1OARH

Fv ige spe-7 in complex with alizarin red
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 122
sequence length 122
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oarH00
5E94B 4PRID 3AREA 5GSRA 4NC0B 5CP7B 5DK2B 2O61B 1RIUL 4LEOA 2EYTB 3V95A 3QUZA 2X05A 3BWAA 1AGBA 4PJAF 4OZFH 1BFTA 4YHKH 1FZJB 4I3GA 3EIFA 4LU5L 2X4OA 5HGAB 2GFBA 3QIBC 4G8FA 1SEQH 1I8MA 3EOYG 5D8JL 4QTIH 5D1ZC 5T3ZH 3LRSB 2J6EH 2APVA 5DJYA 3CFJB 3UBXG 5GZNC 5I9QC 1GXEA 2YPVH 2EH7H 4PRIB 3T0AA 1SJVA 1XCTB 5B22A 5IVXF 2XN9A 1T2QH 5J0BA 4KK8D 2Q1EA 4RAVB 2YD7A 5CGYD 1UWEL 4AY0A 2FX7L 1SY6A 2IBGA 5TF1L 4CW1A 3JVGC 4HC1L 5I1GL 1QLFB 4X4MA 1ZAGA 2I9LA 3LKPA 1Q1JH 5GS1B 3SDXA 1DQDH 2APFA 3MX0A 4PJDE 5JOFB 4KY1L 2F53E 3G04B 5TE7L 1EHXA 1HCVA 4XXCC 4BK4A 2Z35A 1FYTE 1QSEE 3EW3B 2YRLA 4G8GA 1A8JH 1Q94A 1QFWL 3IGAA 5IMKA 1JPSH 1MCSA 2LU3A 4W6WB 2BXZA 4PJHA 5I8KH 5BS0D 3QXTA 1EEQA 3MRNB 2R1WB 5MI0B 3V7MA 2CXKA 1H0DA 4NNXA 5DXWA 1NPUA 5EO1A 2NW2A 3ARBC 3VXOB 4S1QL 4JRYE 3L3GA 1DBKH 3QULA 4F57L 4QXUL 3KXFE 3ES6A 3TZVA 1AJ7H 4AJ0A 1BJ1J 3DETD 4BUHA 1FFPA 3WS6A 2AJZB 3QG6A 4RGMC 4JANB 3K8LA 1AR2A 1KFAH 5J6GA 3QEQD 5GXBB 1BAFL 1UM5H 3QCUH 4HJ0D 4QHUA 4ZSOB 3NZHL 2E27H 1XGYL 5LG1A 4DZBB 3FQTB 5E6ID 4BH8B 2OP4L 5F9WB 3QFJD 4JO3H 1EZVY 1Z3GL 3MYJA 1FNGB 2FHBA 5INDB 4Q9QL 4LKCA 1ZGLB 4XNXH 5EBWA 2CH8A 4ENED 3V2AR 3TNMB 4O2EB 4HUXA 1VSCA 4B5EA 1R3IL 3QEQB 3KPNB 1B0GA 2E7MA 4NUJB 4B53A 3DGGA 4HIJB 4HUKB 1YC7A 4L8DA 1T21A 2RFXB 4Y8AA 1R3JB 5E6IB 1I3RB 5TE6H 3WS3B 1EVTC 3QFJB 1K4CB 1NMAL 1OD9A 1QO3A 5F8QC 5B4MD 2AV1A 4WCYH 4Y5YA 4C58B 1P7HL 2B7DT 5HYEA 3MJ9L 4J4PC 5GRYA 3U48A 1H3TA 4M43H 4JHZA 3RL1B 5L2KA 5I0DA 4U6VL 1D5XA 3VXUA 1ZT1A 1X5JA 2YPKB 3D18A 2JK5B 3VGDA 4Q9RH 4LHUA 4OUUB 3IAQA 4K3JH 2GEEA 4Z7QE 1YNLL 1VPOL 1B0RB 4NRYB 4EXPX 1Q9OB 3O3AB 2WQ8A 4D8PB 2R56H 3OB0K 4Z5RA 4TSCH 2GTWB 3C09B 3LKSA 1EHAA 1QQDB 2WBWB 4JE4B 3R8BB 3OV6A 4HKXA 2BVPB 1BD2D 4FQXD 3WD5L 5EO9B 3IYLW 2XWTA 3MRMA 1AD9B 1BLNA 5GGTA 1CD8A 1MAML 3GSWB 1KJ3H 2PW1B 5E7FA 3CPLB 3KYNB 4PPTA 4JFOA 4NBYB 2K9UA 2F8OA 4QOKA 2R8SH 4KXZH 4XMLL 3DUHA 3IB4A 1YJDC 2HMIC 1N64L 1RZIB 3KYOA 3H9HB 4MA1C 4P23D 3RKDC 1AGFA 3EO0B 5TDNB 1RQ5A 3MNWA 1HHHB 3TBTB 3AS0A 1T80A 1N26A 2QHRH 5HGDA 3HZKA 1BD2B 2A9MH 4OF8A 3PP3H 4FQXB 2FEDD 3HAEA 4PJXE 5F6IC 3RNQA 4CNIB 5IMOA 1EFXA 3TH4T 1E4XI 1YY8B 1FH5L 1PKQB 2R23B 4XWGL 4CUCA 2V9TA 2PN5A 5IB5B 3VGEA 1AHWC 1KPUA 4XVTH 1BVLB 3E6FB 1C08B 3KVQA 2YPLA 3CD4A 4JEGB 4PP1C 5IM7B 4P23B 3UTZB 1MF2L 5J6HA 4LKXA 3V5HB 1I75A 1TZHB 1JNHA 3HUJE 4LRIC 3WFBH 5J11C 1MH5A 2H9GB 4KRLB 2O26U 3LDBC 3K4AA 4L9DA 4L8SA 1YEEH 3TVMD 3LN5A 1U92B 3S88H 2NXYC 3TBWB 3RJDA 1YECL 4L4TE 4FFWD 3UTOA 1KTDB 1A9EA 2CRZA 2G5BB 4FQCL 1A6UL 3EYQD 1CFTA 3I50L 3ELAT 2XKNA 4QRSB 3LKOA 3CFBA 3MRKB 3VFUA 2JCCF 5CD3A 2QR0A 1OB1B 2EZ0C 2PYFB 3DBXB 4J23A 4X7TB 3GJFB 4G9FD 5FK9A 3K1KC 1ND0B 2FZ3A 1OAKL 4I9WE 1UYWH 4F2MB 1FFOA 1MJ8H 3KPPA 4IJ3B 1N7ML 5LQBL 4YHIA 4NQTA 1YMMD 1CR9L 4KI5E 4PG2A 1O7VA 3PHOA 1TZIB 1RMFL 1F8TL 4KUCD 3BYYA 5ITFA 2B2XL 2IH1B 2IH3A 4EOWL 2XQYG 3OR7B 4X6CB 2FJFB 4JFED 1FV1A 4G9FB 4U1KA 1CDBA 4F9LA 1NC2D 1S7WA 4HWNA 2DQUH 1UJ3A 3MGTB 1E27B 2HYMA 4CVWA 4ZUSA 3SQOH 15C8H 1SBBA 4XTRD 5KSBB 1K4DB 1UEMA 4X5XA 4PS4H 4RIRA 3E6HA 1MJUL 4AIZA 2JELL 1YMMB 5LCVL 1NGXB 2NY6D 1QR1B 4OUOA 4G6KH 4F33A 5FA4B 3VG0L 4H8WH 4HQQL 5E2JA 4PJGB 1OAUH 4K7FA 3VFNA 4LASH 3ARSA 4YHLH 5D7LE 3WBDA 4MAUL 4ONFH 1NC2B 3S35X 3TN0D 2VN4A 2X4PA 4Q6YA 3ALWA 4DGYL 1F4WL 5T1DL 3OZ9L 1F00I 4R4FH 1TZGH 3AMLA 3GSNH 3MV8A 2NY6B 3DUSB 5FO9A 4HWBA 2I24N 1AXSA 1NCAH 3QDGD 4X5WA 3SDYL 4JREC 3BXNB 1NDGA 1DVFD 1X5YA 1TVHA 4G6ML 1IMHC 4KMLB 2H2PD 3U0WH 2FJGB 4I0PC 2PXYD 3LH2H 3B5TA 4DQOH 1HH9B 3FOLB 1U8PA 4X80L 3V7AE 2Y23A 1YQ2A 2YD4A 4MB3A 3MRJA 4LCCA 2AXGB 3IDGA 3TN0B 2BNRD 3D3VD 1E28A 2YUXA 1P7KB 4BQCA 4LF3A 3V8CA 3E3QC 1I1CA 2AEQH 2A2QT 2GAZB 4PJ8B 4N8VB 3MLSL 1YEHH 5GZOD 3KR3H 5IJKA 3H0TB 4QXTA 3Q1SL 1CWVA 5DJ2A 1YNTA 3U4EA 1DVFB 2EE2A 2QJDA 2BY1A 4XP9L 5CP3H 1U8KA 3BD3A 3WL9B 1Q9KB 3BP6A 2NY5H 1D6EA 4JG1L 4WWKD 4W68A 3A67H 3QIWA 1FFQA 4GKNB 3C6LD 2PTUA 4JHBA 4D9LL 4DW2L 1UACL 3FB7A 3ZL4H 2BNRB 3D3VB 2F8VA 4PJ5D 1CVSC 4U0QB 4AMKL 3TJEL 2HRLA 1A9BA 5H8DA 2ZOLA 1JCKA 5D9SA 2FEEL 6FABL 1ETZA 5C0NC 3GBNH 2YD8A 1FO0A 4WWKB 3T3MF 1BEYH 2ADGA 1J88A 1R3KA 5GRVK 3BRDA 5FHAL 4EN3D 4PJAE 4TUJA 5IFJB 3LQZA 4YX2L 5I8CB 3NCBB 2N1KA 4OLYL 3GRWA 3MRCA 1NBZB 3RU8H 3VXQA 5C9JA 2CRYA 4JLRB 2MPAL 5KVFL 1OHQA 1AO7D 3FQXB 2WLYA 2MTPA 5JPNA 5C0DB 5EUKB 1R5VB 2VZOA 4LSDA 3L3HB 1O7SA 1ORQB 5JXEA 1W0VB 1YEIL 5ITBL 4MA3A 5BVPL 3WN5C 2CIKA 1QNZL 3EOBB 2E7HA 4D3CH 1TETL 1XR8A 4FABH 3QT2A 2A74B 4L5FH 3B2VL 4YHZL 3OKKB 2ZUQB 4JHAH 1ZT7A 1MWAL 1ORSA 4XX1G 5I2IA 5B3NA 2XTJE 5FUOL 2OJEA 4WNQB 2D7QA 1AO7B 1MNUL 1NKOA 2VXQL 5L88L 1ITBB 3EYFA 4PJIA 5FUZL 1UM4H 2AABH 2DM7A 1A21A 3B5HA 1JHLH 1FPTL 4X9BA 2HFFB 3MV9B 1IGTA 1KCSH 4GXVL 4EI6A 2HJKB 5IV2B 3TBYA 5HHVH 1RIHH 1TENA 4IBLT 1CGWA 1P5UA 3ARPA 4AENB 1LEGA 1CF8H 4NUGH 3GSOB 4HWEH 3HRZA 