2CUHA

Solution structure of the 31st fibronectin type iii domain of the human tenascin x
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
115
structure length
115
Chain Sequence
GSSGSSGPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDIQVTAPGAPPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Tenascin-X
publication title Solution structure of the 31st fibronectin type III domain of the human tenascin X
rcsb
source organism Homo sapiens
total genus 7
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cuhA01
1FGVH 3CH1B 3LV3B 2W9LA 3MREA 1QZ1A 8FABA 3DRQB 1QHPA 3SGEI 3AU1A 4JPIA 5KTEL 3C60D 3O2DH 3F5WB 3D2UB 1KCSH 4IIQC 2LU7A 3TT3L 3QXWA 5JHDB 4LNRB 2Y5TA 3MJ7A 3ARUA 3C5SB 2BOBA 3OKYA 2VLRA 4I2XE 3T2QA 3QUXA 3SE8H 4I0PB 4A6YL 1IRAY 3NIGF 5F7WC 1VGKB 4JREB 4HEME 5FO8B 2YXMA 2GYSA 2P8PB 1HKLL 1E4WH 4KQ3L 1QR4A 5ID1B 5EPMA 1FYTE 5DJYB 4ZXBD 1X5ZA 5J3HC 2BRRH 1FO0H 3P73A 4J3WA 3KPRE 5TH2B 5I1GH 5KSAA 3QO1B 3TA3D 1CGSL 4D0CB 3DO7B 1QA9B 3ARVA 4HMEA 4JFFD 2ATKB 4PRDB 5HI4D 1BHGA 4UV7L 4NYLA 1X5YA 3WBDA 2AKRB 4OZHB 1BJMA 2YC1B 1Q0YL 4QRQB 3V5KB 2R9HC 5CIPH 3S37L 3ZTNH 1NMAH 2KQMA 4U1LB 1OTSC 1I85C 5HHQB 3AREB 4O02H 2I9LB 4Q9QL 4OIBA 3QNXB 2W65B 4YHLH 3LD8C 4Y4KD 2E7HA 2P24A 4NO0B 3BE1L 4M8QA 4LHUA 4L8SC 2ZUVA 1QSEA 2OL3H 1BD2A 1QFWL 5DRXB 5F8RC 3QEUB 3CCHA 4XX1G 3OZ9H 5KW9H 4JLRA 4TVPH 1EFQA 1YMMD 4YAQB 4WTWA 4NFBA 1OSZB 4KVNH 5HPOA 1DLFH 4MYWB 2KZWA 5K9JL 1BPVA 2CK0H 2X09A 5E2WL 1OAXH 3GSVA 3N1PC 3SKNA 1DLHB 3MRFA 2J8UA 1NAKL 1ZVYA 1LHZA 3QDGB 4B5EA 1T2XA 4LCUB 3SJVA 4MDIA 4X9FA 3PGFH 2HJFB 1GGBH 5GIRB 5E8PB 4IHOB 3KYOB 2XKUA 1H9VA 3CUPB 4G7VL 3SE9H 2NY2C 2B1HH 4RA0C 5DHVH 4JQXC 2HA1A 2NY5H 