4WUKH

Crystal structure of apo ch65 fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYHINWVRQAPGQGLEWMGWIHPNSGDTNYAQKFQGWVTMTRDTAISTAYMEVNGLKSDDTAVYYCARGGLEPRSVDYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH65 heavy chain
publication title Structure of the apo anti-influenza CH65 Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wukH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wukH01
1TDQA 5I8KH 5GSRA 5JORB 5C9KA 4UIMB 5E8OB 1IARB 1OQXA 4F33A 1SY6H 4ONHB 5K9QI 5B8CC 1WITA 4KMTH 3TNNB 2W60A 3EYUH 4ZQKB 3HNVH 3ARBB 2A6KA 5DS8B 3FT2B 5BQ7B 2PW2B 4ZUSA 2DM3A 3W0WE 3LMJL 3JV6A 1TPXC 5DVOA 2XQBL 1FZKB 1HIML 1KN4L 3MRQB 4XPTH 2DBLH 4FTVE 2K7PA 4EQ3A 3D0VB 2AJZB 1W72B 1KB5H 4UV7H 5EBMA 2IEPA 1CDYA 4L5FH 2E3VA 3QQ3A 1EIBA 1C5DA 3O2DH 3P4NA 2AK4E 3MOBH 3PP4H 4MD0B 4FQHA 2BRRL 4OGAC 3LCYA 4TSBH 1HH6A 1XGPA 1D5BA 5FYJU 4Y16B 2MQ0A 4LLDA 4X4XB 5DJYA 3WNOA 4U6VH 3WXWL 4LDOB 1ADQL 4RGMB 4W4OA 1AIFB 2YXFA 1OP3H 5IMMB 4AIOA 3KLHC 4OSUL 1F90H 1HILB 4ZNEE 2FD6L 3NA9H 1CZ8H 3D39A 2ZCLH 2C4FT 3D9AL 3FT4B 3GMLB 3OKMA 3OKOA 4RMTA 2RB8A 1DTUA 5FF6A 1FL3B 4MNGE 4MXQD 1WBXA 5ETUA 3AROA 2GQHA 3KPRA 3FL7A 4OZGA 4HC1L 4YO0A 5SWZD 5CEYB 2O26U 4QHKJ 1JWSB 1SY6L 4JRYE 4KMTL 4BUGA 4RFNC 2R2EB 1DUYB 1F58H 1JTPA 2EIEA 3EYUL 1M05A 2EIDA 3HNVL 4JM2A 5MEQA 4CN4A 1FIGH 5J56B 5D1QA 4FQJH 1H3TA 1VEOA 2O5YH 3VGHA 4XHJC 4YFEA 5I73B 4CN6A 2Z8RA 4XNMB 5K59F 3G04B 4L4VD 1WC7A 2PW1A 5C0CD 1C8PA 2D0GA 4XI5C 1ZVSA 4LRIA 1EGJH 4JO4L 4QOKE 1RFDH 4LPYA 4LDLB 4QT5A 4RRPG 1CF8H 4UV7L 2QJDA 2LVCA 1B3JA 3V9FA 1S9YB 3GUTB 4R3SB 4L5FL 4OM0L 3VI4F 4DEPB 2JB5H 3DX6A 5IMKB 2ADGB 1I1YB 3VFVB 5D9SA 2Q8BH 3VJ6B 3MOBL 2X70B 3PP4L 3L3JA 3TV3H 4TSBL 5D5MA 4MB5A 1YN7B 4FFZH 4MDIA 4GRLC 3RWHA 4FQIH 4RAVB 5H94B 4HW6A 3NIDE 4PTTA 2YK1H 4NQCB 1Y18B 1BFVH 4LCCC 1QR1A 4HJ0C 1I4FA 1FNAA 1JGUH 1SYSB 1UJ3B 2Y1VA 3NA9L 1CZ8L 2ZCLL 4MNQA 2EXYD 1UT9A 4CDGC 4JFFE 5GZOD 3O3AA 4H26A 2J2ZA 1NFDB 3IDIA 5DHYA 5ANMB 5K9OB 1BWMA 4NHCH 2RFXA 3RIFK 1TMCB 3TVMD 3CVHA 3U36B 5IHLB 3ORJA 3WKNA 1MHCA 4NP4H 3PQYE 1OAKH 4HIIA 1BOYA 4D0CA 5J9PB 3H9SE 1C5CH 2EDJA 5CJBA 4HZLB 3D87B 1F58L 3C5SA 1FIGL 5IHZB 1LDPH 5FFLA 1UA6H 4QXGL 2O5YL 4S1DD 2AABH 3ELAT 5MP6H 3ARXA 2XY1A 2F54A 3PHQA 3O2WH 1X5XA 3HG1B 3RPIA 3ZE2F 3ZSTA 1QPPA 3HB3D 3SEPA 4HUWA 1JMZA 1EGJL 4P9HC 12E8H 2HJKA 1RFDL 5EFIA 1DQMH 3NCMA 3WFZA 3BZFA 4ELMF 3DXAE 5HI5D 4F3FB 4RISH 4PY7B 2N7BA 1LO3L 3G5ZB 4LLYA 2JB5L 5F1IA 4QRUB 2YKLH 4NYLB 5TDOB 3AGVA 1JFQH 2Q8BL 3SBWA 5KVFH 2H3NA 5IBTH 4KJYA 1IAII 3FB8A 5IW6B 4ELKA 3BRDA 4RQQA 1U2HA 1UXWA 4G43B 5E1AA 4FN0A 3EYFB 1X4XA 2P5WA 3KPOA 4FFZL 5KVDH 1UM4H 1GHFL 4FQIL 4P9HH 3W2DL 3CH1A 4E0RB 3QPXL 1RJZA 4PJXF 4PUBH 2YK1L 3FQNA 4NZTL 4B41A 3VXSB 1BVKA 1WQVT 5KG9B 1JGUL 3QDGE 3K81A 4P2RE 1TQBC 1MF2L 1FVEB 3TLRA 1I1AB 2OBGA 5D7LE 3QIUB 4L1DA 3VGEA 4PJEB 1U3HA 5DK2A 1HHJA 4FXGA 4PJHF 4KROD 4UV4H 5ADOH 1M71B 4O4YH 4YPJA 4JQXC 1NGPH 5KSBE 1OAKL 3SKOB 3QUMB 4MMXC 4DKFL 1C5CL 3RVVC 1GYAA 4IRSC 4F7MA 1KJVB 1LDPL 3MGOA 1UA6L 1J8HA 4QXUH 1NEUA 2AABL 3IDNB 4R7DA 5MP6L 3U4AA 1BAFH 2ERJC 3RU8L 3CUPA 5B21A 1F11B 3U0PB 3O2WL 1RUAH 4HH8A 3OAYH 1CFSB 5CBEB 25C8L 12E8L 1RUKH 3TPUA 4F7CA 1LK3H 4N5ED 3UC0H 2XG5A 3F62A 4RISL 3IAQA 5D2NA 4WI9A 4FQXD 2DLFH 5DTFA 1Q72H 1S7SB 2BJMH 4TNVK 3T8XA 5F8RC 4B50A 1JFQL 2VYRE 4PJ9B 5KVFL 5IBTL 3X3FL 2QSTA 2NX5E 4MJIA 4IRJD 3RWGA 3VXME 3EYOA 2H2SD 4KQ4L 2H6PB 3WXVH 3K46A 4AEIH 3LB6C 1AO7B 4LVHB 2Z35A 1NSNH 4PUBL 4DK3A 1EJ6A 3QO1B 3CFDA 3X11B 5KW9L 1JRHH 2WLZA 3EYSL 4F8TA 4U2YA 5FB8A 5CJOH 3OGOE 4OKVB 3GI8H 3UTTA 3NA4A 5FUCE 4H88H 4R96A 1UACH 1A14H 3SCMA 2NY3B 2DWEA 3P9WB 3MRHA 5B22A 5C0FA 5C92A 3RTQB 4UV4L 5ADOL 5IV2A 1T1XB 1BIHA 4P46D 5EZOH 2NTFB 1MELA 1YYMH 3NCFB 2PTUA 4UQ2B 5GSVB 5E24E 2VLLB 4IEFB 3IJYB 5BW7C 2GITA 3BJLA 4LLMB 5C09E 1IGJB 1UH3A 4QXUL 5F9DC 3GGWB 4QRSA 4ZDHA 3Q5TA 3MJ6A 3RWEB 1RUAL 4NQVB 4UU9A 4N5UA 1MJJA 3G6DH 4Z7VF 2VDPH 2Q86B 2OR8A 1LK3L 1JF6A 2PYEB 3MNVB 3UC0L 4LVOB 1YMME 2PR4H 5HHNA 5FGCB 4JHAL 4P5TB 2EH7H 4KUCD 1Q72L 4O2FA 1I85A 1ZAGA 5T5FH 1EVUA 1UQSB 1CD1A 1WCQA 2VJXA 1U91B 2XWTA 1ZLWK 4AEIL 1WAAE 2NY0D 4PJFE 1G7HB 1C5BH 1D6EB 1I8KA 3MO1B 4K7FA 5EZLB 5GGRY 3PV7A 1NSNL 5ICXB 1A6WH 2R2HB 1CICA 3CXHJ 4GSDH 5KAQF 4U0RC 1S7UB 3GMMA 1HQ4A 5HJ3A 2P24B 4KZEH 1JRHL 3GI8L 2DS4A 5DK0B 5CIPB 4HUUB 4H88L 1UACL 1A14L 3Q0HA 5E9DD 1PLGH 1QQDB 2DTSA 3KWWB 3EYVA 2VZ3A 4GW4B 2IQAB 1JYVA 2V5TA 2YPVH 1FDLH 3N1PC 5EZOL 3QDMB 1YYML 5SX4I 1P1ZB 1S9XB 4EN3B 4JG0H 4OZFA 3HE6C 4P3WA 3X17A 4ZAKC 1E27A 2DM7A 3NAAH 4OUUA 4P4KA 3B9AA 2X4UB 5CFHA 3QUZD 3BHBA 4G9FD 1R5VB 1QHOA 2UWEE 4FXKB 3FTGB 3G6DL 4MDJA 2VDPL 3QH3A 2WV3A 5ADPL 1CVRA 4V1DD 4GW5B 4RA0C 2BCKA 1OAYH 3GSRB 5BO1H 4J4PD 4KPHL 2PR4L 3EJYC 3DHMA 5HYIA 2EH7L 4FABL 5DRXA 3LKNA 2EYTB 4K7PX 2PKDA 3GJEA 1PKQA 2I60L 4M6NH 2EYSA 1OLLA 5T5FL 4P57B 3WE6B 2OTUB 4P23C 4WW2F 1T1ZB 4XC1L 1L7IL 1A7NH 1FO0H 1K2DB 3EFDH 4ODXB 1XIWA 4NWUH 3D25A 3IGAA 4GKOA 1XGTB 5CJQH 4JFYB 5JQ6H 1TNMA 1UENA 2COQA 2I07A 5AZEH 4GSDL 4YHOH 2CLRA 4KZEL 