1NCIA

Structural basis of cell-cell adhesion by cadherins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
GSDWVIPPINLPENSRGPFPQELVRIRSGRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-CADHERIN
publication title Structural basis of cell-cell adhesion by cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion protein
total genus 21
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1nciA00
5JYLA 4ZMLA 1ZVNA 1ZXKA 3K6DA 5DZVA 2QVFB 4ZMOA 4AQEA 3QRBA 5CO1A 4ZI8A 1FF5A 4AXWB 1EDHA 1OP4A 1L3WA 4AQAB 3UBGA 3LNGA 2OMXB 3FF7A 3LNEA 4AQ8A 1NCJA 3PPEA 4OY9A 3MVSA 2OMVB 4ZMZA 1WYJA 2OMUB 1SUHA 4ZMNA 3LNDA 4NUQA 4APXA 2O72A 2A4CA 2X2UA 3K6IA 4ZMPA 4NUPA 4XXWC 3FF8A 2QVIA 5KJ4A 2YSTA 2OMZB 4AQEB 4ZMWA 2OMTB 2OMWB 2OMYB 3K5RA 2WHVA 4ZMVA 1O6SB 4ZMTA 3K6FA 5JYMA 3LNFA 2WD0A 4NQQA 4NUMA 4ZT1A 1WUZA 4AXWA 4ZMXA 4ZMYA 2YQGA 2V37A 4AQAA 3K5SA 2WCPA 3UBFA 1Q1PA 1NCGA 4XXWA 3LNIA 3LNHA 1NCIA 4AK1A 2EE0A 3Q2NA 4APXB 3Q2LA 2WBXA 3Q2VA 2A4EA 4QD2E 4ZMQA 4AQ8C 5CZRA 3Q2WA 3UBHA 4ZTEA 1NCHA
chains in the Genus database with same CATH superfamily
4CC4C 2ESVE 1W0WB 3ARUA 1U8HA 2VDNL 4JFQA 3QBTB 2VYRE 2XBZA 3AWGA 4K8RD 3RNQB 6CGTA 4OJYA 3A67L 3RGVC 2DLHA 4GPVA 1U8CB 2PLTA 3VFWB 1AXSB 1OSPL 1CLZH 3AG4B 5DS8A 4HK3J 2N0MA 4UYQA 4FQIL 4DJMA 1URLA 4L9LC 2VC2L 1X5HA 3MLWL 5LGJB 4KJWC 3IDXL 4G80A 2D31B 4MQ7B 1CFTB 2W81C 3IGFA 4FFTA 3F04A 4UCFA 1UB6A 2XWBA 5PAZA 3T4AB 1TZHA 4P5MA 3I50L 3S3BB 5HVGB 1IT9L 1WAPA 1IBZA 3HR6A 2FCBA 3S3JA 4P2RB 5AW6B 5GS2H 5IHBA 2YBRA 2V2XB 3OXSB 1DVUA 2EDKA 4GQ9H 3DI2B 4FDWA 4JFFD 3MJ7A 3MV8D 2L0DA 4QHPA 4BSVA 1XSJA 4EIBA 1QPKA 1U8MB 1EXUB 4BFJA 1Q9KA 2ZXWB 3KPQA 5I74B 1VB9A 1N0XL 4TM9A 1DJXA 1OGAD 2X2UA 1KYOK 1Q0YH 2DWSA 4JDEB 5JORA 2JVUA 1W0YT 2HT4C 4OZHB 2VERA 2EQDA 1A9BB 3IJHB 1A4BA 3S2CA 1BF2A 1F6AB 4EQ3A 1E27B 2YPVH 4OGQC 3EJYC 3MN8A 4XOCA 3CFUA 4BFOA 5IHWA 4JPSA 2Q2EB 1IKNA 2E75C 2PXYD 2WKLA 3S2AA 1SDYA 3QUML 4MFHA 3CFCH 5JIDA 3L3IB 3OJMB 1YRKA 4G8GA 3MRIB 2QSQA 3K6FA 3WAKA 3DX7B 3EYFA 4L3EA 4YSRA 2X9ZA 1K5NB 1H15B 4ZMXA 3F58L 4Y1AB 4XP6L 4X50A 4E9QA 1KZYA 3BKJH 3C6LD 1B88A 3WELA 1S9XB 3RY4A 4YWGL 4TNGA 1OGPA 3L4UA 2XTSA 2W0KA 3IJYB 5HHVL 4WFEE 2KQNA 5IY5B 4KTYA 4FXGB 4YSAA 5A2KH 3KPNA 4XPHL 4FXKB 3VI3F 5F8QC 3ZYJA 2P1YA 1G9MH 5L4MA 1A3RL 3UTTD 2FD6L 5E6IC 2G5RA 4QTIL 2VZ1A 3U1PA 3ZDZF 1PVHA 4P5RA 1OP9A 1NUDA 4WKZB 2OR8A 4GO9A 3UCRA 3FFCD 1GPOL 3CU1A 2CHXA 2VDLL 4AYID 4XWOD 2BS8A 3KYKH 2X0UA 1E8YA 3HIZA 5ITBH 5IROC 4HWEH 3H4HA 4RDQG 4K23L 2CBQA 3H3PH 5ICUA 3EJJX 1IAMA 3R06B 4LEBA 3HW7A 5GSRA 5A2CA 4C4BA 1Y0LB 5TF0A 2VLKD 4H25A 4HCRA 4ZW8A 1G0XA 2DQUH 2XKNA 2J1WA 4L2LA 3ZQXA 2ZX9A 3QUYA 5JNYA 3ELAT 2JQAA 3BD5A 4F15C 4HEME 1A7PH 3QIWB 3D4ZA 4R5XA 3ETBF 4MJ4A 1JNHB 3KBEA 2L4OA 3ALPA 4AK2A 2X4UA 5KUMA 3FT1A 5IIEB 1HHKA 2EKSB 1SBSL 4MWFA 2DIBA 1AY1L 3HPLA 2FJFB 1HINH 5DJYB 3UYRL 4PREB 5C0AB 5KSUB 2QFRA 1DUZB 2FLBT 3I3DA 3Q3GB 4KDTC 5DQJB 2P8MB 2FEDD 4NZTH 4L1TA 1DFXA 4OD1H 5I6XC 4N9GB 2BNRA 5DVKA 3HG1D 4KNUA 3ABMB 5D2NE 5DMIL 1R46A 5T1LD 3UTOA 5IFAH 5GRJH 4AE1A 2VMEA 2QGDA 4YEEA 4L29B 4FLOA 3VH8B 5LGHH 4QLWA 1ZCRA 1WS7A 5J6GA 4NXKA 1HL5A 4XVTH 1E4JA 3B4NA 3SBPA 3CXHJ 1AGCB 1XGYL 4BRVA 4X5LA 3HHSB 4Y5XB 1G5GA 4GW5B 4WGKA 2Z92B 3SBWA 3CLEH 3S98A 1LXMA 3STLB 4B50A 2WSKA 2X4NB 1OKEA 5H4ZA 2B1OA 4E0RB 5EEVA 3SPJA 2H1XA 4RX4A 4X4XA 1SJXA 1K6QL 1TYJA 1QRNE 5C7ZA 3QORD 3GRWH 2N56A 1XCXA 1MHPL 5ELIA 1DEEA 3QI9C 1SM3L 4X9GA 1NUFA 3B83A 4HHAA 3VA6A 3UGUA 4F33B 1D2OA 1RULH 1NGPL 3APFA 3VVWA 1I1YA 3E9UA 3VGDA 4MJID 5CCKH 4B7IA 3QWRA 2NPLX 3NCXA 3IF1B 5KSAB 5B1KA 3HFFA 1QBMH 5I6OA 4BZ1A 2Q9OA 5DA0B 3LNHA 3PXHA 3TFKD 5J1SC 2DBLL 5J12C 3T0WA 4UANA 1XB6A 3MOBL 2RALA 3SDDB 3DX6B 1D7CA 3MUZ1 3UO8B 1S3KH 3B9AA 3D69A 1FYTB 2WOBA 3DMMB 3V6OC 2X4OB 3C8KB 2QHRL 3AS2A 1U92A 1DLHB 4PRPB 1NCHA 5HYJB 2D7QA 2GUOA 2IDCA 3K72B 4QYAA 2C9XA 5AW2B 2BLFA 4PTUB 5E9NA 1ZVYA 1UFGA 4KVPA 3FTYA 2ZCLH 1OIOA 1KTKE 1SRDA 4D9QE 5FHBH 2NLJB 3K8KA 3L5JA 4Z7OE 2NY7H 5I5MA 2D9CA 5DJ2B 3FUIA 4JREC 2VLRE 4D8OA 4PB0H 5F89B 3WG7B 2QLVB 4OJFL 2ADFL 2G9HA 2JLPA 4QTFA 1AR1C 1G9NC 4L23A 4GG6A 4JPKL 1E7UA 4TLKA 4QRPA 5FDYA 1CXIA 1JV2A 4QHMA 4B3EA 3MV11 3NSDA 2IPTL 2K7QA 3WXWH 1NBCA 4RIRB 1EO8L 4TVUA 2EYTB 4D9RD 1J10A 2XRAL 3BWUC 5CJQL 4RGNC 2L04A 4XXDA 3FT4B 3EDJA 4MYWB 1FNGA 1RJLB 2VLLB 4HMDA 1F00I 2EIKB 2J8HA 1A8ZA 1TLKA 2AANA 3IRCA 2WLNA 2X70A 1U8KB 1PZUB 3RPIB 1BD2D 1NM9A 3D09A 4X4MA 3II1A 1J12A 2AEPL 1ZVSA 4D0CA 4PJDA 2CCLA 3VWJB 4B0MB 4EE2A 3BKMH 3MRKB 1YEEL 4L4TB 5DD1L 5EUOF 2ZWSA 2VDQL 3UG3A 1OE2A 1F3DH 4JKWA 4ZOEA 2A7BA 4H1LB 5IFJA 4Z3EA 4XTRD 3DGGA 3R8BB 1E4XH 2WO2B 4MAYA 4PG2A 5GS2D 3DOHA 4ZMWA 3EFOB 4JRLA 2P80A 1C16A 4G42B 1OB0A 2H1LM 5M7QA 5G4MA 5CHNA 1D5BA 1HS6A 5KG9A 3BLKA 4IGBB 1QR1B 2Y06L 2YUVA 5EU7E 1RZFH 1TF4A 3AU1B 2RB8A 3EGXB 4JRXB 4ZFZB 2OPCA 3T8MA 3CX5K 5IMOB 5KBDA 2JV6A 1C1EH 3K71A 2NY0D 3TZVB 4MNHA 1T7XA 2BSED 3NZUA 4HPOL 1NL0H 5DMYA 5FYKH 3EYSL 3CPUA 2XOTA 1IFHH 4AGPA 5T33L 4ICXA 5EG6C 4K2UH 3HI6L 2CLZB 2IALB 3GJFB 3SCMD 1DJSA 3SDYH 