4XCEB 1DP0A 3GHBL 3FAXA 5LGHH 3TO4C 3KPOA 4Y4FA 8FABB 4JPIB 3I9GH 3S35H 2SEBB 1Z9OA 3VH8B 3F6LA 4ORZC 3DO7A 2CUIA 5CCKL 4DK6A 1C8PA 1R0AH 4Q0XL 2DQHL 3EO1A 1D5MB 5DC0A 4DN4H 4P99A 1BJ1H 1NGQH 3CDGB 3TCLB 4UQ3A 1BP3B 2D03H 1M7DB 5IEHA 2RBLA 3SDDC 3NFSL 4GW4B 4WVRA 3QDMD 4TOYL 3L5HA 1C12A 3EOTH 3QHFH 2Q86A 1HI6A 2ESVE 1E4WH 2B5IC 2BMKA 1JWMB 4ZODA 4R0LB 5E99H 4HT1H 3MLTA 2WUBL 4L3EA 3GMMB 2MCG1 4J8RB 4XHJD 2R9HC 4QNPF 1RJZA 4UDTB 1DUZB 1YN7A 3ULUH 4G5ZH 3DO3A 4LVOC 3LRHA 5GGUB 4UBDD 3I02A 5SWZA 1ZLSL 3WIFA 1E6JL 4EIGB 1JWUA 3DVFA 7FABL 3QDMB 5GPRA 4Z78A 2YA1A 4JN1L 3D85D 1C7TA 2QTEA 1OAYH 5FGSA 2BDNH 4ODXA 5C09E 1A6WL 4AM0B 4HJGB 3EYVA 3MA7B 4PGCB 1K85A 3LKQA 1QFUH 4XBEH 3ARRA 3DI2B 5KS9B 3PABB 1PBYA 2Z4QA 2DQCL 4G6AD 4OD2B 1MI5B 3BKCH 5EU4A 4HLZG 2OSLB 3BIKB 2FHFA 2V5SA 5GRVL 4M5YL 3MLPA 3QRGH 2XNAB 3T0WA 1U6AH 1KPRB 1TDQA 1XF4B 1A4JB 2F54A 4IIQB 3D85B 1JGDB 4C56E 1IAIH 2A38A 1U95A 1P4BL 4GBXC 5F7FA 3DURA 3SY0A 4I18C 1GC1C 1YEGL 5EU3A 3BO8B 3RUGF 4KVCH 4YQXH 4BQ9A 2X42A 3CC5A 3AY4C 1KJMA 3S34H 2P8PB 3EOAA 3RA7L 4DVBA 3GMLA 2CLRB 2CKBH 4I2XA 3T1FA 3EFDL 3SKNB 1KPVA 5INCB 3L7EA 3D2UD 3BHBA 4HMCA 2PTTA 2H1PH 1A14L 2P42B 4MXQC 1NFDB 5D96B 1AD0A 4F58L 4HGKC 5KVEL 3EKCA 4FFYL 4XPFH 1BWWA 2I27N 4P9HC 1I8LA 1S5HB 5JW3L 1RUAL 5C8JB 1LP9A 4IHOB 1AIFA 1RZJL 4Y16D 4NC2B 4JFHD 5JHDA 3HNTL 1SBSH 2EH8L 2NY4C 3BP5A 1QBML 5DD3L 4F37K 1LK3L 3GHEL 3NIFF 3PWVA 4OCRL 4OQTL 1YEKH 3D2UB 3IS0X 4UAOB 4WO4A 4JM2A 5FHBL 1GGCL 3O2DA 3Q6FB 1KLFA 5DSCB 2E6PA 3DJ9A 1GJIA 1AE6L 5C0BA 3BP4A 4R90L 3B2UC 4X8JB 5IB4A 1MCKA 1EEUA 1HOCB 5DHXB 3STLA 4OTXH 3C5SB 4Y16B 1MLBB 4PJBF 1FL3B 2ERJB 2Q8BH 1JHKL 1HCFX 1Z9LA 3LB6C 3PWPA 3QWRA 1GGUA 4ONHA 3V0WH 4MNQD 4LCWA 4PG9A 4ODVL 3IU3B 4OD1L 1NLDH 3LN4A 1A3LL 2JCCE 3CFKB 2P24B 5E4EB 3WLBA 3WUWB 1OL0A 5GS2H 4Y5VB 1PZ5B 5HHNA 5I17A 4LVHC 4OLVL 1H5BA 3MRFA 2R0KH 1A6TB 1S7SA 2XWBA 3GK8H 4NQEE 2X4NA 1LO3L 1YQVL 4HXAH 5ACZB 1UGNA 5BMFL 1LDPL 3IKCB 1YMHA 3QIBD 1RZ8B 2VLJE 3EYOA 5F96L 2UWEF 2CUHA 5C0EA 4UILH 3BGMA 5D1ZD 4PTUA 1QOKA 4J3XA 4XNZC 5GZND 1UH2A 2LVEA 3PQYB 3MZTA 4MNQB 4NPYB 2ARWA 2IG2H 1RULH 3QDJB 4WV1B 4Z7OF 4M61A 3VGBA 4F15C 5E08H 1T3FB 3BZ4A 3KDMB 4X6DB 1KIPA 3BRGC 2FH6A 4PJFA 2YC1B 5I15H 5IIEA 4TYUA 1N2RA 1HHKB 3C9NB 5ALCL 4MQ7B 1IGCH 4XP5L 1G7JB 2JJVA 3L3OB 3TT3H 1IVLA 1PLGL 1U8IB 1YEFL 2X2YA 1Z0NA 3HR6A 1NAMH 1P4LB 1UC6A 1VFBA 5I9QB 1FIEA 4PY7B 3EYUH 1UG9A 1MIMH 3BDYH 1CFNB 4APQA 2OI9B 2V17L 4KUZL 1VGEH 2EE9A 1M71B 3RI5K 3ARBD 3O6KH 1A7BA 3RTQA 4XGZA 2WBKA 1S7QA 3HE6C 3VFPB 4Q6IB 5F7DB 1NAKL 4KAQL 4R3SB 4HFUH 1CLOH 2EDOA 1CN4A 4QRPE 1EXUB 4G80B 4KJYB 5DT1H 2ZSVB 3VFOB 1KG0B 5EU5A 4ACPA 4OZGA 4LCYA 1PYWA 5KAQF 1P2CA 5TH2A 4LSPL 4ISVB 4I77L 2EYRB 4OZHB 1OP9A 3RNKB 3D0VB 5C2BL 4JM4H 4GS7C 3O41B 3UDWA 2H2SC 3MLYL 4KK5C 2VJXA 1FYTD 1JPGB 3EGSA 4ZQKA 4CU6A 3KYAA 2YK1H 3PGCB 4R26L 5DQDH 4PB9L 1ACYL 4XXDA 4JFYB 4QTHA 1J1XL 3VXRE 2MMXA 1GOGA 1A7OH 2YBRB 3DX7B 1BQHA 2RB8A 1AI1H 4W4NA 1CD1B 4JB9H 4WUUD 3HAEG 4XPGH 4EBQL 2IFGA 4H0HB 2HT3C 3ARUA 4LAQH 5ICYA 4PREA 4ZUTB 3ZKND 4L9LA 3MV11 4ZNEA 4J6RH 2HFEA 4MZ3A 1DUYB 3FO2A 4XNMB 1IAKB 3GDBA 1FYTB 4Q74A 4YHYC 1FVEB 2G60H 4X7SL 3V52H 3G6DL 3QXDA 4PJ7B 3X3GH 3BE1H 2W60A 3IJYA 4HDIB 2J8UF 3IETA 5LXGL 3F7YB 2A6JB 1EO5A 2Y7QA 4MXVF 1LO0H 4WUUB 5GRJH 3W39A 4K9EH 1XF2B 2A6IB 4H0GA 4HUMB 2UY6A 3GMOB 4X9GA 3SKMB 4M6OH 2H32H 3KXFB 3U1SH 2AJUH 3T3ME 2FD6L 3O4LA 4ZG1A 5KVDL 1UB5A 2BSED 2WWKT 3HZVA 5FO8A 4PLOB 4QHKJ 3MOBH 1NCCL 2DQGH 2EYSB 4PRBB 5DVOA 5DURD 1R5WA 3J8F7 4D9QE 3IU4H 3G5YB 3ZTJH 4LPVA 5DD5H 5F7EL 2V2XA 3WIIH 5C0RL 2GJ6E 4KC3B 4DZ8B 3MV01 2AJVH 3JTTA 2VWEC 3PJSA 2BFVL 5MEND 5B38B 1UCTA 2DQEL 1QG3A 4YGVA 3RWHB 5CJXC 3RKDD 5DFWH 4NNYA 3V5KA 5A2FA 1MLCA 3BD5A 3ROOA 1T20B 4K71B 5DC4B 3GSUA 4AEHH 5H37G 5GGQH 5DURB 4ZFGH 1A3RH 3WHXA 1SJEA 1MREL 4QEGA 4U6TA 5CEXB 3ILQD 4RMVA 3K2MC 4XP1L 5C08E 5IEKB 4WUKL 3BDBA 5MENB 4MNGE 1PG7L 1UENA 2HT4C 3WNMA 4UT7H 3ZO0A 3MR9A 1NCUA 4S1RH 1CG9B 3K2UL 4MA1B 4PP1D 5FO7B 2Z8VC 1PY4A 2VLRD 4K7PL 1YDPB 2OJZL 3U7WL 4JDZA 1ES0A 1PY9A 5EG6C 4GAJH 5F6IB 1Q72H 3QA3A 3B8SA 1YJDL 2NXYD 5F1NB 3IJHA 4ONGH 3S5LA 4DKEL 4ODSH 3H9SD 4U3CA 5B8CB 1J5OH 4LLUB 3TC9A 1T7WA 1AHWB 2APTA 1I3VA 4NHCL 1AGDA 5EU7C 4LMQI 3HE7A 1HILB 3NIGF 2E9IA 4RDQF 5EPMA 5FYLD 4P2CG 2A6DA 2FL5A 5JDSA 5D1QC 2VLRB 5E94A 2YXFA 3RFZC 1Q0XL 1A6VL 2EZ0D 4MJIE 5J11B 5DK2A 2O61A 3LDBB 5MP6H 2DKSA 4MLSA 4JKMA 1BBDH 5I1EL 1QUNA 2EYTA 1W0WB 3NFPB 4N0YL 2NXYB 4QNPE 5DJ0B 1FZJA 3EDFA 2VSCA 3H9SB 1U9KA 5HGAA 5KANG 1VKXB 3ZYJA 3AXLB 4KWUA 4YUEL 1KUMA 3CFJA 32C2B 1CD0A 4L4TD 5FM5M 4NO3B 2YUVA 4PRIA 4KDTC 1XCTA 4U1NB 4TPRL 4YDJB 4YWGL 4UIKL 4J2XA 4YXKH 5D2NE 1RPQA 2NY1C 4RAVA 1JGLH 1L9MA 3QI9C 2W0FB 1I1AC 4HIXH 2VXVH 1QLFA 1L4IA 3HUJB 1EJOH 5FYLL 4FP8H 4FQ1L 1A7NH 5D7JD 5GS1A 2ZCLL 2X1XR 3G04A 2C4XA 4P0DA 4I9WD 5BO1H 1CGTA 5I0ZA 2Y6SC 4OFPA 4RMWA 4WY7H 1MVUB 2UZIH 4L4TB 4KI5D 1I3GH 3KNBB 4Y2DC 5DD1L 3BPOC 1UWGL 5K33A 3MRNA 4TNVF 4Q2ZB 2R1WA 1CIUA 2Z92B 2QSVA 3AREC 