2OTPA

Crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
194
structure length
193
Chain Sequence
b'LPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQCLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily A member 2
publication title Crystal Structure of 3D Domain Swapped Dimer of Immunoglobulin-Like Transcript 1 (ILT1/LIR7/LILRA2), Molecular Insight into Group 1 Activating Receptor Forming Unique MW Interaction Pattern
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 193
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otpA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otpA02
3TA3A 5BVPH 4MQ7B 1FAIH 2G2RB 2UUDK 3QIUC 4ZO8A 5E08L 4TSAL 2VZUA 3P9WB 2DI7A 3TF7C 2N7BA 5EU7E 1H5BC 3LY6A 4UT6H 2OL3H 4NSKA 5KVDH 3GMRA 5HDOA 5SX4I 4D9LH 3ELAT 4Y19E 1S7WB 4DVRL 1RUKH 1AGCA 2GEEA 2LU7A 1PKQB 3RUGB 4Y19A 5KVFL 1KCSL 1QFHA 3WIHH 1P4BL 3MRBB 5DT1L 4P3WA 3F5WA 4U1KA 1NL0L 3L7FB 1JZ3A 3FFDA 4HUXB 4XXCC 5KANI 2F15A 1F4WL 3HRZA 5FXCH 2ZOLA 3OG4B 3MGOA 4LLDB 1CXEA 4OCLC 3PL6C 1D3CA 1JGLL 1FZJB 1MI5D 2P43B 4XPAL 1A0QL 3IS1X 3MV9E 5I8CA 3ZDYE 1TPXC 4DN4L 3NCYS 4JZNB 2V7HB 2VZSA 5MENE 2HH0H 2VKWA 4Y4KD 3VXQA 1LO4H 3U9UA 1T22B 1O7SA 3MV9A 4U1MA 2Z35B 5JQHC 1LVEA 5JMRA 3TBWB 4AT6A 4B41A 3HE7D 5FO8A 5MENA 4AZ8A 4MXQD 2DMKA 5JO5A 3EYQD 4NNXB 1DUYA 3C8HA 4Y5YB 3MLRH 4XVSH 5CLWA 4NZUH 4KZEH 1RZKH 1KLGA 1V3JA 5J11B 5J1TC 1QEWA 1KLUA 4K3GA 5MERA 1KG0B 3ZKXC 1FSKC 2DLGA 4LRIC 5EOCL 4XB7A 1FH5H 3MLTA 15C8L 4TUJB 1WWWX 3DX6B 32C2A 1AQKL 1IAIM 1L0XA 2Z31C 4MAUL 1MHCB 5ENWB 1NFIA 2HKHH 5IMKB 4R6UA 4UT7H 4TUKL 1A6AA 5B39G 4KVNL 3CFDA 2APVA 1FZOA 1SYVB 5HYQA 3BH8B 4HQQH 4M7LH 4WY7H 2XTJB 3EJYC 2H32H 1I1AC 1T1ZA 1J5OH 5A16B 4MA3A 4OZ4B 2DBLL 5D7IE 3MRPB 4PJXA 1RK0A 3U4EA 1J0ZA 3MGTA 3QRFM 1ZHBA 1NLDL 4X6DE 2R4SL 1D5ZA 1R5VA 5D7IA 1XMWA 5E7FA 5DK0B 5GS2H 1EHNA 3DUSA 3HNVH 3WHE1 5EFIB 2XQYK 5BZWA 1CG9B 5CJOL 3LN5A 2R0LL 3CDCA 3MRIB 1AXTH 1PLGH 3DMMB 3MNZB 1DBKL 3SKMB 5D7JA 1MFEL 3GBNL 1VFOA 5IB2A 3QDMA 3FQWA 5T1MB 5ABDE 3OF6A 2X41A 2COQA 5FUZH 1FCGA 3QH3A 4EOWL 4LMQE 5INDB 5EA0H 1QBMH 5GJTH 4M02A 4Z9KB 2GJ6A 4Q7DA 4UDUA 2JCCE 3VGEA 1RJYB 4F3FA 1FAKT 1HYRC 1CDCA 5CD5D 3N9GL 3ZKSD 4QRQA 2ED7A 5GS0H 4GAGH 1CFQA 3U46B 1FDLL 3CSYB 4GAYA 4WI2A 3CMOL 5J7CC 1OP3H 1RZIA 4L3CA 4RMVA 3T2QA 1AKJB 3GI9H 4KHTL 5E2TH 2C4XA 5T3XD 1HQ4B 1QVOB 5EU6E 3BO8A 3QIBD 3MZTA 1JWSB 2VDPL 1JE6A 1Q72L 1RVFH 2M1KA 4LSVL 4CVZA 4YXHH 2ZUXA 1II4E 1SQ2N 3NVQA 1DBBH 2VKXA 5I17B 1JL8A 4NQEE 1JTPA 4NQXA 3AU1B 1OY3B 1L0QA 4P2CG 5JLZB 3CH1B 3EYFA 2Y9RT 4RAVA 1SEBB 4DK3A 2CKBL 2YHGA 2E6JA 5JXAH 1IGJB 3SGDI 5GRZA 3OGOE 4JR9L 3T0VA 1MCEA 3P0VL 4NZJA 1UKQA 3HR5A 2YA2A 2P8MA 3ESUF 3MLSH 4IOFC 3GHBH 4M6AA 5CEZD 2EECA 2BOBA 4LLAA 4P5MA 2W9DL 3PHQB 4RNRB 3ZDYF 1FRGL 3V4UL 1EUTA 1CL7I 1F2QA 3UDWA 4KTEH 1KTLB 3BVNB 4JJ5B 3RZCB 4U1GB 4GW4B 1G7PA 1WFTA 4NNYA 5GGQL 4XNUH 5I15H 3U0PA 4Y16A 1OW0A 3VI3E 5IB4B 3OJMB 3P4OB 4TNVF 2YC1B 3DECA 2QHRH 1I8LA 1D5XB 4HT1L 4ZTOH 5D7LA 1U93A 4JQXA 2W38A 1HWGB 4BQ6A 1I7UA 4Y89A 3V6BR 5EU6D 3O4OC 3EFFB 1CE1L 1KEGH 3KYAA 4WI5A 2NY6D 4Q9QH 1H8NA 3CVHA 3RGVA 5D6DA 3BWAB 4KMTH 4PY7A 5ITBH 3WYRA 1ZHLA 4P3DA 1ZT1A 3K4DA 1DL7H 1MRDH 2FECL 4X99A 2V17L 2HMID 1U36A 2DF3A 3ARZA 2NYYC 5DFTA 1ZVYA 1ZSDA 4I2XA 5JXEC 5ID0A 3DYOA 1JPFB 2AJ3A 5IFAL 5FECA 4ZMAT 1N59B 1DQLL 4KQ4L 1FFNA 5D1ZB 3OKMB 1BFOB 3H2WA 3T1FA 5B3NA 2YUWA 4OQ1A 4P2RA 4XPBL 2BHUA 4F7CB 5C08E 3SDDB 1MUJB 3CD4A 2HWZL 4X6DF 3QDJA 4TTDD 1MLCB 4Z7VE 2H2PD 2IPUK 2EDJA 1IC7H 1NMCC 4HS8H 4NNPL 4P2QE 1GRWA 1WZMA 2Q1EA 4DFHA 1S78C 5KOMC 3I75A 5DD1L 4LLYA 5BV7C 3ARDA 4P9HH 3OB0K 5J57B 5IFJA 3TT3H 3DIFB 4LQ1A 3BDYL 4PGDB 4XCNB 3I50L 1YA5A 2YZ1A 3QXTA 5I19H 3C5SB 4A6YH 3VWJA 4GUPA 4PJ8A 5IV2B 3QG7L 5I1IH 4OGAC 4JE4B 3LDBC 2O93L 2MPAH 4NBXB 5D1XA 3DJ9A 1FQ9C 5FUOH 5CJXC 2JCCF 4HUWA 3WN5C 2PYFA 1CS6A 4ODVH 4O9HL 1KUMA 2VUYA 4X98B 3P2TA 5GSVA 2UYLB 2HVJB 4ZFFA 3QULB 3VXPB 3VFSB 1MI5B 4FQ1L 4FQHA 1BM3L 3U0TA 1JNLL 3EO0B 2APTA 1JK8A 3MCKA 1NAMB 1CQKA 3VRLE 3PWUB 2LU3A 4HS6B 4U1SB 4GMTH 3MREB 5EH1A 1Z5LB 1TNNA 4CUCA 4PJCB 5C08D 2ICES 1BJMA 1QP1A 2R2EA 5I1HL 5FM4A 3VW3H 4LSSH 4P2QD 1CI5A 4NSKB 4F7TB 3QFDB 4Y5VC 4EBQH 4KVCH 3DURA 1VGKA 5HHOE 3UTPE 1JF1B 3V7MA 4C59B 2NXYB 4Y19B 3QI9D 3KYNA 1MF2H 3U7AA 5JOPE 5KVEL 3VG9B 3F5WB 4U1KB 3BT2L 1YUHA 3TCLA 3FFDB 3LAFA 1LK3L 4LSPH 1EH9A 1UWEH 5EO0B 2ZCLL 2G60H 3HRZB 3GHEL 4XCFL 2ZOLB 3MGOB 1O7VA 5IB3B 5TQ2L 1OF2A 4BKLA 4PGZA 3GBLA 1DLHA 3TCXA 1PX3A 4OLUL 5HYEA 3IFLL 5I8CB 3QAZB 1YDPA 2FGZA 2P8PA 3ARBB 1KNOA 2OK0L 5DSCA 4QXWA 3U9UB 3NCFB 3MV9B 4MNQA 2EICA 3X3GL 4WEBL 4LEXL 4F80A 3VI3F 5J8OA 3QNZA 5IESH 4BQBA 5MENB 2X10A 4O00A 3S98A 5GGVL 3CC5B 1N5YL 1WBXA 4H8WH 2A83B 4WWID 1H0DA 3S35X 3HI1A 1T2QH 1KLUB 4KJYA 5MERB 1M6OA 2LE9A 2XFXA 3OJDA 1MSPA 2KQMA 4U6VH 4YO0A 3D39E 1KGCD 32C2B 1A6WH 1WIPA 3CXHK 3RWGA 3MFGB 4ODTH 2RBLA 3TVMD 1RUQL 1HI6A 4LLWB 5B8CA 3ULUE 5HHOD 3RWFB 5GISL 3UTPD 5CCKL 1A6AB 4IJ3C 3CFDB 4ESKA 1HSAA 1MJJA 4LAJH 1FZOB 1CVSC 5HYQB 1L9MA 5JOPD 1U41A 2EO1A 4JRWA 1MNUH 2K9UA 