1OARH

Fv ige spe-7 in complex with alizarin red
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 122
sequence length 122
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oarH00
1RU9L 1DANT 4YHNA 3G5XA 3VXOB 2A9NH 5SV4A 4L8BB 4ELMB 3MBEA 1FLRL 3JV6B 4G9FE 4Y4HC 4DTGH 1YQ2A 1PG7H 2X4OB 5DEFA 1HXMA 5C0EB 2P24B 3G6DH 3QUYD 4X8JB 3WD5L 4F37F 1U58A 4KJYA 1IC5L 4OQTL 3I84A 4KHTH 3IDYC 1KTDB 3TYFA 3RWEA 3FN0H 1MCJA 3SDDC 4DCQA 4J8RA 5D5MF 1HILB 3WFHA 4RDQF 1KCUH 2YN3A 2FSEB 2H26A 4UILH 5L7XH 3TBSB 5D7SL 3EO9H 1H15A 5J6GB 5FV2A 1R5IA 1KIUA 4HIHA 2RFXB 2FBJH 3GMNB 1H3WM 4PJXE 5FGBC 2G60L 2SEBA 5B22A 3RWDA 5FYLH 4M00A 3WS6C 4WTWA 3PHQB 1OD7A 5IESH 4NRZA 1VA9A 3OJMB 5KVFH 3GDBA 2J5LB 1RZ7H 4PB9L 4ZUWA 5C3TA 1BEYL 1QBAA 4YHIB 3EYFB 1A3RH 4OZHE 4XPGH 3VJ6A 1ZSDB 4ODSL 2UZYB 4YBQD 1KIRB 3JVGC 1RJCA 4PJIF 3DIFA 4NUGH 2V7NB 5EH1A 2E7LC 4FZ8L 3UX9B 3QG7L 4OF6A 5KS9A 3HE6D 3D25A 2XRAL 1BJ8A 5C9JB 4TPRL 1CXIA 4MA8H 4ZOEA 2VZVA 2EIBA 3H7BB 1CE1H 5CEXA 5KVEL 2DLIA 4JQVA 1X5GA 3TO4B 4KKNA 2ERJB 4GQPH 4ZTPH 3TN0D 3VXUB 4J4PC 3SGKC 5F3HA 1EHLH 1A7PL 3WHXB 2V5SA 4JVUA 2F9BT 1I1FA 4QTIL 3QEGH 3EOTL 2F8OA 2NY2B 1ZHKA 2Z35B 3GSWB 3BP6A 2VH5H 2XT1B 2EE2A 4U3CA 1GZQA 4R4BA 4MA1C 5JZ7D 2MKWA 4ZO8A 4UB0H 2JJSC 4YR6B 4HFUH 5AD0B 5IMLA 1GGBH 2B1AH 4DWHA 4HKBB 5I8KL 4GAJH 1S8DB 3FMGL 2VABA 3T8XB 1AO7D 4X6DE 3DECA 2Q8BH 1IGJA 1B2WL 4LGPB 4U1MA 5DI8A 5IW1B 4MXWL 2P8PA 2D7OA 4PTUB 3INUH 4MLIA 5EU6A 3DX6A 2OBGA 3F5WA 4HWZB 1G7MB 3MCKA 3SDAD 3B9VA 5AAWA 1OTSD 5BXFB 1T03H 3GIVB 2APTA 4GS7C 5HDOA 3D85B 4KY1H 3CDCA 4OLWL 4H0HB 1DDHB 4OZFG 4P5TA 1OAKL 1A47A 4ISVA 4EXPX 4WTZA 5FUCC 1H3PL 4UIMB 2ZUUA 4NQSA 5JIIA 3PF2A 1BBJA 5A16B 1L7TL 5E1AB 4W4OA 3MLRL 4U7SA 2YUXA 4XP4L 3U9UB 2I25N 2BNRA 2HFEA 1PYWA 1QKZH 4NO3B 4LSSH 3DETD 3GMQB 4G8FA 4LFHG 3QNZA 1ZLSH 4G7VL 1TLKA 3U6RB 4CN6A 4XRCB 4UTAH 1ZEAH 3OPZH 5T3ZD 4L8DA 4ONHA 4MD4A 4EI5B 1BQHB 1CK0L 1MCWW 3FO1B 3O3BB 3HI5H 2A1WL 4NP4L 1SYVB 3RUGF 4IRJD 4PJ8A 4ODUB 2D03L 5CEZL 3UJJL 5D5MB 4OM1H 4XXDA 4P3CL 4HIJB 3S96B 3GMOB 1HQRA 2Q86A 1P7QB 4TQEH 2EO9A 4POZC 3V9FA 5CD5C 1DL7L 1N8ZA 3SOBH 3VFPA 1YEDB 2J8UA 3U0TB 1QEWB 1JHTA 1V05A 4UQ3A 5A2KH 3WS3B 3MLYH 3NAAL 3I3BA 2Z31D 1W0WB 5HGBB 3CDGB 2OZ4L 4Z7VF 3DX9B 2IADA 3CPLB 5FA3B 2QADC 4DFHA 4PJIB 2BY2A 4HS3A 3CCHA 3V6ZB 2G2RA 3SE3C 3C60A 3QISA 1IQDA 4WWKB 4BFIA 1UCBL 1LEKA 1ED3A 1NDMB 1P4BH 1OGTA 4HHAB 2FDBP 4XC1L 1DJSA 1NAKH 3ULVC 3C5ZC 3CLEH 1E4KC 2ICWA 4IEFB 2K1MA 4KMTL 2HVKB 3G5YB 1N26A 3VD7A 4M7ZB 3NN8B 3ARSA 4OBSA 4ZUUB 1TETH 3GKZA 5T5FH 2Y06H 3QIBA 2FH6A 3WEXA 1UJTA 2VXVH 5CEZE 4GG8B 3VXOA 5DD5L 1SM3H 4L8BA 1GJIA 1PLGH 4ELMA 4BZ2L 3JV6A 4RA0C 5CEYB 1NBVH 2DLGA 2X4OA 5C0EA 3DGGB 4X7DC 2P24A 2P44B 3P0GB 1I9JH 5TFSH 1X5FA 3L6FB 4X8JA 3CSGA 1TJHH 3ARGD 3QH3B 1YEFL 4L4TD 1KTDA 4L3EE 3BKJL 3O2DL 4HXBL 4D0CB 4RMVA 1HILA 2P45B 2FSEA 4Y5VB 4Y19B 2IG2H 3RKDD 3TBSA 4PJHE 3V8CA 5I8OH 3I3DA 1UZ8B 5J6GA 4KK6D 2BP3A 4OFIA 4J3XA 2RFXA 2IAMD 3L3OB 3GMNA 4HUUB 4E0RB 1IGCH 3T0VA 1HHIB 1FNAA 1U91B 5E00B 3MA9L 5AZEH 4WUKL 5MI0B 3KYKL 3PHQA 4Y8DC 2BJMH 1P5UA 1XF5B 3E0GA 3VG9C 3MV7D 2HFGL 3KDMB 1C12B 2CUMA 3N9GH 3WUWG 1CDJA 3R06B 4UZGA 1ZLWH 5MEND 4Q2ZB 1CL7I 1M71B 3X13B 4RBPK 4YHIA 4BSJA 3EOAB 3EYFA 4G6FB 3CMOH 1ZSDA 3MZTA 2WLYA 1FGNL 3BYTA 1KIRA 1H0DB 4XBGB 2FHBA 2V7NA 2Q76B 3ISWA 3MR9B 4Z77B 1JF1B 2DYPD 4CVXB 3FTGB 1U36A 4JZOB 5DJDB 3H7BA 5L8KB 4HMEA 3MCLH 1PKQE 3SDYL 4PY8I 3HLAB 4BSWB 2NY4C 1FIGH 3TO4A 5L6YL 4GXUN 4Z9KB 3O6MH 3VI3E 4WW1B 2AVGA 1RMFL 3RDTC 2H32H 1GGCH 3VXUA 4LKXB 2PR4L 1JI2A 4JO1L 1PSKH 3BW9B 43C9B 1MWAB 4Y5YC 3D3VD 3WHXA 2CK0L 3F7PC 1F02I 3MRHB 3MA7B 2NTFB 3JV0A 2Z35A 3GSWA 4FABH 2OK0L 4HWBL 4KPHL 4Y8AA 5HI3C 3MLSH 4PB0H 4BZ1L 4PJAF 3IU4H 3H9HB 5AD0A 4YR6A 4G8EB 4HKBA 3ZYOA 1S8DA 4XPBL 3UBXI 5EZIL 1WCQA 3A0OA 1WEJL 2AERT 2DS4A 5HVFB 4RMSA 3JWOL 5C08D 1HYSC 5HD8D 5IW1A 2NXYD 4PTUA 1CDCA 3GHEH 4Q9BA 5ANME 4TOYH 5DUMH 7FABL 4HWZA 3FQXB 1G7MA 5E8EB 1XMWA 3GFUA 4XPAH 4X7CC 5BXFA 4KTYA 1UA6L 3D85A 3IYLW 4OLEA 1IC4H 4Q9RL 2VWEC 3GSRB 4PJBF 1DDHA 4ZS6D 2B4CH 5D93B 1CL7H 3MV9B 4TSAL 1WBYB 3VXTB 4UIMA 3ARBC 2F58H 5A16A 1J8KA 2IFFH 4R2GC 4N0YH 4PIRF 5E1AA 3HC4L 3FB7B 3KVQA 1YN6B 3KYOB 3LD8B 2F74B 3PDGA 1MWAH 4KKBD 3U9UA 5SX5H 4I4WB 5I1HL 3H9SD 4KJPC 4NO3A 4YIQB 1YMMD 1A1MB 3GUTB 1SEQH 3GMQA 2EEDA 4N0FB 3N0PB 3U6RA 3NGBB 4XRCA 1PKQB 1HYRC 3BAEL 1NGPH 2ZCLL 1MCSA 4X4MA 4EI5A 1BQHA 1DUYB 4JR9L 1OY3B 3FO1A 3O3BA 1KJMA 1SYVA 4EEEA 4ODUA 3RBGA 4QNPF 4OCRH 4XI5D 3QXDB 1AE6H 5D5MA 4C4KO 1YEJL 4J3SA 2XFXB 1YC8A 1BZQK 4HIJA 4ZAKC 1VKXB 3S96A 2Z92B 4KKAC 3GMOA 2ZSVB 3H7LA 1Z9OA 1E0OB 2KKQA 3RWJB 1YDPB 3G6JF 4Y88A 1XGPB 4M7JL 1P7QA 1AXIB 3I2CL 3AY4A 3QI9C 1NFKA 4JM2D 5B3NA 4OM0L 1YEDA 4S11A 5J13B 3U0TA 1QEWA 3SO5A 4X6DA 3SCMC 3WS3A 3S36L 3RFZC 5L9DL 2P4AB 1EGJL 1W0WA 1FFPB 2Z93B 4GRLC 5HGBA 3CDGA 2YWYA 3ALXA 2DL9A 3DX9A 5B3JF 2P42B 2LABA 3CPLA 4DK6A 3OMZA 3PNWB 5FA3A 5KSAB 4E41D 1G84A 3MRMB 4UT7H 3WO4B 4W4NA 4K3EH 2FX7H 1P4IL 4PJIA 4QGYA 1IGIL 1XGYL 