2OTPA

Crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
194
structure length
193
Chain Sequence
LPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQCLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte immunoglobulin-like receptor subfamily A member 2
publication title Crystal Structure of 3D Domain Swapped Dimer of Immunoglobulin-Like Transcript 1 (ILT1/LIR7/LILRA2), Molecular Insight into Group 1 Activating Receptor Forming Unique MW Interaction Pattern
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 193
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otpA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otpA02
1LWRA 2EC8A 4FQJH 4PP2B 1GGIL 5FYKU 1BX2B 1CGTA 2DQFB 1ZEAH 3VFSA 5B4MC 4XHQA 3T0XA 5IBLD 3GBNL 2H41A 4Y4HA 2VERN 1WZMA 4Y1AD 4KK5C 3WDHA 3AREB 1WFUA 2Q20A 5KZCD 3VWKC 1QRNE 5K9KB 2ZG3A 4QHUB 4Y4KB 2HT3C 3CVIH 4DN4H 5AWNL 1R5WB 4YC2B 4WU5A 1BREA 2FL5B 4NQXA 3KPOB 2NY5L 1PSKL 4FNLH 4C83B 5C2BH 5DSCA 4F37K 4RAVA 4NZDA 1NAML 3CLEH 4K7FB 2X1QA 5CSBA 2BVQB 1WGOA 3S36L 3LS4H 5D7JC 3S34L 3QDGE 1MPAL 2VDML 5F7YC 4P46C 2X42A 1RJZA 5I1EL 1A14H 4FFWD 1RUQH 2EIZB 3VFVA 4WUUD 2X9XA 3G08A 3TZVA 1ZVHA 4L3AA 4XWGL 2ZG1A 3O3UN 3B9DA 4Z76A 4DFHA 1U8OB 2W0FA 4MXQC 2HH0L 4U1MA 3GSRB 4KUZH 4M7KL 1KJVB 3ZLQC 1YC7A 3U0TB 4AIXA 3H9YA 5I1JH 4P2YA 2V17L 1AGEA 2X4SB 4YHNA 3UDWA 5D71H 4QHKI 1F3DJ 4S0TD 4XTRD 2H32A 1A1NA 5I1AB 3BKML 1KXTB 3PHSA 4KU1A 2C7UA 1A0QL 1D5BA 4F9PA 2GT9A 3B8SA 5F7LB 1A7QL 3JBG7 3I6LE 1EXUA 5IUSA 3VW3H 5EZOH 1RZIA 3WEXA 3IDJA 3PL6A 1TVDA 3QHFL 4PRNA 4DQOH 4XVJL 4F2MB 3RPKA 1ZHBA 1QA9A 5GGTH 5F9WB 3NN8B 4LBEB 4ZUWA 1AO7B 1D7FA 1JI1A 4JPKL 3LIZH 5D8JH 2D4FA 4KHTL 4JKKA 4M7LH 1GSMA 3T65A 1BMGA 3WLBB 4PJHF 5CHNB 1RMFL 1MRFH 1PY4A 3MX0A 3LPGA 5B38A 4NHCL 2RAMA 2QV2A 1B0RA 1BVLB 1IZKA 1KPVB 1UM5H 3F7RA 4HW6A 2BSSB 4MCZA 3ESUF 3PWPE 1FORL 4ZFOB 3MV8E 2J8UA 1RULL 3PP3H 5EOCJ 4H8WL 5I1GH 3B2VL 3UPCA 4APQD 2A9MH 1AKJB 1L0YA 4O02H 4OGYL 4PS4L 3MV9A 3V95A 1MCSA 2PXYD 3UTPE 2CIKA 4FTVA 5GGSA 4POZD 3U79A 1K6QL 5ICZA 4RFOH 1AIFA 5E9DA 2AK4E 5L7XH 1YEKH 3U9UB 2HLAB 4OZGB 4B7IA 3O3DB 2IH3A 3F7VA 1CFQA 4M4RA 4OFKA 1D6EA 2FR4B 1FBIL 3QI9C 5I1EH 1D9KB 2UYLA 4TVPE 2XWTB 3D39E 3PV7A 1BM3H 4DZ8B 4KJQC 1LK2B 5BVJB 1AGFB 5JMRA 3O6FC 3QUYA 1NJ9B 3SGJA 3HZMA 4NQCA 3I9GL 5JORA 3RBGA 5C0RL 1XGUA 1N8ZB 2AJZB 4R7DA 5CGYC 4F9LC 3IF1A 4TSCL 5AYUL 2JK5A 1UM4H 5AUMA 2XXCB 4KK9D 3QJHB 3IDIB 4GMTH 2OK0L 4LNRA 1F45A 3WNPA 4EI6B 1MHPL 5ANMB 3NABL 3MCKB 4J6RL 3L3JB 4RNRB 5IK3B 3FTGA 1KXQE 3VG9C 5KVDH 1G7LB 4D9RE 1Z6JT 4GO6B 2YPLB 4NNXB 5F3HB 1KIQB 1ZHKA 1QFWM 4NM4H 3T0AA 4RFNB 3BD5A 3JUZA 3QHFH 4V2BA 4G9FE 5C08E 2A38A 2DQHL 1LVEA 4KPHL 4U6VL 4PJ9A 4HJGB 3CUPA 4R7NA 4ZAKC 5DUPL 3BT2H 4G6ML 4JZJB 4JPKH 1XGQB 4OLXH 4AH2A 2V2WA 4MQXD 4JG0H 4N0CD 4PRIA 3VRLE 3WIHA 2H3NB 3E6HB 3C9NA 6FABH 2CKBH 4NHCH 4OCXL 5M7QA 4LPVA 5IHUL 2FDBP 1ADQA 4XT1C 1MY5A 3O0RH 3UO1H 4FP8L 5E1AA 1YEGH 1FNFA 5K9QG 4PJ5B 3FOLA 3RWIB 1ZLSL 5EULV 4QHNB 2FIKA 4RMSA 4UV7H 3MJ8B 3OAZK 4NQVA 1HQRA 3ILQC 1QNZH 1L7TH 4DUVA 4WI4A 3DMMC 2GITB 4BFIB 5IBUB 1PLGL 3OXRA 2FX8H 4N0UB 4AYFA 5DQ9A 3RUGA 1NBVL 3BP4A 5FB8A 2ATKA 5HYFA 5IV2A 4RGNE 2Y6SC 2B1AL 4LARH 2W9DL 2W9LA 1D5IL 1CT8A 1XR8A 2GJ6D 4G6AD 2Q6WA 1Z9LA 3OPZL 4G6JL 1HHJA 4RCAA 1F3JB 1M71A 4WI9A 3JWOH 4OV5B 1FGNL 1N5AA 3O3AB 2G9HA 2ENYA 3S35X 2WQRA 3MNVB 3S96B 2BOCB 3H9ZA 5IG7A 4ODWA 3UTTD 3TP4A 5TF1H 1FH5H 3ZTJG 3SO3C 1UEMA 3EW3B 1G7MA 3OXSA 2AK1L 1A7RL 3VXMD 3QZWB 2ZSVB 2CUMA 4L1DA 4P57A 5BZWA 1GC1H 1JPGA 4G6MH 4F7EA 1MWAA 1IAOA 3MRMB 4G7YH 4FFZH 5DYOA 4DVBB 3G6JE 1S5HB 4TOYL 3D3VA 1TQBC 1JGVH 4OGXL 5GS0L 1GHFL 5E2JA 1LE5B 3VG9B 4XCCL 4ZUSB 3VRIA 1FPTH 3IETA 4PD4J 5D7IA 3EGSA 5FA3A 1C5CH 4M1CC 1BVKB 3HS0B 2F53A 4FQCH 4M43L 3VD4A 2B2XH 1ZLSH 3WXWL 3ES6A 1IMHC 3RGVC 1OM3H 1WAAF 3LHPH 1IM3B 2MTPA 5GSRA 4OQ1A 1B6DA 3BKCL 2FWOB 1ACYL 4JKPH 4RGMC 2IBZX 3NFPA 4WTZG 1Q9OB 1GGBH 3HMXA 1A2YB 1MJ7L 5I0DA 1MJ8L 4JFDD 5D1XC 4MJ5A 3VCLA 2HJLB 1NFDB 3OWEA 3U1SL 1CDCA 2WBJC 4NUGH 4I2XE 5IF0B 3DYOA 1A3RH 1WLHA 5EO9A 1KEML 3BIKA 1UH2A 2W0LA 2ESVE 3LB6C 4HGWB 1EO7A 32C2B 4DKEL 1AR2A 1E6JH 1QLRB 3D2UD 5HVGB 1JRHL 4IRZL 4AM0B 5TDPA 4LLDA 3RVUD 4FQXD 5ALCL 1GOFA 2DQCH 2DIJA 2CLVA 4JM2B 4JQIH 5JLZA 4Y2DA 1KC5H 1TZHB 3NZHL 4NQUA 4TSAL 3BP7A 2PXYC 1Q9WA 2JTDA 4YIQB 4L5FH 4LRNH 1I3GL 1OGAB 1T83A 2XZCH 3QG7L 1CFTA 3PV6A 4HGKC 5BO1L 3RX5A 5FYLD 3MYJA 5TDOB 4F8QA 1MHHB 3PHQB 5EO1B 4C4KO 2OM5A 4R96A 3IS0X 4HKZB 3B4NA 4MX7A 4LSSL 4Y1AB 4OZ4A 3VD3A 1IM9A 5ID1A 1AGDB 2YOCA 2DM7A 3PF2A 5CBAA 5IWLC 1S7SB 3WN5C 3VE0A 1S9YA 4XB7A 4Q6IA 2OMBA 2Y1VA 2MQCA 4FHBD 3VFTA 4ODHH 1YEIL 2H8PA 3MRJA 4XVUC 5CFHA 1CXKA 2BNQE 1SVCP 2XFXA 1T21B 4K23L 1NGYB 2P5WD 3VXOB 3SGKA 5MENA 4KK9C 3KXFE 4QHKJ 2VIRA 3QXWA 4JFOA 4Y2OA 4KKCD 1FCGA 4JO1L 2XNAB 4L4VD 4UDTA 3FHQA 1AGCA 2ID5A 4NBZB 4X6BB 3E8UL 3WHXB 5B38G 5FF6A 1NUGA 5GS1B 1E4JA 1OVZA 4OZHE 3BZFA 4WUUB 4U4BA 2XT1B 3Q3GA 5FV1L 5GIRB 4Z78A 4ZYKA 1KFAL 3QFJA 2V9QA 3L9RA 5SWZE 2X09A 4PLJD 4PY7A 2K1MA 2A9NH 3KPLA 3MGTB 3BO8B 4MQXC 5JW4M 