1NCIA

Structural basis of cell-cell adhesion by cadherins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
GSDWVIPPINLPENSRGPFPQELVRIRSGRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords N-CADHERIN
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nciA00
2EE0A 2OMYB 3K5SA 3MVSA 2OMUB 4AK1A 2OMXB 1NCHA 4NUMA 4XXWA 2X2UA 2YSTA 3LNIA 4NUQA 1NCGA 4ZMPA 1NCJA 3LNEA 3LNHA 1WUZA 3QRBA 2YQGA 2O72A 2WHVA 4AQ8A 4AQAA 1EDHA 4XXWC 2WCPA 4AQEA 2OMWB 1O6SB 4AQAB 1ZVNA 1Q1PA 1SUHA 5DZVA 4AQEB 3Q2NA 3LNGA 1ZXKA 4ZMTA 4QD2E 1L3WA 4APXB 3LNDA 5CO1A 4NQQA 3FF8A 4AQ8C 1WYJA 4ZMLA 4ZMOA 5CZRA 3Q2VA 4NUPA 2OMTB 4AXWB 4APXA 4ZT1A 1OP4A 2A4CA 3UBHA 4ZMQA 5KJ4A 2OMVB 4ZTEA 1NCIA 3Q2LA 2WD0A 2A4EA 3K6DA 3K6IA 4ZMVA 4AXWA 2QVIA 2OMZB 3Q2WA 2V37A 4ZMXA 4OY9A 3UBFA 4ZI8A 3K6FA 3UBGA 3FF7A 3PPEA 3K5RA 1FF5A 4ZMWA 4ZMZA 5JYLA 2WBXA 5JYMA 2QVFB 4ZMYA 3LNFA 4ZMNA
chains in the Genus database with same CATH superfamily
3ETSA 3MVSA 3QWRA 2OSLA 1KXTB 4DK6A 4Z0XB 2WTRB 3S88L 5CIPA 2GIMA 4UOZA 4UQ3B 2J6EA 4TKWA 4JFOA 2WK2A 3IDXL 3MV7E 4OGZA 4DESA 1AHMA 2AV7A 1RFDL 2R2CA 5EHFA 1PTZA 3K0WA 4LRNL 4XC1L 2NQDA 3WHXA 4GAJH 4XHJC 1T7YA 1BLNA 1J8HB 2V5TA 5E8NB 2O72A 3B7TA 3VXRB 3K4ZA 3LIZA 3MRPB 5CBEA 5AVVB 2CCLA 4KXAA 3RL2B 4NJ9L 3SDXA 4F2EA 1NJ9A 25C8H 3ORJA 2E6PA 4H0LC 4UTAL 1KSRA 2FX9L 1CB4A 3H55A 4N0UE 1XMWA 4PSPA 5HI4C 4IOFD 2R0LH 5AW0B 4XMPH 4EUPH 3RDTD 3QO0B 2GJJA 5AKTA 1OT4A 4DERA 5JIMA 3J27A 5JR1L 1U8OA 5BV7H 3VXMA 3WE6B 1HL4A 3TPUA 3WOVA 5C9KA 4GAAA 4JM0A 4CC4A 5FUOL 1FZJB 4X6CF 2WWKT 3BEWA 4G9FB 4JO2L 1QVOB 5HVHB 4AIZB 5I76A 4JFSA 3FRPA 1W72A 5L9DH 2NZIA 3OAYH 5DMGC 1S7VB 2BSED 1P7KA 5E08L 2V2WB 1FH2A 1MREH 1VFMA 3VX0A 3MFFB 5BUGA 1YECH 5I6KA 3UZVA 5KAQF 4Y2OA 3O6FA 5AUMB 1ZLEA 2CIIA 4WNQB 1DFBL 4HS6A 1EEUA 1KLUB 4PP2A 2J72A 2HVKA 4MAYD 1N10A 2YD8A 4AMKL 4TV3A 1N18A 3E0GA 3G5YA 5E8DH 3RA7H 1HILB 3LY6A 2P47B 4OD1L 2TSAA 1Q9OA 1OCWL 3L7FB 3EJSA 3AU1A 3CGTA 1X5JA 4Y19B 4LSRH 1T89A 3ZE0B 3HE7C 1HHGB 5B39A 5EO0A 4L1SA 5K1VA 2RALA 3D9AH 1IL1B 3VFUA 4FNRA 3T3MF 3ZT6A 4BINA 3TCLB 4HQQH 3QO1A 3S34H 5EOTB 2YIHA 5J6HA 1YMMD 2JJTA 3HE6C 4P4KD 5DMJB 4WTZG 1ULVA 3OR7B 4J2QA 3I9PA 1AZRA 4DCQB 2A6IB 2DEYX 1WCBA 1SJVA 2B7DT 2QFRA 1A3QA 1BYPA 1KB5L 1YC8A 2FIKA 1EH9A 5F89A 4OGAC 4O5LL 1S2EA 5GGSY 4BXVA 1OF0A 1Z5LB 4A2GA 4IKJA 4BZ1L 3KYKH 4XBMA 1JHLH 3L3DA 3WD5L 3RGVD 5LCVA 3SGEI 5LGJA 4CSTA 1QTPA 4XP1L 1HQ4B 3QCUH 4P5TC 1S7WB 1AD0A 3IXAB 1FNSH 4TMPA 2AITA 1NPUA 4N9GB 2WZAA 3MRFA 4KRLB 4BZ2H 3QI9D 1DBAL 5E6RB 3MO1B 5I28A 1U4FA 2MSPA 2VRQA 1BZDA 3H2QA 3LKPA 3U4AA 2VR4A 3V4LA 5D7JA 5KVGL 3OPZL 5MEQA 3FN0L 3GMQB 4DOHE 4LQFL 1RZKC 4P9HC 1KGWA 3CVHA 3EAKA 1F58L 5H4ZA 1AZUA 2VXQH 4BHUI 3QDGD 4PTUB 4EZJA 2IBZX 4AGLA 2WLHA 2B8OT 4PV9A 3JTTB 2J8UF 1CS6A 1FFTB 4X9BA 4UU9A 2QZQA 4DN4L 4BK5C 4HZAA 1S9XB 1RJZA 3EBIA 1F4YH 1CGVA 1NFIB 1ZEAL 3E1F1 2A4CA 3H9HB 4PYHA 5CLXA 4ZFQA 1ACXA 4AYGA 3O8XD 8PAZA 1WAAE 2G4GA 4I85A 1I8LC 2DI9A 5DJAA 1HQRB 2DM3A 1AJ7L 1JFHA 4DHLA 1ZAGA 3ES6A 1AQMA 1SOXA 2CGYA 1NCDH 4ODWA 1T80A 1XB3A 2EE3A 4K0OA 1CQKA 4L9LC 1W6WA 1P4LA 1CXKA 4OM0H 3V6OC 3FT3A 1OALA 5TF1L 2CO3A 3RWEA 4FABH 4TYUA 1JPSH 2FNWA 3K5RA 5TDPB 1E7VA 1XIWD 4EVNB 4LVHC 4M7LL 2R0ZH 3SGKA 4E9QA 1M1SA 2ZX8A 3N2JA 4JZNB 4BJLA 3E8VA 5F3BB 1BD2A 2J5WA 4XBEH 1EUTA 5MERB 4WV1B 2XFGB 1SNRA 1K85A 3KWWA 5L0QB 1C7TA 3ECBA 1BEYH 5I5IA 3DROA 5ACZA 3BH9A 1E27B 2N1KA 3NZHH 1NCHA 4OJEH 2EDRA 4GMSL 2B59B 3RX9A 1RJLB 4AEEA 1PY9A 1A64A 3U30C 3QCTL 4J3OF 1CLVA 5DMIH 1W8EA 4NRZA 3I2CL 1XF3B 4R97B 1OF2A 2AXFA 4PIBA 2FLBT 2YD2A 5DRNB 1EZVY 2FX7L 2E3VA 4AJVA 5AG8A 3DJSA 3IRPX 4PW3A 1IQWH 4HETA 4GSDL 1RP9A 1Z0NA 2LLNA 1MCQA 3OLEA 4E41E 5BNXD 3T0WA 5CINL 2DL2A 1NOAA 3BT0A 4KI5E 4N8PA 4UTCA 2IMNA 2P52A 3JZYA 4K3HA 1F4WH 1ZHNA 5F21B 1K4DA 4PLOB 1E0OB 4WK0B 3VI3A 4PG9A 1AXSB 4F8LA 4JM2F 3O11B 2QELA 1XSKA 2IGLA 3L3GB 2XWDA 4GXUN 4KMLB 5CLZA 1A9EA 3VVWA 1IM9B 4V1DA 1JGVH 4HIIA 4PJBB 2BWQA 2AXGA 2BWDA 1LDSA 1Z1WA 4YBQC 2HLFC 3GBNL 3U9WA 2AI0H 4BKLA 5GS0L 1SHMA 3MOBL 3FU7A 1HEZB 3BPCB 3BDYL 1R3JA 1QFWM 2GI0A 4Q9RL 5DC9B 2VXTH 3V52L 3BWAA 4PRPA 1XQ4A 3GJEB 1CLCA 1EGJH 3RAJH 3ZDZF 1GZPB 4WO4A 2PO6A 5ISZB 1OWWA 4X6FA 5DHYA 1RVFL 5DT1L 3NN8A 3QUXD 4JPWH 3DIFA 3QORB 3RBGA 1SBSH 1ZT4A 5T33L 1EFQA 3PWJB 3AXLA 4JFFE 2DLFL 1RZKH 4P5KA 4AEHH 1MRDL 1ZIBA 1DBKL 4JY5H 1YNTB 4I3SH 5DK0B 1AZCA 2BCMA 5EN2A 5T3XH 3NT0A 3V4PH 3TN0A 3NFSL 2EDEA 1D5BA 4JDZB 3A6OA 3F64A 4GINA 3VRLE 1II4E 1TTBA 1BOGA 3JV6A 2XZQH 3GBMH 5HDWA 1QQDA 4HH8A 1TFPA 4QJ3B 2CHZA 1NGPL 5B38B 1CFSB 1I1AC 2Y1YA 3QXAA 2BSRA 3OF6A 4G3YL 2DM2A 4HU2A 3AUVA 3IGFA 5CEYB 4C59B 2ARJB 1T1WA 2BFVL 4HXBL 4LLQB 6TAAA 1T7XA 3H3PL 3ZE2E 3VGAC 1DQKA 5JOFA 1GGIH 2CR3A 4QHUB 3ZHFA 4I2XA 3EF4A 1X5IA 5I15L 1N4XH 4PS4L 1FO0A 5E9DE 5T1MA 4Z8FL 2DMGA 3L4CA 5I1DB 1YYMH 2QPDB 3GRWH 4LSTL 3ULSB 5C0GB 5I1IL 4RRPM 1F3DH 1OK0A 2IAMA 3HZVB 4HC1A 1Z9MA 2AVFA 4H26B 5GISL 1Q0YH 4X6CA 2UVFA 1QO3A 5EIQA 5BO0D 1BFOB 1VADB 4JR9L 4BYHA 5F88A 2CKBL 4UINL 1FFPA 5LBSA 2P5WE 4HPOH 