4JFOB 1H8OA 3CJJA 3L1OH 3UJIL 2XTLA 3MNWA 4JFZL 4LEOB 3NIFE 4RX4D 5DMIH 1JUFA 4APQC 3CX2A 4HFWB 5DK3A 3DUSA 4P9HL 2B20A 3HUJF 5KN5A 4JANB 1OLZA 1IBGH 4HIXH 3V6OC 4GUPB 2PXYC 3KHQA 4KRPD 2GTWA 4RDQG 5E6IC 3C5JB 2VTFA 1DE4A 4PUBL 1M4KA 4HWBL 2X4QB 2HP4A 3H7BB 1TZIA 2EIDA 5E2TH 2D7TH 1T0NA 4XNUH 1FP5A 1JL8A 4PJXF 4UOJA 3ILPB 3PWLB 3QO0A 2PYFA 5HVHB 4NO2B 2E6PA 1QKZL 4QYOB 1UEMA 4HJJL 4EUPH 3QI9D 1UH2A 5DSCB 2PW2B 2HLFC 2FATL 43CAB 5ENWA 1NAML 5LWYH 4MSWA 3BMWA 2FSEB 1FVDA 2XI9A 2ZCKH 1QRND 5FCUL 2VDPH 4BZ2L 4R0LC 4OZGB 5B22A 2VR4A 4TQEH 4M02A 4QOKB 1W2KT 1R3JB 2IBBA 3BEVB 1CL7I 2VLRD 3UXFA 2EDQA 4ZUUB 1GHFH 3EAKA 5T1KA 4LAJH 1KIPA 1KXVC 4WCYH 5EN2B 1TJHL 2HWZH 5D1XB 3FCTB 5B39G 3RHWK 3OGOE 5KS9E 1CXKA 3U30B 3UYPA 2VIRB 3IJHB 5I1HL 2A6KA 3P9LB 1QR1B 4YDKL 3O2WH 5EO1A 5ICZA 5J06A 5KSAD 4QNPE 3GDBA 1FH5L 5EB9A 1Q72L 3MRNA 1DBJL 4MNGA 4PREA 3T08A 3QDJA 4GRLD 4XVUC 3HS0B 4D9QD 2Q76B 1A7NH 4BFIB 5KSVB 3D87B 1CDCA 1ZVSB 1S9VB 3X12B 4NC0B 4D94A 3DGGB 2JCCE 1A6WL 2X7LA 2KH2B 3EOTH 4FFWD 3HAEG 2IMMA 4QHKJ 5DUMH 1HWGB 1UWEH 3SDYL 3STLB 4WDIB 2DQGH 1IJ9A 3PWPE 4K2UH 2FH8A 3NFSL 1KELL 3HZYB 3VRLE 1I8LA 4L8BA 4OJFH 4PLOB 5HHPA 4LSSH 5MHSD 4FQCH 1SEBA 3AB0B 5DI8A 5GZNC 1AXSB 1FFNB 1P9MA 3X3FH 4XHJD 4ZFFA 5I1EH 4WI2A 4KUZH 1MUJB 4EI6A 3IDIB 3CLEL 5E8EA 5C0BE 4X5XA 1ZGLA 2BVQB 2FGWL 2YXFA 2F53A 1WV7T 4PLJD 1BFSA 2AEIT 4GW5B 4DZ8B 4Y5XA 4KK6D 4UU9B 3IJYB 5B3JE 4GXUN 3FHQA 4GW4B 4YGVB 3L6FA 4HUVB 1AC0A 1BF2A 3WNNA 4XAWH 3C6LA 2UYLA 1KEGL 1ZT7A 3NIDE 1JZ8A 2VSDA 5AEAA 1QP1A 1HCVA 3OJ2C 1F11A 4HWEL 2YEZA 3BQUB 4M48L 3T1WA 1JWUA 4M93B 1F3JA 1T1XA 2HVKB 5BRZB 5I18L 3K8MA 3FO2A 5MENE 5DD1L 3VH8G 4YHOH 1PY4A 5SX4H 2CLZB 3WNOA 2VAAB 