5IW3A 4PGBB 3GSXA 3MBEC 3PQYD 4PJXB 3HNSH 4HK0A 4G80A 5E94A 3U4EB 4WGVB 3D9AL 3HE6C 1LDSA 5LJYH 1CICC 3CPLA 2NQCA 4Z7VF 1Y6MR 4L8SC 2FZ3A 5D7IB 3B2VH 4OCYL 5GGRY 3VFRB 1AXSB 2BNQE 3MLUL 1S7RA 1JZ4A 1N0LA 1FPTL 3DV6A 4PJDA 2GITA 4C4KO 4X6DB 5BZWB 1IC4L 4PB0L 3UTQA 3LN5B 4WW2A 4JRXE 3SJVD 4XZUB 5KVGL 4HX1A 5D7JB 5H37H 1QRKA 5IBTL 5F3BB 1S7UA 4OZHE 1DBJL 3VFVA 5GJSL 4QXGH 3QDMB 1MJ7H 1JPSL 1ZK9A 5AZ2H 2H45A 2ZSWA 3LH2L 3WFDL 3LHPH 3ZO0A 3UDWC 4OF6A 1G9MH 2FX9H 2ZP0T 4OLWH 4OZHA 3HI6L 3IDGB 3WFHB 1GGIL 3D39D 2GJ6B 4TUOB 1N6UA 4EDWL 4F3FB 4DJMA 3M07A 5TPWH 4QRQB 3SDCA 3AAZA 1B4JL 2JCCB 3NTCH 3ZHDA 4JQXC 5D93B 5E70A 3VGFA 4JFYA 2A9ML 4GAYB 4DUVA 3AC0A 4I13B 4DKFL 4FQLH 4L3CB 4L3EE 4P2OD 2OI9C 3W39B 4PRPA 5D96B 4KJPC 3C87A 4P9MH 3LEVH 2VE6B 1IGYA 3BO8B 4PREB 1FFPA 3OZ9L 3BP7A 2DYPA 4HLZG 2BNQD 3HMXH 1YEGL 3C5ZD 4YHNA 4CVZB 5TF1L 4UQ3A 1KJ3L 1RPQA 4XPFL 4LDLB 3WSQH 5EU6B 1CDBA 5HY9A 4K7PH 4NQXB 3W81A 1IAIH 1Q0XL 1FE8H 4JRXD 2NY6B 5FCSH 2IPKA 5KN5B 5IEKA 1S9YB 4NQEB 2V7NA 3MO1A 4BQ8A 2CJUH 4QRRE 3MACL 2B2XH 3TN0C 4JVWA 1BLNA 3MRLB 3LV3B 2P8MB 1FJ1A 5E4EC 4P57A 4OD3H 5BO1L 3NFSL 2XA8H 2BOBB 4IRZL 3FRPG 4NZTH 1JN6B 3QHFL 1A9EA 2R2HA 2YD8A 5F7DA 3V79C 1T89C 1REIA 4ZNEE 4DKEL 1AR1D 2H26A 7FABH 1G7PB 3QNYA 4YEEA 3QUMH 1ZLVK 4H1LG 4NNYB 3LZFH 1RULL 3O3EA 3U0PB 2XKNA 4Y16B 5D1XC 4Q6IC 4OM1L 1ADQL 4G7VL 4AIZB 3MBXL 2AGJH 5DHVH 4L3ED 2F19L 5L6YH 2FSEB 3LPGA 5TDNB 1U93B 1KV3A 3A6CL 3EGSB 1U8KA 4HZLA 4ZODA 5LWYL 4P5TD 1EMTL 3HNTL 3UPRA 4M5ZH 3CVHB 4XNQB 4C58B 3ZKMC 3RGVB 1KCKA 1RAMA 1UACL 5JW4N 4PY7B 4LNRA 1ZHLB 4P3DB 1ZT1B 4X99B 3EW3B 3IJHA 4NC0B 3AS0A 1ZSDB 1YN7A 3WUWA 5ID0B 3ECBB 5FECB 1Q38A 4PS4H 1A6ZB 3HMWH 2GT9A 1JNJA 1RZ7H 5DURB 4QRRD 3QUYA 4S11A 1FFNB 3PGFL 1ONQA 2XZQH 1NGQH 2K7PA 5T1KA 1KENL 3IDYB 4YC2B 4YR6A 1BJ1J 1Q9WA 2ZUTA 3NGBC 1AI1L 3QDJB 5FGCB 1YYLH 5IMLA 3UAJC 3DSFH 1QNZL 5HJ3A 1IQWH 1CXKA 2DQGH 4OI7A 3DO7B 3HZYA 2IGFH 5C08B 4KTDH 2R39A 4M9OA 5E99H 3B5TA 4LGRB 4NO0D 3CU1A 1B88A 4Z7VB 2QSQA 5FOJA 5IKCA 4C57C 4G6KH 4HUNB 3I75B 4J1UA 4OF3A 4LLYB 4P2QB 3ARDB 3QQ9D 4ERSL 1NMBH 5D1QA 5E00A 4OZHF 3LCYA 3KYMB 4N5ED 4HMCA 5J1AA 4JZOB 4XH2A 3QXUA 3VWJB 1LO3H 3DETC 4GUPB 4PJ8B 2X1QA 5F21B 2E7LC 3EIFA 4PJ9C 4ZAKD 4KKBD 4G8IA 2L0DA 2ZPKH 3U6RA 1FVDA 1I8IB 3GIZL 4M7LT 4GXUM 2A6IB 4XI5D 3LKNB 4GQPH 3TBYA 1NCBL 5T3ZL 3SQBA 5I75B 5GSVB 1A4KB 3Q5OA 4ZFFB 4PFEA 2SEBA 4P5KA 1A47A 3OB8A 4FQHB 3U0TB 1GXEA 1P84J 4UTBH 3C08H 3QPQD 3S5LA 1TZGH 1HK6A 4YFLF 1JK8B 3MCKB 4G9FA 4QHKJ 4TRPL 1NGPL 4KRNA 3FO1A 4K7PY 1YNTB 1R24A 2MKWA 4JZJB 1GYAA 4N68A 3BPLB 3FFCE 4CN1A 4D3CL 1FL5A 43CAB 4OT1L 4F15B 4Y1AD 1H15A 5JNYA 3VXMA 5C6TL 3VFGL 1UM5L 2DKUA 4Y2DD 4ZQKA 1B90A 4J2XA 12E8L 6CGTA 1X4ZA 4XP4L 3TESA 1FV1B 4TSAH 1IEBA 5CINL 5IFHL 4KK9D 2WIIA 3DURB 1I75A 3T0EC 4X4ZA 1F8TL 1ZS8A 4HULB 1EGJA 3KYNB 4DVRH 4JKWA 4NCC2 3WFBL 2J6EL 4ZDHA 1YUHB 1QSFE 3HB3D 3LVEA 2QEJA 1P69B 4OLVL 3GBML 5DT1H 4JDVB 3O2WL 3CIQA 2PCPB 5I16B 4WW2C 4Y4HA 2A6JB 4FQXC 1H3WM 1DLHB 3LSOB 5F1IA 1F4WH 3R1GL 4DOHE 2EXWC 4NQCE 1PX4A 1YDPB 5DLMH 1NAKL 2P8PB 4OJFL 3GSQA 1F13A 1JGLH 2AJYL 3F7RA 4MB4A 4XPAH 3UTSD 5E6IA 4BSJA 4YHOL 2DI8A 5HSFA 3VCLA 3L3OA 4NQCA 5TE7L 4Y5XB 1A64A 1OTSD 4X9HA 2B0SL 5D8JL 3QNZB 3GB7A 3PNWA 2BJML 4KROB 4S1SH 4K55A 5D7KE 1WBXB 4WWKA 5L7XH 3FFCD 1H0DB 3VG0L 1TVDA 2FRGP 3ES6A 4XBEL 1A3LL 1WEJL 3SDCC 4KJYB 4M7KH 4NHCL 4QLRA 3OJDB 3P4LA 4YO0B 3U4BH 1MCDA 3BZDA 2CRZA 2E3VA 3RWGB 3O8XC 4X4YB 9CGTA 2BXYA 1D6EA 1HI6B 5B8CB 3R06B 15C8H 3VD3A 4TNWK 2H3NA 1AQKH 1ZANL 5B22A 2E9JA 4OCXL 1MJJB 4MAUH 3QCTL 1ORSB 2XKSA 2YPLE 4GRMA 1QSFD 4KVNH 3EHBC 3GSXB 3FCTA 4OUUA 4WFEE 3BIKA 1S9WA 4QXUH 4MJ6B 4HK0B 1XCQA 3EO9L 1HWHB 3IFNL 1MCHA 3CPLB 5ESVA 1DTUA 1DQDH 4RWYL 1KCUL 2FZ3B 5EOQH 2P47B 5L2KE 1S7RB 3DV6B 5GS0D 3QWRA 1LE9A 1NLDH 2R4SH 4IMLA 4QHMA 3UTQB 5C9KA 2BNQB 2D9QB 5L2KA 2V6HA 3C5ZB 2AABL 5DJ2A 4DVBA 3SY0B 5SWZA 2WWKT 1UJ3C 1Z0MA 4RFEB 5L8LB 2OMNA 5D7KD 4LCWA 3VFVB 2VB5A 3K1DA 3KPTA 1EO8L 3B83A 1UKSA 4MJIE 1HHKA 4HUKB 3UTTE 1F6LL 2X5PA 4OZHB 5A43C 4N0YL 3F58L 2QL1A 3QPXL 1K6QL 3RDTA 1ES0A 3BGMB 4EOWH 3UTTA 2IALA 4YK4C 2DQHH 1V3KA 3SDYL 4D9RE 1NBZA 2ID5A 1RIVL 2VYRE 1GZPB 4LCCA 4PJGF 2EEAA 2E9WA 1A14H 4UU9A 5K59E 2YPLD 3N1MC 3T3PE 5I6XC 4OCNC 1BIHA 4XCEB 2VC2L 2NLJA 3G08A 5CS7A 2DQTL 1FDLH 1X3DA 2X42A 3CMOH 1X4XA 1DVFA 1FFPB 4B50A 4L3EB 2JJUA 3O4LA 5J0BA 3BP7B 2OM5A 4ZO9A 4HK3N 4OGXL 4KHTH 4YHNB 4UQ3B 4CADA 4G6MH 1DFBL 4KK8D 4OZFA 4K94C 5HY9B 5DJYA 2VDPH 2W59A 1YJDL 4P5TB 2X4OA 4NC1C 1W8OA 4XTRC 2Q76A 5IEKB 4S10A 2V7NB 2YPVL 3JWOC 3O41A 2QADD 2UV3A 4MJID 4LNVA 4H20L 5FYJU 3IDMA 1NPUA 2BDNL 3OB0H 5SWSA 4N8PA 4HH8A 2D7TH 2LTQC 1BLNB 3JXAA 3QDAA 4QRTA 4QRRB 4OI9A 3OKKB 4M5YL 3WLWC 4LFHD 4OLZL 4AJ0A 4KRPB 1FYTA 3MA9L 5HVFB 4HGMA 4JFOA 1Q9OA 1A9EB 1ED3A 2R2HB 4KI5C 5AUMA 4D9RD 4XC1L 2C3WA 5HD8D 2IH1B 3QNYB 2W9DH 1FRGH 3V4UH 1TJIL 3O3EB 3P11L 2XKNB 4MZ3A 4K8RC 5C6WH 1A5FH 1HILA 2NMSA 4NO0B 3RTQA 4PLOB 4QHLA 5CSBA 3IETB 3ARPA 4LEOA 1CL7L 4WHDA 1CYGA 2GIYA 2OJZL 4HZLB 4MDIA 2OTUA 4Z77A 3L3HA 5C3TA 3LPWA 