3N1GC 3VXOA 1FC1A 1KJ2L 5HVGB 5C07D 2ZCHL 5E9DE 2DBJA 5T3ZE 1A02N 5D7JB 1FFRA 4E41D 4K3DH 2N56A 3QUZC 1T6VN 1GPOH 2IC2A 4K94H 5F3BB 4YR6B 1KEML 3DHJA 1P7QD 2AJZA 3HNVL 4I0PD 4JANA 4M48H 4MVBD 2BY0A 3MC0A 2VXUL 3D9AL 3U7AA 4LHJB 3MXWH 2EIZB 4ZSOA 5ID0B 3IDMB 1A7RL 4OM0L 4DZBA 2DKMA 3FQTA 4BH8A 3OR6B 2NXZB 4MX7B 4X9FA 4R2GD 3I2CL 4MS8C 5D7LD 1FNGA 3D39E 4E41B 4DOHE 1WAAA 5INDA 3NIFE 4I3SL 4BZ2L 1ZGLA 5A2LH 3MRBB 1P7QB 4KRPB 2IBZY 2C1OB 3TNMA 4I0PB 4O2EA 3T2OA 3QEQA 3S36X 3SGDI 5ILTH 3KPNA 1ZMYA 5SX4H 4NUJA 4JGUA 3SBWC 4HIJA 4LOUC 4NM4H 4Z8FH 2RFXA 5E70A 4RCAA 1R3JA 5E6IA 4WW2F 1I3RA 5B39G 3WS3A 4PJBE 3MJ7B 3QFJA 1K4CA 3L1OH 2VQ1B 4R2GB 1KBGH 5D7LB 3UXFA 5C0ND 1HKLH 2X41A 5EZLB 5L7XH 1XCQB 3O2VH 3MLVH 3TWCH 4HIHB 4TQEH 4LSRH 4RZCB 3RL1A 3OX8B 4XVSH 3TZVC 2YPKA 2DLGA 5I76B 1MCEA 2QQNL 2Z93B 2JK5A 1KCUL 5IW6B 4OUUA 3EDDA 2MQCA 1B0RA 4NRYA 3CFEB 5IHZB 1Q9OA 1NBYB 4M6ML 3NPZB 3O3AA 4D8PA 4JKPL 2UWEE 3ULVH 2VXSH 1F2XK 4KKAC 4CVXB 2GTWA 1QQDA 2BVPA 4XP6H 3I3EA 5HGHB 4M3KB 5EO9A 3ARFB 1AD9A 4E9LA 1LO4L 3GSWA 2PW1A 3CPLA 1XF5B 4Z7OE 3KYNA 3UO1L 4M7KL 1ZANH 3P11L 4YAQB 3LEVL 4P2QD 3SOBL 3LQAC 1RZIA 2ADFL 3H9HA 4N0RA 4DKFH 2VOTA 1NFKA 4DUWA 3EO0A 5CD5C 5TDNA 2BOCB 2JLLA 1IT9L 5I71B 1HHHA 2XG4A 3TBTA 3ZT6A 3V9FA 1U36A 5LGJB 5CEZD 4OCNC 3JV6B 1BD2A 2AK1L 1NL0L 1A0QH 1I9IH 4FQXA 4HK3N 4CNIA 5HHXL 1U8QB 3P0YL 4KGLA 1PKQA 5HGBB 4GAYB 1BGXH 2R23A 1OW0A 3FRUB 1SM3H 4Y5YC 3TYGH 2HKHL 5IB5A 4UTAL 5GGSB 3QO1B 1AP2B 5MEPB 1BVLA 3E6FA 1AGCB 1BQLH 1C08A 1EMTL 1NCDH 4X9IA 1RD6A 5F89B 5IM7A 4P23A 3UTZA 3TO4D 1QZ1A 3V5HA 3FT3B 4LBEA 2R1YB 1TZHA 2H9GA 1X5KA 4PJAB 3MRGB 1QFOA 4ZTOL 4PBWD 1F4YH 1U92A 3OG6B 3TBWA 5KSUB 5EC1B 1K6QL 4HD9A 5E5UB 1AQKH 1KTDA 2OR9L 1V8HA 2O5ZH 3MCLH 4YBQD 4HWUA 2G5BA 3QCVL 5ESQB 5JA8B 1A1NB 1BHGA 3A6CH 5IVXB 3VA6A 4R8WH 5CEZL 3PHQB 3TO4B 1EAPB 2YR3A 1PDKA 3MRKA 4FHBD 4TUKL 1OB1A 2R39A 2PYFA 3DBXA 4ZS7H 4X7TA 3GJFA 1ND0A 3W81A 5CZXC 2VLKE 2R9HD 2QSTA 4RMUA 4NCDA 4M7LL 4JAMB 5EORH 5E56A 5A2JH 2XTJB 4F2MA 4N8CL 4JRXD 5F70A 3QPXL 4OCSH 3UJJH 3TBVB 5I30L 1HYSC 4NGHL 4NKDB 1TZIA 2F8XC 1G0DA 2CUMA 4QKXB 2CDGB 3RL2B 4CDHA 35C8H 5T1MB 5GGVH 3NCJH 3S36H 5AG9A 2ZUVA 2B5IB 5IROA 4YEFA 5FV2A 2IH1A 4HF5L 2DS4A 1S5IL 2J8UE 3OR7A 4W4OC 4X6CA 1WLHA 2FJFA 5E8DH 4QO1A 4MXVE 2BJML 3C08L 3MJGX 4G9FA 1LDSA 3HFMH 3HI5H 4R9HA 4NJ9H 1OPGL 3MGTA 1E27A 4XP4L 2JE8A 2ESVD 1NGZB 3GO1H 1FRGL 1K4DA 5KSBA 4LVOB 4FZEL 3ISWA 4LARH 1YMMA 1NGXA 1QR1A 2DL2A 3BVNB 5FA4A 4CKVX 2AK4E 1JZ6A 4RWYH 1WEJL 4PJGA 1N6UA 4R7DA 4GBXD 1A7QL 3GBLA 4XVUC 2ICEB 1JYNA 1NC2A 1AXIB 1IGFH 2ESVB 3IDXH 1IGIL 1NKRA 3NPSC 1OCWL 5JW4R 2FBJH 4L1DA 3DUSA 3AVEA 3HPLB 2ZPKL 2RQ8A 4N90E 4X7FC 3QDHA 1S7UB 4EUPB 4O4YH 2P5EE 3BXNA 3EYSH 4MXQD 5IVZB 3O6FB 2UZXB 4PG2C 2XQYK 2Y36L 2QLVB 3RPKA 3SDCC 2FJGA 1HH9A 3FOLA 3HC3L 5DRWA 1S7TA 3OKMB 4LCIH 2AXGA 1MCFA 3ARWA 3TN0A 2HWZL 3KJ6H 5C09B 1P7KA 1T03L 1XGTB 1IJ9A 4PJ8A 4F9LC 2GAZA 4N8VA 1CXKA 1UJ3C 1JNNL 3H0TA 4FTVD 1OGAE 5EU6E 1N0LA 5J3HD 4HMEA 1DVFA 1GC1L 3WL9A 4C54A 4GXUN 3CVHL 1Q9KA 1NGWB 1X4YA 2XFXB 1DBJH 4LQFL 2LABA 3QWQB 3B2UD 1MQKL 4GKNA 2A0LC 3UPCA 5CZVL 3QUMH 1T04B 3D3VA 2BNRA 1BIHA 3LB6D 1MHHB 3T77B 3L3DB 3T65B 1NH6A 2D2OA 1GGBH 3BMVA 1IC5H 5GHWL 2B0SL 4F7EB 3QZWB 1B9ZA 5KTEL 4QRQB 4P9HL 1INDH 2FYYB 5IKCB 5DMIH 5FUCC 1I1RA 3HS0B 3QCTL 1JF1A 1FL5B 4U05A 4WWKA 1KF9B 3SCMC 4HIEB 2ZUTA 5DMGC 5IFJA 5I8CA 4BSWB 5DMJB 4H0IA 4WFGD 1NBZA 3RVXC 5FYJE 4JLRA 3MLXH 3NH7H 4PV9B 2O5YL 3FQXA 4LCCC 5C0DA 5EUKA 3UTPE 3SKJL 3L3HA 4XNYH 4RMTA 1I8IB 1ORQA 4ZAKD 2UV3A 3EHBD 4O51B 3GIZL 5ICZB 1W0VA 2E9JA 4LVHB 5IJKC 1BZ9B 3EOBA 4LPXA 1NSNL 4U3HA 3RHWK 4BFEA 2A74A 2X1OA 4KROC 5GS0H 3OKKA 1J8HE 1FLRL 1MPAL 5FKAB 5IMMB 3A6BH 4N68A 2VDNH 3IFOB 2BOBB 4NQED 4WNQA 3RHWF 1GHFL 1AO7A 2CO6B 2GJJA 2O93L 2R2HB 1LO2H 4PJCF 4ZO7A 4NOFA 3FO9B 3CXDH 4ZAKB 4WJ5B 4F15B 3IFLH 3T0EE 4YXHH 4B50A 2HFFA 3MV9A 5F7MC 3PWLA 2DJ4A 3HE6D 2HJKA 3QO0B 4NQCD 4WFHD 5IV2A 2MQ3A 1YPZF 3F6IA 1VEMA 3IDJB 2JCCB 3MRRB 4AENA 2J4WH 1LEIB 3GSOA 4E42B 4XCYB 5C0GB 4XCEA 2NY3B 8FABA 4JPIA 3L5XH 4NQEB 4UB0L 4GG6E 5IESH 3VH8A 2I07B 5CKAA 3GNMH 4EI5B 1CGSH 5CBEB 5IFHH 2BCKB 1RUPL 1D5MA 3QH3B 4ZYKB 4KK5D 1FNLA 4JQIH 1OOAA 3LRGA 5AYUL 3T2QA 3CDGA 3TCLA 3W9EB 3U6RB 1M7DA 4KTEH 1CXFA 3HE6B 4NQCB 4HBCL 4K3EL 1LE9B 5D1XD 4GW4A 4IRJB 2Z91B 4K55A 3O8XD 3HMWL 5EBLB 4C57C 2VDOL 3IXTB 3QXWA 2EDKA 3AAZB 1CTOA 3G5XB 1JWMA 4H25B 4R0LA 3H3BC 2HT3D 1WCBB 4JHWH 1RZKH 3GMMA 4P2YA 3SPVB 1XGQB 4X4ZA 1EEZB 4J8RA 1ZTXL 1I7TB 5L9DL 3MPCA 5IHUL 5IT2H 4UDTA 3NGBB 1DUZA 5F9OL 5GGUA 1IKFH 3FB5B 3CU1A 3WIHH 3Q48A 5D1XB 1QHOA 3QDMA 4C83B 4XMPL 2AV7B 1NGYB 3O8XB 5CINH 4NWUH 1A3QA 1UKQA 3K80A 1EERB 4AM0A 4HJGA 5F71A 5K9JH 2JJTA 3MA7A 4H26B 4PGCA 4UU9B 3T0DA 4N5EC 3FONB 1G1YA 3S5LG 5KS9A 3PABA 5C0CE 4Y4FC 4JFFD 4OD2A 1MI5A 1W72B 2F19H 2OSLA 2DTSA 3BIKA 3GMQB 1B3JA 4FNLH 5FDYA 4YHYB 1C5BH 1G9NH 1NUDA 3F65A 5CS7A 3QUXD 12E8H 4JFDD 2DQDH 1KPRA 4KU1A 5HHME 1XF4A 1A4JA 1GZPB 4IIQA 3D85A 2WLZA 1JGDA 4CVUA 5D2LF 