1NC2B 3RVUD 4O5LH 4P9ML 1IGTB 2D31A 5C0IB 4NNPH 2HFEB 5E8OB 3O6MH 4J8RA 4XXCA 4MNHB 3U7YL 2ZKHL 2OXHA 2I27N 1NGQL 3QDAA 2DM3A 3WFCH 4G9DB 4YHPA 4OF6A 5E99H 1XCQA 1NEZA 2G2RB 1JF5A 1YEDA 4Z8FH 3BXNB 3ARYA 1XMWA 4JGUA 3MLXH 4X6FB 4RFNB 1HKFA 5HHVL 4NQXA 3IDJB 3B9VA 1WISA 2O5XH 3SE4A 2B5IB 4K7PY 5LXGL 5DEFA 5C0RH 2D3VA 1P6FA 4LIQE 2YPLA 4J3SA 1X44A 4PJBF 4JRXA 3VXPB 2GCYA 3RWHB 3V0WH 1GIGH 1CL7L 3E8UL 1Y18A 4PJGF 4KDVA 4P99A 2X1OA 3MO1B 3FT4B 3IXTA 4G8EA 1PVHA 1IVLA 3QULB 3U6RB 1XCTA 1D5XB 2F54A 2WBKA 2X70A 4QRUA 4DKFL 3CX5J 1VA9A 4M4RA 4U1JB 3S3JA 1MCIA 2MQCA 3IFPA 4G3YH 5IB4B 5FKPA 3S88L 1ACYH 4JFPB 1EH9A 4P46B 2W07A 3MV9A 3IDUA 1NBYA 4JY5H 1YEGH 5IV2B 3VFVB 3D0LB 1IM9A 4MMXC 1NGPL 2HN7A 2VR9A 2DYPD 4QXGH 4P59L 3SKUD 4BH8A 3G6JA 1P4BH 4G80A 3W81A 2IH3A 1AGBB 4EOWL 1YY9C 2UWEA 4OTXL 4LPCA 3KNBB 3O6LH 4DJMA 3HG1E 4KAQH 3KLHD 4JFHD 3LN4B 1UWXH 1S7VB 3D25B 3B9DA 3QXUA 2GW5A 3BGFC 3H3BC 4RNRA 4OF0A 4F37K 1A6UL 4P4KD 4WFED 2C3VA 2BY3A 1B6UA 1EO5A 4LCYB 5DWUH 5CD3A 2P45B 4HWZB 1KB5A 1UB5A 2QADD 4U7SA 2Z8SA 1U2HA 4LSTH 2OTUB 2RGSA 5EU6B 2CIIB 5IMOB 1WUNT 1A3LH 4DUXA 5SWSA 3FB7B 2BNQA 3O11B 3Q6FB 1BOYA 1T6WA 3KPMA 1XGUB 4IMLB 4OZ4A 3SN6N 4HK0B 3T0BA 3MA7A 3OKEA 4PB0L 4R90L 4YPGA 5HYJB 3X17A 3VA6A 4WEUD 5C09A 5T5NF 3IGAA 3TPUA 5DT1L 4LSVL 3IJSB 4KI5F 3A6CH 4R6UA 3ZKMD 3WUWA 1ZSDA 1Z9MA 5K9OA 3MJ9H 5E9DA 3CX5K 3DUUB 3VWJB 1JFQH 3SKJH 1GL4B 3ZDZF 2HVJB 4JVUA 1EXUB 4PGEA 3QFJA 4M5ZL 1RIHH 5FM5O 4JFEB 1QBBA 4ORZC 4QT5B 3E2HC 5GRUH 5DUPH 5I74B 4UTAH 5I75B 1RUQH 1BEYH 3IS0X 4OCYL 4OQTA 5EUKA 5CP7A 1NGXB 5FAAA 1NCUA 5EU4A 4ZS6C 4MB3A 1MHHA 1DBAL 3MFGB 4XH2A 3X11A 3O6KH 5TF1L 1IM3A 3BSZL 4TUOB 1R0AH 1I1CA 4P2CG 2Q3AA 4XNYL 