1KENH 5EFIA 4MA1B 4X6BA 4EDWH 3K2UH 3NGBB 2W9LA 4OCXH 1TETH 3ULSA 4ETQA 1D5IH 1MFCL 5T5NF 3BAEL 4OV5B 3MBED 2VKXA 5EU6D 1FPTL 1XGPB 5T1LB 4FTVE 3DYOA 3SDDC 1SY6A 3SO3B 2BNRE 3RY6A 4TUKH 1VADA 5EO1A 3UCRA 3HZMB 5HYJB 1A8JH 3UTSE 4NNXA 3WJJA 1F58H 5DRWA 5CJOH 3HI1A 3F6IA 1YMMD 3VXRD 1WT5C 4EOWH 4ZUWA 4N0YL 2DJSA 4C56D 4KTEL 4YX2H 2B4CL 1A3RH 5D1QC 1LO5A 4J8RA 4OZGE 3MRCA 3EJYD 4XPFL 4ZYKA 4DVBB 2J8OA 3DX7A 4CNIA 3GK8H 2CRZA 1HWHB 3S35H 3QDGE 4RZCA 4PJ5B 4F15B 2EYTB 1H8OA 2W1NA 3P40A 5EO9A 1U8LB 4OV5A 4I18B 4XPHL 3OAUH 4JKKA 2OZ4H 4JLRB 3MA7B 3IF1A 5F96L 1VDGA 4LK4A 4HS8H 3HZMA 5HYJA 1FIGH 4TNWK 4RA0C 3MXWH 1U0QA 2F15A 2DOCA 2O5YH 4H88L 4PLJC 3OF6A 3MLVH 4BKLA 1N64H 4LARH 5J89A 3V7AG 4JAMA 2SEBA 1CICC 3RVXC 4DVBA 1YEHH 3PXJA 3G5YA 4H25B 1CXKA 4JO1H 2HH0L 4R26H 2EYTA 4RGMB 4R7NB 2I60H 4ELME 1GAFL 3QUZD 1T5XA 3OB0K 5IWLC 2NY7L 4RFNB 4ZUSB 2JCCF 4KTDL 5KSUB 4JLRA 3MA7A 4U1NB 5ALBH 3V4PL 4NQTA 1U92B 4UAOC 3VJ6B 5IG7B 4HBQA 5CZVH 3JV4A 4XVTL 3T04D 4GG6E 3OBAA 4HUWB 3BKJL 1EUUA 4WW2C 4JE4B 3HS0B 1TZHB 2J7LA 5FO9A 4ZMAT 1TQBB 2Z8WC 2IADA 4BQBA 3BH9A 1YEJH 1JCKA 3NZHH 4PV8B 1XIWD 4KQ4L 5DEZA 3KPRD 4IHOA 3H9HB 4KK9D 5E4EC 1F11B 4PJFE 4R7NA 4C57C 5KSBF 1L6XA 2OYPA 3HNVH 4BZYA 4GOSA 3DGGA 3IJSB 5CEYB 4OD1H 2VLJE 4AIXA 1V05A 4U1NA 4PP1D 4K7PL 2Y5EA 5IVXE 4U1LA 3RUGF 4PJ9B 4WEBL 5IG7A 5IQ9B 4ODBD 1G9NL 4HUWA 4IRSD 4CN4A 1KB9K 3B2UD 3ARSA 2DQEL 2VDQH 2NX5D 4DOHE 2YBRA 5I15H 5TE7H 3LEYH 2DQTL 4U1MB 4ZFFA 4A2LA 5CMAB 3DI2B 4JB9L 4PV8A 1T83A 4CU8A 4AIZA 5D7IE 3Q3GB 1NCBH 2FLBT 4MDJA 4YWGH 5FGRA 3CFDB 3H9HA 5GS0H 4X6DE 1E4XI 3TN0B 3R0NA 1KENL 2IBBA 3MTRA 3K2UL 3IJSA 1TETL 1JPGB 5CEYA 5HI5C 1D5IL 4JANB 2G75B 4KRPC 3NTCH 4ZS7H 4XNUH 4Y5VC 4L8CB 1JPTH 3VH8B 1SY6L 4TUKL 3CFBB 3MA9H 1JN6B 4LRIA 2FEDD 5C6TH 5DFVC 1F58L 5CJOL 2DKMA 4EOWL 8CGTA 4LLDA 2HJLB 3BKCH 2MSPA 4OLYL 4C55A 4YX2L 2Q6WB 1A3RL 4U1MA 4JG0H 4XGZB 4RBPH 1D9KB 3CFDA 4WNQA 3BD3A 3ZDXF 3TN0A 4NN7B 3GK8L 2OXGA 2I9TA 3RWIB 3S35L 2AJSH 4K55A 4M3JA 4KDWA 2HT4D 1ED3A 2G75A 2DTMH 