4HT1H 1E4KA 3KDMB 2V2XA 2CDFA 2EIBA 3T0WA 1CE1H 4LNRB 1LEKB 1NCCL 2ZUQC 4F9LA 2HLAA 2LVEA 5FKAA 1UWGH 3I6LD 1YN7B 2NX5E 1ZLWK 1CLCA 4WFGD 1I9RL 43C9B 2V17H 1C7TA 1J1OL 4HXBL 1OAXL 3QUYB 4JO1L 2MCPH 1ONQB 5INCA 3RAJH 5E56A 3SE4A 2I9LA 3ARSA 4BK4A 4YR6B 1DQLH 3FTGA 4KQ4H 3HAEH 3FQTB 2ESVE 5HHVL 4HFUL 1MCWW 5IMLB 4IRJD 2AV7A 4PTTA 5HJ3B 1JGVL 1PD6A 4U6XA 2ATKA 2HWZH 5SWQA 3O9WC 2DL9A 3E8UH 5C0AD 2BSTA 3UC0L 1SYSA 4AG4H 1NANH 3DWTA 5IKCB 1DEEA 3CSGA 4JPVL 4NNPH 4WCYL 3WUWG 1P1ZA 5D1QB 5ANMA 5E00B 3FAWA 4NYLA 2ZOKB 3NCJL 4LCIL 4YBQD 5J1AB 5CP7A 4RDQF 4N8VA 4JRYD 4HKZA 4KGLA 5DMIL 4KU1A 3UJTL 4JN2A 4R9HA 4MLSA 3GM8A 3LB6D 1XH3A 3LKSA 5E6IC 4GBXD 1R6VA 4PJ5E 4QHUA 3TBYB 4PJAA 1MCLA 1WWBX 5I73B 3W0WE 1CT8B 5JPNA 4WWKC 2X7LA 4ZFOA 4LASL 4P5KB 4TPRH 5DVLA 2XY1A 3RWDA 4P4KA 5K59F 2D03L 4K3HA 4XBPA 5FYKL 4G9FB 5JW4M 3T3PF 1J11A 1EAPB 3FOMB 1IBGL 3ARGA 1BAFL 5EU3A 2AEPL 3HR6A 5TE6L 1F4XL 2Q20A 1KN4H 3E1F1 3RVXD 1FL5B 4IHOA 5H94A 5DZNA 5JNYB 4AH2A 2X4UB 1VEPA 3FFCB 1FL3A 5ACLA 3MYJB 3H42L 3CFBA 1IEBB 2WIIB 4Y0GA 1ZS8B 3JBG7 2KDGA 5IW1A 1T5XB 3ULSB 1MVUA 1CD8A 1U92B 3HPLA 5AD0A 5BZDA 3ZDXE 5I66A 1GHFH 2R1WA 4ZDHB 2BVQB 4DEPB 1BF2A 3GSNL 5FCUL 1HDMA 5CJBA 2WUCL 3MRDA 1D5BA 4PJ5D 1DJSA 3ARYA 4Y4HB 1QSFB 2ZUYA 1NDMA 1LK3H 3GMLA 1QBLH 3C5JB 4J4PD 2ZCLH 1B0RA 5F1IB 5LXGL 3HS0B 4XCFH 2IAND 3B9KC 3P77B 4LSQH 5TQ2H 3W0WD 1X5HA 3GSQB 4TSCL 1NC2A 4U0RB 4FOMA 2Q8AL 3HHRB 4OLUH 3IFLH 3L3OB 4NQCB 3VCLB 1I1RA 4DUWA 2OK0H 3GB7B 3PNWB 1PKOA 4NN5B 1TLKA 1RSFA 4WEBH 4LEXH 2JB6A 3RWCA 4YBLB 1MCJA 4MS8C 4RA0C 3ES6B 5E9DA 5DZOA 4YPGB 5GGVH 1N5YH 3VMNA 1NC4D 4XMLH 3GMNB 1F90H 4KQ3L 3RX5A 3BZFB 4M03A 5KS9F 1OSPL 3BE1L 1D6EB 2ERJB 4FTVA 1CIUA 3QIBA 3GSOB 2H3NB 4HJGA 5HYIA 5F70A 2YA0A 1X5GA 2OR8A 1RUQH 1VCAA 3VDBA 4GRMB 4P23D 1W8NA 5D5MA 3FCTB 5LGHL 1F4YL 3BIKB 4HWBL 1S9WB 3NH7H 4M8QA 4ZOCA 2QKIA 3B2UD 5GZNC 2YPLB 2JLLA 5ESVB 1IM3A 4R0LA 3QSKB 3DPBA 4K23H 3HUJE 4ZPVA 3QWOB 1JFQL 4FXKB 1J12A 3M17A 5CSGA 3PGCA 1M05A 4FFVC 4N9OB 4QHMB 3LOWA 1ORQA 1OPGL 3LEYH 1VADA 3MLUH 3DVNB 2Z8SA 2IEPA 2UWEA 5L2KB 1FPTH 5DJ2B 4DVBB 2H1PH 2J8HA 2Z4QA 4PJ7A 2AKRA 2GJZA 4PB0H 4M3KB 4U31A 3CX5J 5KVGH 4S1RH 4M7ZC 4ODSH 1PBYA 5I76B 2P24B 3QIWD 3L9RB 4I0PC 5IBTH 4XP6H 3P9MA 1DBJH 2VLLA 4ZSOA 2FX7L 5GJSH 3TGXA 5KSAA 5DMGC 2QADB 4MJIB 3LH2H 3O3UN 3RDTB 1ES0B 3UTTB 2IMNA 3RY6C 3PWPD 1NSNH 5DTFA 5F9OL 2IALB 3HI6H 5DS8A 1C1EL 1GGIH 3EOBB 2NY0D 1NBZB 5CBEA 2ILLA 4LCCB 5HHME 4EDWH 3ULVH 4KHXL 4V1DE 4UU9B 3V6FA 1NFDF 1GCFA 2CO6B 4I18A 4R2GC 3GUTA 4ZTPH 2NLJB 2Q8BL 5HI5D 1OAZH 4JFPB 3G08B 3BIBX 4V1DA 1XF4A 4X0KB 2ENSA 3JUYA 1M7IA 4F9LC 2NY2B 1O0VA 3LN9A 1DVFB 4NBZB 3O4LB 4HPYL 4MAYA 2MCG1 3O6FA 4CMMA 1FNGB 1BVLA 1VERA 1BWMA 4OZFB 4DZ8B 5DJYB 3OZ9H 4W4NA 5CJ8A 2HP4A 2EKJA 5ECJE 1YEGH 1GGBH 2PTVA 2X4OB 4AM0B 5HGDA 1KJ3H 2Q76B 1E6JL 3REWA 1Z9LA 3MV8A 3FO9A 3MCG1 3ZDXF 4YWGL 2YD6A 1Q0XH 3O41B 1JWUA 5E8OA 2PO6A 4YHIA 3L7EB 4NFDA 5GGRB 5SWSB 1XGYL 3U0WH 2V5TA 3SCMD 4HUVB 4WW1B 3ZTNH 1I7RA 3EOAA 5F9DC 3C8DA 5C0RH 3BYTA 1JI1A 4YGAB 1FYTB 4JFOB 1Q9OB 3IYLW 1ED3B 2Y1VA 3MRCA 1HNFA 5AUMB 4Y4KC 5BO1H 4L4JA 4E41A 1P4IL 3VXNA 5GGVY 2Q7YA 3VGDA 4R97B 1XFPA 3V52L 4NRZA 3QHFH 4ODUA 3IAQA 3HE7C 3MRRA 1JNHB 4MXQC 1HILB 3EYQC 2VXVL 3RTQB 5JA8B 5MEOA 1E4WL 2NPLX 4K9EL 2ZCKL 4DKDC 5F96L 1RULH 4GG6E 3G5YA 1QO3A 4ZUVA 5TGBA 4OM1H 4WU5A 1K9TA 4G7VH 3MBXH 4M43L 4MDIB 2OTUB 4Z77B 3Q1SH 5EU7C 3V0VA 1PY4A 5IOPB 4JM2D 1K3IA 2BSSA 2V2XB 2CDFB 3BD5A 3VMPA 4FZ8L 2WAHA 3WXVH 5BV7L 4TSBL 2QTEA 1EMTH 3HNTH 4GBXB 2WP3T 3KPLA 5A1AA 2HLAB 2X1PA 5FKAB 3BRFA 3GI8L 4NRXA 2XQBH 3L5WA 1T0MA 1AE6H 3OKDA 2CLVA 1GOFA 2DQCL 2QLVB 1MOEA 2NX5B 5INCB 1F6FB 4FABL 1P4LB 3AREA 2I9LB 3BKYL 3MJ7A 3ZDZE 2R69H 4NKIL 1K4CA 4TN9A 3HUJF 1OAUL 1KENH 4RAUA 3T2OA 5KTEH 2RIKA 4PTTB 4Z7OE 4ZXBA 3W5MA 1FG9C 4U6XB 3V5KA 1AI1H 2ESVB 2ATKB 1U8PA 1UWXK 5DA4A 5SWQB 4RFNC 1T83A 1BGXH 1VHPA 2BSTB 3CVIH 4LARL 1SYSB 3VFUA 3Q2CA 1QNZH 2R0WL 4HF5L 2CO7B 4PD4J 3BUTA 3NFPA 4RBPK 1RD6A 2NXZD 1P1ZB 5ANMB 4HCRA 4PRIE 2CIIB 4NYLB 2X44D 2Q7NA 4JAMA 3NCEB 4K71C 4HZAA 1TTFA 4PR5A 2VZTA 4HKZB 4Y4FA 2EDHA 4ERSH 2GAZB 2OXGA 3PXHA 2F74B 2HG5A 1XH3B 3LKSB 3UP1A 2AJZA 5EO9A 4LQFL 2AXGA 2IBZY 4QHUB 3VD4A 3P4MA 5CD5C 1OAKL 4FFYL 2IQAB 5JPNB 2X7LB 1MAML 3P40A 4F2MA 1ZA3A 2VLJD 1NCBH 5T3ZH 3VH8A 2PTUA 3RWDB 3ARFA 4P4KB 5LKNA 5FA3B 5I9QB 3KGRA 4UQ2A 3NPZB 3W0WB 1D5IH 1BJ1H 3ARGB 3WS6A 5DWUL 1XIWA 4G7YH 3NCMA 5EU3B 2XY2A 1BZ9A 5HYSB 5F3HA 5I8EB 5C9JA 2F5AH 1LDPL 4YIQA 5FYLH 5ALBH 3QUZD 4IHOB 4TRPH 1KOAA 3WKML 4LPCA 3QIBC 3TZVA 1CFSA 4UBDD 2BSRA 3MV7E 5F7EH 1OAQH 2AAVA 4JM2F 4D3CH 1FL3B 2XZAL 1CU4L 4JO2L 4O2CA 4MMXC 1EBAA 5CZVL 5C6TH 3CFBB 2EYSB 2UZIL 1NC4B 1CDUA 4G3YL 3T2PA 1JUFA 4OQTH 12E8H 1T0PB 4XP4H 3TJEL 5I74B 4LKXA 2EH8L 4Q9CA 4PRID 5CINH 5IW1B 2AVGA 1TENA 1A7OH 1MVUB 3HPLB 4GW1A 4R0LC 5AD0B 5I66B 4C56A 4ELMA 1CGTA 3EFDL 3GSVB 4WI3A 8FABA 4NDMA 4U1JA 1HDMB 3WFBH 4XWGH 5DUMH 1VACA 3V5HB 1OGAE 1NDMB 1WICA 3GMLB 4HKJA 5DO2D 4Z7QF 1OTUD 1H8OA 3BDBA 3BGFB 3FT2B 3GBMH 2AK1H 3KYKH 4OF0A 1WF5A 3O2WH 