2CIKA 1MCJA 5I8EA 1MLCA 1B90A 5D6CB 3HLAB 3LS5L 3BRDA 1E6JH 3PJSB 1DZBA 3ZYZA 4RBPK 5TDOB 1S7WB 4M4PA 1K4DB 3LDBC 4LP5A 3U82B 4PJ9B 5C9JA 4F7TA 2A83B 3QUML 4ZOEA 3UTTD 3EUUA 3RZCB 5HBBA 3MNVA 4UNUA 4F57L 3L3DA 1U3HD 5CBAB 4QRSA 2HMID 3VFTA 5C0CD 2CQVA 1FJ1B 3TN0C 4R9HA 3SDXF 2Q6WB 1MAKA 4XC3L 5MI0C 3ARBC 3QEGL 5DRNA 5IK3A 2PYEA 5IMLB 1FRGL 1HEZB 2VL4A 4HC1A 4BA8A 3DV6B 5JPMB 5D96B 4JN2A 3H42L 3RU8L 4H8WH 3EYUL 4LHUG 1AGEB 2FD6H 3EOAB 5JIHA 5ANME 1YEHL 3SO5A 5CJ8A 2F58L 5I19L 5IW3A 1XR8A 1LO0L 3JV5A 1CT8B 3IFOA 1QG3A 3RRQA 3G5YB 5IMMA 1JYNA 1KIRA 4NN5B 3ZYOA 3N1GC 2DQIH 4LRIA 5H2BA 1GGIL 3MRPB 3EYVB 1JNLL 5A3ID 4HJGA 2Z31D 2VDMH 1KNOB 1A6VL 3GSNL 5D1QA 3U4BH 1YJDC 5BO1L 1KB9J 2ADIA 3GI9L 4O4YH 1VFAB 2HT2C 4G8GD 4XRCA 3VE0B 2WK2A 2VZUA 3W11C 2DB8A 5IQ9B 1IM9D 2D4DA 3TLRA 2JKXA 4PP2A 5IBLD 2W0LA 4U4BA 3I6LE 3BIBX 2A73A 1VEOA 2C1OB 5EZJB 1TJIL 4HXAH 4N0YL 1KPRB 4L3EB 4X9BA 4AEFA 2BSTA 4LKCA 1G7IB 4PJBB 2CDFB 3MBED 4OB5L 3T0EE 4YQXL 3BHBB 4X8XA 2OBGA 2OP4H 1U3JA 3CXHJ 4XP1L 2UZIH 1BREA 1H3PH 3VGFA 5EO9B 1UKTA 4H88H 5ILTH 4RGNE 4Y4FD 2LE9A 3F7VB 4ODVL 5KANG 5KOVC 3R06A 2ADGA 3WLBA 4W68A 5FDWB 4PY7B 2A2QT 2F15A 4U6HB 3GNMH 2ITCB 4JKPH 3TO4C 5F3BA 4KJPD 3KPSB 4JRYE 1PYWB 2EYRA 1WWWX 3ARFC 5HD8C 2WWKO 3KPLB 1A6PA 4Z7NE 2C3GA 2FYYA 1UZ8B 1N2RB 2BNRA 5JO5B 3OKKB 4TUJB 3VFUA 2J5LC 1QLFB 3WV0A 3QB7C 4GO6B 1PY9A 4F15B 5BS0D 3QFJD 3UC0L 1WTGT 4KTYA 3LQZB 4BQBA 1X5HA 3HC3H 1MCPL 3RIFK 2JB6B 1AGFB 3OXRB 3W0WE 2X89D 5BVJA 2VITA 1O7VA 4KRMB 4LOUD 2NY0B 5ALCH 3MYJA 4Y0GA 1QTYT 35C8L 3WFDL 2G75B 4DCQB 1QFWM 1VEPA 2ARJB 2HG5A 3GIVA 5DK0A 1OSPL 1AH1A 4GRWB 3TT1L 1NUGA 1UACL 3GEWB 1RZJH 1NLDH 4U6YB 2BJML 2ENSA 5JXAH 3LKNB 