3V6ZA 3MJ9A 1NGYB 3U0WH 5JLZB 4WWKA 1KJ2B 4XVUD 4S1DD 4HHAA 4DK3A 4YHYC 3NABL 5GXBB 3RHWK 4PLJC 2YZ1A 4PGDB 2HVKA 3G5YA 2E9BA 3NN8A 4H1LB 4F33B 4ZUUA 2C4FU 2OL3L 5FHBH 4W6WB 5JORB 4I3RH 1JYWA 1FYTD 1FO0B 4GMSH 2C4FT 1UQSB 5LBSH 3FAXA 4GG8A 4PY7A 2QEJA 4PUBL 4RMUA 1WTGT 5DT1H 5C2UB 2B39A 3TH2T 3LKQB 4O2FB 4AG4L 1RZJC 5L0QB 3RVWD 4K3JL 5CEYA 4FQPA 1PEWA 3T0EE 1IFHH 1ZHBB 2AEPL 4N9OB 3RPIB 4UI2A 2CSPA 5E1HB 3DGGA 2PW1B 1YEHL 1SBSL 25C8H 2QQLL 3L6FA 4F80A 1CVSC 4OGXL 4YDLB 5DHYB 3QH3A 4X6CF 4UT6L 4D0CA 4HC1L 4LSVH 1J8HB 1A7NL 1FBIH 5I2IB 3N1QC 5KJRL 1EJOH 1X4XA 3QAZC 3I50H 2CRIA 2L7JA 3L3OA 2DQHH 4HUUA 4JPIB 4ALAH 5HGHB 4E0RA 1HHIA 1U91A 5E00A 3VRIB 3MJ6A 1KB9K 1IBGH 3MZGB 1KJ2H 1Q94B 1NUDA 4RQQB 1X5YA 4N0RA 1CGUA 1XF5A 1H5BB 4DGVL 1S3KL 2AEQL 3KDMA 3MROB 1C12A 3R06A 3PJSB 4Q2ZA 4PJ7E 3JWDH 1M71A 3SGEI 3X13A 3FT3B 1K2DB 3EOAA 4HDIB 4YDIL 4H1LH 5ALCH 5I71B 3IDXL 4XBGA 5GJSH 1VACB 2YD4A 2Q76A 3C87A 3MR9A 2D9CA 1NCWL 4Z77A 1JF1A 1AC0A 3BPLC 4FFWD 4CVXA 1UEYA 5DVMA 3FTGA 1QBBA 1LP9B 4JZOA 4HUMB 5DJDA 3P0VL 2VQTA 4JPWL 3QA3B 1XZ0B 1Q72L 5KSBB 3MRLB 4NKIH 3KS0H 3HLAA 1HXYB 4BSWA 4PJ9B 3EFDH 1KT2B 2AGJH 4WW1A 4MQXC 3T0WA 4G6MH 4P9MH 1NLBH 4LKXA 4ERSH 1F00I 3BW9A 5T1LD 1MWAA 3L5WB 4WWID 1Z0MA 3MRHA 1Y0LB 4EKXA 3MA7A 4MAUH 2C4XA 1FDLL 4R97C 3UPRB 2NTFA 5GGQH 3MLXH 5J1SC 4HLZH 5FO7B 3GJFK 1IAOB 2K7QA 3G6JB 3RU8H 3RGVC 2FD6L 2VDKL 1IGMH 3B5GA 1DSFH 3QDGE 3H9HA 1Q9WB 4G8EA 5K9JL 1I7RB 3MBXH 4X7TB 4GG6E 4PRPB 4J12A 3HNSH 4L3EA 4LPUA 5CINL 5D7IE 2C1PB 4P46B 1HZHL 5D7JB 3BQUB 1F8TH 3QO1A 5JIKA 3CVIH 5IOPB 3FQXA 5CEZD 5E8EA 2P5WE 4WFHD 1NBZB 4ODHL 1X9QA 1MEXL 4OZIF 3GSRA 1GOGA 5ISZB 1JRHH 3TNNB 4JANB 2EZ0D 3MV9A 3P2TA 3IU3B 4PJ7B 1WBYA 1KEML 2CIIB 4JFEB 3VXTA 3UPCA 3SBWC 4FQCH 3RTQC 3ZL4H 3A67L 3SE9L 1IQWH 3ARDD 4RGMC 5DFVD 1EBAA 4Z7UF 3IDYB 1Y18B 2HJLB 1Q9LB 3PDDA 1YN6A 2F74A 5IEHA 3SDDB 3WFZA 4I4WA 3U46B 4DKFL 1A1MA 1ZLVH 3MGTB 3GUTA 1LQSR 3LV3B 1BD2D 3UYPA 3AMLA 3M45A 1U92B 4PP2B 4N0FA 5CGTA 4XMKH 4PLKD 1PKQA 1SY6H 4QCIB 4Y4FB 2A77H 3PL6D 2DQEH 5K9KB 1DUYA 2FEDC 4BH8B 3CH1B 3VFOB 5DC4B 2UUDH 3TYGL 5C09B 4KVCL 4FQ2H 3U7YL 5FUCE 4ZXBD 3QXDA 5ID0A 1A21A 2XFXA 4DUWA 3RY6A 3VH8G 1VKXA 1W72B 4MXVE 2Z92A 4S0TD 1S7TB 2ZSVA 4PRIB 4AEHL 3RWJA 1YDPA 2X9YA 4J7RA 5E2VL 1XGPA 4WI4A 4LVNC 1JPTL 4FP8L 5EO1B 2R29H 5EUOE 2Y7QB 5IHBA 2IPTH 3D39B 2UZIL 3P77B 4N1CA 5FGSA 3U4BH 1VERA 1QFWM 1GGUA 5FGCB 1CFVH 1JZ4A 1QLEL 1QSFB 1QHPA 1NUFA 2Z93A 1FFPA 2GY7B 4OZ4B 4X5XB 4R90H 1ORSB 5ICYA 5EFIB 1UJ3C 3W9DB 5KSAA 3CX5J 2XZCH 3D69B 3MRMA 1OARL 2FO1A 3HMWL 2FIRT 2P5WB 4P57B 1O5DT 2DQFB 4NRYA 2RHEA 2D31B 4HSQA 1NGYA 1J7VR 1MFAH 2IBZX 1KJ2A 4XX1G 5KTEH 1INQB 3WSQH 4ZDHB 4KUZL 1DBJL 5EO9B 1FG2B 1CBVH 3KG5A 4I9WE 1BFTA 1V7NH 4PGDA 3ETBF 1OAZL 1BF8A 4H1LA 4F33A 3NH7H 4YFLF 3PWNB 5E7FA 5JORA 5KVDL 1FO0A 4KHTL 1G9ML 1UQSA 1GC1L 5FUOH 2ZUQC 5JW3L 3MV8D 4M43H 1KCUL 4MSWB 3CZJA 3TPUB 3LKQA 4O2FA 4UILL 2NY1D 5GRJH 5HYSB 1CLCA 5IFHH 2XWTB 4KQ3L 2DLTA 1ZHBA 3ZO0A 1JPST 3RPIA 3OAYH 4LDLB 2PW1A 4L8CB 5EC1B 3S5LG 2C7UB 2DD8H 1FNSH 4OLYH 5DHYA 4AQOA 2ARJQ 3ULVE 2R0LL 1I3UA 3CSBA 4LASL 2OR9L 1UYWH 4EUPG 1J8HA 5IB5B 1NEZB 5I2IA 1VFOA 4E9LA 4UBDD 1KCLA 2DMKA 1F4AA 4OKDA 2PXYB 2VLRD 4XCYB 4JQXA 4OGZA 2R56H 4JPIA 5HGHA 3MRFB 2BSRB 3VRIA 1F3DJ 4LCIL 3S3SA 4QEGA 1Q94A 1QR4A 4RQQA 1H5BA 1O7SA 3MROA 3PJSA 5TE7L 4ODBD 4MVBD 4ZOBA 3KPSB 2JKXA 3FT3A 1K2DA 4NSKB 2WWMC 4HDIA 3SEPA 1Q1JL 1CFBA 1J05B 4FRWA 4KRPB 4RFOH 5FYJE 4FA8A 3NPZB 4ZTPL 4QHMB 5LAXB 3SGJA 1F4YL 4WI8A 2MCPH 3CUPB 4ONGH 3BRGC 4FHBD 3DMMB 3GJEB 5FDWB 5IJKA 1LP9A 3LQAH 5CJQL 3OKNB 5GISL 3QA3A 1XZ0A 5C9KA 5KSBA 2ATKB 1OAXL 1UB5B 2FJFB 3MRLA 3MODH 1G7IB 3V4UH 4F7EB 2BVUA 1HXYA 3TT1H 4PJ9A 4PJEF 3MRNB 4O5LL 4PGEB 1IMHC 1KT2A 1FRGH 4L5FL 4FFYL 1L7IH 2Y23A 3HC3H 3QPXH 1BJ1J 4NZRH 3L5WA 4F57L 2R9HD 2UWEE 4N0CC 1Y0LA 1PJ9A 3UPRA 1EO7A 4UV4L 5FO7A 1IAOA 3G6JA 4FQIL 1NUNB 3PQYB 2FLBT 4CVWA 2BRQA 5C0ND 1TIUA 1SY6A 4EDWL 3SDCC 3QFJE 1SJVA 4NQCE 1Q9WA 4OGAD 4M7LL 2DICA 2Q8AL 1PY4A 4W81A 4YXLH 1I7RA 4X7TA 3O81A 3HFMH 3EDKA 4PRPA 1QFHA 3L1OH 1F42A 4JO3H 1OT2A 5DGQA 5C07D 5C70A 3DJ9A 5E9DB 4P46A 4KKCC 5D7JA 3BQUA 4IRSD 2OMBA 3NTCL 4XWGL 3BUYB 5FYKL 5IOPA 5E03A 1AFVH 3FFCE 1NBZA 1FVCB 3EYQD 1C08B 1FN4A 1TITA 4GLRH 2XZQH 4QRPB 5ISZA 3TNNA 2ZP0T 1YMHB 4L3AA 4JANA 1I7UB 5TE4L 3B4NA 4OIBA 3IU3A 4PJ7A 2VUYA 2CIIA 4JFEA 5I18L 4DOHB 1E6JL 4LVEA 1A7BA 3ZTJG 1T4KB 4Q97A 3NCYP 2MTPA 1F13A 1UWXK 1Y18A 2HJLA 1Q9LA 4H26B 4LSUL 1PQZB 2HT3C 3QDMD 4IOFD 3SDDA 3SO3B 3U46A 2YUWA 3MGTA 3LV3A 4PJCE 4PRHE 1CLOH 3M07A 4PP2A 1U92A 1GGTA 1OSPH 4PS4H 3AGVA 3RL1B 5CBEB 1KXTB 4DKEH 3U30C 4QCIA 3D2UB 4Y4FA 1NCNA 4G6AC 3ZYJA 4UDTB 5JA9A 5K9KA 2J2ZA 2VWEE 4Y4HD 3TH3T 4BH8A 5CFHA 2GAZB 3CH1A 3VFOA 3MNVA 2AJXH 2AJZB 5IVXF 3EO0B 3MLYL 3P4MB 5AWNL 5C09A 3QUZB 1F58H 3O6LL 2HRLA 4OIAA 4YHOL 3OKMB 4G8IB 1W72A 4RNRB 1S7TA 4PRIA 2E8YA 3Q0HA 1TCRB 3HG1E 1HHJB 3JVGA 1R3JB 4EDXA 5EO1A 2Y7QA 3QCVL 5KSUA 3D39A 4NKMB 1WCBB 4JM4H 4K23L 4LLVB 2E7LA 4X5WB 