4XAWH 3L3DA 4N0CC 3GJEB 1WBYB 1MREL 2D7TH 2XQYG 4XBPA 4NM8L 5C0BD 3TIEA 3IXTA 1OAZH 2RHEA 4FXGB 1HIMH 2UZXB 3B9AA 3HMWH 1ZHNB 2DD8H 4OZIE 4LSRH 4RGMB 1O7VA 1H0DA 3KYOB 2VXTH 5EORH 5L2KB 1EJOL 4CN1A 3KPTA 5LWYL 1FV1B 1FL3A 1OPGH 3RWGB 4KGJA 1S7WB 3MO1B 4S1QH 3D6GA 5IHZB 3TEUA 4H1LG 1U8IA 4LU5L 1IARB 4EDXB 2YRZA 3AU1A 4S11A 2AJYH 1D5ZB 3LRHA 1UCBH 4G80B 2C3GA 2HG5B 4CNIB 4ODUB 4GG8A 2EXYC 2IAMD 3CH1B 1I1FB 1HKFA 4APQB 3KPMA 3NFSH 1F02I 4O5LL 2B5IB 1SJEB 2E9BA 3V0WL 4PJBE 5F8QC 3IRPX 1KJMA 3ARFD 3HE6A 4G6AC 4OKDA 4MD4B 3SKMB 5IQ9B 3T4YA 8CGTA 4FZ8L 1S7UB 4LGPB 4K94L 4XXCC 1SM3L 1UZ6E 2B8OT 2RGSA 4PYHA 4ACPA 3MFGB 3LN5B 4U1NA 1HSAB 1LE9B 5HD8D 3S35H 1S3KH 4PJIA 1I7UA 3QWOA 3LEYH 1SEBA 2ZOKB 5C0IB 3NPZB 1LP9E 1ZLWH 5EBLA 2FSEA 1MCHA 2XYCA 4WNQB 5ENWA 3RL1A 5HGHB 4AIZA 1NC4A 4X80L 4MXWH 2YN5A 5IKCA 1LO0L 4QRQB 1HH9B 1AE6L 2OP4H 5EDXA 3NFNA 1P7KA 2Z31B 4OFPA 3C5ZA 2D0GA 3CSBA 5I1KH 5C0GA 3PIQB 3BEWB 1YECH 5E8PA 5GRWA 4OTXH 2YD6A 2GI7A 4XPTL 1YEHL 2ZKHH 3BDBA 5MEPA 1MUJA 3Q1SL 4FXLA 5FYKH 3UTOA 2HFFA 4MA8H 4RFEB 4NNYB 2ADFH 3TO2A 5FHAL 3QXAA 2R9HD 2DI7A 3AMLA 4KMTH 1HK6A 3MROB 5F7NC 3HB3D 3RY4A 3ZTJH 1G9MC 2NR6D 5A43C 4PP2A 5F21B 1CL7I 1PEZA 3AXLA 3P11L 1BX2A 2Q1EA 5LGHH 4M48H 5ADPH 2DQFA 3PDOB 2V5SA 1CTOA 4FFVD 4HFWB 5CINH 3LQAH 4KI5E 1JVKA 4WHDA 4HIIA 4O9HL 3DUHA 3OF6D 4H0IA 3TBVB 4UQ3A 1HINL 5K9KA 2MCPH 4NQSB 5D70H 3HI6H 3M8OH 1VERA 4YDJB 4PRPD 3IDGB 3WMSA 4I3RH 5H2BA 4XPGL 1G7IB 4JDTL 5BMFH 1JHKL 3KPOA 1XF5B 1MFBH 4C83A 2XG4A 4FG6C 2QQNL 1L7IL 5E56A 1FNLA 3RVUC 2HMID 4FQXC 1DR9A 4K7FA 2QEJA 5DVKA 2BVQA 4MAYD 1MOEA 3EZ8A 2N7BA 1GPOL 2ORBL 2D31B 1FC2D 4JG1H 1BQUA 4Y5YC 4ZS6D 4DKFL 3TPUA 2GJ6B 2FZ3A 1YJDC 3QCVL 3OSKA 1B0WA 1U8OA 4JO4H 1JPSL 4U3XA 4YDLC 7CGTA 3U0TA 4PRHD 2X4SA 3INUH 3RTQC 1MHEA 2BY0A 1SVZA 1MQKH 1NANH 2OJZL 3QDJA 4Z95H 5E00B 4TUKL 1PAMA 1UT9A 3UTTB 4PP1D 4D0BB 1JI2A 1O0VA 3K4DA 4X7SH 4OIIL 3CZJA 3FB5B 2I5YH 1WCQA 4KKCC 4YGAB 5F6HI 1JHLL 2CUIA 4XCEB 3T3MF 3EYSL 4KROC 3OKEA 2UVEA 4JHWL 4TPRL 2X6MA 3NN8A 4LBEA 1RIVH 2CGRH 2J8UF 4ZOAA 3PDGA 5JA8B 4JGJA 4O2FB 5FYJD 4OLZH 5FA4A 2EXWD 2H32H 4HF5H 1MI5B 1FP5A 4QRUA 1RFDH 2F5AH 5CHNA 4KZDH 1K8IB 1QSFD 2NPLX 4PLJC 1UENA 1WWBX 4JAMB 4YHZH 4ZFOA 5ILTH 4CADA 4OZFB 3AS0A 1U6AL 4K8RL 2LTQB 4G8GE 3WFDL 4MB4A 1MJJA 2VRAA 1AKJA 1JN6A 5C0AA 3EBAA 3WNOA 4BQ8A 1AFVL 1ULVA 2IMMA 1Q9LB 3AB0C 2FEDD 4S1RL 5EZJA 4OCMC 3FFCE 2P4AB 4WRLA 4OLUL 4J12A 2DLFL 1P2CA 4HEME 3P0VH 1X9QA 2HLAA 4OZGA 4GUPB 4JFDB 5J13C 3HUJB 3O3DA 1H3PH 4UINL 1I4FB 3DO7B 3B8YA 3MRRB 4IJ3C 1JGUL 4IIQB 1D9KA 2ORBH 4LVEA 5F6IB 1AD9B 1DBBL 2XWTA 3NGBB 3OHXA 4NGHH 4DZ8A 1UCTA 4WENB 5D7KD 2WNGA 4ODXB 4I13B 1OARH 2AQ1A 3SBWC 5DWUH 4PPTA 3D2UB 1XIWA 5F71A 4R3SB 2WAHA 4DUWA 1Y0LB 2AJZA 2YD3A 4E5XB 2IAMC 4FQXB 3RHWF 5DJ0A 4EI6A 4RGOH 3UZEA 3ARFC 5ANMA 3OJVC 2Y36L 3MCKA 5IK3A 3L3JA 3TO4D 1XF1A 3TJEH 3R0MA 1G7LA 5DRXA 1OT2A 3MSPA 2YPLA 4OIIH 3RKDD 1JIBA 1RZKH 4NNXA 1RZGB 5H94B 5F3HA 1KIQA 2GTWB 1CLYH 3G5YA 4Y5YB 1IGMH 1P4BH 2O5XH 2OBGA 4TPRH 3WO3B 5DD0L 2OTWB 1AC0A 5E99L 4KKNA 5HHPA 3PWLB 1A6WH 3F7YB 3WUZA 3D0LB 4Q9CA 2VXSH 2H3NA 4L3ED 1EPFA 2WLZA 4R90H 3V7AG 1N0XH 1CR9H 5J6HB 3VJ6A 1ONQB 3VFPB 2P5WB 4QXGL 1CD9B 1V7MH 3K80A 1U6AH 4O58L 4MNQD 4D0DB 4CMMB 3O45B 4L4VB 2VLRD 5F89B 2DLGA 3RWIA 3QHZH 5DJXB 1KACB 4QHNA 1K4CB 3RUGF 3MJ8A 5IVOA 3RAJL 4JRXD 3BAEL 4Z7OF 4K3EL 5I15H 2Z92A 1N6QL 3KDMB 3TH4T 3WIHH 2Q76B 2R9HC 4M61B 2GITA 4I3GA 3FO9A 4N0UA 1NGPH 3HB3C 3TYGH 1OHQA 4HDIB 1FYTE 1MLBB 4XNQB 3SEPA 1ADQH 3IDMA 2DQGH 4KJWD 5ESAB 1CI5A 1DBBH 3MODL 3ZHDA 5DEZA 2EDEA 5EWIH 3SOBH 5D5MB 4Y5XB 4D94A 1DEEB 2WM0A 5TQ0L 5T1DL 1I9IL 5DO2D 4Q0XH 5C0BB 5E08H 1A6TA 4FFVC 4JFEA 3W39B 4LIQH 3HPLB 3AB0B 1ZANL 1OTTD 2BY1A 2UWEB 2H2PC 3FB6A 2OLDA 1F3JA 4YWGL 4OV5A 1HZHH 1W72L 1R3IH 2BOBB 3V9FA 1I9JL 4QLRA 1WEJL 5LGKA 4X4YB 3MNVA 5E24E 1A1OB 3CSYB 2KDGA 4W81A 4RMUA 4IRJA 2KL6A 1LO5A 4P2QD 3KHOA 3MZGB 5TE7L 2FX9L 4MAYC 3UYPA 5B8CC 3HPJB 2DKUA 4HUNB 5JXAH 2QHRH 4HQQL 2ZSVA 2YPKB 5FFLA 4NN5B 4OI7A 1FVDB 2OCFD 4HMDA 4NDMB 3QNXB 4YDVB 5GRJL 2A0LD 2IAMB 1I3UA 1KBGL 3EYFB 4JHAH 5D7IF 1QFPA 2A73B 1S5HA 5LBSH 2PYEE 4ZS6C 2KUTA 3ARFB 4LPYA 4HWEL 1KB5L 1LE5A 4ZUSA 5C3LD 1UXSA 2APVA 2M2DA 4XPFH 2HT4D 4PJ7B 3TESA 3I85A 3OAUL 3QQNA 3K4AA 1TPXC 3F8UB 2FO4B 4XNYH 1I1AD 3HS0A 3T2NH 1J87A 4PP1C 1JPFB 1IC4H 2EC9T 5JUEL 3CFBB 1X6LA 5C07B 5M94B 1IM3A 1I8LC 2PUQT 1KSRA 5DT1H 3U4BL 1UJ3B 1J12A 4OLWH 2ZUQC 1DQTA 2IG2L 2FWOA 1G0XA 2ZJSL 2P47B 1A2YA 35C8H 4NO5B 4P23A 3O9WD 1YY8B 5I30H 2VDOH 4S1SH 1NFDA 2BFVH 1PYWB 3U7AA 1QBMH 3NAAL 5L88H 1NAKH 1QRND 5E03A 5D72H 2UZYB 4WV1A 3HNVL 3NVQA 5JA9A 2MCG1 5D2NE 1A3QA 1K2DB 3KPNA 1TZGH 4YK4C 4ZTOH 1BQSA 4F15C 1INEL 4M6NH 5HPMB 4OCSL 3EUUA 3MLUH 5DDHA 1X7QA 2IQ9H 5GGUA 1KJ2B 3M17A 4Z7NF 5C7XH 4AM0A 3QIBA 2P5EE 3HMXH 4GAFB 4JM2A 3QDGD 4RBPH 4LCCC 4YIQA 3SKNB 2FEDC 1OGAA 3BPLC 4C55A 1NKOA 4NO3A 4ZD3L 1A3LH 3QIWD 4BSJA 1NPUA 3ZHLA 1UQSB 4GAGH 1MHHA 3SDDD 4XP6L 3F62A 4R0LC 4KZEL 4NHUB 4AL8L 1BBJB 5EO1A 2VE6B 3HHRB 4TVSa 5F7EH 3T09A 4P3WA 3D85A 4KTEH 1EHAA 