1MNUH 1JGUL 3D5OF 2G2RA 3FO2B 1CE6B 1K8DA 1ZA3B 2YA1A 4JANA 1DVSA 4W9HC 1K2DB 2X87A 3BAIA 4HS8H 4OZFH 2H1PH 3VSQA 2W9EH 4TQHA 5DZVA 2D9CA 5EO1B 3VXUA 4XP9L 4Z7VF 5J12C 4R8WH 3MV8A 2CZNA 3ZIYA 1A3LH 3MJ8B 1KGUA 3IFOB 1X5KA 3B8YA 3D25B 2Q2EB 2BFGA 3BFQG 4ZRGA 3T4AB 2FQEA 4U3HA 4WSKA 5GS2D 2D8KA 5SWSB 4LCWA 4CVZA 3KW7A 1ONQA 4AIXA 3CQQA 1KF9B 2CLVA 2D7TH 2UWEB 3IBOA 3T2NH 4HUCA 1CGYA 1J88A 2YAQA 4APXA 1JS4A 3EUDA 1F3JB 2A6KB 3Q5OA 2DQHH 2Z0UA 2JFCA 1UZ8B 4HWBL 4MQTB 4AZ8B 4PY8J 3MR9A 3NCBB 3MRDA 3ZE1F 4R83A 4JHWH 1G9ML 1IEBB 1OV8A 2ESVB 2XA8H 4KKBD 5KANG 5LAXB 1B88A 1MJUL 1QFWL 3K3QA 1IAII 2CMRH 2Q8BL 5T5FH 3N50A 3TT3H 3SD5A 1MWAA 4I0PC 5JIKA 4YHYB 3HZMB 2PF6A 2XACC 1EHNA 2VN7A 4NKIL 3MRMA 2A83B 4YSCA 4EAEA 3T6WA 3L3OA 5AL0A 1NFAA 1YEKH 1A6UL 3MLVH 4ORZC 4WQOA 4WU5B 4ONHA 2VDKB 3FW6A 4MJ6B 5DZ9A 4E42A 3LEYL 43C9B 2OX5B 3OQ3B 3ARFD 4F37F 1TQWA 2K45A 2VDQL 3ARGC 3P2BA 5HGBB 4Z7WF 2HT2D 3KJ6L 4L3CB 1BFSA 3AAZB 4N68A 4M6AA 2XA3A 3SGEH 3U2SA 1FDLH 3DO3A 4JB9L 2PUQT 2X2UA 3LX9A 5ANMB 2BIIA 2LVEA 4B9FA 2KH2B 1FAIL 4LESA 4M93C 1D5XA 3QHTC 1PG7L 2VDNB 3G08B 3WTSA 1N68A 4F93B 2CGRL 5DRZA 4O9HH 5F3HA 4RMUA 1YMHA 1UZ6E 2G30A 5CS7A 5TE7L 4JAMA 2PW1B 5FGRA 5F3FA 2DH3A 5D7IE 3V5HB 4I4WA 1B4JL 4U1HA 2IOMA 3HG3A 1S7QB 1HOEA 3DLQR 1KTDB 4JO1L 3GK8L 4PGZA 3Q8FA 1EEYA 1TTAA 5DMKA 3FQWA 4UQCA 4AQAA 4B53A 3P2DA 1LO2L 3ZHKA 4GRWH 1FC1A 4HJ0D 3H2PA 1BX2A 2LU5A 1QPKA 3WNNA 2NCMA 5JTWA 4P2QE 3NCYS 1SYSB 3QZWB 5ERWB 2J8UA 1MHPH 1ZVSA 3HMWL 2X9XA 3B3BA 1AIFA 4PJ5B 1F3RB 4BSWB 2VDLL 2R2HB 3AS3A 2V3DA 2OQJB 4FXGC 1R19A 4PB9H 4HIXL 5D1ZI 1M6OB 3EYVB 2DH2A 1F6AA 3MLTB 4OSUH 3C60C 4A55A 4JX0A 2ZJSH 2PPFA 4KV5F 4LCUB 1W0VA 5AVWB 3BGFC 4K94C 3LSOB 5AAWA 1A4JB 4PVMA 1ZLVH 4X83A 1F4XH 3GMNA 4FQXD 1R3IH 2R2EA 5JHDB 1KN2L 1AGEB 1OSZA 4NQVA 2V8MA 4AKPA 4ZUUA 1KIRB 2AJZB 1WHPA 3HC4H 4FI7A 4WEMB 1U8LB 3V0DA 3AREC 3V4VL 3CPLA 1PG7W 3GMLB 4Z3EA 3QWOB 2F53A 3TO4B 1AO7E 2OS7A 5A2FA 5J11B 2DQCL 4QHKJ 3N85L 4KVCH 4HFWB 5KUKA 1CU4H 4ADGA 5JNYB 1FV1B 3PL6A 2V3EA 2A3TA 4LLMB 4N2EA 3DTXB 4JDVB 5GSRB 3SCMC 3G5XB 3HI5H 4ELKB 1KGXA 2WBJC 1ND0B 5DSCA 7TAAA 1GJIA 1NA8A 5BUPA 3HG0A 4OUUB 5F8RC 4P2RB 4ALAL 1BEXA 2SODB 4AVIA 3ZGHA 2Y3NA 3ULVL 2J1WA 2FJFA 1NGWA 5DA4A 3WIHA 3IF1B 3LXAA 5BVPH 3NCMA 1LEIB 1ILSA 1AG6A 1EMTH 3LV3B 3AXHA 2ADFH 4NN5B 4E0RB 1U3JA 5JYLA 3LKSA 1HWHB 2WBXA 4OQTL 1F1DA 5JA8B 3VFGL 4FA6A 1J18A 2W8CA 1KENL 3HAEH 1MN4A 5FM4A 1U30A 1QNIA 5DFWH 3KBPA 1KWKA 2OJ1A 1CZ8L 3LEVH 3BQUC 1BZQK 4UIMB 1WP6A 2ERJC 3ZT5A 4NEHB 2NT1A 2B1OA 3GNMH 5HDBF 3RWIA 2VRKA 1IGMH 4XOAA 2NTFA 2FJSA 5LQBL 2NW3A 1KV7A 3QJVB 5IWLA 1WIUA 2BSSB 2VR3A 4H2CA 1GOGA 5I6LA 4MJ5A 4RWYL 1TU2B 1AGFA 2ADYA 3PJLA 2A74C 2YSTA 1JNHA 3JYCA 5SV4A 2O93L 1NCGA 1I9JL 4JM2A 5LG6A 2VQ1B 3PXJA 4FQQB 3LRSA 4NGHH 2MRYA 1OGAB 3RPIA 4WHTB 1MWOA 1PX8A 1QG3A 1UJ3B 1T1YB 4FTVE 1PZUB 4ZTOH 3MRHA 4JQXA 3SY6A 5DLMH 3THMH 4WUUE 1XGUA 3MYJB 1AP2B 3Q8EA 1RZ7L 4UUJB 4LLWB 1A5FL 3P77A 15C8H 4LNRB 4FMVA 1O5DT 3HS0C 4IDJH 5D1QA 4LAQH 5IKCB 1NCWL 5IQLA 1ML0A 3QDJD 1TKWA 5HHNB 2B0SL 3T1WA 1FL6A 1RIHH 4FOMA 4GW5B 3P9WB 3N44F 4Y4FC 3BPNB 4PJHF 1G6RL 1OLZA 3A23A 3KWVA 3UDWA 4LOEA 4G42B 2L04A 2NSXA 3MC0A 3K2IA 3SDAB 2CLZA 3TONA 5HHQB 4MWFB 3ZBMA 4KO6A 3V4PB 1PKQB 2FCBA 3SO3B 5T1KB 1CD1A 2F15A 5D5MF 3QFJD 2VLMD 5IBTH 2X5PA 3JXAA 5HGAB 5IESH 1CFBA 4ZS6D 4R7NB 2EH7L 1IILE 2JIXB 3GZQA 1JWUA 3D39A 1GJWA 2VXSH 2ZF9A 4XNMB 1TJGH 1K9TA 2GBVA 4G8EA 3WY1A 3ZO9A 1M7DB 2NY0D 3HG1A 1PZ5B 2J21A 1BQKA 2XG4A 4JFZH 4X9FA 2IH3B 4XWGH 3X11A 4I18B 1T1ZA 2BIPA 1ZGLM 4BFIA 3KPRB 1XR9B 4LDEB 3ZL2A 1NL0L 1HZLA 3L5JA 2WZ5A 4XZUA 3QYMA 3ZKNC 2BZDA 4AYFA 3DX7A 1DQML 4ZQKB 3VFVB 3TNNA 1RIUH 1I53A 4DK5A 4DEPB 2NXZD 4FQ2H 4PGEA 3OGCB 5GRXG 4Y9BA 4NO2B 4QNPE 3B9KD 2ZAHA 4K94H 3WNPA 4P23C 1G7MB 3O6LH 3IDNB 1IBHA 4OCRL 4DOHB 4GMTH 3FONA 4I7ZC 4PP1C 1SXCA 1XZ0A 2XBTA 1MI5D 3E1ZA 5D1ZC 4LZKA 4S0TD 1E9OB 3IAGC 1KPUA 3J8F7 2NX5B 1ZD6A 4O51A 4YFEA 4D7BA 3KL5A 3SOTA 4F7PB 4YSPA 3ABMB 4HYTB 4Y5VC 2FZ3A 4M5ZL 3KDMA 1W15A 3ULVE 4QGYA 3ARDC 5EU6B 1BZ8A 4QRRA 2FYVA 1ZHKB 2TRYA 5FX3A 4XXDA 3WAJA 4IRSC 3UPRA 3QAZC 3GHBL 4NWTL 1KCLA 3ZYJA 2P24B 2CA4A 4Z7NF 3QDMB 4LGRB 5FFGA 2K6YA 3LMJH 3WNKA 4PJDF 4LCCA 1NEZA 1OWRM 5D7LB 4L1TA 4APQA 3T6QC 4OZGE 1N9PA 4WTZA 4PJ7B 3ZZLA 4AEFA 5C9JB 1ZJAA 4Z7VA 5AENA 3L9BA 3U6XS 2VE6B 2XN9D 1VPOL 3X3GH 1TTRA 5HJ3A 2YPLD 3K6NA 3MV9D 2KLSA 3TZVC 3MGOB 1USQA 2B4CC 4PJIE 3NJJA 2KLRA 4AYMC 2P48B 1OOWA 2YAPA 1ADQA 2XLLA 4L8BA 4Q4EA 2M8XA 1T66D 3IU3B 1D9KC 5IG7B 5JDSA 3WUWG 2BHUA 2QVMA 3ZDXB 4BRJA 2HT3D 5DEJA 4UT9L 1TQCC 1OAQL 3FOLA 5IB3A 3TH4T 2YA0A 2Z35B 1I75A 3NACL 3LRHA 3HBQA 4U7SA 2WZPA 1ZPUA 2VAAB 4M62L 3MUZ1 3I9IA 1QFUL 2XIIA 3I75B 1LM8V 4ZQTA 3E2HB 5ICUA 1VHPA 3EYSH 4MQXC 1IAIH 2Y1AA 2Z0BA 3DYMA 3E6FA 1S7SB 5H35B 5J13B 5DR5H 4CVXB 4R7DB 4AC2A 4KTGA 1S3KH 2BNRD 4GKSA 2Z4QB 3MNZA 4MSWB 2WQVA 1BZ7A 3FU8A 4UB0H 1MCFA 2PP8A 1HTYA 2JCWA 3L7EA 4UNIA 4XMXA 3GHEL 1CN4A 4EKXA 4Z7WA 1RUML 5LNEA 2WWMD 4ZX5A 5IROC 1FRGH 3KNBB 2W07A 3II3A 