1OARH

Fv ige spe-7 in complex with alizarin red
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 122
sequence length 122
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oarH00
1NMCC 1ZHLA 1NMAH 3PABA 3BRDA 4Y5XC 6FABH 1KIQA 1M7IB 4OQTH 5KSVA 3TYFA 4Y5XA 4IJ3B 2EEDA 2H1PL 1LP9F 1KN4L 3DV4B 3IDUA 4JG0H 3QEQB 5ADPL 3K0WA 4MCZB 5C0FA 4WWKB 3MGOB 1OSPL 4QRPD 1K5NB 4Z8FL 1DEEA 1HHHB 4QRSB 2CXKA 5GRJH 4Z78A 1G9NL 4WUUA 3MOQA 4QRPA 4G5ZL 3MLYH 5D8JH 5BS0D 5DK3A 4RFNC 3D9AH 5HYSB 2F54B 2EDHA 3JWDH 3WS6C 3P4MA 5FCSH 4LSVH 3DJ9A 5E99L 4ISVA 3DYMA 2VABA 2WUBH 3S4SA 5JNYA 3C5ZB 4L29B 3STBA 2W59A 3WS6A 3IKCA 4TUJB 2PCPA 1I3GH 4HH8A 4AT6A 3O6FD 4G6AC 4PJGE 3VFRB 1RUPL 2DM7A 5DSCA 4YXKH 3O6FC 5E24E 2VIRA 1RZIB 1YEEH 1CD1B 2CIKB 3HI5H 3HC4H 2C4XA 3O6FA 5E94A 5I73C 5LXGH 1ZWIB 2VXUL 4QHKJ 3LB6C 1FGNL 3SKMA 2EH7L 3GIZH 3BPNC 5I1EH 3NAAL 4POZD 1OP3H 12E8L 4FQPA 4FABL 1WF5A 4Z7VF 1WK0A 5C8JB 4ZTOL 1NGXA 4I8DA 5I1LA 3OKOB 4YHPA 1F2XK 4I1NB 3TBYB 4U1SA 1HHJB 4WRLA 5D2NC 4OSUH 5I1CH 2J12B 5F7EL 1PKQE 3C6SB 1BBJA 4R4BA 4LRIC 3IFLH 5D2NA 4JFYA 1AR1D 1XIWB 2DQEH 4E42B 3AREC 4M7LH 3MNWA 4V1DD 3BQUC 4LRIA 5HHOD 3KYOB 3NCCB 5EU6A 2CGRL 2DBLL 2WSKA 1XGRB 3B5GA 1VEPA 3AREA 4LPCA 3S9DB 3BQUA 2DQIL 2OTUB 3GSNA 4MJIB 2XIDA 2NNAA 1I8MB 4HLZG 5E1AB 2A6IB 4FQ1H 4ZTPL 1VADA 4AG4H 4Z18A 3O3BB 4KXZI 3GB7A 1WTGT 4QNPE 1HINL 3OHXA 3WFDL 1E4XL 1MCCA 3DBXB 4JO3H 3JTTB 1A3LH 4PJIE 4YEEA 4ZO8A 5IBTH 1P4IH 4EIGB 5HGHA 1AHWB 1AY1L 1LD9B 1MNUH 3FB8A 4LLYB 1VPOL 5EOTB 2NY0D 2Y5TA 3GK8H 4FHBD 1W8NA 2NY0C 4HWEH 1PBYA 1AXTL 4L3EA 4XPFL 3PWLB 4J7RA 4O58H 3IVKB 3HFMH 1F02I 4BQ6A 4NNXB 4MWFB 4GAYB 4LF3B 4KJPD 4O2CA 4GJTB 4ODWA 2UVEA 3W82A 3QQ9D 4DKFH 3GSOA 3MRNB 4OCYL 1MIEL 4X5XA 2IAMB 4NQSB 3EYUH 4FRWA 2ZCHH 4ZFFB 3OGCB 3RPIA 3FHQA 4UQ2A 4IJ3C 3I50H 3KWWB 1S5IL 3FB6B 3QEQD 1M7IA 3KYNB 3P9LB 1XF3A 4JLRB 5C0IB 3WO4B 1I7TB 4OTXH 2G2RB 3PGFL 4WWKC 1NLDH 3DV4A 2OTWB 2AJVL 1GYAA 4Y7MA 4MCZA 4PRIB 4WWKA 3MGOA 4MA7H 4QRSA 3N06B 4XPAH 3KJ6H 3OMZA 3MLUL 2OK0L 2F54D 3DGGB 4GRWB 2KL6A 4MS8C 5E2WL 4KV5F 1QSZA 3EYVB 4J3UA 4R3SB 2NY2B 1MCOH 5C08B 5CSGA 3C5ZD 4I0PB 5HYSA 3EDJA 2F54A 4O4YL 2DL2A 2O5ZH 4NC1E 3MCKA 4ALAH 5L7XL 3I2CH 2A38A 5IK3A 4XP1H 1EDQA 1YNKL 1RU9H 32C2A 4TUJA 4AL8L 3ARYA 3IRPX 4G9FE 3VFRA 1ZSDB 4P3DB 3V95A 1Z9OA 4A6YL 5GS3A 1CD1A 4M8VA 3VXUE 2D7TL 5JW3H 2R0KH 4BM7A 4IRSB 3OWEA 2VSDA 1G7IB 3QZWB 1KJ2B 4M6OL 4H0HB 1QUNA 2X4NB 3SGEI 5C0ND 1TTUA 1JRHL 4YX2L 5IB1A 3PWJB 4JVPA 3MV11 4PJ7E 3OKOA 3TBYA 3W5NA 4PGDA 5T1LB 1RZJH 3QG7L 1PG7W 1XIWD 2ZSWB 3NIDE 4KFZC 1U3ZA 4H26A 2FJGA 4FQXD 2V5TA 4E42A 2DI9A 4LHUD 5HDQL 3WLBB 4P46D 2DN7A 3K8KA 3MLPA 2ED7A 35C8L 1JGVH 3EOTH 2OTUA 3RIFF 4MJIA 1U42A 5CCKL 1I8MA 1IFHL 1WZ1L 2VLKB 3UTZB 1NC2A 5E1AA 2ZUYA 3E3QE 1DDHB 4W70A 1Q72L 1YNLL 3ZL4L 4OLZL 2YD2A 4WV1B 1P53A 1NCNA 3QDMA 3DBXA 4M02A 1EIBA 1MFEH 1BD2E 1AHWC 1BZQK 1NGQH 4LBEA 3IGAB 1MEXL 4KJYA 4Q2ZB 4RFEA 3FJTA 1AHWA 2L7JA 3N85L 1LD9A 1ZA6A 4JN2B 3VU2A 1BGXL 5EOTA 1OAUH 3IJYA 4Q97A 1JUFA 3TGXA 4M03A 3C8KA 4ODXB 1BQSA 2IALB 4NJ9H 5KS9F 3PWLA 4WU7B 1EH9A 3IETA 3QBTB 4C56B 4NNXA 3ORJA 1U8LA 2E9JA 4MWFA 4LF3A 4DGYH 1GZQB 3MA7B 3PDOB 5EOCJ 3ZE1F 2IAMC 3CSYB 4J3OC 2H26B 3IAGC 3BXNB 1FLRH 3WNKA 3GKZA 5F6IC 2DQUL 4M3JA 1FFNB 2IAMA 2VXVH 4NQSA 1MY7A 1OHQA 4K7PX 2FLRT 5T3ZH 4WWID 5IBUB 4FTVB 3O2DH 2CDFA 4ZFFA 3SGEH 1MJ7L 4PRBB 3KWWA 1CL7I 5EU7E 3FB6A 1XH3B 3KYNA 4HCRH 3G5ZA 4JLRA 5C0IA 1V3JA 1L7TL 3HZYB 1MWAH 5IHBA 4N1EA 4UMGA 3PWVA 4GMSH 2OTWA 2AI0L 4PRIA 2JK5B 1KEML 4PJCE 2W9EL 4FMKA 5C08D 3SE8L 4NZRL 2OI9B 2VLLB 4I0PD 2NY2C 4OF3A 2GI7A 4I0PC 4L4VB 5D5MB 1OLZA 3SDXB 4XHQA 3EYVA 5IVXB 1CF8H 1FCCA 5C08A 3RDTB 4JY5H 4PJ5B 4I0PA 3QHZH 1QBML 3AS1A 3MRLB 1OLLA 1S7TB 3T0EB 3TFKC 3BWAA 4J6RH 1ZSDA 2AEWA 1CFSB 1AGDB 1TJHL 2VLRB 1YJDL 4ONFH 4OQTA 4IRSC 1B3JA 1A1NB 1X4YA 3S36X 4AIOA 5GZOC 3B9AA 1R5WB 4IRSA 2YRLA 4TPRH 3F6LA 4ZFZB 1VFMA 3U1SH 1G7IA 3G5YA 4S2SB 1RK0B 4YDKH 3BMVA 2X4NA 4JDTL 3GM0A 1DVFB 4YDIL 1V7NH 3UZEA 5T1LA 4KRNA 1INQB 1O7SA 1SBSH 4NBYB 3PIQB 5FOJA 4FXLA 4PFEA 4UTBH 2P8MB 4UAOB 4MQ7A 3L3JB 4WI9A 1VERA 3DHMA 2A74B 5TDNB 1K4CB 4YHOL 4HPOH 4QXTB 5E8OB 3WLBA 2IFFH 4MLSA 1I8IB 4IOFC 1ZHNB 2VLKD 2ADJB 1JHTB 4JZJC 2FO1A 4P4RA 3CK0L 3RY6C 2IADB 1JCKA 4DW2H 4JZJA 2VLKA 1OD7A 4OJFH 4WCYL 3RY6A 2GT9B 1DDHA 3K81A 3S98A 3QT2A 3C5JA 4Q9RL 1MCSA 4UNUA 1D5ZB 2YD9A 2X9YA 3FRPA 1AP2B 5ADOH 3IGAA 1OTUC 1F4YH 2XNAB 1KPUB 3MRHB 5F9OL 4LAQL 2XV6B 4ZUTB 4JN2A 2NXYB 5T1MA 2X89A 1LEKB 1T20B 2IGFL 1EJ6A 4MA1C 4MQXC 4ODXA 4IRJB 4F7CB 4QXGL 1KYOJ 3MUHL 4ZNEA 2YPLE 2ARWA 4C56A 4PP1D 3LPFA 2JB5L 3OGOE 1NC4D 3MCG1 1GZQA 3PDOA 4FTVD 2HYMA 2H26A 4LDEB 5JOFB 4FZEL 1FFNA 1H9VA 4FTVA 1F97A 4KH2A 4NKDB 5A3IC 3TJHC 2YD3A 1FRGH 3FT3B 2YN3A 1NCDH 3L3KA 2XKNB 2ZOKB 1XH3A 1RURL 5C09B 3HZYA 4UT9H 4AEIL 4JCMA 4GBXC 4RZCB 2F8VA 4TSAH 5F7FA 1ZVSB 3PV6B 3LRSA 2OI9C 4QTHB 3REWB 2C3WA 2RB8A 2JK5A 1DE4B 2BVQB 4L4VD 4OGYL 4ZAKB 3MJGX 1P4BL 1MF2H 1DQLH 4LRNH 3RDTD 4PJ5D 3VFPA 4ZO9A 1GGIH 5D5MA 