2Q3ZA 4ZPVA 3OAUL 3SE4C 2OZ4L 5MEOB 2H2SC 2HJKB 2BNRB 3VH8A 4HS8L 1WZKA 3BZ4B 3CFBA 1MUJA 3V5KA 5BXFA 3O3UN 3MRRA 1FIGL 1KIRA 3MXWL 5I66B 4UI2A 1FN4B 4IIQB 3QUKA 2HJLA 2NY1B 3MUJA 2O5YL 1FNGB 4M7ZC 1S3KH 1EHXA 4UV7H 3MLVL 1AFVH 1N64L 4LARL 4DK6A 3KPSB 3L3HB 1IGJB 5I1DB 4M00A 1D9KA 1YEHL 3TA3B 3D25B 4CKVX 4NN5B 1FO0H 1R3JA 4JO1L 4R26L 2YD6A 1CYGA 2I60L 2NXYD 2V9RA 2GFBB 5JUEH 5K59F 3VMNA 1AQDB 4HQQH 3G9AB 4FTVA 4WO4C 2VE6B 2HJKA 1JWUB 2BNRA 4WTZG 5HYQB 3BZ4A 3K4DA 1S78D 3UTSA 1JPSH 5E0QA 3UYRH 5I66A 1FN4A 4IIQA 2W92A 3FB5B 1T22B 4JREB 1FNGA 1OGTA 4GRWE 4OBRA 4BH7A 4B7IA 5B39G 4F9LA 1U42A 1ZHKA 1SYVB 3KPOB 1ODAA 4OD2B 1A3LL 1KJVB 1IGJA 3ZYIA 2WLYA 3GKZA 3TA3A 1YEJL 3NZHL 3M1BB 4B7LA 3IKCA 3QDGA 1WWCA 4GKNB 2GFBA 3OKYA 3HNVL 4PJAE 3UTZB 1AQDA 5C0BE 3WFDH 1I7RB 2IANE 4OD1L 2P43B 2VE6A 2YD7A 5HYQA 2H8PB 3DYPA 4FRWA 4U1GB 1F4YH 1TQCB 3V0VB 4JFDE 5CLTA 3VWKB 4JFFD 3TVMD 3FQNB 4GG6B 3QNZB 2IF7A 3EIFA 2A9NH 1RIHH 2VXUH 3VFTB 2E8ZA 1C16B 2VDQL 3WLWC 2DLGA 3MV8D 3QPQC 3BP6B 1SYVA 2XFXB 3QAZB 4JGMA 4HUVB 4O2EB 5TE7L 1KJVA 1RZ7H 3LEYL 5E8DH 4L4TE 1P6AB 2IQ9H 3M1BA 1S8DB 4Q9QH 4Q9CA 1LDSA 4PJBB 3HAEH 4C83A 1NCBL 5TE4H 4YWGL 4GKNA 5GS0L 3VRLF 4ELMA 4WIQA 2DI9A 4AMKL 4ZD3H 2CMRL 4PJ7B 1AGCB 5GGVY 4PLNC 2XRAH 1JHKH 2VLJB 4RRPG 1JUFB 2I5YH 2H8PA 3NTCL 1YEDB 4XNUL 4ZS7L 2D9CA 3T3PE 4LLYB 1JPTL 2NY3C 4XNXH 1DANU 4N9GA 4GG6A 3QNZA 3MA9L 5EIVA 5EOTB 4NJ9H 4LBEB 3RWEB 5C6TL 3VFTA 3RL2B 2F53D 1WT5A 1C16A 2JKXA 3C8KB 3BP6A 5TGBB 3BKCL 4ZOBA 3EOYG 3WNOA 4O2EA 4EKXA 5FO7B 5D1QA 3VDBA 3SCMD 3V6OA 2OSLB 5D5ME 5F97E 3D2UB 1CLCA 4FFZH 4JG0L 4BJLA 1CICB 3MFFA 5D7IB 4D94A 1KB5H 3STZA 4WFFD 4FG6C 4PJFA 5MP6H 1X9QA 1C7SA 2AJSL 2DMBA 2R1YB 4S1SH 2PNDA 1Z9SA 1AGCA 1YQ2A 2O5ZH 2WP3O 2VLJA 4YPGB 3PWJA 1JUFA 5DHXB 2DTML 3QEQB 4MJ6B 2Y6SC 1YEDA 1PVHA 5E24E 2FHFA 1BWMA 1JGVH 3KG5A 4A6YB 3P30H 5EOTA 5KS9E 4LBEA 1NUGA 3RL2A 5I1AA 4HG4K 3C8KA 4H1LA 5TGBA 3TC9A 4D9QE 4H1LH 4OCYH 4OJFH 4P23D 4PJDF 5DDHB 4GSDH 5FO7A 3BYYA 1S3KL 3HMXA 3D2UA 4UV7L 3HMXH 1AFVL 1CICA 