2R2EB 3WFDH 3FRPA 4RWHA 2PNDA 2XZQL 3OAZK 2V6HA 5HD8C 2BX5A 4KJWC 3SGEI 2OL3H 3M07A 3BO8A 3ZTNL 1DLFH 1TVDA 3QHZL 5I1JL 4PGZA 5FGRA 2P8PA 1UWXH 1E4XH 2CLRA 3SKNA 3UJIH 3VD7A 1EGJL 5INCA 5F21B 3G6AB 3GM0A 3QUXB 2MHAB 3NCYP 3VD3A 4BH7B 3UTSD 2DM4A 4U6XB 1NFDA 5IQ9B 2Y06H 4WEBH 4KHXH 1NEZA 4O58H 3H9ZA 2DLFL 1U93B 1ZVYA 1H3PH 4HH8A 4MA8H 4JQVA 3WKNA 1S5HA 2OR7A 5C8JA 5TFSH 4IHOA 1WQVT 2P8MB 1FGVH 2A9NH 2GJ6D 3NCCB 3ULSB 3ULUC 2CMRL 5JHLH 3M8OL 4OZIB 3RAJH 2KDGA 3D2UA 3LS5H 2DIJA 4NN5B 5DD0H 2HRPH 3CSGA 4JN2B 4NM8H 3KLAB 1A5FH 5SWSD 1HQ4B 3Q6FA 4R96B 5DSCA 3JWDH 2AGJH 5MEQB 4OGAC 4X8JA 3TEUA 3SE4C 2VDPL 4LSVL 3ILPB 1HOCA 3UZEA 3C5SA 3LZFH 3IFNL 1MLBA 4Y16A 3U7YH 5DQJB 4OI8A 1FL3A 4P5MB 3UJTH 4XAWH 2GJ6B 5D1QD 3SGJA 2EICA 3NACL 4O5LH 3IU3A 5K9QI 4LIQH 3CFKA 2P24A 4YK4C 4TVPH 3WUWA 2FJHB 4E0RA 1NCBL 5F9AC 4JFXB 3NA9H 2ZUYA 1PZ5A 4Y5VA 4ODHH 3GB7B 5EOQL 1A6TA 2G75A 1DSFL 5KG9B 3CX5J 4BELD 5ACZA 4NQXB 1KXQE 3IKCA 4JG0L 1RZ8A 4MHHI 1B6DA 1M05B 4R4BB 4LQ1A 5E03A 1I8LC 3IVKB 4U1GC 2XRAL 4FQPA 4MDJB 1B6UA 5IGXH 1DJSA 5D1QB 3PQYA 5C08B 1WSST 4MMZC 1WZLA 4MNQA 4NPYA 1LMKA 1IGYB 2W0KA 3MLRH 1LILA 2HAZA 5T5NG 2NY1D 3RIFF 3QDJA 1I9JH 4WV1A 4KQ3L 3ZKXC 2IMMA 1T3FA 4GAFB 4ZDHB 1HXMB 2XACC 3KDMA 1SMOA 1UVQB 2G5RA 2YC1A 4WO4C 4JM2C 1HHKA 3C9NA 1EHLH 5H94B 1EEYB 4MQ7A 1G7JA 3SJVE 3L3OA 3NIDF 5M94B 3BESR 3DYMA 1U8IA 3VWKC 2Y6SD 1WFNA 2QADC 1EO8L 1P4LA 2C9AA 4PY7A 4Y2DD 3RBGA 4H5SB 1CFNA 3FCTB 3LSOB 2DAVA 3PGFL 1M71A 2IFFL 1T7VA 4Y19D 3CLFL 2FGZA 1VACB 1KN4H 1IGMH 1KB5B 3JV5A 3CDCA 4DFIA 3CMGA 4MJIB 2W9DL 2DQIH 3VFPA 4Q6IA 4JPKH 3CVIH 5D7IF 3MLWH 5F7DA 1H5BC 5DJDB 4ODTH 4R3SA 1EXUA 4KJYA 4MYWB 4XXCA 4J3SA 2AI0H 2ZSVA 3VFOA 1MHCB 1KG0A 5DUML 3I6GB 4U33A 4LHQB 4XI5C 4Y2DB 1NCWL 3I6LD 3GI9H 3I3BA 4ISVA 1UCBL 2EYRA 4OZHA 3RNKA 4ETQB 3WFCL 3D0VA 1MJ7L 2VC2H 3O41A 4Y19B 4R97C 1JPGA 4X6EB 4XAKD 1S3KH 2XN9D 4Z7WB 5I6XC 4Z95H 3PGCA 1CQKA 3RQ3A 1RZFL 1B4JH 2I5YH 4JPWH 4JFYA 4U0RB 1FIGH 2YBRA 1FDLL 1CD1A 1SJHB 4S11A 4JFQB 5CMAB 5EZOH 3KLSA 1UA6L 2ICCA 5T3ZD 4FQJL 5BQ7B 3VWJC 3WNOA 4ZUTA 3WFEH 2OXGA 5F88B 3D5OF 4LOUD 4AEEA 4G8GD 1DUYA 4XNMA 1IAKA 1RJCA 1FYTA 1FVEA 4QWWC 3S37X 3OAYH 4LNVA 3MODL 3MUY1 1KC5L 1DE4B 4OZFB 1UXSB 2X4UB 5I1IH 3FFCD 3RTQC 3HG1D 5AZ2H 3F7YA 2A6JA 2J1KA 3RUGB 4WUUA 3CFDB 1XF2A 3TZVD 2A6IA 4OJFH 2YS4A 3GMOA 2RAMA 2Q3AA 3BKYH 3SKMA 3KXFA 2ICES 1L7IH 5LVEA 2YUZA 1JGUL 1CDUA 4IEFB 3CU7A 4D9RD 1SY6L 4CMMB 5HDLA 1ZA3B 2R4SL 4OLXH 4KKAD 3RY6C 2OQJB 2EYSA 3O6LH 4GLRH 1WWAX 4PRBA 3UDWC 3UBXI 1SEQL 4EDXB 3P4OB 2VE6B 3G5YA 4QTIL 1F11B 1TJHH 3EO9H 3FFCB 3KPTA 1FZKB 2ICWI 3HG1B 3L3GB 3S4SB 5EUOF 5ADOH 3IKKA 2WNGA 2EH7L 4DZ8A 3P0VL 3FHQA 2DBLL 2ED8A 1T2QL 5B38A 3QG6B 3T4YB 4UIMB 2A1WH 3RWHA 5CD5D 5LWYH 1EK3A 1T2XA 4P57B 4ELMF 4JO4H 1T20A 4L9LC 1R3HA 1BBJB 1Q1JL 4BKLB 2A83B 5HJ3B 1F2QA 5F7YC 2JJWA 4NP4H 3OKEB 5DMYA 4P2RD 3JWOC 4PJCE 5CEXA 3BN9D 2IGFH 1JPSL 4PJBB 1L0XA 5IEKA 1HEZB 5I8KL 5MENA 1VGKB 4YFLI 2A77H 2FX8H 3H42H 1MELA 5EBWB 3VW3H 1CG9A 1YPZE 3BJLA 4H1LH 5EDXA 1DBKL 2VB5A 4LHUD 1J0JA 1YDPA 3ZLQC 5ANME 1AJ7L 2DJSA 4OBSA 25C8H 3LN9A 5FYKE 4P2RB 5AYQA 1ZLVK 1QO3B 2UWEB 1IM3B 3UMTA 4ZXBD 5F1NA 5JMOC 1KFAL 4AL8H 3LQAL 5L6YL 4D0CB 4QXGH 3QPQC 5B8CA 2VZ3A 3F7VB 1XGUB 1UM5L 3Q5OA 4LLUA 3QCUL 3P30H 5GSVB 4K9EC 1AHWA 5F6HI 2E27L 1W0YT 5DFTA 3GKWH 1HILA 3VXPB 5CJQL 2YWYA 2VLRA 1A6ZB 4JO3L 4LRIA 3NTCH 3RBSA 5CZXD 3FQRB 4XX1E 4Z5RB 4XNXL 3OKNB 2XPGB 5AZEH 1W0WA 3NFPA 4ZXBB 5J13C 5DJ0A 1RY7B 1JIBA 3QFDB 5DR5H 4LAJH 3H9SA 4WWID 1MFAH 4GQ9H 4JZJB 3VD9A 1VKXA 3M17B 1F58H 3AXLA 32C2A 4KRMB 4NO3A 5JQ6H 1LD9B 4NKOB 4WCYL 4U1NA 4YDJA 2YPLD 3LOWA 4RGNE 3E1F1 3NZ8B 3S37H 1D9KD 2D7MA 3QQ9C 4ALAL 2W0FA 3HUJA 2XA8H 5DMKB 1OARL 2YZ1A 2VLKD 2MWCA 2XQBH 3VXNB 5HYQB 1GGTA 1XMWA 3RVVC 3LD8C 5E2VH 1MVUA 2AXFB 1FNHA 1KXTB 4L4TA 5D2LE 1U3HB 3KNBA 3RVUC 3RIAK 2VABB 4ZO9A 2VDKH 5J6HB 1OTSC 4Q2ZA 1P84J 4OFVA 1D9KB 3DGCR 2UVEA 2Z92A 3G9AB 1KJ3L 1NMCC 1X3DA 2XICA 1DFBH 2NX5E 1KB9K 3I75B 2R8SL 3AUVA 1NUGA 3RIAF 2VLKB 3DVNB 5D7JA 1ED3B 3NABH 3ZDZF 3GI8L 4ZTPL 5F3BA 2HVKB 4YR6A 5DVMA 3SDCD 4EZMA 1RURH 2QHRL 1UWEH 2AJSH 1WCQA 2FX7H 4FFVC 4POUB 4F9PC 4HC1H 5I1GH 2EIZA 5ID0A 3IDMA 2AK4D 4YH6A 2CKNA 2IAMC 1KYOK 3NPSB 3OR6A 3DXAE 2J8UB 1X5FA 4KY1H 4MX7A 4UQ2B 1GSMA 4E41A 4W6XB 4WI8A 5DVLA 1U3JA 4LDEB 3ZHLA 4H20H 5TPWH 5T3XL 3AMKA 3MRBA 4FXGB 1EAJA 1Q0YH 2EDEA 1P7QA 3SDCB 5GS1C 3WFBL 2C1OA 3R0NA 3T4AB 4I0PA 6CGTA 5JW4M 5GS3A 3L7FB 3ZE2F 3TPUB 1YEEL 1CK0L 1MFDH 2W0PA 2P5ED 1MCHA 4DGVH 4F57H 4KKNA 3S88L 2AK4B 4QF1B 3WJJA 4KTYA 1S7WB 3MJ7A 1VDGA 5HHQB 4RQQB 3FQUB 5TQ0H 2VQ1A 5D7LA 2DF3A 2X4TB 3VH8G 2B4CH 4M1GH 4NOBA 1KJVB 5EZLA 1XCQA 4AIZB 2Y1VA 5I74C 4HIHA 1B0WA 3FTGB 5JOPD 4RZCA 3OX8A 2QKIB 3SCMD 1HHJB 4NKIH 3VFTB 5I76A 2Z93A 5DMGD 5IW6A 2IPTH 1OGAD 5EU6D 3CFCL 1AKJD 5I19L 5D72L 1DDHB 3ARVA 4M1DH 2P5EB 1UYWL 3KYKL 5IHZA 3CFEA 3TP4A 4M8VA 1NBYA 3UYRH 3RVXD 1HIMH 2YHGA 4CVXA 3OBAA 1MCDA 2NYYD 5I1CH 3VE0B 4X4ME 2GCYB 2DTMH 5HGHA 1N8ZB 4DGIH 5F9WC 1ZVHA 