2OTPA

Crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
194
structure length
193
Chain Sequence
LPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQCLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Leukocyte immunoglobulin-like receptor subfamily A member 2
publication title Crystal Structure of 3D Domain Swapped Dimer of Immunoglobulin-Like Transcript 1 (ILT1/LIR7/LILRA2), Molecular Insight into Group 1 Activating Receptor Forming Unique MW Interaction Pattern
rcsb
source organism Homo sapiens
total genus 11
structure length 193
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otpA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2otpA02
1A1MB 4DUVA 1KEML 4NN5C 4I77H 3WO4C 2YUZA 5SX4H 5DJCB 5EOQL 2R0ZH 2UV3A 5A40E 5DD0L 5ESVB 3PL6D 5KANI 5JHLH 4JFPB 1D5MB 1UB6A 4ELME 1R3KA 4ZOCA 4P9HH 1N59A 1U8JB 5GRUL 4RGNC 4ERSL 2CUIA 3KXFE 3P11H 4PR5B 4APQA 4G6KL 3PQYB 5HY9A 3BMVA 5CEZD 1KLGB 3AREB 4I0CC 5TE4L 1IGJA 1U91B 3F65A 3MR9B 4HKXB 4JQIH 5DC9B 3RDTA 3OTTA 3OAYK 4V2BA 1G7MB 4BSWB 1ODAA 1OL0A 4L8CA 2EZ0C 1CL7L 2Y07L 4HUWB 4F3FA 4WEUD 3F6IA 3H9HA 3LZFH 3RPKA 3ZKQD 1BWMA 5T5FL 1SJHB 3MX0A 3VI3E 1UEYA 4Y1AD 3HUJE 1ZA3A 4PJ9D 4DW2H 1KULA 3MRMB 2DQJH 2IANE 5IF0B 4E42B 5JHDA 4HS3B 3OGCA 4LNVA 2CLVA 1S9KC 1RZKC 1FAKT 1AGBA 4JHZA 3ZKXB 5TF0A 4DKEH 2WUBH 2M1KA 2EYRB 2AI0L 4TNVF 5E8NA 1J0JA 4XPBH 5ETUB 4K94C 4LLYA 1NFKA 3OKMA 3OPZL 4PG2A 2YD5A 4XXDB 3CDGA 4MQ7B 5CJOL 4JKPH 1OTUC 2WIIB 4W4NA 4KTEH 5C3TA 1PG7L 2DI9A 4NNXB 4MGXA 1XIWD 3FAXA 4KI5E 3W11D 2YZ1A 1U8LB 1T5WA 2EDRA 1UVQB 1RHHA 1NLDL 2HT2C 4FTVD 3FB6B 4P4KB 2VOTA 4NRZB 2G2RA 3S7GA 1OCWL 4ZSOB 2ZUSA 4R2GB 1I9IH 1R3HB 4FQIH 4G6MH 1T80A 1P9MA 1X5XA 3GI9L 1U8MB 4YEEA 4F7MA 3OKDB 2R39A 3BXNB 4R90H 1CK0H 3A6CL 3GUTB 1PZ5A 4S0TD 2GJZA 2AXGB 3PL6B 3NPZB 3MZGB 3Q3GA 4POZD 2DKUA 4LLAA 1I9JH 2ZSWB 3ZT5A 3QJHB 4F2MA 4QEGA 5F96H 4ONGH 3JV4A 1T2QH 1ZLWK 4JZJA 5HHNB 2WMPA 4PB9H 5DSCA 1F2QA 1QKZL 2HRPH 5AEAA 1W72L 3O9WD 3S37H 4FQHB 1YDPA 1JRHI 4POUB 4HX1A 1NDMB 3H0TA 2CQVA 3EJYC 4WU7B 1IM9A 2R2EA 5ELIA 1S7XA 2DL2A 3PWUA 1JHKL 2VO5A 4HIXL 3SY0B 3BWAA 3ARXA 1YEIL 3BKJH 5LGKA 1A9BA 4NKDB 2W91A 4Y1AB 3D69A 3EYSH 4PJ9B 5EUOA 4S1QL 1REIA 3WHE0 1A9EA 3MRBA 2SEBA 1CGWA 5J0BA 2DBLL 1Y6NR 3LB6D 2QADD 3ZT6A 5MEQB 3KHOA 3BO8B 1MPAL 3RX5A 5CP3A 1KOAA 1JHTB 3SDCD 4TRPL 1I85C 3T4YB 2Y06L 4JN1H 2N7AA 2AJ3A 1LO0L 1OW0A 4V1DE 3V6ZA 3ARSA 4Z7NF 1NCAH 3MXWL 3AREC 3RJDA 1EUUA 4LGPB 5FB8A 2P5WE 4OZGE 5FGBA 3EJZC 2H1PL 1LVEA 4HJJL 1NFIA 1EJ6A 5EWIL 4R0LA 1CLCA 3IFPA 3ZHLA 3CFDB 1BGXL 2BSRA 1BEYL 3IJSA 1RUMH 4QRRA 1ZS8A 3S3JA 5DJAA 3TJEL 2CDGA 5KSUB 3JV0A 3U4BL 2VXQH 4GFTB 5IW3A 1N4XH 1QLEH 5IW1A 3RJQB 4APQD 4Z7WB 5GGSB 3U4EB 5INDA 3QA3B 3ZKXC 4X7SH 1AGDA 1KPVB 2H41A 3RDTD 4BKLA 3AS3A 2F58L 2FZ3A 5E2TL 3VRJA 5GZOD 5AD0A 1BJMA 5F9JB 5I1JL 1PX3A 1NCUA 4KZEH 1UWGH 3O9WB 3B9AA 4J2XA 4UUJA 2Q76B 1ZLSL 1JWUA 1PKQA 2VKWA 2MMXA 3C2AL 3ZSTA 3M8OH 1ORQB 5FGRA 2GIYA 4H26B 4AT6B 4P4KC 3W81A 1FVCB 2VE6A 3HMWL 4ZFOA 1HNGA 5JHDD 3RIFK 2BHZA 5IHUL 4MDIA 3QDMA 4QXTA 3D3VA 1X5ZA 4XCEA 5HYIA 4JFDE 1R5VA 5TFSH 1BBDL 3P9LA 2QADB 1YEJL 4YHZH 3PL6C 1IC5H 3MROA 5A2IH 1ZANL 3CPLA 3VFOB 4IS6A 4PJCF 3CMOL 4PJ5E 1Y6KR 3N85L 4EUPH 2D7TH 3QI9A 1CGTA 3CFKB 1OSZA 1F42A 5C09E 3MRKB 4UILL 4PJAB 3L5JA 1R0AH 4WENB 2BZDA 3O3UN 3QQ4A 1FZMA 3UTQB 1K4DB 4PYGA 5ESQA 1JZ4A 3FT2A 3KWWA 4YHML 5D8JL 4PV8B 4YZFF 3OBAA 4QXUH 4I5BA 4LCCB 3DURA 5L9DL 2FB4H 5F1SA 3JTSA 3CUPB 5E7BA 1A0QL 1KC5H 3X17A 2VQ1A 4PJ9C 1UB6B 2FBJL 1R3KB 5C7XL 3MUY1 1U6AL 5GGVH 4DUWA 1DSFL 1N59B 3BZFA 3PGDA 4X6FA 4U7MA 5K93A 2BVPB 4APQB 5HY9B 5J7CC 4OLVL 1Q1JL 3DO3A 4JG0L 3VJ6A 1VGEL 3MRJB 2X4RA 3RDTB 3SDYH 3VA6A 2BOBA 2VH5H 1UJ3B 5T1LA 4LCUA 4LKCB 3NTCH 1IM9D 4PJ7A 1VA9A 2YS4A 5I19H 3H9HB 1IAII 3W11C 4D9QD 4AEHH 1ZA3B 5I71B 5KVMC 3GMLA 1IL1A 2H32A 1F3JB 2UZIL 2X1XR 2EXWD 2RFXB 5C6PB 5TE6H 5JHDB 3OGCB 5IWLC 5GHWL 1RULL 2X41A 3OAYH 4WU5A 4XRCB 4QF1B 5E8NB 4Z7QF 5A2FA 3OKMB 5IB4B 4GAJL 1RZJH 4ONFL 4UNTA 5HGAA 4PGZA 1P4BL 3C6SA 5AUMA 2H9GA 3B9KB 1FFPA 3FHAA 4POZC 1JYXA 4UINH 3AM8A 3GB7B 2JB5H 2HG5A 1U8NA 4NZRH 5DMIL 1N7MH 2ITCB 4KHTL 2OXHA 1T89A 4EKXA 3EZ8A 1T5WB 3OR7A 1RHHB 1KIRA 3O9WC 1DANT 2P4AB 4X9HA 4FZEL 3QWOA 4QRRD 4CW1A 5BQ7B 1WEJH 4JZNA 1UFUA 2ID5A 2CJUH 2FJGA 4WGVB 4Z95L 4GG8B 1EX0A 5FOJA 3H3PH 1CFSA 1RUKH 1KB9J 5B38A 3NMEA 3ARTA 3T1FB 2GJZB 2R0WH 4NO5A 4KKCD 4NCDA 4K3GA 1I7UA 2M2DA 4JHAH 4LF3B 4F2MB 3JV4B 4JFEE 3LB6C 5C0BB 2QADC 3ARQA 3SKJL 3F7YA 4LAQH 4HULB 4JDZA 3L3GA 3SDCC 3WXWL 1JGEA 4F58L 1NEZG 2XQYG 3BMWA 3PWNA 2XV6B 3IDXH 4NBYB 4M6OL 5EOTA 1SJVA 1K4CB 1HWGB 1T1WB 2IH1A 2DWEB 5F88B 1GXEA 4ODUB 4R26L 4CNIB 2DIJA 4A2LA 3MV8A 5B3JE 1ZLWH 3QDMD 3D69B 3E6HB 3IKKA 4RAUA 4Z77B 2AEQH 1MRDH 3ZE1E 3D3VD 5D7JA 3MRBB 1YNLL 3IYLW 2SEBB 3KLAB 1UH3A 3LQAH 3O6LH 5KSAA 4HQQL 2QKIA 3QXWA 2CLRA 1TLKA 1YYLH 3W39A 3EO9L 4FZ8L 5F9OL 4PS4L 4X9FA 3QWRA 1AP2A 4PJFE 5TPWL 4APQC 2AJ3B 3V6ZB 5L8JB 3QI9D 1JGUL 2RCSL 2EDOA 2KH2B 4PPTA 1NCBH 1OOAA 3SGDH 3RDTC 5IBTH 5JIHA 4PJIF 4YPGA 3VXSB 5FB8B 3WXVL 3I6GB 