3EJYD 4WJ5A 3UBFA 5CAYB 1T5KA 3LVTA 4S1SH 3BWUC 4Z7AA 1S3RA 4PU2A 4IKLA 2CJTA 2OTWA 1IC7H 4CBZA 2WGXA 4NQUA 1R3KB 2OL3B 4NZDA 4ZX6A 1KB3A 2D3VA 2X4SA 4Y4KC 4XCFL 3BSGA 2ADIA 2VLLB 4DFHA 2ZX5A 3ROOB 4N2FA 2O5XL 3WTXA 4HV8B 1ETZB 3GSWA 5EOCL 3OXRA 4HJTA 5TGBA 3BUPA 2CJUH 3FYEB 2NY4D 3GM8A 3SKMA 2H6PA 2BWIA 3HLKA 3AQDA 3D7PA 5L4FA 3BD4A 4L8SA 3RWGA 5D7KD 3FQRB 4O02H 1Y18B 1J0IA 2VIRB 5C6TH 1OB1B 1N64H 5GGQH 3MGTA 5C0IB 2YWZA 3D85B 3HFML 1WV7T 2X05A 3C6EA 4PJFE 1VFBA 3J2PA 2UY6A 1FE8H 4HHWA 1DVFD 3J7HA 2WHVA 5IREA 3HN8A 4NHCH 2P8PB 3VWJB 3R7QA 3NFNB 3TIEB 4AQ1A 4PY7A 3QZMA 3ZSSA 3HNVH 4IGBC 3O3EB 2IADB 2NY1B 2GKIA 4KX7A 1ZSDB 4X0KA 1G7LA 1JZHA 5EEVA 2R8SL 4B9YA 3K1KC 3QHZL 3W11C 1TZAA 3GPEA 3R8BB 4K23H 3RJOA 3UMNA 5BRZB 2VW4A 5E5UB 4IIQB 4IMLB 3T0BA 1NC4B 2D7MA 1B4RA 3JWNC 3MRGB 1DDHA 3TIDB 5BXFA 2H6OA 4K07A 2JKJA 5I0XA 1CDUA 3WFCH 3NGBB 5DHEA 5FYLD 2GEEA 2E8ZA 5B1JC 3RG1C 2IXQB 1T4WA 4FJZA 3T6VA 5C0CD 1TZ8A 1M56B 1BYOA 4JY6B 4MA1C 4EZKA 2VLJB 3BUIA 1U8IB 3GKZA 2WP3O 3OMNB 5JZ7C 2Y5TA 3DGCR 2QTEA 5F9OH 3QNZB 4LEOA 2IH8A 4ETQB 3V4UL 2PXYD 2B4CH 4YL9A 1E9QB 2E7LA 2XIBA 2RQ8A 1EFXB 2O5YL 2ZXWB 4C4UA 5J6SA 2PWGA 1GGTA 3Q8CA 4C56B 1GYWA 3QH3B 3IJEA 1XF5B 1FAKT 4L1BA 4WDIA 5F0PB 4TNWF 4YQXH 3BFWA 4RNRA 3QUZC 4AM0A 5C0RL 1JHKH 1EERB 1JHTA 1Z66A 4A7VA 3FT2B 3QHFH 3U0WH 2VO5A 2RA1A 4LMQI 4F58H 4HOZA 5KYWB 3SPVB 4HG4K 3B2VL 5HPMA 1GHFH 5EO9B 1WZMA 5A16A 3BYYA 1DBBL 2X4RB 4PGCB 4JPSA 4OZIB 3C09C 3QRGL 5JIDA 2BRQA 1UVQB 1QSVA 1WAAF 2P80A 5CZXC 3D3VA 5KW9L 1JZFA 2WN3A 3OZ9H 4X8JA 4MJIA 4UCFA 4PI0A 5HHMD 2DEWX 3O2VL 3AGVA 4HBQA 1AC0A 4G83A 2QSCH 4X5WA 2DWEA 1DZBA 5FHAH 5KVMC 1SEQL 1SHXA 3MNWA 4MYWB 1M6UA 4NYLB 1F2XK 1F97A 3QQDB 5DK2A 5FOBA 1BCIA 3QULB 4GP8B 5E6ZA 2HTLD 3CH8A 1P84K 3SKOA 5I6XC 2VDML 2HKAA 2YGQA 4JGNA 1R5WA 2R29H 2CHNA 1ORQA 2CHWA 1FZMB 1HN1A 3K2KA 3LZQA 3O6MH 4N24A 3L3HB 3FU9A 4EDXB 3KLHD 1WSST 3RVXD 2EDMA 1WS7A 3TA3D 1LE9A 5F0LB 1MIMH 3ARBC 4PJHA 4AGPA 4YR6A 2XSKA 5DJ2A 1AZBA 1L4IA 3OHXA 3OXSA 4V2CB 4F8QA 1RHHA 2H0EA 4N6RA 2YHGA 3N41F 1IBFA 2D2OA 3KH4A 3MBEA 4X6DB 2K3HA 2K3TA 2V5RA 3BW9B 3TTYA 2A6JA 4Y2DB 3UTSA 5D5MA 3IB4A 2Y5EA 5E6SB 4B7LA 5DVOA 3DO7A 2NNCA 3MFGB 3T0XA 3BVNA 3S37X 4LOUD 3GINA 1XXFC 3OM3B 1KGCD 3FCSA 2WJ5A 3DOIA 3F5WA 4Y5XB 2YQ2A 5E51A 3KYKL 5ADOL 1CBVL 2CO1A 4HWUA 2DN7A 1BAGA 4OGXH 3ZRSA 4P2YA 3EFFB 4PJ8D 1BF2A 4MCYB 3S3BB 2L4OA 3QCUL 5C92A 2WANA 2B3IA 1NCAH 1FNSL 3V5KB 1NGXB 4FKEA 3C9NA 2WKGA 1AS7A 1UCBH 1V7ML 4M8RA 1YMME 4PVLA 4AUYA 4BD4A 2Y2WA 4KI5F 5LGYA 2ADJB 1FL3A 1N0XH 4O2EB 2HKFH 2YPVA 2HLEB 3UTQA 1BQLH 1L7TH 2VQUA 1F0LA 4N8UA 1LP9F 2I27N 1XGQB 4UV4L 4BCXA 1FGVH 1TO4A 4B50A 1T22A 1D6VH 1UD6A 2NXYC 4H0IA 4H1LB 3T6ZA 4C4BA 4D3CL 2OYMA 3FO1A 2AGJH 1T6VN 2X40A 4WV1C 3RVTC 5EU7C 2WLJA 5L0QC 1CCZA 4WW2C 4KJQD 4JQIL 2Z1PA 3GSUB 2AEQH 4HW6A 4WCYL 1QHPA 3FFCB 3FMGL 3I6GB 4NT6B 3QXWA 4RMVA 4XPFL 2R9HD 5HJDA 1KJ2H 3CFKA 4HX1A 4CC4C 2J73A 3S3JA 4Z77A 3QIWD 3SDDD 2HG5B 5HDRA 3VGHA 1QHQA 4GBXC 1QLRA 3ZRCC 2KHAA 3QJHB 4FHKA 1MRCL 3COOA 3EDJA 3GHPA 2VABA 3JT2A 5D8JH 3BP5A 3S4SB 3FF7A 4H8PA 1LK2B 3WDHA 4U1MA 4PJDA 2IAND 5BZDA 4F7MB 1TLKA 5J3HC 2LLLA 1E50A 1G5GA 3GMMB 4X7FC 1PLAA 4KJPC 3VQLA 5CLTA 2KZBA 4ZXBA 3HN5A 4LHUD 3GXNA 1T20B 3IXTA 4JREC 4G9DB 4ZMYA 1N2RB 1WBXA 4XP6L 3HBPA 1FIGL 2MNWA 3QDGE 1XB6A 2FJGB 3RVVD 1J5DA 5HI5C 2NY3B 1YEGH 4HT1H 3RY4A 1BVOA 3VXRD 3WFBH 3UPCA 4QHNB 2BZ7A 5F7LB 5LDUA 1LNUA 4QUOA 4E5XB 4AMWA 4EEEA 5CR8A 1CLZL 3P3TA 2Q3AA 5F7UA 4ISVA 3PXHA 5ETUA 4R5VA 4FNQA 3VRLF 2AXHA 3G5WA 2AJXL 1R46A 3OX8B 2CKNA 4G7YH 5BUAA 2ALWA 3FUHA 2YQGA 3C5JA 5F71A 3E38A 4N0UA 4GKZA 4UMGA 3SY0A 1P9MA 4FFTA 1MCSA 1P6AB 2GJ6D 3ZQ9A 3QWQB 2OR7A 3P73A 4NQCA 3GB7B 4RRPG 2OULB 5JPMC 3UL4A 4GT0A 2G9HB 4Q9BA 4X98B 2DYSB 3O3AB 4PJEB 1YQVH 2XQBH 4Z7UF 1B0GA 1Y0LA 1FIEA 2C9AA 2Z7ZA 1NDMB 1N5YL 5FB8B 4K7FB 5FYJD 3FQ1A 4ADJA 2FB4L 2NY6B 3ZHDA 4IU2A 5JORB 3NIFB 2YMTA 3ILQD 2A6DB 2X0VA 1VGKA 1C5DB 1KYFA 4NC1E 4TXVB 3EBGA 1XH3A 1EJ6A 4ZAKB 3D0AA 4Q6YA 2L7EA 3VMPA 3TFKC 3CCHB 1PZBA 1E90A 3KPMA 1A8ZA 3WDJA 1AZZC 4HHGA 1YJDH 4X7CC 4DAGL 5F1IA 3UTTB 4R4ND 3IDIB 2X0UA 5IZ7A 3GSXB 5L8KB 1K3ZA 3DI2B 3IS0X 1HDMB 5EIIG 2P5EB 4O02B 5IVOA 4A37A 3PIQB 4PAZA 2R0KH 1RUQH 1MW3A 2YJQA 3NTCL 4Y19D 3BKCL 3DKHA 4M02A 1JXKA 3FQNB 1E2ZA 1MPAL 4WUKL 5AAPA 4PJGF 4D8PB 1S78D 2DWDA 5CEZD 2XTSA 4YDIH 4P06A 2OJZH 1EANA 5F1NA 1WJ3A 2JQZA 1CFVL 4LBEA 2VERA 3MJWA 3PDOB 4UOW1 2IH9A 2OP4H 2YZ1A 4M5YL 1U2HA 3H3KA 3PXLA 3DI3B 1NBYB 4ZTPH 4A66A 1QLEH 1SBSL 3Q3GB 4HF5H 1NFKA 1F8TH 5CWSB 3DVFA 4EIGB 4QXUH 1P7QA 3DOHA 1OP5K 4G2AA 4NQXB 4NP9A 3VGGA 4B3VA 2VJ8A 1QRNB 1U6AH 4P9HL 5C7XH 1G6VK 5AZEH 4G8GA 1KEMH 4HU8A 2EUZA 4KFZC 1K4CA 3STZA 4JY5L 5BVJA 3DX6A 1NGZA 2E9IA 2GUOA 3V55A 1BFVH 2W60A 2F54A 4U1LB 2ENJA 3UTZA 4NRYB 1BBDL 4N87A 1NM4A 1FHGA 1WRFA 4ANWA 2RR3A 3UAJD 1W72H 5IVXB 4ZO7A 3SO5A 4F91B 2DQ6A 3CVBA 4RGNB 4Y0GA 3LNIA 1Q4NX 1ECZA 4QHMA 4TOYH 1JV5B 5SV3A 1DN0A 3NESA 3UJTH 4MDIB 4TULH 3HBZA 5EZIL 3G6JE 3JTSA 2KMWA 2DM4A 3LPFA 4FQCH 2Z91A 