1NCIA

Structural basis of cell-cell adhesion by cadherins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
GSDWVIPPINLPENSRGPFPQELVRIRSGRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-CADHERIN
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion protein
total genus 21
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nciA00
3LNFA 2OMYB 2OMUB 1FF5A 4ZMVA 4NUMA 4ZMNA 4ZT1A 2QVIA 1WUZA 5CZRA 3MVSA 5JYLA 3UBHA 2WHVA 4AQ8A 2YSTA 4XXWA 4AQ8C 2WCPA 5DZVA 4ZMTA 1ZXKA 2OMWB 2QVFB 3UBGA 5CO1A 3LNIA 4APXA 4AQAA 3Q2WA 3Q2VA 1SUHA 2WBXA 1Q1PA 3K6FA 3LNEA 4NUPA 1NCGA 1L3WA 4AK1A 2OMXB 4AQEB 2OMTB 5JYMA 4OY9A 4XXWC 4APXB 4AXWA 4ZMPA 4ZMWA 4AQAB 2A4EA 3K5SA 1NCIA 1NCJA 2X2UA 3QRBA 4ZMQA 1WYJA 4ZMXA 1OP4A 2YQGA 4ZMOA 3Q2LA 4ZTEA 4NQQA 3FF8A 3PPEA 1EDHA 1O6SB 2OMVB 4NUQA 2WD0A 4AXWB 1ZVNA 2V37A 3K6DA 4ZMYA 3UBFA 4QD2E 2A4CA 3LNGA 2O72A 3LNHA 3K5RA 2EE0A 4ZMLA 3LNDA 1NCHA 3K6IA 5KJ4A 4AQEA 3FF7A 4ZMZA 3Q2NA 2OMZB 4ZI8A
chains in the Genus database with same CATH superfamily
1FO0A 1YYML 4E0RB 2JKIS 4NCC1 5KN5A 2EYTB 2V9UA 4M62H 5GZOC 3CCHA 4F2FA 2DQDH 3JYBA 4J6RL 3UGEA 2VITA 3LKRB 4GPVA 3QYMA 3MOBL 1LILA 4M7LL 5I9QB 5HYQB 3JT2A 4MAYB 3VXQB 2W9LA 4FX5A 1KXTB 4R96A 1CDBA 4S0HA 3VFGH 3QBTB 4G8IA 1XGZA 2EIZB 3LQMA 2EQDA 5D1XE 1YUKB 2B0SH 2CLZA 1KCSH 2VC2B 1ZA6A 2P24A 1OGTB 4GBXB 4EN3C 3TL5A 1UENA 3C8KA 2Z6FA 4A7UA 3S36L 2X89D 3FQWB 4J3OC 3KPMB 3S97C 3PP4H 4EI6B 5L9DL 3PQYD 4Y19E 3T2NH 4QT5B 3CSGA 1JZIA 4WWID 1JNJA 1IC1A 5I1EL 4BRVA 1MCHA 5BZDA 3U0WL 1NUFA 1HXMA 3K6FA 5HGBA 1GZHA 2ZXQA 4PP2A 1E4XH 3PQYE 4WUKL 3FUEA 1N5YH 3BW9B 3HE7D 4ZUWB 5ESVA 1P7QD 5F7FA 1DHKA 4YPGA 4AYSA 5DVKA 3F5WB 3QJSB 2Q3XA 1XFPA 3ARTA 1HU8A 4PS4H 3ZDXB 2B8OT 3K7UA 3O8XB 2JJWA 3BP6A 4P5RA 4FJZA 4LDLB 1BQRA 4E9YA 2IJ0C 2UXVA 4QHLA 1WTGT 4D8PB 1OTTC 2BFVL 4PD4J 1GKOA 2FQGA 4EJ1C 2MNJB 1IFGA 2ZWLT 5B21A 2CJUL 1UGNA 4YHKL 3RG1C 1LO5B 4EDWL 5E1AB 5KSVB 1EVUA 2JMRA 1ZLVK 3X2QB 4LLAA 4AKQA 4R3SA 2K7QA 1XZWA 3IDUA 2V3FA 2J8UA 4MRBA 4PV9B 3IGKA 4LK4A 1OOWA 4ZAKB 3Q44A 5D7HA 1PY0A 2JWYA 4FNUA 1N8ZA 4J6IA 5HVWA 1R3JA 1EZVX 4NDMA 2CG9X 3CDZA 1IAMA 5HHOA 3LZFL 2J5LC 4FOMA 2ZOOA 1MVUA 4GSDL 3APMA 3ARDC 5K1VA 3S48A 4ODXA 1JPGB 3UFIA 1G7IB 5H35A 4Q6IA 1HCZA 3G5XB 4NO0B 5ESQA 2F08A 2OL3H 1TPXC 5TDNB 3W81A 3OZKA 5T5FH 2X53A 5HVHB 4TULL 3RWJA 2DEXX 3QT2A 4KAQL 5F7UA 1X4ZA 2P5WD 5LB1A 2AVGA 5HYSA 2IQ9H 1WS7A 4FERA 4L8SB 1BJ1H 1GOGA 1Q90A 4ONGL 4HC1L 1A7QL 1G7QA 4GRMB 4UQ3A 1EJ6A 2UXFA 4KZ0A 3EBAA 5IT2H 1DQLL 3TWCL 3C60C 2HJFA 4HKXA 4HJUA 3E7JA 3TC9A 1UB6B 2WM0A 3CFQA 3VDCA 3DSNB 3WXWH 4HWBL 5CSGA 2YGQA 5CCHE 2UYLB 5AW5B 5JMRA 2NY1C 4IKIA 5EEYA 2SODB 4WHTB 4OD3L 1V3KA 4FHJA 3UTSE 4R0LA 4GT7A 3PREA 1ZXKA 4JFQA 4Z7QE 1W8EA 4ATTA 1FDLL 4IK6A 1DLHA 1MNUH 2MKWA 3VGBA 2WBKA 2BNRA 3FKUS 1A1MB 1X9RA 1R5WB 1KEML 3IMSA 1DSFL 4RFOL 2HPTA 2PYFB 2VR6A 4HH8A 3PABB 3FSVA 4FQ2L 4UZUA 5E8PA 5D1XB 2F7IA 2EE2A 1NTDA 1MFAL 2EACA 4ZW5A 3ESNA 2VLKA 5T1KA 1F3DH 5EN2B 1TQWA 1ONQB 3U48A 3H2PA 2HLFC 5BO1L 4LCYA 5TE4L 5CMAB 5HJDA 4Y19B 1U2YA 3AFLA 5I2IB 1EGJL 2I07A 4HOZA 2D31A 5FC9A 1JV2A 5CCKL 3A24A 1JFHA 1HXKA 2ZG1A 2AEOA 4CC0A 3PQYB 1ZT7A 2KH2B 1OSYA 5D8JH 1D5RA 4DGVH 2R27A 3B9KC 3GUTB 2DIBA 2KLSA 2PF6A 3ENEA 2AZUA 2KT6A 1DFXA 2P80A 2XTJC 4YH6A 3RYMA 4A2LA 3IWVA 3LV3A 4E41D 3VCLB 1QSZA 4YXLH 4DESA 3HE7B 4AGNA 5IQ9A 5F7EL 4LHUD 3NJIA 4A2EA 3GIVB 5T3ZH 1GC1H 5LNGA 4E41E 3LDBC 3JXAA 4PWFA 2DQUL 3LSOB 3NA9H 3NJVA 4P4RA 4QAMB 1TENA 4JKLA 5LKNA 4PJIF 1HHGA 4DPAX 5IJKC 4D0CA 3DUSB 3OMAB 5KJ7E 3KEHA 1J1XL 2XICA 1EK3A 5FYLD 4QHNA 1UWXH 2YRLA 3GM0A 5JNYB 4DGWC 3VWJC 3FH5A 1SJMA 5LCVL 5HYIA 1EPFA 3LKNB 2H26B 3DIDA 1LQSR 3V6ZB 1NMCB 1ZT1B 4PRIA 3BEWA 4Y5XA 3STZA 3CDFA 3F12B 5CILL 2A9BA 5FYLE 3RVUC 4AI7A 4KK9D 4DP9X 4KV5F 2RGSA 4WW2A 4BELD 4B9FA 2EE3A 1PYWB 1G1CA 1MH5A 4PGBA 1BX2A 3OKMB 1LQBC 4CNIB 2WBJA 3V0VA 4U7KA 2YMTA 4J4PD 4AVHA 1WIOA 5L8LB 3RTQA 3FB7A 3FTYA 1X9UA 4FG4A 2E47A 1OM9A 3QUXD 4G5ZL 5CINH 4AMKH 4I1PA 3V55A 1QTPA 3P0VL 2X5PA 2IOMA 3UJTL 1EEYA 4IRSA 3G08B 5TDOA 1CLOL 3BGMB 1NGXA 1UACL 4ZSOA 1CT8B 2HRPH 3A4FA 2EH8H 4JDVB 3N85L 4KJWD 2JKLA 1UOWA 1GJIA 1L4IA 4AYEC 4F1ZA 3D25B 4PCTA 1J8HE 1PAZA 3ZTDC 4XNZC 1XVSA 5G4OA 1ZT4B 2VDRH 1ZY9A 4WFHD 4OLYL 2XU9A 2APFA 7FABH 4FGMA 5CFAA 5TF1H 3I85A 2B08A 3HHSA 3TCXA 3OVUB 3S0PA 5C0BA 3ES6A 4NKQB 2AJ3A 3MLPA 4NKDA 1MQKH 4HCIA 5IMKA 4Y2LA 1TVBB 4WFHE 4JZJA 3UTSB 4ZYKB 5LGJA 1I7TB 4PMEA 2GJ6D 3KVDD 4Z7QB 1PPIA 3BPNC 1PY9A 5EULV 4Z5RB 3PWVB 2PR4H 5D2LE 1OAYH 5K9QG 3VXNA 4GAYB 1FV1A 3BUIA 4UOZA 1MKFA 4YEEA 4ZS7L 5AENA 2QZ5A 2NY2C 2MHAA 5I16B 1I7UB 1IGML 2QVMA 5JIKA 4MS8D 1GW0A 9PCYA 3VH8B 1YAZA 1BVNP 3PIQB 2QSTA 3BN9D 5CLYA 2OP4H 4XX5A 4DFHA 4N2GA 1K4CB 5IEHB 4UUJB 3JUYA 4HJEA 4LPWA 4H1LH 4OSUL 3ETBJ 1EFQA 1PZSA 4W81A 2HFEB 5DT1L 1OTSC 1A2YB 2PNDA 3VMNA 3WNIA 3O3EA 4H20H 4IBYA 4M5YL 1DBJH 1DJGA 5F6HI 1MFDL 5J6SA 5GHWL 3KLKA 5E8DL 3DYOA 1RUPH 2DAVA 2QVTA 5JHLL 4M48H 1DJYA 1T1ZB 3K4ZA 4H44C 3ABLB 4I9WE 2NY4D 1ZDSA 1YNKL 2JQAA 3ASOB 5DUMH 3ARBB 1I1FB 