4C56E 1SY6A 4LLMA 4XP9H 5GZOC 3AFLA 1UJ3C 3ZTJG 3RZWA 1DBAH 1KLUB 3IFPB 3MLYH 5JPNB 4MQXD 2VXTL 4E41A 1VGKA 1QZ1A 1ZS8B 3L5HA 3QISA 5DJAB 2CDGB 4U1SB 4HBCL 4D2NA 4OLZL 4OCWH 3DRQB 1UA6H 3HZMB 5IM7A 1A7QH 4KVCH 4ZO8A 1FBIH 2HVKB 4JDVA 3EDEA 4UMGA 5KSBF 1CQKA 1I8MA 1AGDB 5CIPB 3I84A 4OF5A 1BFTA 2FO1A 4DGYH 5L6YH 5B4MC 4PG2C 3VRJB 4JFYA 4K55A 2WINA 5T1LD 3B9KC 3NFNA 1R5IB 5DGQA 2Z4QA 1J11A 3TT1H 4WVRA 4UUJB 4XMLL 3OB0K 1PKQB 4Z18A 8CGTA 3DWTA 3UEZA 1FHGA 1U3YA 2OX5A 1NBYB 2YN5A 4MZ2A 3THML 1LE5A 1ZEAH 3D87B 5F6HI 3BH8A 4PJHE 4S1SL 4JQVA 3EO0A 3NFSH 1WC7A 5ICZA 3RUGF 4OQTL 1MWAL 3LV3A 3QDMB 3D25A 3O11A 4QXTB 3GBML 3OG4B 3ULUD 3D3VB 4XCEB 3OKNB 1JYNA 1IM3B 4O2FB 3CK0H 3GSRA 3P9LB 1BM3H 5A3ID 3CPLB 4U6YA 2QQLH 4JZOA 3BGMA 1YEGH 3GMPB 4N1EA 3QG6B 4CUCA 3E1F1 4GH7B 3SHSA 3GBNH 1OSZB 3CH8A 3RY5A 1FZMB 2VNCA 4RWYH 2ATPB 5ILTL 5C0AE 5I0DA 3FT2B 4EQ2A 5FYLE 5SWZB 5DVKA 3MGTB 5EA0H 1JZ2A 4I5BB 1OAZH 1FL6A 3MLVH 4P4RA 3JTSB 3IFLH 3BX7C 3SE9L 3GIZH 2DLFH 2VQ1B 4PRHD 4OSUH 3RWCB 1LO3H 1OT2A 1GIGL 2NY0D 3LDBB 3L5XH 3OR6A 3EYUH 2EXWC 3BZFB 3PGDB 3UBXG 4UTAL 5DUML 5F7WC 4ZNEA 3LEVH 1MJ8L 1ITBB 4NQXA 9CGTA 3VJ6B 4P3WA 2MQ0A 5BV7H 2ZKHH 2VDKH 2Y5TA 1OTTC 2BOBB 1OW0C 4NO2A 3RX8A 5BXFA 4LCUB 4C55A 4KVNL 1CYGA 4GKNB 2EYSB 4KY1L 4NWTL 1J8KA 2FDBP 2R29L 1RIUH 1FFOB 2B0SH 3ALXA 4YFEA 1O7VA 5GS1A 5ANME 5FGBC 1C16A 3MV8D 5BVJA 1CICB 1I1CA 1XEDA 3GMLB 2H32B 1M7DA 5D7JD 1MIMH 1LDPH 2VL4A 4NUJA 2F54E 3SGEH 3BN3B 3O6FB 4P9ML 4QXWA 1AI1H 5KSAD 4CVUA 4WU5B 2OMBA 3OKLA 1MFCH 1R24A 2G60H 3N50A 5F8QC 4FXLA 2H6PA 4PIRF 3QWRD 3CX5K 2DB8A 5HBBA 1QOKA 3MRGA 2YXMA 2VERN 2Y1VA 5HGAB 3RWFA 5DQDL 4KKCC 1F3RB 4G9FA 4PGDA 2VZUA 5SWSE 4OCMC 3WSQH 4FFWD 2JF1A 1FAIL 1U8NB 4YDJA 5DC0A 3QDJE 5DUPH 4QRTA 1EDQA 3OR7B 3WHXB 4ZUSA 1U8OB 2E7CA 1KGCE 4DTGL 5F9DC 1P5UA 3MUZ1 3QWOB 4E41D 2HFFA 1IAKB 4RZCB 4QOKE 1I7TA 1OGAD 2FJGB 4MXWH 1YECL 3TIEA 2QJDA 3QIUA 3LEXB 3GSVB 1CLYL 3WLBA 1UH4A 1K3ZA 5B38B 1JUFA 5F7HA 1TTGA 1BIIA 4NO5B 4OCXL 1J0KA 1JPFB 2NY0B 2OP4L 4EQ3A 2BRRL 1H3VA 1ZV5A 4MNQA 1YEHH 2GTZA 2B39A 5B8CA 4YXLL 3EAKA 4FXKB 1E6JH 3ZKND 3HCVA 3K4ZA 1EVTC 3E3QE 4LCYB 3DX8B 2X4SA 4RA0C 1JGEB 2PTTA 3MRHB 5I1IL 3NH7H 4FA8A 5M7QA 3T2PA 3PWNB 5FV2A 3GFUA 1BFVL 3VXRD 3DROB 5IROA 2NTFA 4JO2L 4RGMB 5A2JH 2BXZA 1YQVL 2P8LB 3S35H 5IVNA 3DUUB 3L3IA 1DLFL 1KB5H 5KSVB 3MV8B 4G9DA 3U0WH 1TJIL 1KXTB 2J4WL 4MQXC 4TVPE 1MY5A 1A6AB 2YR3A 4UTBL 5MEOA 3MLTA 3BEVA 1YN6B 2CLRB 1GAFH 3MACL 4OGYL 2NY5C 4Z7UE 1HYSD 2VLJE 3LDBC 1S9WB 5DZLA 5DR5H 4M7ZB 4RA3A 1AP2B 4G7YH 3CD4A 4G8GE 4NSKB 3RWEA 3BESR 4XXCA 3WL9A 3ZYOA 1F4AA 3B5GA 1ZGLM 3LY6A 1PEWA 3U36A 3GK8L 4OD2A 4FQLH 5CWSA 2I9LA 2CPCA 3MRNA 4RMQA 2B4CL 4YPGB 3VFRA 5E9DE 5E95B 4BSJA 1T04A 1XF1A 2EE6A 5D1QB 3RU8L 1N8ZA 4YHIB 1IGTA 3MCKA 1H3TA 2WQ8A 3KPRD 1BP3B 4PJEA 2XWTB 4E41B 1VGKB 3TLRA 5B39G 4Q9RH 2O93L 1FIGH 2MCPH 4YHNA 2HN7A 4NQVB 3CVHA 4X99A 5FO7A 1T0MA 5L2KA 1CICC 1H3UA 1IGMH 4NHCL 1G6RA 3QZWA 4QHNB 5EZOH 5DRZA 4AQ1B 4KKBD 2NR6D 3CDYA 4JDVB 1MJ7L 3O6FC 4YHLH 4NBZB 2NX5A 4NZTH 3UTPD 3RNQA 3NCYS 5DK2B 5HYQB 3QNYA 3WFHA 3ZL4L 3ULUC 2N56A 4DFIA 3HG1E 4LHUG 4JFYB 2WINB 2QQQA 2IFFL 3ET9F 4WO4A 4DKAA 5A3IC 4AMKL 5C0GA 5JDSA 2VZSA 1HCVA 1F5WA 4PRAA 1I4FA 4QHLA 1T89C 4ZS7L 1CGVA 4R4NC 5C0CA 5C0FA 2JJUA 2OZ4H 1FN4A 3EO0B 1RK1B 4XVSH 1T1YA 5ICZB 1R3IH 2DLIA 3LV3B 3O11B 4NP4L 5FO8A 1CFVL 3ARRA 3INUL 1WBYB 4OM0L 4PY8I 1QO3A 4QO1A 4HZLB 2HTKD 1KCVL 2X70A 1DVFA 3D0LA 3Q6FB 3QCTL 1FNEB 4GQ9L 2UWEE 4G9FD 4X80H 2CDFA 1VKXA 2NY0C 3KPLA 3T0VA 3O3EB 4ENEC 5D7IE 3W9DA 4LPXA 5CILL 4KKAD 2Q8BH 2YBRA 4JZOB 3R1GH 43C9B 4XWOD 1JZ7A 2NNAB 2WV3A 4XP6L 4U2YA 2XG5A 5E8DH 1AD9A 3WS6A 2ADGA 4M1GL 4FS0A 4ELMF 1OAKL 1LGVA 2BY2A 3G5ZA 3T09A 4UU9B 2IQ9H 1SHMA 4RGMC 3KGRA 3QPXL 3O6MH 3QIUD 3I02A 5IKCA 1ZMYA 5J89A 1FL6B 2Z91B 3ALPA 4P4RB 3FRPG 4LDEB 1I75A 3O2WL 4HPOL 3WYRA 2DQDH 4JFZL 3LQZA 2Z9TA 4G43A 4MNQD 1F00I 4W81A 1CR9L 3GNMH 3RIAK 5KSAC 3RY4A 5HHMD 5F7YC 1MREL 2X42A 2XTJE 3I75B 1INDH 4M7ZC 3SE8L 2Y5TB 1UT9A 3L9RA 3VI3F 2A1WH 3GSOB 4NO2B 3E8UL 4M1DL 5BXFB 1VERA 3NN8B 4OFKA 3B8SA 1CE6B 3CFJB 2ATKA 3EKCA 5JNYA 4FFWC 5FGSA 4OTXH 1C7TA 5D1QC 3DARA 4HIJA 2DD8L 3TWCL 3ROLB 5BVJB 3ARDB 3VFTB 1GGBH 1OARL 3LKPB 4Y19E 5DMYA 5J3HD 3W2DL 3FQUA 5CSBA 3UTSA 2X89A 1HZHL 1NFDE 3MRQA 3PV7A 4BELD 4X9BA 4XHJD 5IGXH 3QQNA 4CDGC 2V17H 1A6UH 3OKLB 1R24B 3C87A 3FT4A 1NCDL 4NJAL 3UXFA 1C5BL 4X4ZA 3WFBL 4ETYA 3PWPE 1A6WH 4KI5F 4LVEA 4GG6E 4NCC2 1DBBL 5CLWA 3KYAA 1DUZB 4X6DE 1E4KA 2ZOKA 1C5DA 3X3GL 4JFOA 1FVDA 4XBGA 1QRKA 3ZKNC 35C8H 1QR1A 3EOYG 4MA3B 2OR8A 5D7SH 4ZUSB 4MJIB 2YA2A 1HI6B 3M07A 1KJMA 4UIKL 1JGVL 2HFFB 3MRCA 1N6VA 1GYAA 3B2VH 3RWHA 5DD1H 5L2KD 3BAEH 5E6YA 4FN0A 3QIUB 1OSPL 1OM3L 1AE6L 3HTLX 3WLBB 5D4QA 5DVNA 2NX5D 4ZFOL 5AYUH 4GW5B 3G6DL 4U1MA 4C59B 2EDKA 4YIQA 1MCOH 2GTZB 3QIWA 4M8QA 2N4IA 5B8CB 5HHMB 4WO4D 3O8XA 5DZOA 1MHCA 5K9KA 3HCVB 3RI5K 4XC1L 4MXQD 2X4SB 2PTTB 3TH3T 1DN0B 5HDQH 2ZWLT 3S6CA 3P0VH 5C0CD 3MOAH 4ZO6A 5BS0E 1DE4A 1G9NC 5DO2C 3L3IB 4HMCA 5DWUL 3RVTC 2FBOJ 2AV7B 3EYQD 2X4UA 2CUHA 2RB8A 