3WJMB 3HFFA 4RDBA 5EFIB 4W9GC 2FHBA 4PRDB 3O45A 4N2AA 4YE0A 1CDJA 1Q0YL 4H5SA 4JFEA 3NIGE 4NXKA 4HDIA 1OM3H 3WMPA 1UZ6F 4UTAA 3B37A 1A14H 5C0EA 2EYRA 2ZOKA 1H5BB 3ME0A 1Z0MA 1P1ZB 1XF2B 4XPTL 4L8DA 3MUHL 3RUGB 1MHEB 3A3YB 4QKXB 5LKNA 2Z34A 3MRLB 4DZ8B 2UUDK 2E4TA 4J2XA 2W9EL 1D6EA 1HT6A 4GXFA 1BQHB 5I0VA 4YN3A 3H42H 5L2KD 5TE4L 4JRYB 4RQQA 5LXGH 4FF9A 4Q0XH 1ZE3C 1UXSA 3GJFB 5IR1B 3MV7B 2HMIC 3CX5J 5K9KB 1WAAA 5EPMA 2BOLA 3DJZA 3V6ZB 1JZ7A 1I8MB 4DUVA 2GBTA 4Z7OF 3MSPA 4HJSA 4PUBL 3B7UX 5CZVL 3LKQB 1IGIH 1U8PA 3U83A 4MFHA 1CDIA 3E6HB 1HH9B 1U93A 2DQHL 4MRCA 1ZDQA 3KJ4B 3DC0A 4X4ME 5HVGB 3BPOB 4HLZG 1JXFA 3QXDA 3D12B 4OLUL 1BWMA 5LCVH 1M71B 5FCUH 1LQSR 2FLRT 2BNQD 4S1QH 5E94A 2CLRA 2GBUA 4M29A 5CMAA 2JKNA 4DK3A 5LNGA 3MV11 5DZNA 5JXEA 1AH1A 2MPAH 5DVLA 3QQ3A 3TBYA 3MJ9L 4U6YA 3QEUA 1JD7A 1QNZL 1GAFL 3W1ZA 4WO4C 5KVFH 1PKOA 5IF0A 2VR5A 4IU3A 4QOKB 1CXHA 3VI4F 2GK0A 1CIUA 1UD2A 4P46B 2R51A 1VAHA 4Z5RA 1NAKH 1MCBA 2X6MA 3P0YH 1QKZH 1QSEB 2ZE0A 5J8OA 1RY7B 3NH7H 3CVHH 3CLFH 2DL9A 3JWOH 1YVLA 3Q2CA 3RY6A 4LSDA 3TN0C 1FDLL 3P1VA 4G8IB 1GRWA 4AKQA 4B95C 2QGEA 2ATPA 3CC5A 3EG9B 3IJHB 3X1GA 2FBOJ 1FNEA 3O9WB 1LGVA 4XI5C 3SQOH 1HZHL 4AL8C 1KB5A 1MCDA 1L7IH 5IBUB 4XNDA 1VRSA 1CBJA 3GMRA 3KPLB 4QRSA 1IUZA 1LP9A 2R0WH 1TJIH 1DEEA 3GZKA 2ITCB 2WQSA 1IM9D 1SMDA 2NUPA 5DI8A 4DZBB 5MEOA 1M3JA 2H8PA 2V17L 1OZUA 4BZ1A 1U92A 1UT1A 3GSNL 1ZANH 3LKRA 4NQDD 5FGBA 4Q89A 1B0IA 1DJWA 2RD0A 2ETWA 1CGWA 3GF8A 1MW0A 4MVBD 5C0FB 3WXWH 1D5ZA 1UYWH 4KNQA 4OLEA 1RPQA 1Z2KA 1IT9H 3F04A 1E3XA 3U7WL 5HY9A 1U0QA 5F96L 1G7JA 1MHPL 1PZ3A 1WBZB 2UX7A 3FB8B 3RTLA 3BD3A 2DYPA 2G5UA 3FBKA 3PGFL 5I1GH 1IFHH 4OLYL 1AR1D 3V2AR 3W3BA 4JKWA 4ZS7H 5KSAB 3MROB 4BA0A 1N8ZB 4WI0B 1KDJA 5BO1H 4PB9L 3FUJA 5IP4A 4OLZL 4G11A 3QIBC 3OKKB 4FFVD 5EOQH 5ITFB 3QORD 4WTWA 5IB1A 1JPGA 1Y1UA 5I26A 2JJSA 1HHIA 4YDVA 3VXTA 4LLYB 1DE4B 4TQEL 4I48A 2D7PA 4DP2X 1FVEB 2VKXA 4PJAE 5JIPA 1I4FA 2SEBB 4A38A 5T1DH 1MDAA 3PJSB 4TNWK 4AM0Q 1HHJA 2VSMB 3GD1C 4HH9B 4XNAA 4DH2A 1I1YB 4X4KA 1I7TB 5IQ9A 2VDPH 1HSAB 2XZZA 5DEGB 1R5IA 4M43H 1QEXA 4HEME 4NNPH 2G60L 3FRUB 3VUAA 2K4WA 1KLGA 2OXGB 4LGPB 4UDUA 5B7EA 3D18B 4RFEA 2AANA 5FYJU 4FD0A 3W2DL 1JGIA 1JCKA 1ZE3H 1RZQA 1V7NH 3FB6B 4NQSA 2WJ7A 3VAEA 3NEEA 1DL7L 1EZUA 1PEWA 1KXQE 2EIKB 3M1BA 5D4QA 5K9JH 3I9AA 4K3EH 3KR3H 2ENSA 3QZOA 5BVPL 1VFAB 4L4TA 3L17A 3BKJL 2O4EA 4WSJA 4N22A 3UEZA 1D7BA 3MBWA 1MRFH 3RVUD 1B2WH 1ANUA 1OPOA 4BUQA 4HJGB 1M2OA 2CNYA 1LK3H 2AJYL 1F2QA 3SYCA 3SOBH 2QQQA 4XAKD 3P30L 1ZVHA 4GIPD 4AJWA 1B90A 1TJXA 3L3OC 1WICA 3S6CA 4C58B 2LV4A 1TCRA 4YUEH 4Z7UA 5H8DA 4QXVA 4ONOA 3RFZC 4J27A 1MCIA 4HAKA 4Q74A 1RUKL 3QRLA 5CIPB 3TVMB 3CC1A 3S35H 3ULVF 3KLAA 2E7DA 5F9JA 4R5XA 3K72B 1QBLL 2Y06H 4IBUA 1MUJA 3A6CH 4LPVA 2CRZA 5BS0B 1S9KC 5DC4B 1UEYA 4RESB 4AI7A 3K2MC 3MRKA 3WHXB 2VUOA 5JXAH 3A47A 1BLNB 1PZAA 3F7LA 5E56A 1J48A 3AQXA 3SPGA 1QLFB 4LSPH 2VDRL 5SWSD 2HRGA 2VH5L 4L4VA 5CBEB 4KK5C 4N5EC 3SDXB 4BA8A 2Y07L 4F5CA 4OIIH 1NJ9B 15C8L 4OCSL 2AEPH 3CK0L 5KBLA 5KS9E 4ELME 4X9IA 5E8OA 4AC4A 3NSXA 4D94A 4XPGH 2YXFA 4FJYA 1Q72L 2NMSA 3O6KH 1RIHL 4PJGA 1XL6A 3NRPA 2H26B 4YWGL 1CC3A 2WNGA 4X6EA 2ESVD 4JVWA 4AL8H 2AQ3A 4PRID 3EH2A 3MXWL 3S36H 1JJUA 3GO1L 4OI9A 4YHIB 5DD3H 4U1SB 2IG2L 2OTPA 3BEWB 5I76B 5IESL 5CN1A 1VEOA 3WXVH 4P3CH 3Q01A 3FRPB 4HK3N 5ICZA 2OMZA 5TDNB 2ZT9C 3SE4C 2Z8SA 3L54A 5I16A 1T83C 1P7KB 2XETA 4XE0A 1FO0H 5AAWC 4F9LC 4JFZL 3BHBA 3GSOB 4D9RD 1FN4B 1JPTL 2BX5A 4JFDA 3UZVB 3QDJE 4IJ3C 3UZQB 1OO2A 1S7RA 3O6FB 4HC1H 5CGYD 4HS6B 1FWXA 2F1EA 1OTTC 1AS8A 1N6UA 1JYXA 1NMBH 4EIZC 5I2IA 5LBSH 5BJTA 4NJAL 2XZAH 1ZS2A 4M6MH 2DTML 3G5YB 1U2CA 1K5NB 1MCHA 2P4AB 3WLBA 4DJMA 2YN5A 2WKLA 1LO5A 1VJSA 3GZPA 2MNUA 2VLME 3QFJE 4F24A 3HI1A 5DQJA 4E2OA 1EO8L 1IZKA 1Y6MR 3AU1B 3SQBA 3KGTA 4ACPA 1UASA 5HI4D 4BXSV 4AGQA 2XKNB 5B39B 3QG7H 4KXCA 3BT2L 3NJLA 2BVQA 1A1NB 3RE0A 4G6ML 3DXAB 4JHBA 4M6OH 3DRTB 3FT4B 2ZIDA 1GGBL 1J1PL 1I3RA 5F0JB 5J6HB 3QVAA 1PD6A 2GSIB 4ESKA 2ZUWA 3E2HC 3C8KA 2QT6A 3GSQA 3K8MA 1NCJA 3UTOA 1PZSA 4LVNB 4GRLA 5AD0A 1WCBB 3WEXB 3JV4B 3X1EA 3WJLA 2FIKB 5KSBE 2WUCH 1J05B 4MA8L 4YGAB 2J2ZA 4F2MA 4LIQE 3R4DA 5HVWA 5IWLC 1MWAH 3T0EA 4DGVL 4LL4A 4YLBA 1MI5E 2WBKA 4NCC2 4KK9C 5JHDD 4YPGA 4KJWD 3KYOA 3S9DB 2CRIA 2BVTA 3MYZA 2CKBA 1ZS8B 4HD5A 4W9LC 3MRJA 1A4CA 3EDDA 2ZCHL 4DWHA 4LAJH 3MTXA 3SJVA 1YCSA 3QJFB 2UXGA 5GZNA 1DQJA 5IMKA 2AJVH 3FO9A 3S37L 3TO4D 4PCSA 5CNHA 3HOGA 4JQXC 4RFNB 3MRIB 1A7OH 1FVCA 2XWJA 3QE5A 3LH8A 5DHVA 3EO0A 3TU6A 3QQNA 3UGXA 4JG1L 4P8QA 5D72H 1G9NC 3LHAA 2XN9E 5D4JA 4P2RD 3L5WB 4CKQA 2E8YA 2YPLE 2EDXA 3MV9E 3SDCA 1VENA 3K6OA 1PSKL 1EXUA 4CMMA 2B2XH 3BP6A 3EJCA 3C08H 2QQLL 4JDTL 3S5LG 4N2CA 2FWSA 2DLIA 4GXUM 1D2PA 3DUSB 4PV9B 3VI4A 1UA6L 4FLSA 1U33A 3QZLA 1RJZB 4HWBA 3FNKA 4MNHA 5CCKL 1WWBX 2Y7MA 4ZSOE 2L7QA 2EJ1A 4WI6A 5AYTA 1CURA 4KVPA 4Q52A 3ES6B 4GY4A 1U21A 3A67L 3ARXA 3VWJC 2WQUA 4F20A 5I8CB 1USZA 4U4IA 2EDOA 2Y7OA 3VD9A 4N2MA 4QXGL 3IE9A 1CLYL 3G7TA 2GFBA 3O41B 2YS4A 2RTTA 3LYRA 5JMRA 2C1OA 