3P77A 2NX5D 3GBLA 1QZ1A 3VXME 2WBJC 4JLRB 4KZDL 1NJ9B 5JPNA 2AQ1A 1I1AC 1QSFA 2PUQT 5KZCD 2CGRH 2OXHA 3ILQC 4OZ4A 3STLB 4X5XA 4PJGF 5GGVL 1ORSA 1U8OB 4R6UA 5EFIA 2C26A 1QRNE 4NO0D 3W9DA 2ZJSH 5GS1B 3D69A 3RWIB 5FYJH 3BPOB 2KBGA 2P5WA 2M8XA 2DQFA 3BT2H 4P57A 3FFCB 4LLYB 4TULL 5F72S 2D31A 4WY7L 4TUKL 4YEEA 1INQA 3BP4B 4ODVL 1RZJL 5CLWA 4PG9B 1N4XL 4MCZB 4O58H 4ZDHA 4LRNH 3W11C 1D5BB 3FQRB 1MQ8A 1W0VA 5EO9A 1FG2A 3QDGD 3ZSSA 1N5YL 1NBVL 4LRIC 5EC2B 2YD7A 2VZUA 1RHFA 2WK2A 1X5JA 5I76B 2MFNA 2YWZA 4C54A 1BZ7B 2VXTH 2NR6C 3MBED 3PWNA 3U83A 4HF5H 5HPMB 1H3XA 5H37H 3BPNC 2BXYA 3KYMB 2H2SD 2ICWJ 1CD9B 2X2YA 5F21B 5DZNA 1KUMA 2ADJB 3L3DB 5INCB 4PRHB 4MSWA 2IG2L 5E5MB 3TPUA 5HYSA 2XWTA 3PGDB 1IL1B 4YEFA 1TJGL 3OB8A 1VGKB 4NN6B 4XVSL 2HLFC 4RRPG 4L8CA 4J2XA 1YQVL 5EC1A 3BX7C 2C7UA 3MJ9L 1JHKL 3LIZL 5CLTA 3HI6H 4IDJL 2YA2A 3ECBB 3QWQB 4JFOB 3V0WH 4U4BA 4OIIL 1LO2H 2W9DH 4XT1C 2HTKD 1SJHB 4TNVF 4NM8L 3WN5B 5F1NB 1NEZA 1QSVA 1RZ8B 2KL6A 4LVOB 3SQBA 4XCYA 3IFNH 4M02A 2IQ9L 4LCCC 3WIHA 3MRFA 2BSRA 4KZEL 4Y4KB 3KXFB 3GNMH 5EWIH 5TF1H 4C56E 3KPSA 2D4DA 3UTTE 4NSKA 4PP1D 2YMXH 1J05A 1NKOA 4HV8B 1KPRB 5DC0A 3WXWL 2PTUA 3X12B 1BVLB 4QHMA 4UU9A 5LAXA 3UZQA 4WO4B 3CUPA 4ZAKB 1OAQH 1VB9A 3DMMA 3GJEA 5FDWA 2JJVA 4RA3A 3MLWH 3OKNA 4J6RL 4M1DL 2ATKA 1UB5A 2FJFA 2MSPA 5LQBL 5GHWL 1G7IA 3HNTL 4F7EA 4KDVA 5IBTH 2W07A 3MRNA 4PGEA 3MFFB 3WKNA 4HPYH 4JCLA 5JIHA 1P7KB 3SCMB 3EIFA 5ADOH 2WANA 1JNNH 4PD4K 5J11B 4XVTH 4DN3L 1IM9D 4ZPVA 2DQDH 4U1GB 5GS2H 4S1RH 3FN3A 3IKCB 2ZNWA 2QSVA 2RCSL 1V3LA 3GBML 4WDIB 1QPPA 5DUML 3BDYH 5I73B 3PQYA 4R7DB 3ORJA 5HBBA 4FQXD 3ZT6A 4RWYL 4L3CA 3IJSB 3SE3A 3O8XD 2GK2A 1G9NL 1QBML 1OLZA 5HI4D 3GSOB 5EU6D 1R5WB 4M4PA 2R15A 1LWRA 1QTYT 2YK1L 4Y89A 2NYYC 5E9DA 2EC8A 1Z9SA 4JRYE 2Y36H 2P5EB 1I8LA 3RIFF 2F58L 2VR5A 3BUYA 1NC4B 3W2DH 2WWKO 1A3LL 4N0YL 5D1QB 5JXEC 4P5TD 3TBWB 3FB5B 5E6IC 5CUSL 1XIWB 1KYOJ 2VLMD 1MWAL 3ZLQC 1K8DA 1MCEA 2QADD 1FVCA 2HT2D 1C08A 4QRPA 3X11B 3E1F1 1YMHA 2I60L 3QIWC 1I7UA 1JZ7A 4P4RB 3UTTB 2N1KA 2Y6SC 4ZFFB 1T4KA 1L4IA 3C6LB 4NFCA 1NFIA 2AV1B 3C5ZD 4H26A 1N7ML 3GI9H 1PQZA 1UWGH 5DFTA 1JNJA 4I3GA 5T3XL 2ZOKB 5DF0A 2FZ3B 3RRQA 4CMMB 1CWVA 3QZWG 4J3TA 4PJ8D 3RL1A 5CBEA 3VFUB 3LS5H 2ZSWB 3D2UA 3ZTNL 4I3SL 1YY9C 4UDTA 1KLUA 5A2FA 2H6PB 3HRPA 1T5XB 4YBHA 2GAZA 4U7KA 2AJZA 4DW2L 1GIGL 2MQ3A 3EO0A 3P4MA 4XTRC 3QUZA 1CDYA 2BHZA 2FGWH 2PO6B 1MFDL 3OKMA 5C0CD 3IB4A 4G8IA 4X0KB 4RNRA 1MIML 2P49B 4M03A 4H20L 1TCRA 4HLJA 1HHJA 2ZUVA 5F9WB 1R3JA 1E27B 3RUGE 2D3VA 2XNAB 4I2XB 4NKMA 1WCBA 4LLVA 3NIGF 5I16B 4OSUL 4X5WA 2NW3B 5FM5M 2CLRB 2ZZUT 5GJTL 1KB5B 2BDNH 1ES0A 3QEHB 2V9QA 4JLRA 5T1KB 5IB4B 3KPNB 4N1HB 1RUPH 1C7SA 3STLA 2EH8H 1CDGA 1U8OA 3NCEB 1VFBB 3HB3D 3RAJL 4S1QH 3QULB 5GS1A 3O6FB 3RWIA 2NXZC 2D7TH 1WAAF 4Z7NF 4RBPH 4LKCB 4OJFL 4RAHA 3W81A 3FFCA 4LLYA 5D70H 4R97B 5DT1L 2JE8A 3BP4A 3P11L 2AKRB 1K8IB 3V4VH 3GGWB 4PG9A 4MNQE 4G6JL 4MCZA 3OJDB 3RGVB 3LEVH 1D5BA 1Z0NA 3FQRA 3AREC 3O0RH 2GJZB 3QFJD 4NQCD 3QIBD 5EC2A 1IFHL 2QHRL 2DQGH 2PYEB 3NPSC 3QBTB 2GHWB 5I76A 1DQLH 3HMXH 1BZ7A 3P4LA 1CVRA 3FO0H 2C3VB 3WE6B 5IJVB 3QO0B 5HPMA 1Q38A 4G6KL 4MA7L 1CTNA 5KAQG 3NA9L 3KYMA 4ZUTB 4U6HB 2E9JA 2E9WA 5CJOH 5AZ2H 2OYPA 2ADJA 5DD1L 5INCA 3RDTD 4PRHA 4IHOB 1I3GH 5E5MA 3H6JA 2F19L 2R2CA 2ESVD 4LQFH 2A2QT 3VGAC 3GSNB 3PGDA 1IL1A 5B4MC 3LZFH 1VGKA 2L4OA 4OZGF 5BO1H 3M8OH 2ZUYA 3IFOB 5DUPH 2AP2A 4EI6B 3QIUD 5DJXB 1KJ3L 2CMRL 2ZG3A 3QUXC 3ECBA 1KC5L 1MFNA 5I30H 4JFOA 5D1XC 1C5CH 3LRGA 1QP1A 2IPKB 1BJMA 4YUEL 1SJHA 4K94C 4FFVC 5F1NA 3WN5A 3T3PE 5DS8B 2GW5A 2D7PA 4NGHL 1X44A 2YPLB 1RZ8A 1NCUA 2B0SL 2RAMA 1JF6A 5CCKL 3E2HB 1FO0L 4O2EB 4WGVB 3BE1L 1NMCB 5GGUB 2IANE 4WI9A 1A6VL 3SKOB 1FORL 4Y4KA 3KXFA 3VFTB 4WI7A 2KPNA 3FRUB 1X5IA 1EO5A 1BOGB 4ZO6A 5E8DH 4G43B 4LCWB 4U6XB 1S7UB 3G08B 3OKDA 4TRPL 1OP5K 2WWKT 1FV1B 3B6SB 4HV8A 1KPRA 4RFNC 2XKNA 4OZFH 4P9ML 3X12A 1BVLA 4WO4A 1WV7T 3PHOB 1MHEB 3CIQA 3ARBD 4ZAKA 2V7HB 1MCOH 3TO4D 1QBLH 4N0UB 4DEPC 5FYKD 5DO2C 4QRRE 1B4JH 1F5WA 3RU8L 3VXUD 3GSNH 4C83B 4Z7QE 3B5HA 3JBG7 4PYHA 4WJ5A 1QYGH 3VXMD 1A6ZB 1OGAE 3MFFA 3I6GB 4HUWB 1DBBL 2EYTB 1P7KA 2NY2D 3SCMA 4RGNB 5TH2B 4D0BB 4M7KH 3K4DA 4CADB 1A0QL 4GRLA 5CJXC 1EUUA 3BKCH 5ACMA 2R2EB 4DVBB 3IKCA 4XMLL 4OF5A 3MJ7B 4PBXA 4WDIA 3CVIL 5GS0L 1Z9MA 4JFXB 1KFAL 3CXDH 1IEHA 3WV0A 3IJSA 1MRCL 2BVQB 3F62A 5AG8A 1I1YB 3HE7B 3GSOA 3IDMB 5A2JH 4QY8B 1R5WA 2YD6A 1JRHL 3QI9D 2X89A 1A7RL 4K9EH 4AJ0A 1LEGB 3O2VH 4OCYH 1GPOL 4LQ1A 4N8CL 5DMKB 1LILA 3D85D 1QSEE 4NBZB 3O9WB 1NC4A 3WHE1 5D1QA 5E8PB 1UM6L 3TBWA 3FB5A 5A43C 1C5BH 1RIUH 4CU8A 1XIWA 2JJTC 1H8SA 4I0CC 2YPVL 1RVFL 3ZE2F 3X11A 5T5NG 3ESUF 15C8H 4OCNC 2R0ZH 2Q7YB 5JQ6L 1LE9B 1CIDA 4P4RA 3UTTA 1RUML 4Z6AT 1S7QB 1QR1B 2LFGA 4ZFFA 1V7MH 3DX7B 4NQEB 2VXQL 3C6LA 1JMXA 4D9QD 4WEBL 5F9OH 2AV1A 3UYRH 4PLJD 3V8OA 2I07B 5I19H 4FNLL 3WUWB 3IAQA 2JCCF 1QACA 2JB5H 3CVHH 4C59B 2ZOKA 4EI5D 2FZ3A 2DB8A 4CMMA 4KXZI 4QRRB 5MEPB 2A9MH 2AXHA 2CO7B 9CGTA 3VFUA 1YEIH 3THMH 2ZSWA 1VSCA 1H9VA 4LSPL 4GJTB 