2OL3B 1E9QA 1IM3A 4UQEA 4OR1A 2EE6A 4H4NA 4W9GC 5EO9A 2ITDA 1QSFE 3WMSA 4ZFOA 3JWNH 2F53E 2QZQA 3GUFA 1H8LA 3MROB 2HKFL 3N91A 1CIDA 1JXJA 3BW9A 5EF1A 1ADQA 4R2GB 3TIEA 3M8OH 5AVSB 3CNKA 3LN4B 3DX8B 2FT6A 3FO9A 4E9SA 1SYSB 5DK0B 5EFIB 2F8VA 4HS6B 2BNQD 4KHXH 4Z8FH 1H3GA 4Y4KA 4F7TB 4PJ5D 4P9HL 1K85A 1UTDA 3HS9A 2OMNA 1A1OB 1KCVH 1OB1A 1ONQB 4QXWA 2ETWA 4X5WA 1A9EB 1JZ8A 1R0AH 4N0FB 1JK9B 3OC5A 4NN6B 1GAFH 3FN0H 2WLHA 4PB9L 1I1FA 5TF1L 5IWLA 2D7TH 1TVHA 3NRQA 4I9WE 5E5RB 2JKTM 4M43L 4R4BA 5D6CB 5DDHA 1NEPA 4KI5C 1ZV9A 1S9VB 2WXPA 1IQWH 5I1AB 2JKLA 2H0FA 1JZHA 1PKQE 2HJKA 3DNKA 3E6HA 3E1ZA 3LKPA 4JG9A 1IAIL 3VFPB 4Z77B 4YQXL 3FUDA 2VDOH 2XACC 4Q4EA 3FUKA 2ZUYA 3DO4A 4S10A 3W9DA 3RFZA 1EAQA 2YO3A 2I24N 1NFDE 5DRXA 3ZE1F 4NKIH 3ZTNL 1MN4A 3VFTB 4HKBB 3T2PA 3H9HB 3V4PB 7TAAA 1XIWC 3LZFH 5C0RH 4NPYB 4TUUA 2DTML 4YLCA 1JHTB 1PSKL 1YG9A 1LDSA 3TH4T 3PDGA 2FX8H 3AITA 4PCTA 4TUKL 3MGTB 2BPBA 2HRGA 2WLMA 3GMNB 2PTTB 3H0TA 1T21A 3CZNA 2J1YA 1LEKA 2Q7YB 4AYSA 3QNXA 4NUPA 2AKRB 2CCWA 4UQ2B 4V2BA 3GDBA 3JZ7A 3ZYIA 5H2BB 3DK0A 2LU4A 1MIEL 4EIUA 1EH9A 4BGDA 3KPRD 2NX5B 3RPKA 3FCBA 1ID2A 2PYFA 4NI3A 5C2BL 1CYWA 2IH9A 1CUOA 4PJGF 4OT1L 3VXUD 3TN0D 1FL5A 1MZYA 5SV4A 2P5WA 1FFNA 2QVTA 4GSQA 5T1MB 3T77B 3BSZA 3C87A 4YDJB 4WKXA 4R96B 1QBBA 2J6EA 3J27A 4KK5C 3MBXL 3NCFB 2DJSA 4EAEA 4A2EA 3OSVA 4MXVF 2VITA 5FA4B 1MWAB 3ULSA 1RZPA 2H2SC 4N87A 2CIIA 3VFSB 4HJ0C 1FQ9C 3L1FA 4M61A 3OLEA 1BG1A 3VXMD 4OGYL 1XGQA 3VXSA 3T4YA 1I4FB 4JANA 5GJTL 4C55A 5IQ7H 1BQSA 4M3JA 4L05A 3ZHNA 3L3OB 3NVQA 1MVYA 2ZKXA 3QFJD 2DQTL 4HV8B 4NKQB 5IG7A 1X44A 1FO0H 1L7IH 1WWCA 4KO7A 1TTGA 2PP7A 2AJUL 1CI3M 1QSED 4OVVA 5HP5A 4RETB 1U30A 3M7FB 1N67A 4DGYL 2G9KA 4C56B 3DVFA 1GMIA 2HRHA 3MRQA 1ESOA 2QMKA 4Q6IC 1NIAA 1VACB 2EYSA 4JFDB 4O02L 2OJ1A 2E9GA 3DUUA 5K59E 1RD6A 1USQA 3RJQB 5CFHA 2E6JA 5EU6E 1EHAA 4D9LH 5ICYB 2RCSL 5D1QD 3SJVE 1XF4A 4PS4L 2EZ0C 3W39B 3BDYL 1OT2A 2VW4A 3MA7B 3P54A 4JFPA 4P57A 2WWKT 5DMJB 1R6VA 3DTXA 1CQKA 3U7WL 3LPGA 1EA9C 5C6WH 2WSDA 4ODSH 3AVEA 2Y5EA 2WBJC 4LB8A 4APQD 2DPKA 4JFWA 5EU4A 5E08H 3CDFA 2Y6TE 3B34A 1CGYA 1XF3A 1F97A 2D7OA 2OW6A 3BZ4A 3KEHA 1KTJA 5IBUG 4GFXA 4YXKH 5ISZE 2G75A 3I75A 1H0DB 3MV7B 3FONB 3IXTA 1K8IB 1UWYA 3R19A 1IGCH 5BMFL 4I1RA 1I8MB 3GSVA 2X6AA 4X6FB 4K8RL 4YDIH 5AZ2L 3UOAB 5DR5H 2O72A 2XWEA 1ZSHA 3QZWA 3ECUA 1DCEA 4JE0A 3NAAL 3C09C 2UZXB 4W4NA 4K71C 3D1MC 4WCYH 1E2VA 4WUUB 4JRWA 2V7NA 1J0YA 3GO1L 1CFVL 2Y7OA 5DMGD 3BSHA 3HG4A 3SKOB 2P47B 4U1NB 5IUSA 5A2AA 1KIRA 3GMPB 1DQKA 3EJTA 5KAQG 2LQRA 1R5VB 4TPRL 3R1GL 1CXLA 4JQVC 5EU5A 4AV5A 4UM9D 4P48A 2WN2A 1GJIA 1A6PA 5C08E 1AKJA 4BKLA 4UV4L 5FOBB 1N64L 3BWZA 3MUJA 4AYEC 1H19A 3VSTA 1RK7A 3QJHA 4LHJB 3KH3A 2EDDA 2VN6A 5FB8A 4NZRL 1N4XH 4CVZA 5JQIB 3CN3A 3VQ2C 4F7MA 1XGUA 2BVYA 3JSSA 1ZHKB 1H3XA 3OHMB 3VTTA 5I5RA 1UB5B 1YMMA 2WWKO 2FIRT 5SWSD 2IG2L 3EGDA 2ILLA 4Y4HB 3I6GA 3KVQA 5A6MA 3QO0A 4JDZA 5EZPA 4Y16B 2VIRA 3A6BL 2YEVB 1GKOA 1MI5E 5DJAB 2YN5A 1D9KB 4RGOL 5FGCE 3V8CA 3VRJB 2J4WL 4YL4A 1FFQA 2EIMB 1W8OA 5IF0B 2N0KA 1N70A 1U3HD 4AQOA 1ZAGA 5KBNC 5FYKD 2DJ4A 4L3FA 5CBAB 4YAQA 4QHNA 4YSEA 3JUYA 2CXGA 2NY1B 3KR3L 3MXVL 4IRZL 4R0LA 3KYMB 1K5WA 5GS3A 3G5XA 2HRPH 1AZBA 3K2UL 5C0JB 1ZEAL 2PW2B 4K7PH 2R69A 4OLWL 1PCXA 5TQ2L 3RIKA 4OW6A 4PGBB 4IBUA 4N1CA 5A1AA 4QHKI 4ZAKD 5GRWA 1YQ2A 2WKGA 2Q87A 5C1MB 4XAKE 3WFDL 2F7IA 4D7BA 5T5FH 2OYLA 2RTTA 5FUOH 3VXRB 1MNUL 2W91A 3SPVA 4KKBD 4KRPC 1ZIBA 2X3AA 1A21A 4JM4H 5MENE 2ATKA 2IO5A 4JB9L 4Q4IA 3V0WH 2AJVH 2IV9A 2BNUA 4FTVB 4BRJA 1KIPA 4YH6A 3ZHDA 5HGHB 2Y07H 4PLJD 1VFAB 3HUJF 2BSTB 3X14B 2OCJA 2AJSH 3W0WB 5KW9H 4PSPA 1WUNT 4Y9EA 1FYTE 1IC4H 4S1RH 5IKCB 1E67A 4MLIA 1BYOA 3BKCH 3BT2H 3PWLA 1A7NH 1WAAA 1EZSA 4X6EA 2EDQA 1KMGA 3HZ3A 1Z66A 3A6CL 5KSVA 2JIXB 5IQ9B 3DX9A 1QUNA 5IV2B 4BK8A 1KSRA 1YJDC 2RR3A 4KUZH 1CD8A 2RJMA 1MXDA 4PJFA 3VXOB 1JWMA 1KV7A 1CLOH 2FT7A 4QO1A 4I3RL 1S7WA 1XV8A 1T22A 4FN0A 5E2VH 1WA2X 1QWNA 1WEJL 1KPRB 5E8PB 1KIUB 4O9HH 4R4ND 2ZKHL 4E42B 3HN8A 3LRGA 4D8PB 2B5IC 2QKIC 1UD4A 3PAVA 3ZE2F 2N1TE 5AQ0A 3OR7A 3F7YB 2NT1A 3GMOB 4GBXA 1SY6H 4ZNEE 3NA9L 4XNXL 3TIDA 3TVMC 2VUKA 4U05A 5B21A 2DTSA 3HRPA 5KVEH 2NUTA 2WQ8A 1ITCA 2UWEA 2ZQKA 4K9EC 3WEXA 3N0AA 4HAFA 1Q0EA 3WYRA 2K1MA 4NHUA 3PV7A 2F18A 3CK0H 1PG7L 3B37A 1BLIA 2J73A 3LKNB 4NZFA 2B59A 4IU3B 2VM3A 2HMID 5E4EC 4IRJB 3CC5A 3NRPA 4UIKL 3HPJB 1NANH 3S7GA 4OFIA 1CDGA 1JHKH 1NAMA 2DBJA 1SOSA 2C7UA 3RY5A 4QNPE 2AABH 3PNRB 4NM4L 1PZ3A 3BI9X 1CD0A 1DBBL 3ISRA 4YDMA 1PEWA 3RZCB 3L3KB 3TTSA 2XN9E 1UCBL 4YN3A 1HC1A 5EU3A 2LAAA 3I9GL 4KJPD 5E5UB 1INQB 4MZRA 1RUQH 4Z7VB 1M2VA 5DQ9B 4LFHD 1UZ8B 4TXVB 2OX5A 1IZJA 2VLMD 5DD0H 4I8DA 1NDGA 4LCUA 5F1KC 5GPRA 2XG5B 3IGAB 2CR6A 2FH8A 1E90A 1QFWH 4X5XA 4YIQA 1TJHL 1CLYH 3WFHA 1FG9C 2XWJB 3EO1A 4AL8C 4BH8A 2N1KA 1RCYA 2QADC 5K69A 1CS6A 3EBAA 3SODB 4CNIB 1N5AA 3ULUC 1S9KC 3X3GH 3ULVH 1EXHA 1S9YB 5EOCH 1OOWA 3W3BA 1T5XB 5J4MA 1JOIA 1TDQA 3VCLB 1DSWA 3F6LA 5DQDL 5F0PB 1T66D 2EVJA 3MBWA 2I5YH 5GSVB 5KYYA 3RDJA 3T0ED 4F7EB 4L2YA 5AAWC 2P44B 4E9LA 1P53A 