4PJCF 4E41B 3EFOB 1JXGA 3LD8B 5FDWB 5EO0B 3FRPG 5C3IA 4LHUB 3P4LA 5B39B 3B9DA 4MB1A 2MCPL 2CUMA 5FB8B 1QSFA 3ARPA 3BLKA 1TZHA 1R75A 1KB3A 5IGXL 4LEBA 1JZFA 4L1BA 4OKVB 2OJZH 1OTUD 2EDKA 1A6WH 3WIAA 1R34A 1ZANH 2YBGA 3KH4A 1RUAL 1CF1A 3PAUA 2C34A 2FX7H 2O26U 4NFDA 5GS0D 3L3HA 1KV3A 1YEHH 4LLMA 2C3HA 3QHFL 2EDQA 4N0CC 5E1GA 1S7QB 1UZGA 2YN3A 5DQJB 4DVBA 4L4TD 3H7BB 3IS0X 3MV9D 3EFDL 3CSFA 4ZD3H 3R19A 2JVUA 3NZUA 4X5PA 5FKPB 5E0QA 4AMXA 1TJXA 3OZ9H 5HHVH 2P45B 3H56A 4L4TE 3ZGHA 3ARGD 5FYJU 1Z3GL 2D3JA 3MV9E 4LCWD 1G0DA 3K6SB 3UTTA 4IJ3B 4FI6A 2LVCA 4TNGA 2FJGA 3PDOB 1NGYA 3H42L 2DYSB 5CEZH 5L4FA 2FATH 4NLAA 1AQHA 1S8DB 4GP4B 5AVUB 3FN9A 1IGYB 4FYSA 2ODIA 3O3BA 3Q2VA 4FQLL 4KK8D 3FAXA 4JQXA 4W9ZA 3RUGE 1IM3A 1I7RB 4QWWC 2E27L 3A4DA 5AW7B 3ZMRA 1J8HB 3C12A 2ZWYA 2WNXA 4DZBB 2DLIA 2HLAA 2P28B 4YXHL 3B2VH 1OF0A 2Q0ZX 1P5UC 5F6HJ 4NM8L 3SPJA 3VXSD 1IZJA 5SX4H 3IYLW 5GGSY 1Y7VA 5EF3A 1A4CA 2EXYD 3KBHE 1WGOA 3K5SA 3DARA 3P4OB 1G9NC 3MNMA 4L1SA 4LQFL 4TNVK 2OZ4A 4JFSA 2FBJL 3TJHD 5D2LB 1CBJA 3CFJA 1HQRA 2O6CA 2C7FA 2EKSA 2F2HA 5DK2A 3UPRB 2D2OA 3IJHB 3C09B 5GGSB 3DHUA 5GGQH 5F7KC 4KK6C 2XRAL 2FBRA 4ERSH 3PPEA 5B3JF 2UWEA 1KIRB 3KPPB 1ZVNA 3VTTA 5DD5L 5HY9B 3QRFM 1UD4A 3HLKA 4CA4A 1IBGL 3BGFC 1T2QH 4KTDH 4FLSA 2EZ0D 1JV5A 2W0LA 4NN5B 5K9JL 1S9VA 4GT0A 1G9NL 3MBWB 2F7PA 2B9BA 2J4WH 3AT9A 3N41B 1B6DA 1PKQA 4MTMA 1YEKL 4PJ7E 4ONHA 3VA2C 4GRWF 4MB5A 2XZCL 5HYJD 3NCJL 2J7LA 1HDMB 4L48A 3DX0A 3QXDA 5I28A 5AYUH 3TN0A 5G4MA 2K8MA 2MTAA 3L95B 2G75B 4BYHA 3DURB 2OZ4H 3MRDA 2I32A 2BERA 5AEAA 3JTSB 3KCPA 1VAHA 3AS2A 3P0YL 4AH2B 4PTUA 3SDXE 2VE6A 4PY8J 2ZUWA 3MLSL 3OAWA 4W9CC 3V0FA 5GZOA 3MAWA 1BFTA 4M93B 2HT4C 4CGTA 1XR9A 2K8QA 3U1SL 1HAWA 5DD3H 1FZJB 1PX3A 1G9HA 2AJUH 4OCRL 5DQ9A 5I1DB 1TKWB 2NY4B 3AXLA 1YYMH 2G3NA 3BKMH 3HW7A 5TE7L 1KACB 3V4VL 1S7WA 5SWZD 3MRFB 2AQ1A 2DQTL 1HE8A 4J6RH 5L4JA 3AQXA 1O5PA 2A83B 3FQYA 4NQSB 4R4FL 3MOBH 4EN3A 4WZ9A 4M7LH 3IVKA 3VM7A 5E7BA 3IAQA 5D5MF 1ULVA 5SWZE 3GLAA 5TH2B 2A9ML 4NQXB 2FECL 2Z34A 5FLVA 4L8BB 2FUTA 3VFVB 3TNNA 5KYWB 2A74B 4MQXD 1UYWL 2GSGA 1JF5A 3FBKA 3QK0A 4QKXB 4L4TB 4Q9BA 5GJTL 4ZUUB 3S36H 1E0OB 3MV9B 4A1RA 5C8JB 5IB5B 3EG9B 5L9DH 1JYXA 4K7FB 5L2KA 1S5HB 3SPIA 3T3PE 5IQ7L 4HKJB 5I1EH 4UAHA 3D07A 4FTVD 1VENA 2EVGA 1KGIA 1U4EA 3ARGB 4MXQC 3U0WH 3TPUA 2AQPA 4BKSC 2VWEE 3HE6D 1NCDL 1VFAA 4MA1C 1PEWA 4FQJL 4H26B 1XB6A 4WUKH 3WLWC 1F4YL 4Z1PA 3WJLC 2OXGA 4FTVE 4HG4J 4XNDA 3RUGB 1KBVA 2OYKA 4K5MA 4FQCL 2X12A 4MB3A 3DBXB 2IXQB 4KVPA 1U8IA 3UZVA 3UH8A 5K69A 2A38A 2VAAB 4HUNB 1BP3B 4JG5A 1BG1A 1ET5A 3AAZB 3MJGX 3HNVL 2F5BL 1Q72L 5HI3D 4J3OH 5DA0B 1RJLA 4Q14A 4L4VA 2MCG1 2XG4B 3MLWL 2CJUH 2QQNL 4YHKH 3QCUL 4EDWH 5HHXL 1UOVA 4HGKC 1M3IA 2BS8A 5ENWA 5HHNA 7CGTA 3CC5A 4HC1A 5DMYA 2WIMA 3HZYA 3KD4A 3ZKND 1I31A 3T08A 2Y6TE 4ODVL 4IDJL 5CS7A 1WS8A 2R4SL 2G0LA 4KDTA 1JNHB 5AW4B 5TPWL 3WEOA 5A2JH 4HWBA 3ARDA 4S0TD 4XMUA 1NM4A 3VXMA 1AXIB 4AKPA 4BFOA 4Z7NF 1BXUA 5F7DB 3GJEA 1C5BL 3L17A 4GSDH 2OTUA 1WISA 4JFFE 1J88A 1CLVA 2FO8A 4MNHA 2AK1L 2R1XA 2ZIDA 4HUXA 3T2OA 3NIDF 3KLLA 4EIGB 2JKWA 3AG3B 1O7SA 3D7PA 3FU7B 1A65A 1I8KA 2XNAB 3KS0H 4GNKB 4PJ7B 4TULH 5EU6A 5C7ZA 4YQXL 2VMFA 5FECB 1YN7A 4KAQH 4RGND 5I1IL 4YK4B 4LFHD 2M2DA 4FYTA 3D69B 4ETYA 1CI5A 2E9BA 4ONGH 1G6RB 4HC1H 1A7QH 3D0LA 1ACXA 1LDSA 4WEEA 1LLAA 1RHHB 2CCWA 1DJZA 3CN2A 4RGNE 5IR1B 3WFHA 2LTQB 1DQLH 4QRTB 3CX5K 3TWCH 4I4WA 3QIBC 2OTWB 2Y5TA 2CIIA 5FO9B 2NY3D 5KYYB 3SDXB 2K0RA 2LU3A 4ABVA 4E42B 2KERA 4HWBH 4FFYL 3OQ3B 4PBVC 1EGJA 3DI2B 4X6FB 3BFWA 3BAEL 4WO4C 1DJHA 1FFPA 2ZUTA 1KJ2L 4GXUM 4OD3H 3VUAA 5I76A 2P7TB 4OIFA 2EAEA 1Z5LA 4Z7UF 4NZDA 4U1MA 2W07A 1FYTA 1MQ8A 1OGPA 1ZDQA 2BH0A 3L8QA 4WTXA 4NJ9L 4OT1L 1EEZA 1FDLH 4QRQB 4JY6B 2AAVA 1KEMH 1PSKL 2OSLA 4ZJ9A 1OGAD 4HLZG 5TQ2L 4NKIL 4W9IC 1DSFH 4RMTA 4RFOH 4XBGB 5SWZB 3KPTA 1SRDA 4FQ2H 1RMFL 3AWGA 5T5NG 2ADJA 4AV0A 3NJMA 1MFAH 3CZUB 3ZK0A 3BLBA 3PGFL 1EO5A 3BI9X 1QMUA 4OJDH 3H9ZA 5DURD 3K8KA 5AALA 5I5MA 3S5LA 2QMKA 1DQQA 3OLGA 5IREA 5EO1A 4RH4A 1SNRA 1WSST 3BQUA 3X1BA 5HGDA 5BO1H 5TE4H 2MWCA 5LCVA 3ELAT 3QH3A 3T3PB 2Q2LA 3HBQA 1EGJH 3B9KA 4RZCA 1JPTL 5KYUA 5CCKH 2FNBA 4IBQA 4U1SA 3VX0A 3X3GL 1HHJA 3Q2LA 1OCRB 4Y2DB 2H32H 4PCYA 5KSAA 2DIAA 1DANU 4E9LA 3IDJA 4FTVB 1UJTA 3PGCA 2AEQL 4XH2A 3G7TA 1C9SA 5AVQB 3UAJC 2FQDA 1BM7A 5F6IB 5KVGH 4P3DA 1UEYA 5IJKA 3L54A 1NEZG 2F7QA 2J8UE 5F7EH 3TJEL 5HVGB 5HHOD 3F7KA 2WLLA 2KZKA 1CD1A 2V9QA 1KT2B 4QHMA 4YE4L 3VWJA 2DQUH 3RQ3A 1A0QL 4F9PC 3QI9A 3BX7C 3F7VB 2VAJA 5HHOE 4O2EA 3FH8A 4Z76B 4MXWL 1J1XH 2VDML 2N59A 1L9QA 2W0FB 2X4QB 3C6SB 5LCVH 3MBED 1HOCA 2FEEL 4J3WA 2W9DL 4FJ6A 1T4KB 2WQXA 4WI2A 1M1XB 1ZHLB 5JA9A 5CILH 3VRJA 1U9KA 4GINA 5B3SB 1TQVA 2R59A 5C0DB 2DICA 1J0HA 3CSYA 4J12A 3MO1B 4B96A 4FQ1L 2X2JA 4NQDA 5EF2A 4JFFB 3FQNB 1A4BA 3FZUC 4UBDC 5D1ZD 4O00A 4A7VA 4HVBA 4FFTA 1NFDA 2F9BT 1A9BA 4JFPA 2YSTA 4G5ZH 2WCPA 4JG1L 3SBWA 3I75B 4XN4A 3P0VH 1J48A 3UJTH 5LN8A 3IKKA 1FH5L 4OKDA 5A2LH 4EUPB 1CLOH 1UACH 1FO0B 4P23C 4EAEA 4BWUA 2BNRD 3BDXA 5TFSL 5AVSB 4RGNB 