1OTTD 4HIHB 4OF0A 5FYLH 4M93B 3VFOB 3SDXA 5JR1H 5IVXA 1U8OB 3MQIA 4LASL 4PJ5A 4Z0XB 4RGMB 3T0ED 4G6JH 4GO6B 1JPTL 1EO8H 1U8MB 2E7BA 3X3GH 1S7TA 2VLRD 1B4JL 3FQTA 3UXFA 4PJXA 1OM3L 3L5JA 4YFLF 1E4KC 1N4XH 5MENE 1CFSA 3IAQA 2VLRA 3LHPH 1E4KA 2EZ0D 4G7YH 1LO2H 3GMLB 3NFSH 4S0TD 5IEKB 3ZKXB 3VXPB 3GSQB 1X4XA 3CGTA 3R06B 4PG2C 3WEXA 4S2SA 1RK0A 1DVFC 1BX2B 5I1HL 4TULH 2HKFL 4PG2A 3CSPA 3OG6B 1DVFA 4UAOC 1INQA 3DO3A 4LGPB 5CMAB 2P8MA 1JZ5A 3L3JA 5F3HA 2A74A 2D0HA 3JWOH 3H3BC 2PW1A 2CK2A 1K4CA 2YPKB 4DFIA 2CRYA 4M7LT 2ZCLH 4HZLB 2YA0A 4EJ1C 5E8OA 5F1NB 1YEFH 1OP9A 2FCBA 1ZHNA 3H0TB 2VXTH 4RFOH 3BKYH 4B5EA 2ADJA 4GXVH 4YLQT 2IADA 5TFSL 2DQGL 2WWKT 4Y4HB 4UNTA 4EEEA 2MNUA 2R4SH 3H7BB 2V2WB 3FQWB 2GT9A 4E5XA 3ARFB 1OGAE 2BFVL 4JVWA 2V5YA 1NCWL 5K9JL 4ZD3L 1D5ZA 5FAAA 5E8DH 3UYRL 3MGTA 1AP2A 2ZUTA 1T22B 2NXYD 5IT2L 2H2SC 1BOYA 3Q1SH 1CD0A 4IS6B 1KPUA 5ECJE 3MRHA 2RFXB 4IRJD 1ZLSH 5T3ZE 5DJ2B 4U2YA 2F5BL 1HYRC 4XC1L 4YE4L 4ZUTA 5C92A 2UZIL 4R4ND 3LRHA 1T20A 4DK3A 3GKWL 1XF5B 1OAKL 5IMLA 5K59E 1CFTB 1FIGL 4WTZA 2ESVE 3DX7B 3BEVB 4ZYKB 4WI4A 1A22B 2Y06L 4F33B 3TT1H 3ARPA 1NSNL 4OUUA 5HJ3B 4LVHB 4BQCA 5C09D 4MA8H 4NKDA 2YMXH 3MJ7B 3ULUH 3VFGH 1ODAA 2OLDA 4LCUB 3HMXL 2XKNA 1QRKA 2ZOKA 4GFTB 3HZMB 4HJJL 4OLXH 4OI7A 5FO9B 1CGTA 1SEQL 4ZAKD 5EOQL 2X41A 1F58L 5DK2B 2YD6A 4ZAKC 4LLVA 2Y07L 4RZCA 3V4UL 3PV6A 1N8ZB 3MA9H 4QTHA 2I5YL 2BVQA 4ZAKA 4XPGH 1P6AB 3UJJH 3NA9H 2IQ9H 4R2GD 5ALCH 4W4NA 2DLHA 3IFPB 4RGMC 3J8F7 3DROA 1KLUA 3VFOA 4KPHL 3CDGB 3QQ3B 1ZKAA 1U8OA 4JHWL 5IEHA 3C8HA 4TVPL 4X8XA 5B38A 4JFFB 1KB5H 4E41E 1MH5A 5GRWA 2AEPH 1T7YA 3O2DA 5EZOL 1FAIH 3DLQR 2BSSB 3UDWC 4PJHE 2VZSA 1YPZE 5T5NF 4H8WC 3UDWA 4HCRA 3F7VB 4P59H 5CJOL 4KHTL 3ZKXC 2QADB 3LQZB 1CXLA 2VH5L 1JPGB 3GMLA 4UIKL 4D3CH 4U1KB 1HILB 2VTFA 4LCWA 4MD4B 3VXPA 3R06A 1CU4L 3IT8D 2UWEE 3D87B 1X6LA 2CMRL 2PUQT 5GGQL 3VD4A 3H3PH 5E0QA 5K9QG 4U1HB 1OAYL 3QDJE 5CMAA 3KPRA 5DR5L 1KPVA 1LO3H 4KK8D 4N0UB 3VI3F 2YPKA 4IDJL 5GSRB 2AEQH 4KGJA 3CPLB 4WY7H 4FXKB 5F1NA 3RVUD 4Z7QE 2YXFA 4H1LG 1KIRB 3VFVA 5T1DL 4U1JB 4Y4HD 1ZGLP 4R7DA 1G9MC 4KTEL 2R56L 3ARFD 3A6CH 1BZ9B 3ARFC 2DF3A 4AQOA 1FCGA 1LDPL 4C57C 1G9EA 3H7BA 1UJTA 4ZUWB 1EMTH 3OPZH 1Z3GH 3FQWA 3ARFA 3SEPA 1NUFA 4M5ZH 4UB0L 1ZEAL 3HRPA 3MMEB 5IJVB 3GSVB 4JFXA 5J7CC 2NR6D 2UVFA 4R4FL 3RY4A 5DZLA 4TNVK 4HGMA 2EDJA 4PJHA 4DTGH 2XN9E 2P5ED 4IS6A 2RFXA 1IAOB 3HR6A 1DBAL 1DUYB 1JZ7A 5DJ2A 2W9DL 3KYKH 3FTGB 3K2MC 4LARL 3BP6B 2VC2L 4F3FA 3HI6L 4NYLB 4PRNB 1XF5A 5H8DA 1MCPL 4WEMB 1BVKB 2E9BA 4BK4A 1HZHH 4AYFA 1HN1A 4ZYKA 3LKNA 5C0DA 4P0DA 3A6BL 1I1RA 3LS5L 4GSDH 2DQFB 5IFJA 2MHAB 3SKNA 3PWPE 1UJ3B 2GTZB 2NZIA 5FYLE 3EOAB 2ZG1A 1BAFL 1V7MH 3ALWA 2DLFL 1QO3B 3HZMA 5GSVB 4X83A 5FO9A 3D6GA 2LU4A 3WDIA 4LKXB 1A7OL 3CFCL 1N8ZA 3WFZA 2EC9T 4N5ED 1NFDE 5E8NB 4N5EC 4XVJH 3IFPA 4JFFD 1CLOH 2JE8A 3L9RB 3AMKA 4KVNH 3SCMD 1A21A 15C8H 3SJVE 3RWDB 2OSLA 3QRGH 1CGSH 1R3LB 3KYAA 2IC2A 4N1CA 4JFFA 2YA1A 3OAZK 1TZGH 1UM5L 2BHUA 2MQ3A 3IB4A 1IGIH 4JQVC 4PJ7F 2BSSA 2QADD 4EUPH 4JQVA 3NIDF 2QADC 1A4JB 4J1UA 1PG7X 1AR2A 2KDGA 4UI2A 1A9EB 2L4OA 2F19H 3F7VA 1UC6A 2VDOH 1B2WL 4D9QD 1JPGA 1TJGL 3G6JE 2VQ1B 4Z6AT 3QFJE 2GSIB 2C3VB 3TBSB 1KACB 4KRPB 1KJ3L 3GRWA 4M1CD 2DMCA 2Z8RA 2V17H 2YPVH 1FVCB 4L9DA 5JW4Q 1L7IH 3CXHJ 5FUZL 1I7RB 1IGFH 4GRWF 3OBAA 1VKXB 3P4NB 4NIKB 5E4EC 4OI8A 3IU3B 4N0UA 3RVWD 1KC5H 4DN4H 5GSRA 1BFVH 2NY1B 1IBGH 2AK4B 2Y7QA 2I24N 2I25N 3PWNA 3BH9B 4RWYH 2AVGA 1KIRA 4MNQE 3PP3H 2HJLB 2AJYL 5D9SB 5F1IB 5FOBB 4PB0H 1BZ9A 3W2DH 3WL9B 1KCSL 4Z7WA 2NY7L 4ZUWA 5MHSE 5J1SC 5IB4B 5EZIL 2AJUH 2C3HA 4ZUVB 1FO0B 1PYWB 3MMEA 4BSJA 5IFAL 4LCCC 4ELKA 4XVTL 1AFVL 3GSVA 5FIEA 2BDNH 2NX5B 4L5FH 1S7QB 4LCCA 3EIFA 3JV6B 1XGUA 1U58A 3JWOC 1SMAA 4UTAH 2GTWA 3SDYH 1NMBH 2DQJH 3B9VA 4EIZC 5DEGB 2QQNL 3FTGA 3ZHDA 3VG0L 3ULUE 1F4WH 5GS0C 3BP6A 4Q0XL 5KAQG 4NYLA 3FO1B 4FQJL 4PRNA 3WIIH 3CXDH 5I8CB 1BVKA 5I1IL 4DZ8B 2VZTA 3I02B 1ZLVK 3PP4L 1FNHA 3D69B 4G3YL 3RKDC 1F3JB 1NL0H 2DQFA 2MHAA 1E6OL 5DRXB 1KIPB 3CSGA 5HGAB 4AEEA 3WIHL 2YWZA 2GTZA 3EOAA 5LVEA 1F42A 4QGYA 2YA2A 2Z91A 4KC3B 2DLTA 4S1SH 5D1ZB 3RWIA 3U0WL 1QO3A 3DXAE 4HKJB 5GSVA 1A7PH 5EUOA 4LKXA 1MPAH 1G6RL 4PGCB 2H32H 2BVEA 1DBKH 4MNQA 1Q1JH 2WBWB 1NUNB 1KPRB 3T65A 3QCUH 4K7FB 1WAAE 3PQYE 4L8SB 4KQ4H 1G7HB 2DI8A 3BPCB 1H3PL 4PJBE 4MMXC 4W6YB 4NO5A 5E8NA 2MQCA 3L9RA 4YK4B 2F74A 4WHCA 1SJHB 5TF1H 1YQVH 3NH7H 3RWDA 2O5XL 1R3LA 5I1JH 3TT3L 4I3SL 2AQ2A 4MXVF 5CIPH 4NPYB 5F7MC 3OAUH 3AU1B 4QLRA 1BVLB 3ULUC 4XZUA 1PEWA 2AV1B 4UBDC 4I9WE 1A4JA 3MR9A 4RRPA 3SQBA 4IOIB 1A9EA 3FQUB 3L3DA 1QP1A 1CCZA 2VQ1A 5MEOA 1W0VB 5J8OA 4KRPC 4CU8A 2Y25A 2D31B 2GSIA 4TSCL 3TBSA 4AIZB 1QTYT 2P4AB 4NP4L 1J87A 1F4AA 3GJFH 1C5CL 4NQCD 5E2VH 2DQDH 1R24B 2PW2B 4GKZA 1FVCA 2Q20A 4PJEE 4FNLH 1I7RA 2NY1D 4UILH 1HH6B 4GLRI 3G6DH 5D5MF 3SDXF 3IU3A 5IVXF 1S7SB 3HUJB 2JF1A 2WV3A 2W38A 3WXVL 3VD3A 1MAML 4OB5H 2NTFB 2AK4A 4UUJB 3HE7D 3BH9A 1QSFE 4WO4D 2C3GA 5I0ZA 2HJLA 4PJXF 5D9SA 3CFEA 5I8OL 2FBJH 5F1IA 5FOBA 3IAPA 5M95B 