2K78A 5I9QC 3ZDXE 4NXSA 1SEBB 1Z6JT 3H53A 3OB8A 5DLLA 3N40F 3QC6X 3HC4H 1DQDH 3W56A 1V10A 1SJEA 2F15A 2A9MH 3GZQA 2HFFA 2YS4A 3TV8A 2OSYA 4JHWH 1CFBA 1UZGA 1VADA 2A6KA 1NMBL 4ZX3A 1N5YL 3MFGB 4ZXBA 5C9JA 1BX2B 1XCTB 3H9SE 1OF2B 3MJ9A 4KX8A 3TO2A 2J1XA 1IM9B 4J1UB 2OZNA 4OQTA 2ID5A 3QXDB 5CM1A 3CZUB 4WSGA 3N85H 3CDGA 3U1SH 4JFZH 4LLQA 4KKCD 4XCFH 1CLZL 1W16A 2NTFB 1RZ7L 1JN6B 3B9VA 3DDFA 4XN1A 1KEMH 1VCAA 4HGWB 4YK4C 3CSPA 5TFSH 1AAJA 1JF5A 1GY2A 3LQAC 3MYJA 4WNSA 3WFBH 4L4VE 1SN5A 5DJDA 1JWSB 1E4HA 2C7FA 4FNQA 1C5DB 5LG6A 5IR1B 2VRKA 1HYRC 4H0GA 1J5OH 1TFHA 3QS2A 2NY4D 1BQHB 5HPMA 5C0GB 4HF5H 4HMEA 4WAFA 4ELMF 4DK3A 3BP7B 4GQ9L 4K73A 2UX6A 4MA7H 1XBRA 5LN8A 1HCZA 4GSUA 3UBXA 5IEKA 2K3TA 3WUWG 3WNNA 1IC1A 4J3VA 5JYLA 1Q0YL 1U8IB 3U46B 2EECA 4ANWA 3DECA 3VXQB 3K4DA 2AXGB 3TFBA 3DO3A 2YD7A 2ADGA 1HEZB 1LEGB 3BISA 2YPVL 2PR9A 2YAQA 1FL3A 3KMDA 2ED8A 3S4SG 2Q0ZX 1G6RH 4XP1H 1DJGA 1ILUA 3DV6A 5FO2A 1ACYH 5CSZA 5HI4C 3APDA 2E6PA 4O5LL 1QVOB 5AW9B 2NNAA 3ESVF 3BH9A 4ZS6D 4NO5A 3CFCL 2X7LB 2PCXA 4UNVA 1A7QH 1IVLA 3FKUS 4FI6A 3HMXA 4Z7WF 4CAGA 5FCSH 3F12A 3B7UX 1XH3B 4JDTH 1YHPA 3NZ8A 3EJZD 3BKJL 1B4JH 4AKPA 3ABZA 3QIUB 3EH1A 5SX5H 1EWHA 1CFMA 1H3TA 3PQYB 3UC0H 3MLTB 4YBLB 4FQXA 1QX1A 4ELKA 4F1SA 1G9ML 3ARDD 5JW3H 5JPNB 2BW5A 2E56A 2PW1A 4YC2B 5I0DA 1AXIB 3BJ91 5D1ZB 3FO2A 1GGUA 1FNEA 1SDDB 4MSWB 4K9JA 5C0BE 2ZOKA 3PABB 4MS6A 4IS6B 3FU5A 1KTDB 3A22A 3KYKL 3GS7A 5DD3L 5ITBL 4YHLH 1TQCB 1JYNA 1E3XA 3H3PL 3SGJC 2XWTA 3JVGA 3LKQB 4A66A 5D1XD 4UT6H 2DQJH 1MFCH 1OSZB 5IMLA 2DQUL 2VDNB 2R7EA 1IQDA 5L8JB 4NO2B 2FSEA 4OZIB 2C1PA 4OZ4A 3JWOH 5IJCC 4RA3A 3RVUD 3OKNB 4ODXB 1A7PL 2ZYSA 4WIQA 2R51A 4PJ9B 3TWYA 5IVNA 5B22A 4GW4B 5INCA 1T7ZA 5HYEA 5ICZB 1USZA 1LQBC 4LSQH 1LP9E 2H4EA 2J5WA 1JPGA 3MBEA 4IOIA 2QQLH 1HINL 2VC2B 4URTB 3NJVA 3M1OA 1PAMA 2CO6A 1WA1X 1NWOA 1J9SA 3AUWB 3HHRB 3OLDA 4J3OC 1JERA 2D7NA 3MNMA 4NSKB 4G6KH 3BPNC 3VXPA 4ADIA 5C71A 4HK0A 5DEFA 4LLYB 5TDOB 3GXFA 3MODH 1QEWA 4D0BB 4HDIB 1O7DC 4H8HA 1OF0A 1F1AA 4R7XA 4X42A 5FYJH 3VJ6B 3LQZA 2CLVA 5JW5B 3HE7D 3RKDD 1UD6A 2XQYK 4AIZB 3ETBJ 4XVTL 3UTSA 1KGUA 3BUYA 3L1EA 4PJ7E 4ZUWA 3VB8A 5CLTA 2Z91B 3O6FC 4MZ2A 2D3VA 3P77B 3CLEL 4J5VA 3CX2A 2FLMA 3PWVA 3PAYA 1RPQA 2YPLB 4V1DD 1MLBB 3TX4A 1I3RB 1DBJH 3WE1A 1G1CA 4RWYH 3HC3L 3HOGA 3L2MA 3RDTA 3GRWL 1OEZW 3QUMB 2XZQH 1PNDA 4MZ3A 4UQ9A 1WLHA 3IJEA 1NC2D 2DIAA 3VFVA 4Z6AT 1XEUA 1RULL 2IOOA 4N3UA 1UWXK 1BVKA 2FJGA 4P2OA 1P7QA 5CCKL 3VU2A 2EO9A 3KPTA 4R97C 2PUQT 1OANA 2GJPA 1I1AB 1I7UA 4ILDA 2Z0BA 4S0SD 4MD5A 3PWUB 1KCRH 1RZIB 3HE6A 2O61B 4FG6C 3RI5F 3MGOA 3ULVD 3WN5A 1S3KL 4LCIL 3GKZA 5C3TA 3UO1H 2AJZB 4Q9CA 3U79A 2N4IA 1XDTT 1NA8A 2K6YA 5AW3B 2FEEI 2A0LC 2I9LA 2R2HB 1AGFB 4Y19A 1JIBA 2PCFB 4Z95H 2AV1B 2EXYC 1X5JA 2JXMB 2PWEA 2X44D 4N8VG 1U91A 4B9ZA 4P5TA 2OR9H 4I4WB 5FHBL 4NQQA 1AMYA 1X7QB 3D07A 2NY7L 4PJ8C 5JMOC 4J27A 3TPKA 5GRYA 3GTTA 4DGWC 5EWIH 3FT9A 4M48H 1HI6A 1C08B 3VYPA 3O4LE 4OV5A 4OTXH 4QRRD 2E9WA 3BT0A 2JK5A 4NP9A 5G4NA 2GSGA 4MDJA 1Q1PA 2BOCB 4DK6A 3HB3D 2H32H 1LO2H 5I76B 5FKAA 4HWNA 2PF6A 3UXFA 3JYBA 5KSBB 3VI3A 3FQRB 3QPQC 3GQFA 3MLXH 5CIPH 1MHEA 4MB4A 3RIFF 1JE6A 1WHOA 1VHPA 1CR9H 4YHIA 1RURL 2JCWA 5FK9B 4BK5C 4KROD 3RWCB 2J1ZA 1QTPA 2C9UA 2DMHA 4OLUH 4HGMA 1ZXKA 5IW6B 2BO0A 4NQCE 2OMZA 1ZPLA 3LEVH 3EBIA 3SDCC 4Y9BA 1KYAA 1JZJA 3D2UB 5CP7B 5ID1B 1JBJA 4A63A 2F0CA 3HZYA 2DICA 3TNNB 2GJ6A 3CFEA 3EO9L 1MY5A 3Q44A 1VFBA 3CH1A 4AJYV 5A7EA 2YLHA 2BC4B 2GITB 2MTPA 4GRLC 4RMTA 3QJQB 1UT9A 5CNHA 1CWVA 3U1QA 3V6FB 3UZVA 3WHE1 2GFBB 3F84A 3V0IA 3APNA 3KBFA 1RZFL 3QK0A 4LP5A 3K0WA 5DTFA 2MCMA 4EO5A 3O9WA 1E42A 1C1EL 2Z0UA 3WS6C 1SDAB 4CN6A 2IDFA 1MF2L 1VZGA 4DP2X 1ZLWH 1HWHB 1JGDB 2AV7A 1NL0L 4IJ3B 2AJYL 5ANMA 5FYKL 4P49A 3RIAK 3F65A 4BH7A 5GRXG 1IFHL 4XN5A 4PJCE 4Z7QE 4PHXA 4MXQC 4B9GA 5CBEB 1QLRA 4DCQA 3S8WA 4B9YA 1NFIB 2VDMH 3B2VH 3E2HB 4TVPE 3SDYL 4PU2A 4FNUA 2DM2A 3T4AC 1Y6KR 4HZLA 1UOKA 4TN9A 3HMWH 4BWTA 2VB5A 2P8LA 1KPUA 2V5TA 3MNDA 1NGWB 3M8OL 4RZCA 3N3EA 4F91B 2WNGA 5B38G 3STBA 4Z7VE 5KYWA 4KHXL 4Z8FL 2Z31B 5AVUB 1HT6A 3VFOB 2UXGA 1S78D 3BP5A 3NFNB 1KCVL 5F1SA 5F1OB 1QHOA 4JFOB 2WWOA 3DO7B 1R0AL 2X05A 1GAFL 3FN0L 4FQ1H 2EO7A 2Z7WA 3FB6A 4JDVA 1U9KA 4HUMB 2BHUA 3O11A 3RNKB 1HZKA 1VEPA 3KPSD 1DVQA 3R4DA 5I5JA 2W60B 4A7GF 5IVXF 2VDOL 4L8CA 1PU0A 3HKFA 3W57A 2GTZB 4R5TA 3I9AA 1XEDA 2H6OA 2R1YA 4PJAB 3T6XA 2WINA 5C6TH 1NUGA 5I82A 4C54A 2DYPD 4HIJB 3LZFL 4K94L 4NBXB 5C0RL 1D7DA 4TLUA 3R18A 4XMZA 1M56B 2Y7SA 2FX8L 2Y6SC 3CHPA 1SYVA 2Q6WB 4UIMA 1BOYA 5KBPA 2IBZX 4YBQD 4FXGC 4IYKA 1HJCA 4DZ8A 5D70H 2ZWZA 3G3LA 2BVPB 5E9DD 2CDGA 4HKZA 2EEFA 4KGJA 5AG8A 5ACZA 3EG9B 2PO6B 3DTDA 5EZOH 1KC5H 2H47C 1CJYA 2Z7UA 4KWUA 1SLWA 2VDQB 5B7EA 3VG9B 1HZHH 2X4RA 1FNLA 2X4QA 4ABQA 3ASWA 4GP4B 2FO1A 2ED9A 3AT0A 1HDMB 2C9AA 4LKCA 1DQJB 4I5BB 4WUKH 1BZ8A 4M1GH 2UXTA 4Y2DD 5JA9A 4JGNA 1WBYA 3FQUB 4OGAD 3SY0A 5FYJD 2MRYA 3UBGA 4HJEA 4MNQA 4GAGH 1RERA 5SWZE 2F58H 3CTTA 1G1OA 4U6XB 3VD0A 1EBPA 2F5AH 1RPUA 1IAIM 1SHSA 3UAEA 3BIAX 2WIMA 1J8HE 2QT6A 5F1IB 3S5LA 