1FL3A 3FQXA 4MB5A 2L4OA 2APWA 1EXUA 5MEOB 1DVFD 3TGXA 5JA8B 5E08H 3S88L 2I60H 1TVBA 3B43A 5JQHC 2BSTA 1FDLL 4KKBC 2NR6C 5GGUA 4NKQB 3IKCA 4XCNB 2WBKA 1WZLA 2YUXA 4NC2B 5TDPA 3TBWB 4HPYL 3NA9H 4OD2B 3RPIA 2XWBB 2I9LB 4RDQG 5C1MB 3MRNB 4WHYG 3VFRB 1T6VN 1T04B 3ULSA 3LH2H 3OHXA 2YA1A 3MJ9L 1N8ZB 5JW3H 3ZYJA 3L3OB 1IGTB 1GHFL 1FRGL 4M61A 2V5MA 1J0HA 4PJEB 5I1KL 3VD7A 3MV9A 3OXSA 3BT2L 4YNYA 4DAGL 3H2WA 2XACC 3DIFA 4Q6IB 5EU6E 4ZFZA 1AGEA 2K7QA 4X99B 4HFUH 1JF6A 2ICWI 5L2KB 3V9FA 4J3XA 4ETQA 1G6RB 3QZWB 5DRZB 1TZIA 4EDXB 3JWDH 2NX5B 1G7LB 3QWQB 2UZXB 4YK4B 4XNYH 1P4IH 5GXBB 1B0WA 3L7EA 4L3EA 2C3VB 3QNYB 4KMTH 5JUEH 3WFHB 1J8HA 4HXBH 1V5JA 1UXSA 1XAUA 2C3WA 4WI4A 1A7NH 2HTKC 3UAJD 3LRSA 1F2XK 4EUPA 1A64A 3I6KB 2BFVH 5I74B 3VFWB 2WLYA 1FFRA 1YPZA 2XQBL 1OAUH 4KKAC 4PRAB 3BH9B 4QHLB 5F1IB 2A83A 5DHVB 4XWOC 2AW2A 3SGDI 4HUKB 3O6KH 1Z3GL 4JB9L 3LKSA 4H5SA 5C08E 3V4UL 1BD2A 3MJ7B 4J3VA 3ZDZE 5C0FB 3PWVA 3N1GC 1FNSH 1G1YA 4H20L 3I2CL 1JGDA 1KCRL 4BFIA 3UTSD 2X89D 5CBEA 4PTTA 3DX6B 1T1YB 4WFEE 5FYJL 1K8DA 5JW4M 4AG4H 5E5MA 3IS1X 2WM0A 5GS0L 1J1PH 3QIUC 3SOBL 4F15B 3BGAA 3JV5A 3D0LB 1DVFB 2X70B 1YMHB 3J7HA 1JGLH 1G9EA 3DBXA 2OXGA 3NCMA 3S4SG 2VLME 4AIXA 2I26N 1VKXB 3NFPB 2JK5A 3KPLB 1P5VA 4PJIB 2YBRB 5CS7A 5B8CC 3W0WA 4NM8H 3IFNH 4JRXA 4XCYA 5HGDA 5JW5A 1HH9A 2V5SA 3EYFB 1AD9B 1DL7L 2ADGB 2LAGB 1FGVL 5ENWA 5GGQH 1JF1B 1MNUL 2W65B 1L6ZA 4YDKH 2B1HL 4YH6A 4KK6D 3I02B 3NAAL 3KPSE 4A6YH 1M7IA 3HNSH 2CK0L 3NPSB 2GSIB 5D9SA 2R1YA 1C1EL 2OJEA 3QIWD 4LPWA 4XHJC 1SVCP 4N0RA 4G3YL 3SJVA 2Q8AH 5EORH 3O8XD 2PR4L 4JM2F 4LSVL 1ES0A 4N8VG 5IIEA 2UZYB 3L9RB 1EEZB 1TXKA 5HYSA 2DLHA 4XXCC 4H0GA 4P3CL 3LKOA 2VABB 5D7LE 3QG7L 4PJDE 2Q7YA 2ATKB 5JNYB 4LSSL 1CDBA 2R2HA 4OKVA 4DGVH 4LFHG 32C2A 1XR8B 2ZG3A 3RUGB 1SY6L 5FM5M 4HIJB 4FFZH 3T65A 4WI2A 1AC6A 2DRUA 4WCYL 4Y16A 5I1CL 3AXLA 3FQUB 1U2CA 3MRQB 1IQDB 4Q6IC 1TNMA 1RUQH 1JWMA 5CCKL 4JFFA 3AY4A 3FT4B 3U30B 4R9HA 4LEXH 2XZZA 2WUCH 4YK4C 4RGNE 1EMTL 3TZVB 5FO9A 5HHXL 2ESVE 4D94A 2ZOKB 1KCSL 1C5DB 2APTA 2NY7H 5E2VH 1FVDB 1U0QA 4N5UA 3OKKB 1DBKL 4XBGB 3HI1B 4HK3J 5I74C 1G0XA 4P2YA 3QEUA 4QTIH 1FL5B 3UYOD 1KJMB 4QYOA 4MXQC 2ICWA 3MV9D 5T3ZH 4OCYL 4OBRA 1AGFA 4XX1G 1OPGL 1C7SA 4P57A 1QQDA 1WZ1H 1KT2A 4ZTPH 5L8KB 2P49B 2MSPA 1G9MH 1VFBA 1QHPA 2J8UA 1T1ZA 3IXAA 4L3ED 1FIEA 2DQTL 1J8HD 4P9HC 1IZKA 4GKZB 4U1MB 3MNVB 4F15C 4GXVL 2RHEA 3QIWB 2CKBB 1DVFC 3QHTC 4FQ1H 1IGIL 4CN4A 4F57H 4I3RL 1MHCB 1ACZA 5GSRA 3FFCA 1BAFH 3BPCA 4WDIA 2MPAL 3H3KA 1IFHH 3PDOA 4J6RL 3SKOA 4PJBE 3CC5A 3J8F7 1BD2D 5CJXA 4FQJL 1M4KA 2XNAB 1CFQA 4XPGH 5IQ7L 4PJFF 1E4XI 3MCLH 3FQXB 4N9GB 3TO2A 1WF5A 1FFNA 3BW9A 5DJDA 2J88H 5KVEL 4R4FH 1A14L 3DRTB 1V3MA 3NPSC 2F5AH 4TSAL 4LASL 1TVBB 3UTTB 1KG0A 2BSTB 3L95B 3HKFA 1UKTA 4PBXA 1KEMH 4G7VL 3IKCB 2COQA 3W0WD 3JZ7A 1MCWW 4JRXD 4FFYL 4M5YL 1WFUA 5AZ2L 2VMFA 3HZKB 1MRCL 5EOQH 5IR1A 4X6BA 1DQLL 3ULSB 3VXMB 1OAXH 4MD4A 1A3LL 2EO1A 1CDUA 4ZD3L 1I1AA 2IBGA 3RVWD 5GRUH 1VFMA 4PJXE 4NQDE 4LBEA 4G6KH 5F7KC 1CCZA 2VLLA 4ZFZB 4DCQB 5TE4H 3OKOA 1KEGL 1CFNA 4ETQB 3D9AL 3TN0A 1TZIB 4XPAL 5EH1A 2W0FA 3U9PL 1JVKA 4EBQL 3SJVD 4HH9B 2Y07H 2X44D 1A47A 4L3EB 3L7EB 3ULVE 1BZ7A 1J8HB 1UXSB 4AM0A 3ZE2E 2QTEA 4CMHC 3U30C 3NOIA 3LRSB 5AG8A 3N1PC 4EUPB 4RAHA 3MUJA 3TZVC 1YPZB 2YHGA 3PQYE 5D2LE 4PJHF 5JOEA 4P5KA 4LU5H 1HEZB 3HHRB 3T3ME 3V0WH 5HI4C 1OP9A 4Y4HA 2XKNB 4KROD 4Y16D 1QLFA 2PYEA 2F19L 4J3UA 4CN6A 4BFIB 3AB0B 4PTTB 5CBEB 1K8DB 1K5NA 1ZA6A 4JFFD 3BJ91 4M48H 5E5MB 2EE3A 3TV3L 2VXSL 1R3JA 4KRPD 4KK6C 4U3CA 2X4PA 1TPXB 3T08A 3KR3L 2R15A 2H26A 4P59L 5J9PA 1DQML 5MI0B 2BVOB 4NN7B 2JK5B 1XZ0A 4H88L 2OL3L 3HAEA 5E8PA 1OCWH 3QIWC 4JRXB 3TEUA 4HJ0C 4QXGL 1RPQA 1HH9B 5ESAA 3EYVA 4U31A 3A6CH 2AABL 4JAMA 3IETB 4LP4A 2YN3A 5C6TL 3NBNA 1PYWB 4K3JL 1D5XB 5D71L 5CD5C 1L0QA 1B0GA 1ZE3C 4OB5L 4HUVB 2JELL 3GHEH 1Q9OA 1QVOA 3KYMB 5H37H 1W72H 2JJTC 2RQ8A 3EOTH 4U6XB 4WHTB 2JJWA 2YPKB 5HD8D 5D9SB 1MCCA 2R1YB 3F8UB 3E6FA 1NUDA 2O5YL 3GJEA 2BY3A 2D0FA 3BSZL 3SJVB 5EB9A 4I13B 1JHKH 4Y7MA 3AMKA 3FFCD 3U7WL 1T22B 1YEIH 2W9DH 4XMPL 4UQ2A 4XVJL 2I27N 5BRZA 3LKOB 1LQSR 4R7NB 5CEZE 3KYOB 4JM4L 2R2HB 2GFBA 2APFA 2IPTL 4URTB 4X5LA 5I15H 32C2B 4MAYB 4FXGB 2O5XL 4LL9A 4PGEA 2VDQH 4OZHE 4XZUA 3FB5A 5FDYA 2C1OA 4KROB 4TRPH 4HLZH 4K9EC 2Y06H 4Y16B 4CU8A 1S7VA 3AXLB 3C5ZA 1LO0H 3MODH 3MXWH 2FSEB 4X6CF 4JFFB 3MRDA 4F9PA 3HR5A 1VDGA 4Y1AE 4K7FA 3O41A 2YRZA 2H1PH 3BQUA 4HJJH 4WW2F 4F7EA 3U0TA 3P9MB 1BGXH 1JNLL 1H3PH 4YHOL 3MLZL 5D2NA 5FGCB 3VRIB 1FG9C 2DYPA 2HH0L 3TJEH 2MJWA 1DP0A 4ELMB 5EZJA 3WNMA 2QSTA 4UNVA 3RP1A 5EIIA 1KJVB 1I1AD 4U0QB 4DFHA 4P46A 4W6YB 4QYOB 2ICWB 3LSOB 1AGFB 1OP3H 1BJ1H 3EO1A 4HV8B 3T0EA 4NN6B 4H1LB 5DQJA 5DJXB 2F58H 1CZ8L 2AVGA 2CK2A 3TN0D 3FZUD 5E2TH 4LSTL 3NCEB 4ZOEA 1VFBB 3TBTA 4OFIA 3X11B 5HSFA 1Q94A 1T1ZB 3IXAB 1CGXA 4OFYA 5JHLL 3EHBD 5IBUB 1LE9A 2BOCA 1TPXC 3HC4H 5F7UA 1TENA 1W2KT 1YNKH 3I3BA 3QJFA 3IAGC 4XBPB 3C2AH 4UBDD 2FL5A 1FO0L 3P11L 4NN7C 3REWB 4M4PA 5IG7A 1AXTL 3MLUH 4RFNB 3FFCB 3KPPA 5F1NA 3U7YL 4NQSA 5E6ZA 2AK4A 4JQIL 4LHQB 5IFHL 5IHUH 3GRWL 