3N85H 3CCHB 4KJYA 2CRYA 5FO7A 5EF1A 3WDHA 1RAMA 2VITB 3VD4A 3HUJF 1KB9K 4OLYH 4XMWA 3TPKA 2BNRE 4AW7A 3B2DC 1CGVA 1BF2A 4AX3A 2WWKO 1I9EA 4R96B 2VLKD 5T1KD 4HHAA 1CLZH 1XXFC 2NY3B 4G8IB 4PB0L 2G2RA 3E3QE 2CLZB 2P24B 1PNDA 1SHSA 1KXVC 1ZA6B 2CA4A 1HJCA 5FXCH 3C8KB 2VLKE 2HKAA 4F7PA 5KYNA 1VGEL 4XWGL 1YPZF 2YXWA 3KYMA 1QKZL 2H41A 3FYEB 2J12B 4ZS7H 4ZMQA 5BZDB 2IH3A 1HXMB 3EUDA 5I0VA 1LO4L 1T6WA 4PP2B 2P80D 2XACC 5HGBB 1IGMH 5A2FA 4PVMA 5I6XB 5FCSH 4NOFA 3VFNA 5ESVB 3GBNH 3CHSA 4YPGB 3KEDA 1MPAL 1DJXA 1PZAA 4TTDC 4NC1C 3VG9B 5JOEA 4OSUH 4LSSL 5DURB 4A7TA 3MUZ1 5DT1H 3BP6B 4WI0A 3VGDA 1ECYA 5EOQL 4OGAD 2J1XA 2OW7A 4GXUN 4K5NA 4QHLB 2GG1A 3VXUA 1JUFA 4N2OA 3ZR5A 2WY3B 4M5YH 4MJ6A 1USZA 1MFDH 4V2CB 5GHWH 1RIVL 4N86A 5E8DH 5JHLH 3L2LA 4WFGE 4XTRD 1OM3L 3S3DB 4HV8B 1QFWL 4R3SB 3NGBB 4DKDC 1KGWA 2J8UB 4NP9A 4EKXA 4PRIE 4XWOC 1YNKH 2GKIA 2ZOWA 1N8ZB 2CMRL 2VOTA 1R3JB 1IFHH 1MW3A 5DS8A 4NDMB 3CDZB 5HHOB 1BVOA 2MCPH 4KJPD 3KGSA 1AP2A 4UYPA 1JL8A 5F7LB 3RTQD 5IGXH 4PS7A 3JVGC 2G9HA 4OZHF 4BCYA 1MVUB 4LU5L 3PWPA 4ODXB 2EC9U 3K4AA 2AV1A 5H35B 4KRNA 3V79C 4Q6IB 1RUAH 3LIUA 5FDYA 1P4BL 5ESQB 2ADGA 4P48A 3QHFH 1XO8A 3N42F 3RWJB 4KI5C 2KDYA 1YEWA 5HYSB 3EFDH 1T03L 2VR7A 2ZOTA 4ZSOE 1G7QB 4PRBA 4UQ3B 4EXKA 1T6VN 3CNKA 1T7YA 5IBUB 4QHKJ 3VD9A 4NERA 1IAKA 1Z3GH 3L6FA 4KRPB 5EEWA 2EXWC 5C0BD 4JCLA 5DYOA 5IMMA 2NYKA 2HJFB 4HKXB 4IOFD 5A1AA 3RHWF 5K9OA 4FQXC 1ZKAA 2C26A 3H42H 3S34L 4X6CA 3N1GC 1RK1A 1W0WA 1XZ0A 5C0BE 2VDQB 4KKNA 1M4KA 4FQLH 1WHPA 3ASWA 4BHUI 2AV7A 1TIUA 3OKLA 3NFPA 1VHPA 2E27H 4R0LB 5BUGA 1UATA 4JFQB 4A2GA 1UT9A 5JZ7C 1NL0H 4HSCX 2C9XA 1DLHB 4YXHH 4ZZFA 2BNRB 1JMZA 1OL0A 1JYVA 4NM8H 1FHNA 1K9TA 2W88A 3UL4A 4UM9A 1A5FL 1KTBA 5E8PB 4EZLA 3TO4C 3DECA 1R17A 4HJ0D 2D9QB 2XPZA 3LHAA 4X7SL 3N43F 4LQFH 5AW3B 1GL4B 2VLKB 2HPOA 2VERA 2FBJH 2VW4A 4LCYB 12E8L 1IX2A 4I3GA 1D3CA 5I1KL 2NY0C 3QCTL 3LXUX 2I07B 2D31B 2XRAH 2G4GA 2Z7WA 1NFAA 1JV2B 3AREC 4GXVL 4FEMA 1F11B 1ZT7B 3NCCB 2VLRA 2C3XA 2OA9A 4IDLA 5DD5H 2GVYA 3ZLQC 2XFGB 3MN8A 1IBGH 3RJOA 2WTOA 3TURA 2VIRA 3V4VA 3L4WA 5HD8C 4ZUVA 5K9JH 1RK7A 1T2JA 1G9NH 5IQ9B 4MJ5A 1YEKH 4N2DA 1TYJA 2IWKA 4AW4A 4PJFA 2XZCH 4EE2A 2P46B 3NCJH 4JJ5A 1G4MA 4WKXA 5CEZE 4HFWA 4P4RB 3HHRB 4DOHE 1NOFA 2APTA 4Z7IA 1HHGB 5L88L 4D0CB 2Y6SD 1QSFE 3SE4C 4QHNB 1UXWB 1KYUA 3CZJA 3RVTD 1EUTA 3P0YH 3KR3L 2VGLM 1IAOA 1NAMA 3MLSH 4PRIB 4Y5XB 3BEWB 4ZPTA 3STZB 4G6JL 3U1SH 3NEOA 5KZCD 5GGVL 3TEZA 4OCRH 5BZZA 2APWA 4OUUA 2Y1VA 4WW2B 5F1IA 3CLEL 1PZBA 5TE7H 3UTTD 1MH5B 2GY7B 3L1FA 1ZTMA 1DSYA 3GWJA 3M7FB 3Q9QA 4PGBB 1BX2B 3V4VH 4LO9A 3ZMEA 5JPNA 1TF4A 4RSYA 2DQTH 2HP4A 2WBJB 3V0VB 1R33A 4R4FH 4NRZA 5I26A 2G60L 3RTQB 3FB7B 3UTTE 5IROC 4K3GA 1V05A 2NY6D 3B3BA 3K1KC 3AB0B 2XTLA 4MB4A 2A9MH 2B4CC 1EEYB 4IRSB 2K7PA 5TDOB 2XZZA 5TGBA 4V1DD 1DQTA 4ZSOB 1NGXB 4LPVA 2AANA 3FTVA 3WFDL 3S3BB 5GJTH 1UC6A 3NIGE 1MFNA 4N2FA 1S7SA 1CIUA 2V2XA 3HC2A 3CTTA 3UABA 2H2SC 1E3FA 3WJLA 3MNDA 4P5SA 5IQ7H 1GAFL 7PAZA 2ZKHL 2G2PA 3HHSB 4WFFD 1PZCA 5E4EC 3UERA 3V6OA 1UD6A 5C0BB 3ZHFA 3I6LD 3ES6B 4F8QA 2AJ3B 4NKDB 1NCDH 4Z18A 4FQJH 5IMKB 4NNXA 1U6AL 2WYZA 1F4YH 1MRCL 4JZJB 3AMLA 2ALWA 2BSEA 4JRXA 5LGJB 3IM1A 4LPTA 4FQCH 1BQSA 2B4CL 4X4YA 2X1XR 3U2SA 3C5ZC 2DQFA 4ZXBA 2A6IA 3VFUA 3FF8A 3VXNB 4TL5A 1FV1B 3GSRA 4CVZA 3HNVH 2F5BH 1Q72H 2GJZA 1YNTF 1R5VA 3ARFC 4OCYH 4FHKA 2VXUL 3J07A 4RFNB 3ZIYA 3MLWH 3P3UA 1G0XA 2MHAB 4GI6A 3WIHA 5F72S 2QQNH 4PI2A 2UWEE 3QCUH 4JY5L 5HHXH 4X9BA 5LGKA 2ZCLL 2YAEA 4EI5C 1RU9L 1W9XA 4HEPG 5BUPA 4ODSL 4GIAA 4KKCD 4JHWL 2OLDA 4ODVH 2EC8A 5KYXA 4IDJH 1KEGL 1INQA 2R4SH 5F21B 5DMGC 1U3NA 5TPWH 3CFNA 4FFYA 1MIEL 1PKQE 3TN0D 5A3IC 4GKNA 5D9SA 2CSPA 4WO0A 3O3EB 5KJ4A 1KJ2A 3DETC 4UQAA 5LG1A 4HIHA 5IJVA 1C5BH 1UQSA 1L7TL 4G2AA 3ALPA 1SQMA 2AK1H 3HBZA 3AS3A 3B37A 4R7XA 2GK2A 4DPRA 1S3KL 2ZP8A 2WKOF 4YQXH 5AW8B 2QQLL 5I1IH 1IBHA 4WK4B 3QIBA 2DWSA 1TSRA 1LYQA 4DOHB 3W37A 3CUPA 3DVFA 2WXPA 5HTSA 4XCCL 2GJJA 2P44B 4MASA 2XWBA 3S5ZA 1QSFB 4O5LL 1TZHB 2O93L 2LGNA 2CM5A 4OBSA 4N85A 1S7VA 2CA3A 2BSSA 1HQ4A 4RAVA 1KGCD 4FFYH 3L3HB 4PLKD 4LLMB 3BAEH 3OR6A 1T0PB 3FU5A 3GSVA 1KJ2H 3D0AA 1KGCE 4XNQA 2FO1A 1NZRA 3T0EA 4M8UA 1S9YA 4K55A 1K5WA 5FS5A 5AD0A 5KZCB 4NJ9H 2AP2A 2Z65C 1U8JA 4OT1H 4PBWD 2R0LL 4G8AC 1SJHA 3UTTB 5E9DA 1TOXA 1PSKH 3FUKA 5B1BB 4R97C 1I3VA 4N2AA 2FJGB 4K71C 1NGYB 4NKIH 4IMKA 5TQ2H 3T6XA 3UYRL 5DSCA 1RMFH 2AABL 4IIQA 1KDIA 3O3BB 3LJ3A 3PGFH 2M8XA 1LP9F 2J3SA 3NH7H 4JPQA 5IMOA 1IM3B 3Q8FA 3TJPA 3D34A 4TNVF 4L4VD 1QA9A 2HLAB 3P40A 1N70A 5JHDA 1L0XA 4JFHD 3KPNA 3STLA 3E1F1 1JPTH 1ADWA 3G6AA 3WLBA 3V9EA 4JN2A 3X3GH 3DRTA 4L4VE 4E9QA 4QNPF 2X0VA 4HT1L 5K59E 2R8SL 5KBMA 1V7ML 3E80A 4QD2E 3L2MA 4M1CC 2AEQH 3OMIB 2VRQA 3CFJB 4F9PA 1UH3A 1HQRB 1J9SA 3AGWA 2EKSB 3CK0L 4XVSL 5DK2B 2E7LC 3TJEH 3RPIA 3CH1A 3I3BA 3O3UN 1VB9A 4XCFL 4G71B 4YE4H 3W5NA 3O9WA 3QNYA 2YBRA 1A0QH 3VXME 5GGRA 2UWEB 2IBZX 4BUQA 3QRLA 1BG9A 3Q2NA 4MXWH 1H6FA 2K45A 1WZMA 2VDMH 5BOPA 1T0NA 3VXOA 4AGQA 5D6DC 1JV5B 2PP8A 3VYPA 2W9DH 1S9VB 4N87A 3M6DA 3LKSA 4ODWA 