5KN5A 4GUOA 3QIWC 2ZXDA 3T6ZA 3PV6A 5D2LF 1A9VA 2D03H 5E9AA 5LUMA 2CDEA 3QEHB 1G9EA 1CD9B 2CO1A 5IQ7L 1YPZF 1EHKB 4MCYA 4QI3A 1E28B 3AW5A 5AKTA 3DSNB 2CHWA 2GKIA 5HHOE 3MMEA 5D7JA 1INEH 4NOBA 5EUOA 2YKKA 4RDBA 3QXAB 5C8JA 5CP3H 1FO0L 1L7IL 1FLRL 5DJ6A 3WGVB 4ANXA 3S0PA 3BQUB 4LP4A 4QXTA 3F62A 1N3NB 4NZ8A 1T89A 3BGFB 4B9IA 4P9ML 2FO4B 3O3BA 1E65A 1R19A 1JAEA 5DJXA 2CIKB 1T80A 1YSOA 1HILA 2DWDA 3U9PL 1KBBA 1GS8A 3BWUF 4N2EA 5A3ID 4U7KA 5J0BA 4D9LL 4Z7UB 2EEAA 3CN4A 2F7QA 1HCFX 2GK0B 4TLSA 4HIXH 4Y5XC 4LNVA 1NEZG 1AD9B 3VW3H 4DGIH 1TEFA 5D7LA 5DD6B 2ADJA 3Q13A 1FL6A 1IL1A 5KS9B 3FO1A 1AGEA 2WTOA 1WBZA 5I1LB 1JD7A 1ZPUA 2KZBA 2WXFA 3SKNB 4PP1C 1X5YA 4Q9RL 4ERSH 3GC3A 1TKWA 2PCYA 1QFUL 1TQUA 5E08L 4UDUA 1GOHA 4JY4A 3AS1A 2ZSWA 3LCYA 4LCVA 5GRVL 1OP3K 5CU5A 2FL5A 1EGJH 3C5JA 4U3SB 2E7HA 2PP9A 5IJVB 1GL4B 4UT7H 3BEWB 4ADJA 5F9JB 3NZSA 1IKNC 3I2CH 1OTUC 5JO5A 2DLTA 2VABB 1HYSD 3BYYA 1CGXA 4I77L 1D6VL 4YDIL 1RXLA 5EO1A 2WNXA 5DR5L 2GI7A 3DBXB 2ZXQA 4BELD 4AJVA 1DQLH 4I9XA 1RH8A 5CU9A 3RJOA 2VGLM 3SDDC 4YSSA 3QDJA 4WCYL 4G9FD 5D93C 1Z3GH 1JZGA 4ZUUA 5LLIC 5C2UB 4JK0D 3DMMC 4HAGA 1J9QA 4ZUTB 5AVXB 2IXQA 3MNZA 3V7AG 4JJ5B 4DGVL 2HLFD 1SOQA 3PUUA 1U3JA 1E2WA 1IGJA 4BSJA 3C6SB 5GGTA 4ZPVA 4OBRA 1UYWH 3LY6A 1OQOA 3QUXB 3EOAA 3CFBB 2VLJB 4IU2A 2ESVD 1L0YA 2X6VA 3MR9A 2NQDA 5TQ0H 1ML0A 1KFGA 3ZKXB 2CJ3A 1UG9A 1YN7A 4HWZA 4M7JH 4OAWA 1FI8C 1BG9A 4MRCA 1KGYE 4JFYB 2WNKA 3VGGA 1PY0A 1OALA 1QKZH 1K9TA 1V8HA 4B60A 1M7DB 3NUKA 2GCYB 5BZDA 4K5LA 1MLCA 3BFQG 1DBML 3C2AH 3KG5A 3QUYC 3B7RL 4L4JA 3C6LA 4KI5F 1KYDA 4AYGA 5KJ7E 2UUDH 5TDNA 2WVVB 2IOMA 3QGVA 1KENH 4HP5A 2ENQA 3FC8A 4PJGA 2RIKA 2HRPL 1HNYA 3JZYA 3P11H 1ZLDA 5CILL 1MPAH 4I0PA 5DI8B 3S5ZA 3TNMA 4K7PL 3WIHH 4U1MB 1OWRM 1OK8A 4E9VA 1IO4C 5JHLA 1UXWB 1EEQA 3B5TA 4IIQA 1WPCA 4O02B 4TOYH 4K3DH 3WNMA 1NSNH 3S3DB 1ES0B 3V5KB 3FFCA 5GGRA 4OJAA 1NGXB 4C4KO 5T5FL 2M1KA 4TNVK 5FUOL 4UAOC 5LNGA 1DO6A 3TO4A 1X9QA 4X2UA 2H41A 1AQHA 4N2CA 4IGBC 1PG7X 3HCVA 5DUPH 5G55A 4MMZB 4JFEE 3V0WL 2IMNA 1I8IA 2OCFD 2VLKA 3IU3A 3QG6A 4FQ2H 3T71A 2RQ8A 4F7KA 3LKOA 1T0NA 2NY2D 4WFHE 1L9OA 3L3GA 2AJSL 5KZCD 5KW9L 2B16A 3GSWA 4XN4A 4NO0D 5DEGB 5DYOA 4X4ZA 1IC4L 4S1RL 2Y5QA 4YSDA 3X13B 2BHZA 1CFSA 1F86A 3BKCL 3BT2L 3LVEA 1A7NL 2HLAA 4A2FA 1CGWA 5D7IE 3P1VA 2QVFB 3UABA 4XH2B 4CU7A 3KCPB 5B8CA 4D94A 1ET7A 2RD0A 1F6FB 4K3EH 3WLWD 4ADGA 4WFED 5CEZH 2FR4A 1D6EB 1TCMA 5C0EB 1JDDA 4KUZL 4R2GC 3EBHA 4NWTH 4OCYH 3BAYA 1QPPA 2EXWC 1A6VH 1CLOL 1ZA6A 1EEUA 3K81A 3MUHL 3P4MA 4X6CF 5E2VL 1F3JA 2GHWB 3B6SB 4U1GB 3WJMB 5E6YA 1K2DB 4I1NB 3EXJA 3UBXI 4O9HL 5FKPA 3L6FA 2NY5C 4NUJB 4HLZG 4AQAB 3F83A 3DTUB 1AQDB 3BAXA 5GRUH 4GP5B 2CQVA 2VISB 5I17B 3NSYA 1PY9A 1ZDQA 1SY6L 1BEYH 3DJ9A 3QEQD 1CG9B 2AZUA 2FQFA 4LBAA 4LSSH 3G6JF 4JFFB 1J88A 1BDYA 5KVEL 4XGZA 3MV8B 4JHBA 4XNMA 5JIPA 3PJSA 4CGUB 1RJYA 2WZ0A 5JUEL 5EF0A 1AIFA 4YSQA 5KBKA 1OGAB 3LKRA 3CK0L 1AJ7H 3H7BB 3FU3A 4MYPA 4XRCA 1QBAA 9PCYA 5CD3B 4EI0A 2ROYA 4IW4C 3DC0A 3K6SA 3QNYB 2VL4A 5EULV 5KJ4A 1JHKL 5AD0B 2B9AA 1EAPB 3JV6A 2AABL 3CFKA 4JPIB 4PRBB 3QWOB 4Z7AA 5I0VA 5I15H 3PHOA 3TXAA 2BOBB 5I24A 1GXEA 3HS0B 2PXYB 4M5YH 4JE4B 3WUWA 3ZN6A 1IBYA 3WEBA 3H55A 3C75A 3RHWK 1BZEA 1JNNH 2NUPB 1RUQL 1UXMA 3PGCB 4XB8A 5I8KH 1QSVA 1QFPA 5LBSL 5A40E 4NQDA 3C8HA 4QRUB 5DD0L 2JKXA 3S6CA 3U9WA 5EH1A 3QSKB 3HAEG 2NSXA 1CLYL 4B53A 4G83A 1V3LA 3KVDD 2J25A 2WB1A 2F19L 3FB8B 3X3GL 3ULVL 4DERA 2BSRA 2YRBA 5EOCL 3HG5A 5TGBB 3SDAA 5DLMH 1CLCA 1O7DE 4L37B 4G8IB 4MMXA 4U1KA 4GAFB 3PWNB 4HUWA 1MJJB 2XDHA 3K8LA 2I5YL 3UTTB 5FHAH 3A23A 3V5HA 1QRND 4WK2B 1UT2A 2O26U 3VI4F 1XD0A 2CK0H 4UTBA 2MNWA 5FFGA 3ET9F 4DWHA 1SVBA 3L95B 3PP4H 3TYGH 3HC4L 1DQDL 3Q9QA 4H5SA 4HUCA 5DRWA 3T5WA 3CBKB 3JV4A 2A9ML 1FN4B 1WD8A 4JHWL 2A73A 5KYUA 1ZHBB 4AE0A 5G5DA 5CLYA 1EFXA 1IARB 2HN7B 1YEJH 7FABH 5IVZA 3DHPA 5F7YC 1A14H 1RZKL 4HPHA 5D72H 1AKPA 4ZW3A 3ETTA 1LO5B 1PFOA 4ODUA 3MRBA 5T1KA 1TT6A 4YUEH 2HFEA 4OLEA 3N85L 4NIYE 4FKEA 3VGFA 3U1SL 4JFZL 1A02N 3L17A 4ODWA 4XCFL 2ZF9A 2IH8A 1MJ7H 1XT5A 1BW8A 3ARRA 3U0PA 2JSFA 5GGSY 1KEML 3ZIMA 1OCOB 3MLZH 2EUZA 3QEGH 4YHOH 4K5PA 2D4FA 2DRUA 1F18A 5TFSL 5KVFL 4K7FA 5DZAA 4D9QD 3HUJA 5TD4A 1BFTA 4P3DA 5K9KB 1P1ZB 3HG1B 5T1LB 2W95A 4Y5YB 1ZS8B 3EUDA 3HJ0A 2VLRD 1J5OL 3P73B 1S8DB 4N6RA 4ZQKA 2G60H 1OCCB 3EAKA 1LQSR 2IANB 3K6IA 12E8H 2UYLB 3GS0A 4MA7L 5GJSH 1Q0XH 2XPGB 2BSEA 5GZNC 3FCGA 4O2CB 2GYSA 2WQUA 4GXUN 3LJ3A 4ATTA 2BCKA 3KM2A 3KW8A 4IEFB 2BCMA 4J6IA 4FHKA 5T3ZE 2EIZB 4LCCB 3FBQA 2AQNA 3B9EA 3EO0B 2TRHA 4G6AC 3QORB 4HJGB 5C07B 4LLMB 1G6RL 3VE0A 5BOJA 5CZXC 1MH5A 1ACYL 1BBJA 5L4IA 5TE7H 2XTLA 2B1HH 1T7VA 1S7QA 4L0PB 3RX7A 5D4IA 4DVBB 3OJ2C 2Y7QA 2YQGA 4MJIB 1L9RA 3K91A 4RMQA 1PLCA 2JLLA 1A7QL 3HKZA 3A24A 1A4KA 3FUFA 5HHNB 1P6AB 3RTQA 3E8VA 5AG9A 1H3PH 3ME0B 3UCQA 1DVFD 3CIAA 3EHBB 4TKWA 2OSLB 3BO8A 4A6YL 3UIZA 3WE6B 4KXZI 2V9RA 4U1SB 5AOJA 4JFVA 2J8OA 4NQEA 2G9HB 3LHAA 4OM0H 2IQAB 4XP9H 4X4YB 3ARXA 4I2XE 3UC0L 2P5EE 4Y16C 2JMRA 1HHGB 1MKFA 5HVHB 4OFQA 2NOYA 1I9JH 1AD0A 4O4YH 2J8UE 1P1VA 