3D5OF 2IF7A 4Y4HD 3CC5B 2UVFA 2CKNA 1EEYA 5E2JA 1I3RA 3LPWA 5T5NG 2PYED 3LZFL 1RIVL 2AK1L 4ALAH 4MB4A 4Z7UF 3P2TA 1CFQB 4JDTL 4N90D 5I18L 2ADIB 1D6EA 5K9JL 4RMWA 3GMRA 5GISL 2J12B 3CMOH 4PREB 1D5ZB 3C6LB 1FG2A 3N85H 3RWJA 3TO2B 3TFKD 1FFNB 2DWDA 4ZUUA 4OLWL 3BW9B 3OZ9L 5TH2A 4UILH 4TOYL 4Z78B 4DKEL 4X4XB 2WUBL 3FQRA 1UM4L 5AAWA 1KG0B 2W60A 3V5KA 3VGAC 5CHNA 1RZJC 3EOBA 1A4KB 2HTLC 3GO1L 4HGKC 1NBZA 5D8JH 4KTEL 1QSEA 5LJYH 3FCTA 1YY9C 5IR1B 5LBSL 4KK9D 5IBLC 5ICXA 1A0QH 3K0WA 2XZCH 2FBJH 1WIPA 5C7XH 1I1AB 1U6AH 4KGJA 1EHLL 1X4XA 1DFBH 2E7BA 4LBEB 2OZ4A 4PJAE 4X7TA 4OV5A 3CXHJ 2GQHA 3UZVB 1VGEH 4TTDD 3OKOB 4G6ML 4KROC 5DJZB 4XT1C 4Y16C 4Y2DA 3TN0B 1Z5LA 4AIZB 2HKHH 4UB0H 5CJ5A 4R90L 1CK0L 4LQ1A 1BZ7B 3HB3C 3AY4C 5GJTL 4AM0B 4WFGD 3GSQB 2DQFA 1I9JL 3KPMA 2NY3D 5CP7A 1OD7A 5BRZD 1VFAA 1T2QL 3VFVB 3BD5A 1E4WL 3KPNB 4PB9L 2UZIH 3WMSA 2HRPL 4UV4L 2W38A 4ELKA 1NMAL 1RULH 4Q74A 5EBGA 2XY2A 5HDLA 4ISVB 4PRNA 3TA3A 4GAJH 2KL6A 2O5ZH 1P7QA 4ONFH 3IF1B 3X3FH 2UWEF 3DYOA 1K5NB 4NN6C 4OUUA 5D7IF 1PW3A 3HRPA 3EYSL 2P5WB 5DMIH 5LVEA 3MNZA 2D4DA 5MERA 2R4SL 4KHTH 3BQUD 2C1PB 5JHDE 1TMCB 4FZEH 1XZ0B 4WI6A 4KV5E 3IVKB 3HAEB 5E8PB 3RVVD 2DYPD 4FABH 4JN1L 3WFZA 4Z95H 4RFNC 3TBSB 1NCAL 3FB8A 4P46D 5ESAB 3EYVB 1B3JA 4L1DA 5TDNA 3B2UC 4JAMB 5I1GH 2A74B 4U2ZA 4OLEA 3DTXA 4TVSa 3TH2T 3T0ED 4I9WD 1X7QA 2DI7A 5CJXC 3VCLA 1X5HA 1QSFA 4OIIH 1U8IA 1RUML 1AQDA 1Q9OB 3SKJH 2AJZB 4RQQA 1UWXK 3BPLB 4OFYD 2VXQL 1YZZA 2Z31A 3VXTB 3WXWH 3B9EA 4KI5C 3GJEB 4WFFD 4EVNA 1ORSA 3KG5A 2P48B 1EBAA 4JO1H 4X7SL 1NGPL 4OFDA 1OLZA 4UQ2B 2AK4D 2FECL 3W9EA 2FLBT 3EDJA 5IEHB 1P4LA 4JFDB 3G04A 1UWGL 1YNLH 2GFBB 1NFDF 3GJFK 4HQQH 3CXDL 4PGEB 5T1MA 1EEUA 4MDJA 4CU7A 4MJ4A 1I1AC 1KIPA 4PJ5B 1G1CA 2C1OB 3QBTB 3FO0L 5F9OH 4PS4H 1EFQA 1S7VB 5TPWH 4GG6F 1IJ9A 3C5ZB 3MMEB 5C09B 1B4JH 3MRDB 3BUYA 3HR5B 1LNUB 1QPPA 4D9QE 3WXVH 3TN0C 4K7FB 5EUOE 5ERWA 1NDGA 3O41B 1BQHA 3BQUB 5TFSL 2GHWB 5IK3A 2ZUTA 3U0TB 4F7EB 4YHZL 1IC5L 3EHBC 1QSED 2VXTH 2YUWA 3SGJA 2DYPB 3UZQA 2O61A 2PCPB 1FLRL 4OLZH 1LWRA 1WZKA 2BCKA 2D9CA 5EIIB 3BPOB 4W4OC 4E5XB 3LHPH 4LLWA 2Q86B 4L8BB 4RFEB 5D6DC 4QRSA 2XWJB 3WDJA 4CJ1A 1QFPA 5DQJB 1XGPB 2DQUH 4Y2DD 1XFPA 1GZQA 1ZLVK 4OGXL 5FA3B 4JRYA 4HKZB 2ZOLA 4YX2L 4X4MA 4QRRE 1Q94B 5L2JB 5MEPA 2H45A 3MOQA 4JM2B 4PTUA 1VEMA 2IFGA 1DQQA 1KC5L 3DXAA 1KNOA 3R8QA 3CFIC 2A6IB 5KJRH 1LE9B 3MXVH 3R06A 3HE6A 5GGVL 3VE0B 3MJ6A 4E0RB 3FT3A 4GBXA 5KANG 3UPRB 4Y8AA 1KJ2H 1S9XA 1MELA 1SMAA 4S1SH 3DI2B 5F1NB 3DETD 1SM3H 2AK4B 3P4OA 1EVUA 3MA7A 5C0NC 2KKQA 2A9MH 4OQTH 3REVA 3JWNC 3VXOB 2J8OA 4O4YL 1CXLA 3GBMH 3DSNA 3NTCL 4JQXA 3TA3D 4KRLB 3QUYA 4KK9C 1P7QD 4DEPB 5EPMA 5D1XA 2XFXA 1YNTA 4X6CA 1PKQE 3GMRB 5TGBA 1MCDA 4AEHL 4ZTOL 4BFEA 3BWUC 1GGCL 5DZNA 2CIKA 4MMZC 5BCAA 3NIDE 3O3DA 4HDIB 1A6TA 4WW2A 4TTDC 5FK9B 1EO8L 3QDME 2W60B 4KKNA 4OIAA 1IC4H 1P2CA 1X4ZA 4EN3B 4HIEB 3SDAA 3D3VE 3EOBB 4LPUA 2V7NB 4N0UA 1NBZB 1EUTA 2DICA 3FCTB 4LGRB 4NFDA 4WJ5A 5F71A 3RVUD 5IJVA 2JB5L 4NZRL 3TYFA 3Q1SL 5ICXB 1S5HA 3SE9H 5E94B 4JFEB 2DTML 1QSFD 1ZT1A 4X7TB 3T4AA 5ACZB 1MJ8H 1WEJL 4PP2A 1OP5K 3JV6A 3I3EA 3L5IA 4ODVL 2Z31D 1I8KA 4YWGL 3C5ZC 4AZ8A 5IMKB 5I73B 1CIUA 2D4FA 2Y9RT 1S8DA 4KY1H 4F9PC 2R29H 2R0WL 5HTSA 3IS0X 3KPMB 1S5IH 5IEKB 5CP7B 3C8KA 4JHAL 2FEEI 3BQUC 4KJPD 4WGWB 3QUKA 3VXUA 4DVBA 4LNRB 3ZDZF 4GRWE 3S5LB 1BVKA 4ELKB 3RVVC 2CRYA 5T3XD 4QY8A 4D0DB 1CGYA 4ZO7A 3LRGA 3BPOC 1E27A 2W0PA 4HG4J 3IDXL 3IDUA 3LKQA 5GS2H 3LQMA 4PJFB 1CD0A 1FV1B 4PJ7E 5IB3A 3BD3A 3MQIA 3VFPA 1Y6MR 2EDBA 4A6YA 5EU7E 4HKBA 3MFFA 2XKUA 5CJBA 5E1AB 3RWIA 4OUUB 1U58A 4GUPA 1MQKH 2BJML 4C56B 1CVRA 2K7PA 1MRDL 2LVEA 2GUOB 2XI9A 1NBQA 5T1KA 3VMOA 4JM2C 3O6LL 2BY0A 1I1RA 1W8NA 4MA8L 2E6QA 3ZTJH 3ULUE 1ZKAA 1CL7I 4B0MM 3BJLA 3RL2B 1W0VA 4WFHD 4NOBA 3SQOL 1E6OL 5HGBB 3IXTA 3RY6A 1CLYH 1I9EA 5IBTL 5IHZA 1VCAA 4I0PA 4XP9L 2XXCB 1X7QB 3QQ3A 2BRRH 3N1QC 5D96B 3VCLB 3WDHA 3MLYL 5CBAB 2B7DT 4JRYD 2PO6A 4BZ2L 2D9QB 4GXUM 4RQQB 3DXAD 1RUPH 3AVEA 5I1IH 5KZCB 3HE6D 3MLWL 4KVCL 3V4PH 2WK2A 4GBXD 1FBIL 3KPOB 4EVNB 1MHEB 4PJDF 1ORSB 4ZUWA 4JO2H 3GSWA 1MOEA 1YQVH 3HE7A 3L3JA 4EN3C 2Z92A 1L6XA 3W9EB 5CD3A 4YBQD 3JUYA 4CKVX 1P4LB 3B6SA 4AH2B 2Y7QB 3LCYA 1UWXH 3QUYD 4UTBH 1JN6B 3TT1L 5D1XD 5T1MB 5DI8A 3MACH 4GRLA 4MDJB 4MX7A 3WIFB 2NZIA 4OLYH 1KIPB 5JLZB 3H7LA 1A2YA 1H0DA 1HIMH 4W68A 2H2PD 1ZEAL 1AQKL 3NFSL 4NO3B 2CRZA 3GK8H 3MV8E 3WS3A 4YDIH 4PRPA 4P5MA 3RA7H 3F5WB 5E4EB 5C0AB 4FFVD 1BQHB 3RU8H 5I73C 3SDAD 1KTLB 1FYTA 5KVDH 3GJFH 3CK0L 1ED3A 1XMWA 5IK3B 2OSLB 4DN4L 4P49A 3BYYA 4I48A 1F6AA 1D7FA 2O61B 1NMBL 3VDBA 1A4JB 3ILQD 3LN9A 1MJJA 4LLWB 3DETC 3BIAX 4HW6A 1MI5B 3QUZA 3TJHC 1V05A 2ENYA 2GJ6A 3ZL4H 5FFLA 1A8JH 2HLFD 2OR9L 4LLUA 4JRYB 1U3JA 5I2IA 2IFFH 2HYMA 3DGGA 4E41E 2PXYA 5IMOA 3MLVL 1EAPA 5B21A 3IFLL 3PP4L 3GIZL 2DLFL 3DXAB 1KNOB 3R06B 2IPKA 2ZUYA 5ANMB 3L5XL 5EUKA 2YD1A 1AHWB 2ZCLL 3FT3B 4GBXB 4S0SD 4YLQT 3VXUD 3PNWA 4M6NH 1S9XB 3MRRA 3LEVL 1FNGA 1K2DA 1OAYL 2F54B 4I3GA 3T1WA 5BV7L 1GZPB 4K8RC 4LVHB 4BK4A 3CMGA 1ZLVH 3BISA 3FMGH 2EDYA 1G7IA 3INUH 4OM0H 3SE4A 