4WU7A 5J12B 4DUWA 5CSGA 1QSEE 3I6GA 3LQAH 5JXEC 1FVDA 1XEDA 1T1YA 1I7TB 1D6VH 2EDNA 5CZVH 4A6YB 4OFVA 4Y8DC 4XPHH 1PLGL 4ZPVB 5GGSB 4F7EA 2W91A 1CG9A 5ID1A 4OI7A 5DI8A 2XQYK 2VLKD 3VGAB 2GYSA 1MJ8H 1NAKL 4AZ8A 1CDBA 2YPVL 2EEDA 1FDLL 3OJDA 4JFDD 4QWWD 4J12A 5HHOE 2Y5TA 4OGXL 2GAZA 4HIEB 1MLCA 1ZT4B 5IHBA 3W0WA 1G7QB 4JG0L 4LRNH 4YFDB 3IDJA 2VAAA 1T89A 5GGVY 4BQCA 1MOEA 2J8UF 1UWEL 1KTKE 4PJCB 4IRZL 4XAKD 3IYLW 5D1ZA 4FTVA 3GJFK 3VWKA 2I27N 1BZ7A 4BM7A 2ZOLB 2Q7YA 1DBBH 3S35X 7CGTA 3TJEH 1MJUH 4APQA 2I24N 1KNOA 4WI6A 5JW3L 4TNWF 4HAGA 2AV7B 4KKAC 1JGEB 1ZSDB 5BO1L 4Z78B 3FQRA 2AK1H 5JLZA 1I8IA 4Y19D 1XGRB 3RVXC 4I0PB 3GSXB 2VR5A 1G9NC 3T3PE 1E4XH 5F3BA 3EHBC 1L9MA 3ZKSD 1MCEA 2Y7QB 1C08B 2A38A 3S96B 5EUOB 4GG6F 4ZNEA 3P9MA 3EO0A 1DR9A 3QDJB 4NQED 2X4QA 1A7NL 3PG2A 1FO0L 1F3DH 3EGSA 4TVPE 4WJ5B 4NWUL 4ZFGH 1MWAH 1P4IH 4GUPB 5EO0A 4QKXB 4QF1B 5AZEL 2V7HA 5KSAB 1FVCB 4YHOL 5L2KB 2GUOA 5A3ID 3OF6A 5DJAA 2XY2A 3LQAL 1J88A 1RZGB 1IQDA 3O3DB 4Y1AD 1G9NH 5CZVL 2OZ4H 3AS3A 2V2TB 4PRNB 1WIUA 4JRYA 2DIAA 1FL5B 5JPMA 3ROLA 3ABZA 5DO2D 1JNHB 1KF9B 2HFEA 2JK5B 5HDOA 1P4BH 4ZFFA 4RGND 1VFMA 4N0UE 4LHUA 3SGDH 4BQ6A 2MHAA 3T1FB 4FRWA 5C0AD 4Y5YC 1SJXA 5IOPB 4OFPA 3AFLA 4NKQB 4QOKA 3IKCB 5FM4A 5E2WH 1JPGB 5C0ND 1G7IB 3V5KB 2Z92A 2X5PA 1ERNA 4GQPH 1HOCB 4ONFH 2HT2D 2X4TA 3QR2A 5D7IB 1MJUL 6FABH 1UH4A 1RIHL 3C5ZD 1CD0A 1UWXK 4IS6A 4Z6AT 3V7AE 1WWWX 3TM6A 1JF1B 2XWJB 4PJ8C 4DGIH 2W65A 2FJFA 1XR8B 2AK1L 2DAVA 4U7KA 3NN8A 3KDMA 4U1SA 4EBQH 4P2OC 3JSSA 3GBNL 2BFVH 4C54A 3ZT6A 3QQ9C 3MFFA 4XCNA 1WWBX 2KQNA 4DKDC 2WLYA 1N59B 1MWAL 4JFFA 4ZFGL 2EYRA 3BP4B 3F7YA 4P5KB 4JZJB 5CUSH 4ZTPH 4HIJA 1FGNL 2ED8A 1FNEA 4WUUD 4Q9QH 5C6WH 5SWZB 3T1WA 3PP3H 3HC4H 3P9LB 5EU3B 3U7YL 1LO2H 3EZJB 3BPOC 2FIRT 1A4JB 1FHGA 1BZ9A 2O5ZL 2IPKB 5BS0E 5JIHA 3REWA 2RCSL 3EUUA 3O6LL 5K59E 4JFHE 4L4VB 1KIUA 2AXGA 5I9QB 1ZXQA 4KKCD 5T1MB 1OP3K 3KPPB 3QZWA 3L7FB 4MB3A 1CFNB 3D3VE 3C6LD 2ADIB 1WBYA 5E4EC 4R0LA 3ARED 1WFOA 4K94L 3VI4E 5I1GH 1FORH 1LE5A 3ARUA 1UB5B 5HHMB 5DDHA 4GAYB 3N06B 3P4OB 4XPFL 4DGIL 1CE6A 1NQBA 4HSQA 1QYGL 3WDJA 4LSSH 4PJ5E 3B6SB 4NIKB 5BXFB 2JB6B 2WBWB 4UI2A 2BSSA 5TQ0L 3MV8D 3LD8B 2YPKA 2BFVL 5TF1L 3QNZB 5IB4A 1T5XA 2O61B 1K5NB 1SMAA 3QDGA 1DQQA 4OB5L 1FZMA 2VABA 3H9HB 5D7LA 4RIRA 1TZIB 2CLZB 3SJVE 3VXNA 3UTQA 2PXYA 2Y9RT 1CXHA 5CUSL 4K8RC 4ZTPL 4QHNB 5DHVB 2BP3A 1I9RH 2VSCA 4ZUWB 1W0WB 1Q9WA 3DHJA 3TVMB 3E1F1 5H35A 1S9VA 4Q9QL 1F4XH 3BH8A 3BDYH 4H0HB 4NO5B 5KSBA 5FYJH 1JGLH 3CCHB 5FGBA 2OL3H 2V7NA 2BNUB 1LO2L 1EK3A 4Y7MA 3VH8G 5GZND 1DFBH 3BYTA 2FGWH 1MH5B 3D18B 3PWLB 4QGTA 5HI3C 1FFRA 3TN0D 1U8NB 3ZE2E 3PWPD 4FQ1L 2EDEA 1J87A 3RL1A 3V4PL 3GSNB 3IDGA 4K8RH 3B5TA 3KS0J 4LHUG 1YDPA 3DETC 1FE8H 2IH1B 1QG3A 4PY8J 1QFWI 4XP5H 3MNZB 4ELME 1JGVL 4WO4A 3V6FB 5HHPA 1SEBA 1NL0H 1BBJA 1GCFA 4A2MA 4H0IA 4L9LC 5D1XC 3MRCA 2PO6A 1FFOA 3RL2B 5EU7C 1QFWM 3BN9D 5GRJH 3IT8D 5IROA 2VISA 2HTLD 5DMKB 2NX5A 4UINH 4UUJB 4MAUH 1DEEB 3VMOA 4OQTA 1VDGA 2IMNA 3PABB 3M8OH 2X89A 4XPGH 4NUGH 5DJ6B 2HLAA 4LL9A 4HWZB 3WL9A 1KCSH 3GSWB 1BJ1H 4PJXE 4KJWD 5C0DB 3SGEI 4HIHA 2Y5EA 4FFYH 3O41B 3QIWD 4KDWA 3P3YA 1AQDA 3P0YL 1LK2B 4HFWB 5FK9B 5BV7B 4UAOC 3PXHA 4D2NA 1OAXH 1DN2A 2NW3A 4ODVL 1G0YR 3ETBF 3I3BA 4PBXA 2KZWA 2X2YA 1QSVA 3SDCD 4PJHE 1I9RL 3NCYP 1LD9B 3PHOB 4F15B 3K7UA 2DKSA 3BDYL 5DEFA 4KROB 5FYJL 1JGLL 3WO4B 5F70A 3VI3F 3VFWB 3AC0A 3MYJA 3IFPB 5I2IA 1DFBL 2FGWL 4XNZC 2ZUQB 5DFVC 3WNPA 1T22B 1EO5A 5JIKA 3RVWC 3ULUC 4S10A 5GRUH 4M61B 1DE4A 3SO3C 3L9RB 1KLGB 3IETB 1BD2D 4JY4B 5MHSE 5DUMH 1RAMA 1D9KC 2AK4D 1FE8L 3CU1A 3J8F7 4K3GA 3T09A 3UYRH 4PJDF 1EERB 1ZVHA 1ZA3A 4U1HA 1YMMA 1NL0L 4CW1A 3BWAA 1KG0A 3HAEA 1DLFH 3WSQH 4Y2DB 3W9EA 4N0YH 3BMWA 2IAMA 4O2EA 2MJWA 2VAJA 4FQXB 5GRJL 2AJSH 4ODUB 2H32H 2R0KH 1MCKA 4UINL 3MGAA 4MAUL 4FFVC 1ZGLA 4NJ9H 3ULUH 1UCBH 4XPGL 4IRJB 4HDIB 4G7YH 4PJFA 2F58H 1J0HA 2G2RA 1SBBA 1WSST 1HHKA 1KCSL 2NY2C 4LKCB 1A9EB 1RZIA 5D70H 4F7PB 1DBML 3VFSA 4FFYL 2E27H 1DBAL 3QQ4B 3CZFB 5D8JH 3LKOA 2D31B 5KBNC 3ARGA 3FN9A 3FB7A 4MWFA 2V2WA 2FDBP 1BIIA 5BVJB 4ZUUA 4MAYA 4WHTA 2Q3ZA 2Q20A 2DJ4A 1XF3A 3RVTD 4L8DA 3DV4B 4HKXA 4OZIB 5DVKA 4CU6A 3QEHA 1HYSC 1IM9A 5I71B 5FO7A 3O6KH 1MY7A 5AZ2H 2HJFA 4WUKH 3WDIA 5GRUL 5HYSA 3QI9C 3BQUC 3JV4A 2YA0A 4YHNA 2VL5A 3V6BR 3QUKA 4G6FB 4JREB 5DUML 1WZ1H 5F6IB 5F9OH 4Z7VE 1B90A 3UYRL 3WS6A 3MBXL 3DBXB 1S9WB 1HHGA 1QLRB 4BKLB 1DLFL 4UB0L 3WSQL 2Y06H 5D2LF 3H3BC 4WV1A 4NJAL 4QRRA 4R2GD 2AJSL 4MQXD 4LCIH 4M9PA 4NRXB 1N8ZA 4LKXB 4NN5C 5E8PA 3LN9A 4NJ9L 3ULUL 3EIFA 1K8DB 1KPVA 2F58L 3OXSA 2YA1A 2CDGA 2BY0A 4R4BA 2LFGA 2PN5A 3ULUF 1QFUL 3PDDA 1I9EA 1CDGA 2D4FA 1PX4A 3QYCA 1G6RA 4BELD 3BP7A 4X9HA 3FQTA 1QSEA 3QXDB 4LPWA 1D7FA 5D8JL 3WNMA 5L8LB 3PQYD 5TGBA 4YO0B 3X13A 1AXTH 1KCRH 2ZUXA 3VXPA 3O4OB 4OV5A 3H9SD 4U6XA 5E9DB 4JM2B 4BFIA 4PLKC 3RY5A 2IPUK 1NEZA 3SGKA 3O8XC 1TETH 4QY8A 4CVWA 2VC2H 3IJSA 4PS4L 1LE9A 3K3QA 4TTDC 3ZE1F 4EI6A 1QA9B 1Q94B 2RBLA 1WC7B 1H8SA 2ZSVB 4OZHF 1IEBA 3O6KL 4X99B 1A7RL 4WU5A 5AZ2L 1LILA 1HSAA 1N6UA 3UPRA 5EU6D 