3IRZA 3WL9A 4XTRD 3BKJL 1NANI 1F6LL 2E7MA 3RWJB 3B43A 5IB4A 5F96H 4YUEH 4YJZL 2CSPA 2OR9L 4I4WB 1FO0A 1TLKA 4P2OD 1HQ4B 4HS6A 3GSWB 1P69B 3MJ6A 5HHME 2NX5A 3L5WB 2C9AA 1S7QA 4L3AA 3JV6A 3UPCA 4C4KO 3GEWB 2CKBL 4JO4H 5FUCE 5BCAA 1DBJH 3QIBC 1VFOA 3OV6A 2DD8H 5FYJL 2VLMD 3DECA 3FO1A 2OX5A 1MI5B 2VDQL 2Z8SA 3QIBA 4XI5D 4XH2B 4DZ8A 3I02A 4UINH 3A67L 1BBDH 4DGVH 1EVTC 1F3JA 2BVPB 1BJMA 2E27L 4OFKA 5L2KE 5LGHH 5DRXA 5D1ZD 1UB6B 2H9GB 3BKCL 5FUOH 5GGRY 2CRMA 2XY2A 1PKQB 1IGCL 1IAIL 4YHKL 1S7XB 1F2QA 2HLAA 5I30L 4FFYH 1MLBB 4GLRH 4PGCA 4HUWB 1IAKA 1IKFH 2LTQB 4L8SC 5ALBH 3QUML 1LE9B 2BVUA 1DUZA 4K7FA 1HSBB 5DMIL 4GG6E 4L8SA 4YK4C 4P2CG 1G0XA 1GJIA 3BPCA 3TO4D 1RHHB 2IH1A 5GQBA 1PJ9A 4LSRL 4HFUH 3CMOH 1A3RH 1SJHA 3DUUB 4P49A 5I76B 3TN0C 4XNUL 1NANH 2VLJE 1JF6A 4QOKE 3AU1A 3TN0A 4XBGB 1BVLA 1T4KB 4M1GH 4Y4KB 1NAKH 5BRZD 2V6HA 5I1KL 1BLNB 1I7UB 5IMOB 3L5XL 3FRUB 3CXHK 3IXTB 1QLFB 2ICWJ 1HI6A 1EBPA 1GIGL 5C0GA 3WNOA 4IOIA 5CBAB 3FQUA 3O3EB 4MQSB 1QD0A 5EG6C 3ZE0F 2HT4C 2IQAA 1ADQL 1KN4H 2R1XB 5IB5A 2D31A 1MFAH 4U7SA 5ADPH 1EX0A 1JPSH 4I3RL 4AIZA 1QOKA 1SM3L 4BH7A 3KLSA 3Q3GB 1BQHG 4HS3B 2R8SH 2E8ZA 1R24A 2NLJB 2PF6A 1S5HA 1G9NH 4P5MB 5DQ9A 3KXFE 3S96B 1CICC 2P44B 2J88L 3FO0L 2NQCA 3HUJA 5CGYD 5EIVA 3SKUD 3MO1B 3GSUB 3OJDB 1CICA 2PYEB 2NTFA 5EUKB 3Q5TA 1UKTA 1WWAX 2AP2A 5GISH 2KKQA 5DFVD 1T2QH 1RUPH 3TBVB 1FH5H 5JA8B 2LQRA 3WFBL 2VXUH 1QRNE 3RWJA 3SPVB 2EH7H 5CFHA 1X7QB 3VRJB 3MLRL 5K59F 3KG5A 2EDDA 4I4WA 1MJ8H 12E8H 1HQ4A 4M61B 4FXGA 5IROC 4HC1A 3P4OA 3GSWA 2ATKB 4I2XE 5IROA 5DHVH 5DK0A 3U7YL 5IW1B 2EDRA 3GMOB 2OL3L 4HGWB 4HUNB 4ZO6A 4UOW1 4PD4K 5F7EH 4ONGL 2YD4A 3U79A 2VE6B 1MI5A 4JKKA 3IFNL 1VB9A 4H20H 2DBLH 2XZCH 4G6FB 1TNMA 4PRDB 1DQDL 2XWTB 4YIQB 5E1HB 3R8BB 1BJ1J 1SBBA 1ONQA 1UB6A 2H9GA 4NJAL 4ZTPH 4N90D 4HXAL 5H35B 2X4SB 1HINH 4X7CC 3ET9F 1S7XA 1REIA 2HFGH 1W2KT 2Q3ZA 4HUWA 4J3TA 1E0OB 1S7WB 4PBVC 3U36B 3KS0J 4J12A 1LE9A 4PJHF 2MPAH 4ZFOL 3LZFL 1P5VA 2GITA 1HSBA 1VCAA 4EQ3A 1NAMB 2QL1A 3VFNB 5A2JH 3GMNA 1RHHA 1AXTH 1XF4A 1WBXB 4HUMB 1N5AB 4XPFH 1OY3B 2ZZUT 4R90L 4LPTA 4QF1B 4WEUD 3DUUA 2OR8A 3SQOH 4P2RE 2E6JA 2F5AH 3T4YB 4M62H 4Y4KC 4ZUSB 4XBGA 1BD2B 5MERB 4OCYH 3CMGA 3H9SE 1T4KA 4MX7B 4Y4KA 3CUPA 2LVEA 4QRUB 5IFHL 1I7UA 1JFQL 5IMOA 4J4PC 4KKAD 1TVBA 1VFAB 1QLFA 3RBSA 5I15L 1Y6MR 3U7AA 5CBAA 3O3EA 3OXSA 4J4PA 1P7KB 4OKDA 2XICA 2H32A 3PGFH 5BV7H 2R1XA 4EXPX 2Y6SC 3TVMC 4FFVC 5KVDH 2J2ZA 2AJVH 2HA1A 3E6HB 3VGDA 4JJ5B 3Q3GA 3TVMA 3VRLE 4E0RB 4HS3A 5GPRA 3ZTJG 1NGYA 1U8IA 5F97E 2DIAA 4P5MA 1UM6L 4YDVA 3S96A 5EO0B 2IBGA 5E2WH 4KUCD 3TF7C 1LGVA 3BT2H 5KOMC 2DI7A 2D7PA 3TEUA 5GZND 1EAPB 3MO1A 3GSUA 2B5IB 3OJDA 4NKOA 4X8JA 4YDLB 2PYEA 4GG8B 1KENH 4YR6B 5EUKA 3MFFB 4F7EB 1YNKH 3G04B 3QUXB 4AL8H 4ZS6C 1WCBB 3TBVA 3O6LL 4A6YH 5CINL 2VOTA 1OAXL 1W72A 4ZUUA 1S8DB 4OGXH 1UWEL 2W1NA 4OZFB 2D7TH 4JDVA 3LS4H 1X7QA 1QKZL 3TCXA 3VRJA 5HYJB 5B21A 3IDGB 2YHGA 3WSQL 5BXFA 4XBPA 4YBLB 1MQKL 3NACL 4F37K 3DVIA 1IKNC 4G9FD 5JO5A 4RISL 3H9SA 3FOMA 1JRHH 4BZYA 4PRHE 2EXWC 4MA3B 1IKNA 4ODVL 1ZANH 4QCIB 1EEQA 3QG7H 5EBLB 5EPMB 3VXUD 3GMOA 5IW1A 4HGWA 2VMFA 3B8YA 3NA4A 1ETZB 4RAVA 4P5KB 1NCCL 5BMFH 3LV3A 2YK1L 3GSNL 4XMPL 4GW5B 4MD5B 5TH2B 4Q9QL 4XMKL 1Y0LA 1HIML 2AXGB 3BUTA 4PRDA 3RI5F 2EYTB 3BJLA 2XWTA 1ITBB 1LEIB 4Y19B 1IFHH 1L6ZA 3FB7A 4Z7WF 3EYSL 1U92A 5H35A 2X4SA 4YPGB 1N6QL 2IJ0C 3MCLL 4KI5E 4D9RE 5IESH 4R97B 4U7MA 1S7VB 4Z0BL 5F1OB 4XHJC 5DUML 2ICCA 5GGTA 3PGCB 3BYTA 1MEXH 3U36A 5I66B 2MSPA 5D1QB 5TE4L 5CP7B 5C3LD 5ERWA 1BGXH 5GRYA 4JGMA 2Y36H 1SMOA 5JDJA 5JLZB 3RUGE 2XWJB 2O26U 2AABH 2ZUQB 1WBXA 1XFPA 1R3JB 4QF1A 4NZDA 5JQ6H 1BD2D 4JFQA 3PGDA 3DVNB 1M71B 4LHUG 3T4YA 1F90L 5AEAA 2R2BB 1YC7A 5MERA 4MX7A 2QSTA 1QA9A 4QRUA 1DEDA 4N5UA 2APXA 1VFAA 4Y2DB 4CDGC 3ESVF 3AFLA 2BVYA 1J8HE 3C60B 1P7KA 2VQTA 4M7KH 1L7TH 1KUMA 1LVEA 5EUOF 2NW3A 2NMSA 2Y72A 2AI0H 4XPHL 3I6GB 1KT2A 3E6HA 4HPYH 3VGAB 1KEMH 1I4FA 2P5WB 4JJ5A 4WEBL 3RWHB 5BJTB 1MCDA 2VAAB 3SE8H 4NZRH 5EO9B 3UTTE 4NWTL 5EO0A 1EHLH 4YDLC 2B5IC 3V79C 4FQQA 1X5IA 1BREA 3LIZL 1QBMH 2BMKB 2FRGP 3QUXC 4GG8A 2CKNA 4YR6A 3MFFA 4F7EA 3G04A 3QUXA 1CK0L 3S5LG 1WCBA 3WBDA 2J8HA 4MB3A 1TJHH 3P30H 5HYJD 4U1GB 1YJDH 1YMMB 3S34L 3V4VH 3ULUF 5CP3A 2YD5A 3KPNB 1B4RA 2AEIT 3SDAD 4YBLC 1F3DJ 1H8OA 4XP5L 4PJDB 3DX8A 3VXME 5HYJA 4HUUB 2FYYB 5F3BB 4XT1C 5C07E 1HDMA 3DX6A 1EPFA 4JDTH 3DHJA 3QNYB 2X10A 5TF0A 1IILE 4YDIH 2NY6B 5F8RC 2HT3C 4QCIA 3MLVH 5EBLA 2RGSA 1ETZA 4FQHB 2RAMA 3GNML 4JG1H 3BE1H 3UPRB 2CRZA 5LQBL 4GW5A 4MD5A 5TH2A 4M1DL 1UXSB 3HG1B 1ZA3A 1HKLL 4X4XA 2AXGA 3FL7A 5JW4R 2IF7A 4XVUD 7FABH 2IG2L 4U6VH 3CK0H 1DCLA 5D6DC 4HAGA 1J0ZA 1LEIA 4Y19A 4EI6B 5J1TC 1IC4H 5D6DA 1AXSB 3CFDB 1U93B 3QZWG 4R97C 3MRRB 5IHLB 1HCVA 4LSUH 4P3CH 1CTNA 5B39A 1S7VA 2W07A 1DBMH 4U1IA 4S1QL 5D1QC 5CJBA 3BJ91 2O61B 4U6TA 2WWMD 5JW5B 3TA3D 5D1QA 5F9OH 2AQ1A 2F53E 4LAQH 5CP7A 5GHWL 1WIOA 2ZUQC 1TJIL 1JWUB 2IGFH 5JLZA 4U33A 3MREB 1GOFA 3LN9A 2XWJA 5C7XL 5SWZB 43C9B 1XGTB 4QXGH 4P2QE 1ULVA 1T80A 3DVNA 4KUZL 