1FAKT 1LEIB 2EYRB 3HMXA 4HBCH 1NFDE 2H6PA 3AFLA 1T5XA 1TQBB 3VFSB 4C56D 3NACH 2PO6A 3ZKXC 2L7UA 4BSVB 4Y1AD 1AJ7H 4X0KA 2ICCA 1FGVH 2LTQB 1MFEH 2R1YA 2QHLA 5HDBF 1E27A 5FHAL 1B3JA 4IMLB 4I2XA 5DJZB 2R8SL 2V9RA 4L4VB 4R4FH 5I16A 1K3ZA 2NY0C 5DJ0B 2NW3A 2JB6B 2CLRA 2AW2A 1FE8L 3WSQL 1KB5A 5IB4A 3QEHA 5T1KA 4YX2H 1J9CT 1OAYL 3KPNA 3QHTC 3F6IA 4WV1B 1QNZL 3BWAB 1MFBL 3OKYA 2MNUA 3PP3K 1VFBA 1QSEB 1EVTC 5ILTL 1R3IH 3AM8A 3SKJL 3DOSA 3NH7L 3QULA 3O6FA 1CGSL 4QHKJ 5BMFH 3GO1H 3P4OB 1VHPA 2BY1A 2IF7A 1P9MA 4LKCA 1MQKH 5DR5H 3ZKQD 4NQDE 1HKLL 1W72L 2AKRA 1K8IA 3GGWA 5MP6H 3Q6GH 5IF0B 3RGVA 1ZANH 2NY3C 4DVRH 1DVFC 5J3HD 4LHJB 2GJZA 1CN4A 1M7DB 2IH1B 4GSDH 5CGYD 1NANI 2VDML 2PYEA 3VXRD 4HXAL 2F53E 2C3VA 3WE6A 5IJVA 1MNUL 3QO0A 5I1LB 2BOCB 1RHHB 4JKWA 3LH2H 4ZUTA 4U6HA 4EJ1C 1U42A 3BEWB 5FYKU 3NCFB 1LNUB 4MQXD 4KXZH 3KPRD 4IHOA 3BKYH 4X9GA 4JDVB 4OBRA 1CDBA 4HS6B 3GSNA 2R56L 3ILPB 3QUYC 4DUXA 3IFOA 3GJFH 2X1PA 1NFDB 4EI6A 5DJXA 4JKKA 4Y19D 4EOWL 3DARA 4JDTH 2CIKB 1KCVH 2WUBH 2IPKA 3SPVB 1NMBL 5EA0L 5EU3B 5FM5O 1CLYL 2BVYA 3RA7L 4JFDE 3GBNH 5DS8A 3C09C 3CLFL 4UDUB 2YPLA 4X6FB 1AIFB 4R0LB 1T80A 3NZ8B 2AS5M 3TFKD 4X6CE 2DQUH 5ID1B 4O2EA 4HJJL 5GGUA 4GT7A 4ONGL 4LVHB 1NCCH 3SKOA 4YHPB 1OPGH 1UC6A 3OAUH 1RSFA 3LQAL 1CFTB 4QXGL 5GRWA 3VFTA 3VXPB 1N0XH 4CRPA 3FRUA 2NLJB 4MDJB 2Y4SA 3VFRB 1BOGA 4G43A 4HQQH 3OKOB 2XTLA 4LCWA 2DJSA 2X4NB 1S7UA 4U6XA 3G08A 4YBQC 5J8OA 1FV1A 2ENSA 3B6SA 4TTDD 4NT6B 3S37L 1FRGL 4RMQA 4YK4B 3V52L 2F54B 4P2QB 3ULUF 4HKXB 1U8IB 4ZSOE 2Q6WB 5SX4I 5CKAA 3PHOA 1MHEA 3V95A 1MIEL 3FQNB 4NQDB 4PR5B 4XPTH 4OLZL 2FIKB 4QRTB 3MRPB 3WNMA 4C83A 1F2XK 4OV5B 4DUVA 1A6ZA 1BX2B 3WIHL 3MRDB 3I6GA 1INEL 4ODTH 3MUZ1 5I74C 4HUWA 4QLRA 3TN0C 2BK8A 5I1JL 2EYTA 1BM3H 2WBJB 4G9DB 5TH2A 4D0BA 2BCKB 3UO1H 4M9PA 4CADA 1JZ2A 1JNLL 1R0AH 3VGFA 1TPXB 2R2EA 5F7KC 4DVBA 2C3WA 1JTPA 5CJBA 3NCMA 4GFTB 3MJ7A 3V0AC 4YBLB 3IFLL 5JZ7C 1WWBX 3RQ3A 4A6YB 4JFXA 5E2UH 2XY2A 3F7QA 1U3ZA 3WXVH 1ZT4B 2BVQA 3VXSE 1TTUA 5HHXH 2VDRL 4XNMB 5T3XD 1I1YA 3HE7A 4B50A 5LGKA 5D2NC 3IDMA 4QY8A 5F44A 5CBAB 4R9HA 4W68A 4KK5C 5IM7B 2XZZA 4NYLB 1LEGA 2I26N 1CZ8L 4O9HH 4Y0GA 5B8CC 5D96B 5DMKA 5F6HJ 2G75B 4ZNEE 1ETZB 3O9WA 3S9DB 4XP6H 5E8PA 1T7YA 1AD0B 4QOKE 4ZO9A 4I18B 4PJFF 2UVEA 3H3BC 3MV9D 1X6NA 2D7QA 4HWUA 1HSBB 5J9PB 3CSPA 1I3RB 1KGCD 4KTDH 1DBKH 2ED8A 2R4SH 5DRNB 3DRTB 4MJIE 2Q7YA 1LE9A 1KELH 1RZGA 2MPAH 43CAB 1S7QA 1QR1A 5KOVC 2V5YA 3DX7A 3LN9A 3OZ9L 4NQEA 2ZG2A 5HHOB 1VGEH 4YHLL 5J89A 4MS8D 3MNWB 4OZIE 3I85A 5EIQA 4Y16B 2VZTA 1EO8L 1OQOA 2I07A 2DQIL 3WUWA 1BAFL 1QO3B 5LXGH 3DI3B 1FFOB 3DYPA 1YPZF 3BUTA 4M6MH 4B7IA 4QRRA 4M5YH 4P48A 1VFMA 1YYLH 1MF2H 4A6YH 4O4YL 1G7PB 4MA3B 2J1KA 2VDLH 4FG6C 1LEIA 1OGAA 2EYRA 1JFQL 1A7QL 4IRJC 2AK4D 5SWSB 1WZ1H 2XWJB 1E4WH 3QP3A 5F70A 3VFSA 1LK3L 2HN7B 3QSKB 5BVJB 3D0LB 4BSVA 2VKXA 1CD0A 3AS2A 3UBXG 4JZJB 4IMLA 5DJZA 1N5AB 4L4VA 4CMHB 5SV3A 3GJFA 2I5YL 3ZZ1A 3X3FH 5DJ0A 2JB6A 3L5HA 2WV3A 5KSAD 3UJIH 2Z31C 3UDWC 4KVNH 3TCXA 1D5MB 5IIEA 4UNUA 1FAIH 4WV1A 1CT8B 1MAMH 3BWAA 4QF1B 1QSEA 4ZYKB 4WFEE 3EHBD 1AGDB 4IS6B 4ZODA 3SE4C 1TMCB 5IGXH 3P4OA 4QRQB 5EOCL 4XH2B 1B0WA 4K3DH 1R24B 4XNXH 2XG4A 4AY0A 2R4RH 4HWNA 2OJZH 4BKLB 5ENWB 3GRWL 4MNGE 1MOEA 2OI9B 5SWQB 1FNGB 3DROB 1C8PA 5IF0A 3UCRA 4MJIB 1M7DA 2IH1A 4JG0H 3TV3L 5E99L 2APBA 3GSUB 1KCRH 2R0KH 1U3HC 4NIKB 1RJLB 4XX1E 1FLTX 5I1LA 2BOCA 4DGIL 1RHHA 1PKOA 2NQCA 3RL2B 3L3IB 1Q0YL 3BEWA 1CQYA 1LNUA 4NZTH 3PWPD 3PUCA 4QO1A 2D0HA 4K7PY 1HINH 3OTTA 5F7LB 4WNQB 2KZWA 4HS6A 1AD9B 4LU5L 3KGRA 4Y2DC 3EDJA 5I1GH 4LHUD 5EBLB 3LMJL 4MJ2A 5E4EC 3NIDE 1NFDA 2XA3A 1J8HD 3VDBA 1TXKA 2ADIA 4JKPL 3REVB 1A7OH 5DD0H 2XTJC 5KN5B 3SPVA 3HRZB 5EU3A 4YHKL 1FH5L 3ARFD 4TSBH 4YDVB 4PRDB 3WNLA 3NCJH 1G6RH 4G80B 3V4PH 1J1PL 3QDHA 4KK6C 4UDUA 1WWWX 1NL0H 4X6FA 2IAMC 1AIFA 4R0LA 1JCKA 3NZ8A 5ID1A 1IC1A 5DSCB 4KKCD 4ETYA 5HYFA 3GSXA 3J8F7 4YHPA 3RI5F 2B5IB 3VXPA 1CFTA 5GS0D 1YECH 2NLJA 4MDJA 3VFRA 1NGWB 1OP9A 4N68A 5DXWA 1CR9H 3OKOA 3VFWB 3SJVE 4JKMA 2VDNL 1XF4B 3UTSD 2X4NA 1G0YR 5CIPH 3V6OC 3N50A 4H8WC 3L5IA 5J4MA 4NT6A 2P8LB 4FFZL 4K71C 2ICES 4U6VH 2P48B 4M6NH 2F54A 2OP4H 4P2QA 4HKXA 1U8IA 2Q6WA 4GO6B 2XICA 2DQTH 1JNNL 4U31A 5DMGD 4XVTL 5IR1B 3KPTA 3FQNA 4NQDA 2WUCL 4PR5A 4JY5L 4S1RL 1UWXH 1ADQH 4MNGB 2FIKA 4QRTA 3MRPA 2X7LA 1TVHB 4OCWH 5BZDB 4OV5A 4YFLI 4LLAA 1BX2A 2AAVA 4R8WL 3BXNB 3MRDA 5F7UA 2WBJA 4G9DA 2BCKA 3DI2B 4JFPA 1N6QL 1MLCB 5TPWH 1KOAA 2Y36L 5J7CC 1TZHB 4PJEE 1YNLL 2NXZB 3EDFA 4PRPD 2XZAH 1EFXD 1IC7L 4YZFF 4A6YA 1ZE3C 5JR1L 1VENA 1HIMH 1ZT4A 2ITDB 3KHQA 5C6TL 4XNMA 3OJVC 3R1GH 4GRWF 1GOFA 1W0YT 2OMNA 4Z78A 4N5ED 5CBAA 4HIXH 4Q6YA 4JRXB 3ZYZA 5HD8C 3X14B 5IM7A 1RFDL 5KSVB 4NYLA 3RVXC 4M93B 5TDOB 3KPQB 1W2KT 3T0AA 5ADPH 2G75A 1ETZA 2EDBA 1I1AD 4NZUH 5ISZD 1IM3B 1AD0A 1I9IL 1BFSA 4PG2A 1CXEA 4FXKB 4GAYB 4IJ3B 3V5DB 5IVNA 2FECL 4OGYH 2R0WH 4EUPB 1HSBA 5J9PA 1DTUA 3RPKA 1I3RA 1VFUA 4JFQB 3IF1B 2X4UB 5DRNA 4K8RL 3O4OC 2X4RB 3DRTA 1GOHA 1SEBB 2ORBL 5I15H 4M61B 43CAA 3M1BB 