5EU5B 4GRMB 3DXAD 3ARFD 3QUZB 3A67L 4PGDB 2CRYA 4XWGL 4CVXB 1C12B 4G9FB 3HC0B 3HHRB 2VB5A 3AXLB 5F9OL 1NGQH 4I48B 2FR4A 1JWUB 4KZDL 3CFCH 4PJAB 4IMKA 2CSPA 3T4AB 1F13A 3O9WA 3TESA 4V1DB 2FB4H 4ZXBC 3QIBD 4L8BA 5DFWH 1B0GA 5T1KD 1KC5H 2A0LD 2EH8H 1IQWL 1TCRA 4KRNA 2DQIL 1YN6B 1A9BB 1XGQB 2HKFH 2X44D 2E6JA 5HVGB 4PTTB 4P2RD 1HNFA 2ADFH 3BPLB 2BDNH 3IXTB 5EWIH 4I18A 4JB9H 2CKBL 4NGHH 4NNPH 4NZRL 2ITCB 5AD0A 5HYJD 3FQWA 3MLVH 4HK0A 2EC9T 4DZ8B 3QHFH 3ZMRA 3CSPA 3BRGC 2RFXB 4C83B 1QLEL 4TNWK 5IMLB 3F65A 5I1DA 5J3HD 1AXTL 1KCRL 4N0CD 3FONA 1F4HA 3IF1A 3WO3B 5EBLA 5C0EB 5B3NA 1OGTA 2XIDA 5SV4A 5F7EL 4IMLA 4JDZA 2APTA 1TETL 1AP2A 2VC2L 4B7IA 5CGYD 3GI9H 2X7LA 4JFDB 5INCA 2X1PA 4G8GE 4PPTA 3SDXA 3PHQB 3KYMA 5FUOH 5C1MB 5I74B 3O3EA 5E6ID 5CEXB 2J8UE 3OR7A 2FYYB 4U6HA 3O45B 3QULB 3NZ8B 3GBLA 4HKJA 4PJGF 3LEXB 4MLSA 2X10A 5EFIB 1G84A 5CSZA 4LLWB 5CJXC 1EAPA 5EUKA 1AXIB 2J1KA 1NGQL 4DW2H 1FAKT 3CSYA 4KWUA 3V4VL 1TTUA 4LCUA 4JDTH 4K71B 4PRID 1LEKA 3FB8B 3T0ED 3VXMD 4LVNB 2PTTA 3MRDB 1J12A 2FB4L 5B4MC 3C2AH 4M43H 1JK8A 4YAQA 1BOGB 3WIHL 4OTXH 1YPZF 2NNAA 4Y19B 4W6YB 1ZLSH 3RP1A 4Q9RH 2EH8L 5J6HA 4K9EC 3AVEA 5E5MB 3RIAF 4KK5C 5D96B 2VDOH 1OTUC 1K4CB 5DC0A 1A1OB 1NCNA 3QNYA 4GG6E 5I1JH 4HLZG 2ADFL 1ADQA 3BX7C 3MREB 2Z31C 4HGMA 2DM2A 4JB9L 3A6OA 4NQEB 3VD3A 5DJ8A 2XTLA 3IFOA 8FABA 1FFNA 3VRIA 1P4LA 2IAND 3MLVL 1CGYA 4DN4L 1KCKA 1PG7L 2P45B 2EDFA 5ICZB 3QHFL 1QLFA 5DJXA 4JO1L 1HHJB 1VENA 5C6TH 4HS6A 3VFMA 3BP5B 1LNUA 1CU4L 1TZHA 4J4PA 4Y1AB 3UX9B 1EAJA 3WKML 1SBSL 3RDTD 4DAGH 4HC1A 2NXYD 3NPSC 1AHWB 1HCVA 3ZKMC 1SY6A 4YEEA 3ZHLA 5BS0A 3N1GC 5F7KC 3VWJC 4PJ7F 2FNBA 2W07A 3GI9L 2FJGA 4RGNB 4KXZI 2NY7L 5L0QC 5FUOL 2BNRD 1H5BA 1X6LA 3HRZB 4LPUA 1ZWIB 1NEZG 3B8YA 1EUTA 3QG6A 5FYKU 5L9DH 2H2PD 4PRHD 3WLBB 1WBZB 3D3VA 3FN0H 4LLVB 4F7CB 4YFLF 3RBSA 4LCWE 1YEDA 4RBPH 1UEMA 2B5IB 3U0TB 4DW2L 5DTFB 4KTEH 3L3HA 1Q9LA 2A73A 2HH0L 4DVBA 2XKNA 3TIEA 3ULVD 3MNWA 3K4DA 3MLZH 3QWOB 3C2AL 4M43L 1J1XH 2VLKA 4PJ5A 4OTXL 1ES0A 4Q58C 2BHYA 3V4UH 4Q9RL 3LS5H 4G6JL 4FA8A 4HS8H 5IVXB 1X9QA 2XKSA 2Z35B 5LJYH 2Z4QA 4QHMB 1T0MB 4HUVA 1J9CT 3BIAX 5I1JL 2XQYG 1EMTL 4MCZA 3LPWA 4ZODA 2Q76B 3KJ4B 2DIJA 1PDKA 2I9LA 4M8VA 2OI9B 5FKPB 1U58A 1J5OL 4Z0XB 4EDWL 3NTCH 1BP3B 1TIUA 2AAVA 3G5YA 2NY1D 3S36X 2H26B 1N64H 1RZFH 3MBEC 4POZC 5C6TL 2GY5A 1OGAE 3QWQB 4WUUB 4JAMA 2EDQA 3U4EA 4JCMA 5IKCA 5HD8C 1QHPA 4QRTB 5GRWA 4QRPA 5IJVA 5IB3A 4LLUA 5F97E 1OB1A 5LCVH 3D85A 4ZDHB 4X7FC 3VFUB 3GKWH 4L3EE 1E6OH 1BFTA 5CP3H 3SKNA 4CN1A 5T5NG 4PLJC 5GGTH 3OTTA 2EDBA 2WBJD 4XTRD 4F2MA 3L1OH 1RVFH 4YR6A 3I6KA 4RZCB 2HA1A 3FHQA 2CMRL 3FN0L 2OK0H 4ACPA 1EGJA 1J0KA 1QO3A 2X6MA 3C6LB 5K9KB 5I16A 4UT9H 1M7IB 2B1AH 1QSFE 3AREB 2AJXL 4KTEL 2GTWA 3P77A 4ODSH 4YHKH 1YEEH 3LV3B 4O2FB 5HHQA 4U2ZA 2XV6B 5KTEL 3MLZL 3RWIB 2ATPB 2FEEI 2XWTB 2LABA 2BVQB 3VRJB 3V7AG 3V4UL 4PG9B 4ZUTB 2QQNH 4PJXA 3HNSH 1I1FB 5MEND 3V5DB 4Z7WB 3TC9A 3MV8B 3VFRB 2VOTA 1TJIL 1YMHB 4XP9H 4KJPD 3TZVC 1YY9C 3VFTA 2LTQC 1L0QA 1N2RA 5DYOB 4Q7DA 1O7SA 4NSKA 1R3LB 4XVUC 1XCTB 4L8SC 2E7CA 2PUQT 3EYVB 1IKNA 4L3AA 2RQ8A 1RZFL 1U36A 4LGSB 4IIQA 1P9MC 5HHOD 1RJYA 1VFUA 5FDYA 2Q87A 1Q38A 2YD4A 1FFPA 4LSTH 5BZWA 1TTGA 4Q6IB 1MFDL 1PSKL 3KPMA 5MI0B 5LCVL 1KJ3H 4MJ6A 4XCCH 1ZGLM 4PRPE 3JUYA 3GKWL 3G5VA 4WWKC 4GAGH 3EDDA 3TN0B 5GGTL 2ITDA 1J86A 3PWPB 1BQHA 4DOHE 1RVFL 5AAMA 3DRTB 3HPLB 4IOFD 2DMCA 1U93A 1DLHB 4FZEH 4DK6A 2E9JA 2BOBB 3CSGA 3K4ZA 3V8OA 4UT9L 2B1AL 5IUSA 3AUVA 5IFAL 2C7UB 4JANB 3UO1H 4ODSL 2HVJA 3Q6FA 4CUCA 3W9DA 5CP7B 5I17B 4A2LA 1KJMA 1V05A 3BE1H 1KTDA 1UEYA 2WINB 4S1RL 3G6AA 2DQEH 2ZJSH 5FEBA 3DX7B 4OF3A 2QQNL 1ZHBB 3HNSL 4EVNB 1GZQA 2KBGA 3IGAB 5E8NB 5IWLA 5DSCA 3QIWB 1S7WB 4XP9L 4G3YL 5HYQB 1ACYH 1GGTA 2D9CA 1PFCA 3P4MA 1JUFB 1AGCB 3EOYG 4UNUA 4YHYB 2ZNXA 5A2LH 2RGSA 5I8OH 3DYOA 5IF0B 5MEOA 5E2TH 4GW1A 4F7EB 4U1IA 4RSVA 4Z7QF 1AGFA 1CG9B 1OQOA 4BSWA 2CUMA 3TYGL 7FABH 1AR1C 3QA3B 3ARDD 1R24A 4TSAH 3SDCB 1MHEA 5IFJA 3BKYL 1NCWH 4YH6A 5DJ2A 1UKQA 2Y5TB 1ZANH 3VI3E 1T1WA 3L3KB 5KN5A 5F1NB 1EHLH 3VXQA 4YX2H 2VN7A 1V8HA 3BKJH 3CX2A 4U7SA 1A1MA 5FYJE 2BZDA 5DQ9B 1FG2A 5D1ZB 2NZIA 1OF2B 3EOBB 2YRPA 3MJGX 2VO5A 4GS7C 1JZ7A 1KJ3L 3ILPB 1NCUA 4XCCL 1NC4D 3FFCE 3PL6D 5J1SC 4GAGL 2XTJC 1BD2B 4FMKA 4JCLA 4Z7VA 1EXUB 2FX8H 1NMBH 3BZEB 4PJDE 2AK4B 4CVUA 4FZEL 1A6ZB 4J3SA 5IJKA 4DVRH 4J3VA 1RPQA 3QO0A 4PRDA 2X4SB 3UO1L 2MCPH 5FV2A 3S6CA 4WGWB 3BE1L 1TQCB 5E94A 5T1LA 4MCYB 4POUB 3O11B 2NYYC 5FA4A 2DQEL 3C5JB 2X4QB 1HEZB 3I9GL 2X4RB 1JZ4A 4W4OC 1NAML 5CEZH 3QEUB 2Q8AH 2Z0BA 4MQSB 1H8OA 1F6AA 3UTSA 4MNGB 2OSLA 3BWUC 1YC7A 4G42A 4R4NC 1G1CA 4G9DB 1RZKC 4NHUB 1MVUB 1A3LH 3OGCA 4R90H 2GJZA 3VH8B 4M8QB 1T7ZA 1MHPL 5F9WC 3DLQR 1A6TA 1X5LA 5I8OL 5HGHA 3C8KA 2DQCH 5E2TL 5CILL 1DJSA 5EU7E 3P0VL 4RMQA 2UV3A 3VXRD 2AJ3B 2XA8H 7FABL 1NBVH 3HZVA 4TSAL 5I19L 3VXOB 3PIQA 4ZPTA 1NCWL 3TH4T 5I15L 1ZANL 1NUDA 5DMJB 4YX2L 3F12A 3CAFA 5CAYB 3BKJL 1SM3H 4RGOH 4HUXB 5D1QC 5EC1A 4XCEA 1H3WM 3MRFB 1HSBB 1AGEA 1RZKH 1WV7T 3E8UL 3OJMB 3VFNA 3WCYA 32C2A 4LEOB 1S7QB 