1PKQB 4MJ2A 5EU6E 5LAXA 3QJFA 4ONHB 6FABL 1HXYA 2NX5A 2XPYA 3WO3B 1DVQA 2H1PL 1XGRA 2IV9A 3QXDB 3ECWA 4FQ1H 2O5ZL 3TN0B 3H55A 2QBWA 4LPYA 5F9WB 3MRDB 3CHOA 4PJCA 3H9YA 1HH6A 3KCPB 1ZK5A 1J8RA 1URLA 3NSFA 5FW6A 4ONOA 3EFFA 4PGEA 4P23A 4M5SA 4PTUB 4XPTL 4HU8A 2VE6B 4QI3A 3L9YA 2XWCA 3DYMA 2BINA 1XR9B 4JG1H 2WMPA 1WF5A 4D0DA 5BOJA 1XF4A 2DL9A 5DQ9B 1FH5H 3TBBA 4P5MA 3AXLB 1ZRUA 2WXMA 5JORA 5TFSH 4BSJA 3K8MA 1FYTE 3LH2L 3EO0A 1S7WB 4P49A 4ZO8A 3T6VA 4PJ9C 1PG7L 3CHPA 3II3A 5FYKL 4KMTL 1IC7L 4J7RA 4PJHA 2IWFA 5C07D 3KLAA 4EN3B 3IVKB 4LLDA 4XOAA 2ZD0A 2Q8BL 3TIDA 4FNSA 4LP4A 5IWLC 4PB0H 2VSMB 1JPFA 2B2XL 3BQUD 2GT9A 4OJAA 1UZ6E 1SVZA 4WKZA 3TNNB 4RNRA 3RZWA 2GSGB 4MLIA 3B9KD 2FEDC 3HIZA 3KPLA 4L9LA 5F96L 1VGEH 4CILA 4XWGH 4U2YA 3INOA 2BP8A 4LDEB 3NRFA 5L2KB 5KSAD 1XF2A 1QKZH 2YRPA 3GRBA 2ZJSL 2CDEA 2IPUK 1E9PA 3SYQA 1I7ZA 3TPUB 1FI8C 1LO4H 5IG7A 1VFAB 1MAJA 1G43A 2ODHA 3D8MA 4GSQA 2K70A 3VFRA 2OXGB 1U21A 4U6XA 1MPAH 5HDRA 3ZUNC 1U8KA 1U0QA 3NT0A 3GTNA 5HHQA 3VWJD 1FZKA 1U8IB 4LSSH 2BHFA 4WJ5A 4Y1TA 1AVAA 5D4HA 4OF6A 5EO9A 3UZVB 3QI9D 4TSCL 4HHWA 5EOQH 1J9RA 2X3CA 2A0LC 1D6VL 1J5DA 1RJLB 2XCMC 2XWJA 4L4VB 3H0TA 1EFXD 2MMXA 4FXGC 1RIVH 3Q43A 5ENWB 5HHNB 5LN4A 3CC5B 3HZYB 1DBML 3SBRA 3ALXA 1OM3H 1QFWH 4W9LC 1UWEL 4M03A 2AQSA 3UX9B 1X5IA 2P52A 3ARDB 4BCXA 2WLKA 1PZ3A 3BWSA 2CMRH 3VXMB 1SGKA 2QLYA 2VDNL 4X8JA 2WLIA 1TPXB 2YRZA 4YFLI 1VFUA 3GJEB 3ZT6A 4RFEA 3ZYOA 4NQDE 4LU5H 1AKJA 2OTUB 2XG5A 4U33A 2ZUVA 1R47A 4XX1E 1T22A 4MNHB 2GUYA 1ZD6A 2R1XB 4HUXB 3F62A 4DQAA 1T5XA 1P4BH 2Y23A 4LRNL 4YSPA 4PG2C 1I8KB 1NFDE 5EU6B 2WLZA 4NQUA 2WK2A 1E5AA 1O75A 1YN7B 2WXRA 4HFUL 1TCMA 4ODHL 1GMIA 1AOHA 1UVQA 4KGJA 1T03H 3LKPA 3GEFA 4X83A 3QYNA 3D0LB 1IARB 3HB3D 4GW4A 3DGDA 2NY1B 2HVJA 3WFHB 4Z7WF 2E75C 2Q9OA 2AMGA 4I4WB 1NCGA 1FL6A 2Y5TB 5EG6C 2CIIB 3ULUF 4ONFL 3S34H 2BSTA 4YO0A 1FFPB 4URKA 5IVNA 3D2UA 5D72L 4PWKA 5CLTA 2AERT 4DN4L 5I76B 4J3TA 4PS3A 4UQCA 1Z5LB 2G3XA 3MRLA 1L9RA 5C2UB 1LO0H 2W07B 3JSSA 4GMSL 4PV8A 1FYTB 4U1MB 3LVTA 5D5MA 1EEZB 2JCCA 3DKHA 3FW6A 4QRUA 5FKAA 3RDJA 3TO4A 3WAKA 2K3TA 3OBAA 3HS9A 2OSLB 1OP4A 1J10A 3ILPA 2A4ZA 1IKNC 5EHFA 1AI1L 2ADJB 3NJKA 3OKYA 5AL8A 4BSVA 3GGWA 2ZZUT 3X11A 2JKNA 2X4TA 2YAPA 3BUPA 4X7SH 2WSPA 1AH1A 3S5LB 3P1VA 4RVBA 3DX8A 3FCUB 3WS6C 1DQQB 1RLBA 5EO1B 3EF7A 3AREA 1N0LA 2QHLA 3BQUB 5DJCA 5HGDB 1GKEA 12E8H 2JH2A 3QH3B 4N8PA 1MIML 2CJSA 2O72A 1EHNA 1SDDA 4KJQD 4B9ZA 5A2IH 5I1KH 3B9KB 4F7KA 3QCTH 4RZCB 5J89A 5KYUB 1BCIA 2WNKA 3VXUE 3X13A 4YDZA 4PJ5D 4U1SB 4GXVH 2ZKWA 3F2LA 1R3KA 3KCWA 2DLGA 4I8DA 3VVWA 3PWJA 5KSAB 3TESA 3IDJB 3U1PA 3ILQD 3PGCB 1KELL 1CR9L 3A6CL 3B34A 4YPJA 3LDBB 4XH2B 1QWUA 2H2PD 3CU7A 3ZL1A 2LHAA 4ACTA 3VTAA 4JO3L 4M1GL 4ANWA 2JI2A 1E6OL 1MCQA 2NXYD 2WLLB 2NTSP 2VDLB 1CD1B 1NCUA 4LGPB 4N0CD 5B8CC 4QHMB 3VWJB 1HIML 4I7ZC 3HN3A 3EYQC 3VD1A 2GFBA 3QI9B 1KPVA 5L88H 3O45A 4O2EB 3RVVD 2BHZA 3OGOE 3IT8D 4MVBC 4UF7C 2VR4A 1A7NL 5E5MA 1Z9NA 3O4LD 3PWPE 1HOCB 4KKAC 1XSOA 2OMXA 4MMZC 1KYAA 3IPFA 3FQXA 3V0GA 1SN0A 4G6JH 4ES9A 1ORSA 3SOBL 3VRJB 1I3UA 1BV8A 4N26A 3I9IA 3JV6A 5GGVH 2O6DA 4U4IA 3CSYB 4PJ8A 3WTUA 3CLEH 5IROA 2BCKA 2TSBA 1J8KA 4LCCA 4NQDB 5G2NA 2IBGA 3U7YH 4QCIA 2GHZA 4HW6A 1X44A 2VLLA 5IQOA 1A3LL 2G60H 2VXQL 4N5ED 3CFBA 1J18A 1NFDB 1QVOA 1A9BB 3P4MA 4JFPB 4X6CE 4LMQE 4XAKD 4XNZB 3RWCA 3SYAA 4BEIA 3QEQD 3ARZA 5D4QA 4XXWC 3HA0A 1QX1A 3WFDH 1OLLA 1CG9A 2B39A 3F6IA 4KJYB 3A4AA 1ZV9A 3FBQA 4XAKE 5FO7B 1VEOA 3US0A 4HJGA 4N90D 1VCAA 3EJTA 4Z7UA 2NR6C 3HRZC 1GAFH 4KY2A 2HRGA 2ZKHH 3QUZC 1A25A 1M9WA 3BIKA 4KK6D 3OPUA 2WB7A 3B8SA 4HHAB 3C5ZA 4MHHG 1U6AH 4N90E 1UKTA 1MRCH 2G2RB 1SXBA 4IKLA 5IVXA 3GXPA 3QB7C 5IW3A 1NKOA 3QE5A 3ARFA 4QXTA 2NMSA 3MMEA 5DUJA 4LRIC 4F7PB 3MLXL 4TYUA 3ECBA 2NY2B 5D96B 1BQHG 2X6UA 3U0PA 2GAZA 2LU7A 3MLUL 2ENYA 5DEFA 5B38A 3KYMB 3OKDA 1P69B 3VRIA 5BUAA 4DP1X 2IH3B 2VXUH 3TZVC 1QEWA 1IM9A 3QHZL 4FULA 5C6TL 4JY5H 2ZCLH 2VLRE 1CFSA 2HZHA 1Q0XL 1RU9H 1CDGA 3QISA 3SD2A 4M1DL 2F53A 3VFNB 4ODSH 3GI9L 4JHWH 2GQHA 5DCCA 2BWQA 1IBFA 1YUHA 3IE4A 1KN2L 1KEGH 4LVNC 4I88A 4ODBD 2J6WA 1XH0A 3S5YA 2FAUA 2D4FA 4WI0B 1MIEH 4TUKH 3VXUB 4G43A 5SV4A 4UV4L 2AEPL 1JUFB 2QFPA 4GXFA 1I9JL 4PJFE 1RZQA 4Z78A 1CD9B 2X6VA 5ID1A 5DK0A 4MJ6B 2BC4A 1UJ3A 3UJJL 4GRLD 3X17A 1L7TH 1AR1D 1ES0A 6TAAA 4MYWB 2DQJL 5K39A 1VLXA 3I74A 1CDIA 1H9VA 1S3KH 2Y06L 3GMRA 3IDYC 3LIZL 3ME0A 5JOFA 2QQLH 1Z5HA 5DC4B 5MHSD 2Y25A 2KZWA 4YFEA 3W57A 2DQCL 3ARVA 5ANMA 4HGWA 2DIEA 5DS8B 1H0DA 1O6TA 4X9HA 3AM8A 3CMOL 1TTRA 4XCCH 3HR5A 4PRHA 4UIMA 1OZTG 1OT2A 3MA9L 3QVAA 1AP2B 2NXYB 4OVVA 1KCLA 1LDPL 1TTCA 1KULA 4K7PY 2G9HB 1EZUA 1JPSL 3PWPB 3ZVVA 2AV1B 1MHCA 3CSPA 1E2WA 5E2WL 2NXZD 3KYKL 1TZAA 2ADGB 2JFCA 4OF7A 3MOAL 2Z1KA 3THML 4K7PX 4X4KA 1Y1DA 4XP4L 1YDPA 3Q5OA 2J1YA 1UURA 3WLWD 3D2TA 2EIKB 4PRBB 1AQMA 4Y5YC 1W6WA 1IAKB 2BP0A 3L6FB 2R0LH 3O0LA 2LE9A 4GS7C 1AZNA 5DYOB 5T1LA 5IMMB 1BPVA 5K9OB 1B4RA 3B4NA 2L7EA 2Z91B 2BSED 3EOBA 4JRXD 4X6CB 3UYRH 4F20A 1RK1B 1W0WB 3TT1L 1XZ0B 1VESA 3V6OE 1E9OA 2AABH 3CFIC 3ZHNA 1GHFL 