1QFUH 4WHTB 4P3CH 1OGTB 3P9MA 1S7SA 1RHHB 4PJCE 4PRPB 1IZJA 2NY7L 4I3SH 3W82A 1TNNA 4Z7UE 3JV4B 4PIRF 4RZCA 1B4RA 2ITDB 3O11B 5T1LD 3C60D 4O2EB 3DBXA 1OTSC 4P2CG 1UGNA 1T21A 2VB5A 5HHME 4MAYB 3I6LD 2E27L 4X4ME 5BRZD 5JOPE 3TBYA 5EC1B 5AG9A 2XNAA 4HIJB 4X9BA 3FO0L 5D7LE 1A6VL 3TO4C 2Y4SA 5CJBA 3EO0A 4X6BA 1IKNC 2G5RA 1IKFH 3WHXA 5GS1A 5I1HL 3ARGD 5BV7L 1ZSDB 5D9SA 4L29A 5HI4D 2ZJSH 2UVFA 5F6HJ 5FKPB 4G6KL 3TCLB 3QQ9C 4KKAD 4XBEH 3ULUD 4NWTH 4DVRH 4XNMB 4RAUB 5GIRA 1R5IA 3BZEA 3PWPD 1OAYL 3F7PC 1KLUB 4PRHB 4ZFZB 3TT3L 2PNDA 1TPXB 2XXMB 3WFZA 1TJIH 1MCJA 1WBYA 4WDIB 1WC7A 4IS6B 1F58L 1AR1D 3UTPD 1T66C 3MLZH 3DX9B 4PB9L 2AJVL 1OWRM 3LQMA 3OKNA 4UTBL 4UU9B 2AK4D 7FABH 3C2AH 2ZUQB 1XAUA 4QXUL 4EKXA 5KS9E 4F58H 3KYOA 2X4TA 1MSPA 1IFHL 4YHMH 3VWJD 5L2KA 4Z7WB 2VNCA 4XC1H 4TVPD 2X89D 1OP3K 1GIGL 1FV1A 4HH9A 3RWGA 5CSGA 2ARJA 5K9QI 4FABH 4YK4B 5B21A 5ISZA 5IHZA 2C1OA 4NOFA 2O5ZH 2XKSA 1QSFB 3QWRD 4EDXA 4KJWC 5HGAB 1D5MB 3W0WE 1BGXL 4G80A 2VXUH 4HWZA 2HG5A 3MOBL 4CNIA 3SGEI 3U4AA 3CH1A 5DO2C 1OL0A 1I1FA 2XPGB 5EBWA 4APQA 5HDQL 2Z9TA 3MA9H 1SJEA 4WWID 2LVCA 4LCCB 4BJLA 1OTTC 4PJIF 4ZS7H 3L5IA 3LEVH 4D9RD 5IQ9A 3QEUB 2NQCA 1S7UA 3HZVA 1YNKL 4MJIE 3DGCR 1BECA 4MXVE 1ZXQA 3LN5A 1NLDH 1HSAA 3MRDB 4G9FD 4LFHG 5C08D 5C0ND 5F7DB 2XWBB 3GRWA 3MR9B 2BERA 4YUEH 4QRRD 5DTFB 3ARWA 2BSRB 5EUOE 3SE8H 1S78D 4IHOB 5BV7H 3ZTNH 1YMMD 1QUNA 4OCWH 5HGHA 1NEUA 1M4KA 1P84K 2GUOB 5EC2B 2EO1A 4RWYL 5C9JB 2FGWL 1NCUA 4XH2A 5IBTL 1KPRB 5FECA 2VC2H 4U1GB 1ZTXH 2Z31A 2CLRB 2JJSC 1TJHH 5IMMB 1CDHA 4NO0D 2W65B 2FJHB 1GOHA 4OLVH 4X6FB 1OWWA 1J1XL 3BEWA 4HV8B 5IIEB 5IBUG 1YEDA 4Z7QF 5CEXB 3SE4C 3TO4B 3SKUD 4HWNA 1INDL 4JY4B 2C3XA 2ZPKH 1H15B 3DVNB 1JHTA 1E4KC 1JZ6A 2DQUL 4Y4FB 4RFEA 1I1AC 3O6ML 1UB5A 5CAYB 3PQYA 1MCRA 4Q9BA 3LCYA 2E8ZA 3V5KB 3MROA 3SE3A 4RGND 3TBWA 5GJTL 5DF0A 4YBQD 3MNWB 2WMPA 5JIIA 5T3XL 3ULVH 1WICA 5E8EB 2FB4H 1JWUA 5FGCB 3O9WC 1U92B 4JGMA 2AEQL 4HFWA 3IFNL 3ARTA 4FXKB 5IP4A 1LDSA 4Z8FH 5DJYA 2F58L 5HYSB 3VGGA 3VXRD 1P53A 1NGWB 5JQ6L 5HDQH 5AEAA 4YDJA 3UZQA 3V4UL 3FQXB 4DGVL 4MVBD 1AXTL 2QL1A 1FDLL 3QZWG 4L8SB 1KEGL 4CL7A 1QLEH 1QZ1A 1XF5A 4DGIH 4JRXB 1ACZA 3QPXL 3H42L 1YA5A 2F54E 5D1QC 1NCDH 1PFCA 3B83A 3RX7A 3IDYC 5HGDA 1YEFH 5HXMA 3CFCH 4PGZA 3QUKA 4LVOC 1NFIB 3MRKA 4A2LA 3TN0C 3UAJD 4Z6AT 3QIWC 1MFAL 1IL1B 2OZ4A 1SQ2N 12E8L 5SWSA 4LF3B 1H3UA 1Q94B 2D31A 3SDDC 3NCJL 3J7HA 5ESVB 3UCRA 4UIKL 4QNPF 1QBAA 2GJ6A 1S7QA 3DSFH 2XQBL 1S7RA 3KNBA 4TSBL 2L7UA 3RL2B 1JBJA 5IHBA 1NGXB 1JUFB 4RIRB 1OQXA 4ZOBA 1UYWL 5E94B 5I8EA 5JTWA 4AIOA 1UM6L 2HTLD 3KPSE 4P2QB 2EDRA 2QQKH 3U7WH 1MRDH 4AEIH 2F19H 4PG2A 3O4LA 3X3FH 3ZDYE 2FJFB 5A40E 3MPCA 3TBSB 3VMOA 4J1UA 3ARGC 2RQ8A 1GL4B 2BSTB 4Y5VB 2F9BT 5HYQB 1F5WA 2ESVD 3UJTL 2DQIH 4BH8A 2LAAA 4KKAC 3ULUC 1MI5A 4LAQL 4O00A 4E41A 1FSKC 1HI6A 3QUXD 1B3JA 3KYAA 1I1AB 4P3DB 3GIZL 4OZFA 5IR1A 5C0DA 5I8OH 5HHVH 2P8MB 4HH8A 4XX1G 2NY2D 1LMKA 4JN2B 5GGSY 5F8RC 4L8BA 3QCUL 1OD9A 5CKGA 3IFPA 3OX8B 3VWJC 3O9WB 3HUJA 3CDFA 1I4FA 5E5RB 3BHBA 1QRNB 4K3HA 5F44A 5GRUH 3MRRA 5IHLB 4NP4L 5IMLB 1T5XB 4IIQA 4MZ3A 1AD9A 4ZXBD 3T1WA 5DHXB 1S7XB 3LRSB 5LXGH 3QB7C 4ODXA 3OTTA 4OAWB 2BNQD 5I1CL 3C87A 3A6BL 4TSBH 1FZMB 4GMSH 2YEZA 3KXFD 2CD0A 4GW1A 4O4YH 1X44A 3X11B 3HCVB 3GK8L 4KHXL 3N50A 3QDGB 2EZ0C 3QQ4B 1CE1H 4JY6B 1J0JA 5DR5L 3QIWB 4HK3J 2VUYA 3SDDB 1RZGA 5H94A 1MF2H 4X99B 4KDVA 2OX5A 1JTOA 5DK3A 1F8TH 4H25A 5SWZD 1DBAH 1ZOXA 3AS2A 4WI8A 3WJJA 1E4WH 4M9PA 5IJKA 2VLKE 3EYVB 5J57B 2UZIL 4JQXC 4HS3B 1EHLL 3V8CA 5T1LB 1FFNA 1T22B 3C60B 2ENSA 1PX3A 1G1CA 3HZKB 4YX2H 5J6HA 4JFYB 1ONQA 1CLZL 2P5WA 2WUCL 4WFED 3ARDA 3WFEL 4XC3L 4LCWE 2DQTL 4HIXL 4CMMA 3O45A 2A1WL 4ONHB 5F89A 3RWJB 3QULB 3AM8C 4JZOA 3AY4A 3ARGB 3HE7D 4DWHA 3V4PH 4YXKH 4HBCL 4X7TB 1CU4H 3KDMA 4MJ6A 4NC0B 4M61A 5FOJA 4O51B 3P30L 1PZ5A 3IB4A 1HH6B 2PTVA 1SY6L 4UQ2B 2AI0L 2WIIB 1IC7H 1MLBA 1UWEH 2CLZB 3DRTB 2AGJL 3PWPB 4GKNB 4HDIA 4RGNC 4XNQA 5ESAA 4YBQC 5D6DA 1Q9KB 2NYYC 3VFUA 3EHBC 3FQTB 4FQQB 4Y5XA 5MHSE 1DEEA 4PJXA 2DM3A 3OKOB 1TETL 2XRAH 4UOJA 1KTLB 3NPSB 3U6RB 3CU1A 3W39A 3BE1L 3DXAA 3MFFA 3QIUD 2X4OB 2AK4B 4PB0H 4WIQA 5K93A 4W6WB 3QR2A 3JTSA 3LKNB 4FQIL 5I1DB 5GGRA 1G9NC 4MVBC 5DHYB 1AQDB 3VWJB 1LHZA 3K2MC 3VFMB 5C6PB 4JFFE 3IFLL 1FVCA 2DF3A 3D39B 1G6RL 4X4YA 3CFDB 4Q6YA 1A1OA 4EXPX 3CSYA 1S9VB 5DC4B 3LZFL 3DRQB 1YUHA 4HD9A 3T0VA 4ZFGL 2NTSP 3EOAB 4KTDH 1EEYA 3NCYP 4M7JL 5CEYA 2PW2A 1ZVYA 4GSDH 3UAJC 3VXSD 3KVQA 3F6LA 4DFIA 1J1OH 1BQLH 4MA7H 1P7QD 3QNXA 1RUAH 1PG7X 2NY0D 3VH8B 4CN6A 4UB0H 4DCQA 3LSOB 1FO0A 3V6ZA 5IB4A 2A73A 4AQ1B 4KVNL 1WBXB 1WUNT 1XGTB 5FGBA 5I19L 3FT3B 5ELIA 4I0PA 2IFFL 4OM1L 1ZT7B 5DK2A 1DBJL 4GLRH 5DD6A 4I1NB 4C4KT 1R0AH 5A3ID 4LCUA 4PJHE 2EDFA 4R8WL 5FO8B 1IT9L 1KELL 3FN0H 4YHIA 5TFSL 4G9FB 5C08B 3RDTD 4MA1C 1XH3B 4OUOA 2C4FT 3GIVA 4HCRL 2FO4A 1MHCB 2X1PA 4QRRB 2B1HH 1QQDB 1BPVA 2I26N 4NJAL 2HTLC 4EOWL 1JPFA 1QYGL 4DGYH 3CFBA 1NFDF 5C07A 3WIIH 3OG4B 3TF7C 3THMH 1LD9B 1G7HA 1UJ3A 3TV3H 1BVZA 3V6OA 3CXHK 5EU7E 4LSPH 5HDBF 2O93L 5T3ZL 4IRSB 1M6OB 4KI5D 5IFAH 4G8IA 1YY8A 