3MV7D 5JPNA 3GFUA 4EDXB 1V7MH 4OLXH 3HZMB 1KB9J 2XN9A 3FB6A 2Y4SA 3LKQA 4OD3H 1YQVH 1EZVY 4P9MH 3ROOA 4BK4A 1I7ZA 5IT2H 1S9KC 4M7LL 1I3RA 2CD0A 3IFNL 4JFOA 4Y4KA 1NMCC 5D2LE 4NO2B 3OKEA 1E4JA 1KULA 4MA1B 1FZOA 3NN8B 4R2GB 1KPUA 1V7NH 4JGMA 3S34L 3NFNA 4WW2A 3DMMA 1BX2A 4JPKH 3DVIA 5F3HA 3IVKB 4U1LB 4J1UB 4ERSH 4XCNB 2YBRA 5CSBA 5GRVK 3ULUE 4I0CC 3IFLH 3MUGB 4KVCH 2AERT 3SJVD 1VFAB 1DQDL 4O2CA 1J05B 3STZA 5ESAB 4JLRA 5FM8A 1XF2A 4HIJB 1J1OL 3CDYA 3FO0H 4R90L 2X4NB 2IH3A 2DYPA 4OGAD 1REIA 3K80A 4XBGA 4NDMB 1KEML 2BNQE 2G5RA 3I2CH 4YXHH 3PQYB 3H9SB 1XF4B 1YEIL 2FATH 5JMRA 1S7XA 4LK4A 4JO2L 1ORQB 4C55A 4DKEH 2CLVB 2XA8L 1NBVL 1I75A 4XMKH 5HPMB 4OLYH 3KLHD 2JJWA 4R7NA 1C7SA 3ZE1E 4Z18A 1LEIA 3AY4C 4OZHE 4KUZH 5I75B 1ZT1A 4RGOL 1XT5A 1Q0XL 4YDLC 1RZKL 5C9JA 2E7BA 5HXMA 1N3NB 5EU6B 4AEEA 4U3CA 1KLUB 2FO4A 3DXAB 3ARFB 3KR3H 1V7ML 4OLXL 1AD0A 4OD3L 4TTGA 1YQVL 4HH9B 3P30L 5KVEH 3IDMA 2D2OA 1ZMYA 4WHYH 1U8QB 5IW1B 2XRAH 1MCSA 3CVHH 5C2BH 2PYFB 3MROB 4MXVF 2FEDC 1NLDH 3CD4A 2R23B 2W9DH 5DDHB 5ERWB 4FMFA 3BPNC 3MJ9A 1I3UA 5HI4C 2QADB 1JWMB 5F7NC 3QIBB 3FQUB 3ESVF 4OZGF 1D5ZA 1V3KA 4TUKL 5HY9B 3SBWC 5T1KB 1V7NL 2DMBA 3QRFM 3B8SA 1RZ7L 5FO9B 3I75A 4XI5D 3NCEB 3LKSA 3KYOB 5GGRB 4GG6A 4H0GA 4JPKL 1MAML 3MRKB 4ZSOB 3QDGB 1DQQB 4ERSL 2VERN 4P2RB 1BFOB 3TBWA 1G9MC 1D3CA 3H7BB 3PJSB 4EI5A 2VZOA 2CXKA 3IFLL 1T2QH 4KVCL 4X6DA 3B9EA 4NN7B 5SWSA 2FRGP 2F74B 5LKNA 5HYJB 5B38G 3DRQA 2FIKB 4AYFA 3FO0L 2R1YB 1OLZA 2AGJH 5KAQG 2DLTA 3I2CL 5KSBB 2R69H 3JTSA 4LEXH 2IALA 4GRLD 4GLRH 2VMFA 4OFYD 2I25N 2XZQH 4NN6B 1U3HC 4DKEL 4XMKL 5DVMA 1UB6A 3RIAK 5E08L 1G9MH 3CXDH 2V5YA 2BMKB 4HJ0D 5DR5L 4LCYB 5F7DB 4KUZL 5MHSD 3PGFH 4WENB 1IC4H 4XPAH 1BVLB 1U8PB 3IDYB 4PJGE 5E6IB 4HGKC 4XC3H 2FCBA 2VDML 3RWJB 1Q9OB 1W72L 4CNIA 4LCWA 1YNTB 5IG7B 3KR3L 3RZCA 1GH7A 2DLEA 5KVEL 4P3CH 2C1OA 4HK3J 4WHDA 3CVHL 5C2BL 3LEYH 3DX9A 5MEPA 1ACZA 5HGBA 3FO9A 1NLDL 2W9DL 3L3IB 5DQDH 3UP1A 3T0EB 1AKJA 3VXMB 4LSRH 5D2NC 2QHRH 1HXYA 4Y4HA 5DGRA 1YPZE 4UOW1 4KK6C 1WJ3A 3LZFL 3CFBA 4OQ1A 4CMHC 1EEZB 2P8MB 2VQ1B 2DDQL 3KPNB 1P53A 5DVLA 2NY6C 5EC2A 5ITFB 5F89A 2IPUG 1FC1A 3O4LA 4YHIB 4QEGA 4M93B 3EO9H 4FG6C 4K7PY 2C3VA 4JRXE 4W6XB 2D7MA 3DO7A 2B39A 1S5HA 1JZ5A 1MWAA 1IC5H 2ATKB 3D2UD 2AGJL 4N1EA 1OGAA 3RGVA 3DVGA 3BJ91 1QRKA 4OCSH 4HF5H 5FO8A 3SCMC 4LEXL 3QEQD 2XZQL 2J5LC 3GMRB 3RDTB 4LGPB 2NXYB 5C09B 4PJ7E 4MYWB 4JFEE 1P69B 3ZKXB 5LQBH 5IQ9A 4YNYB 4UIKH 3QFJD 1IC4L 5HGDB 2HVKB 1OY3B 2BNRB 3GMQB 1AGDA 1VA9A 1UFUA 3CSBA 1E4KA 4X6BB 4JRWA 2Q6WA 1QFWH 4OLZL 1ZA3B 4PRHB 4CVZB 4PGZA 4HKBB 1AD9A 1QSFA 4P3CL 4HPOH 4KTDH 2I26N 1WIPA 2YD1A 1KFAL 4NT6B 4WFHE 3WUWG 1RV6X 2DQUH 3TA3B 3RVVD 4TRPL 2J3SA 5GS3A 1BMGA 1HZHH 4IRSD 2BC4B 3OXRA 4YBLC 4S2SA 4LSRL 5EU4A 2QHRL 1FP5A 2F5AL 1NLBH 1L7TH 2ZP0T 1I85C 3OHXB 5I6XC 1WFNA 2XZZA 4GKSA 3TWCH 2EDHA 2QKIA 4P48A 4XCFH 3HR6A 1MHHB 2VLRD 2ZCKH 3OAZH 5LAXA 2NY4B 4OT1H 3SDAA 4G8IA 4K2UH 3LKOB 3EO9L 3P11H 3FB7B 2DF3A 1ZEAH 1CICC 1R3HB 3O3UN 1U9KA 4X80H 4XMLH 2WNGA 2P7TA 3TFKC 1IC5L 4UNVA 2EE2A 1NFDF 3UBXA 4PRIA 2JTDA 1MCCA 3HE7A 4WNQB 1NGZB 4RBPK 3QUMH 4OCSL 4HF5L 4HBCL 1IT9H 5GRYA 1QBBA 1ORSA 1S3KH 3LB6D 3BO8A 5IBLC 3MRGA 4NC2B 43C9A 1HHIA 5FOBB 5JOFA 4AM0B 4EEEA 4I4WA 3LDBC 5LQBL 5JHDD 2CIKA 4AK1A 4BH7B 3JV4B 4YGAB 2UWEB 3U0WH 1HH9A 3QWRD 4NNXA 1YQ2A 4JVPA 4HX1A 2FLRT 4P4KC 1J11A 2WBJB 5JO5A 4GMSH 2FSEA 1KUMA 4NKOB 1NANH 3MOQA 2IANA 5IB1B 5J8OA 4X5WA 3X14B 3GBMH 1JI2A 3L3OA 2JJVA 4HPOL 1W0VB 1JZ2A 3B83A 2ARJQ 3KXFD 4M5YL 5IGXL 1T4KB 1HZHL 2Y6SD 5GS0C 1KBGL 2WIIB 1ED3A 2X1WL 4OZFH 4QTIL 5GGSY 4CKVX 1L7TL 4MJ5B 1R3IL 1ZS8B 2XWBA 4M5ZH 4BJLA 5I66A 5MENB 5FYKH 4XCFL 3S37H 2WANA 4D8PB 3QXUA 4I5BA 1A8JH 2E7MA 4OT1L 3W81A 1CGSH 4S1SH 1S5IH 3LKPA 3P11L 2EDYA 1XIWC 4WHCA 1RU9H 2UUDH 4X80L 4XMLL 1A3RL 5GS0H 4X7DC 1D5MA 1SEQL 3MRJA 4OCMC 1NEZB 4Y4FA 3QISA 4BFBD 2XA3A 1UZ8A 3QUML 4G8GD 4OCYH 4S0SD 5HHOB 5HPOA 4PJEF 3STLA 1IKFH 1IT9L 1CIDA 2C3GA 1S3KL 4YPGA 2D0HA 4DTGH 5IM7B 3RJDA 4OF5A 1AJ7H 5D7JD 1U8MB 3U4BH 4R97B 4GXUM 3FFCA 4XAWH 5I1LB 4N0FA 3U0WL 1T89C 3T0WA 1JHLH 5IESH 1YNKH 1T0PB 4PJDA 5JW5B 4GMSL 4BSVA 5IW3A 5F88B 5HGAA 1JRHI 1PVHA 3VWKC 2ZUYA 2K9UA 2X1OA 3GBML 1K4DA 1NGYA 4RFEB 1K6QL 1MCOL 2J6EH 3MUY1 4APQC 5J6GB 5F9JB 3M45A 4ZAKD 1LHZA 2OTWA 5TDPB 3RUGF 3CU7A 3SY0A 5DA0B 1YY8A 5GGUA 1ZLUH 4HV8B 4NC1C 5DJ0B 1U8OA 4JZOA 1KCUL 4M5ZL 2CPCA 1LVEA 4KRMB 1OWRM 4XGZA 5FYKL 1TJHH 3GJFB 2GCYB 2VZUA 2ESVD 1TVBA 4WI3A 2BXYA 1CGSL 4RAUB 4UNTA 3M17A 4DFHA 3WFEH 5BZDA 5I1DB 1L0YA 5JIIA 3IB4A 5DFTA 4DGYH 1QNZH 1RU9L 1FV1A 5IEHA 1L6ZA 3K0WA 4Z7QE 1FZJB 1CDUA 5DZLA 5AWNL 4ENEC 4HGWB 4JDZB 4P23D 4N0UB 1VFOA 1HK6A 3ARDB 4OCYL 1IKFL 1IC1A 4M48H 5GHWH 3VD7A 2X7LB 4Q2ZA 5I8EB 2IFFH 4M1DH 3O3EB 1UYWL 3UBXG 3S5LA 1XGUB 1AJ7L 2CR3A 2FHFA 4XT1C 4FQCL 3U4BL 3BDBA 3TBYA 5CD5C 1R3KB 5JXED 1NC4B 3PL6B 5DRWB 2DIBA 5IESL 3VXTA 5JDSA 5GRZA 3WMSA 5HBBA 4C56D 4DCQB 1AH1A 5CHNA 4X6FA 3TIDA 5LGJA 5I8CA 4NPYA 4YHZH 2CGRH 4Z77B 2J6EL 3K2UH 5J6HB 3B9KA 2XNAB 5F7YC 1DDHB 3ARBD 5IB2B 3STBA 