1EQWA 5JW3L 3U7YH 5I19H 5GZOC 1D9KC 1JZDC 3IDJB 4N25A 3FSAA 4MJ5A 1T1XB 3S3PA 2VH5H 4B9PA 1NBYA 2ZCKH 4PR5A 5JHDA 5L2JB 3GSXA 5D7HA 1NCNA 2OLDA 4AKOA 1PZ2A 3VNYA 2O30A 1ZK5A 3MUGB 4YHLL 1QSFD 2Y72A 2CBPA 2F53D 5HHME 1U3YA 1YN6A 1NDTA 2VMDA 2NY1C 2DQJL 3PWPE 2V9UA 1MFCL 2DM4A 2ZOLA 4GXVH 4UT6L 2FX7H 4XNQA 4HC1H 5ERWB 3AQZA 2XPZA 4N8VA 1M1XA 1HXYB 2OS7A 3FTUA 1BZQK 3QR0A 4CADB 5F44A 1OTTC 4OF7A 5FGRA 5T3XE 3O6MH 3Q8FA 5TH2B 2NSQA 4G5AA 2P7TA 4PM1A 3SB3A 1SOKA 2A3TA 2CHDA 4HEPG 1IEBA 2HVBA 5JIMA 1F3DJ 3DYOA 3IDIB 1IGTB 4P4RA 2QQLL 3EYQD 3EBGA 1CURA 1CFQB 1UUSA 2FQGA 1BD2B 4RQQA 5BNXD 2RMNA 4I9WD 4WWKA 3FB5A 1PLBA 1OPGH 1R1CA 3J07A 3OMZA 3HI1B 1SZNA 4P59H 1F45A 3GI9H 1KGCE 1QYGH 3CZEA 3WIAA 4G6KL 5C3IA 5EBMB 2MOQA 4BIKA 5KYXA 3GSUB 3R0MA 3MODL 3ECBA 4W70A 1JPSL 2XICA 2BSBA 3ULUF 2BIIA 5FYJL 5ABZA 1VENA 1BMWA 2D7PA 4OZGF 3FRPA 2BY2A 4MQXD 2JI2A 4LHUB 1U4FA 3E7JA 1MG2C 5FLUA 5HJ3A 1RZGA 2A6JB 5EPMB 1J7VR 3OF6D 4J4PC 4WI7A 3BVVA 5B1BB 3SPGA 1U8LB 2NY0B 3HFMH 2VLJE 3QNZA 1KT2A 1DBJL 3PE9A 5IM7B 2IGFL 4MCZB 2QR0B 4BFRA 2XJKA 4AZUA 3KXFE 1RUMH 4I7ZC 2DWEA 2CO7A 1CN4A 3SCMB 2XX1A 1HOEA 4YDVB 3SD5A 4ELMA 5D1QA 4OI7A 2XIBA 3MNWA 1PIFA 4O51A 3KDMA 5E56A 2CGZA 1I7RA 5E6SB 5I5IA 2X12A 3WI9A 3NABH 4UMGA 3DUHA 1WYJA 3T6VA 1KWKA 2ZWNA 4U1JA 1UVQA 5E6UB 2AF2A 2BNQB 3HRZA 2W9EH 1ETZB 4PJ5B 2CJTA 1BECA 1QRKA 4R5VA 5HHXH 3ARGA 4H1LH 3UO1L 2F74A 3RWJB 5I1GL 1E2ZA 4OM1H 1GZQA 2CO4A 1ZVHA 1CFNB 2OMWA 2VO5A 4KITB 2WLIA 4PW9A 3UIYA 4IRJC 3T0VA 4ENEC 5BS0A 3IS0X 3DPBA 3MX0A 3SE9H 5I1KH 3IKCB 4PCKA 4NUGH 4WQOA 5H94B 4LAQH 2ZG2A 5HD8C 2H0JA 4NN7B 4Z95L 1JXGA 1ZWIB 1A7OH 5ANHA 2B8OT 5IHZA 1S7TB 3BPOB 3KCWA 4NKDA 5F21B 3RZCC 5F3BA 2BP0A 1JGEA 2OR9L 5GGUB 5C0NC 2YN3A 3BH8A 2VXUL 3AJ7A 4PJEF 4AH2A 3FTXA 4PRAA 4Z7WA 1F02I 3OKMB 1HNFA 4TQHA 4U0QB 4M48L 5BQ7B 2OM5A 1DE4B 5A2LH 4AITA 4NBYB 3NIFE 4OTXL 3DVGA 4YSPA 5HGAA 1HIMH 2QPSA 1WWBX 4AM0Q 4J39A 1MCQA 3GTVA 5AL0A 3GJFH 4XP4H 5EU6D 1LO2L 3QPXH 5E23A 2AJ3B 3LEXA 4PJIB 3SJVD 4QCIA 4D0DB 1JF1A 5EN2B 3VFUB 5EORH 1JG9A 1YMHB 1F42A 3N9GH 3MLXL 2BY3A 4AM0A 4UZGA 1DR9A 1CR9L 5DHXB 1FNFA 3CDCA 2W07A 4L1HA 2HSIA 2OAAA 3ZE0B 3KPRB 4P4KA 3T2NH 2VM9A 2H8PB 5ISZD 4OLUL 3B3IA 4POYA 5MEOB 3I6KA 3KLHC 3VXUB 4JZJB 1X5GA 3LEVL 3TN0B 3GMRA 1S5HA 1VGKB 3UAAA 1BBDH 2HB0A 1KTLB 4JMXA 3QDGA 5C9KA 3GSOA 5J1AA 1HWGB 5B39G 1U3HA 2ZE0A 4OCSH 3PG2A 4FQHA 2NXYD 5HI5C 3MFFB 4N2LA 1NGYB 8PAZA 4LQFL 3I6LE 2APTA 3VXMB 3MRRA 1L0QA 4WU7A 4G8GE 3JWDC 4GKSA 1XF4B 5FIEA 4MD4B 5C08D 4FA6A 4L3EE 3QFJB 4XCYB 1JZ6A 2COVD 4PCYA 2X09A 3TLRA 4PGJA 3CZFA 4MDIB 3R8QA 5HHPB 1LK2A 1QSEB 2VDML 3B2VL 2DKUA 4X7DC 5IQLA 1P7KA 5C0FB 1Q9OB 5J9PA 4KQ0A 2IWGA 5CLWA 3X1BA 4WFFE 1Z9MA 2JKSA 3HMWL 4G3YH 3GMMA 4QIRA 4CMMA 4RVBA 3UJJH 4NNXB 5F6HJ 1SVCP 3VFMA 3WFCH 5J1TC 2AQPA 3ZU8A 4BZ2H 1MI5D 1W72B 4H7VA 4JUTA 3FHAA 1A3QA 2FATH 3RWHB 1ADWA 3RVXD 1EO7A 2BRRH 4RBPK 4F7PA 5K33A 2C1OA 3X3FH 3QAZC 4PJBB 1VFMA 4IBZA 4OCWH 4TTDD 1U93A 2RACA 2H3NA 5B1CA 3Q0HA 4FQ1L 2XC8A 4APQB 4J3OF 4UBDC 3V6ZB 1ORQB 2CCVA 4E68A 3RVVD 4DN3H 4CKQA 2N7SA 2VN7A 2WQRA 5LBVA 4JKPH 2DKMA 3CHQA 1P9MC 2VRAA 1PIGA 3I02B 1YEDA 3ZKSD 2EEXA 3T3MF 4Z7NF 3BZ5A 4A2HA 1C9SA 2YUWA 4WI4A 6TAAA 4CC4A 2EYRB 2XQ0A 5IGXH 1OQXA 4LF3A 3PGDB 5DHVA 1ZTXE 2QL1A 1YDPB 3RGVA 5C6TL 2YKLH 1KY7A 5GHWL 3P3UA 1A1MB 4DHLA 2J43A 4LARH 4MMYB 1PZBA 1HOCA 4JGJA 5BZWB 1EUUA 1YVLA 5KSAD 3X12B 1L5GB 1IBGL 1H6EA 5MEND 2YUZA 4YBLC 1U42A 3TEUA 3FOMA 3G6AB 4HH9A 5D70L 2BNRE 1ZT1B 4UM9B 2UX7A 1AFVH 2XV0A 1B3IA 4H26A 5H35A 5JPNC 4YC2C 1UXSA 5D1ZC 4OKVA 4BA0A 1FYTD 1KC5L 3HBPA 5B4MD 3V0HA 1MDTA 1HZHL 1SJMA 4F3FB 1TU2B 5LXGH 5SWSB 1TQCC 5IB3A 2VWEE 2Z4QB 1XR9B 4WUKL 4AT6B 1LO0H 4M1GL 3VA2C 2W1NA 3ARWA 1F13A 3RWEA 4RMWA 1NLDL 1U8NA 4GAGL 2QQNH 2IPUG 4IDJH 2F58L 5IVOA 5E8EB 1G7HA 3HZVB 2GVYA 2KHAA 2K70A 4PFEA 1FVDA 2X0VA 3PU7A 4A55A 2F5AL 3H6AA 1ILSA 1Z9NA 4PJ9C 2IANE 3V4UH 3BKYH 1A6WH 5KOVC 2D03L 1PQZB 3GBDA 1BPVA 4NYLB 1S7RA 3WS3B 2QSCH 4L8DB 2E47A 1CDIA 2ADIB 1R5WA 2IFFH 3TP4A 4G5ZH 4PG9B 1INEL 1YEFH 4XVUC 3VYOA 3ZT6A 2HP4A 1FHGA 4PS7A 5CEXA 3N44B 3T0EA 1BIIA 5C07E 1TZIA 1NFKA 4ZAKB 5CGYD 1EDHA 3MHZA 4XCEA 1MFDH 1SFDA 3HHMA 4HSCX 4WHYH 3G5ZA 1V54B 4LSVH 5AVTB 3VWJD 3AG2B 4ELDA 3HLAB 3QRFM 4C83B 5E6IA 1C8QA 2OXHB 2AXFA 2Y0SA 4HIXL 2C3GA 3P3YA 4QOKA 1I3VA 3BUTA 3KS0J 1JK8B 3OKEB 4Q58C 2JCCF 4DGIL 5MI0C 4Z23A 2XN9D 1B0IA 4HKXA 4AVHA 1E7VA 3HZKB 3O8XB 1A1NA 5ITFA 5MEQB 5A43C 2LLLA 4YNYB 4MD0B 2ED7A 3WNPA 2HTKC 1HL4A 5IROA 4M7LT 4ERSL 5K93A 3MV9A 4NNYB 4HGKC 2HVJB 1ACXA 2RBLA 3QXUA 2UZIH 2DD8H 4JM2D 4QRPE 4S0TD 2VDOB 5E5MB 3CFJB 1S9WB 3TZVD 1EGJL 3PHSA 1VKXB 2UZYA 2DEYX 4HIIB 2N7AA 4UT7L 4X6DB 4GI8A 2OSWA 1FWXA 3I2CL 1BQKA 5SV3A 2VDRH 1I1AC 1N8OE 2VKWA 3KZ8A 2UWEB 4JBSA 4XZUA 3ILEA 1DQLL 1ASOA 1QR4A 1A3ZA 2CRZA 2IBGA 1O75A 1Z3GL 4X4ME 1WK0A 5HJGA 4PJDE 5FO9A 4MJJA 1G7PB 4KDTA 3LRKA 1HQ4B 1MCIA 1P5UB 3RB7A 4OIIH 2X6BA 4U6HA 1N59B 1RVFH 4PWIA 4NQTA 1A5FH 3HJEA 1AXTH 1T5WB 4L5FE 1UZ6F 3HI5H 4EDWH 1RUPH 1UYWL 5FF6B 4LLUB 1M71B 3D18A 1DFBH 