1ERNA 2DDQL 5KTEH 5IT2L 1Q1JL 5LGJA 5EIIA 4JJHA 4NO0B 5T3XE 5I74C 5F1OB 3GUTB 2YD7A 4J4PA 2MWCA 2NY6D 1DUZB 3V8OA 1A6AA 2PW1A 2ADIA 3ARYA 4JVWA 5FUZL 5IW6B 3DV6B 3QUXC 1YNTB 4BFGA 4CDGC 1KJ2A 1UACH 1RZFL 2ZZUT 3RVXD 1WWCA 4U0QB 5IFJB 2IGFH 2ADJA 3MTRA 3VXUE 2FBOJ 4Z0BL 4PGEA 5I16B 3VG0H 1NBYA 4P5KB 2PN5A 2DMCA 3SKNA 1XGRA 4RGNB 3DUUB 5E8OB 3GBLA 2DBLL 3M1BA 3CJJA 2NY2C 5I8KH 2JIXD 5LJYH 1KN2L 3R1GH 3FB7B 1UQSA 3P4NB 2AV7A 1RVFL 1LO2H 1R24A 4NHUA 5MI0B 4JM4L 3HNSL 2EEDA 3KYKL 3RIFK 3ZHKA 3TBTB 5F93C 3F5WA 4WHTA 5J1TC 3CZFB 1XF2A 43C9A 1A8JH 1A9BB 1RHHA 2E9JA 5GS0D 4OCRL 3ZL4H 1A9EA 3CXDH 1U8JB 1JWSA 4OLYH 3LEXA 5DJ6A 5KW9L 2XZQL 2HJKA 1PJ9A 1LO3L 1YY9C 2R23B 4LLQB 1XMWA 2VDPL 4LSQL 4UT7L 5KOMC 3LMJH 4NPYA 4EI5A 2D0FA 3CK0L 4XPBH 5EC1A 2ZNXA 1JNJA 1IAKA 4H0HB 4X6CB 3V5DA 5LQBL 2WV3A 4R26H 3G6JB 2D9CA 3L3OA 4NZUH 5FO9A 1ZSDA 2VZTA 4PRDA 4GXVL 5DHVA 1MFEL 4OZFG 1N4XH 5KN5B 5C0JA 1RV6X 2BDNH 3LS5H 1BOGB 4XNMA 1VKXA 5AZEH 3IU3A 5E70A 1X5FA 5I9QC 1QR1B 3SDCD 3IXAB 5I18L 4WDIA 2AV1A 4IS6A 5DVNA 3DX7B 2AXJA 3FFCD 4WFFE 1SMOA 1KENL 3CVHL 1K4DB 4UU9A 2Q7NA 4I5BA 1EEZB 4ZG1A 4M3KB 3PP4L 3W9EB 1LEKA 3RVTD 2WLYA 2IF7A 4I2XB 2V5YA 5DMKA 3C09C 3TWCH 5I74B 3SDYL 2FECI 2XTLA 2ZUUA 2ESVB 4RMQA 2X70B 1VEPA 5F9OL 1AGBB 1EUUA 1QSFA 1CGSL 1HN1A 1SBBA 4DOHE 1EFXD 1DJSA 4LLUB 1CWVA 2EC9U 1GXEA 1GGTA 1EAPA 4LQFL 5ICXB 1F6FB 4X5WB 1KNOA 1ZA6B 5IB5B 1NAMB 3O41B 4M6MH 1XGYH 3QIUC 1D3CA 2VDKL 3UMTA 4BK5A 4HKXB 1BBDL 2CRZA 4KQ3H 2EDKA 4F7TA 4PYGA 2XWBA 3MR9A 1WCBA 4MSWA 5LQBH 4ZXBB 2EKSB 4OM0L 5AZ2L 2R56H 2CRMA 5E2VH 3QP3A 5D93C 4ALAL 1D6VH 5FYJU 4UNTA 2Y7QB 5K33A 3VFNB 1LO4L 4GQ9L 1WAAE 4R4NC 1HHKB 5EZLB 2BNQB 1BFVH 4WVRA 4YHLH 4ZUTB 4TTDD 2R2HA 4XVSL 3KXFB 5BQ7A 1TNMA 1PG7H 3TNNB 4HC1A 1CQYA 3GRWH 5JR1H 5JW4R 4YXHH 1J5OL 1CBVL 4OZHB 4N5UA 3VGFA 5GJSL 4FQ2H 4XGZB 1GAFH 4JY4A 3RDTC 1H15A 3HAEA 3O4OB 4FZEH 4GFTB 4Y4FA 3R8BB 3P73B 3JV6B 5LVEA 4QF1B 1FYTD 5SWZB 3GMMA 3LKQB 1VFOA 4WI5A 1MVFA 3V5KA 5ADOH 3DIFB 4ELMB 4QTIH 1J0YA 2HKFL 3MNWA 3A67L 3TVMA 4AJ0A 4PBWD 1NGZA 5E8EA 1ZVSA 1BWWA 4PGBB 1DQJB 4P9MH 5EU3B 3U0WL 1K9TA 4FXKA 4OZIB 5EU4B 3PE9A 4LASH 5DI8A 3RZCD 1E28A 1IGCH 5HYSA 3FHAA 4LLYA 4RX4A 3CMGA 3FOMA 1CLOL 5AYQA 3FQXA 4FS0A 3HE7B 1FNSL 4QYOB 4L8SA 2VDKH 3MLVH 2I24N 4JRXA 3L1OH 5CEZH 2W60B 2LU7A 4EN3C 3EFFB 2GY5A 3KPQB 4F8TA 4CJ0A 3PHOB 1U0QA 2W9EH 3Q48A 2M1KA 5D7SH 3C08H 2R69H 1U3HD 1OY3B 2J8OA 1KT2A 1NFIA 2E7HA 3LDBC 1QFWH 3MCG1 4PJEA 1KCUH 2VITB 4ALAH 2Z91A 3UROR 4LF3A 4PJBB 1Q94A 2PYED 3T8XB 5HDLA 4JQVA 5ESVA 1TTGA 5HHXL 4C54A 4IDJH 1IGTB 1G9ML 2XKNB 3GKZA 5HJ3A 3WCYA 3G5XA 4LEXH 4MJ2A 3WFCH 1T1XA 1YMHA 4NZRL 5DFTA 4RIRA 1FAKT 1LP9B 4WHCA 4M6OH 3HR5B 5CWSB 5E94A 2F8XC 1KLGB 4JN1H 4MZ2A 3L3HA 4U1KB 4YQXH 2OZ4H 3K0WA 3RA7H 1K5NB 4PY8I 4TYUA 2ED7A 3G6DH 3HRZB 4NNPH 2DQDH 2LV4A 3A0OA 4BZ1L 1CYGA 5IB1B 5DFVD 4JJ5B 4I4WB 2NY0B 2XA8H 3SCMC 5HYQA 4DW2H 5T3ZE 4KKBC 4ODVH 2VQ1B 5GISH 1P5UA 5SX5K 2BK8A 5J12B 1OLZA 2C3WA 4U2ZA 1ZS8B 3PGFH 4GW4B 5IVZB 4LGSB 4XMKL 2WUBL 1KCVH 4XPHL 2O5YH 2P44B 3U36A 1JNLH 5FYLL 2MJWA 1H5BC 4NYLB 3RDTB 2AJ3A 2P5ED 2J3SA 3SDCC 1EHXA 4YGVB 4WW2B 3CSGA 2GIYA 4GRWE 3B5TA 1QD0A 4KVCH 3HUJF 1FN4B 1YJDL 5E2WL 2DQJH 3BWAA 4CAGA 5JO5B 2P8MA 5BOPA 4XP5L 1SEQH 1RUPL 3OX8A 1GVIA 4PGDB 4WO4D 1NH6A 1YN6A 1MWAL 4RDQG 5IMLA 5GHWH 1FAIL 1T5XA 1T0NA 1FNEB 2NY6B 4OZFH 3NBNA 1NCAH 1QR4A 1S7XA 3GGWB 1CS6A 2V2TB 1ZLUH 1W2KT 2E7LA 2D7MA 2Z35A 5CJXA 1KCSL 2FX7H 5MERA 2YD5A 4GG6A 5LCVH 1FFOA 1EO8L 5HHMD 1JGLH 1ED3A 2HKHH 4LLVB 1M05B 1A7OH 4ZUVA 2VL5A 4PJ8B 4TQEL 5JOPD 1F3DH 1SYVB 2QSCL 4ZO8A 3HCVA 3QNZB 4G7VL 5D7LD 3WFBH 3LDBB 2XACC 3VGAC 5KVGH 4X5XA 2JIXB 4WUKL 2C9AA 3BJ91 3QJFB 3LV3A 3MLXH 1AQKH 5ERWB 5GXBB 1TLKA 2X40A 2GSGB 1UWGL 3I6KB 2V2XB 5DUBB 1K3ZA 1Q0XH 4UIMB 4OD2B 1CFNB 1NCBH 1T2QL 1U41A 1VGKA 2AKRA 1KTRL 1PW3A 1DUYB 5IROC 2MNUA 4GXUM 3EYVA 4HS3A 4XCFH 3Q6GH 4PREB 3TFKD 5T1LA 3UJIH 1T22A 3C60A 3HZKA 4TTDC 3GMNB 3H9HA 4Z5RB 5JPNB 4JFYA 1S9WA 2ICEA 4K8RD 1HSBB 2DJSA 1WIUA 5EOCH 2EIDA 1EMTL 3U4EB 1YEEL 1L9MA 4BKLB 1MCQA 5BCAA 1XCTB 3GO1L 3X3GH 5HYEA 4LSDA 2PO6A 1MCFA 3B3IB 4U7SA 2QJDA 4R4BB 4MNHA 2SEBA 4WGVB 2HRPL 2YBRA 2EDBA 4PJXF 4JKMA 4YBLC 1QLFB 3U7YH 5TQ2L 3C6LA 1FFRA 3UC0H 1HH6A 3K2UH 4BYHA 3PWPA 2CLZA 5C8JB 3MV8A 1Q9KA 4WY7H 4G8GB 3SDCB 4PLOB 4D0CB 4HT1H 1FJ1A 1S9XB 4ODTL 5HY9A 3N1QC 1IGIL 2H1PL 2VXQL 3FFCB 1OSPH 4AMKH 1NSNH 1FFPB 3RZCC 2DWEB 1L6ZA 4AK1A 1VACA 2DOCA 4MJID 1A5FL 3IGAB 5GSVA 3S5LB 5CJ8A 3RWEA 1MFCL 1RURH 2ARJQ 2O61B 4K9EC 5ACZB 5DQJB 1IGJB 4IOFC 5DHYA 1T5WB 1NMAL 3VFMA 4U1JA 3D39A 1CICA 2EDXA 4IMLA 3CSPA 4JFXB 3FQWB 4M5ZL 1DBML 1NCWH 1B90A 1P4IL 1S7TA 1NMBL 4KUCF 1FCCA 1ZK9A 4L4TD 1WT5A 1PKQE 4JR9L 4ZUUB 3OQ3B 4JKLA 1WFTA 1GGCH 1JWMB 4QOKA 3IVKB 1EFXB 3ISWA 5HHOE 3DTXB 3T3ME 4NRXA 1HXYB 3VH8A 4EIZC 3HAEG 2HT2C 2V5RA 2Q8AL 3NCMA 5JHDE 5EN2B 4JY5L 3FT3A 3UEZA 5FK9B 2J8UE 1J9CT 4HXAL 3VGAB 1YZZA 2H6PB 1DBKL 3QFDA 4LCYB 4GH7B 4G9FA 3RWDA 1XH3A 1LILA 4FTVE 2OQJB 2J5LB 5JW4N 5FXCH 1I7ZB 4RISL 1UKTA 1KULA 1F90L 4J23A 5DJCB 4WEBL 3MBED 2B4CC 