5FCUH 5LWYL 2JB5H 1I1YB 3BD3A 2UYLA 2X05A 4LMQE 3CFJB 1FGVL 3VXNA 2MTPA 1K3IA 5HI3D 4OIIL 3FB5B 4XAKE 1ZTXH 4FZEH 3WS3A 4Y2DC 2J8OA 4M9PA 3C60C 1LNUB 4YHML 4P5TB 4J3SA 4U1NA 4Y2DA 2BJML 4NRXB 3C60A 2ZG2A 4LLUA 4TN9A 3V0AC 2YPLD 1OTSD 2G5BA 1QFWI 1RURH 3MRDA 3T1FB 1OTSC 2P5WD 1KB9K 4NSKB 3WJLC 1CXEA 4L4TE 4JAMB 1JPST 1ITCA 2ESVB 3I6GA 3WJLA 5FV2A 2RCSL 3RL2B 2P5WA 2NY4B 3QJFB 4D9LH 1ZS8A 5BJTA 5DO2D 1XGYH 3SHSA 5EO9A 5T1KB 4C83A 3O4LB 3QHFL 2R23A 1ZLVH 3EDDA 4ZQKA 5KW9L 4LASH 1HHKB 4OF7A 1JPTH 1FFOB 4PUBL 1MRCL 5JPMA 3LN5B 1NMAL 6FABL 5GIRA 3CVHB 1B4JH 1A02N 1BPVA 2GSGB 4OQTL 2F53A 1OM3H 3BP5B 1DANU 5IKCB 1BECA 1J7VR 2F15A 3T2QA 4JG0L 5BV7C 4KMLB 5IQ9B 1YMMA 3LMJL 5K33A 5A40E 3KPNA 5DJ0A 4GW4B 2OQJB 4K8RD 2P8LB 1GRWA 1HSAB 4HUUA 1K6QH 4OFVA 3IF1B 1DR9A 3RGVB 5I1HH 3KPSB 1O5DT 2NY6C 2HKFH 3D9AL 5MEND 4U0QB 3G08B 3KPTA 2VSCA 2LFGA 4BFIB 4LSVL 4CNIA 1CXHA 1QLRB 3U46A 2YZ1A 2AJ3B 3VW3L 2D9CA 4FQHA 3F6IA 3HG1D 1TCMA 4YXKL 3UPRA 2R0LH 3FN0H 1ZOXA 3HUJF 4X9IA 4H25B 5EIQA 4HSQA 2AGJH 3DGCR 3HI5L 5GRUL 3TBWA 5LXGL 1UXSA 3HG1A 3QNXB 5I19H 1CDIA 3C6LC 1QFWH 2G75B 3VGFA 4LIQH 2UWEB 3TO2B 3V0WL 5TFSH 3C6LA 4Y1AB 2XTLA 1AXSA 1MCQA 1U93A 1TQCB 2BFVH 3VRIB 1NCWH 4ZD3H 3RWGB 1SY6A 5D7KE 4N8CH 2EDEA 1U2HA 4PTTA 4OSUL 5I1CL 4Z7NE 5E8PB 5IT2H 4X7FC 3T0BA 2O61A 4EN3B 1JI1A 2DQTL 3IFLL 1BIIB 4JRYE 1B6DA 4M7LL 3RGHA 4LP5A 4XC1H 4YE4H 3WIFB 1NFKA 2FL5B 2AKRB 1K8IB 1OGAD 3MREA 1AI1L 5GRXG 4L8BB 5SWZA 4JN1H 4XX1E 4OZGE 4MXQC 4OFYA 1G84A 3FFCE 43C9A 1XGTA 1U3JA 4R26H 5INCA 1OQOA 1I8KA 1FIGH 5C1MB 2A9NL 5FA4B 4POYA 1QFUH 5HHQA 1OQXA 1ZVHA 4WDIB 4ZOBA 3CFJA 5T3ZD 4LQ1A 4P5TD 1MRDL 1CTOA 1NSNH 3FB5A 3MLTA 4X6DE 2GK2A 3T2NH 1Q0XL 3KPQB 1A3LL 1GZPA 2XN9B 4JPVL 2HJFB 5IBTL 1P4IL 1II4E 1CXIA 4FP8L 4YXLH 2C1OB 1LK2B 2ESVD 1UENA 2YEZB 3I3DA 4HJJH 3T1FA 1IGJB 5E70A 4QY8A 2APWA 4NSKA 5F7DB 2NY4C 4JAMA 5I6XC 1T66C 3V4UH 2J6EH 1EHNA 5T1KD 4JFEE 2I5YH 4QT5B 4O58L 5IQ7H 3RL2A 1KF9B 1ND0A 3QJFA 3HFML 4CJ1A 1JIBA 3O4LA 1N3NB 4BJLA 2CRIA 4KPHH 4CVXA 4JHWH 1NEUA 1HHKA 4NN7B 4TVPH 3EYUL 1FFOA 2OM5A 2FNBA 2ZCHL 2F8OA 4I3GA 5KVFL 5K9KB 3I50L 1C12B 3CVHA 5FYKH 4JRYA 4ZPTA 2GSGA 1YEKL 1MY5A 3BP5A 4OTXL 5IKCA 3PL6B 3GMPB 4MHHG 5IQ9A 1NFDB 5CJOH 4OZHE 1WUNT 4IM8A 1J1PL 2VH5H 4GW4A 4MA7L 2BNRE 3KPSD 4L1DA 4XPAL 3RGVC 1CU4H 3RGVA 4NKIL 3KPSA 1MCOL 2CMRH 1C7SA 5FM5O 5GGQH 1NKRA 3BESR 4ALAL 5FDWA 5C0CB 4B0MM 3I2CL 1OAYH 1RU9L 5DR5H 2PTTB 3LPWA 3QH3B 2X4UB 2EDOA 4IDJH 4ZNCD 3KPPB 1R3KA 5C0RL 5K9QI 4KUCF 3W0WB 3ZKSD 4APQC 5T1DH 3QNXA 5HVWA 1KCKA 2R56H 3LKQB 4LFHD 2G75A 4APQA 4ELMA 4Y1AA 4M7ZB 1TQCC 5JUEL 3MRPB 5F70A 5HDBF 1T2JA 3B6SB 2VDRL 4KK5D 4HMEA 4HIEA 3S37L 3U9UB 3VRIA 4UB0H 3O41B 1ZEAH 3UTSE 3RWGA 1XR9A 4EN3D 3CDFA 2KPNA 1D5MA 4X4ME 4EN3C 3HZKA 4JVUA 1MCWW 1LO5A 2QJDA 1ZE3C 4R96B 4EN3A 3B5HA 2XXCB 1DBAH 1EFQA 2ID5A 2W9DH 4OGAD 1X5LA 1AGBB 4LARH 3BDBA 3HNSL 1A6TB 3R0NA 2B1AL 4PP2B 1UYWH 2LAAA 1FNGB 1YQ2A 3LKPA 5DJDB 5FA4A 3VFUB 1JWMB 4H5SB 5I2IA 3OKDB 4WDIA 2OXGA 2ORBL 2XN9D 2HMID 1D5IL 2NW2B 2IBBA 5FK9B 5LG1A 2EC8A 2HJFA 1BAFH 4S1DD 1L0XA 5IM7B 4HWBA 2C1OA 2YEZA 5CILL 2D7QA 1IGJA 1ZGLB 1UA6H 1UEMA 1HYSC 5F7DA 1SEBB 1QYGL 1A7OH 5DUBA 3CFCH 2R2EB 1T1WB 1MFCL 3PWPD 5B4MC 1MHEB 1R3IL 3DO7A 5FYLD 3DURB 1DTUA 1CDHA 1Q94B 3IXAA 1AIFB 1RK1B 2B1HL 5ACLA 3VJ6B 5D7IE 1X3DA 1UM4L 4YHIB 3O2DL 1UM5H 1FVEB 4LVNB 5K9KA 1KB5B 4XPBL 1C12A 3PL6D 2JCCB 4NO0A 4RGNE 4HCRL 2FIRT 1YYLH 3IDIB 1R5IB 4H8WL 3BFOA 4W68A 5KOVC 4N9GB 5TPWL 4NQUA 3PQYB 2CUHA 3SJVD 2JJWA 5D2LB 1VFBB 1TJGH 2O93L 4S11A 5DRZB 4OV5B 3UZQA 1WWWX 5C0CD 1KJ3H 4I5BA 1QBBA 5HGDA 4JY5L 4LIQE 4Y89A 5C0CA 4BK5A 5J3HD 3L95B 3DMMB 2FECI 3WUZA 1NDGB 2X4UA 4J6RL 4MJ4A 4CADB 3QFJD 4LAJH 4MNGB 3KPPA 2W65B 1ZT1B 3KNBA 4ONFL 3W0WA 2CK0L 2XTJB 1G9ML 3MUY1 4GKNB 2AJYH 5FGRA 1F45A 5DMGD 3SGDI 3EGSB 4JZNA 3VE0A 5DMGC 2PTVA 2F8XC 3MRPA 4OM1L 3B6SA 1AKJA 2HG5B 3V5KB 4PJEB 1W0WB 1LWRA 1NQBA 4OCNC 1BZ7B 1FL6B 2ARJB 3JXAA 1V7NL 2EXYC 3VGHA 3UO1L 2DYPB 4XVTH 2VITB 4UTBL 5CJXC 5C0AE 1FL5A 4JO1L 4P57A 4R96A 5CJXA 1ACYH 1PFCA 4F15C 1A1MB 5MHSD 4WI3A 4PJ9B 1AGBA 1CL7L 2WIMA 4FFWD 5SX5K 2PN5A 5DMKA 4Q0XH 4WUKH 4FQJH 1A6TA 2ICWI 4ZPVB 4GAGH 4PP2A 5FECB 4QHMB 5KSBE 1FNGA 2ATPA 3F62A 1BP3B 4KJWC 1JWMA 4H5SA 4YHLH 4ODSH 3OKDA 4DKAA 3GGWB 4G3YH 4LEOB 1I3UA 4XCEA 3QA3B 4HKBB 3PNWB 1T3FA 5HI4C 2NW2A 2VL5B 2EDTA 1U3YA 5FK9A 5ADOL 2CLRB 1HWHB 4Y88A 2DMKA 4WI2A 4HLJA 4TVPE 5IM7A 3N50A 4JY6A 1ZGLA 3VFWA 1U3HD 3ARDB 1SEBA 4P23C 5FYKE 5IOPB 2VXQH 1XEDA 3BDXA 2R2EA 5AG8A 1T1WA 3IKKA 3V6ZB 4CGTA 2JB6B 3PWUB 4PR5B 4N8VG 4P23A 1EGJH 4TRPH 4X9FA 1H3PH 5T3XL 4M48L 5TDOB 7CGTA 4OF6A 1AIFA 1RK1A 3DXAD 3VJ6A 3BEWA 1ZHBB 4UIMB 4FQLL 4XP4H 3TT3H 5D93C 4YHIA 2A73B 1IGTB 1FLTX 1FVEA 1IC5L 1NCDL 4Q7DA 3CFKB 5HHNA 3TIEB 2JCCA 5L2JB 3QRFM 3PQYD 5FXCH 5JHLL 1G1YA 2QQQA 1R5IA 4UT9L 1AQDB 2EDLA 4GG6B 5C6TL 5D2LA 3GRWL 4LRNL 3NABH 3HC0B 4Z7OE 4JANB 1N6UA 2FBOJ 4TSCH 3T1WA 1GGIL 4OV5A 2E6PA 4NP4H 1QLEH 1C5CH 3CFIC 1UFUA 2R4RL 1AO7E 2CQVA 2DTMH 1KNOB 