4UOW1 4LL9A 3R8QA 1OGAA 3MR9A 4JKPH 4PP1D 3R1GH 3V5DB 5I71B 4CU7A 1TFHA 1CGXA 1NAKH 1QZ1A 4OJFH 5DZLA 3F7QA 2AJYH 4HWEH 4YHOH 4Z7NE 4M6NL 3WHXA 2UZYB 4GG6F 3RWCB 2BX5A 4L9LA 2B0SH 5C2UB 5I0ZA 2A6KA 2GK0B 2BJMH 2B5IC 5DJXA 3UBXG 2AQ3A 5ISZE 2BC4B 1URLA 1DN2A 4P2OA 1YZZA 4XBEH 1A3LH 2EDWA 3JV4B 2H6PB 4FTVB 4PV8B 4XNMA 4OFVA 3CFCL 3TPUA 3UZEA 5GS3A 3T4YA 4M00A 4KKAD 1YEIL 5MI0B 3G5VB 1F5WA 3O6FC 2IAMD 4LLMA 5FUCE 4OCXH 4ONHB 3OR6A 2QKIB 3QCTH 4JG0H 5HGGS 2Q86A 4LPYA 5GGSA 1B6DA 1JGUH 3KYOB 2CKBA 5C0ND 1IM3B 4P46D 4PD4K 3KJ6L 1QLRA 3PDGA 4R96A 2H2PC 3WJJC 4ZPVB 3E3QE 1FL6A 1UXWB 1Q94B 3IFNH 1M05B 2NZ9D 4UT9H 3JSSA 5L0QB 1E4XH 1ORQB 3HUJB 2DJUA 1D6VL 3HZKA 3NZHH 3CVHL 1CF8H 1GGYA 3N1GC 4UAOC 5AG8A 3GSWA 4MA7L 1TVBA 2E7HA 3QUMB 4PJ7B 2Z4QB 1HKLL 1CXIA 1FCCA 4QF1A 3LPFA 1U9KA 5GIRA 4Z5RA 2IH3A 2AABH 5E8NA 4FN0A 1CFVH 4OD2B 1U8MA 1DCLA 5DHVB 2B39A 1AFVH 1A1NA 3P9MB 2V5YA 2VLLB 4RGMB 4ZSOB 5KSAB 3BPNC 1EO8H 4JG1L 3TIDA 2BRQA 3MRKA 3MRFB 3IJYA 1OB1B 5IB5B 4GKZA 3SCMB 3IDUA 2VLME 2DM3A 3QPXH 4WVRA 1KTRL 5CBEB 4WHTB 3QEUA 2X2YA 1P9MA 4UDTA 4BZ2L 3RI5K 3D18A 3V6FB 3RY5A 3FOLA 4I18B 1RIVH 2MFNA 5DD3L 5HHMB 3VFOB 1ZLWH 5FGBC 1KIUA 3JV5A 3U79A 5J56B 3X12A 4V1DB 4POZD 3MODH 4L8CB 4UILL 5JHLH 4XP9L 3BUYA 4NIKB 3FQUA 2QQNL 1M71A 4MAYB 1P7QD 2DQTH 1UZ8A 3TBTB 2OR9L 3BP6A 1UJTA 3JTSA 3LQAC 4LOUC 4MNHA 3WXWL 3ZHKA 4RMSA 1BVLB 3MFFB 5EIIA 1BP3B 5FF6B 4OGXH 1EFXD 4QRSA 5HGDB 1T20B 2CUHA 1GGCH 3QI9C 1QLEL 4UNTA 3B6SB 4KWUA 1DANU 3MV8B 3FO9B 2J4WH 3ARUA 4D2NA 1F3DJ 4X6BA 3OR7A 3UXFA 4M6OH 4WV1C 2PO6B 4YHIB 4ZXBC 3HC4L 2X9YA 1XF2B 2YPVH 4AEIH 4GRWH 4OFYA 1UH3A 2BOCA 4JFHD 2EO9A 5K9OA 2BDNH 1EHLH 3QCUL 2OTWA 1IQDA 4OCRH 3BD3A 3MRCB 4ZAKA 3AS1A 4X8XA 2W9EH 3S88L 2JIXD 4E41B 1INQA 4HDIA 3VXNB 2Q7YB 3RL2A 2FBJH 3BPLC 4ODUB 1HOCA 2RAMA 5J13C 3MRRB 3UBXI 4XC1H 2EKSA 1I8KA 5MEOB 2IG2L 4GS7B 2NR6D 3DVIA 1TJIH 2VLRA 3P11H 4MD4B 4ZUVB 5TGBB 1V7NL 5F7WC 1RUML 3D2UD 1INDL 3I9GL 2XPGA 2OP4H 4GG6B 2YR3A 3MRQA 3ARFC 5BS0D 2BSSB 25C8L 2V5RA 4Z0XA 3QUXD 2W91A 3TVMC 5E5UB 3U7WL 5EUOF 3KAAA 3KPLB 3OG6B 1XGUA 4X7DC 2PF6A 3BKCL 4YFDB 3PHSA 1NCCH 1U6AH 3TZVC 3OKDB 2CLVB 5IGXH 4CU8A 4POUB 3VU2A 4Y88A 2DD8H 3RGHA 1I9RH 3QQNA 2HRPH 3AREB 1J1OH 1QYGL 1OAXH 1BQHA 4JO1H 5C0GA 3DX8A 1K4CB 4RAUB 4U1NB 4V2BA 4XP5L 4Y5XC 3SDAD 2YXMA 1RUPH 3RZWA 5H2BA 3V5KB 1XGRB 5HHVH 4PY8J 1KCLA 1TNMA 1IM9A 3VFUB 2PW1A 5F7HA 3H9YA 2B1HL 4OV6F 2C4FU 4F8QA 3UC0H 1ACYL 2VIRB 5DFVD 1QBAA 5C8JA 4JAMB 4R3SA 4JPVH 4BSWA 1YEKH 3PUCA 4WCYH 4RIRA 2WK2A 4Y4FB 3IDNA 4PRIB 2EEDA 3KPOA 4LCIH 4W4OA 4GMSH 4YJZL 2AXGB 3TO4A 3I02B 3LN4A 4NP4L 5DMIH 3MV11 4JO3L 1T80A 1U2CA 3PF2A 3UJTH 2DRUA 3MRHA 1U2HA 3ZSSA 2VZ1A 2YA1A 4QOKA 2QR0A 3SO3C 5TE4L 1QRNE 3AROA 4F2MB 3DUHA 3MLYL 4L9LC 2VDNL 5IT2L 1B4RA 1YPZF 3FQNB 4UQ2B 1JV5A 4XX1E 1V5JA 4PG9A 1B2WL 1QRNA 3WO4B 1NCUA 1VKXA 3ZYIA 1XIWB 2EYRA 4P2OC 5C9JB 3O45A 2D03H 4FP8L 5FYKH 1UCBH 3I3BA 4H0IA 4QTIH 4YHLL 2F9BT 3NABL 2CR3A 4IRSB 2GSIA 3SKUD 1KJ2L 1OT1A 1K85A 5TE6H 3IGAB 1F4XH 4JQVA 4ZS7L 4NCC1 4O2CB 1FLRL 5D9SB 3MV7B 4H0GA 2HTKD 3H9HB 3O2DL 2PW2A 4OGYL 1CXLA 4LKXB 2HT3D 3H42H 2KZWA 5KVMC 5D70L 3J8F7 1TIUA 1YEJL 4C56B 4ELMB 4NQVA 4RFOL 4NDMB 1XCTA 2EDYA 1VACB 3P0YL 1A6UL 3ZLQC 4HKJB 1R3LA 3GSNH 3QCVH 1AHWB 4JN1L 1LGVA 2FJHA 5JQ6L 3O2VH 1FNSL 1I1CA 1OGAB 1MRCH 1AR1C 3PP4H 3RHWK 2NY5C 2JJSA 5LXGH 5HGAA 5CGMA 1A21A 4LHUD 4BFEA 2AI0L 1LP9E 4HWZA 5EC2A 3RRQA 4RCAA 3GJEA 1QFWM 4E42B 2NY4D 3MOBL 1T21B 2GW5A 1UA6L 1QHPA 4HPOL 2A6KB 5AYQA 2J1KA 2R9HD 2XWJA 3L5XL 3ZT6A 5FV1L 1P9MC 3LKRA 1ZGLA 4R4FH 5J3HC 3HTLX 5ISZB 2H9GA 3QRGL 2ZUUA 4XNMB 1PGRB 3OKNB 4XWOD 3TIEA 1VEMA 2ORBL 5H35A 3NIDF 1BQUA 4GW5A 5JDSA 1OSPH 4A2LA 3MROA 3T4YB 5GHWL 1XF5A 5FB8A 4ZNCD 5D2LE 2FD6L 4LLMB 5GRJL 1FZMA 3BFOA 4JANA 5AZEL 3NCYP 1M7XA 1VPOL 2HJKA 1I85A 4JQIL 5GGSB 2LFGA 1TZIA 1CLOL 3MNWA 5BJTA 2CKBB 2KUTA 4L8DA 1F4YH 4Q2ZA 4R96B 3HI5L 4X80L 3FHAA 1FL6B 2KZ1B 3QNXA 3GSUA 2R29L 1PYWA 3ULVD 1H3GA 4OIIL 3AMKA 3LKPA 1JFQH 3HZKB 5DQ9B 5I1CL 2YD3A 1KIQA 3GSWB 3TH4T 1TVBB 4J8RA 1T4KA 3QQ9C 1ZGLP 1S7XA 1D9KD 1WCQA 4O4YL 4N5EC 2CXKA 2MWCA 5F9JA 2N1KA 3VJ6A 1MVFA 4U0QB 4QF1B 5L2JA 4HC1H 4Z5RB 1BD2A 1INEL 2K3TA 4PJIA 4X6FB 2ZWLT 2AW2A 2OJEB 1IZKA 1QSEE 4L3AA 4ZAKC 1A1NB 4K2UL 3E2HC 4KKBC 1IMHC 1HIML 1ADQA 4RX4D 4HIXL 3TIDB 4XI5C 3OXRA 3HN3A 5AEAA 4FQQA 5EBMA 3IDJB 4ZYKA 3IJYB 2FX7H 1AGEA 4GKZB 3DNKA 1F3RB 2QQLL 3JWOL 1SMOA 1GAFH 3QPQC 4UDTB 5F9OH 3D18B 4QRPD 3ZE2E 3FOLB 4WTXA 2JIXB 5ALCH 3PV7A 4KHXH 4OZIE 2HKFH 3MUJA 2WBJA 3GO1H 3RWHA 4NKQB 3BUYB 3IT8D 3O3BB 3BPCB 4Y2DC 3LKOA 2Q8BH 5CMAB 3FQUB 2AXFA 1M71B 2HJFA 4R4BA 1UZ8B 3HAEB 3BP6B 2L4OA 1HCVA 2DS4A 3H3BC 4MNHB 4YXLL 2EIZA 5EIIB 4PRDA 1U91B 1IVLA 4K8RL 4KK9C 1LD9A 1YY9D 2C1PA 1MHEB 4EUPH 4H25B 5HYJE 5GRWA 4GT7A 1UWXH 3QUXB 3UROR 4X6EA 1RZKC 5EN2A 2GUOB 1MCOL 3H9ZA 4U2YA 5J12B 5JORA 3HB3C 1JWMA 3OR7B 5HYJA 5C0FB 2RCSH 1QSED 5AAMA 1U3JA 5A3IC 5HDBE 4BUHA 4APQD 4YWGH 3HZVA 1MCWM 1KXTB 2F5BL 5CWSA 4MD0A 1IGTA 1WK0A 4JKMA 1F4AA 3QZWG 1VFAB 4J23A 5L8KB 2OTWB 1IQDB 1NAMH 4XAWH 4KUCD 