1SBSH 1LD9A 4M1GH 5HYSG 3FQUB 1UZ8B 5D1ZC 3Q0HA 3BD4A 3QRGH 4IRSA 1RU9H 5ITBH 1JZ2A 5DFVC 2E6QA 1K85A 1F42A 4AEHL 3GUTA 4LMQE 3VXQB 1OF2A 2OI9C 2YZ8A 4YXLH 1DUZA 5DS8B 4XNUH 3KR3L 2P43B 3V52L 2BNUA 5IW6A 2EIEA 3MJ9A 3DV6A 1HKLH 1YNTA 1YPZE 2F54D 4OQTL 5LAXB 2DQEL 2ZCLL 4QRSA 3VXME 4YAQA 5JOEA 3REWB 1YC8A 1FYTB 4GOSA 4EBQH 5I16A 5DEGB 1T03L 3ECBA 3AFLA 3M45A 2KBGA 1EJ6A 2E8YA 5IFHL 2J2ZA 1Z3GL 3BPOB 3DUUA 3BN9D 3GHEH 5E8OA 1IRAY 4D8PB 4UT9H 4URTB 5F7KC 3FN9A 1Q8MA 3VI4F 3P4NA 3MGOB 4XPAH 2YK1H 1EGJL 5ID0A 4WO4C 3HLAB 1RUKH 1BFOB 4XCYB 2YC1B 3G5ZB 5CBEB 4RDQF 1KJ2H 4PRIE 5B22A 4ONGH 5HVHC 2FIRT 3CZFA 1U8QA 3NTCH 3EYQC 5AD0A 2GEEA 5DMYA 1TVHB 4HPYH 4X8JA 1IGFH 3RNQB 3U30C 1AHWA 5FUOH 1U8JA 3KPSD 2PCPB 4OT1H 2A74B 3ZKND 3GM0A 3EFDH 1B4JH 5E6YA 1JPST 1NL0H 5IESL 5JXED 2R23A 4HS8H 4LLQA 3BGMB 4D3CH 1JZ4A 3BRFA 4LIQE 3DGGA 3VMNA 5EU5B 4PBVC 1N2RA 1U3HB 2ERJC 5DC9B 4MNGE 2XA3A 4ETYA 1HILA 4M8QB 4PY8J 5DLMH 3B5GA 3G6JA 5IEKB 2PYEB 4GRMB 4NKDB 3W2DH 1FRGL 3RUGE 3D0VB 5BXFA 5KN5A 5DD1L 2VAAB 1TZIA 5CD3A 3WNLA 4RMTA 4NQEE 5FV2A 4H20L 4X5LA 3GSUB 4LLWB 2UY6A 2A6KB 3RGHA 3ROLA 2R29L 3LY6A 25C8H 1DP0A 1CIDA 4MMXC 5GS2D 1JJUA 3SDAD 5K9JH 4D9QD 2FJGB 3WHE0 3UJJH 2BCKB 5DHVH 4PJGA 1B2WL 1X6NA 3SQBA 1WISA 1FGVH 3FAWA 3UPAA 3W9EA 3N9GL 5D2NB 4V1DE 1A4KA 1OAKH 3DV4B 4OI9A 5T5NG 4PJDA 3PWNB 1HOCA 4EEEA 2OI9B 3BP5A 2Z8VC 1ES0B 3O6KH 1AGBA 2OL3L 3MMEB 2E9IA 2C4FU 3B6SA 4NKMA 2P5EB 2EH8L 5DRNA 3D3VE 3WKML 5MEQA 1VESA 4U6YB 2G2RB 4UILH 3ARUA 3QAZC 4KRMB 5FKAB 5IB5A 1NDGB 1NAMA 2BHZA 5D7IE 1ZWIB 2V7HB 2XZAL 3GJFK 3SE9L 3RNKA 2YS4A 5CIPB 4HIHA 3ARBD 4D9LH 2F53E 4HPOL 5FYJH 1LDPL 4I18C 3GMLA 2DTML 4NWUH 2Z8RA 3L5XH 3ARRA 4X6EB 2XN9A 5D96C 3FFDB 1ZT1B 2R0WH 2VDNH 4PJCB 4X4ZA 1AI1H 4ZXBA 2EKSA 4JPWH 4Z7UB 1P84J 4YHOH 3T77A 3FKUS 2GYSA 3H3KA 3VFNA 5SV3A 1DQQB 1BIIB 5EZLA 5KSAD 5HHMB 2D03H 3C6SB 3EYOB 2NW3A 2XTJE 4JCLA 2BSED 4I77L 3KXFA 2LU4A 4LCWD 4Y16B 5HI5C 3TNNA 1GCFA 5D7LB 4PUBL 2FO1A 1DQDL 4OZHA 1YDPB 5DUML 1MCEA 2EYRB 1J8HE 1P9MA 5E2UH 4CDHA 3CDYA 4MDJA 3WIFB 3RFZC 4QF1A 4Z7NE 3OKKB 5SWZA 1T7XA 4QO1A 2W0KA 3LKQA 1RJCA 3BIAX 3MBEC 3DIFA 4K7PH 5A16A 2W91A 5I66B 1ZT4B 4HC1H 3V4VL 1NLBL 1FZOB 1T1YB 3NACH 2NW2B 2CMRL 2R4SL 4PJFA 4ERSL 2N1KA 4UV4H 3IAPA 1DQJA 3MLRL 4PGBA 3SQOH 4G42A 3W81A 1NBQA 4MAUH 4OZIA 5EU4A 3WKMH 5KS9B 3HAEH 3WJLA 5HYJA 1KLFA 5FO7A 1KN4H 5I6XC 3MV11 4WW1A 4JFFD 3GBML 5H37G 1UFUA 1I3VA 1UA6L 3HE7A 2GCYA 2Y06L 4QYOA 4F7MA 2ICES 1MJUL 2K7PA 3K8KA 4PJEF 3VA2C 1CGYA 4G5ZH 2W60A 2B0SL 2DTMH 5IMKB 5IGXH 3KPQA 4FQHB 1ZHLA 4UNUA 3VH8G 3PHOA 1N5YH 1GYAA 4XNXH 5ACMA 1EVTC 3W0WB 3OV6A 2BJMH 4NN7C 3WS6A 2EDHA 3DARA 1LEGA 2WBKA 1J0KA 4ZQKB 1KCRL 2QSQA 4JCMA 4PLNC 2Q8BL 4PJBA 3BQUD 3QAZB 3QFJE 1GGYA 1TCMA 4LKXB 1NMCC 2WWMD 3VFWB 4KRLB 5HGGS 5B39A 5JW4Q 4MJIB 2F74B 1RZ7H 1IGTA 3OKDA 3EKCA 2NCMA 1T0MA 1UB6B 4LMQI 5HGBB 4I18B 3G5VA 2CDGB 1CD1A 5J8OA 3JV5A 2DYPA 3EJJX 5D96B 3MRFB 1LP9A 5FCSH 5EUOB 3HR5A 3ZKNC 3LN4A 5JHLH 1KLGA 5DMIL 4C58B 4DN3L 2A6DB 1A64A 3MBXH 4U1KA 3HR6A 5JXEC 3CU7A 1NQBA 2Z4QB 2QKIA 4HG4J 2D9QB 1MCLA 1JZ7A 3HRZA 5INDA 2ZUWA 5BZDA 1MRCL 5T3XD 2EDQA 4P9HC 3SJVA 3AAZA 4JJ5A 2IADA 4I4WA 1CD0A 1WIOA 3TYFB 1JPTL 3CD4A 4UUJB 4HHAB 1YQVH 2GFBB 1S5IL 3FRPG 5IOPB 4GW4A 4PJAA 1TQCC 3MJ7B 1T1WA 4NJ9H 4FN0A 1MAML 4NYLA 4WW2A 3WO4B 2AJUH 1YYLH 1ORSA 1OLLA 1JFQL 1XR9B 1JGEB 4U1LB 3SDAC 1ETZA 3S88H 2D3VA 3T0WA 1E4XL 1FN4A 3EDJA 2DJ4A 1JTPA 5E95B 3MBEB 1Q72H 5GZOD 5ETUB 3GKWL 4X9GA 4E42B 4PJIE 3TA3A 4HJ0D 43CAA 2CJUL 4JO2H 1FNGA 1BLNA 2X4RB 1AP2B 2A83A 3GMRB 4UAOC 3OB8A 1XCQA 3NCYS 3ZKSD 1VDGA 1R3HB 2BP3A 4GG6F 2IH1A 5T5NF 1X5IA 1V3LA 2I25N 1DQLH 3IJHB 2R1YB 1FNEA 2PR4H 5I6XB 2J88L 1MFNA 1F11A 2QADD 3PNWB 3GGWA 4BZ2L 2GTZA 1R3JB 2R8SL 1QBLL 2F54B 1ITCA 4JPIB 1N64H 3DROB 1WBZB 5M95B 4LLVA 1XF4B 4NZTH 2VWEC 3QUZC 5B4MD 4GRLD 1T6VN 4JB9L 5DXWA 2F5BL 4LCIL 1I7RB 4PJ8A 2I60H 3STLA 1RIHH 1SYVA 3EYUL 3Q2CA 3QNZA 3ULUL 4X7DC 5EOTA 3CDGB 3I02B 4NN7B 1I9RH 3E6FB 4Z7VA 3VWKD 3MUZ1 2JB5H 2LQRA 3ARBC 2JCCE 5E7FA 4Z18A 2VUOA 4Z7QE 3JVGA 4GS7B 3QJFA 2GSGA 1E6OH 1NMCB 3P9LA 2HVKA 3I6KA 2V2XA 5DUBA 3NH7L 4S10A 2EE6A 2C3VB 4OD2A 3QSKB 1JPTH 3L95B 1R3LA 4NKIH 4CN4A 5CZKA 2WBWB 3KPSB 4P46D 1RK0B 2WINB 1RSFA 4TVPL 4WFFD 4JFQB 4QRTB 4F33B 3LOWA 3HFMH 3ZYOA 1IC1A 3ZT6A 4Z5RA 4LHQB 5F1IA 1EZVY 1QPPA 2LFGA 5EU6E 1FIGH 2A77H 3U4EA 3QEGH 4MXQD 5TE4L 2J6EL 2ZUYA 5GGVH 4O2CB 3OGCA 1XCTA 4A6YB 3D9AH 1RJYB 3B3IA 4Q9QL 1KG0A 1SJHB 4M1DH 4LOUD 3WSQH 3O8XA 4MWFB 2CO7B 1NGQL 4WU7A 4DTGL 3P0YH 3BH9B 4G9DA 1VFAB 4WFHD 3GI9L 4HK0B 4P4KC 3IAGC 4N90E 5I1LB 2PYFA 3EOTH 1IEBB 4G8GA 4J3UA 5DJAB 4D0CA 4C59B 3SDAB 2R0LL 2AJXL 1T2XA 3GI8L 3FFCA 1CG9B 3MNZA 3NOIA 3IDNB 4LVNC 2X4PA 1V05A 3QNYB 3PWVB 3GNML 4L3CB 2OR9H 3IGAA 3L6FA 3QDJE 4XP9H 3WNMA 5C3TA 3HC4H 4NIKB 4M7LT 4X4XB 5ACZA 5DQJA 1IGJA 1TVBA 2X1WL 5C86A 4GT7A 4HIEB 1N59B 5DJZB 5GGRY 4ORZC 1G7JA 3MLSL 4U3CA 4GKSA 4JFXA 2LVEA 3DI3B 4OSUH 1DQML 3FQWA 4N1CA 3P4OA 4ZTPL 1HQ4A 3MACL 1HEZA 3MYZA 4M62L 1EH9A 1U8HA 4L3EE 2ZUTA 2JJTC 2EYSB 3MRIB 3NA9L 5HYIA 