3DMMC 2GJZB 5IV2B 3OSKA 2PO6C 4CVUA 3WKMH 1CXFA 2HLFD 4HHAA 5EA0H 2AJXL 3DMMA 3I6KA 5E5MB 2HLFC 2K7PA 4CVZB 2PO6A 1MCNA 5JHDA 1N4XL 4CADA 4CDHA 3WXVH 1MAMH 1YZZA 2J5LB 4MNGA 4TUKL 2XTJC 5CLTA 5GJSL 1JJUA 1ZT1A 2DWEA 3WNNA 4V2BA 1S78D 2BNQE 4KZEH 1UB5B 3NFSL 5I8OH 1J0JA 5CUSL 3EGSA 3NVQA 4PJFE 3C2AL 1FVDB 3DUHA 3CLFL 1R6VA 3BKJH 2HG5A 2DYPD 4OZIB 2X4RB 5ICYA 1W0WA 2P46B 4U6YB 3V6BR 3QIUC 2W0PA 1JVKA 5DJCB 4LDLB 4LK4A 4RX4D 1QSFD 1B0GB 1V05A 2GJJA 3QIUA 2DYPA 2VITA 4W81A 3BPOB 2G9HA 3JWOL 3U2SB 4PJ9C 5TJWK 1LP9E 4QXUL 1A1MA 4PJ9A 5GS0L 5FYJH 3ZKND 5C86A 5GGRB 2VXTL 4RFOL 3BKYL 1IC1A 1RUQL 2VDQH 4N0RA 5GRVK 1NLBH 4PJAE 4ZPVA 4GXVL 5FECA 4JRXB 4X9BA 3EYFA 4LPWA 5HHMD 1PGRB 2IPKB 2R4SL 3A67H 3PHOB 3REVB 2B4CC 2MWCA 4LEOA 3RJQB 1AO7A 1LDSA 2E27H 3FT4B 4HKBA 4HS8L 3V52H 3PNWA 5E8DL 1WZMA 1RAMA 2EDXA 1A7NL 1KLGB 4EDXA 1HHIA 1EUUA 2CLRA 4Z7UB 3ARDD 3DETC 2CDEB 1IGCH 4HFWB 3EUUA 1T21B 1TVHB 4R9HA 3STZB 3BD5A 2OMNA 4DZBA 4NO2B 3V6ZA 3QUMH 2JB6A 3PWUA 5L2KD 4PR5A 5DWUL 4MVBD 4NGHL 4PY8J 4XNXL 5DMIH 4ONHB 1FZKB 3B2VH 3BISA 4WFFD 5TDOA 3U83A 5IR1A 3TT1L 4LSRH 1KLFA 3VD5A 4U1LB 4X6CB 1ZHBA 2P45B 3KS0H 3MRMB 4XNUH 3NCMA 2A73A 4MA8L 1EXUB 2JJVA 4LL9A 2YMXL 3ULUL 3VFGL 3TIEA 3CFKA 5L2JA 2WNGA 5I1KH 4RMVA 4RMQA 1U8QB 3FQNB 1UWGL 4BZ2H 1AQDA 3RVXC 4DOHB 4WHYG 3V7AE 4PJAA 4O51B 1MCRA 4LKCB 1ADQH 1J9CT 3HC0A 4QOKD 3NA9L 4JFHE 4JANA 3S3PA 3O4OB 3SDDB 3TH2T 4ODBD 3OAYH 3NZHL 3RL1A 1QSEE 1AQKL 4DKEL 3I3BA 4NCC2 3GMMB 1KNOA 1CBVL 1I8LC 3R8QA 1I8LA 2AJSH 5E5MA 2J88H 3FO0H 2J3SA 4J2XA 4CVZA 3ULVD 5C0EB 1YUHB 3WE6B 4WNQB 4H1LA 2PKDA 4BQBA 1TNNA 3IDNA 1CDJA 2CUMA 3BPLB 2E9IA 1E27B 2A6DA 4MDIB 3U4EB 1UB5A 3BP7B 4D3CL 2WIIB 5GXBB 1FVDA 3MACL 3QI9C 3GI8H 1FO0L 3K7UA 5HTSA 3WFBH 2W91A 4OZGF 2X4RA 4OZIA 4U6YA 4TNVF 3CH1A 3B9KB 3QI9A 4UOW0 2PTUA 2NXZC 3SDCC 3BPOC 3H3PL 1ZK9A 1SVZA 3P9MB 2XOTA 2IBZY 2ICWB 3GJEB 3IDYC 2WBJB 2XPGB 4MB4A 3SDCA 3T0XA 2A9MH 3P40A 4QRQB 1KN2L 4WY7L 1QRND 3SY0B 4JRXD 4OD1H 4MQTB 4LLDB 5SWSE 4XMLL 3BH8B 3D18B 3A6CL 1INEL 2QQLL 3Q48A 4JHBA 1RJYB 2BOCA 4JFOA 2IPKA 4WFGE 4Z5RB 1DSFL 3PHOA 5F71A 2VJXA 3C9NB 3RJDA 3OB0H 4U1MB 4Y16B 1DQDH 4WGWB 3OX8B 2Q8BH 1MCEA 3V4PL 3FT4A 1T1ZA 4ELMF 3E2HC 2VR5A 2AK1H 3G5VA 4NJAH 5BO1L 5FFLA 1KLGA 4HXAH 4PS4H 3HAEG 2CDEA 3MOBL 3MRQB 1T21A 1TVHA 4RBPK 5IUSA 3STZA 1FYTE 4M3KB 4LSPH 2R2HB 4PV8B 4R7NB 4NO2A 5E9DE 4NUGL 5JORB 1T1YA 2BSED 5C6WH 4KKLC 3UTQA 3LZFH 1A4KB 1FSKB 5DD6B 1HZHL 4TOYL 4ONHA 5EO1B 1FZKA 3HS0A 4IOSD 1UH4A 3FKUS 4YZFE 2Q8AH 1PVHA 1QHPA 1RZKH 4R90H 4OIAA 4PTUA 4U1LA 4X6CA 3V9FA 3W39B 2V9RA 3B4NA 4NBXB 4PRPA 1EXUA 1L9MA 1WV7T 1V7ML 3A6OA 1Q38A 1QPXA 4G8IB 2QV2A 4BZ1L 5IFHH 2HTKC 4XNYH 1JFQH 1U8QA 3FQNA 1JL8A 5I15H 3BIKB 5IVZB 5IF0A 1F11B 3ARGB 3BX7C 4O51A 1ROWA 3O4OC 4P2RD 3RUGB 4N0CC 3SDDC 1A1OB 4YBHA 1NBVL 1UQSB 2XG4A 5C3TA 1U8PB 3OF6D 3SDDA 5J1AB 1CFNB 1EGJA 4RWHA 5C0BB 3UAJD 5DI8B 4KK6D 4KVNL 4QXWA 3Q0HA 3W11C 15C8L 4HK0A 3MYZA 4OCSL 3T2PA 1OGTA 4W6WB 1TZGL 4OCXH 2W0LA 1CN4A 4U49A 1IGIL 1P7QB 5C0EA 2FHBA 1J8HB 1YUHA 3BPLC 4WNQA 3ZSTA 3UPAA 3TJEL 1E27A 1OWRM 3L7EB 1ZVYA 4MDIA 3U4EA 4Z77B 2VDOL 3ZYOA 1ES0A 5L0QB 5KS9E 4JM4L 3BP7A 1BWMA 1MVUA 3B9KD 2FLBT 3BN9D 2WIIA 5FYJE 5M7QA 3TCLB 3IJHB 5HHPB 2Z93B 2BRRL 4EBQL 5EU4B 2V17L 2WBJD 2ZOLB 4HC1L 1QKZH 2PXYB 3GUTB 2X40A 3K4ZA 1H3UA 1NCAL 4FS0A 1HK6A 2H2PC 3KPLB 1WFNA 1MQKH 4PLKD 2ICWA 3GJEA 2XPGA 3NFPA 1ZHKB 4RISH 2BOBB 4ODVH 1BFVL 3WNPA 2FJFB 1S7RB 3SY0A 4ERSH 1VACB 3QEUB 1X5AA 2NYYD 3MV7E 1DN0B 3QQ4A 4LLDA 4HULB 5J57B 5JW4N 4R0LB 4NQDB 1CWVA 3VXTB 4OLUH 5MI0B 4Y16D 3D18A 3GSNH 4KKNA 3NPSB 3RU8L 3W2DL 3GSXB 4Q9QH 4PRHD 1HIMH 4Z5RA 3RVTD 3C9NA 4M8QA 4U1MA 2AJUL 3OX8A 1V3LA 5GGSY 3LEXA 4HT1L 3VA2C 4FG6C 3PDDA 2BDNL 2DTSA 2VWEE 1JNNL 3EYSH 4UTAL 1N6QH 4KMTL 4HKZA 2B2XH 3LSOB 3VA6A 3MRQA 4Z0BH 4KJQC 4O2EB 2H8PB 5DUMH 3N9GH 1OSZB 1OP5K 4KRMB 1G7JB 2R2HA 4R7NA 1FHGA 3JVGC 3WIIL 3CXDL 5TE4H 5JORA 3HB3C 3QXTA 3RRQA 4YXHH 3JVGA 5DD6A 3LKRA 3QG6A 5EO1A 1RZ8B 4KDWA 1NL0L 4D9RD 4KI5D 4AZ8A 1A7QL 5DEFB 3W39A 1QHOA 4OGZA 4O2FB 1F90H 3PXHA 3QR2A 3NBNA 2GAZB 3PHSA 5EWIH 4CMHC 1CQYA 2VXSL 4MSWB 5DJZB 1S9VB 1YY9D 3ARGD 2UY7A 3EO1A 1JZ3A 1SYSB 4QRRB 5CKGA 4ZSOE 3BIKA 1QFOA 3TH4T 3ARGA 3K74B 1X4ZA 5K9OB 3FAXA 5C0BD 1UQSA 3D39E 4KQ4L 1BQHB 1U8PA 5B8CB 2D9QB 5J1AA 5I1GL 3DVFA 1CFNA 1HXMB 3D25B 4JFZL 5C0BA 1FPTH 5DI8A 4Y0GA 5MEQA 1YQVL 1NBYB 2R9HD 5I1JL 1P7QD 2R9HC 1J8HD 2VN4A 4NWTH 1E28B 4ZFGL 4UOJA 5D71L 1SJEB 3RFZC 5HD8C 1D5XA 2X70B 1T5WB 2E3VA 3LIZH 4XNMB 5EB9A 1FZOB 2A77L 1G7LB 5ESAB 5DZOA 5L0QC 3RP1A 2Z8WC 5HY9A 2XXMB 4LGRB 4L4TB 3X17A 4Z77A 1W72L 5ABDE 2JCCF 4YBQD 4XCYB 4U05A 3FONB 1FZMB 4YBQC 5SX4I 2PXYD 4Y5YB 4A6YB 2FIKB 3S34H 2PXYC 2WZPD 5FYKU 1BFOB 3IJHA 4PLNC 5HHPA 5EBWA 3GHEH 3VXRE 2MOVA 3BIBX 2ZOLA 1D6EA 2PXYA 5ISZB 3GUTA 5D2LF 5KSBF 2I07B 3JSSA 1GCFA 2ITDB 2OXHA 2VQUA 2BK8A 4C58B 4UILL 5IHZB 4BFGA 3G6DL 4HWZB 5LGJB 1KJMA 1FZJB 3CSBA 2ZNXA 4OB5L 2FJFA 5BS0B 3AS0A 1S7RA 3P0GB 1ZLUK 3BGFB 3K8MA 1HXYB 1H5BB 1VACA 