5AB1A 3GS7A 3M17A 5IK3A 3HUJA 3UTZA 2Q10A 4Q58C 4ZXBD 1NFKA 4OB5L 2AV7B 3OKLB 4JRXE 3NFPB 1AKPA 2OR8A 4RMWA 3ARWA 4GKSA 3ZDXF 4BFIA 3L13A 5CD5C 1OE2A 2B59A 2HSIA 3W39A 4PY7A 4MDIA 4P2OD 1JPEA 4XNBA 4HT1H 4UM9B 1NGPL 2R8SH 1YPZA 2DWDA 1V7MH 1DN0A 4KK5C 2Y7OA 4ANUA 2V5TA 1ECZA 3S8GB 4JREC 1M9SA 3W82A 4F15B 5F97E 2WXGA 3EBGA 3CK0H 2EXTA 2HJKA 2LV4A 3HOGA 3LXCA 3LPPA 2Y7LA 1HHKA 4HAKA 4NBXB 4Y16C 2BIIA 1I8MA 4I48A 4PVLA 3BGFB 4XCFH 5D6DA 1JVOA 5E8EB 2J72A 1OLZA 1N3NA 4NHUA 2VLRB 1Z9SA 3FS9A 1CDJA 3WELA 2NDFA 4DO5A 5CGYC 3UACA 2V0AA 2VIRB 3SKOB 3V4VB 3K2MC 3VYNA 2RQEA 3QIBD 3L2NA 3BWAA 2FIKA 1XB3A 2H0JA 2CLRA 2DWEA 4MJ5B 4Q0XL 6FABH 4PJFB 3WUWA 4AIZB 4JJ5B 2H1PH 4HFWB 3BSZL 3L3OC 2O5ZH 5C0RL 4LLWA 3EGDA 4PWGA 5BZWA 4KV5E 4PYGA 3SDAC 1KMGA 1CFTA 2V2WA 4IEFA 1IAOB 1NAMB 3T0ED 4ZPTB 1ZLVH 3HNSL 5LXVA 1PCSA 1X5HA 3APCA 4OZHA 2FH6A 1AG0A 2CGYA 2KPWA 2XTSA 4OUUB 1M71A 3ML8A 3T0EE 5F1IB 3VX1A 3LH2H 5JPNB 2F8VA 1JNNL 1J5HA 2G5BA 1QFWM 1E43A 1PG7H 3FL7A 4NRZB 5FYKH 4KMTH 3BSGA 3B43A 3UDWC 1IC7H 5E9DE 4JPWL 4F58L 1D9KC 3P9MA 4FQPA 1MFEL 1AG6A 3QO1A 2Q8BH 4L9DA 2I60L 4NUGL 2OX5A 3ZTJH 4ODTL 1MZYA 2OJ1A 2B2XH 3CN0A 3N1FC 4H88L 1P7KA 4P99A 3GMPA 3IN2A 5JHDD 3HTLX 3ZUCA 3ULVC 5F96H 3EJYD 3IDGA 5F7HA 3VFTA 4MA1B 5A2CA 1S7SB 2V2XB 4WJKB 1OAZL 5JHDE 2D7QA 2ZJSH 2Y7SA 4QLRA 5JPMC 5F7AA 3TBTA 3KLHD 2WVVA 5FGSA 1H3VA 1SM3L 3QAQA 3NFNA 4NNXB 2F8OA 2J1ZA 3RKDD 1WD8A 2RCSL 4TOYL 2CD0A 4JRXB 3ZY7A 4DN3L 5AB2A 2MQGA 2FJHA 5DMKA 1HNFA 1WE5A 4LZKA 1UWXK 5FWQA 4X4YB 3U2SB 1E8ZA 3O9WD 2DQFB 2JTYA 4FXGA 2A6IB 2AFNA 2WO4A 4ZXBB 3VFUB 4TSCH 3ULVL 2Z7YA 3GSRB 3W9EA 4CVZB 2GJZB 1D6VH 4GJTB 1UADC 1R5VB 4NN6C 5HI4D 2CBMA 2ZAHA 2XQYG 4AQ1C 2LU5A 4J3VA 3VFMA 4LQ1A 4MAZA 3TWYA 1DBMH 3LEYH 1MRFL 4OCNC 5KYXB 4N22A 2CUAA 2DLFL 1UWEH 2VDPB 1INQB 1SBSL 1DBAL 2I25N 1MCSA 1MG3C 2XKNA 5IQNA 3MUJA 1A4KA 1I1RA 1MY5A 3D33A 3NK3A 4GKNB 5D9SB 3O81A 2NX5E 4LSPL 5F1NA 1GXEA 2VDNH 4HXBL 1KJ2B 2D0HA 4K73A 4JFEA 2AXFA 4HIHB 4ES8A 2YUVA 1PD6A 3LKQA 1UQSB 4R4NC 1E90A 3WFEL 4GW1A 4UI2A 1EO8L 4AEHL 1IKFL 1PIGA 3AXHA 1IC5L 1DFBL 2P8LA 4PJCE 4EO5A 5F3BA 4RAUA 5IHLB 4LRNH 5FUZL 3WEXA 4HPOL 1TYEB 2ICWI 2NQCA 4KUCD 1BZDA 3JTBA 3OGCA 4HFUH 4ODHH 3QIBB 5CD3A 5I18H 3VE0A 1Q1PA 3LNEA 3CUPB 1WP6A 1ZE3C 2XWBB 4S1QL 1KCRL 5ID0A 1ASQA 3R4DA 3WJMA 2FT7A 1O5DT 1S7VB 3EDJA 2BSSB 1HQ4B 4K3HA 4RAVB 4ONFH 4PJHE 5C09A 1I1CA 3OX8A 4HETA 3OR6B 3GSVB 5I71C 5D72H 4XNQB 4DN4H 3T0EB 1N67A 1S9YB 3EW3B 1XSJA 3NJLA 2HFTA 2FT8A 4GMSH 1GJWA 1EEUA 5AD0B 4Z7QF 1IKNA 1U8JB 1XGTA 2V3DA 1MCWM 1QWNA 2E8YA 1A22B 4WAFA 4D0BA 1SJHB 3WKQA 5E9DB 4B6ZA 4YSCA 3D0VA 1ZA3B 3WS6A 3SO3C 5AZUA 3N1QC 5IFHL 5DSCB 4NC1E 3CFTA 1AI1H 4IIQB 3IEAA 5DJ8A 5HGAA 5MEPA 3ZT7A 4V11A 3LPFA 1Z2KA 2YQ2A 1YSOA 2Q76A 2VUKA 4XPFH 2VDMB 5IMOB 4J1UA 2GSMB 1NEUA 2XUWA 2CALA 1QA9B 3A5VA 1MIMH 5JHDB 3KPNB 3STLB 2YO3A 2GBUA 4M56A 3G6AB 1B0GA 5DUBA 3WLBB 2IG2L 4JN2B 1KY7A 3DRTB 4EUPA 3FF7A 1O7DC 1OB1A 3C87A 4H0GA 5D2NC 1UD2A 1D6EA 1KELH 3BESR 1CR9H 3A6CH 5E1HB 5GGRY 2ICWJ 4UDUA 5H94A 3G5ZA 1GJUA 3F7YA 4FXLA 4JO3H 1UCTA 2QTVA 1X6NA 4M1GH 3RPIB 1R46A 3CH1B 1HYSD 1E6OH 1SQ2N 1HIMH 3O9WB 2MCAA 3QNYB 2YBRB 1H3WM 4LNVA 5GGRB 3TM6A 4FMFA 4ATWA 2WQAA 3Q3GA 5GZNC 1T0NB 1YNLL 1CDUA 4JR9L 1A7NH 2EYSA 3VXOB 2YD5A 4XOEA 2JKXA 3EO1A 4P2RD 4PJEA 5MEND 1X9LA 3OLDA 1S78D 3HN8A 3L3KA 5ETUA 5CO1A 1FORL 4CU7A 3LKSB 4ODWB 3SOBH 1BAFL 3OHXC 4ISVA 5J6HA 5JXEC 1CXKA 3QJFB 2IDCA 2YXFA 1HXYB 2NX5B 3SPCA 3V4PL 4K9EC 4HIEA 3C2SA 1XGRB 5BV7C 5D4IA 4RAHA 2R2BA 5DYFA 4MRCA 4LBAA 4OZFG 1MXDA 4KH2A 4PJCB 4BSWA 1ZS8A 1HH6B 4JHVA 3W0WA 5JZ7D 2CWRA 5DZJA 2VXQH 3EFFB 4PGEB 3DRQA 3D2UD 4P23B 2R29L 1BMGA 1XH2A 3B5TA 1L6XA 4X42A 2EDEA 4OF5A 3WEAA 4IGBC 1BLIA 2WMPB 4D0DB 1UUSA 1XF4B 5I0DA 1HYRC 5DD6A 2AHIA 4KNUA 4P5MB 3HRZA 4JDZA 1XTMA 3QUZA 5JORB 1ID5I 3RI5F 5JXAL 3HPJA 1AGCA 4CVUA 1RZIA 2XXMB 3EO0B 3QGVA 4K9EL 5D5ME 1GCFA 4AY0A 3N3EA 1EHLL 5BV7L 5B1CA 2JCCE 2QELA 1FH2A 3MRPA 1ACYL 3GB7A 2X9WA 4PJHB 5CN1A 1IEAA 3KLAB 4LLDB 3HZVA 4LRIA 4JFYA 3TIDB 2J6EA 5ILTL 5DHXB 4JFDA 1NIBA 1JPFB 2YARA 2GT9B 4YSUA 3HKFA 4WKZB 1QPPA 5I8KL 4RNRB 1UXLA 1YEGL 2PPEA 3OG6B 5C9JA 1FIGL 2BO0A 4OFQA 3MLXH 3KPLB 2K6YA 2BVUA 4L9LB 2G9KA 2YR3A 4I5BA 5DC2A 2BP8B 2JB5L 3VSVA 3D18A 3MLUH 3RL1A 4FFZL 1XF2B 1Y0LA 4ZOBA 2YPLA 1USQA 1PS3A 2CDEB 1E9PB 3I84A 1I7ZB 2QGBA 3LB6C 2QPUA 1LWHA 3QHZH 4JE4B 4NQTA 1X9QA 5IG7B 5JUEL 1CYWA 2I5YL 5C6TH 1K3ZA 1Q0XH 4F37F 2Z31C 1FFNA 2ZXWB 4M1DH 3VFRB 3GI9H 3MTRA 5DO2D 4U6XB 1G9MC 1U8KB 3GNML 2GITA 1KN2H 5LAPA 5HHQB 1CXFA 3PNWA 1FZKB 1BGXL 4WJ5B 1X5FA 3N41F 2WQSA 5EO9B 1QZNA 3BH8A 1J87A 2AEPH 4S10A 4UV4H 1I9JH 2XWJB 1XIWA 4DTGL 3H0TB 3LZNA 1KGYE 1T66C 3JWNE 3UJJH 2E76C 1EAOA 1T2XA 4RETB 1PLGL 4I2XA 3FOMA 3FC8A 3TFKC 2VQ1A 3FQTA 1F97A 4JKKA 2DQJH 3K80A 4QXVA 4BFEA 5KBKA 1F56A 3KPOA 4H0IA 4YUEL 5HYEA 5KBPA 1URIA 4Z7NE 4S11A 1LK3L 4PJ8D 3C6LD 2Y06H 3LIZH 1G9ML 2QKSA 2GPZA 1D2PA 1U3HC 5E99L 4QXWA 2E4FA 4YVNA 1OY3B 2BNQA 3CMOH 4X8JB 2WLIB 3RZCD 4MD4A 1ZEAL 3MA9H 3NIDE 1Z6JT 1D7FA 1Z0NA 