4A7GA 3JTTA 5IVXA 1TJGL 4JN2B 4BFIB 5LQBH 1ECYA 3ZOAA 1BSIA 1LHZA 1UC6A 1RMFH 2GY5A 1R33A 3ZT5A 4KQ4H 1T7YA 5TQ0L 1NCIA 4HFWA 4Z76B 1TZ8A 1AGBA 4FX5A 2GHZA 5TJWK 3FCTB 2NDFA 2EE0A 3ZJAA 4M7JL 3C60D 4CBZA 1R5IA 3RVTD 2V7HB 1IEHA 2BVQB 2NT0A 1GZPB 4RRPG 3UDWA 2ZZUT 3OMAB 1MCKA 1QKZL 2JB6B 4OZHF 3L2LA 4WDIB 5L7XH 3JQOB 4Q9QH 1DQQB 3A4EA 1OTSD 3QI9A 4AIXA 3TF4A 2WUBH 2RHEA 4L4VD 4YLBA 4K15A 4JZNA 3C2AL 1MRFH 1LD9B 4HOMA 5J7CC 3GHEH 2BRQA 4LDOB 3BP4B 4J3UA 3RUGB 2NCEA 1OAYH 4PIBA 4PYGA 1FO0B 3GLEA 2FK9A 3ECQA 1KG0B 4KAQL 1T0MB 1FAKT 3GSRA 1UGNA 5FM4A 2R2BB 3P11L 5T5FA 1MPAL 1U8PB 1YEGH 3MBEC 3VDAA 3WIHL 4O2EB 5CSGA 5FGSA 5EZJB 4ZDHA 3UYPA 5KUKA 5CGMA 4M4RA 3LZPA 5AZUA 2Z35A 4K3DL 4TOYL 2XVGA 3BN9C 5A16B 4JKKA 3BUBA 5AYTA 3KNBB 4U2ZA 2O4EA 1B9KA 5DRZB 3V0JA 2B4CH 3KPOA 1H8SA 1KPVB 5D2LA 2FYVA 3F2LA 3L4XA 4KX9A 3QIBB 4JZOB 1T20A 5DHYA 5DUPL 3C9NA 3CAFA 5D1XA 4BSWA 5AFAA 5F1NB 4FFVD 1L9MA 1KBVA 2AJXH 4FQ2L 3Q6FA 1YPZA 3O3DA 4OZFG 4DO4A 3ZQWA 4DUXA 4XN8A 1DUYB 1E30A 2L7JA 4O2FA 1YY9C 4PWHA 1JZ2A 3U6XA 1NGZB 4BXSV 2WKOF 2A6IA 2R56H 1XGTB 2XN2A 4RAVB 3IVKB 1QI5A 2G3XA 4KKAC 2IDTA 4N6QA 3M17B 2O5ZH 3PGFH 1QA9A 3E2HC 4FFZH 1NPJA 5DSCB 3BPCB 3RDTC 3QDHA 5IESH 1YEKH 3NDYE 2YFNA 4K07A 4XMKH 4BQBA 3VRIA 4K3EL 4J3OG 4LGSB 1KGJA 4W9ZA 4F93B 1OAZH 2WIIB 1OGSA 1NC4D 4NWTL 3QH3A 4P2OC 4FRWA 4X7SH 4OCYL 2B1AL 2WMPB 1EUTA 4X6BB 4P04A 3GBLA 5AZEH 4LL4A 5C0BD 5HYQB 1K4DB 1MW0A 2JNZA 1AP2A 3HE6C 3O41B 3B56A 3OD3A 3HE7A 4X83A 5HDBB 1F41A 2W0FA 5GRUL 3IGLA 4OD2B 5ENWB 2NY4B 4KJYA 4FABH 2P5WE 3CFIC 2I07B 1BEYL 2NXZB 5EOTB 5I1HH 4LSSL 5J13B 3ZR6A 4V1DA 1LO4L 3O2DH 2V17H 3CQPA 4LASH 4UUJB 2VE6B 3WL9A 4XX1G 1MEXH 4KKLC 5B7MA 4WO4D 4PV8B 1AO7B 4WV1B 1L0XA 4P5TC 2YEQA 5LVEA 3EFFA 1BOGA 1MWOA 5D5MB 3S5YA 3VXSE 1N26A 3LIUA 1Q90A 4AC4A 1XF2A 1U8JB 3ESPA 4HUVB 5I15L 4OB5H 4DIXA 1ROWA 2EH7H 3L08A 4XMUA 2ZCHH 4JPWL 3H1ZA 2CBOA 1BPLB 5DYFA 1T1WA 1HSBA 3RGHA 1HQRB 3WLBB 3WSQH 1I3UA 4Z0XB 3QR2A 1JNNL 1UQSB 2G2RA 4UQDA 4Y2OA 4JM0A 4P07A 5I8KL 3EGSA 2Q3ZA 4X7TB 4IKKA 4G1MB 5JPMA 2R1XA 4Q2ZB 4HS3B 4Y1SA 1TJIH 2FDBP 4LEEA 3G5YB 2W0PA 4Y5VB 3V8OA 4KHTH 5GXBB 4F8LA 2ODHA 4W1TA 3S34H 3VG9C 3O2VL 4BQCA 1ZV5A 2V33A 1AE6H 1I75A 2WZPA 5ABAA 3N41B 4HX1A 4ANUA 5E24E 2GSMB 2IH3A 2N59A 3P30H 1J8RA 1MFMA 1WHPA 2HX9A 4PRIB 4I18A 1C7SA 1SEQH 4XVJL 3ARDB 1D5ZA 1KCUH 4EIGB 2YSSA 3T65B 3RL1B 3A4DA 2J2ZB 3DRTA 4YEFA 2CK0L 1CXKA 1JGIA 2OXGA 4Y4HD 1KWGA 4M02A 5CZKA 3GUTB 4WSJA 2WGXA 2XFXA 3WENA 3PP4L 3TYGL 2IAAC 2BXZA 4GRMB 4HFUH 4X7CC 2DH2A 5LAXA 2YARA 4A2MA 1EEYA 2YAEA 3Q01A 4W81A 1SJHA 4P23D 3RWIA 1O6SB 1AH1A 4IOSD 3BE1H 3O9WC 4QHLA 1Q94A 1YEJL 1F4WH 4PJBE 2Q1EA 1A14L 1XIWA 3GBMH 1D5XB 1SQ2N 4FQPA 5D72L 3NN8A 3TWCH 4MA3B 3BQUC 1RP8A 2EILB 2FNWA 4YUEL 3VX0A 2VJ0A 3BGFC 4U33A 2C3VB 2HT2D 4AYFB 5EF3A 2W59A 3FUNA 1RUAH 1AMXA 1MJ7L 4CDGC 3LN5A 4WJ5A 3ZDYE 1DZ0A 1P84J 4RWHA 4JRYA 5DFAA 4Q89A 2X42A 3MLZL 4P9HC 3NFPA 4YHOL 4ZFGH 1NMAH 1P4LA 2J72A 4GW1A 3EYVB 4J3XA 4XBGA 4ZUSB 2KH2B 3RAJH 4QY8A 4G9DB 4YHNB 4R90L 3U30B 4EI5D 1KB5A 1QNIA 1YMME 3APCA 3ZX1A 1NM4A 1I9IH 2CUMA 3A21A 4ALAH 2G60L 1UA3A 3HC0B 4JVWA 3O4LD 5FGBC 12E8L 5F7DB 4ETQA 1FDLH 1J8SA 4FTVD 2P8PB 3GXPA 5GJSL 3ROLB 1Q0XL 4GO6B 5JDSA 2HFGH 2WUCH 1IJ9A 3BIKA 4Z78B 3ESMA 4LPXA 4FQLH 3WFEH 2WYHA 3O3AA 5K39B 4X6CA 2NY3D 3LIZH 3OKDA 2WZ5A 2WBKA 3VQMA 3OJDB 2CUIA 2QGEA 3QARA 5DO2D 1LMIA 2ROXA 1BMGA 4ZZFA 2PCPB 1AHWA 5TE7L 3GZPA 1NC2B 2B1HL 4KZCA 5ESAA 1XZ0A 2QPDB 3EDEA 2LAGB 1JWUB 5J6HA 2WP3T 4P3WA 4NQCD 3MU3A 1GC1H 3EW3B 3O3EB 3G6JA 2EVHA 2KI6A 2Y22A 1GOFA 1WVZA 2X9YA 2IADA 5JIKA 1H3PL 1ETB1 3MKGA 3QUXC 5F3FA 4PMEA 3EH2A 1HX0A 1A2YB 1J0JA 3ARED 2VDKH 3KGSA 3FULA 4NEHB 3DGCR 4J8RB 1S7SB 4U7MA 3OZ9H 5CEYA 1H9DA 1K8DA 1WFMA 3BVNB 1FVCA 3UAJD 1TTCA 1GYUA 3CFDA 4IMKC 4XI5C 4XP9L 5FWRA 2GTWB 3ZKXC 1BJ8A 2Y2YA 3QQDB 5I6LA 1P4BH 4XMPH 3FB7B 4OLYH 4YLQT 4PBWD 3V4VA 3QPKA 1I9JL 3E6FB 3OX8B 3D51A 1GHFH 1QI4A 1O7VA 3KWUA 3U7YL 5I19L 2ZD0A 5I28A 4XPTH 2GIMA 3ZRFC 2VH5L 1H3WM 1WGOA 1V7MH 2YWZA 4G70B 4KC3B 2ZCKL 4Y4FD 2FYYB 4KOCA 3SYPA 1WAAE 1Z5YD 4TVPD 4LVOB 3TBTA 1E50A 3IJSB 1T6VN 4LLWA 3UPAA 2EP6A 4DP6X 5CFAA 4HIHB 2YEZB 4QRRB 4TNFA 2WTRB 4GXVL 3K5SA 2FX7L 1VESA 3BXNB 2HRLA 4HC1L 1B2WH 4PJFE 3HB3B 5AW1B 3A4AA 3F6JA 1E4XI 4YOKA 4LCYB 3SYQA 5E9DA 3ROOA 2DEWX 3MO1A 2PYEB 4NKOA 3CCHA 1CT8B 4R7DB 4LMQI 3WDJA 1RIHH 4NWUL 5D7JC 4MKTA 3T3PB 4KO6A 4H8UA 4S2SB 2YOCA 5H37H 4KRLB 2EXTA 4M6NH 3K3QA 4WW1B 3VI4A 3Q2VA 1FZJB 5FV1L 2DAVA 4LOVA 4NENB 4KROB 5EEWA 5DZPA 5C0IA 4EF3A 1Z5LB 2Z1KA 1QD0A 5HHVH 4LKXA 2ZSVA 1AOZA 5D96C 3B1TA 2YC1B 4J23A 1DANU 1OPGL 2UWEE 1J5DA 1ZSDA 1ZVNA 2AEWA 3NIDF 3GI9L 3PWJB 3QUZB 4P59L 1HHIA 1NAKH 1QYGL 2UV3A 3DIFB 3OAYH 2ZP9A 4ZJ9A 1YUKB 4ISVB 3BDXA 1H6TA 1Z9SB 4GSDH 2Q10A 1QABA 1RI8A 1HESA 2V8MA 4NCDA 3TEZA 5FC9A 4FI8A 1JFHA 1MIMH 4J28A 3M7OA 4IRSD 2PKDA 3LB6D 4G1EB 4K8RC 3IMBA 1L9QA 4EOWH 3MRPA 2P8LB 3NPSB 3HFML 4GRWE 3D52A 4U6YB 1T1YA 4AY0A 3KYOB 1B3JA 1G6RB 5B39A 2C9PA 3SDXB 3PNWA 1XGPA 1K3ZA 2FQEA 1RUML 3T1FA 4IHBA 4FEIA 