5D7KD 1CFVL 3V0VB 3BGFC 2EZ0C 2BVPB 5JW4Q 3QXAA 3RNKA 4AY0A 2YD9A 3FT3A 4QCIB 1JPTH 4WEBH 5F7FA 1TJHL 5DURD 5E0QA 3HPJB 3UTZB 2VH5H 1D9KA 3C08H 4GXVH 1QLFB 2GJ6E 3BH9B 2NR6C 4K3EH 4KKAD 3MCLL 2VXQH 4EUPA 2BNQA 1LNUB 4ZFOB 4AH2B 4XNYH 4DGYL 1QNZL 3S35L 4MA3B 3QNXA 3DV6A 3U6RA 4YDKH 2OJZL 3IU3B 2FZ3A 3LHPL 1CYGA 5BS0B 1MREH 3VXRB 1WT5A 3T2NH 1MI5E 2MFNA 4L3ED 4M48L 5GHWL 4Y16D 4OZHA 5C0JB 4GKNA 3D1MC 2IFFL 4M1DL 1RUQL 5E99L 2H1PH 1EEYA 4HHAB 2EDDA 4OD2A 2X4PB 5D6CA 1MFBH 3GM8A 3GIZH 2DBJA 3N85L 1YEDB 4WY7H 3MV7B 2QSCL 1U8IA 1HINH 3KPLB 2HRLA 4NUJA 1KB5B 1Q9LB 2VQTA 1FYTE 2IADA 2XZAL 3R06A 4HWNA 3SE3A 5I1IH 3PWJB 5HDQH 5B8CB 5F7HA 3MJ7B 3MNWB 4R0LC 5TPWH 4BH8A 4UDTB 2BHZA 1GAFH 2CGRL 3DTXB 1MUJA 3K2UL 1NMAH 4X7SH 2AEQH 4G6KH 2YMXH 4G7VH 5DLMH 5A16B 1GOHA 5ALCH 1HYRC 1TPXB 4MD4B 1EBPA 4D0DA 1MRCL 2Z4QB 2P5ED 2JIXA 1U8LB 1QKZH 2R1XA 3N1QC 3V52L 1GZPB 2YSSA 4QHKI 3QDHA 1BEYH 5INDB 5HVHB 4WEBL 1JPTL 3MYZA 3SJVB 3MV11 4F80A 2CKBA 2XTJE 2UZYB 3C08L 4GXVL 4H1LA 4K3EL 1P7KA 1GXEA 2VXQL 5CEZE 1U41A 4PJ8D 5FDWA 4NO0B 3OB0H 2AV1B 4XNQA 2EKSB 5KANG 4XNYL 3BSZH 3TBVA 2NLJA 2G60H 3WIFA 3TBTA 5ISZD 2PXYC 3B3IB 3U4EB 3OPZL 2R4SH 4P2OD 4YDKL 3VD4A 1Y6MR 4LLUB 1CK0L 4PRPD 3T2NL 1ROWA 1PQZA 3QQ9D 4XMPH 5FGBC 3D85B 5C08D 5C0BE 5TH2B 2ORBH 1PW3A 1E4XI 3HCVA 3EO1B 4PJGA 3PNWB 4YR6B 1M6OA 5AG8A 1UJTA 4ELMB 2EICA 4HJJH 4QRQA 3NCYS 4WY7L 4YBHA 3KLAA 2ICEB 4RA3A 5I16B 2XFXB 2GI7A 5BMFH 3P77B 2ICWA 1N5AB 4LASH 5I1IL 2BOCB 2G5BB 4WO4C 2KZ1B 4H5SB 4LPCA 4RFNB 2DQFB 2P42B 3FKUS 3L3GB 5IR1A 5TPWL 1XZ0A 3X12A 5JQHC 3OR6A 1JBJA 2PO6C 3BD3A 3KPRE 4XZUA 1YPZA 4OZGE 1GAFL 2GW5A 4X7SL 3OBAA 2AEQL 4G6KL 2YMXL 5DLML 3E6HA 1INQA 2V9RA 3WIHA 1MJ7H 5T3XL 2D7QA 3L6FB 2E7LC 3O3BA 1CL7H 1QKZL 2GSIA 4GJTB 1T5WA 3SGDI 4CMMA 5C3LD 5J1AA 3GB7B 5CD3B 1BZQK 4X5LA 1ZHKA 2A6IA 4NSKB 1MCHA 3FN3A 4FQQA 5D6DA 1IGFL 3H3KA 4PJHB 3L3DA 2UYLB 5FUCC 3HMWL 4XRCA 1R3JB 2DQGH 1EA9C 4AIZB 1RJYB 2IBZY 1GC1C 1IAKB 2G60L 3BSZL 1ZHLB 4G8EB 4X0KA 5HGGS 3EOAA 2R4SL 4GG8A 2HP4A 4GRLB 2NZ9C 1WISA 4OQTH 2H8PA 3C60A 4ORZC 4WW1B 1QRND 4ODHH 1HHHA 4PJ7A 4UILH 5JUEH 3KPMB 3PHSA 4PP2A 1U42A 1X5IA 3B4NA 4XMPL 1RK0B 1E28A 1T04A 4LCCB 4N68A 3MRRA 4IDJL 4CJ0A 1RJCA 2ORBL 1G7MB 4YHPB 3VXUD 3UJJH 2I5YH 4JZNA 4RNRB 4IJ3C 3C6SB 4K8RD 3T4YB 1A6AB 1UGNA 2GK2A 1GC1H 1NCTA 1DVFA 4C59B 3HZKA 2YPLD 3MRLA 2EE9A 4I9WE 3V0WH 1N0LA 2EXYC 1LO5A 4LASL 3UBXI 2OJEB 1IGML 2HVJB 2LE9A 4P2QD 3RWFA 1LGVA 1OP9A 3G5XA 4UT6H 5D7IF 1U92B 1KTDB 1SJHB 2F15A 4OM1H 1FSKC 1HQRA 4ALAH 2IAMC 3RFZC 2UZIL 3TPKA 1HKFA 5DJDA 3WN5A 3O6FA 3QDAA 4ZO6A 3W39B 4E42B 2ZOKA 1XF5B 1CL7L 1SYVA 2GT9A 2C4XA 3EOTH 2HYMA 2KQMA 2APXA 3KJ6H 3FCTA 2F54E 5AYUH 5D1XD 2V2XA 3ECBA 3HB3C 1UM5H 3SE9L 3CFKB 3SKJH 4MX7A 5LXGH 3I02A 1QFOA 4POYA 3HAEH 1DCLA 2V5RA 3E6FB 1CGXA 1AGFB 3ARGC 1GGYA 15C8H 3ME0A 4QLRA 3MUZ1 5ESQA 3PDGA 2XXCB 2DQGL 1IM3A 3RA7H 5HI5C 5IK3A 3QJHA 4H1LG 2DI7A 3OKNA 4HKZB 4X9BA 3VE0A 4OQTL 3P73A 3QEQB 2R8SH 4MAYC 2ZUUA 4L8CA 4UILL 5E70A 3U9UB 2DD8H 4UBDC 1T7VA 3GSUB 1C16B 1KIPA 4ETQA 5E2VL 4KI5C 3TBSA 5FHAL 2P8PB 1A5FH 3IU4H 1NC2A 5EOTA 2OLDA 3VFPA 4MS8C 1TQBB 2CJUH 1N6QH 3UJJL 3MJ8B 2I5YL 5C07A 4NWTH 4Z7VB 4L4TD 3TYFB 4GOSA 2N4IA 2CDFA 2YD3A 3DUSB 2AXHA 1C1EL 5DJCB 2HT3D 4JKPL 1JTTA 2V6HA 4Z7NF 1DSFH 3P40A 3V0WL 4JFPB 2WBKA 1A4KA 4PB0H 5IEKB 4IHOB 3VDAA 3WS6C 1YEJH 2EIZA 3AS2A 5D93C 4NCC1 4R6UA 5EN2B 2X4OB 4IRSB 3HI1A 4JEGB 4ALAL 3N9GL 4WV1C 1JYNA 1X4YA 3V5HB 3RVWD 1CXIA 1JHTA 1H15A 4M3KB 1ZLWH 4X6CA 4FP8L 2ERJB 5B38B 4O02H 4Y5VA 3LIZH 3UZEA 3SGJA 1DUZB 3A6BL 5GIRA 2R1WB 3DVNB 1A21A 2VLRB 4U1KB 1J8HE 1DQLH 4PYGA 3K1KC 4H8WC 3KJ6L 4MVBD 3RQ3A 3WFCL 1A6TB 1KIQA 1UM5L 3PDOA 4X6EA 2AEPH 1HXMB 2X09A 5JZ7C 1HCFX 1NFDE 3HI6H 15C8L 3T04D 5ANME 1TFHA 4FFVD 4Y89A 4G6MH 3PIQB 1PBYA 4HXBH 4N5EC 1AXSA 1PYWB 3RA7L 2NXZC 2MWCA 2WQRA 3V6ZB 1X5FA 3RVUD 2F19H 2E6QA 2YRLA 3G6JB 3WNLA 2BVOA 1U95B 1UXSA 1MRDH 1RUML 2NY2D 3RAJL 2ZG3A 3SGKC 1ZGLP 4GBXA 3VFNB 4MJIE 1ZOXA 2QL1A 2H2SC 2J8HA 3GSNL 3IU4L 5JHDB 3MUHL 3QUYA 5KANI 1JP5A 1G6RH 2CJUL 2HJLA 1N6QL 5ELIA 1K8IB 4NWTL 4NFDA 2BSTB 4ZYKA 4JDVB 1NJ9A 3OAZK 1P2CB 4QTHB 3IS1X 4X4YA 4NQXA 5JW4M 1DSFL 2V5MA 4YXKH 3D2UA 4EXPX 1FZOB 4PB0L 3TCLB 1BHGA 4NKMB 3BEVA 4IMKC 1YEJL 3KXFB 4M7JH 3PV6B 5HDBF 3S3JA 2VITB 3F6IA 5I30L 4TUJA 5GS1A 3O9WC 4AENB 3QDMD 4OCXH 5F3HB 4BFEA 3THMH 3VGDA 1F2QA 3BQUD 4LF3A 4P46C 4YWGH 1KJ2B 2GK0A 4O02L 4NC0B 1DANT 4KI5F 3FFDA 4W68A 3QFDA 3V6OC 4TSCH 4CADA 3U2SB 1DQLL 2XICA 4Z7UB 4D9QE 5BV7L 1XF2B 4I18C 4F7TA 4U1JB 3VXSE 1DBKH 2CK2A 3HS0B 3L5WA 3FB5A 5J57B 1HE7A 3R0NA 2AEPL 4J8RB 3WS3B 1AY1L 3NABH 1S7XB 2YWYA 5IVZB 3WLWC 1NFIB 1DZBA 1T80A 1YUHB 3HI6L 2F53D 3NCBB 2FL5B 4X9FA 3AS1A 1FLTX 4PRAA 4XH2A 3DURA 3PWUB 4PJEE 1LP9A 4G8GB 5EO1B 3TO4A 5A2JH 1LEIB 4TUOB 1CFQB 3FQXA 1MRDL 2J8UB 2IC2A 4U49A 3SQOH 1NDGB 2G9HB 3JV0A 4GXUN 2KKQA 1RHHA 2A2QT 3T2OA 2A9MH 4U0RB 4O51A 4LNRA 3WUWB 3TZVA 2XPGA 4NRYB 2NY0C 4CDHA 1I7UB 4NQDD 4G8FB 1IGYA 4JY6A 4E41D 1T21B 1FAIH 2ENYA 2IPTH 2FX7H 2VIRB 4PLKD 3O8XD 1HDMB 