3IU4L 4RFEB 2R69L 5ADPL 1AKJB 1PCXA 2XG5B 2XVGA 1JPSH 2C9SA 1CGYA 1T22B 4FXKC 5E2WH 5FAAA 3BMWA 1T5XB 1QPKA 5KG9A 4GP5B 1EVTC 3D30A 3KYKH 3PWNA 4FS0A 3SJVD 3Q06A 3MOAH 4Y5YA 1I75A 3SY0A 2BP5M 2J20A 2NT0A 3THMH 4XP4H 1OSEA 1UVQB 3L9RA 3ZKXB 3LKPB 4XZ4A 4ZX5A 4CMMA 4WSJA 2FH8A 4D7BA 1XH3A 4GW4B 3MTXA 2HVJB 1B4LA 4JL2A 3WNOA 1FL6B 1I8AA 3UAEA 3MV8A 3AT0A 3NSDA 4Z7UE 2CR3A 1BIHA 4KWUA 4ABWA 3N2JA 1LL1A 2X9ZA 5ICZA 2BSTB 3M1OA 4YO0B 4YSTA 2X87A 2VMJA 2UVFA 3ARFD 3DTUB 3T0AA 3TT1H 4MFHA 1GHFH 2K78A 2XZAL 3D2UB 5FYJL 4NO5A 4HUCA 4EVNA 3MJ9L 4OB5H 3BCDA 3MRLB 5IVXE 2XKSA 4PRPA 4F92B 4PV8B 3ZO9A 4S1DC 1O9ZA 2N0MA 5GSRA 5D5MB 4IRJC 3QXUA 4RGOL 2JCCB 2WQWA 4QRUB 5FKAB 4PWHA 5ACZA 3LEVL 3TO4B 3LNHA 1IM9D 5I6KA 2JKJA 1TEFA 1TEYA 3ETSA 5F0MB 1JIBA 5EU4A 3ILPB 3PJSA 5BXFA 4JGUA 2HFFA 1NGPH 3MDJA 4BSVB 4KHXL 3M88A 3K6IA 3GGWB 5GGVY 3X11B 2NY0B 2X4TB 3DC0A 3HNTH 2F53E 3DX8B 5DHEA 2OK0L 3AREB 1N0LB 4RA3A 4U31A 5DJCB 3BGAA 3BISA 1SDDB 3RDTA 5FWRA 1BJMA 3ZJAA 4BA8A 2A5UA 1ZIBA 3NSJA 2F54D 3X13B 3FSZA 1DO6A 1R3KB 3LZLA 4MZRA 4QGYA 2GK0A 3PJLA 3PWJB 1XCTA 2CBTA 3T65A 3GUFA 2WSKA 3UBXG 2JK5A 5F9DC 4W4OC 2W91A 3RWFA 1FWXA 2BXYA 3MCLL 3RJQB 2K4WA 1LEGA 4Q0XH 5AKTA 3QJOA 4PRHD 3K2IA 3FONA 4JS7A 4XAWL 3PL6A 2FX9L 4YDLC 4APXA 4ZG1A 3BSZH 2HRLA 3G6JA 5ANME 2GFBB 2EDBA 4R2GD 1KPVB 1PMYA 5C0RH 1OAQL 4PRHE 4XMTA 3O45B 1S4IA 5FUOL 1LEKA 5KVEL 2C3WA 3BSHA 3P30L 2LR4A 5FV1L 3D08A 3CPUA 5I17A 5E5MB 4PW4A 4YHML 3R0MA 3MX0A 3ARRA 1N7ML 2OMXB 3FQXB 3QIUA 3HNSH 1F42A 1ORSB 1GH7A 2X10A 3JV6B 1MAML 3QNZA 3FT1A 3FCSA 3UDWA 1J05A 4PJ8B 3L3DA 4ZMPA 1D9KA 5T1LD 2BCKB 2WOBA 3QSKB 4M5ZL 4LCCB 4M8QA 1JNNH 2YQ3A 4B9GA 4QCIB 3QJXA 2VLLB 3GINA 2DQMA 3MQIA 3U9PL 4JPWH 3CFBB 4F58H 1MFEH 1QVOB 3KNBA 3P4MB 4BA0A 1PZDA 2I60H 2YXMA 2FT6A 4NUGH 4ODTH 3GRWL 5JTWA 2DMBA 3HG4A 3RWCB 3IGLA 4H88H 3TNMA 5LBSL 2ED7A 3HUJE 4W9HC 1A6AA 1M7UA 5E03A 5JPMA 2XV2A 1CG9B 4TQHA 5E4EB 1XR8A 2KZBA 2YA2A 1Z9LA 3JBG7 3GMOA 3CQFA 5EBMA 5L8JB 4UTAL 4HJGB 3T3PF 1OAZH 5DWUL 4Z7UB 1IGFL 1JNLL 1NC4A 3BIKB 1W0VA 2NUPA 2X38A 2H4EA 4HWNA 2ZSVA 1SM3H 3B7RL 3C5ZB 5CZXC 5INCA 1YPZE 4TOYH 5IVXB 4DN3H 4OLXL 3I9GL 5JDJA 3ARFB 4QXTB 3MMEB 5J6GA 4G70B 3TH3T 3ECBB 1U8OA 3U0PB 4C4KO 5EC1A 5ECJE 2GAZB 3ULVH 1OCWL 5DEFB 3OKDB 5B38B 1WT5C 3SDCC 3VRIB 3QPQC 3E6FA 2KQNA 1BXVA 1LNUA 1QEWB 3U0TA 1IM9B 4KO5A 2YWYA 4YBLC 5B7EA 1RULL 2DM3A 1CFSB 2QVIA 4X6DA 1JWUA 2F53B 4BGLA 1MRFH 5DFVD 2O4EA 1YUHB 3VGFA 2DLFH 1SBSH 3R8QA 1M7IA 5DJ0A 3CN1A 1DBAH 1NBZA 4NO3A 3I3EA 3TO2A 4G43B 4Z78B 4LSPH 4X8XA 4HXBH 3UBGA 4B7LA 5ID1B 4FN0A 5DK0B 2BC4B 1UJ3B 5B1JA 5J06A 5TJWK 4F2EA 4AEHH 3WFEH 4GAJL 1EO8H 1ES0B 1IKFH 5DDHA 3L5JA 1IC5H 1DFBH 3N0PB 5CM1A 5K39B 3RWDA 4NYLA 3GXUB 4UYQA 5FUZH 5ABZA 3H4HA 4HPOH 4Y4HC 5JOFB 3GMRB 4KXDA 3ME0B 4OZHE 2NNFA 4M6NL 4FI7A 3L7FA 5ANMB 4HGWB 1H0DB 2NY5C 3HR5B 4PRHB 4UIMB 4S1QH 1E8WA 3PYCA 5DRXA 1KCRH 4Y7MA 1K72A 1XQ4A 3ABKB 1JK8A 4KY1L 4ZW3A 5IV2A 1MHCB 1EAQA 3QJZA 5E9NA 3UZEC 3IPBA 4M7JL 4MCZA 1E2ZA 4JMXA 5IHUL 1BW8A 1OWRM 1IL1A 4CADA 1I8IA 4GB9A 4LF3A 1A7OL 1YDPB 3WXVL 4R97B 3HI1A 1UH2A 3BD3A 1U8MA 4K71B 4D9LL 5IESL 4JK0D 2Y9RT 3BPOC 5D1QC 2BP0B 5LUMA 2B1AL 2NY5L 1ZE3H 4OBRA 4ZMYA 1ADQA 1T5WA 5T1LB 3CQQA 3BOVA 1XTLA 3QUKA 3EOBB 5IFHH 4QDGA 4UAOC 3ZDWA 1UA7A 4PWEA 1E9OB 2UVEA 1EJOL 2OMUA 4NIKB 3M17B 5IK3B 3HUJB 1WO2A 3UTZB 2L8AA 3LNDA 3N40P 1SYSA 4NP4L 4XODA 3B2XA 3RU8L 2WZ5A 4ODUA 2R23A 4GKSB 3FHAA 4BFIB 3VD0A 1OO2A 2HG0A 2B59B 1KLFA 1L9OA 4HIQA 3GBLA 4LEOA 4NLHA 4XPHL 1FCGA 3Q0HA 2A6JB 4PY7B 3NUKA 3W39B 2IG2H 3EHBC 1NCWL 4MDIB 3SGJA 3BIBX 3ZRSA 3RGBA 1N12A 3O41A 4Q9QL 3V4PA 1YPZB 2DWDB 4CBPA 1XXDC 2MFNA 1DN0B 2XWEA 4PCSA 5L0QC 4V2BA 4YDKL 3AJ7A 2C9RA 5E56A 2P4AB 2NSMA 5DC0A 1PD0A 3GSQA 2HJKB 1YY9C 5ISZA 1HHKB 3MJ7A 3OMNB 1I8MB 3TBVA 3VFOA 4N1EA 4I48B 2X4UA 3DGCR 2HT3C 1SBBA 2KHAA 3FH7A 3GSXA 1BD2D 4E9WA 1N3NB 4NHUB 1EXGA 1Z9SB 3OF6A 4JFEE 4I77L 3LNIA 5JXEA 1H9DA 5E6RB 4Z3FA 1V54B 2DMKA 1YNLH 4JR9H 2BFGA 1WA2X 3UYOD 3JV5A 4J39A 3D85A 3BWAB 2FIKB 1FORH 2WBXA 3O0RL 3OSVA 1NMBL 1BAFH 2CLRB 2DWEB 4NCC2 4PQXA 4RMVA 1OE3A 2VN5A 4QR7A 3V4PH 3WUWB 4RMUA 2O61B 1VZGA 3CZGA 2PPAA 4ADGA 4LLWB 2Q6WA 3EGDB 1YYCA 3LRLA 3F7QA 4IGBA 5C86A 1MY7A 4P2QA 2H6OA 2VJ0A 4HS3A 5BZWB 4YHPA 2QJDA 2QDWA 2WWOA 1CFTB 2V2WB 2R29H 4IEFB 4M6ML 4CN4A 2OMNA 3AADB 4MMYA 5AOLA 4FFZA 1F3RB 2BRQA 5C09E 4JVPA 2EUVA 4OZHB 4LCUA 3L5IA 3IJSA 4UTBA 1ET8A 1QW9A 5DGRA 1QRNA 1Q9KA 1CD0A 5JXAH 3SDDC 1HAUA 3FT3A 1FPTL 3N42B 4K9EH 3MRMA 3OAYK 3TEYA 1G4RA 1PFOA 2RA1A 2YJLA 5E4AA 5BV7H 1EHLH 1VCBC 2G5BB 1ACYH 3S6CA 2CLVA 4H8WC 1P1VA 3P9MB 1AQDA 3QO1B 2EDXA 3HI6H 3ZHKA 4BQCA 5D93C 2EO7A 5ILTH 2OX5B 1J0ZA 1A3RL 2JKSA 3DGGA 2R2EA 4N8VA 1P7KB 3GMPB 1SLWA 5I8KH 1YEGH 1FIGH 1NBCA 1K3IA 2R51A 3VRLE 5J7CC 3IDGB 3VFTB 4F1SA 1MDTA 3TT3L 2JB5H 4Z7OE 3QWRA 1WFTA 4LOVA 5EOCJ 4QRBA 4FFZH 2UUDK 2X9YA 4HEME 3M8OL 3TBTB 2WVVB 5JUEH 1L7IL 2I5YH 1FHGA 3QQ4A 2WUCL 1MF2L 2VDNB 3NFNB 2B5IC 4H8WL 4DPBX 1OALA 4MDJA 2R0KL 4BGDA 5HHMD 2TRYA 4NPKA 2FJHB 5DMKB 2R69A 4YDNA 