3HI5L 5EA0L 4EIGB 3EAKA 4ZUUA 3UTSA 4HKBB 3S36X 3IVKA 1EFXA 2N4IA 2VDRL 4MNQE 3RWHA 4X6DB 3WXVL 4YNYB 1OCWH 2VLRE 3DTXA 3CCHA 3S3PA 1RUMH 1F4YH 1H8OA 3ZYZA 2HA1A 3MRNB 4HUUB 3QI9D 1P1ZB 1OAUL 2WWMC 3ARBB 4KJQD 3ILPA 1I75A 3L3KB 2H6PA 1EO5A 3O6FD 5C0AE 3C5JB 1DLFH 3G9VA 4HS6B 5H37H 3KYMB 4AZ8A 2AABL 4FQPA 3VXPA 4K3JH 1QKZL 2OQJA 1I7ZA 2IPTH 4EZMA 2WP3T 1VFBB 5DJCA 5IVXA 1OAXL 1A6UL 1AY1H 5I73C 1XT5A 1OW0C 4KJPD 1L0XA 1G9NL 1MCPL 5KSAB 3B9KB 3RY6C 5I76B 3A6CH 5DJ8A 1RK1B 1YYMH 2X4QA 4LCWB 1MCIA 4YHPA 3FQNB 3BIBX 2ZCKL 3U9PL 3VXQA 4XVTL 2L0DA 3DURA 3BDYL 1QSEE 3GDBA 4R97C 2FATL 4PTUB 4P2QE 3VA6A 1I8KB 5DD3H 3I50L 1PVHA 2H9GB 4KMQA 3I2CH 5LAXA 5CZVL 2ZOLA 1FYTA 5DD5L 3H8NA 3O2WH 3F58H 3N85H 1DSFH 3TM6A 2BNRE 4PV9A 4G8EB 4LLMA 4K3DH 5B39G 2DWDA 4XMPL 1LK3L 1QFOA 3FO2B 1J1PH 4KAQH 2X4UB 3MGOA 2WIMA 1NCCL 1RIUH 3RIAF 1DFBH 1U8LB 4JPVH 3HLAA 4BUHA 1BFOA 3MJ9H 3ILQD 3G5ZA 5TPWL 2ITCB 3DMMD 5C9KA 3QHTC 3AUVA 3LKPB 1UXWB 2QADC 4OBRA 4JFFB 1ZLVK 1BD2E 3CGTA 3RNQA 4LSUH 4PLKD 2Y6SD 1BZ7A 1MEXH 2A74A 3VFRB 1FLRL 4GRLC 4MQTB 4U49A 3JWDH 3BGMA 3K46A 4N8CH 5EU5A 4NFDA 3MXWH 3BKJL 3WNKA 4ZPTB 1U3HA 2QTEA 2W38A 3JWOC 1F4WL 2VDLH 5EFIA 3E0GA 1Q38A 2HTKD 2IPUK 4M8QA 4DAGH 4WTZA 3MLTB 1WTGT 5L0QB 4UTAH 3OZ9L 5T3ZD 3BQUB 1MCWW 4GRMA 1QFHA 4OI8A 5C0CA 1EEUA 2PTTB 3D0VA 4UT6H 2NY1C 4U7MA 2VAAA 4KK8D 3BRGC 4ORGB 1CL7H 4PJHB 1CF8H 4Q2ZB 3G6AB 4P5TD 3LD8B 1Q0YL 2CK0L 3BGFB 4P2OD 3GSUA 4JFEE 3CFKB 4G3YH 4LRIA 1GC1C 4WGWB 3BDYH 4PJGF 1T7ZA 4ZNEA 2QR0B 3CFIC 2VQTA 5AAMA 1N7ML 2Y5TA 4N9GB 3T1FB 2WW8A 2E5EA 4EDWH 1IAMA 4Q9RL 4PJDF 5I73B 1A7PH 4YHKH 2R0KL 1PKOA 2MPAH 3IDXH 4MB5A 1KB9K 1MIML 4M1CD 5D2NA 5JIPA 4LOUC 4OB5H 5E2TH 3DV4A 1VPOH 3PWNA 1I8MB 4ZSOA 3TH3T 1KXVC 3RGVD 2VABB 5K9OA 4JREB 2AEPH 4WEMB 2I27N 3KJ4B 9CGTA 5KAQG 4LSVH 2P24A 2BVUA 2P5EA 3VXUB 5BRZE 4HXBL 1V5JA 1DE4B 4N0FB 5D1XD 1HE7A 4QRPE 4NRZB 1UWXH 4ZMAT 1M7IA 3ARXA 1RJLB 1GGIH 5FKAA 1OSZB 4YZFF 1NDGA 2WBJD 5A1AA 4F57L 5CIPA 1OP5H 1NC2D 3GBNH 3LB6D 1INQB 5DRZB 3ULUE 5FEBA 2IALB 1IILE 4X6EA 2XICA 2E7MA 4QHMB 1VENA 4YPGA 3OZ9H 4PJCA 4R2GD 5AWNH 4XI5C 4KGLA 5FDWB 5CUSL 4QY8A 2QADB 2NY5H 1PSKH 4Y4HD 3DX6B 5DC0A 5JW5A 4J3TA 3L3GB 4D2NA 1Z2KA 3PWUA 2G60L 1C12A 1NAMH 1CCZA 4YR6B 1DN0A 2OXHA 4TNWK 4OD3L 3S36H 5C0EA 3C6SA 5HDBE 4GRLB 3S34H 1MPAH 2VDMH 3L7EA 1HXMB 4Y16A 3H7BB 4EUPB 1F4XL 5D7LA 1U8KB 4K7PY 3VWKB 3GHBL 3BWUC 4XWGH 1QO3B 2VL4A 5EIVA 2EYRA 1FE8L 3FAXA 2HH0H 4M7KH 4XVUD 4PJFF 3ME0A 2V17H 3OKKA 3TZVD 1T3FB 2NY4D 3FL7A 4H1LA 4L9LC 5LG1A 2AW2A 4OZIF 1ZA3B 3BKMH 5D7JB 5KSBA 5I66A 4KJPC 2DLTA 1ZT4A 3S5LG 1A0QH 4P46B 4MCYA 1X5ZA 1FZOA 5DZOA 3EOBB 2J4WL 2NW2A 4XX1E 3U46B 1A7QH 1MY7A 1QBBA 2OTPA 2J8HA 1OAQL 5TH2A 3OB0H 4XVJH 5DRWB 5EZIL 2BX5A 3RWFB 2NNAB 4QRRE 3RPIB 5L6YL 2KH2B 5J1AA 1W0VB 3R8QA 3BSZL 4U6HB 3TIDA 5DURD 1YMME 4KHTH 2DKSA 1FG2B 3SY0A 3CIQA 4G8FA 4I48A 1RMFH 2XIDA 5IMKA 4HWBL 4FQHA 2X2YA 1FORH 2DMKA 2WANA 2MHAB 4XZUB 3W0WA 4BFBD 4XP4L 4DOHB 1RULH 2VH5L 4YLQT 5HHOD 1N3NB 2ED9A 4H8WH 1KJ3L 3B2VH 3OR7B 2AP2A 5I8CA 4ZQKA 4OGYH 4PS4H 2P48B 3VGBA 2DI9A 4CVZB 1MFDL 4UDUB 5JHDD 1H3TA 5F9AC 2VR4A 4BSVB 1JE6A 1NFKA 4U1HA 1K6QH 1CDIA 3P9WB 1LP9F 4PD4K 3KPPB 4LKXA 3PUCA 5C6TL 3CFJB 3VFWA 3DUSB 4C56A 3LRGA 2F74A 4G43A 1HCVA 4JEGB 1BZQK 3ARZA 5HGBA 3L3IB 1FBIH 2CDGA 2YMXL 4FTVD 1QTYT 4EVNB 5I1IL 4PLKC 5IEHA 2EICA 3MRFA 3VXTB 4KY1L 4F37F 3LKSB 2EXYD 4B5EA 2BVOB 2A6DA 4CJ1A 3RJDA 1FHGA 3I9GH 4AEFA 5C0RH 2VTFA 3FT4A 4TSCH 5AYUH 5HBBA 3K4ZA 2HTKC 3BPCA 1EIBA 3LVEA 4PJAF 3REVB 2OK0H 3VXRE 4WI6A 1MHPH 5ISZE 3NABH 3UP1A 4J6RH 2R0ZL 3O2VL 4WW2F 3QI9B 1T4KB 4HHAA 3EJYD 4KK8C 2GFBA 5E6IA 4K2UL 3ARSA 3MA7B 1BOYA 4P5TC 2BVPB 2VXVL 4P2OC 1CXEA 1DDHB 2H45A 4U1IB 1NUFA 3O6FB 4P4RB 1JNHB 2DQHH 3FN3A 2V9TA 4KPHH 5AAWA 4U6VH 5DUPH 4L8CB 1XR9A 5J9PA 4YDKL 4X6CE 4F7PB 4QTHB 4MDIB 4QXWA 3MV7A 2APTA 5ETUA 2GK0A 2P7TA 4AEEA 1L6XA 4OCXH 5IHUH 2MKWA 4Y19A 4GBXC 2VH5H 1AP2A 5CKAA 4LHUA 5CILL 5CCKL 4FP8H 1CGVA 1R3HA 3V5HA 4PRID 2Q86B 1UKQA 3BGAA 3IJHA 4NO2A 4YFLI 1YN7B 1U8MB 3E1F1 1DVFA 4ZAKB 5F7WC 5C0FA 5C70A 2HN7A 1IBGL 1A4JB 1R3JA 4Z7VF 1W72A 2F54A 1PLGH 3K8LA 4JPIA 3DROA 5FOBB 1XF4A 1G6RB 3LQAC 1NBVH 1I7RA 3VFGL 4JGUA 4I9WE 2OTUB 3CDGA 3I02A 5DEFB 1TJGL 2B1AH 3MRGB 3DLQR 3QXVA 2W9DH 2DAVA 5F88A 4N68A 1D5IH 2EEAA 3O3BB 5TDNA 1PD6A 5L2JA 1MIEL 3PQYE 4PV8B 1M7DB 2FBJL 3BXNA 3OPZH 4G6JH 5BW7A 4N0YL 1E4XI 4X9FA 4MD5A 2ICCA 2MQ0A 4FG6D 4NQED 4TUOB 5TE6L 5CEZE 1FGNH 3P0GB 4FMKA 4R2GC 5EBMA 3DMMB 5H35B 3SPVB 2C3VA 1E27A 5D2LF 4X0KB 4Y4HC 2D7QA 4KK6D 5GGVY 1KB5A 2CDFB 3KPRE 4U3HA 1EEQA 1RK0A 2D2OA 5E8NB 4JFQA 4QRTA 4F33A 5IMOB 3IFOB 3G9AB 2VOTA 1I7TB 1A7RH 2AK1H 4PRBB 4WJ5A 5BVPL 2VYRE 3OJDB 1MH5B 3S6CA 3BVNB 5KZCB 3WS3B 1CD8A 3O2DL 3VD9A 5HI3D 2OR7A 4V1DD 3HC3L 4O2CA 4TOYH 1PGRB 3RTQD 1RY7B 4OGXH 5GS0H 3DVGB 1SJHA 3WD5L 1GHFH 5CZXD 4XCCH 4GW5B 4TUJB 3QEQA 3BH9A 1AJ7L 3TZVC 3DHMA 1VFAA 2NY4C 3SO3B 3HNTL 4UOW0 3UTQA 4P5TB 5SWSE 1X4ZA 5KJRL 4P2OB 4LSTL 3D3VD 4PBXA 3T0EA 4HK0A 4M43H 3WXWH 1AD0A 4CVUA 2NZ9C 5I1LA 4GRWB 2ICWB 4HEPG 1IEBA 5DJAA 