5HDOA 4IIQA 1TTUA 1ZA3B 3CGTA 2P5WB 1CFTA 1TCRA 3DX6A 3ULSB 5D7JC 1U95A 3GMMA 1W0WA 1V3LA 3HCVB 5IVXF 5FECA 3W82A 1V7MH 5DUBB 4X6CF 5I16B 4J23A 5L2KD 1UCBH 3IDXH 1FNGA 3F7YA 2PYED 5SWZB 3NAAH 5KVMC 3QEQB 3EDJA 1WFOA 5E70A 5CEZD 2FBJH 5JMRA 1CLCA 3OMZA 2RBLA 4FP8L 5FV2A 1EPFA 2BRQA 3QJFA 2PO6B 2CRIA 2PN5A 5E0QA 5GS0D 5C6WH 2HFFA 1CF8H 1KUMA 2NY6C 2VZSA 1U8HA 2H9GB 4PY8I 1GZPA 3OKDA 1JGLH 1GRWA 32C2B 4KKBD 5JLZA 4BKLA 5I1CL 4P5KB 4D3CL 5TE6H 1J1PL 1EUUA 3LN9A 4HXBL 2R39A 3U36B 3MROB 1J8HE 4HIIB 3UJJL 5C07D 1I85A 4R97B 3P4LA 5FA4A 4ALAH 3V6ZB 3LKOA 5BMFH 5F1NA 2APVA 3CVHH 2YD1A 3E6FB 4L8SA 4WHCA 1Y6MR 1F97A 3OKNB 5IEKB 3QR2A 4TNWF 4U1KB 3NGBB 1AR1D 4QRRE 4LLWB 5C6PB 4LFHD 1LO4H 4U7MA 4XCYA 3UBXA 4UTBH 1RUKL 5F88B 5ESAA 3NCJL 2DLTA 5CBEB 1UA6L 2Y72A 3OGCB 4PJHB 1A7PL 3R0MA 3ZDXF 3MLYH 4YC2B 4Y8DC 5TDNA 4GKOA 2VC2H 3LZFL 1I1FB 2PNDA 5JOPD 5KSBE 1K2DB 3PQYB 1T3FB 2EXYC 4LCWA 3KYNA 2GI7A 2CGRL 4HPYL 4YZFF 1NSNL 1ZE3C 4JQXA 3TT3H 1DVFC 3CLFL 2VDQL 4I5BB 3HZMA 2AJVL 2UVFA 5B39B 2VLME 4P4RA 4RCAA 4QRTB 3V6FA 4PJ7B 2EH7L 2H1PL 4DGVL 3KYKL 4YXHL 4L9LC 4A6YH 1RZ8A 1ZWIB 4LSDA 4APQA 3KXFE 4E5XB 1WAAF 2APFA 3V6OA 1I1YB 1HKLH 2PXYA 4KQ3H 3MRKA 2DL2A 5DD3L 1TQBB 5E6IA 1M71A 4K8RC 3DVNA 3S35H 3WKML 3VFRB 1NEZG 2VZ1A 3LAFA 3V8OA 1G7QA 1VFUA 1CGSH 3VXRD 4UV7H 5ECJE 3REWB 5C0FA 2KUTA 3BEWA 3MGTA 3MRJA 1M7IA 2IGFL 3HAEB 1Q0YH 4NQEA 1OD7A 2WZPD 4MQXD 1FZMB 2B4CC 2NX5A 3S37H 3OJDB 1F4WL 5DJ0A 2Y36H 4Y16C 3MV7E 4Q9QH 1XFPA 2EZ0C 3KR3H 4XCFL 2XWTA 1OM3L 1AXIB 2F19L 4JPVH 4N8VA 4XNZB 3UAJC 1DSFL 3Q0HA 1CXIA 4R7DB 3CSPA 3MLPA 4R0LA 3MR9B 4ZQKB 4V1DA 3P4NA 1OGAD 3O2VL 3Q3GA 2EKJA 1TVHA 3WLWC 1BZ9A 4B0MM 2H26B 5GGTL 5ICYB 5K9JH 3LHPL 