5MI0C 3FZUD 3QEUA 8CGTA 1DN0A 3VXMD 3NPSC 4QHNB 1TZHB 1ZAGA 3QEGL 4JR9H 2FBJL 1YMHB 4NOFA 4NQDA 5C07D 3VXTA 4BSWB 5E00B 4M1DH 3GSXA 4GKSA 4OIBA 4L8DB 3QYCA 4NQEE 2BXYA 2IG2H 3LH2L 2X7LB 5J9PB 1ZMYA 3B9EA 4F2MB 4F9LC 5FA3B 4YHZL 2FHFA 1JTPA 1UWXK 2A6KB 3BZ4A 4PREB 4F9LA 3D3VB 5CD5C 4L3CB 3NCYS 5JOEA 3S88H 3IYLW 2BC4A 3ZTNL 3KR3L 3U4BH 4MNHB 1IMHC 4JO4L 1CT8A 1DBJL 4S1RL 5DHXB 3MV8E 1OSZA 2R0WL 1G7JA 5C2BL 3KLHC 2LVCA 4D0BA 4OD2B 5E08H 1YA5A 3VXRA 3GM8A 4ETQB 5E4IA 1JTTA 1I9JL 1R3HA 1VEOA 1TDQA 4DGVL 4V1DB 3IJSB 5JXED 2Q6WB 3RWCB 4Z7OF 5JXEC 4KUZH 1FNFA 1IEAA 4O2FA 1Q9WA 2GAZA 2D0GA 4QRPE 1FGVH 2ENYA 5JXEA 1TVDA 1B90A 3CX5J 4MSWA 4OIIH 1S9VA 5B3JF 1EEUA 4YHMH 4X0KA 2VDNL 2BJMH 3RZCC 1SYSA 3E1F1 4QRRA 4P2QD 3QWQB 3P3YA 5ALBL 1KXTB 5DJYA 5B8CC 2P43B 4QO1A 5K9OA 3BZEA 3RZCA 3HE6C 1EFXA 3FFCB 1DQML 1BQHA 5B8CA 2DDQL 3HA0A 2CDGA 3HE6A 3D25A 4GRWH 4JY4B 4WI7A 1RMFL 3CMOL 1A3RL 5CZXC 1NBYA 2XY1A 1IEBB 1RZKC 4LLAA 4WW1B 5TQ0L 4J23A 3QHFH 3O8XD 4UZGA 1MJJB 5KW9H 2FEDC 2HAZA 1T5WA 2X70A 1NAKL 4L4TD 2FATL 4XNMA 3SE9L 4PUBH 1MRCH 1T7WA 4F80A 3MV8A 2FGWL 5ESAA 1Q9KB 3F58L 3DV6B 2EH8L 3S7GA 1FNSL 4Y5YC 5D2NE 5KN5B 3IDMA 4JFEB 1QACA 4OQ1A 1FZMA 2BZDA 1MFAL 1N26A 4Y5YA 4HUXA 1JPSL 2I26N 5ISZD 5EU6E 2ITCA 4JM2B 1T03L 1KJ2H 4GH7B 1BFOA 3LMJH 1OARL 4M6ML 4PLOB 4PJAF 2R8SL 1ED3B 5HHOE 2XQYG 3AS2A 2ITDA 5LBSH 3ROOB 4P3WA 5IHZA 3RIAK 4HBQA 3GSRB 1JWSB 3BGFC 2UZYB 5BS0A 1TQBB 5GISL 3MZGB 1HXYA 2ZWLT 3VW3H 3QEHB 3MBEB 3P73A 3TIDA 1T2QL 4JHAL 4QHNA 4DKDC 3NN8A 1FH5L 1JHLL 4H88H 1YMHA 3N1FC 4HV8A 4XBEL 4BSWA 5GRUH 1WFUA 5DJ6B 1IZKA 1JE6A 4L3EE 5FGCB 2X7LA 5J9PA 1CDUA 2ZCKL 3D3VD 3V0WH 4F2MA 1MJ8L 4POZC 1Q9OB 5FA3A 3F8UB 3WN5B 3G9VA 5ILTL 1MLCA 3D3VA 3LD8C 5DHYB 4OZIF 4L3CA 4JPKL 3EO0B 5L88L 1SYVB 1XCTB 3X13B 43CAB 5IJKC 4MNHA 1U8KB 1I9RL 4V2CB 5IJKA 4YNYB 1NGWB 2DQTH 2DKUA 3VD9A 3VXQB 1FORH 1AR1C 3I6LD 2P49B 4OD2A 3ARBB 3MRKB 4H20L 4AK1A 3DX9A 2P8PB 1MREH 2XZCL 3QEQE 4PRAB 4FQXB 4F58L 1AI1H 3KDMB 4LHUB 4V1DA 5HHOA 4P46B 3RWCA 5IW6B 2A9NH 2EE6A 3WDHA 1PDKA 4QHLB 4HXBL 1JK8B 4RMTA 1FL3B 4XNZC 1GAFH 1MRDH 3DUSB 3VI3E 4K55A 1KFAL 2YUZA 4OCWH 1Q0XH 2WBKA 2F54E 1YNTB 3TESA 1PY4A 3NGBC 4JPVH 3U6RB 2R1YB 4HWUA 2HFGL 3KPMB 1WLHA 2K1MA 3FFCD 4GQPH 4FP8H 2APBA 2MPAL 4JB9L 4OLVL 3MX0A 5EN2B 3W9DB 3CNKA 2EIEA 2R29H 1R0AL 3ME0A 4TSBL 5EFIA 1IEBA 3SQOL 3HZVA 1F00I 2F5AL 1T5XB 1IM9D 3GI9L 4M62L 3VXSB 4KJPC 3KPOB 2VZVA 1QFHA 3QQ9C 5KZCB 1PY9A 5L9DH 1MJJA 4KK9D 1MJUL 2FDBP 3ETBF 5HGGS 1PX4A 3I84A 4X6CF 5B38G 5J13B 5KVFH 3S5LB 5I74B 4JFED 1N2RB 4OKVB 5EH1A 1WJ3A 5EOCL 1YEKH 4JM2D 5KVGL 1NBQA 5KN5A 5BV7L 4CW1B 4U6XB 4F37F 5KVDL 3QEQA 1CIDA 2HFEB 4KAQL 4AQ1B 5ACZB 1J1PH 1K5NA 1HHHA 3W9EB 4NFCA 4MJIE 5F9JB 3K1DA 3B5TA 2XG5A 3M07A 4QHUB 4O9HH 5D7IB 5J11B 1M7DB 4MHHI 4NKIH 3ROOA 5EC2B 1T2XA 3BT2L 5CZVH 3GSRA 5JZ7D 3C5ZC 1EEZB 3ZT6A 3MBED 2AXFB 5MEPB 2H41A 1KENL 4KXZH 3QDME 3C5ZA 4L29A 2BNRD 1Q0YH 4PGJA 3QEHA 1H8SA 2DKSA 4Q6YA 2DMBA 5C0RH 1RZIA 4BKLB 2CIKA 4D8PB 1LILA 3GHBH 3MLZH 4EI5B 4Q74A 1ZWIA 1IZJA 2QEJA 1T0PB 3BAEL 4OGXL 4X4YB 1F3RB 3LS4L 2YOCA 5D6CB 2IPTL 3AAZB 5JUEH 5C8JA 5EDXA 5SV3A 1SY6L 2VDRH 3QCVL 4PJ8B 4YZFF 3SGKC 5BVPL 1M1SA 3S37H 5DHYA 5C0NC 4X6FB 1ZANL 3SGKA 3KHOA 3EO0A 5F9WB 1XCTA 1HHJA 2IMMA 3OB8A 1U8KA 4GMTH 1XIWC 3C6SA 3ARBD 1OW0C 1QFPA 5BMFL 1NGWA 3ALPA 2CR3A 3CX5K 1HNGA 1XIWA 3FO2B 2EDNA 3VXQA 1J8KA 4FQXC 1OW0A 1ZT4B 4G9DB 3KYOA 5KAQF 1OAZH 1XGRA 4KY1L 4ZOAA 2P8PA 2CIIB 2MQ0A 3HNSH 4P46C 4KKBD 4PRAA 4FQXA 5D1XB 1X5YA 3KDMA 3O6ML 4PRIE 4LHUA 3UTSD 3PDGA 2B1AH 4P46A 4R8WL 3PHQB 2A6IA 4QHLA 4GRWE 5FYJU 3O3BA 2R69L 2ORBH 2CXGA 3H42L 3RTQD 1D5IH 2AJZB 3UYPA 1XGPB 3DUSA 3UCRA 5C08E 5IESL 4LFHG 1TTFA 3JTTA 2EIBA 1YNTA 4PBWD 3QJHB 1JP5A 1MSPA 3BVNB 2VDKH 4JO2L 5AZEL 1MHPH 5A43C 4KROB 3BOVA 1VEMA 4LLYA 5CILH 4JKPL 3D1MC 4YPJA 2Y36L 3W9DA 1QYGH 1UCBL 2AABL 1FC2D 3VXSD 1MFCH 1CE6B 1F8TL 3IVKA 2VR4A 1R3IH 5LCVH 2HTLD 1W8OA 5JQ6L 5KZCD 1F4HA 1HEZB 1FC1A 4GAYA 4M9OA 1T7ZA 4MJ6B 3VXSA 4PLJD 4URTB 3KPOA 2B1HH 1RV6X 1KXVC 2H3NB 2ZUVA 3MRNA 5J13C 3CVHL 1NFIB 5I74C 1NC4B 1UM4H 1GGBL 3OGCA 3S5LA 3WO4C 4XPBH 2FJHB 2YXMA 2BRQA 2A2QT 2IBZX 3P9LA 4B53A 4NZTH 1A6WL 4M7KL 1I7TA 2G2RA 5EC1B 2XZAL 4CW1A 4H8WH 3GBML 4U6XA 3MV01 5TPWH 4HPYL 1CXKA 1C8PA 3C5SB 1AGFB 4HWNA 4G43B 4PBXA 3U4AA 5IG7B 3DGGA 4QHUA 4KKCD 1EHLL 4J8RB 2VLKE 4RGND 3QCTH 4ODTH 4R3SA 3ZDYF 2GYSA 3Q5OA 1BQLL 1FDLL 2XACC 1ZT7B 2P24B 1Z0MA 4YAQB 4HUVB 1U36A 1C16B 4OFDA 5MEPA 2ZUSA 4TYUA 3LDBB 2KBGA 4EI5D 3RHWK 5M94B 4P3DA 4EI5C 2A1WL 4MAYD 3P30L 4BKLA 4D8PA 3V4VL 4XXDB 4EI5A 2CK0H 1G9MH 1MOEA 3JV5A 3KJ4B 4OI9A 4U7KA 3UTPE 2WP3T 4KDTC 4PJ8D 4QGTA 3PUCA 4PJ8C 3QZWA 4ZNEE 5D6CA 1KJ2A 4MXVE 1NCTA 4KDTA 3QXUA 4C56E 1MCFA 4OM1H 4LSDA 1PQZB 4PY8I 4PJ8A 5EU3B 5F9WC 3FMGL 3PWJA 4NN5B 3LQAC 1WCQA 1CDGA 3JZ7A 4X6FA 2MMXA 4HIIB 3L3IB 4PB9L 5HI5D 2EECA 3QUKB 3MLVL 3UO1H 2ZSWA 4FTVE 3LOWA 1TCRB 4JO1H 5DDHB 4JG1L 3BE1L 2YD8A 5D1XD 5ESVB 3FO2A 4XWGH 5D1XC 1WT5C 1ZT4A 4G9DA 1U41A 4JFDB 1CL7H 