3C9NB 1TNNA 1AQKL 4TTDD 2UUDK 3GHBH 3MGTA 3SDDA 4M7JL 3RUGE 1OSPL 1PZ5B 3HE6B 1Z5LB 4ZAKB 4JKLA 2AXFB 5AG9A 4OAWA 4QXTA 4YWGL 3QUXA 4JRXD 3B5HA 1RMFL 4Y5XC 1Y0LB 3T0AA 3RGHA 1MFAH 4TSCL 3D69A 1AO7E 1FO0B 3QWRA 5FA3A 1P7QA 3KPSD 1NAMA 2ESVB 2E5EA 5IIEB 5E7BA 5FYKE 4OV6F 1DBKL 3GMNB 4HUKB 4ZXBD 3BYYA 1F8TH 5JOPE 4J3WA 1EJOH 1OCWL 3CPLB 2BY3A 4HXAL 4LIQL 5AUMB 5FECA 3NABL 4JE4B 4P5MA 3NBNA 4JFED 2NPLX 1U8KA 2Y36L 1KB9K 4P23B 4J4PC 5I1EL 2UZXB 3BZ4A 2EE6A 1JYXA 3RWDB 4U33A 4Z5RB 3SQOL 4JO3L 4PV9A 1YEFH 1ADQH 2E8YA 1T0NA 1VEMA 4ZOAA 1ZLUK 1PJ9A 3QDJD 2GY7B 3DUHA 4GKZA 1H5BC 4D0BB 2H9GB 2FD6H 3DUUB 4XXDA 3DECA 4V2CB 1F3JA 3D9AH 4WFHD 2L4OA 1UG9A 4HT1L 1FAIL 4JJ5A 1LEGA 4V2BA 2FX7L 4C56B 4XP4L 4U4BA 2PYEE 2I9TB 4HC1H 4R26H 4XBPB 3GHBL 5FGCE 3CFBB 5EORL 1KIRA 3CMOL 1WLHA 3DI2B 4KUCF 3BGMB 2HWZL 5F89B 1HWHB 2R2BB 5D7JA 4WFGE 4OBSA 4GRWH 1OD9A 4YIQB 2CDEB 1SHMA 2HG5A 3SDXF 1MFAL 5BRZD 1CFTB 3DO7B 4HJGB 3VW3H 4JO4H 2BY1A 1CLCA 5DURB 1JPFA 1VERA 3JVGA 1MRFH 5EPMB 4XWOC 2HLFD 3TJHC 3OJVC 3SHSA 2PCPA 3MV9D 4XCYB 1OGAB 5B4MD 2VLJD 1F8TL 4JPWH 4OM0H 1EJOL 1UADC 4LBEB 3MRBB 4LLQB 4EKXA 5KSVB 4KK5D 1OTUD 3ARTA 4D9RE 3GSQA 3GRWL 4KY1H 4CBPA 5C0BA 1TVDA 2B1HH 3ZDYF 2Z31D 4L3EB 4PGBB 4NFCA 1S7VB 1D5XA 4NC1E 5KSUA 4L29A 4ONGL 1YEFL 3MCKA 1JZ6A 2YUXA 5C0GA 1KTLA 1NGXB 1FQ9C 5C2UB 2Z91B 1A7OL 1OSZB 2FJHB 4XVSH 4OGYL 1ZE3C 1MIML 1B2WL 1FL6A 3OZ9H 4WDIA 2FGZA 4DUXA 2D7PA 2EDWA 1CVSC 1FCGA 3SE8L 3ZKMD 3BPCA 1Q9KA 2W0FB 3VWJD 1QUNA 1VFBA 4PJAF 3JTTB 4R26L 2ARJB 2LAAA 4HMDA 2VZ1A 5CJ8A 4HFUL 2JCCB 2A74A 4JQVA 4RX4A 4Y5YB 4AT6B 2VSDA 4PJBB 5DO2C 3MRPB 1O0VA 4QXGH 1KGCE 2P5EB 3TNMB 4HMCA 1ONQA 4I3SL 4U6YB 4PB9H 4YFLI 1IJ9A 1FH5L 1FNSH 5SWQA 3WJJA 3X3GH 4YHLH 4EZMA 4KMLB 1QVOB 3VW3L 3DNKA 4QGYA 4NM8H 4GRWF 4UQ3A 1MRFL 3RWCA 2HN7B 4NO3A 5BOPA 2FBOJ 1ZK9A 4PJ8B 3ZSSA 4JPWL 5JORA 1LO3H 5CJ5A 4UIMA 5E8OA 5HHMD 5ISZB 5CINL 3C5ZC 4JPIB 1BVZA 1IKNC 4ONHA 4P2OB 2V5SA 4IIQC 4JG1H 3TNNA 2W9EH 3L95B 4ZQKA 4KY1L 2NY5L 1P6AB 2D7TH 4HPYH 4PRPB 2LQRA 2B1HL 3FT2A 5BQ7A 1F3DJ 5C08B 2EEAA 1GHFH 2PW2A 5KS9B 4OIBA 3W2DH 4DOHB 3QPXH 4YK4C 1FZKA 4YDJB 3WD5H 5ENWB 3CFEB 1KT2B 4NZTH 1OWWA 1FRGH 2R0LL 4E5XB 3MBED 3D0VA 2AJZA 3MR9B 2A6DB 4POZD 1W72A 2V9QA 1EFXD 1MF2H 4XVSL 2AEIT 3L3OB 4ORGB 5J89A 4NQSB 3S8WA 1MCPL 5A40E 1JGDB 3EAKA 5F6HI 1VACB 3OZ9L 2D03L 3VFOB 3S36L 3BPOB 3OB0K 4MD0A 4OCRL 2DTMH 2YN5A 5HHVH 3MRIB 1MFNA 3AY4A 4DKFH 4Y16A 4X4XA 1MCIA 1KCVH 1BGXH 4ZFZB 4ODTH 1AIFA 2VTFA 1G7JB 3UJTH 5H8DA 5IMMA 3RU8H 4I1NB 1HILA 4HMEA 4PB9L 3TF7C 1FNSL 3X3GL 5E4EB 1TVHB 5DRZB 4KK8C 4YHLL 1T66D 25C8H 5IWLC 3FT4A 3GMLA 2C26A 4NM8L 4PYHA 1R5IB 2A6JB 2H45A 5L2KE 2ADJB 3ZT5A 1YJDC 1CT8B 5JXAL 4G5ZH 1II4E 2OP4H 5F7MC 1IGTB 3A0OA 2QTEA 1JWSA 1NGWB 4PY8I 4JG1L 3X3FH 3WIIL 2W9EL 1V3JA 1QRNB 2OL3B 3Q1SH 1DUYA 2D7TL 4HPYL 4KQ4H 3FFCB 3OKKB 4XNMA 3TH3T 3G04A 2MSPA 2DB8A 3VXUB 2AKRB 1A64A 4XVUD 5ICYB 4PJDB 3WD5L 1ZHNB 2DQTL 2PF6A 2YEZB 3H0TA 1FRGL 2HFFB 4O5LH 5KW9H 3R1GL 1YJDH 3PWVB 3EYSH 1HKLL 3T65B 1U3YA 2DKUA 2AXJA 1I7RB 2YPLB 3GUTA 4R3SA 4JN1H 5D7IE 5IMKA 5IJKC 2ADGA 2W92A 1I1YA 4P2QB 3VFVA 5GJTH 3VJ6A 5DT1L 4LGRB 2X70A 3MACH 1KELH 4PR5A 5C86A 4FS0A 2DTML 4ONOA 5HHVL 5IFHH 1YN7A 5JHLH 2UVFA 1U8OB 2YD2A 4WWKD 1XGYH 3RZWA 1EZVX 1KCVL 1BGXL 2JKXA 2Z9TA 1UM6H 2GJ6D 4RAVA 5H94A 3F7RA 1CDCA 2AI0H 4ODTL 4EIZC 5IVXF 3UJTL 2GFBB 1NUFA 4NQCA 5ACZB 1N5YL 1X7QA 1Y18A 3D0LB 1SYSA 1UJ3A 1BLNB 1XR9B 4ZS6C 3ZKNC 2P49B 4L9LB 5D1XB 1FV1B 1F4WL 5HTSA 2ZWLT 1NFDA 2ZCHH 3GNMH 5ANMA 5K9OA 1MI5D 3U36A 4Y2DD 2DQHH 4LARL 4G5ZL 4JHAH 2OP4L 2J7LA 2R0WL 2VDKH 3ZYJA 5JA9A 5SWZE 3BN9C 5J9PA 1WWAX 3BW9A 4TOYH 3Q1SL 2HTLC 4HZLA 2WIMA 2A77H 2Z8WC 3U83A 3DIFB 5IHZA 2FHBA 4RMWA 2MQCA 1J8KA 4YDVB 2A9NH 3KYKL 2J4WH 4UAOB 1FYTD 3HG1A 4KJWC 5I76B 3HTLX 4G80B 5C0CE 2YOCA 4L4TB 2X9XA 1OPGH 2YZ1A 2NW2A 1LO4L 5KOMC 4O5LL 3TP4A 1YJDL 3H7LA 1AR1D 5D2LB 4TVSa 2MNUA 1ITBB 4Z7NE 1FFQA 5L2JB 5C3TA 1FC2D 2SEBB 4PY7A 3WHXB 1UVQB 2A1WH 5TDNA 3G5ZA 4JN1L 1WF5A 4NYLA 4Y4KC 5GJTL 5TDOA 3MACL 1KELL 1VB9A 1S78C 2H32B 4XNZB 5IW6A 3F8UB 5IFHL 4G43A 1X44A 3EYFA 3QXAB 1OOAA 5JHLL 3FOLB 4WHYG 5DRNA 1XGYL 3SO3B 4I77H 3FT3B 4WW2C 2XTJD 1UM6L 1M7DB 3DMMC 4E0RA 2AI0L 4Q9CA 1D9KB 5CEZD 4YBQD 4N90D 4Z7WF 2XI9A 3VXSA 3H9ZA 5KG9A 2CRZA 1VEPA 4G6FD 3UJIH 5FKAB 3QXTA 1V3MA 1RIUL 1FVEA 5JNYB 1JJUA 1I1AA 5C0IB 1X5KA 3DV6B 3QIUA 1MNUH 5CBAB 2ZCHL 3GNML 5ADPH 4PJEA 2DQHL 3PUCA 4KPHH 4LP4A 5CMAB 5GS2D 4FABH 2EC9U 2VDKL 4GKNB 2R9HC 4F57H 2I60H 3SKOA 3QUMA 1BJ1J 1F4AA 1I8MB 1INDL 2NY2B 4TOYL 4TQEH 2YA2A 3PGDB 2A77L 4U1GC 1KJVA 3O81A 4R4ND 1VESA 1DQJB 3IDNA 4M6MH 4XC1H 1X5GA 3D39D 2A9NL 1L7IH 4U1MB 2J4WL 3UMTA 5HVWA 1F11A 3U0PA 5EA0H 1CFSA 5CBEA 3VGFA 3W82A 5JW4N 1OPGL 3HLAB 1KEGL 3LKRB 2M8XA 3C8HA 1P5UA 1G9EA 1URLA 1IILE 1KENL 5KVGH 5ACMA 2ZPKH 4KV5F 1QBML 2A1WL 5HDBE 4X7EC 4DQOH 4C57C 3Q3GB 3RUGA 1S7SA 4JM2D 4QHUB 5MERB 5FAAA 4J2XA 4PJ9A 5D1QD 3PE9A 1NAKH 3GMOB 3P2TA 4PGEB 4OGXH 2XT1B 2H6PA 3SDYL 2O93L 4UDUB 3QI9B 2YWZA 3BQUB 4KI5E 2M26A 4I77L 5EO9A 3KPQB 