1N2RB 4GXVH 5HHOA 4WFFE 2NY5H 2GCYB 1NMAL 4ZOCA 3MNWA 4KKBC 3MLVH 1INDH 4Y16A 5D6DC 5SX5K 5FUZL 1XCTB 4QYOB 2ILLA 1OOAA 4Y4FD 1QO3A 3TP4A 2DM4A 5LKNA 1FFOA 1Q9OB 1NCBL 2KUTA 4B53A 5D7LE 1E4JA 3TH4T 2IBBA 2DM7A 1G7PA 3F58H 3QEQD 4MA3A 5I75C 5D2LF 4NQVA 3D0VB 1DCLA 3LY6A 5L8JB 5SWSA 5HYJD 4PRID 2MQ0A 2XWJA 5ETUB 4XI5C 3S98A 4K3GA 4X9BA 2FJHB 5H35B 2HN7A 5BVJA 2RBLA 4UAOB 3O3EB 3D39D 4F15C 4P9HC 5J57B 4V2CB 5E8NB 5EZLB 3RWFB 4JZJA 1RULL 5EOCJ 5BJTB 1D5IH 2D7TL 4JM2C 5GRUL 1QSFD 1N5AA 4FTVE 4JG1L 3ZE1F 3HPJB 4JPKL 4EUPH 1TTGA 4DEPB 1KNOB 2F15A 3MACH 2D4FA 4DQOL 1T5WB 3V4VL 1CFNB 5GSRA 1XR9B 1D5MA 5DWUL 2CRZA 1MRDL 4P23C 1HQ4B 1CT8A 1NGQH 3BVNA 3ZKSD 1P2CB 2DQGL 4QF1A 3DUSB 4OD1L 4ZS7L 4WENB 3UYOD 2AXGB 4ZYKA 3U9PH 2IBGA 1AGDA 2VLLB 3S4SG 4IS6A 2GJ6B 4XH2A 1OB1B 2FYYB 4F9PA 5IMMB 1CDUA 5C2BH 1R24A 4XVUC 2YRPA 4S1DC 4CNIB 3KAAA 3SKMB 5D71L 5CJOL 5HDQH 1J5OH 4BKLA 5ENWA 1JGVH 5SWQA 1FNGA 1I3GL 3DROA 4L29B 1UM4L 1U8PB 4MJIA 3GMMB 3VXSD 4Y7MA 2NZ9C 4ONFL 5TDPB 4CDGC 4LDOB 1JGDB 3MTRA 3R4DA 5BS0B 4AEEA 1RJLA 4OLXL 4PGJA 1TZGH 1KB5L 4TNWF 1CYGA 3L5XL 4HGWB 1T89A 3TVMB 3VRLF 4KQ4H 3RL2A 1EV2E 4D9LH 3DVGB 1EEZB 1ADQA 3RVWC 3PV6B 4WNQA 5JXEA 1AHWC 1AD9A 5DUBB 3C8HA 2R1WB 4GRMA 5EBLA 3VFMB 5KW9H 4GRWB 1RIVH 1YEEH 3DO7B 2GUOB 1SMOA 2CXKA 3PIQB 5CSZB 2FECI 1JUFB 3REVA 5GZOD 5KN5A 2PXYD 3HRZA 5E8DL 4DKAA 4OD2B 4YDVA 4WUUE 4F8QA 3K0WA 4G80A 3OL2A 4QXWA 3WIFB 5E94B 3MLZL 4TVPH 1GAFH 3NFSH 3FRPG 3B3IB 4FTVB 1ZVYA 2O5YH 5DSCA 5FIEA 4M9OA 2BERA 1FVDB 3S34L 2OTWB 3KPSD 3BRFA 3HUJB 4HULB 1WWAX 1QBLL 1S78D 5E6ID 4JJ5A 4JN2B 2XPGB 1NGWA 1JZ3A 3GSNL 2E7MA 3VFWA 3WIIH 2JLLA 2BNUB 2EDNA 5ABDE 5BVPL 1X5AA 1D6VH 3GKWH 2QJDA 2P8LA 1S7WB 4HT1L 1U2CA 2W9EH 5JW4M 3VXNB 4HX1B 3BMWA 3GIZH 4M7KL 2R69L 3ARZA 2Y6SD 4FFWC 5FECB 1JF5A 2H45A 1JGEB 3SDXB 5IR1A 3MLUH 2AJYH 3QDJE 4M5ZH 5KVMC 1CXFA 4G3YL 4MNGA 3FT4B 1WFNA 5KS9F 3WJJC 1TVHA 1F11B 1S7RB 1BP3B 5BZDA 4ZO7A 2BVTA 3FKUS 2X05A 3BXNA 3DX8B 3VFVB 1UKTA 2QLVB 4NWUH 3WLWC 1DQML 3BIBX 5JXAH 1FNLA 1A14L 1MJUL 4JFFB 5CILH 5E5UB 1MLCA 1KIQB 3C9NB 4ZFZB 1TZHA 3L3KB 2YZ8A 4R4NC 1FHGA 4D8PB 1MY7A 4V1DB 5TQ2H 2OR8A 4LPWA 1C5BL 1IAII 4X7FC 1RIUL 2ZUTA 3T4AB 2ITDA 5E9DD 1MLBB 2ID5A 4WVRA 4BH7B 5GRVL 4GQ9H 1JWUB 3SKUD 4Z8FH 3N85H 1CGWA 1U3JA 4I48B 4JRXA 1DVFB 1FIEA 4YHZL 2BSSB 3X14A 5KSVA 4B0MM 15C8L 3MRQB 3FT2B 1SQ2N 4XP9H 1T7XA 3TA3B 5TDOA 3TBVB 4D3CL 5BV7B 4PJ5B 3S5LA 3KPQA 3B9EA 2WZPD 5E2TH 4OD3H 4EN3B 1UACH 3QHFH 1IM3A 3BSZH 4FXKA 4GAYA 3V5DA 3RX8A 1LMKA 4EUPA 2YR3A 3UAJD 4XPHH 4JB9H 3IDNB 1CICB 2EZ0C 3EKCA 3RGHA 4JFQA 3IF1A 2X4UA 4RAUB 2X4RA 1SEBA 3BISA 4OB5L 4X98B 5M94B 1YEIL 1F97A 4M61A 4EQ2A 1XH3B 2OSLB 3QCTH 3ARDC 1N2RA 3M1BA 5DFVC 2EIZB 4HBCL 5JUEL 1AO7E 1S7VB 1BIIB 5D2NE 3ARED 3MQIA 5IUSA 4XB8A 5D9SB 5HHVH 2BVEA 5MEOB 3GMPB 5IFAH 1XCTA 3K46A 4OCSL 4QYOA 3IGAB 5ESAB 5J56B 3D2UD 1CFSB 3CSYB 3MOQA 1SHMA 1AI1L 1Q9OA 2X5PA 1YEKH 4LEXL 3MOAL 1BFVH 4PLKC 1A6UH 1F6AB 3U48A 4OUUB 3PP4H 1MFEL 3C2AH 2DI9A 3PL6C 3QUZD 4JQIH 2H1PL 2HVJB 3D0VA 4R4FL 3BGMB 3CFKB 1LDPH 5AYUH 4F7CB 5DRZB 2J6EH 4OTXH 5CWSB 5ETUA 2XQBH 5TQ0L 3TBTB 4ZXBC 5A3ID 3VD3A 5H35A 5I1IL 2EC9U 1ZAGA 3O3EA 2VIRB 4M48L 4UNTA 4FQ1L 3QUXD 1R3IL 5E8NA 5EZLA 3T3MF 3RWFA 1G1YA 5C0GB 2EC9T 5D1XD 3PWUB 1JIBA 4NNPL 3CFEB 1A6WL 2O61B 5EZOL 3HE6B 2VR9A 2X40A 2ZUWA 2VB5A 3HPJA 3QUKB 4WIQA 5C0BD 2BVPB 3K3QA 2C9AA 1ULVA 3T0XA 1KNOA 3KYAA 1T5WA 1CFNA 1J86A 1XR9A 1DLFL 5J12C 4DVRL 2OLDA 1KBGL 2BY0A 4XP5H 3W82A 2VDOL 2J8UF 5C86A 1WF5A 1P2CA 1O0VA 3DUSA 3K80A 4X9FA 1FNHA 2AXGA 3NIGE 2EH7L 3TN0B 4P59H 2J4WL 3CX5K 2PNDA 4RGOH 2GJ6A 1OB1A 2FYYA 1MHCA 4X80H 5IMMA 1OP5H 3V6FB 1KEGH 4XXCC 4CNIA 3IFPB 3SKMA 2P8MB 2FX8H 2Z4QB 1ACYL 5C7XH 5CZVL 1VADB 3OJ2C 4L29A 1U8PA 4PFEA 3GMMA 1DBAL 2Z8WC 3RP1A 4I77H 2AJUL 4Z7NE 5H37G 5TDPA 1JGDA 3MXWH 1GGIH 3S36X 5BS0A 4XNYL 1KCSH 2LAAA 1W8OA 1N64H 1ITBB 4HGWA 3MUJA 2WUBL 3TVMA 1F4WH 1I3VA 3O45B 5HHMB 1CU4L 3JTSB 4X5LA 3IXTB 3DVGA 3BHBB 1EEZA 4YC2B 2BHUA 1YYML 3PV6A 2V6HA 3SDAB 5DUBA 2R1WA 2EXWD 3WJLC 2V2XB 2L0DA 1XGUB 5F96H 1LGVA 1IGFL 1OW0C 4Z7WF 4ZOAA 4ELMF 3VFMA 3BP6B 3B9KB 4HH8A 4MZ3A 3ZE0F 3DO7A 2GUOA 1OPGL 1QFWH 3PIQA 4R4BB 1UM5H 2QQNH 5CSZA 1JUFA 4IRZH 2ZOLB 1QFUL 3QZWB 1UADC 3SGDI 1L0XA 3PDOB 2EDEA 4WFFD 4OZGE 3EAKA 3BOVA 4UBDC 1GGYA 2X4QB 4Y4KD 5IT2H 5E94A 5HGGS 4G7YH 2PW2B 3B3IA 4FTVA 1P84J 5D72H 1EZVY 1FVDA 4K7PX 2OTWA 3J7HA 5C0JB 5D7LD 3HUJA 4HBQA 2W92A 2LVCA 1CD1B 4JN2A 4K7FA 2XPGA 2X44D 5DJAB 4AMKH 1HHHB 3ZHKA 4WO4D 2BNUA 3TWCH 1U93B 4X7EC 4ISVB 2KH2B 4JN1H 1U0QA 5T1MB 5F7EL 1UXSB 1S7WA 3JWOC 4L4TE 2YSSB 4NWTH 3EJYC 5JQHC 2NMSA 3VXNA 4LAJH 1RUAL 4HX1A 2XTJE 4XNZB 4JHZA 4YQXL 5FECA 1BBJB 1JGEA 3SDXA 3WFCH 4HCRH 4DGYH 1P6FA 2A6DB 2V9TA 4P2RB 5DJ8B 3FT4A 4KDWA 2CLZB 3VGGA 3IRZA 3S88L 1F11A 1S7RA 4UTBH 4M8VA 4HK0B 4XBEL 1PW3A 1XGQB 3WFDL 1NAMB 2F5AH 3AMKA 3DX8A 1LO4L 4OF7A 3S35L 4LIQE 3VFVA 4CJ1A 3MV7E 4BUGA 4K8RD 2QTEA 5MENE 4WW2B 2R9HC 1E6OH 3JUZA 3L3HB 3RZCC 2WAHA 3B83A 4JFFA 4NKDB 4UIKH 3ZYIA 