4LKXB 5DJ0B 5ESAB 1FNFA 3U46A 4BFOA 4KUZH 2XDHA 1UWFA 4MGXA 2R1WA 5CD5D 2BNRE 4QO1A 4E9XA 7PCYA 1MZZA 3KWWB 3R06B 5BW7A 2VERN 3ECBB 1WVZA 3FQXA 3S35X 5IQOA 3WSQH 1AQDB 5A6IA 1WFNA 4NUQA 1QX1A 2YAEA 3TS8A 3D69A 3KCPB 3EYUH 2CPUA 3AY4A 3SDAD 2XQYA 1OB0A 4YSEA 3FB7A 1DO6A 3VG9B 5IMMA 3ALWA 1RMFH 3IMWA 2YEVB 3P0VL 4YSDA 4OCWH 1NKOA 4Y4HB 1NWOA 2FSDA 4LCCC 3T1FA 4APQC 3JV5A 3GGWA 4ANUA 2JIXD 1P2CA 1IKFH 1ZLWK 1AIZA 4DKEH 1XR8B 3ZTJH 2W0KA 4J3OH 5DD5H 3WIHH 5J6GA 2YD5A 1K5WA 2J88H 1KNOA 2MHAB 4TPRL 4HMCA 1K4DB 3WFZA 1CT8B 1ZY9A 3VI3B 2VXVL 4KH9A 3S36X 1MJ8H 1JD9A 5D7KE 3B3IA 4IRJB 2ROXA 5C2BH 3VA2C 3UO1L 1OP3K 1FP5A 2OXHB 1KN4H 1ODAA 1WFMA 3FN3A 1LO0H 4F3FA 5B4MC 1I3VA 2JK5B 1RH8A 4MQ7B 5LGKA 3N9GH 4AXWB 1SQMA 3ARVA 4OCYH 4M4PA 4XN5A 4AWJC 5HJBA 1YYCA 4AOFA 4ODTL 4WNSA 3HHMA 3QFDA 3DECA 3PNRB 1COBA 4GQZA 4HKXB 4OJCA 3L3IA 3L5XH 1QR4A 1UGNA 1U3HD 4CW1B 1IGCH 3RWFB 3V4VA 1QTYT 2OMVB 2QR0A 3BVVA 1R3JB 2K4AA 5D7IB 4XP4L 3ZIMA 4BSJA 5EIIA 3FDWA 3QZNA 4PD4J 4KRMB 4PLJD 3BZEA 2QVIA 3PP3K 3RI5F 5HD8C 1FH5L 4KROD 4XB7A 4CMHB 4WFFD 1J9RA 5ICYB 3IJ8A 5EU6D 4WNJA 1TUPA 3WKQA 1QR1B 5DHYB 2EH8H 2VYRE 1TNNA 1C08B 4QTHB 4Z3TA 2BDNH 3DIFB 3QDMD 3TV8A 1GHFL 1PDKB 4MNGB 3RTQA 4PTTA 3AXLB 5FYLE 1TETH 2VDOH 5D7LD 5I0YA 1L5GA 1G9NH 4NZ8A 4YVUA 1F90H 4P5KB 3VQMA 5HYJD 5C0CE 4JM4H 2DWTA 2DIBA 1S9YB 5MEPA 3ERXA 2B1AH 2MTAA 4WHCA 4ENZA 3LPOA 3L6FA 3O4OB 5EN2B 2KERA 3CJJA 5IQ7L 2WB1A 4ZNEE 4OQTA 5GS1C 5E6IB 5E8PA 1UXWB 4ZPTA 4L8CA 2F5AH 1HEHC 2W91A 5A2AA 12E8H 1BOGB 1LO4H 5FA4A 1EEZB 3IWVA 3UXFA 2XXGA 2VGLM 2R29L 3DHJA 2V2XB 1AO7B 3O6ML 4BEIA 3IFPB 1L9SA 1UWEL 1T1WB 3GSVA 4Y7OC 5D4IA 2DDQL 1D5MA 5A6LA 2UVEA 3WFDL 1UM6L 3BP7B 2ZUXA 4H0HB 4YBQD 1A6PA 4HWZA 5I8OH 4U1JB 1AGCA 3ZLQC 2YBRB 3VE0B 2HAZA 1W80A 2IAMB 4HZLB 4XX1G 3TF7C 5D9SB 2VSKB 4JPQA 4TQ8A 1QO3B 1DQLH 5HHME 5TFSH 3KG5A 5F88B 3VFNA 1EXHA 2B9AA 1Q9WB 5AFAA 2G2RB 3FL7A 4YZFE 5DF0A 1RK0A 3CQPA 4LE8A 2AKRA 2Z31B 2Z7UA 3RYMA 3ZKMD 5J1AB 1N3NA 1G6RA 4R2GC 3OAUH 2XQYK 2XBDA 1W0YT 2TRHA 4PRAB 2KPWA 4G6AC 5AVQB 3N06B 1TPXB 3K4AA 3S96B 3S7GA 2K6ZA 3BKML 5IIEA 4RAUB 3MV8B 4JY4A 4JG0L 1G43A 2DJ4A 4YHOH 2RBLA 5KANI 1HL8A 5M95B 5J06A 2Q3XA 4NN7B 2ATKA 1OE3A 1GGUA 3HB3B 5AVUB 5L4MA 4LCWB 5CU9A 4CVZB 1KIQA 1S7UA 2NY3C 1D6VL 1Z3GH 2CE6A 2CLVB 3SPIA 1ZTXL 5CKGA 4ZBJA 1TCMA 1IGYB 4XO3A 4UQIM 4FXKB 3F7QA 4CU7A 1W0WB 2E7CA 3LS4H 1KGCE 3BVXA 2H4EA 1JV2A 2NY7H 2PNDA 4WUUB 2LTQB 2CM5A 4P9MH 1U8CA 2WIMA 4JO5A 3S0PA 3T3MB 3MRDB 3OAZH 4OFDA 1KJ2L 3APNA 4X99A 1OAYH 2CIKA 2FGZA 2E56A 2J44A 4FKHA 1ADQH 3AFLA 4HVBA 4NUJA 3V0WH 4G5ZH 2JKLA 2HPTA 4H25A 4FG6C 5D2NC 1A7PH 3EH4B 4JKLA 3FUMA 4ZMWA 1YYLH 4XOBA 2F1AA 3MRMB 1FCCA 2HH0H 1JG9A 2DQDH 1CF8L 4F80A 4OD2B 4ZD3H 4RX4A 3RIFF 4M1GH 2H3KA 4ENED 2C3HA 5I9QC 5AOMA 4JN2B 1PY4A 1QI5A 1T03H 3B7YA 2NZ9C 2FH6A 3IGAA 1YEGL 2QPSA 4M7KL 4KHTL 4TUJB 4ZUTA 5IB2A 1P4IL 3U7AA 2NNRA 4GG6F 1CXLA 3MXVH 1GZQB 1RUAH 3DMMA 3PWUA 4KGLA 2NNAA 5BRZD 2X3BA 1D5XB 2XWZA 3UC0H 4WFED 3GRBA 4R7LA 1D5IL 5DRZB 3EOTL 2DQTH 1UJTA 2IANE 1PIFA 3DARA 5F3HB 4I1PA 1YMHB 4QRBA 4W9ZA 43CAB 4PYGA 4ANXA 1NUNB 3APFA 4NSKA 4ZW3A 2ICWA 4I4WB 5F1KC 4U1HB 3T6XA 1IARB 4XWOD 3ZMNA 3T8XA 2ZYRA 1QASA 1OLLA 4ABUA 5DMKB 2YPKB 4OD3H 4AQAB 1D7DA 1KBVA 3BI9X 1EFXD 3B43A 1JI1A 3G6JF 4MA3B 5A6MA 1D3CA 4IYKA 4QRPA 4C56D 4QRFA 4LPUA 5IHLB 4WWKD 3G5VB 4UT9A 1ZVSB 3ASOB 1XGYL 4LQ1A 2XQBL 3VXRE 3TBVA 3BRGC 2W9LA 4ANVA 3RPKA 3CQFA 1E3ZA 2D31B 1KC5H 4KXZI 4CADA 3LH2H 3SQRA 4A67A 3CZFA 2BJMH 4TUUA 1F6AB 3DX0A 3E3QC 4RETB 1RULL 3NSDA 1W0VB 2ZXDA 4YDKL 4W9DC 1CR9L 2WTOA 4NPYB 3IVKA 4KTDL 2ISDA 4UTBL 1MHCB 4OZGB 1U8QB 4NO0A 3ROLA 3EOYG 5CSBA 4ZW6A 4HLJA 4I5BA 2GBAA 1YEDB 2GJ6E 1IKOP 2X4PA 3F2LA 4G80A 2J43A 1KEGL 1QSFA 5JO5A 5C07A 5ID1A 1LL1A 5CUSL 2C1PA 5KBNC 3QIUB 5D70H 3N43F 3CDZA 1L6PA 1RUQL 4OY9A 5E9AA 1YY8A 5J1TC 1WDAA 1CPUA 4QGTA 4NDMA 1KBGL 2ZCLL 5KVEE 3J07A 5J0BA 2OJZL 5FYJE 3QEGL 4X4YA 2C4FU 4TSCL 3NABL 4UF7C 3X1NA 5AKSA 1NZRA 5EN3A 5DSCB 3P3YA 4KBPA 3EFDH 4HGWB 2KYIA 5A2BA 1KFAH 3AADB 1EO7A 3EH1A 4HKJA 4XN8A 1T04A 4UAOB 5BMFH 4GQ9H 2FJFB 3CU1A 1NANI 4DPRA 3WN5A 2YKLL 2H5UA 2JQMA 2XICA 4M7JH 4YHMH 2EE0A 1OW0C 1IGJA 5BOJA 5HYQA 4POZC 1YN7B 2CK0H 2IAAC 1AXTL 1FNHA 1U6AL 4Y2DD 3OWEA 3LKSB 1OTSD 4PREB 4F33B 5KBPA 3JTBA 1TTUA 3HC3L 4L48A 2JTYA 4S0HA 5DZJA 4P2OA 2BSTB 4YHKL 3UABA 2GIYA 5FO9A 4E9TA 2GITB 4Y19E 1V05A 1HKLL 3RWIB 3ATAA 4Q56A 4P5SA 4PJ9C 1ZK5A 5CEZE 1E7UA 1URLA 2NW3B 1BXAA 2WXKA 3STLB 2I60L 1EAJA 4MJ5B 1UA7A 5IFJA 5HHXL 1EHLL 4PRBB 3D0VA 1I8AA 1YZZA 2J12B 1E8XA 6PAZA 1MFCH 4JM2B 1SPDA 4ONGH 4YXKH 3UJTL 3FULA 4KNTA 3NJNA 1B0WA 2BXYA 3Q06A 4YE4H 1OPGH 1LMIA 1E43A 4LVOB 2IDTA 5I8KL 2CDFB 2IV9A 2AJSH 3N3EA 2Y5QA 5HHOA 2EINB 2OW6A 5L8LB 4PRHA 3G5ZB 4XCNA 2CRYA 1BXXA 4PFEA 5F7KC 3L9RA 5D1QB 1CGSH 3QJRB 3SDYH 3SE9L 4KO9A 5EULV 3BUYB 2PPAA 1OM3L 1D2OA 1GL4B 2DLHA 3FFCD 4FQ1H 4M61A 2CH8A 4KKCD 4PI2A 5TQ0L 3WL9A 4DGYH 1ECYA 1A14L 4NM8H 4GI8A 3LN9A 2QKIB 4G43A 4F9PA 3Q9PA 2P8MB 1ITBB 1A4AA 2WUBL 3DPBA 3VJ6B 2AK1H 1JYVA 