2V5YA 3GNMH 4BH7B 1FF5A 3FUIA 2FNWA 1PLCA 1TLKA 1E5BA 1BGXH 2W8CA 4WHDA 3NCBB 2APBA 4FXGB 4HYTB 4WIQA 1CXIA 5HHME 3W9EB 4ZQKA 4I18C 5EDXA 4RDBA 1N8OE 1U2HA 2KC0A 4NGHL 4DTGH 5E08L 2DTML 4JM2C 4MAUL 5JOPE 3VFMB 2W80C 1PLGH 4PV9A 4BKLA 3VFSA 3GLZA 5EH1A 3U9WA 1U3HA 1IQDA 4YUEH 1CFQA 4HWEL 2BSRA 4PJEE 1DL7L 1G9MH 1KSRA 2XKNB 2ALAA 4FI8A 4J3BA 1G94A 1A4KB 2PCPA 3B2UD 3OB0H 4JG9A 4XI5C 3QPXL 5E99H 4FXKA 2NNXA 5F1NB 2HX7A 4WW2F 2H3NA 2AXFB 1ZEAH 1N64L 4JFEB 1OP3H 3QUML 4AQEB 4DK5A 4W68A 3IU4H 3GSOA 1BF8A 2R69H 3LKQB 5ADPH 2EUXA 4GW1B 3RVXD 1HL8A 2P8LB 3W0WE 4GSUA 2FK9A 4LOUC 4BQ9A 5F3BB 4RAUB 5FPIA 1AZBA 15C8L 5DWPA 2Y3AA 3WEXB 1Q1JL 4WWKC 3QUZD 2IPTL 2YWZA 3LRHA 5FGCE 3BAIA 3OGCB 4Y9GA 3U1QA 3M07A 5CD3B 4N2CA 3VE0B 3QAZC 5DGQA 2F19L 2RIKA 4JO8A 2CK2A 3KH3A 3VDBA 1EA9C 2BVTA 3F83A 1J5OL 3V6BR 5ID0B 3WJMB 4WRLA 3N50A 1OP9A 3KDPB 4OD2A 2PCXA 4JFDD 3WO4C 4F3FA 4R7VA 2QZQA 2WO2B 2OI9C 1QYGL 5C09B 4M4PA 3JYCA 3OX8B 3CU1A 3PHQA 4XGZA 1J0YA 3UPCA 4CMHC 4GIPD 1G1YA 1U3ZA 5F93C 1M53A 2XZAH 4JFDE 3UTOA 2ZX6A 5FYJH 5DMIL 3MJ9H 1CGSL 2ZX7A 3BZEA 4A6YL 1RFDL 3CFKA 1T1YA 4RGOH 1XGTB 5IJCC 3LEVH 4G8FA 4M7ZC 1YZZA 4XVSH 4D0BB 4YSSA 1CFMA 1IBDA 5C0NC 1PEZA 4H25A 4XVJL 3D0VB 4AE0A 2YPLE 2EH7L 4NZTL 4M7KL 4IU3A 1T80A 4MMXC 1V3JA 5AWNL 4RGMB 5DF0A 4JO4L 4R5XA 4KHXH 2E5EA 4HMEA 4PLJD 5DJ8B 5AZ2L 3NPSC 4H2AA 5HGAB 5MEPB 3NZ8A 3W38A 3W11D 2W92A 4HKBA 2Q76B 2UZIH 3LXBA 2OK0H 4J1UB 4LT7A 5CWSA 4YMPA 4Z7OB 1XIWD 5MP6L 3T8XA 4KI1A 2NRDA 3MACL 1B0GB 5DUBB 1QSEA 1QUNA 5A7EA 1JRHL 2NNRA 1WWWX 3IFLL 2EDTA 1OB1B 4X4ZA 3VH8G 4MLSA 1D6EB 1WC7A 4JGJA 4I2XE 3HPLA 4UDUB 5H94B 3CHXA 2HA1A 1MCPL 3G5ZB 4OCSL 4GG6A 4YNYA 3F7YB 3MCLH 1P84K 1MVFA 4U1JA 3BZFA 3FB8A 5HHMB 4F8PA 4Y4KD 1JVKA 4XAWH 2RB8A 2FX9H 1B9KA 5GJSL 5SWQB 3I02A 4FE9A 3WFCL 2BNQE 4NUPA 1YLBB 3QDAA 5LBSA 2DIJA 5FUOH 1I1AC 4IW4C 3Q3GB 5E6ZA 4LVOC 3P30H 3ULAB 5KVEH 3S96A 1QR1A 3MLYL 4O02A 4AYGA 2CKBA 2EYSB 5DUPL 4BZ1L 3EO1B 4PJEB 1N7MH 1TTAA 1O6SA 1SLXA 3L3KB 4UTAA 5ETUB 1R9FA 2ZSWA 4NNYA 2DLTA 1PJ9A 1YVLA 3CFUA 3MLVL 4ISVB 3ZO0A 5J6HB 2EDJA 2JJSA 1KYDA 1MAMH 5KVDL 5JHAA 2E7BA 4HIEB 3STBA 3AU1A 4LHUG 4XVUD 1WBXA 2R2BB 5B39G 3MGOA 3FU3A 4M5ZH 3S7GA 1ZS8B 2Q5BA 4BSWB 3W0WB 2BW4A 2YAQA 2JIXA 3G08A 4HPYL 3U9PH 3DRQB 3CXDL 4XO3A 2DLEA 1ZSDA 3MV8E 3BPLB 4JCWA 4AITA 2I69A 1NAKL 1F5WA 2EXSA 5JO5A 5FGCB 4BDVA 2KZ1B 2V17H 4PRPD 3S8FB 1M57B 3GRWH 4YS4A 4PHZA 3LQZA 3ZE1F 4L4JA 5DD6B 1CMOA 1B2YA 2XETA 3C6EA 5LBSH 3HRZB 1NCOA 1QNZL 2AQTA 3QUZB 4JDZB 4KK5D 4MQTB 1C7TA 3HPJB 1AGCB 3NQIA 2HTKC 4PRPE 1RZIB 1SJEB 2J57A 4OZGA 1O9VA 3OWEA 5GQBA 3DO4A 1G5AA 1F4XL 1RSYA 1ZWIA 1QLFA 3GB7B 1IGFH 4JUSA 5DWUH 1JNLH 1IEAB 4U7MA 2VXTL 2FWUA 2Z8WC 5J0BA 2ZNWA 3HZVB 4JFYB 3D4YA 4XP5L 2AK4A 3OJMB 5I75B 4JFDB 4B50A 2UZYA 1CFVL 1I9RL 3IFPA 1YJDC 3PWLA 2COQA 3KG5A 4OLXH 3T2NL 5IW6A 4X2UA 1WT5A 1I1YA 3I9GH 3NA4A 4KITB 1XHHA 3RDTD 1J8SA 5C9JB 2HXAA 2OMWA 5TGBB 1H6UA 4I5BB 4U4BA 1WFMA 4I0KA 3LQAC 5DJDA 3D18B 3VD7A 3RL1B 1OCWH 1Y0LB 4JO2L 2YPLB 1OPOA 5H37H 5DJAA 3EJZD 1H5BA 4LVNB 1QQDA 2UWEF 1AIFA 5D55A 1RULH 3ZE2E 2WHVA 1FFNB 1T4WA 2Z92A 1IJNA 2GITB 1HHHB 1YJDL 3PL6D 3L3GA 3PNWB 1HWGB 4YLBA 4HS6A 3UAFA 3P9WB 3BH8B 1Q94A 4HA1A 5GSVA 3HEIB 1XIWB 1NKGA 4RESB 4WV1A 3LQAL 3G6JE 1B3JA 4Y4HA 4KXZH 4ZOEA 1TTFA 4GAJH 4I2XB 3FOMB 3QIUD 3IBOA 1A7PL 2IALA 2VQ1B 3FQTB 2NYYD 3BMVA 2AJXL 3WAJA 3KPOB 4FA8A 3P73A 2P5ED 5ECGA 1BOGA 1KB5L 1ZTXL 4M4RA 1JYNA 2X7LA 1DO5A 2J43A 3QORD 3EYOA 2NSQA 1YN6A 1HJBC 3V8OA 2BNQB 1UA6L 3UZEA 1LMKA 4MD4B 3V8CA 5L8KB 1I85C 4L18A 4E9VA 3KLQA 1HILA 3U79A 4AJ0A 4KY1H 1WYJA 3RGVC 2WN3A 2EC9T 2R9HC 4LIQL 4BH8A 3BD4A 5KG9B 3ULUD 4M7JH 3PWNB 1DTUA 4NWTL 1PNCA 2PYEA 2HB0A 5IBLD 5IHUH 3ULVE 4Y5YB 3SY0B 2VRAA 4J3OF 4CW1A 1A7OH 1JZHA 3COOA 3WXVH 3L9RB 5I6LA 3ULUE 3L5HA 2IGTA 4CMMB 5IZ7A 4WHYG 2F1BA 5IESH 4X5LA 2ISDA 2Q3AA 1XH3B 3U7WL 3MZGB 1NC4D 2R4RL 1TQCB 1WH0A 2B1AH 1TZ8A 2NY5H 4OFYD 4WCYL 2ERJC 5CJ8A 2ZWNA 5AL0A 2KQMA 4NN7C 4JAMA 3MV8B 1SFDA 2LOEA 3RIFK 2QGDA 1AD0A 3MC0A 4ANVA 5ICZB 1OAJA 1EJOH 2ZYHA 5HJGA 4Y89A 3A67L 3EH1A 5DVOA 2VLME 4NO5B 5A2KH 3VNZA 4EVNB 4KKLC 2GIYA 3DLQR 4NP4H 4PRPB 2Q3ZA 3QZNA 5GSRB 3RU8H 4KFMA 3KPRA 2H5UA 4Y9CA 3U36A 5ACZB 5I5JA 1XSIA 1AZUA 4XPHH 2OYLA 1O9WA 5C0FA 2X40A 4AL8C 1NCWH 1YYLL 5E8OA 3PJSB 5EU4B 5BXFB 1KBBA 5K59F 4Q9QH 1OZUA 2HFFB 1JZGA 1PZUB 3SSGA 3KXFA 3K0WA 4PP1C 4YDKH 3P3TA 3NG5A 4FL4B 4X6DE 4XZUA 3FO2A 4WU7A 4LNRA 1FSKC 3T09A 2JLPA 3ARQA 4P9ML 3D3VA 5G5DA 3T0VA 3P4NA 4JZNA 1BVKA 4HPHA 1BQLL 3RDTB 4O2FA 1TSHA 2H0EA 1PGRB 1SDYA 4BQ8A 3Q2WA 1E28A 1DCLA 3QDGB 4AJYV 4FTDA 4LL4A 4MDRA 1N6QL 4AQOA 2GK0B 3ZE2B 1XCTB 3KL3A 3N1MC 4I77H 4AL8L 3T65B 1VGKA 4L05A 3EOTL 3BRFA 4F27A 1MLBA 1B9ZA 1NCBL 4ANXA 1JCKA 3RWFB 3O11A 3UGXA 3O0RH 1NMBH 1LEGB 2EEBA 2JSFA 4LLYA 3FONB 3Q6GL 4KKBC 4LPCA 3WCYA 3PL6B 4APXB 3VAEA 4G82A 4GYBA 3G6JB 5FOJA 1NBVL 1W8NA 3V0JA 5C9KA 5DTFA 4C58B 2WP3T 1LEKB 4ABQA 1L3NA 5E23A 5I17B 1CYGA 1AXTL 2Z7UA 3MX0B 4M6MH 3ZSSA 3DJ9A 5FK9A 3SZKC 4ZDHA 3QIUB 4OFIA 1QATA 3ISYA 1P0SE 