3ULVF 3OAUL 5HDLA 4G6AD 5T3ZE 1UQSB 1TTGA 1EZVX 3S7GA 5DR5L 1INQB 2M26A 4HDIB 3RL2B 1T66D 1LP9F 2C3VA 4NM8L 2QSCL 4FFZL 1OTSC 4GAJL 1HOCB 4LSUL 3HRPA 4R8WL 2HYMA 2EIEA 2IMMA 5T1LA 2EKSB 4YBHA 2OQJA 4XNZB 5IR1A 2PYEA 3TO4C 4ZFGH 3I2CH 1JMZA 4MGXA 2DJSA 3B8YA 3FONA 4Z8FL 3RNKA 3VXSD 2VXVH 4DGVH 2NY3B 4PBVC 1E4WH 4G6JL 1E6OH 3QO1A 4K9EH 5F96H 4RMRA 5ERWB 3MXVL 3QXDA 4LLVA 1HZHL 4YDLB 3E6HA 4Z0XB 1RHFA 3DVGA 2OR7A 5DJCA 4PGEA 5HDQL 2X4RA 1NCTA 3NFNA 4UUJA 4OF7A 4JFQA 3EOTL 3GRWA 5E5MA 1IKFL 4QCIA 1TETL 3EDFA 2Y5EA 4PRHE 2E5EA 5D2LF 3H0TA 5ADOL 1AO7E 5ETUA 3KG5A 2EH7L 3GI8H 4XGZA 4U1LB 4AENA 2ADJA 4PRHA 4QXTA 5JW4Q 3SDXA 2BFVH 3SQOL 1KYOJ 2YKLL 2DQCH 5C0GB 3DX8B 3KPMB 2J6EA 3K2UH 4FABH 1MAJA 2P7TB 5H2BB 4F37F 3RVUD 3W9DA 1CLZH 4NKIH 5T3ZD 5A2JH 1RV6X 1TZHA 3OAZH 4CKVX 1IM9B 3WFEL 2PW1B 1A7QH 1WIOA 1EJ6A 4J4PA 1U8OA 3K8MA 2IANA 3QFJE 2AEWA 3S4SG 4LARH 3LD8B 1KB5L 5FYLD 5ELIA 1LEGB 1T2XA 3T65A 5IB1A 1YEHH 4R3SB 3N85L 1VGEL 2DL2A 4M1DH 4WO4D 1TQBB 2DLIA 2N4IA 2VLKA 3KPOB 2Y5TA 4Z7WA 4RMQA 1BQHG 1BVKB 1C5DA 1E0OB 1RQ5A 4G43A 5ACZA 3LN4B 1IAOA 5CP3A 3NPSB 4WENB 3HZMA 1A6VL 5MP6L 4KUCF 5GS1A 1MH5A 4JO4H 3D85D 4LQFH 4QOKB 4ZFZA 4ONFH 1A7RH 1OAKH 4FFYH 1EA9C 1T5WA 4YFLI 1JV5B 2BNRD 2PETA 2VDQL 2DQUL 2XI9A 1MAMH 1QRNB 3FB7A 3M1BA 4JPKH 4AL8L 1VKXB 2EYRB 4OZIF 4NQDD 5IJKC 3FT3A 5IM7B 2Z8VC 5IVXE 3O45B 2DJ4A 2DQFA 2WUBL 4U05A 1EAJA 3NA4A 4YDIL 5TFSH 4XC3L 3B3IA 5DWUH 1OLZA 2O5ZL 5IVXA 3KJ4B 1J1XL 2ICEA 2XYCA 2VDRL 4GOSA 1TTUA 4WDIA 3H9SE 2XICA 4PBXA 4UV4H 4OLXL 5ESAB 2XZAH 3L95A 3RWJA 2IFFH 3TBVA 1I85C 3QFJD 3G6JE 4CMHC 5CZVH 3QO0A 2A1WH 4CVUA 2UZIH 4BA8A 3T8XA 3WMSA 1MFDH 3GNMH 3TJEH 4NQVB 3MRGA 3QDGE 1EO7A 1XCTB 2X70B 5JPMA 1GPOL 2AJSL 2C5DC 3V6ZA 3O3AA 3UTZA 3QDGA 1R3LB 4ZOAA 4R4NC 5FA4A 2FJHB 4JPIA 5HD8C 2FR4A 3CLEL 2IFGA 3CSPA 5JW5B 1S9VB 2RGSA 3SGEH 3FZUD 2X4NA 5HGAB 4M1CD 3ROOA 4DGIL 4HWZB 2D3VA 3MRMA 3PWPA 1IE5A 1AY1L 4FQJL 3EYUL 3S96A 4HIIA 5F1OB 1G1YA 2WSKA 4JCLA 4N9GA 2ZUVA 5F97E 1EUUA 4R7DA 2ADFH 3DOSA 2XZZA 4M4RA 5K93A 3BP4B 3LKRB 1ZGLB 2G9HA 2EE3A 1FFOA 4WIQA 5CAYB 5J1SC 4M93C 2DIBA 2H9GB 2X1WL 3B43A 3L6FA 1LE5B 1I4FB 1YECH 5I30L 2OZ4L 3BKMH 1CGWA 3VDAA 1Q9LA 3S8WA 5H35B 4ZG1A 5JDSB 2ARJA 2J88L 3MROB 1XF5B 3C6LD 2YUXA 3AY4A 5DVOA 1CFTB 1FZMB 5F9AC 1HSBB 4YH6A 4B0MM 3AS3A 3B9AA 5D2NA 1WC7B 5D2LB 1TZIB 2BRRL 3MNWB 5BJTB 5I1JH 1KTDB 1AJ7L 1H3VA 1W0VA 4IRJC 4L8DB 4R97C 3DXAA 4Q2ZB 4EN3A 5C09A 4NUJA 2I9TA 1J9CT 4PUBL 3KLSA 3S36L 3PGDA 1PYWB 3VRJB 4N0UA 2CGRL 3DRTA 5ADPL 1U3HD 3AB0C 2FEEI 3VFPA 4FA8A 1KIQB 1S9KC 1T4KB 1OQXA 1IGCL 1S7XB 1S7QA 1SEQH 3SKJL 4N1HB 1MCBA 1NUFA 1D6VH 4O5LL 5F9JB 4HIJA 3BSZH 3CVHH 4YBQC 1S3KH 1BD2B 3ZKND 3L3DA 1MPAH 4YLQT 3SKNB 4I77L 4CNIB 1FO0L 4FQQB 1OCWL 1I3GL 1QSEB 3HC3L 5EBMB 4I5BA 2MHAA 4RDQG 4ZYKB 1VESA 5DJAA 3OKEB 1SJXA 4MWFB 2DTML 5DQJA 4JG1H 3MJ8A 5JIIA 1QFUH 1ZXQA 4EVNA 5IROA 3VFNB 3GJFK 5C0CE 4LFHG 1K8IA 4U6TA 5JA9A 1XR8A 5DRNA 3KXFD 5C0CA 5IVXF 4BZ2H 1DN0B 1QFWH 3HCVA 3RVXC 3BGAA 2C1OB 2WBJB 3V6OC 5DD6B 3RWHB 2FJFA 5DD3H 3LKOB 5JHDE 4OZIB 2AXFB 2DM2A 2HJFB 3WLBA 3PXJA 5B39A 2FEDD 2XN9E 1NCNA 4J12A 3H7LA 4PRDB 1LD9B 5JHDA 4PJBE 2QQNH 5KAQF 3G6JF 4IMKA 2NW2A 4H8WC 1PSKL 1XZ0B 4PJBA 3MLXL 1ZAGA 4NKMA 1YYMH 2ZNWA 4ZFOL 5JORB 1FVCB 5HYJB 1ZA6A 4TOYH 5FM8A 4H5SB 5IBUB 1H3PL 1NJ9A 1HQRA 1I7ZA 1QLEH 2VXSH 35C8L 5BRZE 3STLB 3HZVB 3IJSA 4O51B 2E7CA 1A2YB 5CWSB 4MD0B 3N50A 1IGTB 3S34L 3GZKA 4J4PC 3HC4H 5TDOB 3CNKA 4FQCL 1A22B 2P5EE 4A2MA 4OF5A 2W0KA 2N7AA 1H5BA 1H8SA 4XCCH 3M8OL 3KPNA 4GLRI 3QCUH 4ODWA 2C3VB 4OM0L 3HKFA 4HMDA 5KSUA 1A3RH 3S88H 5T1LB 4GRLA 2OQJB 5IR1B 1KXQE 5FYKE 5EU4A 1NGWA 4PRBB 3FONB 5E1AA 5EB9A 1EBPA 1CFNA 3QA3A 2V5MA 4NGHL 4XXCA 1F2XK 3QXDB 4C55A 1V7NH 1WZ1H 2CLRA 5C07E 6FABL 3PL6A 1PEWA 4L4VE 1INDH 4PGEB 2X4RB 3NFNB 1G6RA 1B0GA 4BSVA 4UUJB 4K7FA 1LEIA 2DQIL 5E5MB 2A73A 2X09A 3AXLA 1BWWA 1A1OA 1NCAL 1C8PA 4P23C 5ETUB 5C92A 4GRWF 2IADA 3QIUD 1S7SA 3B2UC 4ODHH 2VL5B 1QUNA 4PRHB 5F7MC 4EIZC 3SDXB 1N8ZB 1AO7B 4OKDA 2VQTA 3VDCA 5FDWA 2BVOB 5KZCB 3EDJA 4ORGB 4I9WE 5FHBL 1AIFA 1K3ZA 4LRIA 1QYGH 1DLFL 3W9DB 4DN3L 4EI5A 2CMRH 2R2BA 5T33L 2Z31A 4IDJL 3P3YA 2DB8A 3TNMA 3QG6A 4ZD3H 4PV9A 2Q6WA 1FNLA 5T3XL 3E6FA 4XNXH 5FYKD 5IB1B 2B20A 1NQBA 4NN6B 4Z0BH 3VXUE 2ADIA 2DQEL 4X5LA 1I1AA 3QFJB 3QIWC 4OD1L 1ACYH 1AD0A 3DMMD 5FO7B 2VLKB 4E0RA 1OL0A 3MMEB 5DUPH 4Z7WB 5ACZB 4G43B 1IGML 1DQJB 2YD9A 3FT4A 2GKIA 4L4VD 3ULUH 3ZTJH 4N0FA 1CE6A 4HEPG 5GS1B 5EZJA 5AAWA 2NY0C 4ONOA 5K9JL 4DQOL 5K9QG 4YHPA 3FAXA 4NP4H 5CZXD 3C6SA 1X5ZA 5C0BE 1IGFH 3BQUD 2BMKB 3G9VA 1T5WB 1EEYB 4UV7L 4EEEA 4C83A 5TE4H 3GM0A 3M1BB 3MLYH 5IT2H 2AV1A 4PG2C 5C0BA 4BQ9A 4YFEA 5CEZL 2VXQL 2DQFB 4CDHA 4P59L 1B2WH 4WUKL 4HJJH 1A7PL 4XXDB 5IVXB 1MREL 4I9WD 1JHLH 2JF1A 4L5FL 2ICEB 4QTHA 1HNGA 4HWBA 3NABH 3AY4C 4Z78A 4OB5H 2P5WA 4YDVA 1JHKH 3G5XB 1R3JA 3EJYD 5IMOA 3TBVB 3H9SB 3TT1L 1FLRH 1KCRH 1L0YA 5D2NC 4DCQA 3QO0B 4S1QL 3RU8H 3JVGC 1F11A 3LKQB 5HVHB 1OGTB 3VXUD 4KZDH 4EN3C 4PLNC 3MZGB 1TQCB 4OGYH 1QACA 4I3RL 3MA7A 5H37G 5IVZB 4RMWA 2WM0A 5JPMB 