3DGGA 2GC4C 1Q0EA 3IDUA 2F58H 5HDQH 2DQFA 1B0RA 3RGVA 3H42L 3Q6GL 2QQKH 3MACH 4V11A 1DO5A 3MJ7A 4XAWH 2V9TA 3DWTA 5KYYB 4PJFB 2G5BA 1JWUB 1IC5L 4H20L 5KJ4A 4UBDD 3H9SD 2Y3AA 4G8EB 3ALPA 5J4MA 1KCUL 2JKRM 4M8UA 3AITA 5B21A 1DFXA 4KI1A 4E9VA 4BFGA 5I1AA 3X11B 4CVWA 2H0JA 4BFIB 1GY2A 3F7PC 4ERSH 1XH2A 4D0BA 2JI3A 5B1AB 1JNLL 3DX7B 4YIQB 1U95B 2V0AA 3T2OA 4BFJA 2V9UA 3JUYA 4OB5L 4D7PA 1ZIAA 3O0RH 3ECWA 1ACCA 3AU0A 3NQKA 5FYKD 3WTUA 5EZOH 1XBRA 5LHDA 5FCUL 3QDGA 3MBXH 5FPIA 1HNGA 5C0BD 4EIUA 1RJCA 1MCPL 5L2KE 1YNLL 3FHAA 5E2VH 5T5NG 1CFNA 3PQYA 3PJNA 3FONB 4NS0A 4QDGA 1S9WA 3GIVB 5KUMA 3VFRA 2EDHA 4O51B 2YEZB 2YPVH 2VLKA 4Z7QF 4FLHA 1T5WB 3FU6A 4TUOB 1RK1B 2DQJL 3KDMB 2WO2B 2ZWZA 4QRRB 4K9EC 5J7CC 2HKHL 2PW2A 1IGTA 3CVIL 4XXDB 1P7HL 1UCTA 5E6YA 3NPSB 2E86A 3CLFL 1MIEH 1Q9KA 3U9PH 4Z78B 3RWJB 4RSYA 1H0DA 3ZX1A 3BP4B 1NEZB 3WELA 5E1HB 4KH2A 3KPQB 4NUGH 1WD9A 3EJZC 1MFBH 4U4BA 2BNQE 2NY6D 3BAKA 4MMZA 3Q8BA 4JGUA 5AVZB 3SQOL 5HJ3B 2R1YA 4H13C 4ZAKD 2D0HA 2VR7A 3WGUB 3M7FB 2RH0A 2B14A 1T0NB 3UTTD 3GWJA 5GZOA 5IM7A 3O3BA 4L8BB 1QHOA 2NR6C 3ZRFC 2VL5A 2MWCA 4KTEL 3ET9F 5JDSB 2KQNA 4LPTA 4UAHA 4W9JC 5C09A 1GMIA 1SYVB 5DHXB 4AH2A 1DCEA 3BIBX 2YGPA 2ZSVA 3K7UA 3TA4D 3FOLB 5IUSA 5JHAA 4XVJH 1QOKA 4F7KA 1MDTA 5GRUH 3ATBA 5DRWB 1CWVA 1KPVB 3ETBF 1UQSA 3GYRA 4IRZH 1FFNA 1BMZA 2JI1A 4K71B 4IQHA 5KS9F 4NLHA 3ECUA 3JZ7A 4U05A 4ZS7L 5IW6A 5JUEH 1W91A 4PMFA 4C83A 4YLCA 2FWLB 1EDYA 3MRBB 3KBHE 1J12A 2GW5A 3OZLA 4QCIB 4UM9B 4L4JA 2C9PA 4PR5A 3MREA 4MDRA 1BJ1H 1Y07A 2IDQA 5HGHA 3MNZB 1UC6A 1BZ7B 3GLZA 3EDEA 4PJBE 1AHWB 3RI5K 3L7EB 2B15A 3QA3A 3LB6D 1A22B 4NQDE 5T1DL 3HZKB 2UUDH 2APWA 2FVNA 3S5LA 4F7EA 4Z7WB 4CAGA 1CI5A 1FVDB 4XVSH 1MAML 4BQ6A 2QDVA 2WYHA 5I17A 4Z76B 3HPJA 2AEWA 3ZKXB 3BAEL 4GG6A 5C08B 2Y6SD 1CXIA 5EUKB 1BA9A 3DBSA 4RGND 4OZHF 1FC2D 3W39A 1MFEH 3DO4A 1YMMB 2AZAA 2VDKL 4UZGA 7FABH 4L9DA 4U2YA 2PWHA 2CA3A 4EKJA 3S3CB 3OAYK 1D9KD 2UZXA 1CLOH 5DZOA 3DX2A 4KK8C 4EQ2A 3T8VA 3E80A 1FORL 4K3EL 1H3WM 4W1TA 3AG3B 3ZDYF 1BP3B 4TSBH 4U6HA 4XO8A 1N5AA 5DDHA 1VKXA 1I8UA 4M56A 4X7TA 2NPLX 1GY1A 2J7LA 3OXRB 4FQJH 1NLBH 1MRFL 2H6PB 1B2WL 1CDHA 1AAJA 3DBXA 3G6JA 1RURL 2FYYA 4Z7IA 4IW4C 4GI6A 4JO3L 3KEDA 2BMKB 1JZDC 3APMA 1J10A 3HR5A 3MGTB 1TTGA 2KLTA 5SX4H 4G6KL 4F7TA 3CDFA 3D48R 1E3FA 2A73A 4DEUA 3QI9B 2CO6B 1J0JA 3VXOA 4KXZH 4BFEA 1MJ7H 1XCWA 1YEJH 2EE6A 2EEAA 3RY6C 2NYYD 5AW7B 4JRYD 2ORBL 4XCEA 3FUKA 5JLZA 4AQ1B 2C3VA 5EC1B 5JXAL 3FO0L 4LPXA 1UOLA 4ZUVA 3L1FA 4KI5C 1R47A 3LN4A 3HE7A 1SGKA 1MFVA 4NIYE 2PCYA 4UOQA 2AEPL 4GXVL 2IPTL 5C8JB 4XAKE 2BVOB 4G72B 4RFOL 1ES0A 1BOYA 1CDCA 1BFTA 1EAQA 3O6KL 4OT1L 4L5FL 4P5RA 5JW5B 3BE1H 4Y4KD 3LH9A 2NY5C 3EYFB 1XCQB 3AWGA 2AV1B 3O8XB 3W0WD 1BF5A 4AL8L 2AK4A 1RI8A 2H3NB 3VVVA 4DP6X 3IDGA 4CILA 2JH2A 1QUNA 4V33A 1IC4H 4B7IA 4GS7B 5KYXA 2VRAA 1CICA 4P5MA 2FD6H 3IDXH 1NANH 1S6NA 1Z9OA 1RFDH 2ED6A 1Y1DA 3IJEB 4UQ2A 4D9LH 5L6YL 2R83A 4QOKD 5SWSE 3E9TA 1BPVA 4WDIB 1EAOA 3ZTCC 5ILTH 4LRNH 3HI6L 4XC1H 4P46D 4RNRB 1XIWB 4I9WD 2R4SH 4P5TA 1J87A 1JHTB 2APBA 2UWEE 2FQFA 5I6OA 1QSED 3HMXL 3LTVA 3M17A 3NCJL 2KDGA 3FUEA 5HPMB 4KRPB 1SRDA 4NJ9H 2BINA 5C3TA 4F7CA 4XGZA 2ESVE 4DQOL 4U1IA 4PRIE 1S4IA 2YLHA 3BQVA 3O9WD 5L7XL 3D3VB 1QBAA 3ENEA 3CVCA 8FABB 1I85C 1ED3B 3AY2A 2VR9A 3H3BC 3ARZA 4PWEA 4QT5A 4JRWA 5JR1H 3OJVC 3MNWB 2WXIA 3UGEA 5CSZA 1S9VA 4JZOB 2EE2A 5KOVC 5FUOH 1D7CA 2XJKA 3TEXA 4K5PA 4HS3A 4AT6A 2OMYA 2YMOA 4JO2H 4Z0BL 2Q8AL 4D9RE 4H0GA 2L0DA 5IUCA 3N44B 4PJHB 5E08H 1I7UB 1A4BA 1FA4A 3OXSB 1RHHB 2XVBA 3HTLX 4N6RB 4O2CA 4U31A 4BGDA 1JFQL 3DVNA 3IT8D 5ANME 1G5AA 3HPLA 1I1FB 3ARSA 4L9LA 5FYKU 5KSAD 4GW4A 5T5NF 1DFBH 3L4TA 5EBWA 3V6OA 2ODHA 3A0OA 3IKCA 4JLRB 5D5MB 2X1WL 3FOMA 3AVEA 1OHZA 4QHLA 1KJMA 1F56A 4IOSA 3TJHD 3X3FL 4ECNA 2FHFA 1R5VB 1RUPL 4EN3B 3HG5A 2DQGL 3EO9L 1Q1JL 3OD3A 4AMKH 5EZJA 4K9JA 3LZLA 3B34A 3DK0A 3I6SA 2NY2B 4OD1H 2CR6A 2GSMB 1A66A 2ZP8A 5E5MA 4JUSA 3UIYA 1OCWH 2Y7LA 5DLLA 5IMLA 1M42A 1B4LA 1HINL 1RZJC 5DWUL 1QWHA 2JE8A 4PBWD 2K6WA 4QIRA 3Q5YA 1EJFA 1DBJL 1QFWI 3FTYA 3MNVB 2FBJL 4G1EB 4JRXA 3UG3A 2EUXA 1JK8B 1C12A 5FO7A 3BYTA 2HPOA 5E70A 3KPOA 4Y1AB 2JV6A 4K2UL 5CJQL 3NCFB 3C6LA 3FO1B 1KG0A 1TR7A 5FF6A 5E6UB 4XT1C 1G4RA 2XTJD 3HRPA 4A2MA 4L5FE 1UKSA 3LKNB 1JOIA 1KB5H 2DJSA 3Q2WA 5ENWB 3HCVB 5HJGA 3C08L 5JHDE 1HHHA 3LDBB 4AITA 2MQGA 1SMAA 5GRJL 3K6FA 3RZCD 3SGJC 5B8CA 3CFKB 1XAUA 4O5LH 4KNSA 1OVZA 1T0OA 5TK4A 4Z77B 2DICA 3JWNG 4BZ1H 1QLRB 4L1DA 1F00I 4MMYA 3BGMB 3WD5H 1ACYL 3QWRD 4R4BA 3BP5B 3F12A 4XP1H 3DHPA 3HUJF 4A6YB 4U1MB 4PJDB 3U7YL 4GP4B 2CALA 4AY0A 3TVMD 1AC6A 3RL1B 4ZXBB 1DBAH 1NQBA 3MJ9A 4NENA 2XKSA 4HWEH 3X13B 3P3RA 5J5EA 1KJ3L 3JUZA 5G4MA 3NAAL 3LZPA 1QEWB 4L3EA 4LSVL 3IXTB 4R96B 4Y7MA 4P2RE 4YSUA 5BS0D 4JRLA 4RBPH 1WBXB 2D4DA 4ADIA 3GMOB 1JNNH 1T21A 1ZXQA 5FV1L 3SD2A 3V9FA 5KVGH 5EG6C 3OPZH 3RX5A 3FN0H 3IRZA 1R9FA 3VMOA 4LQFH 3T3PF 2BVEA 4CN1A 3OGOE 2H6UA 5FA3A 1F58H 3IDJB 1LNUB 1Q9LA 4OF5A 3BGAA 2ZKXA 1GS6X 4YXLL 3DV6A 2G4EA 1DUYB 2B5IB 2GJZB 4Q4IA 3VA6A 2W9DL 