3ARFA 1R3IH 2EDNA 1V7NL 1XF5A 2YD3A 5DWUH 3SCMB 5DK0B 1ZHLB 4YAQA 1OGAB 2YD5A 3KJ4B 4PJIF 1AKJB 5EU6B 4RNRB 1DBMH 3SQOL 15C8L 4P59L 4PS4L 2E7CA 2BOCA 3NIDE 2WSKA 3CSPA 1DN2A 5EWIH 1PEZA 4LCCB 5LGJA 5IP4A 3MJ9H 4EQ3A 1WWBX 4HWBL 3RGHA 3JV6A 2I26N 4H8WL 2VH5L 3GSNB 1LEKB 1QKZH 1C5CH 1OAUL 1U8QA 3B6SB 2ATPB 4WU5B 5HGBA 4GAYA 4LASL 2HH0H 3FRUA 3RWGB 4YHLL 1YNLH 3V6ZB 4ONFL 4MJ4A 4UV7H 5GGSA 3IDNB 3QO1A 1AP2A 4OFYD 1OWWA 1AGCA 5F89A 5D7IE 1YYLH 5GISL 1QRKA 4R4FL 1TZGL 2YA0A 1RV6X 3FT3A 3X11B 2R1YA 4FQHB 4PJAA 3MRGA 1MAMH 3BKJH 5DZNA 4A2LA 3BZEB 4WFFE 2ID5A 2VAAB 3U0WL 4DCQB 3C09C 5D6DA 3GMRB 3LH2L 4DQOL 5B4MC 5KSUA 5EC1A 1N64H 2C7UB 3OXRA 3F12B 4JGMA 1JPTH 3K4DA 5ESQA 4D0DA 1JV5B 1A1NA 1CDHA 5IVXA 4YXLH 3PHQA 3RY5A 3TO4A 1TJGL 1EAPA 1EUUA 3QG7H 1YEHL 1OSPH 4HXBH 4WI4A 4GSDH 1U8JB 3ARGD 3ULVC 4RFOH 3VXQB 4BSJA 4XWGH 4U6HB 1HZHH 1WBYB 2DJUA 4JAMA 1CICB 4LLAA 3TF7C 2QL1A 5JPNB 2NQCA 3OWEA 1FO0L 4M8QB 2ARJB 4L8CB 3FN3A 3ZHKA 2EDYA 3A67L 3MTRA 4FQXC 3MXVH 3TBVA 5F9JB 3CDYA 2J8HA 4NKDA 4NDMB 1MF2H 3QP3A 3VXUE 2CDGA 1E6OH 3RL2A 1OW0C 5T1MA 3GRWL 2W65B 2P7TB 1U58B 3QEUB 4OIBA 2V5RA 3OF6D 2NNAB 5CSBA 3RX5A 4N5ED 3ARGB 5ISZE 4BFIB 2E6JA 2J7LA 5FB8B 1NGZA 4XPAH 1MHPL 5H35B 1A6UH 4GFTB 1BPVA 5CJ8A 4DKAA 3BVNA 3RU8L 4ZMAT 1P6AB 4LGRB 2LTQC 1RU9H 4EI6B 1CXIA 3GSQB 4KJWD 4XH2B 1T1YB 1OAKH 5EUOE 3BUTA 3OJDB 2ED7A 4W81A 1OQOA 2ICEA 3KPOB 5LQBH 1GL4B 1KNOB 2ESVA 1I8KB 3FAWA 4D3CL 1KT2B 1WVZA 4FABL 1RMFH 3EO1B 2X4RB 4HEME 5IJVB 3V5DB 3HHRB 3HPLA 3LPGA 5BVJA 4ELME 1LP9F 3LS4H 4PJ9C 1S7UA 4EUPA 3H7BB 5IVZA 5TE4L 3O6FA 4FFWC 4Z7UF 1MFBL 1BWMA 2LAAA 4WW2B 1UM4L 2FECL 4OV6F 2AABL 5IROC 1L6XA 2WIIB 3OKMA 2FX9H 4PUBH 3HI6H 2JELH 4X7EC 5LCVH 3ZZ1A 5C09A 1PFCA 1KCSL 4HPOL 1XGTA 3F7PC 4WEMB 5HHVL 4YBHA 2OYPA 3ULUD 1U8NB 4S10A 3VG0H 4HQQH 2BHUA 4NUGL 3OB0H 4HWEL 3JBG7 4MD4B 1WK0A 5JO5B 43CAB 2EIBA 4TRPH 5LGHL 3I9GL 3S35L 4LSQL 4NO2B 1NGWA 2VKWA 2XFXA 1CFQB 4OGAD 1RJYB 2EDXA 1G7LB 4FS0A 3EZJB 3OAUL 2BVQB 4DN4L 2XV6B 1H3XA 1T04A 3SE3C 4TSAH 1FVDB 2VR4A 1MHHA 3T77A 1CGVA 3L3DA 3T65A 3SDYH 4LLMB 3VA2C 2DL9A 4F7EA 3QZWA 4KHTL 1MRFH 1R5IB 4QRQA 4XC1L 3QQNA 3UP1A 2FYYA 1MY5A 5IKCA 1V3JA 3K1DA 3O3UN 1KGCD 1MAKA 1RHHB 5E99L 2DLHA 3HS0A 3DIFB 3RKPA 4OI7A 5IW3A 3OKDB 1GZQB 1FL5A 2PO6C 2D7PA 4HIEA 5LGKA 1H15B 2ZJSL 1QBAA 4DAGH 4BSWA 4U1IB 3KPRD 2EC8A 3ULUL 1OY3B 4WTXA 1MY7A 4F7TB 4PJFF 1JP5A 4PV9A 4KJPC 3TN0C 3T3PF 4OF6A 5I1AB 1XIWD 1I8IA 1G0XA 3GKZA 3TCXA 2BDNL 4PJ8C 3W0WE 4O51A 5ICZA 1F90L 1IAOB 4D9LH 1BZ9A 1DL7L 4XBEL 4XMKL 4BJLA 1OGTB 5F7KC 2AJYH 4JM2D 3PP4L 3C8HA 5LBSH 3BKCL 5FKAA 4IDJL 4G7VH 3KPRB 3VWKD 5IMMA 3TJEH 5DEGB 1S8DB 5E0QA 4P4RB 2QADD 2ZOKB 1FAIL 2BOBA 1ZWIB 3N50A 4O02H 3QRGL 3Q5YA 5FGCE 1U6AL 2CKBB 2R2HA 2VXTH 4WENB 2EKSB 3FO9A 4ESKA 1IAIL 1XIWB 5HI3C 3WE6B 3QWRD 4ZAKA 3ZKXB 3MV8E 4M00A 1OM3H 4YX2H 4OCXH 4IDLA 4IOFC 4AIOA 3QO0A 4G8EB 4KVCL 4YQXL 3IDJA 2DI8A 2JCCA 3MRRA 4UDUB 3OGCB 2LU7A 1URLA 3BIBX 1LEIA 4E42A 3VWKB 4XCYA 5C0GA 2CKBL 1XF3B 2NY7L 5CSGA 3ZDZE 4N0UB 4NQEA 1GRWA 4XI5D 4FXKB 2I07A 2VLLB 4LSSL 1YC8A 4EI5A 5CBEA 2BCKA 4LSUL 4DJMA 2BSTB 3SJVD 2DMKA 4KQ4H 1QNZH 2BY3A 4YZFF 5B38G 3QH3A 1U0QA 3M1BB 1K8DB 4Q58C 4ZYKA 3O2DL 4P3DB 1NGPL 1MWAH 1NMBH 3LN4B 3W9EA 3DARA 3U6RA 5GS2D 3HE6A 4OGYH 1WZ1H 4NQCA 4DVRH 1LE9A 4WI3A 4IRJA 3SGDH 3LKRB 5FUOH 1L7TH 1U8LA 2VDRH 5EBLA 3LIZH 1MNUH 3IXTA 1SBSL 4Z7QF 1J9CT 3AAZA 3G5XA 4H25A 2HT2C 1FNFA 4NZRH 1WCBA 3VWJD 1PX3A 4JY4B 2WZPD 3SPVA 1XGQA 1EEZA 2D0HA 3SJVB 3ZKQD 1I7TA 2IPUG 5A2KH 3ZE2E 3RPIB 4R97B 2YRPA 4NKMB 5J1AB 1XFPA 4QWWD 1B2WH 3FB5A 4JY5L 4X98B 3SN6N 4OTXL 5D1XA 3GHBH 4MSWB 1IM9B 4C83A 2GITB 2AV7A 1NGYA 3O8XA 1RUMH 4GT7A 3NVQA 2C3HA 3V0WL 5CCKH 5DVKA 5A40E 4Q0XH 4UU9A 4H26A 4M93C 3ZYZA 2VR5A 3FONA 1G9MC 5GRWA 3VWJB 4LPCA 3NAAH 4U7MA 5CIPH 5DD6B 4BUGA 1W72A 1OT1A 2R0KL 3IDIB 3SEPA 3GMQA 3FT4B 4HXAL 1F6AB 3U9PL 4F3FB 4EJ1C 1GZPA 5FEBA 2A6KB 2R2EA 3FJTA 4UT9H 1O0VA 4LK4A 5C1MB 4C55A 2IG2L 1RULL 1NAMB 3VXRA 5GIRB 5E08L 4LP5A 4R0LC 1WFOA 3FHAA 2ZUWA 4J3VA 4PJIE 2ARJQ 1TPXC 2XKUA 5I15L 1JZ8A 3INUL 1IGCL 2BRRH 3G6AA 3QUXA 3TT3L 2RHEA 3E8UL 1A6WH 2MCPL 2MHAA 2VDMH 4BH7A 4U6XA 1NAML 3C8KB 5IQ9A 3B43A 2PTVA 3HKFA 3EYUL 1MIML 3BDYL 2DQCH 2WV3A 3P77B 2P49B 1K8IB 1J12A 3AM8A 1HSAB 1WUNT 5J12B 3QYCA 1RZKC 2JJTC 3O6KL 2XG5A 5D7SL 2P8MA 4M5YH 5CJXA 2BSSB 4QYOB 4FQ2H 3CGTA 5FM5O 2Q76B 3ULSA 2HFEB 4OZIA 4OLWL 4Z76B 3MBEC 3FMGH 5DA4A 1CLOL 1P4BH 4JN2A 3VMPA 3KLAA 4MHHG 1HQ4A 1A6AB 4K7PY 1ADQA 4R96A 1YEGH 4HUVB 2P1YA 2CIIB 3BH8B 2W60B 3HZMB 3QPQD 43C9B 1GGIH 4IIQC 5MEQA 1NJ9B 5CAYB 2BNQD 3RA7H 3ILPA 3E0GA 3EFDH 4L3EE 5DQJA 2F5AL 2YK1L 4P5MA 2GJ6A 2FCBA 4LCUB 1PX4A 4BZ1L 2C3GA 4GUPB 4LRNH 3JWOL 4RRPA 3LHPL 1H3WM 1YY9D 1A7OL 1HKFA 5SWZE 4F58H 1AI1L 5KVEH 1H3UA 1G9NC 2ENSA 4WI7A 2FJHA 4IMLB 4HUNB 1ZSDB 4XPGL 3ARQA 4JFXA 2XA3A 3VXSD 3GB7A 4N0CD 1RUAH 4OGXH 4LAQL 1RZJH 3DTXB 4OF3A 5KG9A 1AR1C 4NQXA 4AEFA 4CGTA 1IQWL 2V2XB 2BNQB 5DRNB 5L2JB 4XZUB 1M05A 4R4BA 5HDBF 2H32B 1MFNA 4PIRF 4YHMH 