4U2ZA 4PJFB 5D1XA 2CIIA 3RAJL 2CLZB 1WT5A 5HYIA 7FABL 4U6VL 1YN6B 3AXLB 4LSTL 4OD3L 5DYOB 4GAFB 5C0AD 1IC4L 3UTZA 2VL4A 4WV1C 3EKCA 4NZUL 1D9KD 4M5YL 4L4VE 5D5ME 3SDXE 1XGPA 4LSUL 5IVXE 4WV1A 4CN6A 4GUPB 4P3CL 4PJ5E 4L4JA 4KROD 4HWBL 4LLWB 3QJHA 1HE7A 1DBML 4NFDA 4NHUB 1CD9B 2ED8A 2YBRB 4Q2ZA 3FAWA 3AMLA 3T0EE 5D7LB 4PJXE 3VDCA 2E7HA 1MFBL 4NKMB 4JPIB 2VLRE 1OP3K 4LOUD 2IALA 3OKNB 5D96B 4LPUA 1RULH 3OKEB 4GXUN 5DVKA 4WU7A 5HPMB 5I1DB 1HEZA 2CO7B 5FCUL 5T3XH 3MA7A 1PZUB 4PP1C 4MJ6A 3CSYA 4M48H 4TVPD 3BXNA 1C1EH 2H3NA 2OMBA 2FZ3B 3ES6B 3O6KL 4H0IA 1ZTXL 1NFIA 1NC4A 2ZP0T 4FQLH 1F6FB 4N0FB 1G0YR 8FABB 5D70H 1OVZA 1IC5H 4PRBA 3HNVL 2N1KA 5JHLH 3IDXH 4NNYB 4BFEA 5EC1A 2C4FT 1KG0B 3M17B 3TBTB 4RRPG 4I48B 4RAUB 3EJYD 4Z7VB 4G8EB 5C6TH 1XR8B 4G8GB 4NFBA 4D9LL 2HVJB 3C5SA 3GBNH 3GRWH 4FFZL 1XGYL 4G43A 1BM3H 2VLLA 4MLIA 5IG7A 4ODUB 1GC1C 3RDTC 1BHGA 2B0SL 3ECBB 4L4VA 5E6ID 4J8RA 1J05B 1OTTC 1EHAA 3MXVL 3RDTA 1A6PA 2R4RH 4R2GB 1RUMH 1ZT7A 2P24A 1P4LB 5T33H 3U7WL 3UZVB 3T0EC 4YAQA 4HUVA 4ETYA 2IANB 4EXKA 3MLSH 3O3DB 4RGOL 4MXWH 3MRLA 2AJXH 1UT9A 3MSPA 3T0EA 1MELA 1WICA 2OZ4A 6CGTA 3VXOB 4TUKH 3HI1B 5GJSH 1AGDA 3KJ4C 1EV2E 1UZ6F 4DAGL 3T3PF 5DVNA 1A1NA 2EZ0C 2VDLH 1HQRB 1R5WA 5CUSH 4X9GA 4ZFZA 1K6QL 3LEYH 3C2AH 1A8JH 3CLFH 4NN5C 3DSFH 1PQZA 1NCBL 5EU3A 5FGSA 1LK3L 5SV4A 3EHBD 4U0RB 4HIIA 5J12B 5FF6B 1CGVA 3PIQA 3CCHB 3MFGB 3MC0A 1TCRA 3MV9B 4JFDD 1VDGA 5DDHA 5TDNA 5HVHB 2CH8A 5JIIA 5DD0H 1IAMA 2R0LL 3FN0L 3MJ9H 5ESVA 3ZE0E 3MNZB 4NO3B 4QXTA 1GXEA 2X1WL 2AGJL 2R0ZL 4QXUH 5C09E 1I8IA 3H2WA 5GS0H 4NC0B 4JFDA 5DVOA 1T6WA 5I19L 1QFWL 2CLZA 3B9DA 1JHTA 1RUQH 4WFHE 3UROR 4LIQL 2HKHL 5CEZL 3IDJB 3MTRA 4O02L 3L6FB 4XVSL 5FB8B 4NCDA 3VH8G 3OKMB 4HS8H 2N4IA 4GUPA 3EDFA 3DPBA 4N8CL 5D7LD 2APFA 1A7NH 1TTGA 4NHUA 3K8LA 1MAJA 3RA7L 3O9WB 2NXYC 2FX7L 2YBRA 2XNAA 3X12B 5DVLA 5D7LA 2RIKA 3VCLB 3TNMB 4IRJC 3G9AB 5D96C 2HH0L 1LEKA 4JPIA 1J0IA 2P5EB 1GL4B 4R4NC 1G6RB 4IRJA 4JN1L 4F7CA 5DWUH 4R26L 3OKEA 4NGHH 4DVBB 3EYQD 4XNXH 4Z95H 5I1DA 1KCLA 1FQ9C 1JYXA 1QFUL 4LCWE 3V5DB 5JOFA 3ES6A 3T2NL 5JTWA 4MDJB 1P9MC 4N0FA 8FABA 1DBBL 2QKIB 3F12B 3DYOA 4UT7L 3FT3A 1P9MA 3KPRE 4YXLL 4L9LB 3RNQB 1EBAA 1RIUH 2JTDA 5C09A 5E9DB 4G8GD 1UWGH 4HK3N 3M17A 5CEXB 5AUMB 1ZVSA 2J6EL 3QDGB 4I48A 1M6OB 2D2OA 4RAUA 3REWA 5F93C 5IQ7L 1DE4A 1XR8A 1CVSC 2OJEB 1FNEB 2HVJA 1F6AB 2HWZL 4M93C 2A83B 4ONOA 3AM8C 2EIZB 4ODUA 1FBIL 1GPOL 4O00A 2CUIA 3ECBA 3GMQB 2IAND 4R2GC 4HIHA 2KZ1B 3NZHH 5DGQA 1J05A 3AM8A 1AQKH 4DKEH 4Z0XA 4U3XA 1FIEA 1P4LA 5H37H 1CBVH 1U8MA 2IANA 1MUJB 3O3DA 1CDYA 3QDHA 3SCMB 5FYKL 4NCC1 2SEBB 2DJSA 2X4OB 5CJQL 3O3AB 1NCUA 4RIRB 3VXOA 4JPWL 4HDIB 5AD0B 1A3QA 3VWKD 3FQRB 4JGJA 3U48A 4EUPG 5IEKA 5ITFB 3GSQA 3K4AA 1JZ4A 3MACH 5B22A 4U31A 1FO0H 1BX2A 4U0RC 3ZT7A 5J12C 3MXWL 1R5VB 5D7JD 5IIEB 5BZWB 3MV9D 2YSSB 5FF6A 5GS2H 3CCHA 1J86A 1P1ZB 3WFHB 3M8OL 1NUGA 3OQ3B 3RKPA 1YECH 4KK8C 5ID0B 3HPJB 3VWJD 3LY6A 4NO3A 4HZLA 1KN2H 3MUJA 5KS9B 5KSAB 5DLML 5HXMA 2CKBB 4KRLB 3RVUC 2GK0B 2F9BT 3H0TA 1DP0A 4XMLH 5HHXL 4Y4HC 3WJJC 1INEH 2C7UB 2QQLH 3QFDB 4OFIA 4Y4HA 3L6FA 2B4CL 3O2VH 3ILPB 4MZ2A 1RHFA 1TZIB 3WKNA 1DSFH 1SHMA 3WJJA 2V2WA 5FB8A 3O9WD 3V4PH 1KYOK 3OKMA 3B2UD 5T3XE 2MJWA 2GJ6B 5BO1H 3B2UC 4JFFE 1T22A 3BSZL 1VHPA 2AQ3A 2NR6C 4XC3H 3HR5B 1HHGB 3QXAB 3X12A 3MV7B 3MOBH 3VCLA 4WFGD 5DF0A 3TNMA 1J1XL 2HFTA 3AS3A 4N8VB 1B0RB 1GOGA 4GAJL 2P5EA 1L6XA 4YFDB 4NUGH 3Q6FB 1JZ6A 1EK3A 1HWGB 1UYWL 1YEGL 1CFTA 3DX7A 4TOYH 4IMLB 3BEVA 5DA4A 1MFDH 4F33A 5A16B 3V5DA 4CRPA 4LVHC 5JXAL 5MP6L 3FFDB 3TV3H 2B7DT 5HJ3A 4MDJA 1CDBA 5DJ8B 1FYTD 5E9DD 4L9LC 2QKIA 3F12A 4F7MB 5IMMB 3LRGA 3MJ7A 3AY4C 4WTXA 4LHJB 4LCUA 3QDGD 4L9LA 4BZ1H 3RNQA 5HBBA 4N0UE 1UA6L 3AY4A 4K9EC 3G5XB 1TENA 5CWSB 5DK2A 5CEXA 1A0QL 5AUMA 3QDGA 5F6HJ 1BVZA 2I9TB 3VMNA 1M6OA 5AYUH 2OJEA 4C59B 2DM3A 1F6AA 1NBVH 4OCMC 2CO6B 3QDAA 3AC0A 4RNRB 1YC8A 3UEZA 4Z7WE 3GMQA 3CDGA 3QQ3A 1N5YH 4NM4H 3QSKB 3SCMC 4OCSH 2IPUG 2WWKO 4E9LA 3TPUB 3BN3B 1A6UL 3SCMA 4AMKL 4N0YL 3W5MA 1P7HL 4X6BB 4NQVB 2SEBA 4ODHH 1T0NB 2XA8L 1KCUL 1YYLL 5DA0B 4KQ3L 4RIRA 4CUCA 3N1GC 4HDIA 1FFRA 2WUCH 5AD0A 3TJEH 3D39B 3DIFB 3LQZA 4Y4FB 4JM4H 4U1KA 1QR1B 1V5JA 1HILA 4MD4A 2HJKB 2BRRH 4EBQH 3WFCL 2BHZA 3QUYD 4AY0A 4HC1H 4M1CC 3LKSB 4JE4B 1RJLB 1LO4L 1NCAH 2FD6L 5IIEA 5BZWA 2G60L 5IMKB 2C4FU 3UC0L 2YSSA 5F9DC 3RZWA 4U1HA 4NQCB 5TQ2H 1I1AB 4TVSa 1WWCA 5KSAD 1DQQB 3TNNB 1WEJL 1CGXA 5ID0A 3RVWC 4YEFA 3EO9L 3HPJA 5FYJD 3CPLA 4FXKA 5EUOE 2OL3B 2CKBA 3GMRB 4U1JA 3NFNB 1RJCA 1JBJA 1EZVY 3HE7B 1JTOA 4WO4B 2VZOA 2C7UA 2EDYA 3RU8H 1PAMA 3ILPA 1DLHB 4AEHH 1TZIA 1PLGH 1IJ9A 2GJ6D 3L3GB 3OR6B 3WYRA 2J1KA 3BUYB 2XYCA 4K3GA 5IJVA 5JA9A 5TE7H 4HT1H 3ZDZF 3ARRA 3NCFB 3MV7D 1JNNH 3X14B 3KGRA 4P2OB 5I71B 3QXAA 4KMTH 1IAOA 1ACYL 3WFEH 1DUYA 5KVEH 2LU3A 3BD4A 2NCMA 4XCNB 4N8VA 3MJ9A 4WUKL 2X6MA 2DAVA 3Q6FA 4GAGL 4NM8H 4ZFOB 4IMLA 4YHLL 1M05B 5KANI 4ODSL 1FJ1B 5A16A 1X6NA 1RD6A 1UJ3C 1A7QH 2M26A 3FFDA 2J8UB 4HJ0D 1UJ3A 5DJ8A 2FX9H 4X80H 3G6AB 3HPLB 5IMMA 4HF5L 