1YEJH 3L3JA 1P2CA 2OMBA 3V6ZB 2I60L 4FNLH 2PXYA 4IBLT 3O3AB 3UTZB 3QDGB 4RFOH 5AYUL 3LS4L 4IOIA 3P0YH 1A6UH 2FYYB 4YEFA 2FR4B 3K8LA 4KY1L 2B7DT 1B9ZA 2X4NB 1E28A 3EYOA 4JN1H 4YHKL 3ROOB 4ENED 3K74B 4JB9L 3BEWA 3MRMB 3S37X 4KMQA 3G6AA 4MQXD 3S96B 1FORL 1G7LA 4HIIB 1G1CA 4MHHG 1HKFA 3FQRB 5CEXA 1DQTA 5GPRA 4N9GB 4FXLA 1QR4A 4LVNB 2YD2A 2ZCHH 2AK4A 1IC5L 3BWUC 4I48A 2WMPA 2JELL 1DQQB 4WUUA 5JTWA 3KHQA 5J4MA 4FS0A 4K3JL 4R7DB 1QA9A 3MOBH 5IROC 4JM2C 3WS3A 1UA6H 4AMKL 3T09A 3WNLA 1FLTX 2AERT 2A6DB 3W11D 1IEHA 1KULA 1VSCA 3L6FB 3NAAL 1JF6A 5E2UL 5EO1A 3U36A 2GCYA 4MJ5A 5DJZA 3MOAH 1PG7L 1Q9LB 2YSSA 3ETBF 5E2VH 4Q9RH 1RUAH 4KV5E 2BHZA 3UJJL 2ARJB 5B38A 1KT2A 3THMH 3KPSA 3RNQA 3MCLL 4N0CD 1OSZA 1HHHA 4I3SL 1IL1A 2ORBH 1KB9K 1CZ8H 4W70A 2Z93A 4F58L 2DQDH 3KLAA 5IHBA 3RPKA 2YN3A 2FD6H 3L1OL 4UTAL 3LS5L 2EC8A 5GRJH 1W0VB 4LCUA 2YXFA 2WWKO 4XCYA 5AZEH 1VPOH 2ZKHH 5C09B 5ITFA 5D1ZD 4JQIH 1R3KA 4KKCC 4NUJB 4J6RL 5HPMB 1I1YA 1CLOH 3BAEL 3K1KC 4N0UB 4PJCE 4NO5A 1T7YA 1X6LA 3HI5H 3SDDD 4O02L 3TC9A 2RB8A 3VFPB 2NXZC 4OIIH 1S7QB 4UB0H 5JXEA 5DMKB 4F33B 5I1CH 4MX7A 4JM4L 5JIKA 5F6HI 4NKDB 2F54A 4YHYB 5JOFB 4JHZA 3L3DB 3LQAL 4LGSB 3MUGA 4Z7UA 1KPVA 1Q9KA 5K9QI 4HIHA 4LSTL 3X13A 5B3JE 2F58L 4K2UH 3VWKA 4GRLC 2MHAB 3OXSB 4TULL 2FB4H 5DJAB 1HIMH 5EOCJ 3RP1A 3D2UA 2NY7L 4HIXH 3MJ8B 3Q6GL 1WUNT 3HA0A 5BS0A 2GTWA 4PB9L 5E7BA 3CAFA 1K8IB 3WV0A 5A2LH 1X7QA 3JWOH 4MVBD 3QXAA 1ZVSB 4WI8A 2EDDA 2PN5A 3F12B 5DGQA 4KPHL 4FMFA 2P44B 3V4VL 1JI2A 5C0CB 4PTUA 1SBBA 3HCVB 3QUZC 3L3KA 3DO3A 5IMMA 4HCRL 2FGWH 2FJFB 4UZGA 4UBDC 1JGDA 1G7QB 4R90L 5B39B 3GKWL 5KSBE 1A6PA 5I1EL 3NCCB 5M94B 1S5HA 2I27N 3PV6B 3WN5A 5CJXA 3IVKB 1X9QA 3TA3D 5EBWA 2DIAA 1CGSL 5GSRA 5JHDB 1OWWA 5ESQA 5KSBA 4RGNC 2XN9B 4YXLH 3FB8A 1M4KA 2NW2B 3SDAA 3WCYA 4AEEA 4PJBB 1M7DA 4NKMB 3DHMA 2J12B 2N56A 1U8JA 5J9PA 3VFTB 1NJ9B 1HQRB 1I7ZB 1IGIL 4EI5C 4IM8A 2P49B 4OZGA 3LEXA 2C9AA 2NXYD 3IJSB 3RVVC 4Y19D 2CXGA 4LRNL 5DO2C 1OTUC 3ZL4L 3AGVA 3QIUB 3O6ML 1TCMA 5BRZB 1I3RA 3UYRL 4JCMA 4I8DA 2F5BH 3S37H 1AC6A 1H5BB 2HT2D 4PJXE 1I9JH 1RFDL 4MHHI 1EEZA 3KPNB 4MLIA 4Y5VA 5E8DH 3ZT5A 2P5EB 2IPTL 3OAUH 4JFFA 5KSUB 4NQTA 5IBLC 3QQ3A 5GRVL 4MJ4A 2XZCL 3ARBD 3PDDA 3LRSB 2BXZA 2JE8A 2QSCH 4FFZH 4NM8H 5MEPB 1OM3L 3QJFB 4LSUH 3FN3A 4R8WH 3MV9D 1CFNB 1MCNA 1MIEH 3T77A 3QA3B 1UYWH 1J88A 1Z9MA 2F53A 1K4DB 4EIGB 4D9QE 5MEND 4KJQD 1AQDA 2VXUH 2X40A 1ZWIA 5C0JA 2Y06H 2CLRB 1EGJH 3VRIA 3PL6B 1T1XB 2DIJA 3D3VA 1IAII 3QDME 4HIEA 2YZ8A 1G6RB 4PJFA 3MXVH 1NGYA 1TPXB 5C07B 2I26N 4KV5F 5F88B 1WQVT 1LEIB 3D1MC 4L4VB 2GJ6E 2I07A 3AXLB 4KKAC 1A1OB 1RMFL 3L5IA 3IU4H 2IAMC 4LPVA 1UC6A 2IADB 1IKFH 1JRHH 5C3LD 2HAZA 1TETH 2XQYG 3OBAA 3BQUB 3CFJA 3UZQA 5ADOH 4LKCA 5C0NC 4M4PA 4P46C 2EH7H 4NWUL 3BZEA 1NUGA 3TP4A 5DRZA 3N06B 1ZEAH 3ZKXB 1FSKB 4P99A 3SQOH 2NZ9C 2CH8A 1C5CL 2LQRA 3GSNB 4PJCF 1YMMA 4WTZG 3VGBA 5BOZG 2Z31B 5EORH 4WEMB 4GQ9L 5FYJL 1K5NB 3TNMB 1P5UA 3I3EA 3Q48A 3QG6B 4PV9B 2Q6WB 4B7LA 4BFIA 1DEDA 4QNPE 1KTKE 3WNPA 2PXYC 1MHHA 3C09C 4PP2A 2ADIB 1I1AB 3FRPA 2G5RA 1ZKAA 4MA1C 3MBEA 2V9RA 3RL1B 1AD0B 4JJHA 4D9QD 3IKKA 5D7JD 3WL9A 4E0RB 5B3JF 5SX5K 3VXUB 4JY5L 1A7NL 1HINL 3HE6A 1CICA 3FT4B 2MNUA 3MRJA 3QDMD 4H1LA 5F7UA 4DW2H 3OF6D 4L8SA 4YDKH 1DE4B 3MJ6A 4N0FB 4OV5B 4YHPB 1YN6B 1L6XA 3C6SB 1LNUA 4D8PB 3S3PA 2GJ6D 1SY6A 4OCSL 3ILPA 3CSBA 4X5WA 5GRVK 3GMOB 2DWEA 5C0BB 2EYTA 3A0OA 4XBGA 4PYGA 2VDQH 4AL8H 2DQUH 4ZUSA 5IUSA 5D7SH 3DX9A 5JUEL 1BOGA 3UPCA 3E3QC 2NY5L 5DVMA 4QTHB 1R5IA 4XC3H 1T6VN 4DZBA 4XHQA 4HBCL 1R3IH 3TV3H 4N8CL 3IKCA 4YQXL 2O5ZH 5D7LE 2BCKB 2FWOB 4MNGA 2P5WB 2W0LA 4YDVB 5GRUL 1J1XH 1NDGA 1R3JB 2VDRH 5IMOB 4JFEE 2ZG2A 3Q3GB 1HXMB 1NGXA 4GXUN 1KBGL 4DCQB 1CFBA 1IFHL 2W0FA 1F11B 4OLXH 1ZLSL 4AEHL 3C60A 4JFEA 3IFOA 3HFMH 4U49A 3MA7B 2X6MA 1BREA 1KCVL 3L3JB 1D9KA 1CR9L 1P2CB 3SGJC 4I2XE 4NQED 1MQKL 4JHWH 3NZ8B 3QHZL 5E03A 1G7MA 2XXMB 3VE0B 4OCWL 2EC9T 3NA9L 4IOIB 1RZFH 3C2AH 2EDBA 2AJSH 4PJXF 4HKBA 5KBNC 4P2RE 3CXHJ 1E28B 1MEXH 4GKNA 3QDJE 4QKXB 3BEWB 5D7IF 3BJLA 5FGCE 5DJDB 3G6AB 3CLEH 4FG6D 5LGJA 4NPYA 1MWAA 1K8DA 2NR6C 1BBDL 1NEUA 5CEXB 3VXRA 4ELKA 3VWKC 3I6KA 4I48B 4OZFH 5JR1H 2R15A 3F6IA 4HKXB 3EYUH 3MPCA 3TN0A 4Y16D 1QA9B 3IFPB 4QRPA 2Q87A 4JFZL 1YC8A 2AXHA 1KFAL 5CSZA 3R4DA 1C16B 4JREC 3RVWD 2XIDA 5DD5L 1OLLA 2R8SL 3DYMA 5D7LD 5K9KB 2XXCB 4CVXA 5EO1B 2D4FA 3U36B 2GCYB 3VXOA 4MJ5B 4YXKH 5DJZB 1T89A 1FAIL 2YSSB 5J89A 4KXZI 1G7HA 4YNYB 1KT2B 3IXAA 3RGVD 4EUPB 5I30H 1WAAA 2G75A 2IPUG 3KPSB 3RKDD 3SE9L 4UT6L 1OSZB 1HHHB 4Q6IA 5KVDL 1IL1B 2X9WA 5EPMA 3FMGL 2VDOH 2G5BB 1RUKL 4K3EH 1CD1B 5DYOA 5HGHA 3GIVA 4PJHA 3ROLA 2IBBA 1WITA 3TBSA 1UFUA 4LCUB 5DURD 3RVTD 4XCYB 3O4OB 5HHQA 1IKNA 3FQXA 4JGUA 1T6WA 2MQ0A 3SDAC 2X4SA 1R3KB 3SBWC 5I18H 1G7IA 5IEHA 2BRRH 5IJVB 1AJ7H 5DI8B 2BNUA 4P2RD 3QQ4A 3EJJX 4JLRA 1MJUL 1XF3A 1N6VA 2ICWI 3QDJD 4Q97A 4G5ZL 3TYFB 4WHYH 2V2TA 3SOBH 2WQ8A 4QNPF 2CGRH 1DBAH 1A1MA 3TA3B 3RI5F 5ADPH 5B38G 4JY6A 1Y6NR 1Y18A 1HHGA 1N6QL 4MX7B 5EOTA 1IGCH 1P7HL 4RZCA 3SKJH 4QYOA 1LO4L 3GMPA 1KPVB 2DM4A 4IS6A 4O5LH 1Q9KB 