2CLVB 2R1WA 3DRTA 1INQA 2AV1A 5E2WH 4PP1C 2I9TA 3VWKD 4XMPH 4P2OD 4NNXA 2YR3A 2D7OA 4LU5L 3MA9L 2DWDA 1GYAA 3EO1B 5DEZA 3BGAA 5HGDB 5E8DL 3BH9B 2GJ6E 3DROA 3BRFA 4W6WB 4I18C 1CLYL 1CFVL 2XV6B 4MNQD 1S7SB 1KPVA 3KLDA 3DMMB 4G7VH 2R69L 4JPWL 4QXWA 1DN0B 4S10A 3LVEA 1BQLL 4KI5E 3RQ3A 1HHJA 1P1ZA 3DLQR 2C3XA 4MQSB 5GXBB 3WXWL 1X5KA 4JFDA 4Y88A 1LK2A 2R9HD 4R3SB 4JFZH 3TFKD 4ETQA 1A1NB 2JE8A 4CN6A 3AS2A 3G5ZB 4N9GA 1IC4L 4JM2D 5JOFA 4P9HH 2WV3A 3VH8B 4KKCD 5DHYB 3LEYL 4WRLA 2P48B 3HC0A 2DN7A 4NRZB 3U4EB 4DZBB 1Q9WB 4PJAE 2VDRL 4LLUA 3VXUD 3L3KA 5IVXB 2ZP0T 1RURL 1SM3L 4JN1H 2RQ8A 2GSGB 2V2TB 1Z3GH 1K8IB 3MRIA 4PJIB 2J8UF 3O0RL 2APXA 3O4LB 4Q9CA 4WWKD 3MRQA 4Z7WE 5L8JB 3QSKB 1MLBB 1FIGH 1QKZH 4HJJH 3KPQB 4V2CB 4BZYA 1EO7A 2ICWA 2FATH 4P0DA 1A7OL 1NAMH 1QSFA 4BUHA 3MRDA 4DAGL 1T0MA 1RY7B 5DA4A 1IAOB 4HUKB 4MVBD 5GRZA 4EIGB 2D2OA 2H32A 5FCUH 2X4SB 4BZ2H 4OLXL 2BX5A 1EAPB 5HHOE 1HE7A 2NQCA 3PGCB 4XI5D 3D48R 3SGEH 4X6BB 4FQXB 1M1SA 3VFSA 1TJHH 1MFAL 4MD5B 4NBZB 4EEEA 1AIFB 5DVLA 1IT9L 1ZHNB 1IGML 1RSFA 1FBIL 1FYTB 1ZEAL 2UVEA 1NBQA 2G5BA 4M9PA 1X4YA 5I1HH 3C8DA 4NJAL 4GLRI 3KPRB 3WHXB 2JK5B 4YDKH 4Q58C 1EUTA 5FK9B 1FH5H 4DUVA 1NGWA 3N9GL 3OAUL 1N6VA 1Q72H 1JVKA 4CKVX 1DBJH 1JWMB 4NQED 1N3NB 2J6EL 3T2OA 2CR3A 4OCMC 2NX5D 1EJOL 3PHOA 2HLFD 4FQHB 5DXWA 4HCRA 3FO1A 1RI8A 1FAIL 3OKOB 2A74A 5EUOA 3PV6B 5DDHB 2N7AA 1A6WH 3KJ6L 3ARDC 4KH2A 5D7IF 3WO4B 3K4ZA 3I02B 2EYTA 2K1MA 5H37G 1S8DB 4JPKL 2FO4A 3FO0L 3SDAC 4M9OA 1EEZA 3SDYH 2EDTA 1ZTXL 2IADB 2XY1A 5EIQA 3NFSH 1KELH 3UPRA 5I1IL 5F6HI 1AD0B 4CJ0A 5I6XB 4JQVC 4L8CA 1TVBB 1FFPB 1EZVY 1J1XL 4OGYL 4K9EC 1HQ4A 2BHYA 1AGDA 5A2FA 3M17B 1GAFL 3T09A 4Z77B 5D7KE 4OBSA 4WENB 5EBMB 