1LK3H 2XWJB 1G84A 2AEPH 4PJCB 3IVKA 4JQVC 4OCRH 4XCFH 4MDJA 5GRUH 2FB4L 5D1QA 2X1PA 1CE6A 3V52L 2HLFC 5C08A 3X3GL 3UTTE 3BE1L 1IGYA 4DN3L 4NNYB 1J87A 3HCVB 5GJSL 1LO0L 4ODBD 1YPZB 5EZIL 4K9EL 3VXSB 4ZDHA 1HXMA 1F6FB 3U1SL 1UVQA 4ODWB 1KB5H 3BYTA 5ANMB 5H94A 2E7LA 1EEYA 5DVNA 4UINH 3MV7D 3X17A 1ZEAH 2IPKB 1G9EA 1DEDA 1D7FA 2DQGL 1A3LH 5CGTA 3RVUD 3IU4L 4H5SA 4Y16C 2DI9A 2J2ZA 3FCTA 3LSOA 4I2XE 1N6QH 5DD5L 1OTSD 2GUOB 4KZDL 4GMSH 4GRMB 4G6FD 3WIIL 1D5IL 4HMDA 3MRLB 1VACA 1YQVH 1S7VB 2AJVL 1KB5A 5F96H 2JJSA 1FFNB 4GMTH 4NO0B 3S6CA 3SGKC 2W9EL 4MJIA 5E4EC 3QNXA 4XRCB 4MAYB 2YN5A 1AXTH 4Y5VC 4U1SB 5JIIA 5DJDA 3MV7B 5C70A 2HVJB 1RVFH 1LP9E 3LD8B 3VFWB 1NFIB 2NPLX 1MHCA 5GGQL 3I6GA 4ZFGL 5DGQA 1A7PH 4Y2DA 5ACLA 1L0QA 5JHDE 4YBLB 1KELH 3ZE0E 4FFVD 4ETQA 1JK8B 3KS0J 5JLZB 4G6FB 3VRIB 5I8OH 3W11D 4Y19A 1NMCB 4NRXB 4X6EA 2IAMD 4Z7WA 2C3VB 1P1ZB 1IKNA 4UTBH 3S97C 2HN7B 5KVGL 5T5NF 4WV1C 4JZOB 1MCLA 4M5ZH 4UT7L 4RGNB 5C0BE 4MLIA 5HVFB 3RDTB 1SJHA 3FQWB 4JFQA 4UOJA 5CMAA 4GXUM 3QJHB 2CK0L 5IVNA 4JO2H 3KHOA 5BQ7A 2GSIB 4GAJL 3GGWB 3PWPE 3P4LA 5D71L 5F88A 4EDWH 4LCWE 1FP5A 1R3LB 2HG5B 1Q72L 2EKJA 1Z9SA 5ALBH 4ONGL 2IAMB 4GRLC 5J9PB 4ODSL 3U46B 2OI9C 1NAKH 1J5OL 5D2LB 2D31B 1DE4A 3N85H 2ICWJ 4J1UB 3OJVC 1UXSA 4OZFA 1JYVA 2W9LA 2X4UA 5AUMB 2P45B 5FOBB 3LCYA 4Q6IC 2YRZA 4LSPH 3RUGA 1INQB 3CFDA 1MRDH 3VFVB 5MP6L 2J6EA 1TMCB 4X4XB 1WBXB 3V4UL 2L7UA 2EDTA 3T08A 3T2PA 3SBWA 4NQSB 3Q0HA 4R26H 4ERSL 1N4XH 4PB9H 5KANI 1ZKAA 4CMMA 1ZA3A 3VI4F 4JFPB 2OQJA 1YNKH 3PV7A 4EDXA 3D69B 3P4OA 1MFEL 2VE6A 1F11A 4PJFE 3FFCA 1FZKA 3HG1A 3S4SA 3T3PE 5I74B 2OZ4H 5IMLB 1CGYA 3CDFA 2F58H 1J1OL 1N5AB 3T4YA 4UIMA 1FGNL 2VXVL 4P57A 1EJOL 3PDOB 4FP8L 1BBJA 2B1AH 3BPCB 4BKLA 5DHYB 1A7NL 2A83A 4QGYA 5HJ3A 4X6BB 5A3IC 5BO1L 3TIEB 3OKEA 4M7LT 5C6WH 2OZ4A 2VUYA 3DECA 5CILH 2UZIL 1I3GL 4PJBA 2P5WE 3RWDA 5KVDH 1HEZA 3RGVB 3DWTA 5HVHC 2HA1A 1BVKB 4LVEA 5C0JB 3FQNB 4D94A 1VGKA 2VZVA 2H6PB 1A2YA 4F7MB 3H6JA 1UM6H 4BZYA 1QLRB 8CGTA 5J1SC 3RVTC 3ZKNC 5HPMB 2FBOJ 1H8NA 4K3DL 5F7EH 2AQ3A 1F3JB 1GPOL 1U8MB 3DYOA 3GJFK 4NZJA 1OLLA 4HAFA 3DX8B 1HWGB 2OTWB 1QFWM 4P2RA 2BFVH 2OTPA 2UWEA 3N9GH 1IM3A 5HGGS 4YZFE 2CRMA 5C71A 4N8PA 2JB5H 4D0CA 3MXWL 5GSVA 3F7VA 1XGUA 1FL6B 1T66C 2R2CA 5F44A 2WAHA 1AGEB 3VXPA 4C4KT 3L3KB 5DYOB 4EUPG 1U8HB 4ZNEE 3TYFB 1A6ZA 2BZDA 4YLQT 2R69H 3ULVD 4I0KA 1D5BB 1FJ1B 3FQRA 4OIIL 4XP1H 4Z0BH 3OKNA 4K71C 2XPGA 4WUKH 2NLJB 1KIRB 2P48B 1PG7H 2DI7A 5TJWK 2AS5M 3FO0H 4ZXBA 1QLEH 4X6CF 3QIUD 3QFDA 5FCSH 1BJ8A 3K2UH 4U1HB 5D7KD 4Z8FL 1B88A 4JZJA 1SMAA 3M17A 3PNWB 3W2DH 5E2UL 4YFEA 5KSBF 4PY8I 2FECI 3O4LE 4S2SB 1JYXA 3L1OL 2X89D 1LD9A 3VXMD 4X6FB 4NKOA 3WLWD 2FGWL 1HKLL 5L7XL 3NZ8A 3O2VL 2PW2B 4JFZH 3MLVL 4YDLC 3TWCL 4KUCF 4UT6L 1W8NA 4DKEH 1KLUA 3IFPB 4TQEL 3LV3B 5D7IB 1MCBA 2CDFB 1V3MA 4PJGF 3SDAC 2YOCA 1F3DJ 4NHCH 3EDEA 5CKGA 3QIUB 3SGEH 5DMKA 2X1WL 3ILQC 1ZK9A 3QZWG 3V0VB 3VXNA 1XGPB 5HYQA 1Q0XH 3ULVL 3IDUA 4KDWA 5E2TL 2EXWC 5F1IB 5B8CC 1ZGLM 4W4OA 2AXFA 3PXJA 3NCYS 4AQ1B 1U3HA 1CBVH 3VXMB 1M6OB 3ZT5A 4WFED 5I1EH 4XP6L 4YC2C 2VABA 1D9KA 4LBEB 4Y1AE 3ETBF 5BZWB 4P46C 3BP7B 4M1CD 2KZWA 2E3VA 1ZANL 4QHNB 3I75A 5FKPB 2YA2A 1P69B 3BT2L 3T04D 2VLKA 3DVNA 4PJ9D 1ED3A 2GY7B 5EBMB 3TO2B 2LTQB 2HVKA 4J3WA 1QA9B 4IRSC 3MLZL 2KBGA 5JQHC 1EZVX 3ET9F 2FRGP 1A0QL 1I9IL 2PCPB 4WHYG 3SHSA 1CD9B 2X7LB 1RZ7L 2Q87A 1SM3L 2CXGA 1A1OB 3TYGL 2J8UA 5KSAC 3JSSA 1OSZB 2VLME 1NCTA 5ISZB 4UQ2A 1FLTX 1J0YA 1ONQB 5DLMH 5AWNL 3F62A 4PJ9B 1NCDL 1BQLL 3DOSA 1HINL 5IBTH 4FXGA 3WSQH 4ZFOB 3KPSD 3SDCA 5DC9B 2W91A 2YD1A 3T4AA 1P84K 3L7FA 3EJZC 3TPUA 3F58L 2OTUA 3R1GH 4Y88A 4CBPA 4XPHL 1WITA 3DYPA 1Y0LB 4F7PB 2AK4A 2ZCHH 5FCUL 4AIXA 4QF1A 1OP5K 3LAFA 1KCRH 1AQKL 1IAII 5ENWB 2HKFL 5HHQA 5EUOB 4RQQA 3FQUA 3HPJA 1L0YA 2X4TA 4CMHC 3A6CL 3K8MA 4OCYH 2OMNA 1KJVA 4D0BB 4QXWA 2VZUA 4OF7A 3VXTB 3HNSH 3FTGA 3KPSB 4NNPH 5D7JC 2QKIA 2PO6D 2EO9A 1HHJA 3VFTA 2MNUA 3AROA 2D4FA 4ELMB 1DDHA 4R7DB 5EORL 4HS8H 3MCG1 2P5EA 2Z8RA 4PRIE 1IBGH 5HVWA 2YUWA 1FNSH 2HFGL 4KI5C 5HDBE 3BH9B 3VDAA 3V6FB 3L5IA 4KK6C 4OLZL 4KJPD 3BZFB 4LDLB 3QQ4B 3R06B 3MRIB 3QBTB 35C8L 3VE0A 1ZE3C 5GGVL 2GCYA 1N8ZA 3NCJL 1T1ZB 3S36L 3THMH 4PJ8D 3NMEA 2RCSL 3RZCC 2NXZC 2OCFD 1FNEB 4Y4HD 5E8DL 1ZHNB 4ZNCD 3HFML 2PO6B 3SCMA 2Y07H 3HI5L 4NT6B 4YDIH 5DK0A 1ZHLA 2W07A 1OGAA 5EU6A 4I1NB 1AKJA 4JY6B 4M4RA 3UPRA 4RNRA 3LEYL 3ZE1F 4KRPC 5DTFB 1CS6A 3Q6GL 4MVBC 4P2OB 4LARL 1DBBH 4JJ5B 5DRWB 1Q9LB 1I9RL 3BJ91 1S7TB 5HI5D 3T1WA 5HI3D 3WJJC 3GSNA 1LEKA 4RWYL 5D93C 3DMMA 4H88L 2QQNH 3B6SA 2ATPA 4WU5A 4R2GC 4Y4HB 5I8EB 3H2WA 4HCRH 4Q7DA 3RWGA 5FYJH 4IOFD 5I1LB 5D5MB 3V6ZA 4RGOH 1IC4H 3DVGB 3IDNA 3S98A 1IGFL 4TUOB 3IDXL 3W82A 2WK2A 5JXAH 5E1HB 4O00A 5BS0E 1QRNE 3X11A 3K0WA 4ZSOE 2FBJL 4FQHA 5J7CC 3DNKA 4O4YL 3NN8B 1HNGA 1LO4H 5E5RB 3BZEA 2AEIT 2VAAA 4M7KH 4DCQA 3GMRA 2B4CC 3HR5B 1QYGH 4MJ2A 5CP3A 4TULL 2C7UA 3ARFC 3F12A 4LCIL 1QD0A 3O0RL 1MIEH 1X4ZA 1E4KA 1NLBL 3KPQA 1JV5A 1JF1B 5GGRB 4OFYA 3KJ6L 3W0WB 3QEQE 4IMKC 5I1HH 1MVFA 2AXHA 