4J3VA 2E6QA 2HKHL 1KIQA 2A6IB 3C9NA 5T1DH 3V6OE 3L3KA 5JHDB 1FPTH 3OWEA 4Z0BH 2CKBH 5ALBH 5CJ8A 5T33H 1X5LA 5C0NC 1J1OH 4D8PA 2DN7A 4V1DA 4JGMA 4J3OC 1T2QH 2X89D 3A6BH 3OHXA 1MJ7L 3T4AA 1MLBA 3JXAA 4BH7A 4JHWL 1HHGB 1M4KA 2P5ED 1IARB 2J6EA 4TYUA 1JWUA 3ARUA 2GSGB 1DBKL 1N6VA 1NC4D 4I48A 5T3ZH 1DVFA 4KROB 2BSSA 3UJTL 3VFPB 12E8H 2YUZA 2NY0D 3O2WH 4IRSC 4RRPA 3TA3A 3TBVA 4PJ5A 1A4KB 2DTMH 3H3PL 4H88H 2B2XL 2VN7A 4EN3A 2HKFL 3D3VE 1MRFL 1A5FL 1GVIA 3AUVA 2HTLD 3PP3H 3EYQC 4JJHA 2DQCL 4JZNB 3JSSA 4M6ML 4Q0XH 3IDNA 4RAUA 3QDAA 2HP4A 4X98A 1PG7W 3QFDB 3QUYA 1XH3A 2CR3A 2OSLA 2VDLL 1NAMH 2EIZA 3ARGB 3TT3L 4YE4H 1S7VA 4HS8H 4L4TB 2NY3D 5LWYL 4HKZB 2N4IA 5D9SA 5C08E 3ZE2E 4C55A 3HHRB 5MEOA 4IOFC 3F65A 3GMPA 1KB9J 4OV6F 4KAQH 4WUUD 3TZVC 3IGAA 5ESAA 5J6HB 1CFSA 1DANU 3CSYA 3RKPA 3MV11 4M6OH 2NY6D 2W1NA 4U3XA 1MHPL 4X7SH 4WI5A 5I1CL 1F6AA 4OUUA 5D1ZC 4Z7WB 4OCXL 4UT9H 4XMPL 2HVJA 3LCYA 2J12B 3C2SA 3BGMA 4L4JA 3CFKA 3HZKB 3OQ3B 3QCUH 4F7CA 2JCCE 5DRZA 3WHE0 3VWKC 6FABL 3W0WD 3MV7B 5CWSA 3TBTA 1QRKA 2F8VA 3BKML 2WINB 4LSQH 4ZTOH 2W59A 1FAIL 4JREC 2VIRA 2FB4L 4O02H 3TJEH 3L3GB 4G42B 5C0GA 3CZFB 3PWUA 2EEAA 4NCC2 3CFEA 5FEBA 2O61A 3H9SE 4RDQG 3HE6A 3QDJD 3LKSB 1YMME 3QUKA 1WISA 2BVPA 4IIQC 4NC2B 4X6BB 4TUJB 3O6FD 1TJIH 2B1HH 2VE6B 2M26A 5L2JB 4X6DF 4AYFA 1TNMA 4TSCL 3TN0A 4ENEC 1F2QA 2FX9L 2IALB 1JGLH 4G8GE 5BOPA 5EORH 4Z95H 1BF2A 1AH1A 4GMTH 3V6FA 2FATL 5DJ2B 5EIVA 5MEQB 2PYED 3IFPA 5DQDL 3CFJB 2P8MA 3RX7A 2XV6B 2Z4QA 4LOUD 4YDKH 1S9VB 1VADA 3P0YL 2CQVA 2DRUA 4HFWB 3I9GH 2QQKH 3T1FB 5L2KD 1WZMA 5ICXB 1OCWH 3MBEC 4LIQH 1MI5D 1U3YA 4NHCH 5C08B 4N8VB 2H2SC 5BRZB 2NXYB 1A7OL 5DD0L 5AAMA 4ZUVB 3O45A 2AI0L 3WFBL 4HCRA 3JTSA 4H8WH 1YJDH 4E41E 3IXTA 4RSVA 3BHBA 3UROR 1I9RH 4NNYB 1NH6A 1ZV5A 4HGKC 3FFDB 3SDAA 3ULUL 5FM8A 4MZ2A 4LFHD 4BQBA 1EEUA 1TQCC 2V2XA 1XGUA 4HWEL 3U1SL 4G9FB 1M7IB 3B9KA 5DYOB 1X5KA 3D9AH 4MMZC 2DDQL 2VL4A 3C08H 1PDKA 4WEMB 5A40E 3LEYH 2ZOLA 2HTKC 3QZWA 1BFOB 2FHCA 3RJQB 4EBQH 3PDOA 3ZDZF 5E24E 2X4QA 4NO2B 1FYTE 4KK5D 5F8RC 2ZCHH 3HTLX 5EOQL 1OL0A 2PW2A 2DQTL 2EXYD 3QWRA 5C0JA 3DUUB 1JPSL 1ADQL 4PJXB 1CD1A 2AK1H 5DJAA 5IHUH 5JHLL 3A6CH 4DN4H 1HHHA 5I1KL 4PP1C 5IV2B 1U93A 5IQ7L 3C6SB 1WFTA 4M1CD 2GY5A 5T1MA 1UXSA 2YSSA 1RK0B 3WUZA 5TE6L 4OZHB 1FG9C 4HUXB 2DL2A 3BFOA 4KWUA 1KXQE 3MGAA 4B5EA 4MJ6B 2A6DA 1YEGH 5C0RH 2VZSA 4P2RA 5DJ8A 1K4DB 5DURB 3QUMH 2CLZA 1R5VB 2HWZH 2UY6A 4YGAB 4HK0A 1HIML 1XGQA 4S10A 4GUPB 1NAMA 4FZEH 3VW3H 2AJ3B 1HWGB 2DMCA 4MMXC 3EYSL 4JGUA 4WW2A 3L3HA 4NJ9L 4FG6D 4NKDA 5E95B 3DNKA 4XP1L 1YY8B 2YKLH 1KJMB 2A6IA 3BZFB 3WKMH 4E41B 4M1GH 3NOIA 2O5ZH 1RUQL 2WQRA 4KUCF 4HG4J 2DLFH 5JHDA 3HE7D 1T7WA 2EYSB 2P7TA 1F4XH 4FQXC 5ADPL 5LGHL 4ZQKB 3O8XC 2J88H 4I1NB 5CHNB 4YHML 2VXUH 1C1EL 5HI4C 2GITB 3DO3A 8FABB 1HHGA 2E8ZA 5IFJB 2GSGA 2PCPB 3O9WD 3TIEB 4DFIA 2WP3O 5HPOA 2B8OT 4X6DB 1GCFA 1A4KA 3IRPX 3KJ6H 4P5TC 4R26H 4AEFA 1EX0A 5I1EH 1INDL 4BFGA 2HT2C 3GHBH 4JZNA 4ZFGL 2I9TA 4NQED 4RAVB 2HMID 1RU9H 4N1EA 2XI9A 3QFDA 3V7AG 1L0YA 2ZKHL 2VQ1B 1PD6A 3ARGA 1P53A 1FZKB 4L4TA 4Z76B 4ODXB 4ZFOB 4HKZA 1NCDH 2DM2A 2XN9D 1JZ8A 3WD5H 5J6HA 1U3HD 3VD9A 4KH2A 1IC5H 4OQTH 4PJ8C 1A3QA 2XOTA 1QLRB 1CDIA 2ZPKL 4WFHE 4PY7B 5H2BB 4JO4L 5C1MB 4Z7WA 4JPVH 2Y07L 3HZKA 5D7SH 3BYYA 3MV7A 1K5NB 4Y2DD 1KENL 1AQDB 3HNVL 1D9KB 1OWWA 2WINA 1C7TA 1NSNL 5CJ5A 5CS7A 1L9MA 4XCFL 4L4VD 5E6ZA 5C0AE 2H32B 2UYLB 4NN5C 3L3GA 4G42A 1FCGA 3CZFA 2XTJD 4PB9H 4F37K 1G9MC 1MJ8L 1RUKL 1GC1C 1V3JA 1N3NB 2JIXD 4YDJB 3NZHL 4OLVH 1FZOB 1BEYH 1BVZA 3CAFA 1AXTL 2DMBA 3LKSA 3LQZB 4Q7DA 1BD2E 5HDQL 4X6BA 4TUJA 3CU1A 5E2WL 4EZMA 4FZ8H 3QG7H 2VE6A 5E0QA 2XRAH 3HB3C 3MOBH 4YJZL 3BGAA 5L2JA 4FQJL 4IOSD 4TPRH 2PF6A 2DF3A 3CMGA 1Q0XL 2V17L 3I6LD 3AAZB 5KVEH 2IALA 4JO2H 2ICEB 5I9QC 2DWDB 2G5BB 4MCYB 3RVTC 2YXMA 2W60B 5DJ2A 1BBDH 5MEQA 1H8NA 3CFJA 5I6XB 3H2WA 5DJCA 2CKNA 7CGTA 1S9VA 4BQ6A 3QIBC 1A7PH 4HFWA 3IDIB 3EOTH 3T1FA 2ZCKL 3PG2A 2W0KA 2BOBB 1JGUL 3O4LD 5ICXA 5C08A 2YD1A 4N8VA 3OR7B 5BRZA 1OF2B 4ZUVA 2V5TA 5CSBA 5I8KH 3OGOE 1J1XL 4HZLA 4I0KA 1RIHL 4ORGB 4NNYA 3DXAD 3FFDA 1MREL 4WTXA 4TVPL 1EAPB 1ONQB 4U0RB 4YAQB 4JFZL 3E8UL 2DBLL 3LS4L 4G9FA 3QIUC 1M7IA 1YNTB 2O5YL 5DYOA 5DRWB 2FRGP 4EIGB 2LU3A 3O3UN 1A6AB 2EKJA 2GIYA 5F1IB 5IW3A 2P47B 1BFOA 4AIZB 3P30H 4KGJA 4OLWH 3A6OA 1HHKB 4L3EB 1OAKH 3E3QC 2VDPL 1D6VL 4LHUG 4NO2A 4RISL 5B21A 1JI1A 2J5LC 3RVXD 2W9EL 5F3BB 1H3PH 4CAGA 4MDIB 5F9JB 3QO1B 4OI9A 5SWZE 5ECJE 4PJHB 2BXZA 2HH0L 3MV8E 2XKSA 1L7TH 3DUUA 3MLRH 2A6KB 4XP4H 4PJXA 3UBXB 1VCAA 4P2QD 4EQ3A 3ZT7A 4OI7A 5IV2A 5E08L 2W9LA 3C6SA 2VISB 1MCIA 4PTTB 4G7VH 2EEBA 3QHZL 1M1SA 5JDSB 2RGSA 1RK0A 4LCYB 5JXAL 2BNQE 2EECA 4OZHA 4HUXA 4KRLB 3D5OF 1S5IL 3TO4C 4X99B 4NP4H 2A1WH 5IWLA 3QR2A 2PYFB 4MJ6A 1EUTA 2ERJC 5CEZH 1K4DA 5IEHB 2VLRE 1R5VA 5DJ6B 2APXA 4P3CH 1BPVA 1LP9F 1ZKAA 3R0NA 4GUPA 1BECA 1T83A 2NY2C 2AJ3A 5KSBF 3VCLB 3N1FC 1DL7H 5L88L 4MYWB 3TCLA 3NMEA 3WCYA 2OS7A 3DUHA 1YY8A 3BZFA 4KK8C 4E41A 4P5MB 3Q1SH 4OQTA 4G8GD 3NAAH 2EYSA 3BZ4B 