4WY7H 5ETUB 4AVJA 3AB0B 1ETB1 4QWWD 1MG3C 1V3LA 1HNYA 1LDPH 2IALB 2W65A 1T7WA 4I3RL 1ZEAH 4GO9A 4JFYA 4AVKA 3MUGA 4LLUA 5KS9A 1YNKL 3KCWA 3N0AA 4IHOB 1A0QH 1H8SA 5DEFA 4ZX3A 1LWRA 1AJ7H 2EXTA 5IK3B 3PWPA 1RMFL 4OKVA 1KELL 1MCWW 4JFPA 4NO3B 1HC1A 4ODUA 3BD5A 3QUYA 5TF1H 1IKFL 4GOSA 1PLGL 2EECA 1B0GB 2ID5A 4JVPA 2X4NB 3FUIA 4XXCC 2B1HL 4M7LH 4KWUA 5DJ8A 4L0PB 1I1AA 2B9BA 2IO5A 3BZFA 2OMTB 1MKFA 3CH1A 5JQ6L 4RISL 3O6FD 3B9VA 3VD0A 1KBKA 4L05A 1WLHA 1RLWA 2WLLB 3EGSA 3P4NB 2HN7B 4WTXA 5HHPA 2E7HA 2EYSB 2GSGA 3OR6A 5DJXB 4OZHA 1JWSB 4X9GA 5BCAA 5E6IC 3W56A 4GMSH 3QDJA 4X6BB 4NQEB 2YRLA 3BAJA 5GHWH 4UM8A 3SEPA 1PKQE 1RZFL 4MD4A 4ZOBA 1WISA 3QCTH 4TVSa 3RVWC 4F8NA 1LE5B 2EZ0C 2CO7A 3WTVA 3V0VB 3I2CH 4DP1X 2CDEB 1YY9C 5I73B 5AQ0A 3BSZL 3KEHA 4HUUA 1Q94B 4WRLA 4J39A 5C0DB 5ACMA 5K93A 2FX7H 2APFA 3QFJA 3SDCC 3FSAA 1IBYA 4OV6F 4O2FA 1EXGA 1C16B 4QJ4B 4GSDH 3DXAD 2EIJB 3VWKC 5DJCA 5FV2A 5CINH 5JPNB 2UYLA 2O30A 2OL3L 4OFPA 5EUOE 2EH8L 4J7RA 5CJOL 4DTGH 4GB9A 1F6FB 5CGTA 1URZA 4P3DA 1ZCRA 4BH7B 2HJFB 4LP8A 3T2QA 4N86A 1F90L 3TYFA 3WS6C 1R0AL 1OIOA 1KCRL 2R1XB 1JZ3A 4G8GB 5TDOA 1JZ2A 3EW3B 1LJMA 2B1AL 1XEDA 1G7QA 2FWOA 3UBXB 1I9IL 5BVJB 3GS7A 1I7ZB 5ESQA 1A25A 3DX6B 1NGZB 2GUOB 2W5PA 3WHE1 2F54B 4PJAB 3TBTB 2YBGA 3FK3A 1CQYA 5KSBA 3FH5A 2X2JA 3GBNH 5AL8A 1XVSA 1VEMA 3MOBH 3P4OA 4R9HA 3PV6A 4WFFE 3BDYH 5EU6E 3TCXA 4LCIL 4F2FA 3VYOA 2EVJA 4JHUA 4PGBB 3I3DA 4Q97A 4Q9RH 3HB3C 3U82B 4I0PA 2A4ZA 3MX0B 4FJ6A 3QDME 4JJHA 3VFPA 3UG5A 4GYBA 5D7LE 4HIEA 1SF5A 2Z91B 5HYJE 5D7JD 1RVFH 1N0LB 2A2QT 1WWWX 3CFCL 4TTDC 5DT1H 4GKNA 2CBOA 3KLSA 2LTQC 4HEPG 4WI5A 2B3RA 4IKNA 5DCCA 2MQ3A 1PVHA 3QB7C 2ICEB 4H5SB 4JFEB 2DLFH 3Q8AA 3ARGA 2PYFB 4N2NA 5DUPL 4R7VA 2EC9T 4OV5A 3PHQB 1TLMA 4J8RA 2Q20A 5EC2A 5C0EB 1HEJC 1DBKH 3R0MA 3PFQA 4HUWA 2NCEA 1JK9A 2XN9A 1QWUA 1R24A 5LLIC 4L8DB 5HDLA 5ACLA 1WIPA 3NFSH 1MAKA 5DWPA 3L4XA 3ZDXE 1E5CA 1DVZA 3OVUB 2FEDC 1NGPH 1ZDSA 2IH1B 1DQQB 1E4XI 5J56B 1B6UA 5IVNA 2XNAB 1CE1H 5D55A 3F7VA 4G3YH 3WS3A 3PP4H 4E36A 2H47C 2BFVH 3M46A 4HXBH 4LLVB 5EPMB 2BY2A 3PCYA 2F61A 3H3PH 4MMXB 3PHOB 5CKAA 4FN0A 1CF1A 1MW1A 1M4KA 5TH2A 3S8WA 2FEEL 2FL5B 5I15H 1LEGB 3V0AC 4M00A 1HKFA 4PS4H 3TESA 4Z8FH 1ZGLP 4HALA 1WC7A 5KYUB 4LSTH 1BD2D 5I1IH 3L4VA 4RZKA 1U93B 3DPDA 5GISH 5LAPA 2WNXA 4HGKC 1P0SE 3CFEA 4P48A 4XO5A 3U9UA 4ELMB 4AIEA 4EXPX 4JR9H 5E94B 3AT9A 1A7NL 3ULUL 2CKBH 2BM3A 1ZA6A 4FXGA 4UINH 1ZLVK 3HS9A 1V5JA 4BKTC 4G5ZL 2D2CC 3C60A 4MZIA 3QQ3B 1EJOL 4H8UA 5I0DA 5I19H 3ML8A 4HMEA 5F72S 4AZUA 5B38G 2FAUA 3PP3H 1H8LA 4RDQF 4XP9H 5IF0B 4H2AA 4YFLF 2GK0B 3N0PB 4ZD3L 1EEQA 4Z5RB 4M1GL 2FSEA 2X70A 4LEXL 4L23A 3KYAA 4Y4HD 5GJTL 2JXMA 4N8VA 3O3DA 5EEYA 2OAAA 3ULVC 4S2SB 1SHWA 4U6TA 4JG5A 2DQIL 3PWLA 2R2BA 4FYQA 2PWEA 3NPZB 1DSFL 1U8HA 1BVKB 2FX8L 1KYOK 5F7HA 1DBML 1OAXH 4BH8A 3SCMA 5IEHB 2ZX9A 2WBJA 5EDSA 4HD9A 3W5MA 1A2YA 2W88A 4HWBH 4TVPL 4IRJD 4UV7L 3U79A 4OU3A 2DBJA 3ZT7A 1BHGA 1PF3A 3ZE0F 4AYSA 1G9MH 2H1LM 3GMRB 4HKZA 4L2LA 4PWHA 5DS1A 3HVNA 1QFWH 4PEEA 4YL4A 3ZW3A 1DEEB 2YC1B 5ID0B 3I02A 3LZFL 4V1DD 5DI8B 2Q8BH 3V0HA 2P3YA 3TNMA 3V6FA 5MEOB 3K46A 5MHSD 4FNUA 4PD4K 2MCG1 1WWCA 4NKIH 1P5VA 4RAVB 4U1KA 2AABL 3FTSA 4K5OA 3EFOB 3Q2VA 1A6UH 1D5ZB 2CO2A 3C5SB 2W38A 1AGDB 4GUPB 2FATL 4Q58C 3BQUA 4GP5B 4QF1A 3GC3A 4PV8B 5DFVD 2NY0B 3LEYH 5DUJA 3H85A 5HY9B 2CDGA 3L4WA 5CZKA 2NUTA 3UP1A 2DYPB 2VDQH 3T9WA 4PRPD 3R0NA 2XV3A 1X5AA 2PO6D 5BRZE 3KJ6H 3SKNA 4JFQB 1NGYB 1P4BL 4WFEE 3HUJA 1E28A 4JB9H 3VNYA 3IU4L 1L3NA 2NXZB 4YHPA 2Y23A 3Q2LA 1TVBA 1PY0A 4JPIA 1KYAA 1BAFL 1JMXA 3B9KB 3K6DA 4L37A 4E9LA 2NQ3A 1PG7H 2VC2B 4K7PL 3VXNB 1UM5H 4QJ5B 2CGRH 3TLRA 1HHJB 2EC9U 3X12A 2QSTA 5DVPA 3VFOA 4F8PA 3MLUL 3HS0A 4HK0B 4OZ4B 4RZCA 5TE7H 5IQ9B 1MI5B 1NCBL 3QUMB 4XO4A 3WGVB 1B4JH 4Q6IB 1V3KA 3ZMEA 4C56E 4OF6A 1BVLA 4PJXF 1H3TA 4JO1H 3GK8H 4YEFA 1A9BA 3UAFA 4X4XB 4NFCA 1KDIA 5CGMA 4ZNEA 4RFEB 4E9SA 1C8PA 3OF6D 1ET8A 3SBWC 3KLQA 4LHJB 3LQAL 3U4EA 5DD6A 3HMWH 1BAWA 3KE0A 1KFAL 1VDGA 5SWZA 5KSVA 3TBSA 2VDLH 3TEWA 3JVFC 3UC2A 4OZIE 2IPKA 4L4TB 4HIXH 4M7JL 4WEEA 3P4MB 4WGVB 3RWDA 5I82A 5MP6L 3WLWD 3MBWB 4MXQC 2IPUG 4P57A 4BKSC 3US0A 2IAMD 1NKRA 1GC1C 2YPLB 2IQ9L 2EVHA 3B56A 1MEXH 5FYKL 2W94A 2QKIC 1KPRB 1TQVA 2MTPA 2ZNWA 5GGTL 2OMXA 1KN2H 2PETA 2XX1A 2ENPA 3GBDA 5KBMA 3SZ6A 3VFWB 4R90H 4UIKL 3V4VH 1ZT7B 2X1XR 2Z31D 4RA0C 3VDCA 1IC1A 4J3UA 4ZSOB 5IHZA 3KLAB 1FFQA 4IBZA 5F9JB 2EDFA 4TS6A 2XG5B 3VXUD 1QA9B 3ILPB 1MUJB 3N85H 4B9GA 1WD8A 4QY8B 4P23A 2WGNB 1KGYE 3V0GA 5JHMA 3ZHNA 3MV8D 1X5MA 4WFHD 1NAMB 3HN3A 4XNZB 3QZWG 2BP8B 4WW2F 4M7ZB 3EIFA 5D1ZA 1VCAA 2B20A 1PD1A 4HXAL 5CCHE 4LCWD 3LRMA 3MA7B 2VN3A 4L4VB 4YAQB 4ALAH 1YEIL 3TA3A 3ULVH 1DJGA 2YAMA 3NDZE 4N1CA 4Y5VA 1TVHB 3ARDA 3GXMA 4WI4A 2A9CA 1INDL 3B1UA 5E8OB 2P8LA 3SDYL 4AVHA 4IRSA 2HWZL 1WIOA 2IVFC 4FQ1L 4OQTH 4PJGB 3TM6A 2EDNA 4FXTA 4G5AA 3VFGH 1HAWA 5JQIB 5KSUB 1PZ2A 1JGDA 1HESA 5DJDB 5F7BA 5E1IA 3WHE0 1CZ8H 4FKKA 5T3ZD 1NKGA 5E2TH 5EB9A 4OF0A 4Q9QL 2QJDA 2FDBP 3MRCB 2B39A 3TZVA 4WHDA 4C4KT 1SY6L 