4KWUA 1AO7A 3QUYB 4GS7B 3RVUC 4C83A 3QCTH 4LDOB 2B0SL 4TN9A 5D1XB 3IAPA 1Q0XH 2XFXB 1YNTB 4X6CB 5SWSB 4U7SA 3TO4B 2ICWJ 3GSXA 1IBGL 3QRGH 5D96C 2WWMC 5CILH 2CIKB 1PZUB 1LDPL 1RAMA 3O3DB 5T1KD 4WW2B 1A6TB 2BK8A 4JKKA 3ARZA 4XP6H 1MFCL 3ISWA 1P2CB 2CDEB 3NCFB 4M1GH 5DJ0B 1O7SA 1KIQB 2YWYA 4TQEL 4UOJA 5I1LA 1LO5A 4Z7NE 3OXRA 1KACB 5ID1B 2IG2L 3WSQL 4I0PD 1IEBA 4HPOH 1S5HB 3OF6A 3F7VB 1XF2A 1CR9H 1RSFA 2V2WB 4Q0XH 1ZT1B 3ULVF 3BI9X 2PO6D 4V2CB 5E1HB 3T4AB 3HNVH 1NGZA 4BA8A 3F7RA 4ZYKA 4NO0A 3TT3L 3SE8H 3KJ6H 4LLDA 4WNQA 4Y5YA 2BVQA 3GM0A 3E8UH 4F7CA 1OQOA 1JCKA 3P4LA 5D2LF 3FHQA 3R0NA 1BOYA 1S7SA 4GMTH 3T3MF 3HE7D 5E4EC 3QUMH 5KS9A 1YEHL 3VXUB 5CINL 2G75A 5D1ZB 1BF8A 3TWCH 4DVBB 3G5VB 3MRIA 3UTPE 1OTSC 4ZNEE 4OAWA 4XVUC 1OARH 2ZP0T 1BVKB 5CGYD 2PW2A 3SGJC 1ND0A 1EGJH 2IALA 5ITBL 1MCPH 2FLRT 3NH7L 4QY8B 4GRLD 4U1NB 1I9RL 3MO1A 3W5NA 1NCDH 1QTYT 1C5BH 3DI3B 4G8GB 5HHQA 5IB3B 4RMSA 5L88H 3P40A 1DBBH 3KPQB 2NY6D 4A6YB 2IH3A 4HKBB 1KB5L 4BSVA 1GRWA 3RWIB 1OWWA 1J1OL 1W72A 1U58B 4WTWA 4PRPD 4UT7H 3X3GH 3ZMRA 1LMKA 4FQCL 3B83A 2QLVB 2OR7A 3DSFH 1FYTD 4YDLB 1KN4L 3BIKA 2Q3ZA 1QBMH 3L6FA 2ITDA 1GAFL 4UIKH 3VG9B 4Y8DC 1AHWC 4GBXC 4G7YL 1W0VB 1J87A 1MHHA 4GMSH 2A9NL 2HT4D 1OSPH 4U1JA 1LEGB 3IXTB 3KJ4B 1AE6H 3QUZD 4G9FE 4GRMB 1OM3H 4HCRL 5IHZB 3C8DA 4OF8A 4EXPX 2GJ6D 3ME0A 1VPOL 5FM5O 5IV2B 5DJ8A 1ZVSB 2APVA 3G6DH 3QQ3B 1I8IA 4JQXC 3U46B 3QUYC 2HP4A 4GS7C 1ZVYA 5J06A 2VXUL 5D1XC 4TUJA 2PO6B 2PXYD 2R9HC 3KYNA 1AXSA 3TO4C 3C5SB 3MJ8A 2C5DC 2LE9A 3JWDC 4WEMB 5F9AC 2P43B 4GKSB 4WW2C 4YHLL 3RFZC 4ZOAA 1ACYL 3GSWB 2D31A 3HE7B 3S96A 1UADC 5GRJH 3L3JB 4M00A 3WNLA 3ZDXE 5DMKB 5ISZA 1V7ML 2FH6A 4OZHF 1WFTA 4MNQE 1JPTL 3LKNA 3D0VA 3BKYL 3CIQA 3B6SB 1ULVA 5HHME 1AO7D 3MTRA 4U0RB 4AK1A 1IAIM 4KTYA 5JORB 1CE1L 3AMLA 4M8VA 2UWEB 3ILQC 5DI8B 3S88H 4MX7B 4IRSA 5DEGA 1A2YB 1H0DB 2B20A 2P45B 5DC4B 1FDLH 1QSVA 4S1RL 5F1OB 5F7DA 4HIIB 1PBYA 5DVMA 4QRPA 3EGSA 2YPVH 3E0GA 4HPYH 4XVSL 3WN5B 2HAZA 4QCIB 3BP5B 3LEYL 3KXFA 3AGVA 1FYTB 1A1NB 5CJ8A 4GW1A 1GHFH 1FRGH 1JWSA 2CSPA 5BOZG 2EDFA 1XR9A 1FJ1A 4X80L 1F6AB 5GGRA 2Q8BL 3P30L 5GQBA 2ZUQB 5DDHA 3OF6D 3GSNH 5HHPA 1MJJB 5CZKA 1YC7A 3QUZB 2YRLA 1E28A 5E8DL 4DWHA 1NMCB 4MCYA 2GJ6B 4G80A 1NGYB 2AERT 4NO0D 2BERA 4LLUB 4PJEE 4PRID 3DVGB 2H8PA 2PXYB 5L0QB 5J6GA 3PIQA 4CVXA 2XQBH 2DQHH 4FQQB 1MCNA 1I1FB 4Q9QL 5L2KE 4ZPTB 1S78C 5DMGD 4KK8D 5GRYA 4AENA 1Z3GH 3PNWB 3GNML 4FQXA 4JB9H 1Q9WB 4P2OB 4XP1L 2NX5E 4X5XB 5D5MF 1K2DB 1PSKL 1KPRB 2DL9A 5DTFA 3VG9C 5JW4N 1VFOA 1KCRH 1NFDB 4IOFC 4M93B 1XH3B 2A0LD 2EIEA 5FYJH 2DM2A 4ZUTA 2A1WL 1G7IB 5IB5B 5GS0H 5I16A 1EH9A 2OJZH 3PWPB 4I3SL 2YD9A 2BNUB 4GG6B 1UYWL 3WD5L 4I0PC 1J0IA 1H5BA 5D70L 3LOWA 1G7HA 2NTSP 3CAFA 1X5KA 3GSXB 4X5WB 3G9AB 2OTPA 2PYFA 3HZYB 1U8PA 1GGBL 2JIXB 2PO6C 4N9OB 4JHBA 5IVZA 2WIMA 3QXUA 1DL7H 4Y4FA 1FGVH 4NC1E 1MAMH 5A1AA 3QO0A 1B90A 1J86A 1Z6JT 4FHBD 5I1LB 1J05B 4PLOB 1BQSA 3QUXB 4JHWH 5EBWA 3HE7C 4QRUA 1XGRA 5C9KA 4LPYA 4HK0A 1QNZH 1IEBB 3OX8B 1KELH 4PRBA 4MSWA 2CK0H 2MHAA 4WWKB 5D7SL 1XF2B 5DLMH 5CGYC 1C1EH 2E6PA 3ES6A 5FM4A 5K59E 3D18A 2PR4H 2A38A 3RQ3A 4NNYB 4LPTA 4XCFH 2D0GA 5DJ6B 5DD1L 3QCVL 4Y5YB 4YBLB 1G7JB 2E9JA 2BVQB 1AJ7H 5GRZA 4QT5A 4F7CB 3ILPB 4UDTA 3H9SA 2BDNH 5AYUL 3WN5C 4LSSH 5BS0B 1S7SB 2VLRA 1A1OA 5HJ3B 3QULA 1U8HA 2IWGA 5BJTA 5KS9B 5ISZD 2HWZL 1UACH 3RWDA 5DS8A 3CZFA 1JJUA 5FDWA 4WCYH 4OAWB 5I1CH 3ZE0E 3NABH 1ND0B 2BNRA 4OZFB 1DEDA 4GOSA 2WANA 5CCKH 4WUKL 3MO1B 3VD3A 4IRSD 4NYLA 5TJWK 3QUZC 2D03L 1GGYA 4LLVB 1NMCC 1EMTH 4QRPD 4NQEA 1NAMH 3F7QA 1DBML 2CD0A 4KV5F 1ZT4A 2AGJL 4HJGA 3KXFD 1DBKH 4KU1A 2FYYA 2PXYC 4FOMA 1FCCA 2E8YA 3UTSE 2VQTA 4UIMA 3LN5B 2ITDB 4WHYH 3B4NA 1YEKH 5E5UB 2I60L 3LS5L 2VLKA 2JCCA 3KYKL 1EO5A 3IDIB 3ZTNH 5EU6B 1BBJA 2XZAH 1OPGH 2E27H 5T1DL 1TJGL 4OZIF 3EOAA 4U1JB 4M93C 1QEWA 4LRIA 2DQTH 3G5XA 2CLZA 3LH2L 4K2UH 5DRXA 3AAZB 1PJ9A 3SE4C 1S7UA 1ADQH 4ZG1A 2IAND 2EEBA 5F9WB 4TUJB 4I3RH 5J12B 3RWGA 3SCMA 3KYNB 1S9YB 4UOW1 1AXSB 2HVJA 3NA4A 1JK8B 3PABA 1GC1L 2MPAH 4JO4H 4RGOL 1V3KA 2GEEA 1IAOB 1JPST 2VZ3A 5DURD 3ZO0A 3FFDA 5C08B 4FQXD 3HPLA 2YC1B 1A6ZA 1G7QA 5DXWA 1PFCA 1T0NA 4FQJH 4NKOA 3S96B 4ZFFA 2IJ0C 5LKNA 2IGFL 2P8MA 5DGRA 4P23A 3LKNB 1RQ5A 2A6JB 3B3IA 2BFVL 3GMOA 1CD1A 2UY7A 3QUXC 3GEWB 4KJWD 4Y2OA 5DD5H 1NC4A 2DQIH 5KVEH 1A14H 2ZUUA 4TSAH 1CWVA 4IRSB 1RU9H 5DEGB 3JSSA 5EUOF 4CAGA 5J1AA 5F7DB 4U3XA 1FNSL 3JWOH 4LCWA 2GTWB 5BZDB 4BUGA 1TVDA 3EGSB 4FFYH 25C8L 3QRFM 5C0DA 1M6OA 4LVOB 4Y5YC 4YBLC 1UXWA 4Y4FD 1DQLH 3O0RL 5JOPD 1FH5H 4Z7VA 1A3LH 4GW1B 1A6VH 3CVIL 1JGLL 1AIFA 1XR9B 1FJ1B 3LD8B 5GGRB 2B1AH 2P5EA 4G8IA 2YRPA 4KK8C 1KENH 4OQTA 1MWAA 3FQNA 3GSUA 5J11B 5HHPB 2IQAA 5EU4A 1KEGH 3D9AH 5KVGH 1E28B 2AXJA 2X1PA 4YXHH 3MLXH 3C9NB 4EBQH 4MCYB 4PFEA 5E8EB 3ELAT 1JP5A 2BMKA 1CFTB 4YDKL 5FHBL 4YAQA 5FF6A 1T03L 5D7LB 5H35A 3MV9E 2H8PB 4PJDB 4CVXB 4L8DA 2ZNWA 3H9SD 1LP9A 4KZDH 2VLRD 4U1GB 1FVEB 2YEZA 5DURB 4FQXB 3BRGC 5EORL 5DTFB 4L3EE 5E8OA 5FCSH 1J8HE 5FOBB 2BNRD 4ZUTB 2V2TA 3P9WB 4O9HL 3TV3H 1JF5A 2OQJA 5I16B 4EI5A 1MCFA 5EO0A 3KR3H 5CZXD 1YPZE 