1OQXA 3P9MB 5ID0B 1XT5A 4ZQKA 2OZ4H 1ERNA 4XCCL 1E4XL 1YNKH 1Y6MR 1CLZL 5CHNA 4YWGL 2GITA 8FABA 5IFJA 1J12A 2AABL 3ARRA 2PCPA 3TIEA 3DTXB 4JHAL 1RZKH 1UCBH 3U82B 4N5UA 4Q58C 2DBJA 4K55A 4H0IA 2X9XA 3FZUD 4XC1H 4P23D 1ORQB 4S1SL 3BIAX 3T2NH 5ICYB 4KMTH 5ANMB 5I0ZA 2J7LA 4QT5B 3CFCL 4XAWL 3TESA 5F93C 2HRPL 1QOKA 2NY1B 4NRYB 5D8JL 4U1IB 5HHOD 4D0DB 2J3SA 3HC0B 2CJUL 3VWJD 4RAVA 2EDYA 5DD5H 3ABZA 4U1SB 4BZ2H 2VQ1A 5F6IB 5HGDB 1L6XA 5DEGB 1FZKA 3R8QA 4Z76A 4ODXA 4PJ7F 4ZFOA 2EIDA 5C07E 4GXUM 3MRIB 2NZ9D 3VFGL 1LO3L 1UWEL 3Q2CA 4EI5C 3WBDA 4C58B 5BV7L 2CD0A 1OTUD 2ZG1A 5SWSD 1OM3L 1QLRA 3BKJH 1PGRB 3O2DH 4HXBH 4KTEL 5H2BA 3PGCB 2Y5EA 4OT1L 4K7PL 2E27L 4APQD 3IJHB 4P2OD 3BGFB 4AEIL 1ZA3B 1P6AB 2XA8L 1P5VA 1K5NA 3NIFE 4ZG1A 1AQDA 1D9KA 3AY4C 1IT9L 3DLQR 3MA9H 4WUKH 1EIBA 3KYKH 1ZGLM 2H32A 1X5XA 4OQ1A 5IHLB 2UYLA 3RJDA 3U2SB 2HFGH 4M3KB 1N3NA 4YDJA 5LCVL 4RGOL 3QDME 1FZOA 1WT5A 4X80L 4PJDE 5I8CB 1NC2D 3LQZA 3EO1B 3CH8A 1FGNH 4MXQC 4PD4J 1VPOL 3ULUD 4HUNB 3OKLB 4GG6F 4WWKC 1MCPL 4BJLA 3VDAA 1GGIL 3AAZA 5T1LA 1KCSL 3V0VB 2ICEA 2DWDA 2G5BA 4K2UH 3OKKB 4MCYA 5L6YH 2W60A 4M7ZC 1RMFH 4YXKL 1R3KB 5MERB 2PR4H 4JO1H 3BEVB 5J3HC 4NDMB 4ZMAT 5CGYC 2CK0H 1FC2D 3IETB 4KU1A 2JELH 4LP5A 3IDIA 4I5BA 1FQ9C 2NX5E 2BOBA 2OK0H 4DJMA 4HWBH 1E4XI 4KPHH 2DLHA 4KHXH 1MJJB 2CH8A 5JOFB 2DIAA 4BZ1H 3OR7A 3ESVF 1A6PA 1OF2A 5DD6B 3BP7B 4XPBH 5DD3H 1UXWB 3V6BR 3WLWD 4QXUL 1WEJH 2VDQL 4ORGA 4X9IA 1RK1B 1JZ5A 1AXSB 2IGFL 1EAPA 1ONQA 4F2MB 4YAQA 4PLNC 3MRRB 2AEWA 4M3JA 5HI5D 5E4IA 1FCCA 1YNTA 5GGSY 5DRWA 4Y5VC 4R4ND 3T0EB 7FABH 1A6AA 5DMIL 5F1IA 2VQUA 4AIZA 1UA6H 1FNEB 4Q9RH 5MI0C 2V5MA 4YPJA 1HHKA 4C4KT 1DN0B 4JN1L 1QFOA 4P4KD 3TFKC 4CU6A 2OZ4A 4TSAH 3QDMB 4E42A 5EBWB 5FV1L 5F3BA 5F9JA 4MDIA 1G0DA 5HY9B 4PJHA 2RJMA 1KN4L 1EHNA 1IAIM 3ARTA 4HCRL 3LN4B 5D6CB 1MY5A 1HI6B 3HC4H 2AJVL 2A6KA 4AQ1B 3UBXA 4KJQC 1ZHLB 5I1HH 1G9NC 1FN4B 1AR1D 2EDKA 4TTDC 4Y4HB 4LLDB 2O5XL 3SGEH 2VISA 4PTTA 1J0HA 1EEYB 3WMSA 1UZ6E 2AJSL 5JDSA 3BAEH 3VG0L 5IB1B 3T04D 4ZXBA 4LCYA 3W5MA 2ZCLH 5C0AD 3OAZK 3C8DA 5HYEA 2OL3B 4X99A 1VEOA 2VLKD 2XY1A 4KMQA 2PYFA 3BN9D 5EDXA 3UZEA 2BMKB 3SQOL 5LG1A 1U41A 5ALBL 3S4SB 5T33L 1Z3GL 5DJ6A 4RX4D 1YEJH 5AEAA 1T2QL 5FCUH 1ZGLP 2PKDA 2NX5B 1JV5B 4LARL 4M7JH 5LVEA 3VCLA 3I2CH 5T3ZL 3LHPL 3EYUH 4WCYL 2EDTA 3TGXA 4OM0H 5KS9E 2YD9A 4NO0B 3O2WL 3MNVB 3H8NA 4P5MA 4ZD3L 3IS1X 3S36H 3BZ4A 1EGJH 3O2DA 3P9MA 3WFEL 4JRXD 4HJ0D 4XXCA 4YXHL 3O11B 3H42L 3F7VB 4KI1A 3GI8L 4EDXB 1P4IH 1A2YB 5KSUB 3QDGB 1IGIH 1XGYH 5CGMA 3DTXA 3UTPD 2ED7A 4GG6B 3UMTA 5JPNB 1S7SB 3MUGB 5DGRA 4F58L 3QJFB 4MAYD 4YE4L 5D7IB 3ZDXE 4HS8L 3NABH 5D93C 1ORQA 2CLVB 4HAGA 5ANMA 5CZXC 4XCEB 1UH2A 4I0PD 4QT5A 4KAQL 2XXCB 2OL3H 2R23B 3G04B 4U1IA 1JNHB 4D0DA 4CU7A 3HC0A 3LD8C 1I8MB 2A9NL 4PUBH 4U1SA 4NKQB 4UT9L 5AG9A 1P4LB 5GQBA 5EU6E 5HGDA 1W0VB 4AG4H 1K6QH 4P99A 3CD4A 4MS8C 4DTGL 1L0QA 5DEGA 4K3JH 4MA1B 1PG7L 3DSNA 1FL6A 2AEPH 5ESVB 3MRIA 3BESR 3G6DL 1YEHH 1DQQB 1SBSH 2QQLH 4OGXH 5F7FA 1OVZA 2C5DC 3LSOB 32C2B 2DAVA 4UT6H 4IOIB 1D5XB 3FN0L 5SWZD 3PGCA 3K2MC 2VLME 4HC1H 2HYMA 5J1AB 5EIIB 1A7NH 3RY6C 5L7XL 4KJWD 3IJHA 3EO9L 5KJRH 1OLLA 1ZA3A 2FBJL 2QV2A 4GS7B 1ACZA 2B1HL 5FYLL 5C92A 3WNPA 5IESL 4GBXD 1RJYB 5EZJB 5J13C 5KVFL 1RZ7L 3U2SA 2BNQD 4DGVH 1S3KH 2AEQH 2RR3A 4WFGD 3LEXB 4Z95L 3R8BB 1V3KA 5FKPB 1A3RL 4XPGL 4YDIH 4GMTL 5I8CA 3MC0A 5KSAC 1FYHB 3EO1A 5EUOB 1FNFA 3IDXH 3WO4C 4NUGL 2VLJD 4YDKL 1NCWH 1BVKB 5F1OB 1SYSB 1ZMYA 3OKLA 4MA8L 1T6WA 3X3GH 1CE1L 3EHBC 3P0VH 4JPWH 1YN7B 3O41B 3V0VA 5IBLD 3QJHB 1IGYB 1IM9B 3OKKA 5C0CE 2ITCA 1KJVB 1R3KA 5MERA 3EJYD 3OX8A 4UU9B 4FQXB 2Q87A 3BEVA 5L8LB 1EHLL 4NDMA 1EERB 3N1PC 4HAFA 3IETA 3O8XB 3QEGL 1OHQA 3TVMD 1FDLH 2H9GB 2VH5L 1BLNB 1MJJA 5JOFA 3D9AL 2FD6H 5L0QC 1MH5B 3U7WH 5CSGA 5IMOB 4UB0L 4HFUL 1GGBL 5DD6A 2B1AL 4GAJL 4U1KB 5K9JH 3BP7A 1UXWA 1BIHA 4YDLC 2Q8BL 5ICZA 1JWMB 1RK1A 3RZCD 4QTHB 1AXSA 1BJ1H 2E7BA 2GEEA 5CINH 2ZCHL 4ZPVB 5EB9A 4NKOB 4F2MA 2A73B 2QADB 4MLSA 1K4CB 1HZHH 3INUL 3MRRA 5DDHB 3T0EA 4CN4A 4L3CB 3EDDA 4JQXC 1T03L 2XG5A 3ZKMD 4KY1L 1QD0A 3ARFC 4ODHH 5FM4A 1FNEA 3A6CL 3IAGC 1MEXH 4IM8A 3ROLB 4ELME 3C5ZB 1DN0A 4A2LA 1EGJA 1H5BC 2W65B 4U3HA 4GOSA 3QDMA 1KEMH 5EBWA 3FQUB 1MCKA 2P46B 5HY9A 4HEPG 3H9YA 3AU1B 4BFBD 3BZDA 3A67H 3MREB 4JAMB 3SE9H 3V5KB 5I71C 3LN4A 5GS0C 5D6CA 2ESVE 1HI6A 4FQLH 4HUKB 1K8DB 3OG6B 1ZHLA 3SGJC 2WW8A 4MNHB 1QKZL 5D4QA 1BWWA 3LQMA 5B39G 4YFEA 4DKFH 4LSSL 4PRNB 5BQ7A 2FHFA 4Y4HA 4LLDA 2OJEB 2FJGA 1ZLSL 5IB3B 3VW3L 2KQNA 2OQJB 1EEYA 4UTAL 1ZEAL 3OPZL 5GS3A 1XFPA 4DAGH 5IB1A 5DMGC 4MB5A 3WLBB 4LPXA 1AQKH 2OL3A 3HI5L 1NFIB 4NN5B 1CXLA 2BMKA 2W0FB 3E3QE 3RVUC 4KVCH 3S4SA 1ZA6B 3U7YH 2X1WL 3AB0C 3WNNA 4OM1L 1RV6X 3TZVD 2VXSH 4JFFD 2NX5A 1VDGA 2GYSA 1QA9B 4HMCA 1JV5A 2ICWI 4AEHH 3OG4B 1IZKA 4TQEL 2EE3A 5D1ZD 5FGBA 3SOBL 3QB7C 4V1DD 1KLUB 3LOWA 3WS6A 3TC9A 3S37X 4NO0A 4RMTA 3VG9B 3VWKD 3ULVH 2UWEB 1NBYB 3IXAB 5I9QB 1P1ZB 4HC1A 3UXFA 5GSVB 3M17B 3CK0H 3GSQB 4PGBB 4P46C 3BPCB 3O11A 3BQUC 3TA3D 4N5EC 3ZKNC 