2C4XA 4KROD 1GZQB 2HAZA 1MCBA 3BMVA 3BKCH 2ARWA 1H8SA 5SX4H 3UDWC 4P59L 1CG9A 1ACYH 3IDNA 1B0GB 4HZAA 3CPLA 2F53D 3QNYA 1IVLA 4HUXA 3PWVA 1MJ7H 1TQBB 1MJ8H 5EPMA 3CC5A 3MUY1 4HFUL 3R0NA 4F9PC 3QUML 1B6UA 3U1SH 1KCKA 3BH8A 5T5FL 5KSUB 1KEMH 1N59A 5DJZA 3QDME 5EUKB 4ELME 1CE6A 2HFEA 3O4LE 3PL6C 2ZUSA 3X13B 2NMSA 4X7FC 1BQHB 1BIHA 1JV5A 5D6CB 3RGVB 2G5BB 3IKCB 4DKEH 2EYSA 4JDVB 1JRHH 4IRZH 4P5MA 4HK3N 5IQ7L 5ALCH 3TPKA 2XTJD 3FJTA 4HKBA 3OR6B 4WFEE 4JLRA 3NZHH 4TSAH 1MVUB 3DOSA 3IJSB 1I3GH 4YNYA 5D1XB 3FT2B 3QG7H 5BO1H 4E41E 2EDLA 5FHBL 2KKQA 3MRNA 2WBJB 1P1ZA 4ETQB 2RB8A 3VDAA 3GSWB 5L9DL 4EJ1C 1ND0A 4XP1L 3A6OA 4WWKA 1J8HD 1NC2B 1CK0L 2JE8A 3O3EB 1NUDA 4KQ4L 3L3KA 4LSSH 5IVXF 1U58B 3D69B 3C5JA 4HS6A 4EQ3A 3OAZH 3HC3H 1HWHB 5J06A 3VFSB 5JDJA 5KANG 4R2GB 2DJUA 2IANA 1A7NL 1WFOA 4Y4HB 2VLKA 4KJYB 4W4OA 2APWA 1D5XA 1YEIH 2PXYB 1IM9D 4TULL 4K9EL 4K23H 5F9JA 1YQ2A 2BRRL 5KSAA 1RZKC 3B9KA 1F2QA 3LKRA 5I76A 2H26B 4M5YL 4H88L 3QUYC 4JO1H 1WZ1L 3SGJC 2D7NA 4MQ7A 1CXHA 3FQNA 3E8UH 4RAVB 4Q97A 4R4FL 3LH2L 2NY3D 3EJYC 4HJJL 3CVHB 2F8OA 2XOTA 5MEND 1FQ9C 5JW3L 2I07B 4PTUA 3WN5B 3P77B 4ENEC 3SGEH 3HZYB 2RIKA 5IB3A 2PTUA 3P4MB 1PY9A 5DJDA 3F6IA 5BOZG 4NFBA 3STZB 1RJZB 1V8HA 1KFAH 1C1EL 2CIIA 3CLFL 4JVPA 3VXSE 3VFVB 4K3GA 3G08B 2NY4B 3EJZC 5JOFA 1FNAA 1MREH 4FQLL 1MCNA 2DIAA 4NM8H 2FLRT 4PJ9C 4X9IA 1JNNL 4U1MB 3FO2A 4LKCA 2JELL 3QFJD 2X4UA 1AGEB 1PBYA 4YHNB 3ZE1F 4I0CC 3QXUA 2H32B 5J6GB 3S37L 2ITCA 1EJOH 3VFOB 2DICA 2B4CL 3C8HA 3DETC 3QH3B 5LWYH 2GT9B 1VA9A 1PZUB 3QO0A 5DURB 1EXUB 3N06B 1MCWM 4LU5H 4PRNB 2Q7YB 1ZHBB 1P69B 3V6FB 3VFRA 1QA9B 2V7NB 1PKQB 3BD3A 3RBSA 3PXJA 1QSZA 3DECA 1CDBA 2H2PD 3AREA 4ZPTA 5HHOB 2LAGB 3IYLW 2X9YA 4QHUA 4O5LH 2BHUA 3T65B 4Y4KA 1HDMB 2BRQA 3V0WH 3MLTA 5B38B 1S8DB 2GAZB 4OJFL 5JHDB 5CSZB 2A6JB 1R5WA 1B0RB 2FL5A 4QGTA 3BQUA 4FZ8H 4JANB 2QBWA 4K94H 2XWJB 2J8UB 1SM3H 2PTTA 1I85A 4JO3L 4AG4L 4ORGA 3WFHB 4NKOB 2V5TA 3G6AA 3IU4L 5I71C 3S7GA 4KK6C 4HKJB 4NSKB 4FTVB 5GGSB 4JFPB 3HE6D 1ROWA 3DXAE 1AIFB 1BJ1J 4JE4B 2EIZA 4LHUG 4X80H 3RVWD 4DJMA 3T1FA 1TITA 1HWGB 3F7VB 1CFQB 1LO0H 3CMOL 3S9DB 4YE4L 1A02N 1AE6H 2X10A 2UYLB 5E6IC 5HI3C 4H5SB 3T2OA 3GSRA 1KJVA 5J7CC 3LAFA 1NC4D 5KVFL 4KV5F 3AROA 1RI8A 3OAYK 1V3KA 5CZXC 5JORB 4XPTH 1XGUB 4NC2B 5I1AA 1I8MA 1I1YB 3JXAA 1YEHH 4LVHC 2DB8A 2VABA 3C5ZD 2JK5B 3MLWL 5AUMB 1F6LL 3Q1SH 2VLME 1WWAX 1YPZB 1QHPA 3UYRL 4B41A 1BEYL 5FHAH 5F9DC 3VXMB 5KVEL 1DL7L 3FTGB 3OBAA 3VXUA 4F2MA 1CLCA 3LPWA 4NRZA 3IAQA 2RBLA 4GAYB 3P11H 1AO7A 1UH4A 2XY2A 3AC0A 2GW5A 3BUYB 3SKOB 4CVXB 3CUPB 3WLBA 1INQA 3Q5TA 3ZYIA 4MS8D 5GGQL 4O9HH 2IALA 4AH2B 1BJMA 1BVLA 1KPVA 4M4PA 2BSSA 1HINH 5IM7B 3STBA 4PRIB 4TTGA 3QXDB 2FHBA 4XPGH 4TRPL 4JDTH 2CDEB 2UUDK 1JHKH 2PETA 4WCYL 3GSNL 2QQNH 1L7IH 2ZG2A 4ZO7A 5F7UA 2WWKO 2XTJC 4YR6A 5L8KB 5E4EC 3QCTL 1L9NA 5CIPH 3FOLB 3U9UA 3PG2A 4ZO9A 2FGZA 5EU6D 5FM8A 1DANT 2FIKB 5DQDL 4MNGB 1HXMA 1W8OA 1U9KA 4M93C 4EUPA 2VDQL 1GPOH 2FR4A 1C08B 1T0PB 5T33L 1MCOL 1REIA 2Q3AA 5F96L 1LK2A 4Y2DC 5BVJA 4DKFH 2AXFB 4GAJL 1AGFA 1T83C 1YEJL 3RUGB 5KSBF 1NJ9A 3QCVH 2DL2A 1U93B 1JPSH 2P49B 1J0IA 4NQEB 1OTSD 1N8ZA 1I1RA 3KYNB 1T3FA 3UX9B 4N90D 2OJZH 3QJHA 3IDIA 2NXYD 1XR8B 4TUKH 2Q6WB 4QHLB 5D7JA 4HLJA 4RNRA 3S8WA 4P46A 5EIQA 3CX5K 2QQLL 2K3TA 1N5AB 4Q6IC 1IAIL 3U46A 2G9HB 4R9HA 3VI4E 1JHLH 4X83A 4AY0A 3QDJD 5IG7B 4ONFL 4W70A 1PDKA 3EYSH 3QQ9D 4JHWH 3MOAL 2NY3C 2YRPA 3FMGL 2OJEB 4HJGA 4YDLB 3KLSA 4V1DB 3SGKC 1C5BL 4JZJA 2LABA 4H1LH 1XGQA 1G7MB 3RTQB 5GRVK 3JZ7A 4P57B 1X5YA 3E6HA 1JPGB 2DL9A 4F7EB 4IMKA 5CJQL 1T66D 1T1ZB 1MWAB 1U95B 4XCNB 1BAFL 4HBQA 2MHAA 3D3VB 4K8RH 2Y07L 3WFDH 1N3NA 4CRPA 3OR7A 2AXHA 3X17A 4S1DC 4KROB 1AFVH 4PJ5A 4S1RH 3VRIB 4BSVA 3IETB 5D7IB 3EGSB 3RY5A 4OLUH 5FA3B 2DLFH 2YN3A 4MHHI 4XMLL 3KPPA 2F53B 3CFJA 4M03A 2YD9A 4BFIA 3ES6B 5ALBL 2MSPA 4OGZA 5C0AD 4UINH 5GSRB 1JGUH 4HUMB 4XBGB 4ODSL 4QXTB 4GXUN 3NFPB 1WK0A 2A6IB 3LKSA 1V7NL 2BVOA 3MUJA 4YDIL 3RIAK 1JCKA 2D7OA 4JZNB 3BIKB 2XTJB 5E4EB 3KLAB 2UY7A 5MP6L 4X98B 5J13B 3O3AA 2Y36H 3ZDZE 3S96A 1XIWD 2BOCA 4IJ3B 1CDJA 1QSED 3QI9A 1T4KA 1NDMB 5BV7C 4LLDB 4RAHA 4MD0B 4JFZL 2CLVB 2YKLL 4FFYL 4NC1C 5JLZB 1J8HB 2BVPA 3SDXE 3BP7B 1DDHA 3HE6C 3O6FA 1MNUL 4P4RA 1JNHA 3BKYL 3QZWA 1CVRA 5DD0H 3KJ6L 1Y6NR 3MYJB 4TNVF 5E99H 1FVEB 2YXMA 4M7ZC 5DZLA 4F9LA 1X5JA 3RVWC 2BNRD 3MRMA 4OBSA 2YPVL 4F7PA 4MDIA 4DVBA 3ALPA 4ZO6A 4OZ4B 1IM9B 4KTYA 1SY6A 4OGAD 1MELA 1TENA 1VFUA 4QXGH 3MCLL 3VE0B 1S9YB 4O58H 4Q6IB 3TT1L 1UC6A 4LFHD 1BVKA 3VFTB 3FONB 5E8DL 2FYYB 3QXTA 1VCAA 2NY3B 4N1EA 1YN7A 3C5ZC 1BD2D 1U8MA 3RAJH 4ZAKA 2AJSL 3BAEH 3H2WA 4K3EH 1DTUA 3ULVC 1N6QH 4A6YL 15C8L 4P9HL 1IQWL 4UDTB 1J88A 1Q9OA 3C5SB 4N1HB 5FF6B 1IQDB 1G6RA 2ZCHL 2HJLA 3BZFB 4KXZI 3MODH 2OTUA 3PP3K 5DEFA 5TQ0H 5T1DH 3P3YA 5IF0A 1JK8B 4GQPH 1I9IH 3ETBF 4Z78B 3QFJB 4HGWA 4MS8C 4U2YA 1ZANH 3L9RB 2NX5E 4PV8A 4PY7B 1SYSB 32C2A 5FM5O 1ODAA 4Z9KB 1MLCB 3L3DB 3SKJL 1QLRA 1QG3A 4YWGH 1W72H 4FQ1L 5D1QD 4G6FD 5H35A 4XBPB 1I9JH 3DMMA 3H9SE 1WEJH 3TIEB 1XEDA 2EH7L 4JFED 1GZPB 5GRVL 2BC4B 1TZHA 3MXVL 1WQVT 