4P59H 4UQ3A 1DQMH 4RGNB 1H5BB 5E56A 8FABA 1NUFA 1NL0H 4JPWH 4NQED 2VYRE 1E4JA 3CFEA 2ESVB 2FR4A 2XN9A 5J13B 4EUPG 5I17A 4KRMB 4BK5A 2PYFB 5F9WC 1BD2E 1U8PB 2YOCA 2Z35B 1UCTA 5LG1A 3HR6A 4NFCA 5J12C 5IB1B 2OK0L 4LLQB 5CJQH 5F44A 4KAQL 4YDVA 4S1DD 1RUQL 4XI5D 4DGIH 1YQ2A 2VLKD 2AABH 4Y4FB 1NEZA 4C54A 4X9IA 5C6TH 4LEXL 4K3JH 3QO0B 2EC9U 4OGAD 2BXYA 5D71H 4R3SB 5JPMA 5EBWB 4QRUB 1KPUA 1XGRB 4OB5H 2QQKH 2JELH 4N0YL 5I75C 3FQWA 4PRBB 4MSWB 3BN9C 3T2QA 2MHAB 4N5ED 3W0WE 3CCHB 4JRXE 1RZ8A 1X9QA 1Z9LA 1ETZB 2O5YH 3ES6B 5T3ZL 3D18B 4HIHA 1IAMA 3SCMD 4IRSC 3M17A 3MV7A 3QYCA 1KLFA 3U7WH 1CIDA 4TUOA 4XMPH 3RHWK 1X4YA 3U48A 1WZ1L 1MFEL 4ZTPL 2A73A 1Z2KA 5I1DB 3G6JA 1G9ML 3QO1A 1DBJH 1P6FA 1YMMA 3H9SB 4GRWF 1RZKH 4JM4H 4HLJA 5D5MA 3K1DA 5GZND 2VLRB 3D2UA 4NFBA 2C7UA 5D72H 3QULB 1U8HB 5BJTB 1F3DH 2O5XH 2Q3AA 5SWQB 4K94H 4UOW0 4P23D 4D8PA 3CZFB 4XWGL 1XGUA 4FQ1L 1FE8L 3HFML 1URLA 4PJ7F 3DVIA 4OF3A 3SJVE 2R1XA 1T1XB 5FECA 3LD8C 4U1LA 4Z5RA 5IQ9B 5E24E 1OVZA 1BAFL 2ORBL 1NC4D 2BNRB 1RD6A 1IFHL 5J11C 1ZHKB 1TZHA 5HGGS 4M7KL 2GCYA 2XT1B 1OY3B 2IADA 4LCWD 1ONQA 3BEWB 2FIKB 5SV4A 4YHOH 1T4KA 1TZGL 4HJGB 3ULUF 2HH0H 2XZQH 3UTOA 3MCLL 2FYYB 2EICA 4K23L 3V0VA 3FKUS 4UIMB 2J88L 4NQDB 3TBYB 4ZQKA 1L7TL 4R4FL 4U1GC 2K1MA 2VLKB 4JFFE 3MRPA 1WGOA 4GAYB 2P5ED 1BBJB 1BVZA 1RHFA 1CXKA 4FQXC 5FCUH 2DKMA 1QFOA 1CZ8H 3EOAB 4LSTH 4OI7A 1QEWB 4L4VA 2EDEA 5BW7A 3EJJX 4GLRI 5FGCE 4X98B 5JA9A 2CLZB 4KK5D 4M62L 1OAXL 1FNFA 1S7UB 4OCLC 4QWWD 4BQBA 2WBWB 3VFGH 1WIUA 1VFUA 1FO0H 1H5BC 3RWGB 3SCMB 5D2LB 2J6EH 1YEFL 1AXTH 2ZSVA 4B7IA 2HVJB 5J13C 3MA9L 3U7YH 3CLEH 3PABB 5H94B 4JY4A 2HRLA 1RZGA 4JCMA 5IFHH 3GRWH 4UDUB 3FFDB 1HWHB 1KN2L 4YFLF 3BP7A 3GJFA 1JNHA 1A6ZB 3QDGA 1D5IH 2J8UE 4NKOB 1S7RA 4Y4FC 3ZYIA 4G6FD 2JLLA 4DZBA 1RIVH 2AK1H 3CZJA 2P8MB 4H1LG 1OGTA 5K9JH 4JDTH 5I18H 1NGWA 5GISH 4FMKA 2HFEA 1PQZA 3B3IB 4L1HA 1CD1B 1DTUA 3S34H 5HI3D 4EI5D 1YJDL 1QFWI 1QHOA 1YUHB 3U1SH 4OM1L 4OLWH 3FFCE 4PLJC 4LU5L 3CDCA 1NGXA 3OZ9H 3U2SB 5DT1L 5IBUG 4TOYH 2HA1A 3UC0L 3V0WL 4NUGL 5I76A 2XN9D 2E9IA 1CLOH 1UM4H 3UBXA 4JN2A 4HWEH 2NQCA 3EYOB 1LK3L 3GO1H 3MREB 2EC8A 4D3CH 2R1WA 4HC1L 5EU5A 5C0DB 1M6OB 5BO1H 4DZ8A 2APBA 5EG6C 5LBSH 4GKOA 4WW1A 4M48L 4PLKD 1R5WB 1TCMA 4GW4A 3L3KA 4P5TA 3RZCA 1BPVA 3VXQB 1EHLH 4OZIA 4ESKA 5ID0B 2FO4A 4JFXA 4G8IB 2D7QA 1MWAB 1UZ8A 3FQNB 3GSUB 2P7TA 3MRFA 3D39A 1W0WB 1Y18A 1FORL 4LCIH 2IQAB 2Y72A 4LIQH 5EU4B 5K33A 5GS2D 4NKMA 2EDLA 1RFDL 2AJVL 3HC0A 4WEBH 4NT6B 2RR3A 4XP5H 1J10A 5GJTH 3MV7D 2BMKB 1O0VA 5FUCE 3WIHL 4FG6D 5JIPA 2PTUA 5CZXC 4YAQB 2OTWA 5FF6B 4U1HA 3EZJB 1ZTXH 4P2RA 1E4WH 4L8DB 1Q9LA 4F8QA 3GHEL 1YMMD 4UV4H 3GKWH 3D2UD 3ECBA 1CGUA 3EOTL 1NMAH 4OZHB 4JY6A 1H9VA 1HHGA 3LPGA 2R4RH 4XI5C 2DI8A 4IJ3B 4XNXL 4G6FB 4LOUD 2W9DL 5F7LB 4OGAC 1KBGH 2V2TB 5DVOA 2VDPH 1C12A 4EI5B 2R4SH 5EO0B 5C07A 4UQ3B 4XGZA 4LRIC 3ULVC 4MMXC 5I15L 5EO1B 3B8YA 4N5EC 2FR4B 2XN9B 5I8OL 2VDQL 1F58H 2GITA 3SQBA 5JXEA 2YD2A 3AU1A 5I17B 4U1KA 3SCMC 2PYEE 4BQ8A 3MODL 3WUWG 3PWJA 4N90E 2VAAB 5JO5B 3I6LD 3QUMA 1XIWB 3JVGA 4OKDA 3O3AA 1MCJA 4DK6A 3TESA 3BYTA 4RBPK 5GZNC 5JPMB 3VWJA 3MBEA 1G6VK 4FTVB 1H3PL 4L4VD 4RSVA 1EGJA 2PTVA 2VN4A 4ONHA 5I66A 3P4MB 1EFXA 5FYKL 3CGTA 1B88A 1DLHB 2N7BA 1ZT7B 3WFEL 1SVZA 1KF9B 3PHSA 3TVMA 3HAEG 4R96B 1NGPH 4O2EB 2IAMA 2B2XH 4L4JA 1EAJA 1IC7H 2X4TA 5JMRA 4H8WL 2UYLA 4TPRL 1BQLL 4Q7DA 2X4OA 3QO1B 1YMMB 4R8WH 2YD6A 3QDGD 5D5MB 2X1OA 1M71B 3D2UB 1XGQA 5GIRA 5HI5D 3HRZA 1CDYA 4YFLI 2OYPA 3TNMA 3CXDH 3HC4L 1YNKL 3TBVA 1XGUB 3CSBA 5FUOH 3FO0H 4YR6B 2Z8RA 2R1XB 5B39A 4U1LB 3MLUL 4Z5RB 5E2WH 4WFGE 5D6CA 3DX9A 2DJUA 4GAGL 2CXKA 3FONA 5BRZE 2IPUK 4XPFL 1EPFA 1H8SA 1Q9KA 1VEPA 5I1HH 4ALAL 4KK5C 5IFAH 4XTRD 2DOCA 4OD3H 5I8CA 2CIIA 4OZ4A 3SDCB 1II4E 1KTDA 4P5TD 1FLRH 3RZCD 2GY5A 4HHAA 3VU2A 4N8CH 3MRPB 3QNXB 1P7HL 1FCGA 1NQBA 3D39D 4IJ3C 1NUGA 2KQMA 2ICEA 5IB2A 4OGXH 4YX2H 2IBZY 3CU7A 5D2NE 2AJXL 5CAYB 2XZCL 2YD7A 5HI3C 4EI5C 5D7KD 1YN7A 4NZUL 1DFBL 1JNJA 3A6OA 4P2RD 3VXPA 5AWNL 5MENA 3H9YA 2VISA 4XNZB 1IGJB 3T0EE 4I9WE 3ZDXF 1RZGB 3Q2CA 3MJ9A 3P4NA 1QFHA 4O4YH 2HKHL 3LVEA 4UB0L 1R3LA 4L8CB 2W07A 1WICA 4F3FB 4PLKC 1WBZA 1XIWC 5E0QA 1OGTB 1NEUA 5EOCL 4OQ1A 2HFEB 1PQZB 2VR5A 4ZTOH 4WFFE 1GGCH 3K7UA 4NRXA 3VGFA 5C07D 3FRPA 1NGXB 2Y36H 4NPYA 2CLVB 2AK4E 1AGBB 1EO8H 3UBXB 5JXED 4JN2B 2FJHA 4LLYB 3SO5A 3DYPA 2O5ZL 1JZ3A 3CU1A 3CDGB 5KAQF 3X3FL 2R1WB 5ADOL 4DZ8B 4UV7H 4AEIH 4WW1B 3D85A 3Q1SH 4GW4B 4P5TB 3BRDA 3RZCB 3VGGA 4MB3A 4DQOH 4DN3H 1D9KA 1YEEH 3ARFA 5JXAH 5LGJA 4OZIB 3VWJD 3MBED 2AV1A 2DTMH 2FO4B 2ADFH 2ICES 2G2RB 4JFXB 1XF5A 1I3UA 2V9QA 1UZ8B 3L7FA 4FABL 1H3WM 2P7TB 1NLBL 1Y18B 1EFXD 4ODVH 3WDIA 2NY4D 4YWGH 4F7MB 3SPVA 4PJEF 3HC0B 3IJYA 4LVNB 1QSEE 5ADPL 4Y5VA 1PZ5B 3TVMD 4YO0A 5I1GL 4BUHA 4PRHA 3Q3GB 1WBXA 2IAMD 1YEDA 1BJ1J 5IP4A 4JRWA 4JZJB 4OIIL 1KXVC 1MFAH 1Q9LB 5DSCB 1DDHA 2VLJD 3NVQA 3DOSA 4IBLT 5C6WH 1N0LA 1YDPB 4JY5H 4HX1B 2GK0A 2ED8A 4L9LA 3UJTL 4JY6B 1HHGB 3H0TB 1IM9B 3C2SA 2R2EB 1S7XB 1TQCC 2V9RA 2H3NA 3PWUB 4X6DA 4JO1L 4YHPA 3DMMA 1ZWIA 3BWAB 3QEQA 2DTSA 4K3HA 