3KWWB 3EYOA 4UOW1 4WW2B 2GJZB 3LPFA 4RFEA 5FO8B 1SGKA 5EF2A 3HTLX 4FYSA 1AY1H 4RMSA 5IMMA 4K3JH 4RISH 3FF8A 1JMZA 2AXJA 5CLZA 5EBLB 4A6YB 5LCVH 2E5EA 1QATA 4PWFA 3L4CA 4KK8D 3KVPA 4GT0A 5SWZD 1B4TA 1RPKA 4NRZA 4X8CA 4NC0B 2W9EL 1U95A 1J8HD 2YUXA 5HHXL 1HH6A 3RUGE 4U3XA 3JTSB 4PJHB 3IJ9A 1EJ6A 3V9EA 3VGAB 1DQVA 3D30A 4MASA 3V4LA 5FUCC 3D2TA 4JCLA 2TSAA 2BP3A 5IBUB 3SE9L 4NJAH 5I1KL 3X17A 4PJXB 1CU4H 5J89A 4NUGL 4LAQL 3RU8H 2ZUQB 4N4YB 4B95C 1A7OL 4R7NA 1BQRA 2XA8H 3HS0C 5HHOD 2PXYC 4IMLA 4NDMB 1F6LL 1L0PA 3QULB 3KPSB 1MCDA 4RNRA 4X0KA 4LSUL 1I7ZA 2KPNA 3PP3K 1K6QH 3GIVA 1UJ3A 3CLWA 3SQOL 1NDMA 3T2LA 4NRYB 1ULVA 2BH0A 3VXNB 5E94A 4JRFA 1XFPA 3OWEA 5CIPA 4JHUA 3QYCA 2DYPB 4MQTB 5IB4A 3BRDA 4AGNA 2DMKA 3C6LC 4XP4L 2W9DL 3QPXL 3H2WA 4PP2A 2MNUA 1MAJA 3TONA 4GP8B 1XSKA 2MNJB 3CVDA 4NT6B 3IXAA 3ETSA 3DUSA 2VQTA 3HN5A 5DJ8B 1R3JA 3N9GL 1MELA 2YQBA 4GO8A 4ICWA 1OW0A 1WP6A 3DETD 1R24A 1UOVA 5DRNB 5JXAH 2QKIA 4S1QH 3IFLH 2CNYA 3P4OA 4AQ1B 2A9BA 5HGBB 3QIUD 5FDWB 3TV3L 4X8JB 2ZAGA 1YECL 3PV6B 4B3VA 2YD8A 3T2NL 3TVMA 5JW4Q 3RWFA 3D50A 3WAJA 3QE5A 4XWOC 4FMKA 2XN1A 3Q9PA 3BLBA 5DGQA 4AXWB 1ZGLM 1ZD6A 2QKSA 3HBZA 4P5SA 4N0CD 4QF1B 3GJEB 2CRYA 5DURB 4ORGB 1CBJA 1KGIA 2E9IA 3TBWA 3UTPE 1BBDL 1X5KA 2NNFA 4UYPA 4HVBA 2ZYRA 2AQ1A 2J1KA 3HG0A 4BEIA 4M93B 1ZE3H 3LNEA 3A47A 4OCSL 1S7UA 4ZW5A 4QYOB 1JGUH 5JA8B 3EXLA 2R83A 4JLRB 1MFEL 1A47A 5IMKB 3HVNA 2F54B 2WXNA 2WYTA 1W91A 3ILQD 4G8EB 5B8CC 3FK3A 4MNGA 3AAZA 1MCLA 1AHMA 3C5ZB 3CBRA 3FTGA 2FEDC 2OQJA 3NT0A 4WK0B 1T6WA 5E1AA 2H9GA 2KYIA 3MRFB 4OFYD 5D5ME 5EO0B 5CCJA 2YJLA 3ARFD 2NRDA 3VNZA 2X3CA 4L3CA 2OMTB 3RTLA 1KXQE 4WK4B 5LXVA 5JXED 2UUDK 3T8XB 3VH8G 5L9DH 4QRBA 4G3YL 3GMLA 4ZTPH 3DOSB 4OZGA 1ZY9A 4FS0A 3GXIA 3UJJL 1SUJA 2GAZB 4LPYA 5TTRA 3MPCA 5E00A 3WFCL 3EYUL 3AXLB 4UQ3A 5T3ZH 4BZ2L 3W5NA 3ZDWA 2HJFB 2FATL 5AAWA 3OXRB 1XZWA 1ZGLB 2DQHH 2BRRL 1XF5A 5C0DA 5EO1B 3BAEL 3X3FL 2W0LA 3OKOB 4OCWL 5FYKU 1G7JA 2F68X 1KYFA 3X1FA 4LCCC 5AOIA 3KBPA 3QORC 2YD2A 4N0UA 3JV5A 1BZ9B 4DN3L 2IAMD 2UY6A 3B9KB 5I66B 3MRHA 3RL2B 1OGTA 3FZUD 4JKPL 4D3CH 4TUJA 4PRIE 3L3DA 5CMAA 1MHHA 3ZO9A 5GS1B 1IC7H 1F4YH 4OSUH 4AW7A 5BUGA 5IGXL 1SXSA 3EOBB 1JV5A 2AQSA 1DDHA 1X3DA 5T33H 1JI2A 1CYXA 3DJZA 3TFKC 3A4FA 2H32B 4PMFA 1IKOP 1MXGA 5E5LA 1M6UA 5DWUH 1YY8B 4RESB 4LARL 4GH7B 4G9FB 1Y7VA 3PAUA 1PF3A 1R3KB 4JQIA 4R3SB 1KDIA 2HKFH 2R59A 3QEQA 5BXFA 5JMRA 4N2GA 1GGYA 1DJYA 3OGCB 4JFED 3U4BH 5E8NB 5HVHC 4LLVB 1KNOA 4ODHH 1AFVL 1JTOA 5HYSA 3IK2A 4WFHD 4YSCA 4NCC2 2R4RH 4PJEA 4HEMA 4P2QA 2BK8A 4XNYL 4EUPH 4MMXC 1IE4A 1OVZA 4NERA 4AX3A 2ESVB 4UILH 3UTSE 1YYCA 4ZD3L 5EEXA 4OGZA 3DX3A 2XJLA 5LXGL 4OGXH 3TESA 5TF1H 4RMRA 4M43H 4TVSa 1LO0L 5T3XH 5B3JF 1G7LB 4F37K 5GIRA 3BUDA 3OWRA 2QQNL 4HALA 4YQXH 2ICES 1TTUA 2J12B 1CXFA 2WLLB 4NUQA 3L5XH 1X7TA 1UH2A 1AYRA 4ZNCD 5HBBA 3HNTH 1U33A 4K5NA 1SLUA 4PS3A 3V4UL 1AZNA 3BKYL 3RJDA 5J06A 3P9LA 3H85A 5LDSA 3MRLB 4M62H 3REWA 3KBHE 4H2CA 2EDBA 2VRQA 2QSCL 5K9QI 1KJVB 4UV7H 2IFFL 4P46D 3V0EA 5I1DB 4Z7VF 3GGWB 4FLHA 4HW6A 5C09A 2FLRT 1I31A 4KVCL 5F7LB 4YHPA 3P69A 5T8IA 1XVSA 1XGRB 4ZPTA 3L5HA 4JY5H 4XTRC 3LXCA 4G6FB 2BW4A 2VZTA 1MFDL 4LSVL 3GXNA 4LGRB 4Y19E 2JH2A 1J9CT 1E40A 5T5NG 2PP8A 2QQKH 1LWRA 1GGBH 5MERB 4Q9BA 4P06A 3DURA 4ORZC 5EIQA 3TA3D 3H42H 3MRMA 5ESQB 2APFA 1XL4A 5IFHH 1YNKH 3HEIB 2NY2B 2AGJL 4W6YB 1N10A 3BEVA 1I9RH 4BFEA 5KZCB 4NO0B 1S4IA 5I16A 3LXBA 3CQQA 3N42B 4NIKB 2UZIL 4HWBH 1ERNA 1CL7H 4RZKA 4W9DC 3VRLF 4E41B 2CM6A 1P4UA 2Y2TA 1T4KA 3MRJA 4MRBA 3SCMC 3V0VA 8CGTA 2R39A 4OGYH 4YBHA 1JZEA 5D7KE 4OZFA 1L3NA 3D25A 3CPLA 3VQLA 3VI3E 5C0CA 3K1KC 4NO3B 2A38A 3MCKA 4GMSH 2VDRL 1J1XH 4HUUA 2A6DA 1FFTB 1IJNA 1Y18B 2AJUH 2EEBA 3FU7B 4ZBJA 4ZYKB 1AG6A 2XTJE 1J05A 3IS1X 1L3WA 4CN1A 2ICEB 5SWQA 4P99A 2L3BA 2FHBA 3QZPA 1NANI 43C9A 3VWKB 1BFOB 2ATPA 2YRPA 1L6PA 3VTAA 1CE6B 1G9MC 1G7QA 3UX9B 2YD9A 1PZ5A 1TCRA 2B3IA 2R2EB 3C5SB 2PR4H 4OIIL 3U83A 1RVFL 4JX0A 1AXTL 3OKLA 3DX2A 2PYEE 3S36X 3HI5L 3FH8A 2UXFA 1RUPL 3BDYH 4NN7C 4EDWL 3CVHA 1DFBL 1CICD 2FJHA 1DDTA 2Z31D 1LNUA 2GSIB 3ALXA 1IGMH 3BPOC 2G2NA 3G08B 2GJ6E 3ILPB 4KUCF 4WTWA 4ZMZA 4ZX6A 5AOKA 1RMFL 4TL4A 4QXVA 2R0LL 1QFWI 4KQ4L 1I53A 2GEEA 2VAAA 3H8NA 4K3HA 4GAAA 4C47A 3P2DA 4QRQB 1ZHNA 3S4SB 4I88A 3U2SB 4PGDA 4AV4A 3F7VB 2D0FA 3BLPX 4MTMA 1JTPA 1NPNA 2F8IA 4N8PA 4PRHB 2BP8B 3P9WB 3QUHA 3DRQB 1A6AA 5ANME 4TTGA 4ZO8A 2N3JA 5L7XL 4G6JH 4LCWA 4Q9QL 1KTRL 1DVSA 1CK0H 1NWPA 3KLAB 4I13B 1TPXC 2WUBL 4HUWB 4HOZA 4KV5F 2EICA 2WQSA 5AW0B 1MRFL 3WIHA 4A39A 4EKJA 2HUHA 2WCGA 3GHEL 5D2NB 4AENB 3O45B 3REVB 2AK1H 5JDJA 2IWKA 4M8VA 2HVKB 4GEIA 1OAYL 3GO1H 4TF4A 1EEZA 3IBOA 5DFWH 4F9LC 1EO5A 3COOA 3O0RL 4GIPD 4M8UA 4EN3D 1KXVC 2E7CA 1BZ7B 1YEGL 3PHAA 3R1GH 2AK4A 5BOPA 2DWTA 5C6PB 1E6JH 4PCSA 2V2WA 1YNLL 3UBFA 4NS0A 4JZJC 3TN0C 1BFVH 2X4SB 4H20H 3AM8C 3TBYB 1OOAA 1NCGA 4HKJA 2W94A 3QUKB 1PYWB 4WU5A 2PO6D 3UROR 1T0OA 1A65A 3MRDA 4HBCH 1YAZA 1YCSA 43CAA 3T0DA 5T3ZD 3FOLB 4ZSOA 2ZWLT 5L2KA 2B4CL 2V2TB 5DS1A 1QRNB 2VXQA 3Q5TA 4HCFA 4Q0XH 4UU9B 1W6WA 5FA3A 4CC1A 