3ARDD 3GMRB 4HIHB 3X13B 3V8OA 2A0LD 5KSVA 1LHZA 3KR3H 3D25A 3F7VA 4MQTB 4U6YA 1AGCB 5EZLA 1JHTA 3VXSA 4ZO6A 2DBJA 4PJ8D 3MLRL 3VWJD 5L9DL 4X5XA 4NZUL 4K7PX 4KZEL 1NMCB 5E4IA 4G8FA 2DKMA 2ZJSH 3HC3H 2PR4L 2GTWB 2IJ0C 1FH5L 2DDQH 2APXA 3QXAB 2O5XL 1CD9B 5BV7B 2UVEA 3V7AE 2E6PA 4PTUB 5DDHA 2HKHL 2HLFD 2PNDA 3L3KB 5DRWA 4UT7L 4MNQE 3KPRA 4HUUA 4GH7B 2E7LA 2GQHA 1FG2A 4PJ9A 3LDBB 4M7LL 4WY7L 3VXQB 1A9BA 3DV4A 1S5HB 4U1MB 3HAEG 4WNQA 3D87B 4AT6B 5EBWB 4QHNA 5FO8B 2HTKC 2YD4A 5KSBB 5JO5B 3D0VA 1YEDA 3FB8B 3OWEA 1DUYB 2HT3C 4JVPA 3VFWA 1KLGB 2FDBP 5FHAH 3K80A 1QEWB 1W72A 1OTTD 3HNVL 5J9PB 1IARB 5F7NC 1PSKH 5CD3A 3MLTB 4LF3A 1KXVC 3MLXH 3LEXB 4M61A 4RAHA 2Z9TA 4G8GA 3DUUA 1YNKL 1NFIB 1KC5L 3DGGA 2XV6B 5EDXA 3X14A 3SE8H 3U30C 5D72L 4QY8A 4FQCH 5T1DL 1JP5A 1T1ZB 3UJIL 5EA0L 1RJZA 1QBML 2FJGA 4Y5VB 1P7KA 2VZOA 4MA3B 3T0EA 1RK0B 3QQ3B 3MGTB 2NY4C 2CLZA 1ZHBB 4PJDE 2DOCA 1D5ZB 1R5VB 4MNQD 3QBTB 3T77B 2WP3O 3FB6A 2R9HC 1NFKA 3DUSB 2DI9A 4GAGL 5IF0A 1AQDB 2RFXA 4KROD 4ZS6D 3W82A 4C54A 4KKNA 3RFZC 1ZE3C 5DJ6A 1HHJA 4XP1L 1T1WA 4FQXA 1BZQK 3D3VB 4NGHH 3DVFA 2ITCA 4PJFB 5EZOH 2AEQL 3GI9L 1NGYB 6FABH 1KJ2A 2HFFA 5IB2B 3KLHD 3FQWB 2P8LA 4U3XA 2Y36L 1RVFL 3BRDA 3QH3B 4F9PC 3LQMA 1DBBL 4GSDL 2V2WA 5BVJA 4UDUB 4NBYB 4NHUA 2H8PA 3CFJB 3O2DA 4IIQC 5HHNA 5GQBA 4LKCB 4H88L 4X7SH 3ULUD 4LVHC 3BZEB 4XRCA 4RMTA 5DRZB 3TWCH 3K4AA 2XRAL 3ULVC 2E9BA 1CFQB 4PRPE 3C60C 3VRLF 3FJTA 1KJVA 4M6ML 3O8XA 4FQ2L 5FHBH 1RZIB 3MLSL 4DN3H 1D9KC 4BFIB 4IJ3B 1LK2A 4PP2B 1FGNH 3FKUS 4XT1C 1CD0A 3O0RL 5HXMA 3MBEB 3BN3B 4X4MA 3WHE0 1AXIB 3WL9B 2KPNA 1UH4A 2DQEH 4DUXA 5I15L 2HFGL 4D0DA 3HE6B 4LGPB 1CICB 2AJVL 3KPPA 3MRJB 4H1LB 3EYFB 2R4RL 5LBSH 4L8SB 4RAVB 3DSNA 2UY6A 3WDHA 3K8KA 4ZTOL 1IGMH 5FIEA 3O6LH 2MTPA 2MOVA 4URTB 2DMBA 2FECI 2KKQA 3BZ4A 1J0YA 2B4CC 1KEGL 1WBYA 3B9DA 3ILPB 4LPTA 3HR5B 3QEQE 1UJ3A 4YAQA 1ZT7A 2DWEB 3MV01 4JHAH 1CCZA 1DL7L 1MRDL 5E2JA 1HH6A 4HMEA 4S1DC 4XBGB 2VL4A 4LHUG 4P5MB 4UV7H 2YWYA 4ZUSB 3QEQA 3C6LA 1QLFA 2VDKH 1PAMA 3V4PL 1MIML 3KLDA 4HXAL 3T3ME 3N1QC 1R5IB 4P59H 4DZBB 2NCMA 3IKCB 4WUKH 1NANI 3BPOC 1YY9C 1HHIA 1MREH 3RHWF 5CJ5A 1FNEA 1E27A 1NGXB 5C0DA 3EHBD 5D7LB 2M2DA 4F7PA 3QJHA 1WTGT 1I7UB 1ZOXA 4M3JA 1IKNC 4JFEB 5EBGA 3IFOB 4HS8L 3K7UA 3K0WA 3TT1H 2J8UA 2VITA 4S1QH 4APQC 2IC2A 5EG6C 2UUDH 4BFGA 2OI9B 2AJUH 3DHJA 3PWJA 4LAQL 2JJTA 4Z6AT 3ULUF 5CBAA 3EUUA 3WD5H 4I2XB 3SN6N 3MJ9A 4G6AC 5I19L 4HKBB 2AJ3B 4NC1E 5F6IC 5HI3D 5C70A 4A6YL 5KW9H 1T66C 5I1IL 1FZKA 2MPAL 3LS4H 4ALAH 5E5RB 2MSPA 4GKNB 5IQ7H 3HG1E 2AEIT 2ARWA 4X8JA 4KRPD 3T1FB 4JEGB 5LGJB 4P2RB 1K8DB 4ODVL 1Q0YL 4JDZA 1RIUH 1NCWL 2GFBA 4PJDF 4YHKH 4X6CA 3VXRB 3HG1A 4PJEA 4XPTH 4ETYA 4WW2F 2R1XA 5FOBA 1J8HA 3TN0B 5JMOC 3QXWA 1R0AH 1WBZA 1LQSR 3WIIH 5E4EB 4KI5E 4KTYA 1MFAL 2JELH 4LLUA 4NJ9L 5DJ8A 2ZSVA 3H3PH 4OBSA 1JCKA 4CVXB 3T4AA 5IFJB 4AMKH 3INUL 2EDLA 3WDJA 4LVEA 3P4NA 3CDGA 1G7HB 3NAAH 3B5HA 3IXAB 4Z95L 1BQLH 2X4TA 3FRUA 2G75B 4LSSL 5D1XB 1PG7H 4Q6IB 4XMKH 1RU9L 4Y7MA 4HUWB 4FZEH 2PYFB 4CN4A 5DYOB 3MCLH 5HGHB 4I3SH 5T5NG 3ROLB 2WWMD 1S7WA 2D7QA 3BMWA 4G9FE 4F58H 3FQXB 3QUYD 1MF2L 4W6XB 1GC1H 2X4SB 3RVUC 1G7IB 1PKQA 3EYSH 3L1OH 5EULV 1G9NL 3RUGA 2BNUB 3QQ4B 2G60L 1XF3B 3MNVA 3SEPA 3VXME 3L7FA 4J6RH 2V2TB 2LAAA 4HUXA 2AS5M 2XG5A 1SBSH 4O02H 4O58H 1WCBA 2R2EB 5EOTB 3GRWL 3U7YL 2FX8L 3GMPB 4WO4C 4IS6B 5E08H 5D1QD 4MXVE 4JZNA 2V7HA 3OPZL 3F7VB 3GGWA 3NGBB 4KI5D 4NUGL 1T22A 3O3DA 1VGKB 1AP2A 3B5GA 4H8WL 3EOYG 3U82B 4X5XB 4TQEL 5I8OL 4G8FB 1T2QL 3O9WA 2F58H 4M48L 1SVZA 4NNXA 3TCLB 4Y5YA 2PUQT 5KVFH 1KCSH 1BFVL 4U6VL 2NY7H 1P4BH 4OI8A 3ARTA 1A6WL 3Q6GH 3EAKA 1WT5C 1NL0H 4XAKE 1OF2B 4BKLB 4ODTL 5FM5M 3D0LA 5DDHB 3DX6A 4KPHH 3V4VH 4G9FD 1FG2B 1KNOB 4PJ9B 4FXGA 5DSCB 3T3MF 3SGKC 1A0QH 3DV4B 4Q58C 5JZ7D 4MNQB 4L4TA 5A2IH 4HCRH 4WNQB 4DN4H 4QHNB 4R90H 3GKWH 3HNSL 5I1EH 3GMQA 1YEDB 5A16A 1ZGLM 5FO9A 3W2DL 1EEUA 2YK1L 3VFWB 2CK2A 3MRPA 1L7IL 3HI1B 3I6GA 3CXDL 2Y72A 5GS2D 1M6OB 2XFXB 4LF3B 3AM8A 4M61B 3QHTC 3IRPX 4G8GB 3DUUB 3NIFE 4JFDE 2APFA 1KB5A 1CDHA 1W0WA 3LMJL 5EOCH 5EFIA 3DGGB 1CG9A 2J7LA 1JZ7A 2VSDA 3IB4A 3MRIA 1HSAB 5SX5H 1CTOA 3N0PB 4JFDA 2GK2A 1MJ7L 3MNZA 3LHPL 1X6NA 3O6MH 3FZUC 4M1CC 4FFWD 4TUKH 4OLWL 4Y4HD 1RJZB 3N1PC 3T0EB 4G80B 5E94B 5F7LB 2CLZB 3ZYOA 2IPTH 2DBLH 1AD9A 5E6ID 2DMCA 4NQCD 3FB6B 5BQ7A 4U2ZA 3NTCL 2ED8A 2XZCH 5A40E 1FN4A 1OM3H 5SWZE 5B4MD 2EDOA 2RFXB 2GITB 3AFLA 4PJDB 4KI5F 4ZUWA 5DJ6B 1HHJB 4WW2B 4LCWE 1T1WB 4FQXB 2H41A 1KJMA 4HX1B 1X44A 5E8PA 3B9KA 4P9ML 5CJOH 1S7UB 3LEVL 2R0LH 1KJ2B 2HFFB 3PJSA 2VN7A 1DBKH 2ZSWB 3C6LC 3TNNA 2P8LB 1RJCA 5LAXA 1AKJA 1MFEH 5F7YC 2J5LC 1PFCA 3GBNH 2Q3ZA 1HQ4A 2V2WB 5BVJB 4N90E 4NZDA 2L7JA 5J6HA 5HHNB 1IAIL 1TMCB 4NHUB 3MGAA 1OT2A 1FE8L 3RBGA 4NN7C 3H6JA 3OL2A 3VGAC 4ETQA 3SDCB 3AU1A 3AAZB 2NY1C 2FATL 5JLZA 3CH1A 3MOQA 1SEBA 3N9GH 4DFIA 1IJ9A 4OF8A 1KJVB 4JFYB 1U3HC 5GGTA 1I8MA 1PZ5A 3P73A 4WFED 3K2MC 1T03L 4Q0XL 3O4LE 1P6AB 3QISA 4PRPB 2XA8L 2E7MA 3P30L 3RWEA 1QPPA 2JJTC 4NZTL 2VMFA 1IAMA 3QWRD 5FYJH 1IGYB 4IEFB 3ZKNC 2DYPB 3GJFA 5L2KD 4WFFE 3H8NA 5SWZD 