3X14B 3ZDYF 1P7HL 2HWZL 5JDSB 5TE7H 3TN0D 2FD6L 4KKLC 2OYPA 3PGCB 2FX9H 4Y4KC 1H0DB 3H3PL 5E8NA 5TDOA 1TTUA 2RCSL 5IMOA 3IFOA 4HCRA 4PRBA 4YC2C 3PHQA 5ITFB 4HQQH 3OJDA 3KJ6H 4HKZA 4Y1AA 5E1HB 5B3JF 4IRJD 5CLTA 4YEEA 5GRJH 1AGDA 4FQJL 3WS3A 3PXHA 3CH8A 5SX4I 1KBGH 3CDCA 1ZEAL 4DK6A 5I2IB 4HWEH 1KB5H 1S7VB 1VB9A 4GG8B 4TUJA 4XXDB 4PJEE 4NCC1 1NGYA 3OAUH 5B8CB 3VXOA 3CVIL 2FNBA 2NXYC 4DN4L 3U48A 3SHSA 3HE6B 4PR5B 2IMNA 5JUEH 1X5AA 4FNLL 5C2BL 4QRPD 1JRHI 3ZE0F 4M7ZB 1GZQA 2E6PA 4YH6A 3U4BH 1BJ8A 4U1NB 3CLEL 4WUUA 2IG2H 5K59E 1B0GA 3VD7A 4PJIB 1I7UB 1JZ3A 1SEBB 3LS4L 5ENWB 1CXFA 4OF0A 3NAAH 3RL1B 3HNVH 3NIGF 4JHBA 1NC4B 3IKKA 5KSUA 2GSIB 3MGTA 3BO8A 5EUKA 1INEH 3GJEA 4OF7A 2DM4A 4OCSH 3NFNB 1LEIB 4P23D 5D6CA 3OKLB 3RGVA 3C5ZB 2G5BA 4KUZL 4FXGA 2KZ1B 5GS2H 4EUPG 1T89A 1H8NA 5I1JL 5C0GB 1F97A 1ZHNA 2FCBA 4RSVA 5D71L 3FQRB 3E3QC 1MVUA 4QKXB 5D1XA 1UVQB 3BMWA 2ED8A 1MUJB 2HFFB 4OFVA 4ZD3H 1MCKA 2XY1A 3QIBD 3TO2B 4ETQA 2JCCB 1KPUB 2E9WA 3QXAB 1S7WA 3GSWA 4XP6H 2W07A 3VW3L 3MO1A 5EZOL 4F15B 4KZEH 2FLBT 3TGXA 4AL8H 1NC2A 2AAVA 3O3EA 4DQOL 1OGAD 1JF6A 1MAJA 2P1YA 5GGTL 1D5ZA 2OMNA 4XWOD 2WSKA 4DUXA 3AXLB 4ODUA 2NY7H 1WV7T 4M8VA 3LIZL 5D8JL 2DM2A 4M7LL 5FDYA 4KJYA 2PXYA 1MRFL 4HIIB 1D9KC 3D85D 3GSVB 3BPLB 5J56B 2EZ0D 3SKMA 4MD4A 4Z77B 5BJTB 1UM5L 4P48A 4UQ3B 4BSWB 3V0AC 1F3RB 2E27H 2H26A 5H2BB 5EU6B 5I1GL 2A9ML 4O02L 4R0LB 1LE9A 3ZZ1A 3FO0H 4NBXB 1A6VH 1XIWC 3MUGB 3BJLA 4GG6E 2ZOKA 4MB3A 5C0IA 5I1HH 4CW1B 1PQZB 4RFOL 5IWLA 3CVHA 5HVFB 4WNQA 1ZGLM 3W9DB 2FH6A 5L7XL 1YEKL 2I07A 3WN5A 3P77A 4G6KH 3HZYA 3U82B 3P4MA 3ULVF 4L4TE 3GB7B 4QRQA 3NCCB 1HH9A 2COQA 3STZA 4ZNCD 1OAYH 1BM3L 3TT3H 2EE9A 3OKYA 4RFNC 5F1NB 2NXYB 3I6GB 3TPUB 3PIQA 2FZ3B 3UYOD 1F58H 3DPBA 4OGAC 2XG5A 2P46B 2OL3B 3RVVC 4PB9H 2AJVH 3FZUC 4JZJC 3Q5OA 1KUMA 4UTBH 2IBZY 1MHEB 4QXUH 1UM4L 2X41A 3QDJB 1EFQA 4GMTL 4NNYA 2VLJE 4OV6F 5J6GA 4IMKC 1IFHH 3VFOA 2E6JA 3IJYB 3QH3A 5KVDL 1GIGH 4MJ4A 4KI1A 2NYYD 3EHBD 1J86A 4YPJA 4PGCB 4NM4L 4L3EB 3PDOA 3OKEB 3JUYA 2Q7YA 3V6FA 5L2KD 1DLHB 3VI3F 3F12B 4HUKB 3WKNA 2V7NA 1PKQA 1BGXH 3MOBH 3BT2L 4OLXL 5HHNB 4ZFFB 4MNQB 5HHOA 5FA4B 3TBVA 5ISZD 4QRUB 2VLRB 4JG0L 4NQSA 1HDMA 3IDGA 5JNYB 4YO0B 3WE6B 4S0SD 6FABL 1S8DA 3K81A 2GAZA 2CKBL 5CSZA 1G7IA 2A6JA 5JHDA 4UMGA 4GKZB 4U6XB 1YNKH 4JANA 3IDUA 2XWJA 4CADB 3O0RL 3UO1L 1MJJB 5EB9A 2OS7A 1YEGL 3WFHA 1JN6B 5C0AB 4NKOA 1HCFX 5JMOC 3K1DA 4HKJA 5EZJB 4NSKA 2C3HA 4JFPA 4UV7L 1CN4A 1P2CB 1CTNA 1QNZL 4H26B 5CD5D 1L7TL 1O7SA 4RWYH 5E4IA 2FGWH 2FX8L 4QWWD 1ITBB 1N6VA 3BX7C 5IBTH 1U8PB 4IRJC 2P8LB 3CAFA 4JKWA 3OHXB 1KB9J 3WUWB 4H5SA 4XXCA 4OCNC 4LARL 3MC0A 1J1XH 3T0BA 1CDGA 1XIWB 2XI9A 5SV4A 5E00A 1QSEB 5A2KH 1INDH 3UTTA 4D0BA 2Z31D 1I1YA 4QOKE 4U6TA 3JWOL 5DJ0B 4CVWA 4FA8A 1YPZA 2DQUH 3MZTA 5B3NA 3FB5A 3O6MH 3VXMA 2X1XR 4XCEA 2C1PB 5DRXB 4I9WD 2ATPB 5TF1L 5GJTH 1FH5L 2BNRB 5T3XH 4GAYA 3ZE2E 3G5YB 1NCNA 4O2FA 3PQYD 3BUYA 2MFNA 2AEQH 3NCBB 2HYMA 3SKOA 4CVXA 3IFNH 3GSQB 1GC1L 1K8IA 5HHPB 4G7YL 2F58H 5CEZD 3QYCA 5IM7A 5JQ6H 2YA0A 4JAMA 1EX0A 4FFZL 3NIFF 3QXDA 3V4UH 1Y6MR 4DGVH 4P23C 1JGVL 4OZGF 2MOVA 1AXTH 2CDEA 2VKWA 3VJ6B 4CGTA 2KZWA 1FDLH 1KCLA 1KEGH 1BD2B 3KPRD 3RJQB 4PTTB 3QPXH 4WV1C 1Q9LA 3H42H 4D9QE 1FPTL 1SHMA 1P6FA 4NUJB 1EUTA 1C5CL 2YA1A 3S4SB 4FQCL 2B2XL 4GUPA 4JFDA 2KQMA 3EDFA 5J3HD 1OM3L 4MNGA 3DO7A 3LHPL 1MFAH 3QIBC 3DSNA 4AENB 12E8H 2Z92B 1C08A 5E7BA 3FO9B 4NQTA 3NCJH 4JKPL 4JM2C 1GGBL 4OIBA 4UIKH 3NZ8B 2AXFA 3IDMB 1U93A 4XWOC 5FUCC 1OP3H 3D2UA 1QEWB 2XQBH 2ZSWB 3GJFB 4R3SA 5EOQL 5SWSD 4NUGL 5D1QB 1Y0LA 1YY9D 4NQEA 4G6FB 5C09E 4E5XA 1A3RL 3IDYB 4FQXA 1A6TB 3KYNA 4JFEB 4X6DE 5IBLC 1UYWH 5ACLA 2VWEE 4LVOB 3FB6B 1UM6H 1ZLWK 4EUPH 4QHLA 4HZLB 3TN0B 3VMPA 5KANI 1E6JL 5DGRA 5F72S 3RQ3A 4J2XA 2DQCL 2GTWA 4JQIL 2CQVA 1KC5L 4MA3B 4L5FL 4LRNL 4Y5YA 4IRJB 1LO5B 2XZCL 1BQHG 5GRZA 3R06B 5E6ZA 4U05A 2OJEA 2OTWA 4U33A 4V1DA 3QDMD 3PWLA 3F7YA 3UJTH 3O4LD 3RTQA 2VMFA 3MRHB 3D0LA 5LKNA 4LAQH 3NIDF 1P4LB 1UJTA 5GS1C 4FFWC 1T1ZA 1RZJC 3VFPA 1U95A 4XCNA 3GIZH 4JRYE 5BRZB 4KWUA 4KDWA 4BELD 4NKQB 4D0DA 4L4VA 1MI5D 1KTDB 4QRPB 4ODHL 2FRGP 1UXSB 4E41D 4B0MM 3F7QA 5DJXA 1K4CA 1QRKA 2YRLA 4XTRC 3QCUH 1TXKA 5GPRA 2AERT 2Q76A 1FL6B 3VGDA 2GJZB 1KYOK 1T89C 4NP4H 1FSKB 4XBGA 1J11A 1IAII 2IFGA 4QXTA 3U83A 1WJ3A 5D5MA 4I0KA 5EG6C 2A6IA 4PJGE 6CGTA 4P23B 1F4AA 5C0BA 5I1CH 3HPLA 4WV1B 3A6BH 2UWEA 5EOQH 4JZNA 3KPNB 2A9NL 4PJDE 4XAWL 3GK8H 4KHXH 3KLAA 4M6AA 2J7LA 2D7TL 1DEDA 2BOBA 5DDHB 4PRAB 1X7QB 4X98A 1CFBA 5GGUB 1OAZL 3M17B 1T2JA 1FC1A 1HIML 5DR5H 3HMWL 3QIBB 1NDMA 2DD8L 3B9EA 2E7CA 1X4XA 4MD0A 4APQC 4LSRL 2IBGA 2B5IC 1J8HA 3HPJA 2VXTL 5EORL 4R4ND 3R4DA 4POZC 3SBWA 2CRYA 4KDTA 3CFEB 4NO3B 1U42A 2YPKA 3QQ3B 4XRCB 4Y89A 1OPGL 5CD5C 1FVEA 1FVDA 4NDMA 4YDVA 4NQDE 2IAMA 2HJFB 3EYFA 4S1QL 4ZOEA 2UZIH 4P49A 4QWWC 1EHLH 2XN9E 3D85B 3ARFA 4YZFE 2AJYL 1UCBL 2JJVA 3P9MB 1CLZH 4FRWA 2WUCH 1DANU 3WFEH 4XC3H 4CU7A 4PGJA 4RZCB 4PJ7A 4MGXA 2DQTH 3NFSL 4HIXH 2A1WH 3FONA 2FYYA 1ZGLP 3DBXB 3E2HC 2Z31C 2B39A 5CS7A 5EO0B 1YMMB 1OQOA 3ARDD 3DVFA 4HBCH 1CFVL 4OD1L