4RWYH 5GGUB 3CZUB 3WIAA 2OMZB 5FK9A 5I16B 4OQ1A 1MFUA 1I9JH 3PG2A 4JUTA 3NPSC 4PH8A 4XO9A 2APVA 1XFPA 3WV0A 3IJ9A 4JFDB 2Z92B 1BQUA 3ISWA 4M48L 1S7RB 3FFCE 1JGEB 3GQFA 1BVNT 1A5FH 1MY5A 4IOFC 3IEAA 3U6RA 2PYEB 3OJDB 1H6FA 5F9WC 4OTXL 4E68A 3BXNB 1NCWH 4YX2L 3RDTC 5DC2A 2NSQA 3OG4B 2B0SH 3MRNB 2J20A 5EBMB 2WVVA 1JZJA 1ORSB 2P42B 2J6WA 3RLSA 1G6RH 3D06A 1OAJA 5D2LF 5GGRA 3CZEA 4HPYL 3MLRL 5IW1A 3W5NA 5FECA 4JGMA 5IEKB 4BQ9A 4JZJB 5DS2A 1P6FA 3BVWA 2X6VA 4YK4B 1SBBA 3VRJA 3D2UA 4D0CB 1ID5I 2BVQB 1GSMA 2EH7H 4J4PD 3AM8C 4ZMPA 2N0KA 4QHPA 2BY1A 4KK6D 1JWMB 4Z0XA 1RKRA 2WTRA 1I3RB 2R29A 4UQ3A 5EA0L 4KDVA 4DP9X 3VFTA 3TPKA 5IROA 1X7SA 1U2YA 3GSQB 1X5FA 2ZF8A 1ADWA 1U91B 1MIEL 1YPZF 4EBQL 4HWNA 3CTTA 1G7IB 2WSKA 2R69L 3CZJA 1YNTF 4UQ9A 4P2OC 5FYKE 4A68A 2J5LB 1NL0H 1X9QA 1A3RL 4MAYC 5M7QA 5C0BE 3WKML 3QJUB 1DQMH 1J8HA 3GXDA 3FUDA 5F70A 4EI5B 4GKLA 2J2ZB 3QAQA 4NKQB 1AHWC 3VXRA 5K9OA 3MRPA 5G55A 2WCGA 5C0AA 3T0EB 4J28A 4HLZH 5C0CB 3VD2A 3P69A 4OI8A 3WE1A 1UGKA 5GGVL 5E1QA 1QPPA 2ZTBA 1TIUA 4OCRH 1TDQA 3WMQA 4URTB 3VM7A 3WKYA 1CTOA 4Z7OB 2P44B 3NSFA 3CHQA 3B8SA 3SJVB 4W6WB 1DQJB 1G1OA 3QO0A 3FO9B 2F53D 3EBHA 3UYPB 3P11L 3QIUD 1QTSA 5GXBB 3OKLA 1FVCB 2CPCA 2PCPB 2XWJB 4PJEE 4P4KC 3WE6A 3PL6D 4M5ZH 3REWA 3UFIA 5DHVB 2O61B 3WDIA 1R75A 4BDVA 1M7IB 3FUNA 1FZJA 4IRZL 1PG7X 3R8QA 4G9FA 3GHBH 1QVOA 3BVTA 4NWTH 4LSQL 4OCLC 4S11A 3V8CA 2Z9TA 4JDEB 3Q05A 1S7VA 4CU6A 4F9PC 2WWOA 2XCMC 1GR7A 4J3OD 4ZG1A 1EXUB 5LG1A 4CMMB 4CSZA 4OH2A 4HCGA 5E1AB 4IGBA 5D93B 1U3YA 3G6AA 1OKEA 5DS8A 3VI4B 1VPOH 3UTTE 4HG4J 1DANU 1IO4C 3RGVC 1SXSA 35C8L 2MNJB 1GW6A 4URKA 4OGQC 4WTQA 4R3SB 3CFJA 4I0KA 1KLUA 4EI0A 1KJ2A 2XN2A 1I3UA 2WLZA 3IE4A 3AABA 2EYTA 1UWXH 3FFDB 3QI9C 3CFBA 5EWIL 4B5EA 2AQSA 1TMQA 3WY2A 3ARQA 4ZFFB 2APXA 2PABA 3SBQA 1HILA 4QTFA 4UT9H 5B1JA 4F15B 1OAQH 1TZIB 3KH3A 1WZAA 3L7FA 2RCSH 4BFRA 3NACH 4PGDB 5DVNA 4Y2NA 1IEAA 4JM2D 4OR1A 7FABL 4MAUL 4E9YA 4M62H 4YO0A 4FI8A 3CDGB 1QFUH 4KMTL 1IL1A 4BGLA 2D73A 3KVQA 3S5ZA 3TCLA 2QL1A 2V7NB 3ZQWA 5EOTA 4S1RL 5DJZB 3L3KB 4LVEA 2HSIA 4MNQA 5GRWA 5FUCE 1E8YA 3FQXB 3OR7A 4OFYA 3QUZA 5D1QD 5E95B 5B3JF 1UD4A 2C3XA 4DCQA 2H0PA 3O8XC 1UB6B 2DOCA 4IS6A 1Y6NR 5GQBA 4PV1C 2WCPA 5H94B 3IDYC 2OZ4L 4PJ8B 2NSMA 5IVXE 5HGGS 1BJMA 5DO8A 4GS7C 3GHEH 1IM3A 1QBML 1RUMH 1HXYB 1BSIA 4RGNE 5IQNA 2ZKYA 1Z5LA 4BCZA 2H1XA 2E46A 4ZYKB 3SKJH 5IJVB 4YZWA 4K5MA 1YEJL 4KQ4L 3ZQXA 3GGWB 1L3WA 1XIWC 1P2CB 2JELL 5LN4A 3ZGIA 2BK8A 1S7WA 1SEBA 1E2WA 3BOVA 4KO5A 3IXAA 4TNEA 3D39D 3BPLC 4HJEA 5FKPA 1D5RA 2FUTA 3S48A 3NCEB 4N9GA 4NCC1 4MMZC 2I9TB 3HG1D 1N6QL 2VN6A 4K9EL 1L0XA 3QNFA 4XCFH 1XF4B 3SE6A 3UZEA 4NZRL 5HDOA 3OG6B 2PP7A 2G75B 1C5BH 1W16A 4BWWA 2F7QA 2FGWH 2O5XH 4HUXB 3B3IB 1QD0A 5EEUA 3EGXB 5DO2D 3ARBA 5EOCH 3STBA 4K8RD 2D9QB 5AOZA 5IB5B 4NC1C 4L3AA 2VNCA 1A7QL 3QIWB 3SDDB 1NFDF 3RUGE 3EDKA 5LBGA 4UTBA 1NMAL 2A4EA 3OLGA 3C87A 2BOBB 3KBEA 1EHXA 4G7QB 2F7RA 4JRYE 2IANB 3TEZA 3HFMH 5GJSL 1IC4L 5DUBB 1S5HA 2QR0B 1NIDA 2FD6L 1WZ1L 3H9HA 3VTTA 1WZLA 3L1EA 1SJHA 1XF1A 2WQWA 3CN3A 2Y36L 3OKMA 4LHUB 4D9LL 4ONFL 1AKJB 5MI0C 1BMGA 5ILTL 1HL9A 1OTUD 2NLJB 5F7EL 2I5YL 2R4SL 4QRRD 2QADD 2C34A 4KDTA 3L4ZA 3KW8A 4LOVA 4XVOA 3AMKA 5I30L 2R8SH 2E9BA 1PEZA 3QHZH 2HLAB 4PTTB 5ESVA 3RTQB 5K59F 1JNJA 4EVNA 3POCA 1XGTA 4Y16B 2ZPKL 3F58L 2PR9A 3EOBB 3W0WE 1ZWIA 1THAA 1ITCA 5A3ID 3L6FB 5F3BA 5IT2L 4L18A 3DUUB 4YMPA 5MERA 4WV1A 1KY6A 4WW2A 4ZPTB 2XPYA 3ARUA 3IDMA 5F6IB 2CUAA 3A4FA 2A38A 5J57B 1E27A 4OJFL 3FT1A 4G8FB 2GJ6B 2JB6B 4QOKE 3V4UH 2B59A 4Q2ZB 2YD4A 4N85A 4I9WE 2IMMA 2O5YH 4Z3HA 2NQCA 5CJBA 4GBXA 4B3EA 1QSEE 1NGQH 1AKPA 3L48A 1D5MB 3BVDB 1OD9A 3DTDA 3QG6B 1XF3A 2BCKA 3D50A 3QUXC 2WZPD 5C0RH 2HVJB 3JV0A 2AMGA 4X5RA 5DRNA 2ICES 2XXCB 1AGCB 1FYTB 1Z32X 5AYUH 3B2VH 5H4YA 2QQNH 4XCCL 3F62A 1NPNA 4AYEC 3NSCA 3MLYL 1UACH 2VZ1A 1CVSC 4KNUA 1DBBH 4OFIA 4AE1A 4KFMA 5FLUA 3QRGH 4UM9D 5JQHC 2BSCA 2BXZA 5TTRA 5AB0A 1HL5A 1DJXA 4JKPL 3VQ1C 4N8CL 5D6CB 3U48A 4OIFA 1CYWA 2H2SD 5KW9H 1R17A 1RK0B 3FCTA 1AXSA 3O2VH 1G6RB 4QR7A 1SEQH 4KU1A 4FCAA 1UH4A 1F4AA 3D08A 5I18H 2A9AA 5G4NA 5IIEB 1DQVA 5JHBA 2VDMH 3OKOB 4ZMQA 3MV01 2WMPB 3O4LA 5C08D 4K5NA 2EDLA 3NP3A 3APDA 1HEZA 1KIQB 1S7UB 4P4RA 5B38A 5D2LA 3WFEL 3FB5B 1WFUA 3TEYA 4UT6H 3V9CA 5IGXH 5JPMA 1HWWA 4JCWA 1JV2B 4WEBL 5AW5B 5EMYA 1GZPA 1U8CB 1DLHB 1R3LB 5ISZA 4P2CG 1LO3L 2YD1A 3AB0C 3OJMB 4KGJA 1O7VA 2Y6TE 4FFWD 4TUKL 3S98A 5JYMA 1CICC 3PWJA 3PNWA 5ADOH 4NUJB 1CBVH 4YXHL 2RHEA 4LSUL 3GEWB 2AXWA 5H37A 1JSYA 4XNBA 1E65A 1IAKA 1YPZA 2NY5L 1A6ZA 5DK0A 1YNTA 3BH8A 3QP3A 2ZWNA 1V7MH 4HWEL 3FTUA 2DMBA 1IAOA 4OFQA 5IV2B 4GKOA 1CJYA 2BPBA 4MKMA 2DIEA 1ZJBA 2PCFB 1BQRA 1KJVA 1KIUB 2BVPB 1LLAA 1CFSA 2XTJE 3CG8A 4GO8A 4UILL 4UV4H 1I3GL 1JNNL 4ZO6A 2J56A 2LLGA 3UJJH 5CEYA 4D3CH 5IB2B 2ARJA 5C0JA 4LLQA 3AT8A 4J5VA 4TQPA 3VCLB 1YEEL 4JQIH 2XFXA 4QHUA 1GTNA 4WCYH 3PWUB 3DMMB 4KKBC 4LP5A 3FMGH 3BCFA 2HT4D 3QT2A 3UCQA 2PWDA 4RIRA 1TQBB 4WY7L 4XPFH 3DRQA 1A6AA 5I1DA 4NBXB 5C0GA 3F85A 3ULSA 2UXTA 4LU5L 4JPVL 4MS8D 3HZVA