4MXVF 2RJMA 3S35L 4D0DB 1Q72H 4JJ5A 2H2SD 3KPPB 3RZCA 4LSVH 3BMVA 2IPKB 4PLKD 3K46A 5L6YL 3B9VA 1TJHL 5SWSE 1A7NH 5IB4A 3MO1B 3P4OA 4PRAA 1N0XL 4I3GA 3CZFA 1K2DA 1JGEA 3RDTD 1D5XA 3UTTD 1WBYB 1S8DA 3ARQA 2CKBH 5C6PB 2GI7A 1FYTE 3CFKA 2OBGA 4MS8D 3IXTA 3BXNA 1QHOA 1UJ3B 4JR9H 4YAQB 1FJ1B 1ZT7B 3P0VH 4P57B 2OZ4A 5C71A 4NOFA 1LO5A 1HH6B 3QEQB 3BWAA 5B21A 1ERNA 5F7DB 3OV6A 1QLFB 4I0PA 2CPCA 2FEDC 2H26B 2QHLA 1FNAA 3OKLA 5JUEH 5FM5O 1NGQL 1JPFA 2D0HA 3RY6A 1KN2L 4TVSa 5DMJB 2NY2D 4YK4B 2CDEA 1N59A 1DVFD 1E27B 4HBCH 3O4LD 4YQXH 5GGQH 5C0DB 3OKMA 1BFOA 3W5NA 5GRUH 4MA8L 3QJHB 1IQWL 1CTNA 1U8KB 4KTDL 5KAQG 2J8UB 5I1GL 2Y6SD 3UPRB 1MLCA 4WFFD 1ZLSH 4AEHH 3NIFF 5CLTA 3IJHB 5CBAB 1KCVH 4UNUA 5HVWA 1CR9H 3WUWB 1JYVA 4JKLA 1MQKH 5SWSD 5ICZA 2GT9B 1LO3L 4BYHA 4OCWH 5T5FL 1ZV5A 3G04A 3NA9H 4PGDA 1FO0A 5T1KB 5IFAH 1FYTD 3C5SA 2YMXL 5IV2A 3LIZL 1Q9WB 2FNBA 2WINA 3CUPA 4JDZB 2GFBB 3HG1B 4GG8A 5EWIL 3VA2C 4XPBH 5FOBB 1J8HB 3HZYB 1BBDH 5E0QA 3IF1A 4MB3A 1TZGL 1WBZB 2LTQB 3RTQD 5ANME 2UYLA 2HVJA 3QDHA 4Y5YC 3VXPA 1UKTA 3VFSA 4LLUB 1MI5A 1FGVL 4J1UB 5DJ8B 1EHAA 5J11C 4JFZH 1JPGA 1KFAH 2JTDA 3TJHD 1T1YA 4HS6A 4Y4KA 4U1SA 5DD5H 2XTLA 4R2GD 1NEZG 1EVTC 3MREA 1QSZA 4LPXA 5BCAA 4XH2B 5DD1H 1G0DA 2AQ2A 2X4TB 3FRUB 4PJAE 2FL5A 3HE7A 3BDYH 2D7OA 4G8IB 3I50H 3T0AA 2OSLA 4WGWB 3QWQB 2X89D 2MJWA 1FVDB 2J3SA 3JWDC 3U6RB 3QG7H 2FHFA 1KSRA 3SE9H 5GRXG 2XTJC 3KNBA 1HCFX 3FMGH 4F7TA 2VXTL 2BY0A 3QFDA 2SEBB 4R7NA 4CJ1A 4DTGL 4O9HH 2NX5D 4JVUA 4IOSD 4I0CC 1JF1A 3S5LB 3DBXA 4RGOL 4QRUA 4QHKI 1H3TA 3EJZD 3MNVB 5L88L 4NJAL 3FO1B 4FQ1H 1BM3H 2ZUQB 3AM8C 3HPJA 1R24B 1JNLH 1CGVA 3MLWL 5GGUA 5EO0A 3EYVA 1G6RL 1MJUH 1H15B 2ESVD 3VXMB 2IBZX 5IB3A 3QUKA 4G5ZH 1WCBB 5DLML 4ZQKB 1XGTA 3DMMC 5GGSY 2C7UA 5KJRL 1N6QH 1QQDA 5HHPA 1G7JA 3ARBA 5DC4B 1FVEA 5I1HH 3GGWB 2LU4A 3O3DB 4S1SL 1AP2B 1Y6KR 3ZZ1A 5L7XL 2GTZA 4BK5A 5CZXC 3D5OF 2HN7A 2HT4D 4KUZL 3O9WB 3BQUC 2W92A 3CC5A 4M7KL 2A83A 5L9DH 3S97C 1BFTA 3UBXA 3U4BL 5KVEH 1NUNB 4HV8A 2PR4H 3BT2H 2YRPA 3D0LB 2VISA 2D4DA 3GHEH 2O5XH 4P4KD 1F97A 2CQVA 4MDJA 2YS4A 4FHBD 2DM7A 4FXGB 1VFBA 4NWTL 3RX8A 4CBPA 1LO0L 3ARGD 2Y23A 4LLWA 1RK1A 5E6IB 3RWFA 2VO5A 4L4TB 1E4XI 4QXUL 1CXHA 3DLQR 2HJLA 5E9DE 3GMQB 2FHBA 1FYHB 3X3GH 2YBRA 4WWKB 4PGBA 2W0PA 1DQDL 5FO9B 2EDRA 3PWVA 5EOQL 3I6GB 5TF0A 2E7BA 4HGWA 5T3XE 5TH2A 4FTVE 3WUZA 1YEEL 2NTFA 2EZ0D 3VFRA 1AXSA 1A3QA 5E8EA 1KB5B 1W0WB 3WJLC 4X6DA 4QEGA 5D5ME 1YNKH 4JFDB 4AIXA 4XZUA 4YUEL 3BHBA 1HXYA 1ZHNA 1KC5H 3IAPA 1MCRA 3EDEA 1KACB 5F3BA 5GISH 1SM3L 1F45A 4ENEC 5CCKH 2ZZUT 4OUUB 5D72H 4MQXC 3RIFF 1XCQB 4NKOA 5T1DH 1KPUA 3UJIH 3RZCC 4U1GC 3IDGA 3WFHA 1NC2D 2DQHL 4TUOA 1AD9B 1RHHA 2CD0A 3STBA 2GSGA 5BQ7B 5CEZE 1YC7A 2UWEE 1BPVA 3D9AH 1FN4B 4PGJA 2R1YA 1LE9B 4PJ7E 1A14L 4IMLB 2A9NL 4OCYH 4ZUWB 3W11C 2JCCA 3SO5A 1KJMB 3FO0L 3NBNA 5SWZB 1V7ML 4GLRH 5E9DD 5E8PB 1IC4H 3B9KB 3FN9A 1SMAA 4XP1H 4LCWB 4ZSOE 1ZLVH 3PJSB 1MCQA 3W39A 3TNNB 4PJAF 1HHKB 5LAXB 1UGNA 2AEQH 4N0CC 4G6ML 4ACPA 4FTVD 2VE6A 5DRXA 1UM6L 4PREA 1JPSH 4X7CC 5J6HB 3WFDH 2Y36H 4LVOB 2OX5A 3DX7A 5IIEA 3CU7A 2OCFD 4GSDH 5EU6A 3KWWA 5F93C 5A2KH 4ETQB 1LWRA 5D1ZC 3BD4A 1UH2A 4UNVA 2X4PA 3QEHA 1WFNA 4H88H 5KN5A 3MSPA 1S9YA 3SDDC 4NQEA 2D7TL 1I8MB 1PZ5B 1U0QA 1B4JH 3P73B 3V2AR 2XRAH 1JJUA 4NC2B 5IHUL 5EBLA 1WWAX 4M6MH 3RWEB 1JBJA 2A9MH 1X5FA 1FNHA 3MRLA 3MX0A 4FQ2H 4DKFH 3LV3A 2F8XC 3GJFB 1DZBA 1C5BL 3CLFL 4CJ0A 1EDQA 4CADB 1JN6A 5DHYA 3V95A 3EO1A 1JZ6A 3MV8E 1A5FL 2EE9A 3O0RH 1UXSA 3DI3B 5TF1H 4XPFH 3WJJA 3TM6A 3BKJL 2HFGH 2AJVH 5KSAD 5F89A 4ONGL 4AIZA 4PRAB 1DSFL 5LCVL 2R4RH 3CZFB 1K2DB 2DKSA 1JGEB 3TFKD 1ZT4A 2FSEA 3IDMB 5TDNA 1S8DB 4MVBC 3CFKB 3IXTB 3BXNB 4MXWL 3EGSA 2R2CA 4KDTA 4QRTB 5AWNL 1DUZA 3MACH 4ZO7A 4E41E 1LO5B 1WLHA 4XNQA 3PHOA 1UWGL 1CGYA 1QG3A 1SJHA 4M7ZB 4I0PB 3ET9F 3NFSH 2BY3A 4G8EA 4IRZH 5HHMD 1W2KT 5CGYD 4HWNA 4U3HA 3V8CA 3OKLB 4V1DD 3TA3C 2MCPL 3RAJL 3ECBA 1TITA 1A6ZA 1Z3GL 3V4PH 1MIMH 4HXAH 4DKEH 2CDEB 4QHLB 2NW3A 4MAYD 4LEOB 3O6FD 1ADQH 1DBML 3REVA 2F19H 3L3HB 4K9EC 4R2GB 3E8UL 5I1DA 4AG4L 5FGBA 2NXYC 3A6CH 3DO7A 5C08A 2EDTA 3MV8D 3T04D 3VG9C 3WNMA 5LWYH 4UIKL 5D5MF 4Z7VA 2NNAA 2PO6D 4WI4A 1UACH 4PGCA 2FH6A 2CIKA 5ICZB 2HT2C 4LAQH 4LU5L 3VD7A 4P2QA 1I9EA 2FLRT 2UY7A 3G04B 4XVUD 3KYMA 1IILE 1FO0B 4JZOA 3QAZC 4U1HA 3ARBC 2ITDA 3QI9A 3FTGB 5F7KC 2WINB 3R0MA 3OJ2C 3CUPB 3PGFH 4E41D 2AV7B 1HEZA 1I8IA 1X5XA 5FGSA 4GG8B 2HVKA 2V5SA 2UWEF 2A6IA 4WV1A 3LKNA 1AH1A 4TPRL 1Q0YH 4KJQC 1NCWH 3IF1B 4PJ7F 1A4KA 5LQBL 1MCPL 4X9IA 2AP2A 1EPFA 1DEEB 3I84A 1JPGB 1KN4L 1T1YB 1MFAH 4QGYA 4Y4KB 4MD5A 4NJ9H 1YNTA 4EXKA 2EE6A 5CP7B 1I9IL 4N8VB 4JZJA 4FRWA 4JN2B 43CAA 2FL5B 2QV2A 3INUH 3HE7B 4EUPG 2GHWB 1W0YT 1CBVL 2OSLB 3O11A 1PY9A 5IWLA 4Z95H 1J0HA 2KBGA 4LP5A 4PJAB 4LOUD 1KGCE 3A6OA 5JW3L 3KNBB 1NMAL 3MJGX 1FV1A 3P0GB 5KG9A 1SJEA 1RU9H 4OFDA 3ESVF 4ZFOB 3GIZH 4R7NB 4BELD 1GHFL 1ZTXL 3RJDA 3ARED 3DBXB 5C7XL 3GFUA 4QRUB 1JF5A 4XBPB 1RI8A 2JK5A 3TVMA 4MMZC 2Z91A 4KJWD 3HPJB 5HHOA 5I0DA 2B8OT 4UIMA 1G9NH 1QBLL 3PQYE 5GGUB 4ZXBD 3EYVB 1QSVA 5H94B 2D9CA 1NGPH