2F74A 4MA7H 1YEIH 2WZPD 5D7IA 2YWYA 2MPAH 2MQ0A 1I1CA 5ECJE 2F9BT 5F7WC 4X6DA 7CGTA 3MRFA 5JPNA 1FO0L 1P69B 4CMHB 4HJGA 1N6UA 1Z6JT 3OKMB 5E4EB 3TBSB 3EYFA 5IWLA 3SGKC 4YXHH 3JWNC 4PRHD 3AVEA 4MJ6A 1UJ3B 4PGDA 3ILQC 5FA3A 4JHWH 4A6YA 2C1OB 1JPSL 5I8EA 3UYRL 2QLVB 4PBXA 4LSPH 3DSFH 5MI0C 5HBBA 3K8KA 3D0LB 2FBJH 4WW2A 5DDHA 1DR9A 2X1QA 5IBUB 3AU1A 1HXMB 4XTRC 1MWAB 3BPNC 4MWFB 3TBYA 2X70B 2VB5A 1RURH 3TBSA 2PR4H 3Q1SH 2B0SH 1CDGA 4Q58C 5C9KA 1BQSA 1NJ9B 2GJJA 3ARGB 3ESVF 3WIHH 5H35B 4P46C 3U0WH 2ADIA 3WFDL 2Y4SA 1UJ3A 3CD4A 4LVOB 1NEZG 2KPNA 4M4RA 1DQQA 2K7PA 2C1OA 5C0GB 1F4YL 4WW1B 1JVKA 5C0FB 4HX1A 2E3VA 1CL7H 1G6RB 2A9NL 1RIHL 2VXUL 4IDJH 1AGDA 1HXMA 4WHCA 4D8PB 1X44A 1RZ7L 1MWAA 4P9HH 5E8DL 2H32H 2IQ9L 4XCCH 5JIKA 4Q9QL 3V2AR 3GMLA 3U36B 5TE4L 4NQDE 1U36A 1HCFX 2QSCH 4M8VA 4NZUH 1NJ9A 3H3PH 3ARGA 5H35A 1H3TA 3LRGA 4PJAB 5EOQH 5C0BB 2Z35B 1PX3A 2XRAL 1JHKL 3BPLC 1U3ZA 3D6GA 1IC4H 2I5YL 2D7MA 2PO6D 1LDPH 4R2GD 1W8OA 5IEHB 4XNXL 2MOVA 2W38A 5EUOB 4UT6H 4ZPTB 5L7XH 4NJ9L 5M7QA 4DQOH 1N7MH 3EDFA 3KPNB 4JRXB 2J5LB 4GRWH 3CDFA 4PREA 4NO5B 5TDPB 2EE2A 4L3CA 4I1NB 5CKGA 5GZOD 2XZQH 2GW5A 5HGHB 4FFZL 4L4TB 2A0LD 3S4SG 5HD8C 2VABA 5I1CH 5HHOE 1KB5L 3U36A 1YA5A 4ZQKB 5ACMA 5MP6L 4JQIH 4MD4B 4GUPB 1TITA 1MHHB 3B2VH 4LKXB 4HK0A 4MX7B 4PJAA 1B6DA 4S1SL 1PYWB 1AR1D 2O5ZL 5C0BA 5I73B 2IANA 4KRMB 4WO4B 3SE4A 3BZFB 5IEHA 2VLKB 1JGVL 3U1SH 5BJTA 3L3IB 5EUOA 3C09B 3P30L 4MXQD 5DMGD 3CLEH 3NCJH 1BIHA 3KPNA 5IW6B 5F1OB 2XYCA 5ADPH 4NO5A 4OJFL 1B88A 4GSDL 1OAZH 1UJTA 3EDJA 3KYMA 5D5MB 5MENE 1NGWB 1LVEA 2CSPA 2VYRE 3HMXL 4L4TA 3RWDA 1X5HA 2QJDA 1BQUA 1PLGH 3LB6D 4MA7L 1YEIL 2PTVA 1WISA 2MPAL 4PJXF 4YDVB 4ZQKA 5ITBH 4GUPA 1EHAA 4ZSOB 3GSUB 1VA9A 4MX7A 5ID0B 3D5OF 1UKSA 5DI8A 4C58B 4POUB 3ARFC 1RZGB 1HXYA 4YXHL 2XACC 1P7HL 3OKEB 4WO4A 2YUXA 3BZFA 3JUYA 3DHJA 4JHWL 1MVFA 3L3IA 1OF2A 3HAEG 2NY4D 3PWVB 4G80B 3V95A 4LSPL 1I7ZA 5IW6A 4OSUH 5JDSA 4I9WD 2K7QA 2FBJL 1B4RA 2JK5B 3P11H 5D5MA 1NPUA 4DKFH 2H6PA 4DN3H 1NGWA 2EIDA 1FVDB 3MV9D 1BD2B