3KS0H 4M6NL 4AG4L 2HT2D 5T33L 3LMJL 3QUMB 2AK1H 1ZS8B 3PGDB 1U8JA 5HHXH 3P0YH 4XHQA 1OT2A 4PD4K 3QFJE 5I71C 4U6HA 1WBYA 1CICA 3QISA 4G9DB 4LGSB 4L8CA 4M8QA 2ARJA 4I4WB 1DBJL 5DJCA 2J12B 5C92A 4LLYB 5C7XH 4X9HA 5F9JA 5FGCB 4NRZB 4AH2B 3QUML 4NDMA 3MV9D 2C5DC 1MRCH 5GS0D 1NBVL 2W65A 2P7TA 1U58A 3QEUA 1GGBL 2DWEB 5DDHB 1CT8B 1IC5L 3C2AH 2NNAA 3GZKA 1W2KT 5KSVB 3CSYB 3FL7A 1MHEB 3ARGA 3HMXH 1PVHA 4BFIA 3B9EA 3ZYIA 4J12A 4MJ6B 5FB8A 1BF2A 5DGRA 1NCNA 2OR9H 3L5WB 2AJXH 5H35A 2Z0BA 1IAMA 2HJFB 1ODAA 4S0TD 3VCLB 4RRPG 5D6DC 3VI4E 1KXVC 2BNUB 4LNRB 3PWLB 4PGBB 1JI1A 3GSQA 3MLXL 3NH7L 5KN5B 4DFHA 4XPTH 3OF6A 4M93B 4OD3H 4XH2A 1T1YA 1OLZA 3FOMB 2F74B 2Q3ZA 4MNHB 4XNYL 1KEGH 3OJDA 4K2UH 4N8CH 3AS2A 1QFPA 3C2SA 4M62H 1KNOA 5JORB 4XBPB 2VUOA 1I8KA 3PXHA 1CGUA 3LPFA 4NGHH 3PWJB 1BD2E 1KT2A 2AQ1A 4G6JH 2X4RA 5IJVA 4GQPH 1ZVSB 3V5DA 1J0HA 1EPFA 4P3WA 2XTJC 2DQTH 1AC0A 3D48R 4BA8A 3HC4H 1S5IH 1G9ML 3H7BA 2BJMH 3UZVB 5ECJE 4BQ6A 4YBQC 4WI9A 3QQ3B 1F97A 4WW2A 1V05A 4KMQA 3CXDL 5E4IA 1QHPA 2WIIA 4YXHL 2NCMA 3U9UB 4R4NC 2WQRA 4YPJA 4HAGA 1TPXB 4UNTA 2P8LB 3IJSB 1MI5D 2CLVB 3W5NA 3MBED 1U8NA 3O45A 4TSBL 4MD4A 5JO5A 43CAA 2Z8SA 1A7QH 4LP4A 1JRHL 3RRQA 3L5XL 4NO2A 1I7UB 5IESL 3GNML 3RVWC 5IFHL 5H2BB 3STZB 1CFQA 1RJYA 1WICA 2KL6A 1G7LA 1T5XB 3MCKB 1IGIH 4POZC 4UV4H 2BVQA 4JQIL 1OCWH 5CFHA 1J86A 3N1QC 2Z31D 2VRAA 1FVDA 5ABDE 3SQBA 4PV8B 1S78C 1FZMB 4LLMA 1HSBB 1G0YR 1AQDB 3R4DA 1JBJA 1CXHA 3MBEB 1R5IA 3VMOA 2Y36H 4OCWH 5B3JF 1RHHA 4KK9C 5F97E 3DIFA 4Y4KD 4JHWL 3OKDA 1GZQA 1RZKL 3CNKA 2Y5TB 3ZSSA 1UJTA 1AR1D 1RFDL 1H15A 3CMOL 4V1DD 3SE4A 3O6FC 4X6CE 5IT2L 1T03H 1JN6B 4U1IA 4G9FE 1IKFL 1CTNA 3OHXB 2Z31B 1CVRA 4X6DF 3WIHL 2NY2C 2HLFD 1J1PH 4LMQE 4F7TA 5B39B 1FC2D 3T2NL 2IANE 4BQBA 5KSBE 1GC1H 5CINL 5I1AA 3O6MH 5FDWB 4P5KB 3WYRA 1YMME 4LQFH 3PV6B 5K9JL 1IAOA 1MQKH 3C6SB 4Y4KB 3QXUA 5EOCL 5CZVH 1OAQL 1OGTA 2X9XA 2AP2A 4PJGE 2FO4B 4V1DB 3KYMB 2ZUUA 1NEZB 2F19L 2OL3B 4FNLL 1INEH 4JFEE 4OZFG 3KPRA 5DEGA 5GHWH 2NTSP 4XPBL 4XCNB 1S8DA 4P4RA 2ZOKA 1G9NL 1ZWIA 4S1DC 12E8L 2XT1B 3MOAL 2DQDL 2CKBA 4JZNB 1F3DH 2EKSA 1CE1L 1P9MC 3OKLB 1XIWA 4RA3A 5JNYB 3WE6A 3WFDL 1IE5A 1JTPA 1FG9C 4OIAA 5J3HC 2H41A 1T0NB 3UTTD 1MAJA 5D6CB 3BN3B 4G8EA 1DLFL 4OZHF 4OT1H 4M7JH 4UDUA 3OGCA 4F37F 2XXCB 3VWKA 1XF3A 2GQHA 3UJIL 3S4SG 2H8PB 4N0UA 3SKJH 4FXKA 2ZG2A 2VLLA 4KRNA 1QFWI 4UNUA 3GIZH 2YD2A 4GW1B 2BSTA 1FBIH 2YEZB 2Y06L 3DHMA 1K8DA 3M1BA 3PQYD 4KHXL 4U4BA 4P3DA 4WEBL 1DLHA 2PYED 2WANA 3QDGE 1H3PL 4MA8L 4TVPD 1TCRB 3QDJD 2OBGA 5EFIB 3UTTB 3RWCB 1MCWM 5TFSL 4E0RB 3LKRA 2AW2A 3X12B 3VGAC 3KG5A 4BFGA 1EUTA 1GHFH 2WP3O 1N3NB 4MWFB 2A9NL 2G75B 5KZCD 1AFVH 5DUBB 1ERNA 1I1YB 2ZWLT 5EH1A 1DQLL 5F7NC 4YHNB 4YIQB 4KV5F 3RAJL 2BNRE 3LS5L 2W92A 5DD0L 5JUEH 4NYLB 2VISB 2HRPL 4JPVH 4JY4A 4PJ7F 3ECBB 4QCIB 3SJVA 4NM8L 5EIVA 1A5FL 1F45A 3IT8D 4FN0A 3RPIA 4NKMA 4YPGB 4GRLD 2PYEB 5J1AA 1N5YL 1JZ4A 3NCEB 4OLUH 2AGJL 1B4RA 4PBXA 4W6YB 4X98A 1S9YB 5ELIA 4ZAKC 5T1LD 3EHBC 1C16B 1D6VL 4MSWA 1IM9A 2GITA 2OM5A 3ARYA 3UJTL 5KZCB 4HIIB 2N7BA 1JPST 1PAMA 4PB0L 4O5LL 1MFCH 1BJMA 1REIA 3VWJA 4LIQL 2DKUA 5KOVC 5HYSB 2K3TA 4TVPL 3ALPA 4PJ5E 5AYUH 5DD6A 2NY3C 3NA9L 2FO1A 4ODHL 3B4NA 3IDIA 4HH9B 5AAMA 4EI5C 4GRLB 3TFKC 4HK0B 3FT4A 3JV0A 3U0PB 3HMWH 1F6AA 4F3FA 2VDOH 2APWA 4Z7UB 5T1LB 4LHUG 5LKNA 2XI9A 1D5ZB 5FIEA 4MD0B 3SO5A 2VIRB 5IGXL 4KGJA 2A6KA 4IRJC 2WW8A 2H3NB 2VZ1A 1HK6A 3RI5F 5L9DH 5SX5K 5F9OH 1I9JL 1NAMA 2IPUK 3SO3B 2DQFB 4CVZB 3OL2A 5GIRA 3CJJA 4I3RL 5KBNC 3WV0A 1J11A 1F02I 2HP4A 3ZE1E 3V6BR 4K8RH 3ARXA 3RY6A 2F53D 2NTFB 5KW9L 1IZJA 3NGBC 4L29B 1QSED 4XVJH 5A3ID 1BFSA 2DD8L 2X10A 4LLQB 5SX4I 3STBA 3C8KA 3VFMB 5D1XC 4PRDB 3ME0A 2LV4A 3O8XC 1DQJB 1X5HA 1F4XL 2IEPA 3KWWB 2XZAL 3P77A 1JYWA 4O2CB 1K8IA 3ZDXE 5ICXB 1HSAA 4JRYD 1IGML 3KXFD 1FAKT 2BSSA 4QYOA 2WIMA 5I18L 3MRDB 3RVTD 1UH3A 3UCRA 4PJDB 3SKUD 2Q76A 2F53B 4HFWB 3MLWL 2B20A 3WKML 3OXSB 3UYOD 2OLDA 4Z76A 2R0ZH 3CUPB 4QRRE 3UPAA 2XZQH 3OPZL 1QSEB 4I48B 1FG2B 2AI0L 5BV7H 1OTTD 4ORGB 1A6AA 4HUVA 2EE3A 3DV6B 2CIIA 3BH8A 1A47A 3GI9L 1YUHB 3HZMA 3QHZH 3P9WB 43C9A 5HVHB 2ZNWA 1NJ9A 4WGVB 2VC2L 1SYVB 1T66D 4JRYB 1G6RH 1OWRM 1EGJH 4PRHE 5BXFB 2P5WD 4LCUA 4GUPA 1B4JL 2I5YL 1JFQH 3WFZA 1SVCP 1F13A 4DK3A 1FIGL 2QHLA 4X5LA 5EO0B 4XC3H 4HLJA 4ZO6A 4IMLA 1ZSDA 3QDME 5EZOL 4DWHA 3QUXC 1FVCA 1M4KA 4KPHL 4PJEF 3DTXA 4B41A 2Q8AL 5DRNA 2BNQA 2NZIA 5L2JA 4XZUA 1DQTA 3U4BL 1KIQB 4WW1B 2H32A 3WNLA 4ZUUB 2XWJA 5FYKH 5C0FB 4PJCA 2A73B 3M8OH 4EXKA 1N59A 1GAFH 4XB8A 5IB2B 3AM8C 2P5WB 2M1KA 4Z77B 2I60L 3G6JF 5I1IL 2X1QA 4NQDE 2DIBA 3HCVA 4NN7B 2KQMA 1R3HB 1YPZA 5FFLA 3BKML 3VXSA 3SDAD 4BM7A 2DB8A 3BQUB 3BKYL 3LKNB 4LSVH 4QRUB 3EJYC 4NN5C 3HLAB 3MSPA 4ODWA 4XCCL 5T5FH 5ANMA 2DRUA 4R6UA 4FA8A 3T0VA 3NACH 2IPKA 1K5NB 2EXWD 3MYZA 4OLXL 5DZLA 4MQSB 3O6LL 5CJOL 4LDOB 2ADIB 1TJHL 3EO9L 2Y72A 4GKOA 5EOQH 2GUOA 1G7IB 2F15A 3GMPB 4YDLB 4GRMA 2O5XH 5ADOL 1DSFH 4P46D 3MRLA 5HDQL 5EIQA 3BAEH 1S7VA 3SDAB 2X4SB 1IEBB 1FFNA 4NO0A 1IC1A 5E00B 4XRCA 2DQJL 