1A9BB 4EJ1C 2VDRH 4MCZA 4U6TA 2BJMH 1VHPA 1U41A 4TNVK 1TDQA 5EUOB 5ACLA 1C12B 1SJXA 4S10A 2XA8H 5C07B 1A9EB 1HXYA 1CTOA 4G8FA 1I7RA 5ALBL 5BW7C 2GITB 4MA8H 4NQCA 2AJSH 3K4DA 1P1ZA 3S5LG 2FJFA 2QSQA 1TTUA 1GH7A 3V6FA 3SQOH 1E6OH 3K74B 1HSAA 1B4JL 2VIRA 3U82B 2L7JA 4XNZC 2B4CC 4RISL 2QSCL 3VFUA 4OGZA 5IVXA 5DVLA 4YE4L 1XCTA 1OAQL 5LXGL 4I4WA 3PWLA 1NFIB 4Y5XA 1FSKB 4XBEL 4R0LB 1V3LA 4GXUN 4KXZH 5HI5C 1HKFA 5K59F 2BSRB 4KC3B 3IJSB 2R69L 5JZ7D 4M7LH 4QRRB 4BZ2H 1U42A 4M02A 1T7YA 5I66B 5TE7L 1OGAA 1CLZL 1N5YH 4TSBL 4M43L 3OKYA 2FWOA 2AEIT 1EFXB 2ZG1A 3RGVA 3NGBB 2NY4B 4FQPA 7FABL 3MLWH 3LHPL 5IW1B 3ZZ1A 1N6QL 4JO3H 1NAMA 5INDB 4KHXH 5MEND 2QR0A 3G6AA 4BKLB 4RBPH 5B22A 2DQUL 2FZ3B 2EH8H 2UYLB 3QHFH 5AD0B 1QSFE 2X4OB 2F53A 3ZE0F 1P69B 4MJ5A 1XGQB 5GIRB 3VI4E 3HRZB 5KJRL 4IHOA 4P5TC 3MXVL 1CT8A 3RZCC 1JWUB 3V2AR 3TBVB 4ODHH 3VXRA 1JPSL 5C8JA 1XGTA 1TCRA 1O5DT 1KJ2L 5CIPH 2WSKA 3CJJA 5EN2A 4JJHA 2VE6B 4ZFOB 1AQKH 1SM3L 2A9ML 1U9KA 4MDIB 3DX9B 1P9MC 1RZFL 4LVNC 1R5VB 4LK4A 1UM6L 1LEKA 1SEQH 4DN4H 3MROB 5T3XE 5I8CB 2BSSA 4IS6B 5ECJE 5FKPA 3D85D 4X83A 4PJ8A 1NUNB 1NMBH 3FB7A 4LSPH 3V5DA 4JZJC 4XAKD 4HHAB 3QI9B 1D9KD 3ARFD 5I9QB 1UH2A 3TNNA 4MNGA 3MNWA 3ARYA 3IJHA 3QQ4B 1IZJA 1IC4L 2C4XA 5FYJD 2E9BA 4QRQA 3V7MA 1RIHL 5IW6A 5ESQB 4ODXA 5GS0D 3DNKA 3KWWB 2VN7A 3KPRA 2OR9H 3ARUA 4OFVA 1KFAH 1QRNA 5EFIA 3UCRA 4PD4K 3DURB 2V5RA 4M5ZH 3PP4H 1I3VA 3F12A 1BQHG 4WV1A 4WFHE 4QKXB 4X6FB 2ZCLH 4HK3N 1MI5E 1EZVY 5IJKA 3EIFA 3VGBA 4GRWB 3VXPB 1OAYH 4PJGA 2X4RB 3MYJA 3RKPA 3S8WA 3P4NB 3QHZL 3QDAA 2CUMA 4PYHA 1R3LB 5T1LB 4JRYE 5F7NC 4PJ7B 4X4ME 2NY5H 3M1BA 3DMMD 3P73A 1WBZB 3QEQD 3DXAE 1S5IL 1UZ6E 1JRHH 1IBGH 1SEBA 1FSKC 3MBEC 4R0LC 4NRXB 1Q72L 1IL1B 6CGTA 4H25A 2B8OT 2RAMA 2VDNL 1AH1A 4NPYB 3ESVF 5SX4I 3NGBC 2NY4C 4NQCD 2FJHB 1CG9A 4KUZL 2DLGA 4XAWL 4TQEH 4OLXL 3C6SB 3IDYB 5AUMB 2H9GB 1FFPB 4X6CE 2IG2H 1MQKL 2HG5B 3TIDA 1MEXH 1DR9A 2BHUA 1CU4H 1KIRB 2AV1B 5T33H 3UJIH 1NBVH 3D48R 1UM5H 3T0XA 4CW1B 4JZNB 4F33A 3MUGA 3TT3H 3RGVD 4BH7A 4LPCA 3MFGB 4N0UE 4E9LA 4M6AA 1NSNH 4KDWA 3IJYB 2CGRL 1CFSB 4ZDHA 2VUOA 3STZA 4WI7A 2DMCA 3ZHKA 2VUYA 4PRHB 1WBXB 4Z7OE 1AD0A 1B2WH 2OL3A 1PVHA 1L4IA 4KQ3L 1I7UB 2WBJD 1YEDB 1QP1A 5CINH 4WIQA 5I30L 2P8PA 1B9ZA 3DLQR 2BVTA 5GPRA 2F53D 4TNWF 1GVIA 3F7YB 4JDZB 3CDFA 3L3GB 4M3JA 5F93C 1KCKA 1RUPL 5D93B 5ITBH 4MJ6A 3MLPA 1I9RH 3LKRA 1MAKA 5E6IA 2R0KH 3QI9C 3U6RA 3V4PL 2X40A 5EOTB 5I9QC 1M05A 2EC9T 1YPZF 2H3NB 4YHPB 2E8ZA 4G5ZH 2IH1B 1Q8MA 1TVHA 2MQ3A 3HZVA 1J1OH 3DV6A 1X5AA 3IB4A 3X14A 1V7NL 3VXUE 5SX5K 3ARVA 4RAUB 4CVZA 2DIBA 4FQCH 5D7JB 5CGMA 1HXYB 3LN4A 5JZ7C 5CKGA 1I7RB 1KN4H 3O2DL 5KSAB 4X9GA 2QKIB 4I1NB 4O2CA 1IARB 3FOMA 4OLYL 3W39B 3SDXA 4PJ8D 1HIML 1P1ZB 3BDYL 5FA4A 2A9NH 4ZOBA 5FXCH 5LWYL 1HSAB 3WUZA 2VR4A 2DQEH 4YBHA 3UJJL 4NJ9H 2YKLL 4PGCA 4HCRH 4YDIL 3VFUB 3RA7L 1VPOH 4LLMB 5LGHL 2YMXH 4BYHA 3VFSA 1KXQE 5KVDL 4N0FA 5DK0A 4K71B 2X4NA 1S7TA 1F8TL 1NCNA 2ZCKL 2VXUH 5EU7C 1QRND 5C92A 2Y5EA 1OGAB 3IDGA 3OWEA 4U49A 3BRFA 5I1EL 2EECA 5IM7B 1IT9L 3SO3B 2X6MA 3H7BA 2O26U 5DFVD 1ACYH 1MRFH 1N0XL 4J8RA 1I8MB 3G6AB 2AKRA 4EZMA 1WVZA 3QH3A 3QFDA 5FYLL 1L9MA 1V7MH 1A7OH 1JPTH 4MHHI 2IC2A 1UKSA 3HMXH 3BKYH 3IDYC 3WLWD 1ZLUH 3AM8C 3NFNB 4MJ5B 1CE1H 4LEOA 2Z4QB 1CT8B 5GGSY 4L4TA 3VXRB 5C8JB 3ARFC 1XGTB 4A2MA 4M6NL 2EIZA 5KW9H 4S1RH 1LE5B 5EN2B 2RGSA 1N3NA 3BH8B 2AEPL 4ZODA 5HHOA 1HSBA 1WC7B 4Q9CA 3D25B 5GS0C 2Z93A 3FMGL 3CSPA 1IAIH 3BP4A 3LEYH 4H0IA 4PJXA 5HPMA 5ICYA 1T20A 1FO0A 4Y5VC 2XRAH 3GSRB 1LEKB 4PRDA 1A1MA 2J6EA 1Q0XL 1Z9SA 5C2BH 43CAA 1L7IL 2BSSB 4U6YB 5FKPB 4PJ8B 3FB7B 3QRGL 2V5YA 5CEXA 3P30H 5I1AA 1MHPH 3BGMB 3GRWA 4F80A 5AZEL 2FECI 5ESVA 5CSGA 4LFHD 4JFPA 4MNGB 1D5MA 3MNWB 1LEIA 1CTNA 3N06B 5D93C 4PRPE 1U8JA 4QRQB 4PR5A 5I8KH 1RVFL 1FYTE 4ODXB 1KLGA 3KPRB 3DMMC 3AREA 5JR1H 4U7KA 1U91A 1UENA 3MR9A 4HKXA 5EFIB 4CMMA 3UX9B 2VAJA 4GQPH 1NCCH 1JHLL 4BSWA 3GKZA 3F12B 1HQ4A 5GGTH 2QBWA 5EIVA 3OR6B 1YA5A 4Q9QH 5D7JC 4Q0XL 2F74A 3VMPA 4XP1H 3WFCH 1SJHA 2J8UF 3HNVL 1PSKH 3V8CA 4NQXB 2GJ6E 3O4LA 4KGLA 4ZAKA 4Z6AT 1HQRA 4PJGB 3KJ6L 1TTFA 2VC2H 3MRMA 5E6ID 4E42A 4G42A 4HS3A 4I3SH 3BD4A 1X5JA 1UYWH 3WD5H 1CD9B 3M1BB 4GMTL 5D70H 4NWUL 5GS1B 3QUML 1C16B 3DV4A 4XXDA 3PG2A 2NPLX 4K71C 2WIIA 4I8DA 1M7DB 4J23A 2ARJA 4NNXA 4NUJB 3QSKB 2NXZD 4I2XA 1EGJL 3RGVC 1MCPL 1WAAA 2FD6H 1VSCA 3A67L 4P99A 3SO3C 2EH7L 2FX9L 2H6PB 4F8TA 4MLSA 2ZJSH 4ZO9A 1AO7E 4P4KA 3FB6A 3WO3B 3RGHA 3MRGB 3RWFB 4O51A 5L88L 3MLRL 4ZSOA 4G9FB 4PGDB 4B50A 4AL8L 1ZHBA 4BZ1H 5E99H 4TVPL 3VGEA 4UT7L 4YDJB 5MHSD 3OKDA 4TYUA 3BXNA 3P77A 4QRTB 3D6GA 3DSFL 3OB8A 1IE5A 4NQTA 1QBML 4NNPL 3OSKA 4IOSD 2C3GA 3DVFA 2EYTA 5CKAA 3QJHA 1I7TB 4F33B 5HHNA 3MUGB 3QCVH 4GMSL 3TIEB 1F4WL 3PF2A 4JQVC 5HGHA 1HINH 4FQHA 1JUFB 4HUUA 4M1CD 2WP3O 1BIIB 2FX8L 4WU7A 2OL3B 3HA0A 3Q5OA 1U93A 3K81A 2HWZH 4MNQB 2ZUWA 2MFNA 7CGTA 3SY0A 4FP8H 3DGCR 1K6QL 4I18A 4HS6A 4NKDA 1HYSC 4PJ8C 3Q0HA 5IMLA 4OF0A 1A7RH 3FN0L 4MJ6B 4WUKH 3U6RB 5E6IB 5I8EA 1A7PH 4L4TD 3OV6A 1M05B 2D03H 2NTFB 3RIFF 2GAZA 5MEQA 3BO8A 2D7PA 1JHTA 4X4YA 