5I1HH 1AO7A 1UWEH 4IRZH 1MAJA 2IJ0C 2ZUVA 3QO1A 4MQ7A 2P44B 4EI5C 3S4SB 4M6AA 5BCAA 1XH3B 3UJIL 1H0DB 2R56L 4OKVA 2NCMA 4XX1E 3CFJB 2NMSA 1BJ8A 3MJ9H 1MNUL 2GEEA 3BISA 4CU7A 5JW3H 5EZJB 4NN5B 2F53B 4DZBA 1BQSA 3RTQA 4KVNH 1T1XA 3LQAC 1CGTA 5B3JF 3KYNB 2NTFA 4F57L 4F58H 4QRRE 4UQ2A 5GSVA 2VLLA 4XB7A 4TQEL 3SKMB 4HS3A 3IJYA 4M9OA 4X5XB 43CAB 4LLMA 4Z76A 1IGJA 4M6ML 1MLBB 1KPRB 3GGWA 4MNQD 3KLAB 1ZA6B 4MSWA 1S7TB 3RWEA 2RAMA 4NQVA 2AW2A 4IOIB 5EA0L 5ECJE 3TGXA 4NQDB 5D7SL 4E41B 2B8OT 4WTWA 2Q86A 3RZCC 3E3QC 3X12B 3BKML 4JN2B 2PYEA 1EUUA 3MNVA 3WYRA 1WCBB 5KVGL 2ZPKL 5DMGC 3O8XB 1YPZB 4P5TA 4DQOL 1INQB 5DMIH 3UDWA 1JV5B 2J6EA 2ZUWA 4F9LA 3F7VB 5TJWK 4Y4HC 1UQSA 4CMMB 5J1TC 1U91A 1G6VK 3JZ7A 1DP0A 2WZPD 3TO2B 5IMOB 4JRXB 1IAOB 3P4LA 1G7HA 5I1HL 3T77B 1D6EA 3MO1A 5EZLA 5ICXA 2R2HA 2FEDD 2P4AB 3L5IA 1S7UA 3KPSB 2A83B 2P24A 3RPKA 4ZXBB 1H3XA 5DK0A 3NH7H 4O00A 5CIPA 4X0KB 4HUUA 1F5WA 1KV3A 1RIHH 3MJ9L 4LHJB 1A2YB 3T0DA 1HHHB 4PJ7B 1QQDA 3KWWA 4JFEB 5DQJA 9CGTA 3ILQC 1H3PH 3RGVC 5K9JH 4LIQE 4GW4A 2IQAA 2P5WD 4KVNL 3REVB 4JKMA 3MRRB 3QDMA 4F58L 3CLEH 5I1CH 1DN0A 1P1ZA 1S9XA 1NBYB 4PRBB 4EN3A 1GIGL 3GBNH 5J11C 3V6OE 2X4UA 1YEKL 1OT1A 1HI6A 2X41A 1U8JB 4WVRA 1R5VA 1F97A 3VD9A 5F1KC 4IBLT 4X6DF 1E4KC 4NRZA 4LOUC 1FJ1B 3SPVB 4FXKA 5ID0B 3FTGA 3RWFB 2BERA 4G6AD 1U3HD 3GMPB 2DWDB 1INEH 1FGNH 2OQJB 4GW5A 1QR4A 5A43C 1QBAA 1SMOA 3U7YH 4K94C 5DMIL 3QCTL 1NUNB 1NDMB 4U6TA 3CLFL 4P57A 3WE6A 2O5ZH 2OTUA 3V8CA 3MCG1 2P47B 3LN5B 2RCSH 3O6LH 1T1ZA 5H37H 2ICWJ 4M4PA 3SDXE 4HAFA 1ZT7B 1K2DA 1JPSH 4ODXA 1XGTA 4JFYA 4MX7B 5BRZB 3CC5B 3I02B 4GQ9L 3BVNB 3R8BB 3SDAC 2QQQA 4OZFG 1FBIH 1EPFA 3MV9B 2VLJB 3NH7L 3GIVB 4K94H 5EBWA 4KK6D 5DD0L 1I7TA 2JELL 3VMPA 3VE0B 4MQTB 5DJZB 3MRMA 4ZPVA 4QNPF 5GGSA 3ZYIA 2NY6D 5K9JL 1NFKA 4MJID 4XPFH 3HE7C 1H3PL 1BPVA 3T0EC 4Z95L 3ZDYE 1QYGH 3FRUB 2Z31B 3CLEL 5I1CL 4HIEA 5EOTB 1ZT4A 5TQ0H 1G7QA 4HLJA 3BP6B 3H8NA 5F8QC 4OGZA 5TF1H 3LVEA 4J6RH 1FNGB 3ZDZF 4F37F 4I2XB 3FO2B 1DBJL 3UTTD 4UZGA 4OB5H 4F9PA 1H9VA 1MFEL 3SCMD 4QXWA 2ZOLA 2KH2B 4G9FE 5C0RH 4M3JA 1N4XH 3VG9C 1INEL 2AV7A 3DOSA 3NPSB 3QXVA 4PJAE 1JGEA 1KXQE 1WTGT 1ZSDA 3ZTNL 4Z78A 5H2BB 3VWJB 4V1DE 4GLRI 1FGVL 5L0QB 1XGRA 2APVA 4I0PA 4QYOB 3WEXB 3GSXA 5SX5H 1BFSA 4AG4L 4JFZL 2W1NA 2G75B 2Y7QA 3NIFF 1C08A 4YUEH 3S96A 5EUOA 1AE6H 2Y72A 3ES6B 4N9GB 1R5WB 2XG4A 4FQ1H 4JGUA 1JPSL 2YUWA 3V4PH 4FNLL 4WJ5A 5FYLD 4X6EB 4GUPA 4ZD3H 4GRWE 4QF1A 5KSAA 1FVCA 4N8PA 4XVJL 5L2KA 1GGUA 2H2PC 1JGVH 1U8HB 1CBVH 1FBIL 1RZGA 3LAFA 3NVQA 3O3DA 1G7LA 2V2TA 3BI9X 1QEWB 5GGVH 1QBLH 4PRNA 3ESUF 4YGVB 1FL5A 1WFTA 2K3TA 3IKKA 4Y4FC 1JNHA 2JK5A 2FX9H 4N0RA 2VLKE 4OJFL 4JFDE 1ETZB 4H25A 1JN6A 2VKWA 2ZNWA 1CICD 3DGGB 5IOPA 2QQLH 2YD7A 4J6RL 4PIRF 5F6HJ 4X7CC 3P0YH 3IKCA 3TFKD 4XAKE 5F21B 1JPGA 1YYLL 4PGCA 1G7IA 4MNHB 3V5KA 1OAZH 4M7ZC 3MBEB 4BZ1H 1HOCA 5J7CC 1EFXB 1ND0B 5C0RL 3BEVB 4ODVH 3GDBA 5D7IA 1NCBL 4ODWB 1EV2E 5BJTB 1N4XL 5IBLD 3ULVH 1BF8A 35C8H 2NY1C 1IGCL 3QP3A 2XWJA 3K4AA 2FHCA 4B0MM 1XR8A 1QTYT 5E8EB 3RI5F 4QHLB 2D0FA 4Y19E 4M1CC 1RJLB 4P4KD 3CX5K 5IB5B 5IVNA 1Z9SA 4QRPE 3MSPA 4CADB 2VL4A 4YUEL 1AE6L 3FMGL 4KGJA 4F7TB 2X1XR 1CLOL 2DQJH 4NQEE 3NMEA 4JFQB 1N59A 1CS6A 3BZDA 4PTUB 4ZD3L 3M1BB 1TZGH 1FPTH 2B4CL 1IL1B 4P5KA 4JZJA 2P8LB 5GS0D 1CBVL 3DURB 5HYFA 1NBZB 1T3FB 3C2SA 5SWZA 4U31A 5GGVL 2OR9H 1QBLL 4Y1AE 3P9LA 3QJFA 1L0XA 4JQIH 1B0WA 5EOCH 1A4JA 2E7LA 2FX9L 4HWBL 3INUH 2IPKA 5DD6B 2WW8A 3TZVB 3E2HB 1XIWD 4RGNE 1VGKA 3I6LD 2LTQB 4RMSA 1AC6A 5FGSA 4L4VA 1VKXB 1DBMH 2QQLL 3ALPA 1WZKA 3UAJC 5C0CA 3OKDB 5C0AE 5T1MA 4DJMA 1DBAH 2CIIB 3KPPA 4L8SB 4LPVA 3EW3B 3L7FA 1OAZL 1CFNA 2YD8A 3LRSB 4BZ1L 5DA4A 1S7RB 2ZSWB 3OKLB 2DICA 1OTSC 1JE6A 3ULVL 1UB5A 35C8L 3FZUD 5TE6L 4GAYA 3P4OA 4PG2A 3W0WD 1G7PB 3BUYB 3ULVF 3B9KC 3B6SA 3KGRA 2ID5A 5BXFA 2JB6A 2R2CA 4WWKB 4NQTA 2EDKA 1RK1B 5D1ZD 4NBXB 4FTVD 5IVXE 2GJ6B 1VADB 3QNZA 1IAMA 1P7QB 2O61A 1K5NA 2DJSA 3WNKA 4NOBA 3VWKD 3AU1B 2Z93B 2HTKC 2DQJL 2HT4C 5I1AB 3H9HA 4APQD 2ZG1A 1TZGL 1FPTL 1TZIA 2CLZA 1NANI 5DUPH 4D9RD 4HUMB 3MBXH 2DM4A 4X7TB 4QHNA 4KRPC 1MI5B 5DHVA 2EC8A 4K23H 4ZUWA 1W0WA 4UB0H 4NKDB 3KVQA 3TVMA 3QZWG 4NO5A 4NJAH 3VA6A 2OR9L 4WUUE 2BNUA 2D7NA 4JQIL 4FHBD 1B6DA 1WT5C 2MTPA 4WIQA 5EOCL 3D18A 1A1NB 3PWLA 3INUL 4GH7B 5C8JB 2JJUA 3QT2A 3MMEB 1T20B 2MPAH 4N8CH 1U8NA 4IOSD 1QFUH 3GSNA 3LN4A 1FYTB 4EUPH 5EIIB 2IH1A 3OF6D 3ZHDA 3MLXH 4ENED 1LQSR 4Y2OA 3MNZA 3V6FA 4WFEE 3BKCH 5GSRB 1QP1A 4JRYD 3RL2A 3SE3C 1OAUH 4F33B 2LVEA 2W60B 2AJVL 5DMKA 5E2JA 1OTTC 1AFVL 2A6KB 2YR3A 4UUJA 1MSPA 4LHUD 1DEEA 4HCRA 1IRAY 4GS7B 3PABA 4PS4H 5F93C 4LSDA 5CD5D 2DLIA 4ZUSB 5DJ6A 3JV6B 1A7RH 1CLYH 3GSWA 4HWEL 4QOKD 2XTJB 5C0DA 4Z7WE 1LK2A 5LBSL 3BUTA 2CR6A 4HFWA 3A67H 5EBMB 4XWGH 5FK9A 3UTOA 4YHML 4OLWL 5DD3L 2CK0H 3IJHA 3QQ3B 1C5DB 4KZDH 5DUPL 1R6VA 3P4NB 3QPQD 4OF7A 5JTWA 4LVEA 1MEXL 4FQHB 5FOJA 4K23L 1HH6B 4Z7OF 1XGPB 1X6NA 1D5BB 4LLDB 1EFQA 4XNXH 1D5XB 5KSUB 5SV3A 5DJYB 1IQWH 2DQIH 2W0KA 2NR6D 1T22A 4P2CG 4JFFD 2CKBH 4NZRH 2IBZX 3D39B 4H1LH 2MPAL 4M61A 4N8CL 