3AU0A 3QNZB 4Y1AD 5GS2H 4BD4A 3FCSB 2BK8A 2P48B 43C9A 1J05B 3L3DB 2HX9A 1D9KB 2MTPA 1WPCA 5D1ZI 1MI5A 1OP5K 1FPTH 4QJ4B 4M8QB 1NWOA 4HWZA 2NNCA 2OR7A 4U0RC 3CLWA 2N4IA 4N3TA 5I66A 3AXIA 4N0UA 5CEYA 4CSZA 4YL4A 2AZAA 3KNBB 5LGHL 2YD7A 1A3RH 4UT9A 1X6LA 3HKZA 3TNMB 2YFNA 1A6AB 4UT7L 5JPMB 4O58L 1XR8B 2DJSA 1AOZA 3ROOA 2LU4A 1DEEA 3QUYC 3GMOB 3TT3H 5EBMB 3RFZC 4N0RA 1O7DE 1MFCL 1OW0C 3LH9A 1JZ4A 3C08L 3M8OH 1L0QA 4UOW1 1NC4B 3JZ7A 2HAZA 3PF2A 1L9NA 1W0VB 1G7PA 2NUPB 3VFWA 2ED8A 2ZSVB 4J8RA 1NPUA 1L7IH 1XAKA 2WUCH 1MF2H 5INCB 4H8WH 4GQRA 3WU1A 2R0KH 3QUMA 5ISZD 3OWRA 1NIDA 4I18A 1TQBC 4NN6B 4QTHA 5J6GB 3MRNA 4WNSA 1G7MA 1T7XA 4JM2A 3RVWC 3NABL 1X5MA 3QZLA 1U8OB 3US9A 2ICCA 5ADOL 5EC1B 2HYMA 3A23A 5ISZE 1DN2A 3BP4A 2EDWA 3HR6A 3MXWL 1QACA 2AJZA 5JXED 3JZYA 4FXTA 3E6FB 3IJ7A 4I89A 4B7IA 4NGHH 5E08H 1CUOA 1LNUB 2DTMH 1FNEA 4FD0A 4M9OA 4MAUH 3U0TB 1GGUA 3QHTC 1TJMA 4JFXB 1BMZA 4PVBA 3H6JA 4X6DB 1BFVL 1CLCA 1F8TL 1JWUB 4APQC 3ALWA 2AMUA 1F3DJ 4HX1A 4S1RL 3MJWA 4A7GF 2X0WA 4HWEH 1DL7H 1DBJL 4GUQA 2H1LM 1M7IB 3OKOA 4HBQA 5DJ0B 2BOLA 1NBZB 4NO3B 2OS7A 3TO2B 3QPXH 1BJ8A 5EZLA 4N2BA 5I74B 4IGBD 4WI4A 3UTPD 3U4EA 3BKJL 4P2QD 3HAEA 1N64H 3QUMH 4ELMA 2UX6A 2C3VA 1EHKB 4A6YA 5KBLA 1UCBL 4TV3A 3K4DA 4Q9RL 5DDHB 1A6VL 2C8NA 2VCOA 3UTPE 4J8QA 2EILB 4P2QE 3RWDB 4NYLB 4CSPA 2HT2D 4IBZA 15C8H 3IXTA 1Q1JH 1AJ7L 2IPTH 3MU3A 4MXVE 4MAYD 3SE3A 4R5TA 3L7FB 1I8UA 4RX4D 4AENA 4DP2X 2JJVA 1QRNE 4CUCA 1IC0A 2F19H 2ZT9C 3VQLA 2OJEA 4QUOA 4FQIL 2EDYA 3AQDA 4NUQA 5DRXB 1J5OH 4F8NA 1KTKE 3K6DA 4QHUA 4JNXA 3B7SA 1JK8B 1OT1A 3D39A 5IV2B 4B53A 2PXYC 2E9WA 3D87B 1A6UL 1A6ZA 1OQOA 4ZD3L 4A7SA 1QYGH 4MCZB 4OQTA 2JI3A 4ZQTA 1CDHA 1JZ7A 3BWUC 1IL1B 4CADB 1I8IB 3FPXA 3MCKA 4ZS6D 4LF3B 4GAFB 1Y18A 4Z0BL 4EUPG 5DMIH 1CGSH 2MIZA 3VB9A 1GGYA 3QWRD 3HI1B 4KRMB 1RFDH 4A6YH 5BPPA 3SO3B 1JJUA 1U8MB 4UINL 3BP5A 4DHLA 5EIVA 4LFHG 3LN9A 5DK3A 1T5WB 4MWFA 3S2AA 4XVJH 3O8XD 4ZI8A 2OSYA 2EH7H 3QUKB 4NZTH 4M7KH 4DO6A 5I8EA 3BUDA 5AWNH 2OMUB 4JO4H 5AZ2H 1NPJA 2XQ0A 3B3IA 3BDYL 1E8XA 4POZD 5FEBA 3RWGA 3GBDA 1N5AA 1SYSB 4RWHA 2B15A 3TBWA 2D7TL 3TS8A 3KWXA 4NI3A 4BZ1A 5MP6H 1QBLL 4ODUB 1KTCA 2R23B 1MOEA 2EEAA 4E5XA 1KLFB 3MACH 1PVHA 3MUUA 4LEOB 2RR3A 1U8NA 2MRYA 5BOZG 3O41B 3V4PB 3CXHK 4GQQA 1JRHH 2ZYRA 3IFLH 3GSUA 4P3CL 1AGEA 1OF2A 1KN4L 2X2YA 2ZUYA 2E6JA 1GW6A 4XXCA 4YHNA 3CN4A 3D4ZA 3SD5A 4JGNA 1MCPH 4H8PA 4OCSH 2Y0SA 3GSQB 3PHAA 4LCIL 4D9QE 5ISZB 1I1AA 1SZNA 3L5XL 3B2PA 3MJ7B 4F33A 5GPRA 3TBVB 1SXZA 3EJSA 3VFOB 4Y1SA 2X4UB 2CO6A 5GJSH 1WA0X 4L29A 4U3CA 3WFCH 1TJIL 3GSXB 5AAMA 4PAZA 3EBHA 2IAMC 4OTXL 1VIWA 4LGSB 4HZAA 1HWWA 3MLYH 3GC3A 5DUPH 4BZ1H 2ZOLA 5BV7B 2YKLL 5F1OB 3D85B 2MPAL 4YSEA 3OKKA 3SHSA 3MLVH 3L5WA 1MCKA 3SIKA 3KLDA 3M1BA 1OARL 3WDIA 1WA1X 5KVDH 2CO2A 2LVEA 2YN5A 4OM0L 2X0UA 1CLYH 3RWEA 5SX4I 1ZHNA 2Q6WB 4IRZL 4IGBB 2CRMA 3PXLA 2GYSA 4JHAL 5KVFE 4BRJA 5MEOA 2GI7A 4HS3B 3AZUA 3SE8L 4YHPB 1WVZA 2HH0H 3CXDH 4ZX4A 1P1ZA 4MMYB 1NAKH 3MYZA 4X6CF 4LCUB 2KBGA 1H3UA 5KW9L 3IJSB 5HYSG 3VGAC 1PBYA 1QRNB 1Q9KB 2KLRA 3HG3A 5D1XD 1QNZH 1HH9A 4MSWA 3A3YB 2JTDA 1ESOA 3FT3B 5IBTL 3MRMB 5IBUG 3SCMA 5K9QI 2HUEA 1JYWA 1F4XH 2PP7A 4PD4K 4Y19D 2CLVB 4GFTB 5AOMA 2VXTH 1BVNT 2XT1B 3E1ZA 1AQDB 4MCMA 4YDIL 3R7RA 1JXFA 5JIPA 1EHAA 1KJ3L 2DRUA 2JXMA 4XP5H 3QFDA 3MKGA 3KPQA 3UPAA 3DGGB 1I9RH 1CFVH 2R2EB 4N8VB 4OZ4A 2ZTBA 3SKMA 3ZIMA 4LARL 2DBLL 2V9RA 2L0DA 3S35X 3VXRA 2IOIA 2QPFA 3GO1L 1O6VA 3D9AL 1SYVA 1QSED 4G6ML 3S4SA 1BM3L 1VF5C 5HI5C 3EOAA 4HF5L 3MRKA 4JO2H 2E4TA 3ZHLA 1H15A 1HK6A 4AQ8C 2APXA 5I9QC 1QSEE 2FDBP 5DZVA 3QQ4B 3KAAA 4JHZA 4LDOB 4MDJB 4PLOB 3O6ML 2OL3A 3JWOC 1MVYA 5ACMA 3BUQA 5T5FA 2BRRL 2RHEA 2X1QA 2YGPA 3QIWC 1GCYA 1SMDA 2Z4TA 1YJDH 4GG6E 1LXMA 1R5IA 1JOIA 2K9FB 3FMGL 4ZQKB 1TZIA 4R7LA 1XMEB 4CKVX 4PJFF 1S7RA 4HV8A 3LQAH 3EF4A 4Y4FA 2R1WA 2XN0A 3ISRA 5IB4A 3MXVL 4BKLB 1GGCH 3OMZA 3VFSB 5KANI 3N0AA 2PO6A 1A7PH 2XBZA 3QG7L 1U3HB 1E6JL 1IQDB 2AJXH 1CFQB 1HZHL 3RBSA 2BSRB 1MRDL 3JWOL 1I85A 1KB5H 1ZTXH 3MNZA 5T3XD 2H6PA 3BD5A 3TH4T 2PCPB 3RGVA 4OUOA 4DGUA 3DMMC 3LRSA 4JFUA 4FXKB 4QLWA 1AO7A 1UA6H 4X5XA 3AW5A 4JY4A 4NPJA 4PREA 2J5WA 1UB5A 2FTAA 1P6WA 1QBBA 1TU2A 2H3NB 2JIXD 3G3LA 3DNKA 4K9JA 4W9GC 2G3ZA 3AQYA 3GSOB 3L4UA 4H0LC 3RFRA 4P4KC 3BVTA 4G8EA 4LIQH 2K1MA 4JB9L 4PJDA 1X5AA 4N28A 4NWTH 2Z3FA 4MGXA 2YK1L 4JCMA 1TXKA 4OFDA 4LLUA 4DEPC 2APSA 3U9UA 1XF3A 3GHEL 4OF0A 5CP7A 1HSAA 1EO7A 3F3HA 4I1RA 4K8RC 2PN5A 5JW5A 3EJUA 1N6VA 3UTSD 1OXYA 3U7WH 2WAQA 4PB9L 3LPWA 2R4RH 2ZG3A 4OZGE 4WCYH 4HSQA 4F5CA 4OD2B 1TO5A 2AK4D 4X7EC 5D7JC 2Q87A 1YY8A 4F3FB 1JGLL 3U4BL 1BIIA 2BCMA 3NRQA 3SKUD 5AFAA 2VQTA 3PHQB 4XGZB 4U3SA 2ZCHL 3A67H 4KH9A 2AK4E 2MH4A 3Q1SL 1AACA 2RFXA 3MRBA 5CJXC 2DV6A 3BZEB 2OW6A 3AUWB 3CFKB 4L8SC 5JLZA 3K74B 5K1NA 1CFBA 1F45A 1IRAY 1T1YB 2DI9A 2PETA 5AKRA 4G8FB 5F1SA 3T6WA 4A38A 4K8RL 3FQ2A 2KLTA 2VR9A 4R26L 1KXHA 4H25B 2CBOA 2W65A 1YYLH 3VMOA 5C0JA 4OZFH 4IOSA 2QSVA 1A66A 4IU3B 2EDLA 2FWOA 1OCZB 3WY3A 1TJHL 3BZ5A 3D51A 3NZ8B 3KE0A 2WVSA 4HKBB 3GF8A 4W9JC 4P9MH