2VXSH 1D5BB 4XWOD 4U3HA 3MNVB 4XWOC 3G5XA 2C5DC 5CWSA 2FECL 3VMOA 2AK4E 5ANMB 4Y5XB 2VXQL 4KZDH 3BYYA 1UVQB 2I9TA 2WQ8A 1EGJL 1S9XB 4TRPL 2WLYA 2E7CA 5I1GH 4RNRA 4XRCB 4JFZH 3W81A 5C70A 4WUUB 4Q6IB 1I3RB 4G7VH 5FEBA 2APTA 4QHKI 3TO4B 4XP4L 4UV7L 5JDSB 2ZJSL 3ARWA 3ZZ1A 1MHCB 4BUGA 4ZFGH 3TPUA 1U9KA 5D71H 1CLCA 1D6VL 3BZDA 4RFNB 2E8YA 2X9WA 2NX5E 4NQVA 4AEFA 5CKAA 1T0NA 2VABB 3D39D 3S4SB 2BX5A 4Y4FD 2A77H 1CR9L 3H9HB 3MRGB 2VERN 3ARUA 3TWCL 4QTIL 5BRZB 3TH3T 1PX3A 3EOYG 1W72H 2J4WH 3DIFA 3S6CA 4DVRH 4M43H 3NABL 5ID1B 1QR1A 3V6OE 2C3VA 5F7KC 3TZVB 2HJKA 1KIUA 3RQ3A 2VLME 2E6QA 1QLEL 2D7NA 1I1AD 3LKSA 1N0XL 1RJLA 2DTML 5IMKA 1WTLA 4X99B 2ADGB 3SOBL 5I1LB 2X1OA 3WKML 4NQCA 5EA0L 1VKXA 3P4NA 4C54A 4DGIL 2NY1C 1DQQA 3TNNA 4HEME 2W0FB 3TYGL 3AGVA 1CLYL 5D2NB 4DFHA 3HE7C 1MCKA 3GMRA 4KZEL 3MNWB 2Y4SA 4WO4C 1F4XH 3QEGH 3HE7A 4WO4A 3F5WB 3BQUB 4XTRC 3L3GA 3OR6A 3LH2H 2ZKHH 3HAEB 3BUYA 4ZUVA 1PYWA 4YHZH 3OHXB 4P2OC 4P9HC 4JFPB 2APVA 1O0VA 3X14A 5HVFB 5GGTH 4P2OA 1J5OL 3ZTNH 4MAUL 3KR3H 2ERJB 4PJGB 5DEGA 4CN1A 4S1RH 3V6OC 4ZOEA 2R0WH 5C2BH 5I8CA 3V6OA 1NLBL 5EULV 5JOPD 4XI5C 2LABA 1TPXB 2NY3D 4ZFOA 3MBXH 5E56A 3D69A 4I13B 1I9JH 2F58L 1FV1B 1X5JA 4AIXA 3V52L 1KIPA 3GDBA 3DTXB 3BKML 2J8UA 5HGAA 4LPYA 4RDQG 5D1ZC 3G6AA 1UKQA 5DRWB 2EEAA 1D5BA 5D1ZA 4ZG1A 3RPIB 4UQ2B 1DL7H 3MNVA 4HKJA 3HUJE 1LE5B 2DIJA 1XF3B 5ANMA 2VDNH 2R15A 1UVQA 1KPRA 1S9XA 1OPGL 2C26A 4WUUD 5B3NA 1DQMH 1NBZB 1EJOL 2BVOB 3B2VL 1G7HA 2DDQH 4XRCA 4Q6IC 2ZNWA 3TO4C 1RMFH 4B7LA 4Q6IA 1I3RA 1FG2B 3IU4L 3TO4A 1UZ8B 4K23L 4NPYA 5JDSA 3LAFA 5DEZA 5TQ0H 1MHCA 1A5FH 3MCKB 4PJIB 1RZFL 3SE9H 2FATH 2AV1A 5IK3B 4G6AD 32C2B 1XZ0B 4BZ2L 2CLVB 3H9HA 4IDLA 2BP3A 2FGWH 3F58H 3MRGA 2ZG3A 2L0DA 3TZVD 5BRZA 4ZODA 2EH8H 2OCFD 5CP3H 1FNSH 3TZVC 1INDH 3LB6D 4OZFH 1MI5E 5ID1A 1W0VA 2NY5H 1HOCB 3TZVA 4F57L 1T03H 1OARH 4M6MH 2PW2A 1Y6NR 2W0KA 4X99A 2ADGA 2ZUUA 5IB1B 1HH6A 3S37X 2EKSB 3ZDXE 4PGDB 2AJSL 1BOGB 1S7SA 2EC9U 2J7LA 3NCBB 1FG9C 2W0FA 5CGYC 5EU6D 4H26B 4UUJA 4N90E 3ARED 1YEHH 3MLXL 2FJGB 3BQUD 1JZ8A 2X09A 3I75B 4JHAH 4XPTL 3T08A 1JHLH 5DFVC 4XBEH 3F5WA 2DOCA 1P6FA 3GI8L 4AH2B 4L1HA 1ERNA 2PNDA 5L6YL 5KBNC 1I1FB 1NC2B 3MRFB 2ZCKH 3HAEA 2WMPA 1EA9C 2A9ML 3EBAA 5ILTH 1F5WA 2Z35B 4JFPA 3PE9A 3L5WA 2ERJC 3QDMB 2FH6A 4JPKH 1P84J 3MLWH 4MD0B 4LBEB 1ZXQA 2IWGA 4G9FB 2DM2A 5DJXB 5L88H 1JHKH 4PJGA 1VA9A 4KJYB 4RFEB 3ZE2F 4XCCH 5AYQA 1LO0L 3GO1L 1I9RH 1BF8A 4OD1L 4L3ED 1ZA6B 2EEBA 5F7LB 4P48A 3ZLQC 4JZOB 3IJYB 4NNPH 1TPXC 1JUFB 3VXUB 3C8KB 2BERA 4GQ9H 4XH2A 2FEEI 1H3VA 4F58H 2MKWA 3IETB 1U8LB 1FV1A 2Q8BL 2BVPA 2E7LC 5D72L 2AK1L 3DTXA 4PJ7B 4AM0B 2B8OT 4HXBH 4CL7A 2E7LA 4PS4L 2D3VA 5AZ2H 5DRWA 1RI8A 2CDFB 3BZFB 5F6IB 1PKQA 1KFAH 3PP3K 1LE5A 2LTQC 3BP4B 2PYEE 1MLBA 3IS0X 3G5ZB 4WWKD 2RBLA 4LSPL 1AD0B 4HAFA 3ISWA 3WUWG 5IGXL 1BWWA 3PWVB 4JB9H 4OLVH 1NBZA 2BVOA 3OXRB 4IIQB 5HDBE 1AC6A 3CAFA 2VZ1A 2Q8AL 3JUZA 4MS8D 1R0AH 1RZKL 5DQDL 4TSBH 4XNQB 5I76A 1FG2A 1A6AB 1UZ8A 3GI9H 4F8TA 1KGCE 1QZ1A 3DI3B 4PJIA 1EERB 1MJUH 4OBSA 1BLNA 4CBPA 4XNYL 1WVZA 1XZ0A 3FRUA 3IXTA 1JGLL 2CLVA 1IRAY 3BWAB 4KKAC 2EE2A 5EOCH 1IGML 5AWNH 3QPXH 5KVGH 2FH8A 1HOCA 4KAQH 3P0YL 2W60B 1GVIA 3ALXA 4XX1G 2DB8A 3G5YB 1RSFA 4K8RH 2NLJA 4Q9CA 1NGPL 4WHTB 4OCXL 2K7QA 2EDKA 2EKSA 5DFWH 1BOGA 1IQWH 2DIBA 4MQ7B 5GZNC 3EW3B 2HN7B 1QEWB 2IPUK 1TFHA 4MJID 3I75A 5CSZB 1CLZH 4HLZH 4JKLA 1YEIH 4PJCB 2JKXA 1NC2D 1C08B 2HRPH 4P4RB 4AH2A 3SO5A 3BAEH 2I60L 3SPVA 1AC0A 3SKJL 1OL0A 5GGVL 4LLQB 1N64L 4JZJB 1I1FA 3MRFA 4NC1C 3QDMD 2WQRA 2QBWA 2IPTH 3C5JB 4QWWD 3SDAB 4M61A 1SY6H 3QCVH 3QP3A 4QWWC 4YHNB 5BVPH 2Z35A 3ARTA 2ATKA 2JELL 1S9YB 4MD0A 5EORL 2Q3AA 4G9FA 5DJXA 3INUH 2WANA 4OLEA 4ERSL 3V0VB 5T1MB 4DWHA 4JZOA 4F9PC 2VE6A 2D7MA 3VXUA 2H6PB 4OLUL 3GJFK 4HMCA 4NRZB 4F9PA 4KY1H 4MA1B 4K71B 3O6MH 3AUVA 2IAMD 4YIQA 3ZHLA 3T0VA 4R8WH 3VGBA 4PJ7A 4AM0A 2R69H 4LNVA 3LPGA 3H42H 2FB4H 3BZFA 4LEXL 1XMWA 4O5LH 2B2XL 3BP4A 3KLDA 3L3KB 2YUXA 3KVQA 2CJUL 3N9GL 3I3EA 1MIMH 4JO2H 4PRID 5AZEH 2FX8L 5FHAL 1S7WA 1AD0A 4EKXA 4IIQC 4JKPH 2CD0A 5FHBL 4YXHL 3LRSB 1NAMA 3HMWH 5L8LB 3BRGC 1UCBH 3E3QC 3OXRA 4IIQA 4G8FB 4GBXB 3TA3B 3VFNA 4GS7B 2NY2D 4H0GA 1A6VL 3BW9B 1N5AA 2DQCL 1F8TH 3VFPB 1LQSR 4NWUH 4XNQA 1CG9B 5HYJE 5EIIB 3RVVD 3NTCH 1A6AA 3RVVC 3HKFA 5EWIL 4ZUSA 1BD2A 3WNLA 3CVHH 3WDJA 5DXWA 4OCRL 3TFKD 1CI5A 3FQTB 4NHCL 1GGBH 4PJXB 4CKVX 4JEGB 4IRSD 1A6WH 3PV7A 5KJRH 1KSRA 5GZOD 2XZAH 3T0WA 3GBMH 4OZ4B 1CIUA 2YPLB 4LPXA 2W60A 5F72S 1FPTL 5BQ7B 3WEXB 2ZUWA 4E0RA 5T1LD 5DS8B 4Y19E 4WHTA 4XCFH 1GHFL 5EU7C 2X1QA 3QWRD 1BQLH 1FDLH 3JWDC 1EAPA 3MUZ1 5DC4B 5F3HB 2BY0A 3WLWD 2PW1B 3FHAA 2EKJA 3STLB 3V7MA 3QWRA 1RFDH 1KTRL 3WLWC 4RA0C 2BSTB 1QEWA 2HN7A 4IOFD 5CSZA 1P84K 2A1WH 2BVTA 4PJCA 4D2NA 2QLVB 2NY5C 25C8H 1Y6KR 2Y9RT 1C08A 1S8DA 3GHEL 3T8XB 4OZFA 5DD5L 1C7TA 4XGZB 4LLQA 3SDAC 1E6JL 4DN3L 4E5XB 3IDGA 2XT1B 1MQ8A 4TQEH 3SDAA 4YHNA 3FMGH 3MGTB 1GGCH 1S9YA 4MA3A 1CD8A 1OTUD 4PB9H 5EU5B 2X89D 3QUZB 5F44A 5EPMA 2BHYA 4WI6A 5MENB 3O0RH 4Y2OA