5JHBA 2IG2H 3M88A 2BZCA 5AKSA 2XUWA 3D3VA 1TENA 5I8CB 1OM3H 1NGQL 1FNHA 4FQJL 2NZIA 2AJXL 1TR7A 5EC1B 3E80A 2L7EA 4YPGB 4JFXA 4PJ8A 1OE3A 3KYNA 4MVBC 4TVPL 5JOFB 2VN3A 2ZKYA 5IQMA 1KLFA 1OCZB 2ZT9C 3LRSB 1ET5A 3S37H 3WN6A 3MJ8A 3PDOA 4PBVC 1PY4A 2R56L 4GQRA 3MRNB 2XVKA 1BZDA 1S7VA 3P4NA 3QJXA 1CD1B 5KBMA 5CWSB 2OI9C 2O5ZL 3PGFL 1ZT7A 3FQ1A 3MRGA 4YGAB 4FFZL 4TUOB 1IAOA 5L0QB 1U6AH 4KZEL 2AMUA 4MX7B 5IESL 1YEKL 4NQSA 3BZEB 3FS9A 3LVTA 2J5LB 4XMKL 2CBTA 1DHKA 3FSZA 3HBQA 3MXVH 4IRZH 2P5ED 5KANI 4OZIF 2CDFB 1KJ3H 3GYRA 4ZOAA 1OAZL 2IV8A 4X7SL 2K9FB 2OFQA 3OMIB 3P9MA 3Q43A 5D1QC 1KLUA 2JCCA 1IAKB 2MIZA 4GRLD 3ARYA 3LXAA 4BK5A 4GG8A 1MVUB 1HU8A 3QQXA 1S5IH 5FX3A 1ETA1 5AZEL 4BINA 1RL1A 1AGDB 5I8EB 5ADPH 1XR8B 4HCRH 1NIFA 4Z7OB 1OSYA 4PI0A 1TFPA 2VXVH 4PYHA 1PD6A 2VLRB 4C59B 2DL2A 3IDUA 4NM8H 5AEAA 4Z5RB 2LABA 3SDCA 4FABL 4APQC 2MWCA 2OSXA 4PTTB 1IB5A 1MRDH 5HHMD 1FA4A 1ZTXH 1TJMA 5I1HL 4MNQE 5GISH 3PWPD 5BVJA 5A6IA 1F56A 4QHKJ 5DUBA 3BVTA 4PJ6A 2VSMB 3O2DL 2V17L 4L0ZA 1W0WA 1LE5B 3N1PC 5HGDB 2IPKB 3MGAA 4OF3A 1MEXL 5T3XD 3CQFA 2HTLD 3KAAA 1OY3B 3RNQA 3MCG1 1U8CA 4BBWA 3AG1B 1AXSA 3VFWA 3X11B 2P9RA 1BJ1J 3A6CH 2VQ1B 1VDGA 4PV9B 4OB5L 2ZXBA 1TTAA 3EDFA 1E9PB 1D5IL 3DLQR 5DMGC 5EUOE 2ZCHL 5LGJA 2D31A 4MQ7A 2OTUB 3U4EB 3WSQL 1CFTA 8FABB 2R8SH 2QV2A 2V4LA 4N28A 3LS5H 1KGCD 1AQKH 1GJUA 1MFUA 2P42B 1A0QH 3IDGB 3NJNA 3LHPH 4OKDA 4QXUH 4CW1B 3T4AA 1KULA 4FXTA 2ARJB 1TJIL 1DVFB 1WICA 1FBIH 4DW2H 3L48A 2ITFA 4P2RA 3DXAB 4KHTL 4F24A 2V2XA 3OXSA 3S34L 4LDLB 4XXCA 2F54E 1AE6L 1U8MA 3DJRA 1EXUA 4XX5A 3RRQA 3Q2LA 1E5ZA 2WBWB 1ZLUH 2GW5A 2DQGH 5D7LE 4PRDB 3Q7JA 1VJSA 5DS2A 3P30L 4OZHA 1WQVT 1AANA 1SEQL 2VLJD 4Z3FA 1A9BA 3IJHA 4M9OA 1F6AA 1E27A 1HCYA 1T83A 3KXFD 1MCHA 4J3BA 4YHYB 1XGZA 4BE6A 1IGFH 1B0RB 1U3HC 3L3IA 4F8OA 1ZHLB 1SXCA 4HFUL 3PL6D 3MRIA 1QSFB 4NC2B 2HCZX 3ECVA 2F53B 3DX7A 3QP3A 2ZIDA 2BZDA 2BIHA 2P49B 3BE1L 2BFVH 5D71H 5G4OA 1F4WL 1K5NA 1H15A 4KKPA 3I9GH 3LS4H 4Y1AA 3GBML 1J5IA 1KBPA 3TWCL 2BSCA 1QLEL 5DVPA 3IE4A 1GSKA 4WY7H 4NP4H 1Q9LB 2OMXB 1S9XA 3QDJE 2BVOB 2FQDA 3SGEH 3L7FB 3OZLA 2DIJA 4ZAKC 3IJYA 2N01B 1VRSA 4YSOA 2B9BA 1ZLSL 4FXGA 4ES8A 1JZ4A 5KSBF 4FXKA 3VXTB 5AAPA 1M42A 3RPBA 1XAUA 3IMWA 3FT3B 3CVCA 4HZAA 4BA8A 2CLRB 4KKBC 3V10A 3L3JB 4WKZA 2HLEB 4RMBA 4Z3IA 1NMAL 1PKQB 1C5BH 3ZE1E 4OJEH 3U6RB 3SKUD 4X0NA 1A6TB 3RAJL 2CJSA 4K5MA 2AAAA 2WKOA 3Q8CA 3JBG7 3TOPA 3WMPA 4PLJC 4IQHA 4PH8A 1NFDB 1I9IL 5ID0B 1KF9B 3JT2A 4ALAL 4UTAH 1A8JH 1EBAA 3R06A 1Y0LA 1FDLL 4EVNB 4IHOB 4QT5B 1RJZB 2BHFA 1B0GB 4BQ8A 1SVZA 4QRTB 5E1QA 3WDIA 3T2OA 5BV7H 5F7UA 3GB7B 3KEDA 4FQLL 3QEUB 3WFEL 2NW2B 3POHA 3QIWA 1N5YH 1UASA 3F7LA 3UTZB 4NC1C 1JNHA 2UY7B 5KVDE 1XCQB 1X5LA 3LIZL 1AZRA 5IIEA 4TQIA 2EKSA 3HR5B 1INDH 1BQHG 5DJYA 4PGEB 4R4NC 1IIKA 4PREA 5KSUA 4P2CG 4PJGE 4X98B 1FZMB 2C8NA 5C0AA 1DUZA 1HE8A 3APMA 1AS8A 2DQFB 3Q3GA 4GMTH 4GYBA 5DQJA 2P8MA 5C70A 1RZ7H 3B7SA 1P5UC 3BUPA 4XWGH 3NJFA 3NYKA 4Y89A 3O6LH 4N9GA 2Y5TB 4ZOBA 2X88A 1GC1L 5B38B 5IB2B 3L9RB 4HUXB 1DQMH 2DZEA 5C86A 1ZGLP 1AR2A 4L29A 4QJ4B 3V0AC 3PIQB 4MXVE 2JI3A 2VDKL 4ZTEA 5B3NA 4QR7A 3LMJH 5EUKB 3OZ9L 2XWCA 4RSYA 1URIA 4F2MB 1AGCA 1UD3A 2M8XA 3HHSA 4Y5XA 4GW5A 5F88B 2Z92A 2GIXA 1LK3H 3I6LD 4FFYA 1P4BL 3STLA 4XMPL 2X4NA 4JVPA 2HMIC 1WO2A 2VO8A 4OLYL 4WZ9A 4E0RA 4G8GD 2VTFA 3QZOA 5TE4H 1GHFL 4CDHA 2G5BB 1W9XA 4Q8BA 4XPTL 5A2FA 2VZ3A 4L3ED 4YX2H 2X10A 3FQYA 1EPFA 1V7ML 4PBXA 2I9TB 3Q8BA 2ZYIA 1T04B 4HC1A 4KJPC 4KU1A 5AW7B 4F33A 2AVFA 2JTDA 5IBLD 2VL5B 5BW7C 4XMXA 3QVAA 1FZKB 2A9CA 4XPAH 1RHHB 2FSDA 4WFFD 5I73C 1G7MB 3WTTA 3H2QA 4O5LH 5KSAA 3IF1A 2BDNH 3ZW3A 1B2WL 3KLQA 4PJAF 5EU6B 3ECWA 4DFHA 3SJVB 3ARBB 3AWEA 1MZZA 1JZ3A 1MG3C 1N9PA 3SDDA 3DX6A 1RIHL 3CN2A 3S35H 5DHMC 3OPUA 4PW3A 4IBLT 4FMVA 1FYTA 3DMMA 4PHZA 4E41E 1T66C 2X4OA 3C8KA 4LVHC 4PW4A 2E7LC 4M6NL 1KJMB 3QW9A 1DLHA 4PRPA 2QVIA 4GIAA 3T0EC 5HYJA 1DLFH 3K72A 3ZHLA 1SHWA 3VFNB 1JDAA 4PTUA 2Z8SA 2LV4A 4QLRA 5TE6H 2H26B 4KO9A 3CZGA 5PCYA 4LEXH 5B1AB 5ISZB 1CC3A 4WI0B 2RFXB 3EF7A 2NLJA 1PX3A 1NAKL 2A74B 1ED3B 5DJ2A 5F89A 1I8KB 5DZJA 2PABA 3D05A 4GSDL 3NJHA 1GRWA 3EOTH 1BGXH 4AYBA 3MZTA 1WFIA 5DD3H 4N1HB 4LSRH 1MCSA 4KZDH 1MFBH 5AUMB 2NXYB 1MIML 3W82A 2VSDA 3EJRA 4L48A 1M7IB 4RIRA 4EOWL 2EYTA 3L5WB 4ZNEA 4KKCC 4LU5H 3VTMA 3FT4A 2BWIA 2EO1A 5BJTB 4URKA 1FJ1B 2IOIA 4JAMB 1SJVA 2BNRD 3G5WA 1RJLA 2VLLA 4PN6A 4OIFA 5C08B 3SKMB 4NQDE 3CUPB 4IOFD 1U8KA 4EZMA 3RPIA 1HXMB 3BSZH 4OF8A 5HI3D 2J6EH 4B97A 4PRHE 3VWJA 3UBHA 3MRKA 4NNPH 2EVFA 3N55A 4L4TA 5FYJU 3ZUCA 2AQ2A 4ZMLA 4K3JL 2NY4C 4CVUA 1IEAB 2XYBA 3GHBH 4H1LA 4RISL 4CILA 4OI8A 2CUHA 4OUUB 1NEZB 5LCVL 3OVUB 4PWJA 3UBXG 3BVUA 2Z1PA 5J13C 1B6UA 3EFOA 4RX4D 3AQDA 4GT7A 1MI5B 2XSKA 4G42A 3EFDL 3H6JA 2H6PB 5EIVA 5FGCB 2WXMA 1I7TB 5GS0H 4ZI8A 3IFNL 2HG5B 2PNDA 1QR1A 4IGBA 1AOHA 1TQVA 2IAND 3AU1A 4WV1C 4HJTA 3EGXA 4JRXA 4Z7UF 5IMOA 4ZFZA 3VH8A 1E8ZA 2DYRB 3TZVA 4HIEB 4NJAL 3QFDB 1CU4L 1FFRA 3ASNB 1KIQB 1O5DT 3QWRD 3NEXA 3RU8L 4FFWD 4L9LB 3QS3A 4D9RE 5KS9F 2OMBA 3ZKQD 2XA8L 1AIZA 5L88H 1EDYA