2WWKO 4MAYA 4A6YH 4FQIH 4U1SA 3PIQB 3MV7A 5LWYL 2V9QA 4BSVB 1UQSB 2HVJA 2J5LC 1J0IA 4JO4L 3VFWA 4IRSD 1NFIA 2QBWA 2DWDB 5AEAA 4H1LB 4Z0XB 2QQLL 4YNYB 4YC2B 5IFAH 2EDJA 1ZT4B 1JK8A 5JLZA 3VRIA 4PTTB 2IGFL 4P46B 4NRXA 4B7IA 2WUCH 3ZHDA 4OQ1A 2CGRH 2C3VA 1P1ZA 3UC0H 2HN7A 5KSAD 2A77L 3QXAB 4JZOA 2KH2B 3H42L 4Y1AD 4OCMC 3RDTA 3JTSB 3FQWA 3K4ZA 4IRSB 4NZDA 3MLUL 2E7LC 1IEHA 3PGFH 3QJHA 4PJXB 3T0BA 3JUZA 4ODUB 1KB9J 4KMTH 3EJZD 4JFHE 2GSIA 3OAZH 1KENH 3GGWA 1DR9A 1JUFB 4F9PA 1R3LA 4OV5B 2HG5A 1RK0B 1Y6MR 3IS1X 2W9DH 4MCZB 4AL8L 4DTGH 2IAMA 2IQAB 5J9PA 4QXGL 3U46A 1WV7T 5D2LA 5KSAB 3P30L 2D31A 1U2HA 3ZKMC 4J1UA 5CLWA 4Y89A 5AUMA 2JJSC 4PYHA 4Y1AB 1NEUA 5FOBA 4WI5A 2R0LH 1INQA 1KYOJ 3NTCL 3VFVA 5B3JE 2XTLA 3VG9C 1XZ0B 3O3DB 1WBXA 4X4XA 1KTLB 3WFHB 4LSTL 4OM1L 1YA5A 1J7VR 1YEJH 4NQSA 5AZEL 3WO4B 1PQZB 5DHVB 3AB0C 5DR5L 4HLZH 4KK6D 4JFPA 1JGEB 1M7IB 1MFAL 4X99B 3MZGB 3D69A 4X6DE 4CMHB 1F58L 2FEEI 4WDIB 4PRNB 1IKNC 3RZCD 2NXZD 1UA6H 2CQVA 5IMLA 4U0RC 5JQ6L 2DM2A 4P3CH 5D2NC 2GJZB 4GG6F 3S37L 1AH1A 1N5AA 1CDIA 1GCFA 4KRPD 5EULV 3MODH 3NFNB 1B90A 1T5WB 2XA8L 5MERB 4NN6B 5LAXB 3PDOA 1CFBA 3BPCA 5DHYA 3X3FH 2XQBL 4HULB 4X6BA 3TIEA 3RZCB 4KTDH 5E2VL 3JUYA 1JGUH 4N1HB 2MKLC 3ESVF 4QY8B 3REWB 3RGVA 1BVKA 2VDKL 5C0JA 3FQNA 3CLEH 1SY6H 2DDQL 4UMGA 2H6PA 4M02A 2R4SH 1BF8A 4F7MA 4PGJA 1KN2H 1DFBL 4N9GB 4B7LA 4OZHE 1QLRA 3K74B 4WHTB 4Y5XC 1PSKH 1BECA 5HPMA 5IQ7H 3NABL 1F3JA 1U8MA 1X9QA 3UROR 2LVCA 1YEDB 3P0VH 3R0MA 1GH7A 1GIGH 3DX8A 5D93B 1FSKC 2DBLH 2OTWA 5FA3B 1AC6A 5HI4D 4TVSa 1RURL 2AJSL 2JTDA 3ARFD 4O9HH 4PGDB 4YFLF 1W8OA 1FL6A 4PY8J 1AGEA 4RA0C 3L3KA 1WC7B 4K3GA 5DYOA 1U8HA 1XGRB 4RFNC 3L3JB 3TYFA 1MCWW 3RWIB 1TNMA 5HSFA 4KV5E 1D5BA 1FJ1A 4JDVB 4H20L 1YYMH 5TPWL 4JJHA 1FORH 1Q0YL 4PJ7E 1NDMB 2NLJA 1KIRA 1QRND 3V4PH 2XOTA 3IRZA 5K9KB 5E8OB 1OAZH 5BW7A 2CLZB 2NMSA 4WUUE 1MFDL 1QSFE 4U1HA 4DGVL 2ZG3A 3PNWA 4DEPC 1MCCA 4ZS6D 3FZUD 1DZBA 1SHMA 3E2HC 4S2SA 5TQ0L 1L6ZA 4X6FA 4UUJB 3CH1B 4UOW1 2B4CL 4M1GL 3MNZB 2PW2A 1P4IL 3LQAH 5TDPB 3IFPA 1JGVL 5L6YH 2XZCH 3LV3A 4UOW0 5D7IA 3FT2B 5BS0B 2CDFA 1QRNB 4NKIL 1PJ9A 3QIUA 2IPTL 5JDJA 5CJQH 1JRHI 4M1DL 3BN9C 1A4KB 3V0VA 3UYRL 1XGPA 4X7CC 1HIML 3UYPA 1CDGA 2HTKD 5F1IA 1DBAL 4QRTB 3B9KC 2X89A 2D0FA 3WDIA 3VXMA 1M6OA 5I1CL 1CL7L 2DTML 1YZZA 3L95B 1F3RB 3O2WL 4DGIL 1X5ZA 5BZWA 5FXCH 3BP7A 3MRQB 4JDTH 1HQRB 2EE6A 5DWUL 4QHNA 2IJ0C 5CEYB 1T0MB 4L4JA 5FKPA 1MEXL 3G5ZB 2XTJD 1DBML 3WCYA 1JZ7A 5EBMA 2VKXA 2VSDA 4ZXBC 3TO2A 1U91B 1RK1B 5MENE 2EIEA 2UUDK 1QA9A 3OXRB 5CHNB 5EWIL 1IL1B 3P73B 4D0DB 4JZJC 1TQCB 1CLCA 4ALAH 5GGTH 2PCPA 1QKZL 1C5CL 3OKYA 3J7HA 1MCPL 1K3ZA 4R4ND 1T6WA 3FFDB 4RISH 5M7QA 2X7LA 5J06A 2HH0L 1OARH 2IBZX 3QDAA 1A1OA 2C4FT 1D3CA 1OSZA 4UV7L 5ISZA 1ONQA 2BVTA 4PJ9A 4P5TD 3TV3H 2B39A 1YYLL 3RWFB 3V4VH 1G1CA 3ARZA 1UKTA 1DCLA 1BM3H 4NBXB 4WEUD 4ZFOA 3DUUA 3RVWD 3HAEH 3BKJL 3WJLA 5I1KL 5B21A 1VB9A 1QBBA 2VLRE 1F4AA 4POZD 1JNLH 3AU1B 1CLZH 1FHGA 1T0PB 1Y0LA 4F7PA 2K7PA 1JI2A 2MKWA 1U3HC 2RR3A 3AFLA 1S78D 4ZPVB 1TQBB 5ENWA 1JPTL 5EUOA 3GI8H 1D9KC 4ZTPH 2C3WA 4P5TB 2JF1A 4K23H 4F8QA 4YXLL 4D0BA 3H9SE 4OB5H 1CYGA 3QG7L 4KK9D 2YN3A 3VXTA 1T89C 3DSFH 1OSPL 4HUUB 1OQXA 4HXBL 3KPSA 1ZLUK 4GSDL 4RFOL 5FYLE 3O6FD 4ELMA 1HZHL 3FN9A 3Q5TA 4PJEE 5IBLD 3SE3A 4A2MA 4M03A 2H26B 3VMNA 5AG8A 3BH9A 2NY2D 3MXVL 3V6FA 4HK3J 4Z18A 3BZFA 1E6OL 5IR1B 3QQ4A 3R06A 3MRIA 5C09D 5T3XH 2DICA 4PRPE 4NWTL 1J0ZA 3U30B 3G6JE 1T1ZA 1TTFA 3MGAA 4U7SA 3EAKA 1FNEA 4NJAH 3QJFB 1ZHNA 5BVJB 1CK0H 2FATH 2PO6A 5DJ6B 4NT6A 1NQBA 1ZLVH 4QHLB 4JY6A 3RX8A 5DTFA 4K3HA 4XPAL 4OCLC 4P2OA 1PW3A 4JJ5A 4KVNH 1Q9LA 1WFUA 3O9WA 2NY2B 4S1DD 3F8UB 2VERN 3HRPA 4YHOH 3V6OA 4C56D 1EH9A 4WI6A 2K1MA 4LEXL 5H37H 1RU9L 2BSRB 4U2ZA 4GW5B 1JZ3A 1MCOL 3UAJD 5I8EA 4Y4HA 2MSPA 1LQSR 5F1KC 3CFCH 5I19H 5D72H 1OF2B 3TVMB 5I1LA 3S3PA 2M2DA 4XBGB 3KYKH 2IAND 4XT1C 5D5MA 2VO5A 3DVGA 4MD5B 4TUOA 2AKRA 3BSZH 3V0AC 4EEEA 2CR6A 1LVEA 2GHWB 1NC4D 4JKLA 3LS4L 3NCFB 4FQLH 4C56B 4JR9H 3NN8A 5C07E 1V7NH 4FZ8L 1CDCA 5HHPB 4E41E 5CBAB 3GMNB 3HR5A 4UZGA 2R29H 2IANB 3QWOB 4P59H 4PUBL 2FX9L 1MJJB 3HI6L 4JO1H 5GGRA 3W0WA 2I9TB 3QEGL 4JRWA 4P9ML 4H8WC 4DKDC 2QQKL 4HWBH 2W0LA 2ED9A 3QUMA 3KJ4C 2WWMC 1ZS8A 1NC4B 3PGDA 2VH5H 3VI3E 4G3YH 1GGYA 3E3QE 1V5JA 1BQHG 4TRPL 4JFEB 3BD4A 1TCMA 4XWOD 2R4RH 4G9DA 2JKXA 3HI1B 4I4WA 3NA4A 4LGPB 3MGOB 1BFOB 2F5BH 4LLYA 2NYYC 4POYA 2DN7A 5GISH 4NRZA 4AH2A 3DMMC 3VGAB 5E2WH 4TSAL 4GJTB 2AXJA 1PG7W 3Q2CA 2DWEA 4MCYB 5DDHA 3A6OA 1CT8A 3HC0B 1MRFL 2DYPD 1I1FB 1OAXH 5KSVA 3CSYA 1MHEA 3WNNA 2ZCKL 2NY3D 1U8OB 4IS6B 2W59A 4MJ6A 1Z6JT 4EI5D 1MSPA 3TFKD 3L5WA 4HHAB 5HYJE 4FFZH 2CO7B 2VLJD 3T8XB 1BIIB 4OFDA 2HJFA 4DAGL 3VCLA 5HBBA 1UT9A 1TJGH 5JMRA 2BNUA 4LNRA 4PGBA 3QDGB 4WTWA 4NZTH 4IRJD 5KN5A 2NY5C 3ALXA 4HSQA 3HTLX 1E4KC 5F7UA 4U6YB 2DYPB 5DJZB 3FOMA 2F74A 4MNHA 4N5UA 1FO0H 4D2NA 2IWGA 2PXYB 5DRXB 5IF0B 1I85A 2FIKB 1CZ8H 4XBPA 5JORA 1VFUA 1FCCA 3PWJA 1ZLWK 3MBXH 2VLJB 4ZD3H 2AJYL 3HA0A 1ZVSA 2L7JA 3CIQA 5LBSL 3GRWH 1CICC <