3B5HA 5GRJL 3T4YA 3N1MC 1DBMH 2P24A 5HHOD 5KS9E 3DV6B 3MJGX 2AGJH 4G9DB 3FQTA 3EJYD 4CVZB 2V2XA 1CXHA 5CMAA 4ODWA 3MLTB 3BEVB 2NXZB 3TCLA 2P1YA 3GI8L 3LS5H 4O2CB 4WV1C 3KYKH 4U3HA 1P84K 1LO2H 5DFVC 3RWEB 3O4OB 5IJKC 3WL9B 5T1DH 2AS5M 1TJGH 3AS0A 2YPVL 3U36B 5KSUA 4J3TA 4OZFG 3S3PA 5CWSB 5SX5H 4U33A 3OJDA 2DMBA 1NJ9A 3CX2A 3VFSB 4Z7WA 3MCKB 4N0FB 4ZPVA 5DK0B 3L1OH 3U4EA 3Q48A 3QA3A 4NCC1 1S7TB 2UVEA 3ARED 5I0ZA 2N1KA 5GS1C 2BNQA 2VSDA 3IDGB 4YHNB 2W9LA 4NQUA 2HN7B 1MVUA 3CVHB 5FO7B 1GC1H 3EJZD 1T0MB 3GSNL 2V6HA 4RGOH 4R6UA 3H7BB 1UB5A 2FX7H 3CFCH 2Q76A 4NM4L 3RNQB 4J8RB 3O4LD 4ZAKD 1ORQA 3QH3B 3QFDB 1J12A 2IGFH 4ODSL 4H26A 4X7CC 15C8H 1CBVH 3CSYA 2PKDA 2EDDA 4WO4B 5C0GB 5JDSB 4LEOB 2DQHL 2DIAA 1G6RH 1I4FB 2P42B 4JANA 2VKXA 2QL1A 3A0OA 5C0CB 4EIZC 1N3NB 1LD9A 1FN4B 1A02N 5DRWA 1NH6A 3I50H 25C8H 1MF2L 1HSBB 5ISZE 5ALCH 5FO8B 3BP4B 3CFKA 2FEEL 3O0RH 2OJZL 4PB0H 5HPMB 1T20B 1QO3B 4PJAA 2YPLA 4RRPA 4P4KD 4CRPA 4YEFA 3UTQA 3CVIH 1K4DA 1CDCA 4ORZC 4PRDB 2C3HA 4R2GD 5DHVH 43CAB 1PG7X 2CDFB 3W9DB 5CEXB 5LCVL 3WFDL 5I1AB 4PV8A 3SKNA 2LV4A 2LTQB 4LCCA 4XNQA 4QRPE 3CUPA 1LEIB 4O02L 1GOGA 1IGCL 5E6IC 1Z0MA 3MRLA 3Q6GL 2BVPA 4O00A 1MAML 3G5ZB 5IROC 4QHKI 5FHBH 1T03H 4JHWL 1L9NA 3MRJA 5BMFL 5IKCB 4CMMB 3I9GL 4OF6A 1QNZL 3D1MC 1KELL 1HQ4B 1UJ3A 4LKCA 3LQZB 4G43B 3T77A 4LSQL 5J3HC 5DLML 2F74B 2NXZC 2GT9A 4DVRH 3ARPA 3WKML 3O4LB 4ZAKB 1FZOA 1HQRB 2EDHA 1WCQA 4AJ0A 4XC3H 4XCFL 5C0RL 4W70A 1F3JA 3O4OC 4O9HH 4F7TA 4ZFGH 1AJ7L 2RFXA 4G42B 1XF3A 2IBZX 1UEMA 2BDNL 3OAZH 2DN7A 4XRCA 1J1XL 4QF1A 3AROA 2QQNH 5IB4A 3DV4B 4KTDL 1UACL 4QHUA 1MFNA 3B9KA 4YGAB 2YXFA 1U92A 2ARJB 3GB7A 3GHBL 3UTSB 2OK0H 3NABL 4UAOB 4KAQH 4I2XB 2ITCA 4CMHB 1NGQL 1OP3K 1UKQA 1PAMA 4O51B 4OT1H 4M1CC 5BQ7A 3VG0L 4FQ2L 5FV1L 4EI6A 1NAML 1ZHBB 3QNZA 2K3TA 4N0YH 2GKIA 4JFOB 4GG8A 5DFWH 5DEZA 1GGIL 2R8SH 2HKFL 3P77B 1QR1B 3O3BA 4WO4C 1EHNA 1T21A 3T1FA 3C09B 1YEKL 4M7LT 2EYTB 2BNQD 4LF3A 2I9TA 3ZTNL 3MRCB 1BIHA 5JOPE 5C0BA 2XZAL 1A5FH 2E27L 3RWHB 1JMXA 1MFEH 1C5CH 1IQWH 5HGHB 4HWBH 3OAUH 4HUUB 3EYQC 3FO1A 4K2UL 3QXDA 1F6FB 1U93B 4NC1C 4YIQB 3SGEI 4TUKL 2D3VA 1K4CA 4M8QB 1DQTA 1T1WA 1ADQL 4XWGH 5TQ0L 3VD5A 1GOFA 4Q9BA 2DWEA 5F88A 1FE8H 3HFMH 4ODUA 4CNIA 4I18B 3O8XB 4HS6B 4M4RA 1FNAA 5K9KB 1WFOA 1FNLA 5EBLA 3E6HA 2EDJA 1OLLA 1UC6A 2ORBH 5IMLB 1K9TA 4JO4L 4Z77A 4HUXA 1FPTL 4N0CD 4HT1H 2LTQC 3KLAA 5IHLB 2EIBA 5I8EB 1PLGH 4XVTH 4R4BA 1AGCA 4M7KH 1OD9A 3V52H 2GAZB 2DMKA 3H9SE 4KJYA 1N64H 3ZDYF 3WS6C 1DE4B 2VLRE 4X4YB 3NIGE 2R23A 2P24B 2CKBH 3FQTB 1TZGH 2X4UB 3ZSSA 1INEL 3KS0H 3VMNA 2FHBA 1FL3B 2V2XB 5CMAB 4CVWA 4ODWB 2YWZA 2YPLD 1EXUB 3VXSA 4K23H 5DD5L 3I6GA 4B53A 3TCLB 2DQIL 5JQ6L 1L7TH 2BNRE 3QEHA 3BZDA 1UQSA 2DDQH 4Y0GA 4WI5A 1RU9L 5JPNA 1KLUA 1MSPA 3WIIH 5GGUB 3VD4A 3JWOL 2LAAA 5TDPB 2OCFD 4DUXA 1GCFA 4U1SA 4ZAKC 3WE6A 4NQEE 1FZKA 3DRQA 3RPIB 3HZMA 1MJUL 4ONOA 3UAJC 3NCJL 3OJDB 1NJ9B 4M62H 3OHXB 5DD3H 3N9GH 2HVKA 4CU6A 1FH5L 4M3KB 4ZPVB 1A6VL 4M61B 3RTQA 2VZOA 3S36H 2D7MA 5CIPA 1WIOA 5TQ2L 3MV9B 2P44B 3OXSB 4YNYB 4ACPA 3IU4L 2VLKE 3QEGL 2B1AL 2BNQB 2JCCE 1YEFH 3DIFB 1KENL 1MVUB 3MA9H 1AGEB 4L5FH 4DKFL 3U9UA 1R5IA 1KN2H 5KVGL 4UAOC 1UB5B 2OI9B 4YXHL 4K7PY 3MLXL 5E00A 4WY7H 1PKOA 1F90L 3VI4F 1BOGA 4NRYA 1NBYA 5J4MA 4K9EH 3CSYB 2W92A 4R2GC 4CL7A 1YJDH 3BKML 1E4KC 4OM1H 4KZDL 5DT1H 5B4MD 4OD1L 3OKNA 4KDTA 3UC0H 2A83B 4NUGH 1IM3A 4JANB 4O2FA 4JFHD 1DQDL 3LKSB 4H5SB 3B9KD 1W0YT 1BD2B 1S3KH 3C09C 3MLSL 3PWVB 1LD9B 1LK3H 5DRWB 2MWCA 1JGDB 2HT3D 4HC1H 3GMPA 3QG6A 1BFOA 1K8IA 4XH2A 2YPLB 1IKFL 4WTZG 3DBXB 5DK3A 2ATPA 1NL0L 4JPWL 1WUNT 1MCRA 5FM8A 1QUNA 2NCMA 5SWZA 3SKNB 3MGTA 4XNUL 3W0WB 3I85A 2EO9A 1FORH 1JZ5A 3GMQA 4I18C 4NC0B 4LCWE 3O8XC 4L9DA 4XNQB 5CJQL 2WWKT 4XCYB 5HGDB 5JW5B 1RFDH 3RWCA 2AJVH 4IEFB 4DGIL 1SBBA 3C08L 3FTGA 5INCA 4U6VL 3MRLB 5ENWB 3IDMA 5C0BD 3WIHH 4R7DA 4Z7VE 2V7HA 2XKSA 4GAFB 2CH8A 1UG9A 4UZGA 3CLFH 4EIGB 4RIRA 2QQKL 2P5EE 1M7IB 3IGAA 3KDMA 4GKNA 2EYSA 3T77B 1AR1D 3VGAB 4PUBL 1FFOA 2OJEB 5DJYA 2GT9B 3TPUA 1AY1H 1FZOB 4XNXH 1ES0B 5FYKU 3QFJA 2Q20A 1CICA 5IIEB 4F7TB 5HYSB 1UZ6F 1HH6A 1EHXA 3O2VH 1XF3B 3O6FA 2GYSA 1DBJL 1I7ZA 2Q7YB 1RZKL 5C0JA 4OKVB 1LP9E 2FATL 4FNLH 5D72L 4EOWL 3DUSA 4NZJA 1OTTD 2BP3A 5I8OH 4K94L 2AAVA 2ZG2A 1EZVX 3T65B 4QHUB 2YD4A 5F7MC 1RY7B 1X5FA 1U92B 4OCSH 5GJSL 5KG9A 3L3HA 1HKLL 3VXSD 1JWMB 1H8NA 1L0XA 1GOHA 3WHXA 1U8OA 4KRPB 3K80A 5KVFL 4L3AA 2OI9C 1IAKA 2XG4A 4RZCA 3PHOA 5FO9B 5TF1L 4EI6B 1IKNA 2R56L 2XN9E 4WRLA 3QNZB 4HF5L 5F8RC 1T7VA 2XZQL 3LEXA 3IDJA 3GSVA 2J7LA 2AJUH 4HBQA 5FYKH 3O3BB 1T21B 2C9AA 3QEUB 3RTQD 1RUAH 4LP5A 4D0BA 1YYML 3WFEH 3TYGL 1JPFA 1H3GA 4N0CC 2I9TB 1KB5A 1SJEA 4Z7OF 6FABH 3NZHL 3TC9A 4FXKA 3STLA 4P57B 4AY0A 5FCUL 1QQDB 4H8WH 5CFHA 1B0RA 1KT2B 3Q5YA 4TPRH 4LCYA 1BQLH 3DX8A 2MNUA 3MRHA 4FTVE 2MQCA 2F5BH 2J8UB 3FO1B 2YD8A 3C60A 3DROA 3QXDB 1WTGT 2Y6SD 1LK2A 2AQ1A 3VFGL 1VB9A 2P8LA 3DUUA 4OLUH 4D9RD 5KSVA 2DQGH 2J6EL 5GSRB 1SYVA 5EBLB 4H1LH 4HCRA 3BPCB 3CLEL 3MV7E 4WDIB 4HUXB 1KCUH 4JPIA 1A6AA 3PDOB 1H15A 2P47B 4LCCC 4GAGH 3SKOB 4R4BB 4Z9KB 3ULVL