1OARH 3F7VA 3QQNA 4PJ5D 5FYKE 3UTOA 3QFJB 1A2YA 4HPOH 1T0MB 3QDGA 4LBEB 4NQCB 3VXUE 3DGCR 4EN3D 4YO0B 2APFA 2Y9RT 5CP3H 4NO5B 2W0PA 1GZPB 1U95B 4GG6A 1P4BL 1ES0B 1S7SA 3HR5B 3MUGA 3QJFA 4KUZH 5K59E 1NAKL 1DBJH 5D7IA 5GZND 1B0GB 3CLEL 1CICD 2CLVA 2NY4B 2WQ8A 1NCDL 4BK5A 1OAZH 4XCEA 1TETL 3RDTB 1RZIB 5T5FL 1NQBA 2Y06L 4O2CB 4ENED 4J4PA 5DLMH 4TUOA 2ESVB 2R23A 3SGKA 3G04A 4Y5YB 5KVDH 1JNHA 2JF1A 2VXVL 1G9MH 5DVKA 1GC1H 5GGSB 4IMKC 1I8MA 1KLGB 5JOPD 5JW3H 1SM3L 3FRPA 3QIUB 1PLGL 1P4LA 4JRWA 4JPVL 5IEKB 2YHGA 3T2PA 4KQ3H 3RNQB 1RI8A 2JJSA 5ESVA 5TFSL 1I9JL 5IMKB 1DQQA 4Y4FC 4IDLA 1TJHL 5J1TC 3LSOA 32C2A 2IC2A 2R0LH 3AC0A 4IOIA 1J0IA 1D5XA 3AROA 2Z9TA 4LASH 5J1AA 1KV3A 2OR9H 4OLVL 4PJCB 5EIIA 3GM0A 2GT9B 3V79C 1J0KA 5I8OL 2YA1A 4RMRA 4U05A 4OF0A 2B7DT 3E6HB 5F7NC 1IGCL 4ZUSB 3BZEB 5AZEL 3P3YA 4LCIH 5FOBB 4QWWD 5TDNB 3MOBL 4D9RD 1B6DA 3B2UC 1RJYA 4XAKD 5EZJA 2BJML 4D9QE 1HNFA 3EDEA 3TBYA 4MB4A 3N9GL 1WFOA 1Z2KA 3LEXA 4JO2L 3ARBB 5TE7H 4ZFOL 1CXHA 3HAEG 4LP4A 4R2GB 5FKPA 3CMOL 3HG1B 1Q1JH 1BBDL 5E6YA 3LRSB 4NM4H 4X4ME 4UQ2B 2WIIA 5EUOA 3TEUA 1EEQA 1I4FB 5IW6A 1CGVA 1F4YH 2Q20A 1BVKA 4WRLA 3VXMB 3KJ4C 5D5ME 1SYSA 4JFHD 1FSKC 1I85C 5CJQH 4OF8A 5GISH 3MCLL 4OI8A 1OAXH 2LV4A 1YN7A 3O41A 3OKDB 3QJHA 1IGYA 1FIGL 1IM9A 3VMNA 1QRNB 3O6ML 4O5LH 4Y1AE 5FGRA 1IKFH 4L5FH 1KJVA 2OCFD 2XKNB 4FFYH 3RVVD 1GGCL 3DYMA 1PSKL 1DEEA 4FQXA 2DI7A 1B6UA 3TJHD 2X09A 1QHOA 4F57H 5FA4B 3D87B 3O8XA 4FABL 2H9GA 5HHMD 2VN4A 4UV4H 2OM5A 3LQAC 4FQIH 1BLNA 1X5HA 1WWCA 3MLSL 3QI9B 3PWJB 4PB0L 5BCAA 4EDWH 1MH5A 4PJIE 4WJ5B 2D9QB 3IU4L 5IMOA 1OTTD 2Q8AH 4M7LH 4U1KA 3P30L 2EE6A 3B9KD 1NKRA 2FLRT 3N1MC 4GRLB 5EPMB 4NC0B 3DV4B 5HHNB 3OXSB 1JWMA 1KLFA 4QTHA 3T2OA 4NKOA 2A73A 1K4CA 3GHEL 2Z8SA 4BA8A 5DDHA 3B8YA 2OTUB 3NTCH 4TOYL 2KQMA 4XWGH 4HH9B 5FYKH 2MCG1 5GZOC 2PXYC 4XPAL 1IC4L 1PAMA 3VXRE 4KI5F 3ROLA 4YHYB 4OFPA 3QWRD 2B4CL 3C5ZA 1CL7L 1E4KA 1TENA 5TE4H 5IROC 2W65A 4HUVB 4PRAB 5I18H 3FQUA 1UGNA 1E6JH 3S3PA 3AU1A 2IFFL 3QEUB 3KPRE 3MREA 3PGFH 4JAMA 3V5KA 4FOMA 5DTFB 3W9EB 1QUNA 1S78C 3Q48A 3KLHD 4KRPC 3ZDZE 4LSUH 3L9RB 3V5HB 5CP3A 5IK3B 4MNHA 4AT6A 1MCFA 1SEQL 4PRNA 4QHNB 4JVPA 2D0FA 3DMMC 2OJEA 2IBZY 4Y19E 5IB3A 2OQJA 2YUVA 4C56B 4P2RD 2BNRD 1NGPL 5C0CA 4Y1AB 5EO0B 2XWBB 3WLBA 1WGOA 5FO9B 2WBKA 1A64A 1VESA 4F3FB 3Q1SL 2W0FA 4OCRL 5AWNH 5IHZB 3S97C 1ZA6A 1AE6L 3O6LH 1NBQA 4YHOH 1YNKL 3HCVB 1QA9A 3QAZB 1WC7B 1T0PB 1H3GA 5JHDD 4DKDC 3IKKA 4OUOA 3QCVH 4K23H 1RZKL 1EJ6A 5I1AB 3MFGB 3MRGB 1EPFA 4PYGA 5GPRA 3RHWF 2MWCA 4KZDH 3GB7B 2UWEA 1NBYA 3IXAA 1P1ZA 5GGVH 2NTSP 4KROD 5GSVA 3T2NL 3M17A 3AS0A 4PGBA 3GSQA 3BPCA 4UT7L 1I8LC 4BELD 2R1YB 4K3EL 2FX7L 3QFJA 1T0MA 5FFLA 4LBEA 2VSDA 4NQCA 2D2OA 1RJZB 3BPLB 4YO0A 3NCBB 4TULH 4NO5A 3U0WL 1GZPA 2VOTA 1U95A 1JTOA 4F7MB 1XCQB 4WY7H 4TUKH 3VXRB 4ODVH 1RZJH 5ACLA 2RIKA 1N4XH 3HR5A 3MUY1 1T04B 1B0GA 1N5YH 4JRYB 1QPXA 3T3PF 1KN2H 3C60D 3Q5TA 5FYLD 3KPRB 1RZIA 5FHBL 3RDTA 3UAJC 4XWOD 2DJUA 4O2CA 3S6CA 4I3RL 5C8JB 2ESVA 5IP4A 2Q3AA 4HZAA 4Y5YA 4GMSL 5LBSL 5FF6B 5GGSA 3F12B 3RVTD 3EOBB 4Z7VE 5FKAB 1KLGA 5A2IH 3CJJA 3QIUA 3SO3C 5T3XE 5IEKA 1F3JB 3RNQA 2OTPA 1TJGH 3D1MC 4U49A 1G6VK 3L5JA 4XVSH 1XGTB 5IMKA 1YQVH 25C8L 3MJ9H 1JHKH 2FH8A 1WK0A 3LIZH 4CL7A 3V7AE 4OZFB 4IDJH 5EU4B 4OIIH 4AIOA 2DI8A 4FXGB 4P0DA 3QUZC 4LSVL 3MV9E 4NM8H 3ZDYF 4WHTB 4PJCA 1FBIL 1RURH 2GT9A 3CXHK 1EJOL 4XVJH 1KGCE 1WQVT 3I50L 5DQ9B 5A3IC 4Z7QF 2IQ9H 2DQHL 3E6HA 3NCCB 4ALAL 3KWWB 4ZUSA 3BZEA 5FOBA 4KZEH 1IBGL 1KJ2L 4LGSB 4LPTA 5TDNA 5A2LH 3QNYB 5C9JA 1ZS8B 3DRQB 1WIOA 3VU2A 2N7AA 3JWDL 3ARBA 1SJXA 1S9XB 3RTQB 3BDBA 4K2UL 4UINH 4RGMB 4P5KB 5ALCL 1MAKA 3HG1A 3LRSA 4TNVK 4UQ2A 5GS1C 1HEZB 3RUGB 5I17B 3TIDB 5GJSL 1DEDA 3WXWH 2DKSA 3BPOC 3HA0A 1II4E 1I4FA 2E7HA 3EJJX 3VXMA 2JELL 4FMFA 2WM0A 1CG9B 2AK4E 5F7MC 4J6RH 4KHXL 4M1DH 4NKIL 4I13B 5F89B 3FCTB 5LQBH 2QKIB 5GHWH 3HNTH 4LMQE 2X4PB 1QRNA 3EFDL 1JJUA 1QFPA 2AGJL 4HJGB 4G6ML 5DD3L 1NLBL 4OF3A 3T8XA 4ERSL 1X4YA 2YPKB 3AS3A 4Z7OF 5FA4A 1XEDA 4KKLD 4Z7VB 5BRZD 4DN3H 1K3IA 2A38A 4MAUL 1AGEB 4MNQB 3MLXL 5GGQL 4P2CG 2RCSH 3GBMH 1FZJB 4LVNB 5DFWH 2FR4B 4MJ4A 3QI9A 3PWJA 2ADFH 1J0JA 4RWYH 1IGML 1DSFL 3F7YB 4NN6C 1WBXB 1G9NH 3GIVA 5F97E 1QBMH 3MBXL 3PHSA 4U7MA 4G9FD 2BSTB 4QGTA 1S7XB 5EPMA 3HNSL 3DV4A 1GL4B 1I8IB 5HHNA 3OXSA 3KPPB 1KPVB 2YK1H 1FFRA 4NC1C 2EXWC 4AL8H 4XNUH 3CVHB 3VD5A 2YD8A 1UJ3B 4KK8D 1F8TL 3ARQA 2OTUA 3WN5C 5HSFA 2DOCA 4HH9A 1BQSA 1A3LH 3UTZB 3Q5YA 4LVOC 5CUSH 1MFCH 2JJWA 2XQYG 4BM7A 1NFDF 1G7LB 4PY8J 3LRHA 5C0IB 2E5EA 4Y4KC 2JK5B 1C16B 1MCQA 2I60H 1KIPB 4PJAE 4HUVA 4PRAA 4FQCL 2LAGB 3ZL4L 4LMQI 5IQ9B 3PWPE 1IQWL 3QEUA 1P84K 5DTFA 3W9EA 5IVOA 4OFVA 5KBNC 1BOYA 3RIFK 2IANB 1N7MH 2ZUQB 3L9RA 4QHKI 3V5HA 4WO4C 5IK3A 5T3XH 5FCUL 1J8HE 4QHNA 3CX2A 2AK4B 1HK6A 3GSVB 4XMKL 3RWHB 4C56A 5I66B 1SY6L 1RZGB 5DURD 2A77L 1OD9A 4U6TA 4Y1AA 3EYUL 3ZTNH 5EO0A 2XWBA 4I3SH 3KLAB 4WHYG 3UEZA 2DQEL 2YC1B 5FO9A 4PJBE 4F3FA 4DW2H 1GIGH 4FQ2L 4LSTH 5IHZA 5GIRB 2GTZB 1MFDH 5J11C 6CGTA 1F90H 4U1GC