3OKMB 1KLGA 3IETA 3OKOB 5F9WB 5FF6B 4LFHG 4BK5A 3UTSE 2IQ9L 1MCWM 3MLXL 4JM4H 4OLUL 1WBXB 5ETUB 1QLEH 2W0PA 3BKCL 3JWOC 3KPRB 4OZGB 4KV5E 4OCNC 1CR9L 1OW0A 5KJRH 2ZUTA 1OAUL 4ZO7A 1Z3GL 3RX5A 4FQXA 3L7EA 2PNDA 4ODUA 5F7EH 2VWEE 1M05B 5MEQB 3T3PF 2YD5A 4OZ4A 5D1QB 4K55A 3NIGF 4IRJA 4HDIA 2VDQL 2PW1B 1CLYL 4LKCA 1A9EA 1FN4A 1ZVSB 5IHUL 4F7PA 3K1DA 4WI2A 5DWUH 3JWOH 3RX8A 1ZVYA 2W9LA 4QT5B 5A1AA 1Z2KA 1NMCB 3QQ4A 2D31A 2XN9E 2E9WA 1RUPH 3LRGA 2CK0L 3D6GA 5D6DC 1UWGL 3I84A 3V4VH 1EH9A 3DX6B 4B53A 5E2UH 1AI1H 1KXTB 4MHHI 5D9SB 5L8JB 5BVJA 3L3JB 2CXGA 2QADD 5EDXA 5KVMC 3T2QA 5B3JE 4NFBA 5D5MB 3DV4A 3WIHH 4OZIA 5T5NF 4MDIB 4XNXL 1OM3H 3C60C 4P46A 3RWHB 3K8KA 3HAEG 2E7HA 3GHEL 4X4ME 3V6OA 3QDGD 1QR1B 1I4FB 3MA9L 4RMRA 5HVHC 1A6VH 4MNQB 5D7LD 2VUYA 3DYMA 3LY6A 2PXYD 3O3AB 4H26B 4DN4H 1PG7H 3IXAA 1BD2E 3S7GA 3IDIB 5DHYB 2YUZA 4JM4L 1CDHA 1DVFC 3CVHB 4JO1H 3CK0H 1A0QL 3DBXA 1ZV5A 3FOMA 1S9WA 1QLRA 3K8LA 1MHCB 1CU4H 4BKLA 4HWUA 5KJRL 1F4YL 3WKMH 1SBSH 2YN3A 4HIIB 4D0CB 3C5SB 2AS5M 4NRXA 4LKXA 4KQ3H 4WCYL 3BT2L 4S0TD 4YDLB 4YDIL 5E1HB 1K8DA 2NY7H 4ZMAT 1CE1H 2KDGA 3WN5C 2F54B 4LNVA 1ZLVH 3O6FC 1MQKH 3U1SL 3RPIB 5ILTL 3G08A 4HUWB 2QHLA 1QFPA 3BDXA 2HJKB 5DWUL 3JWOL 4WO4D 4AIXA 3Q48A 4NCDA 4KKLC 4ZFOL 3BZFB 3BPNB 4UT7H 5GPRA 3QXDA 2PO6D 5E56A 5I8KL 1RUPL 4BZ2H 4LLYB 5DZNA 5F1IB 5E2UL 2XYCA 3JWNC 1AI1L 5HYSG 2OX5A 2NX5D 2H3NB 2HH0H 4KFZC 4KJYB 5E9DA 2VLME 4XX1G 2X89D 4ELKB 4RQQB 1XF1A 1UXWB 5E1AB 3VDBA 1MCLA 4LFHD 3DSNA 2P5WB 3KPOB 3U48A 3GRWA 1OM3L 1QA9A 1Q94A 1IC7H 2ZSVA 4G6JH 3CH1B 2WK2A 1RJZB 4X99A 4Y5XA 2AP2A 5I0DA 1IBGH 1C7TA 3FQNB 3H0TB 1EMTH 4XPTL 2DBLL 1BVKB 5EU5A 4GRMA 3MLPA 1UH2A 1A6VL 3QUZA 1KB5L 1AGBA 4PGDA 4X6DE 4CVXA 1C12A 4G9FA 1J5OH 5SWSE 3HC0A 4EDWH 2FECL 3AXLA 4I48A 2NZ9D 3GEWB 1JWUA 1UC6A 3O2DL 4PJAA 1U3HB 5DK2B 3T4AA 3CK0L 4FXGB 1GGBH 4PR5B 3WJLA 2CO7B 3IRPX 4V1DA 1MCBA 1N26A 3CFIC 1ITCA 4ZO9A 4Q97A 4NNYA 4NM4H 5C09D 4U6VL 4F7MB 1YN6A 1A9BA 3MGOB 1T03H 4KQ3L 1XGQA 1LWRA 1J8HB 3T0VA 2DL2A 4R7DB 1X7QB 1CE1L 4F37K 4XNUH 3CUPB 1F90L 3OB8A 5TQ2H 4Y5VC 1MQKL 3IXTA 3SGJC 2ITCA 5F1OB 3AB0C 1MCRA 4Q0XH 3TPUB 2CMRH 4DZ8A 3CH8A 1O7VA 1YMMD 4UT7L 4C83A 3V7MA 2IAMD 4PGJA 2L7UA 3E3QE 4K3JH 5IMLA 5D2NB 4BZ2L 2AJXH 1QPXA 3T8XB 3TA3D 4N8VA 4QNPE 4LMQE 4FOMA 3SN6N 5C0EA 3G9VA 1K85A 3BW9B 4CMHB 2NY6B 5KTEH 3V79C 4MJIB 3RWGB 5A2KH 3EYOB 4FQJL 3CDCA 3HR5A 4L3CA 4JFDA 1IC7L 4OCLC 3QAZC 5CEXA 2FYYA 3ZDZE 3O45A 1IVLA 3NZ8A 1IBGL 1CL7I 3QULA 1TJIH 2NY4D 3CFDB 4GBXC 2NW2B 3LEXA 4KHTH 3B5GA 3ARGD 3QUYC 3I50H 2RHEA 4Y88A 5EU6E 3O4LE 5FB8B 5E8DH 4LLWA 5DEGA 3UTTB 1CF8L 1UZ6F 4R96B 4NCC2 2B20A 5TDNB 3SCMB 1P6FA 2DWEB 4MAYD 2J5LB 1FCCA 1S8DA 3MRHB 5C0FB 4R4FH 1GGBL 4UBDD 5IV2B 3TV3L 3MRDA 1K3IA 4KI5D 5EG6C 1IM9D 1VHPA 1BOGA 4I3RH 5DRNB 4MS8D 4Y19A 3U82B 4NM4L 5GS1C 1IAIM 4NKIH 3RNQA 4KRLB 1MVFA 4TYUA 2GITB 5E5MA 1T03L 1MFDH 1PSKH 3QHTC 1K4CA 3NIFE 1A1OA 4QRSB 5FCUH 1BFVL 4XNUL 4ZSOE 3MREA 5TQ2L 4UU9B 2UVEA 4NQEA 1MJJB 5CGTA 3JBG7 4Q0XL 3BD5A 3NCJH 5ICZA 1AR2A 3L5JA 5HYJE 4NHCL 4YBLB 2J12B 4K3JL 5HHNB 3BP5A 4QRRD 1YC8A 3FRPA 5IFAH 4NP4L 4Y1AA 3RI5K 5I6XB 5E6ZA 1AHWA 2CH8A 1CD1B 3NGBC 3TO4C 4S1RH 2IMMA 4XXCA 1IEAA 1I9JH 5A2FA 3CJJA 5SX5K 4K7FB 1I8KB 4X6CF 3HRZA 1ZWIA 5C0AA 1CICB 4KTYA 2FH6A 3GMMB 5HYEA 1HQ4B 1QSED 4KHTL 5HJ3B 2WUCH 4G3YH 5JZ7D 1DQML 3WLBA 1WBZA 3I50L 4LLVA 5E8DL 4B7LA 2NXZD 4ZOCA 3MXVH 4M00A 2FWOA 3U0TA 3ARWA 2VZTA 1E6JH 3RRQA 3RUGB 2YKLL 1FYHB 3C5ZA 3RKDC 4R4FL 3TYGH 4JKKA 4FFWC 5CZXD 5CCKH 4PRIE 4UTBH 3BKYH 3QWOA 3T0EE 3LDBB 5KVDL 3SDDC 4I3RL 5EO9B 1UM4L 4OZFB 4WGVB 1G0DA 3QB7C 4P9HL 1E27B 4NKIL 5IVXA 4OUUB 2X9WA 4P4KB 4QHMA 1T0MA 4MQ7B 2ZZUT 5FCUL 3BHBB 3QUXC 2Q76A 1CDJA 2DI8A 3UPAA 2FO1A 2X42A 5FKPA 5L88H 3LQMA 4Z0XA 4MDJB 3NCJL 3CNKA 3QH3B 2OR7A 2IANE 3O9WD 2H26A 2BCKB 4KK9C 4DZBB 3MLWH 2HFGH 4O4YL 5DRXB 3LKNB 1NGPL 4WUUA 4YJZL 3GJEB 1PKQB 2EYSB 1OARH 4QRTA 5C70A 4HS3B 4LHQB 2Y6SC 4X8JA 4W81A 4Z76B 2EKJA 4N8VG 4TVPD 1I9JL 4RWYH 1BAFL 4MXWH 3I9GH 3VFUA 4MSWB 1XIWB 3D25B 1NAMH 2HFTA 4U3HA 2BNRE 2I07B 3DWTA 4RZCA 2WUCL 3WLWD 2CLRB 1RUKL 4WU7B 1MAKA 3I6GB 4PRHE 1FVDB 3C6LA 3MXVL 1MHPH 5JIPA 5K9KA 1T1YB 1M7IA 3AREA 2DLFL 3KNBA 5CWSA 5T1DH 1E6JL 2BJML 5CILH 3LV3A 4PBVC 3P0VH 5ID1B 5DI8B 5I19H 5CCKL 4UTBL 3OJDB 1KJ2H 5I15H 3RWIA 4P59H 2ATPA 2GAZB 3ULVE 3WXVL 1MLCB 1LP9F 3W0WB 2BVQA 3VRJA 4PG9A 2WWMC 3ZYOA 2VAAB 3IDJB 4ZUTA 1I1FA 5J13C 4Z7WA 3V5DA 3MV8A 3VFRA 4FTVB 3E8UH 5D7JC 1BBDH 1YMHA 2VXUH 3HUJF 2DI9A 4PJIF 3VWKB 1BZ7B 3VRLF 5CJOL 2Q7YB 4X9GA 1QSZA 4YC2C 5DYOA 3OJ2C 5L88L 4X98A 3H42H 1R3LA 3JVGC 4APQB 1KNOB 1XCTA 4M7LH 3IFNH 4OF6A 3QQNA 5DQJB 3FQRB 1F3RB 3C09C 5JLZB 1I8IB 3MLWL 2HFGL 1U0QA 4XVTH 1M4KA 4KDTA 1DN0B 3KHQA 5F3BB 1OARL 2E9BA 3G6JF 3S34H 4Z9KB 3FRPG 3S37X 5E5UB 2N1KA 4Q6IA 4RAHA 3P9MB 3EO0B 3A6CH 3K74B 1HI6B 4RWYL 4MXWL 5CLTA 3EGSB 4UTAH 5EO0B 3TN0A 2XOTA 4NRZB 3PWPA 2V7HB 1DQDH 3DRTA 3HPLA 2MKWA 2GUOB 3LH2H 1DLHA 5DJAB 1J1OH 2BOBA 5T3ZH 1KEMH 1IQDB 3ZKQD 3GSOA 3OG4B 4MMZC 4JRYB 2C7UA 4JANA 5T1DL 1EEUA 1YEIH