4NZUL 2XRAH 4GG8A 3WL9A 4JRWA 3BPLB 5C9KA 1R5VA 4RMSA 4HHAB 2FGWH 1G7LA 5HDBF 4YFLF 4TTGA 1FYHB 4Q7DA 4OFDA 4I9WD 8FABB 2QQKL 4HS6A 4BQ9A 1PZ5B 3BN9C 4GBXD 4LVNB 4X4XA 4BK4A 4FS0A 3BZ4A 4XXDB 1LE5A 4WO4D 3SGDI 1CZ8L 1KEGH 2Y5TB 2QHRL 1MIEL 3RNKA 2BOBB 4X6DA 4UB0L 3MUJA 4HWEH 4M48H 1KLUA 2HRPL 3QPQC 4KMQA 4ORGB 5I18H 4H0HB 4PRPD 5DD1H 1Q0XL 1XIWD 4DOHB 4PGCA 3PDGA 1FC1A 2JIXA 1DN2A 1SJEA 2BHUA 4TNVK 3F58L 5D70L 3F7QA 4P9MH 1K5NB 1P7QA 5I2IB 3IETA 3OX8A 2BVTA 3P73B 2X4OA 4J1UA 5T1DL 1MEXL 3U7YH 5JXEC 1NGQH 3MJ6A 3S5LA 1CVRA 3ZYIA 4HS3A 4P23D 3OXSB 1QLEL 4Q2ZB 3PWUA 2YN3A 4GMSL 1DQQB 1QRKA 8CGTA 2A77L 1UJ3C 4FOMA 1T83C 5ITBL 1FVCA 4JB9H 5HHVH 2WP3O 5FEBA 1JGEA 4HSQA 4M8QB 4Z9KB 1HHHA 2CXKA 4LHUB 4H20H 1G0XA 5LXGH 1QSEB 4QWWD 1HIML 5JW4N 3CCHB 1QFOA 1IAII 4JLRB 3P11L 2O93L 2QSTA 4OFKA 3GBLA 4DGIL 5D9SA 1OQOA 1CL7H 3E8UH 3TH4T 3RAJH 1T1WA 1W72L 1H3XA 5MEPA 3QA3A 4LCCC 3GSVB 4M6AA 4QXTA 3SKNB 1N59A 3MRFB 5CCKL 3S8WA 4GAYB 1EERB 1QBML 4I0PC 4GG6E 3AY4A 4N68A 6FABL 1I8MB 2XN9A 2A9ML 3RHWF 3O8XB 5CHNA 4R8WL 4MDIB 3SJVB 4DKFH 1YMME 3UROR 2EECA 4V2BA 4K94L 1CG9A 2JCCB 3S88H 3FTGA 1UKQA 5DK2A 4K7FB 4HMDA 2FJHA 1NUFA 2A38A 4G7YL 3SO3C 3MLUL 4QHNA 3PWPB 4P59H 4PJDE 2IAMC 1VHPA 3ZDXE 3QIUC 1FSKC 1JUFB 3S3SA 2AI0L 2OK0L 3UYRL 3BPCA 2D7PA 1CTOA 3DUSB 5KN5B 2WBJD 4EOWH 1H8NA 3AREC 4OTXH 4KJQD 3KHOA 4TVSa 1HCFX 2GTWB 4IOFC 3TN0A 1L9NA 1DUZA 4XMKL 3LN5A 4EDXA 3ARBA 1T0NB 3M45A 3TBTA 5TDPA 4CN1A 3HR5A 3MRRA 4KZEL 1U8QA 2Y1VA 4GJTB 2BOCA 3IS1X 2DBLL 4FG6C 1G1YA 1DANT 3MLWL 4ZUVB 1SY6L 3CSYB 3O6FC 3WN5B 1H5BA 4HIJA 1ZGLM 3KYAA 3UBXG 4DKEL 3DGCR 1ZLUH 1WAAE 3HRZB 4MSWB 1FVDB 4PB0H 4R90H 4HUNB 2QLVB 2FNBA 4LSVH 3CFJA 5DT1H 4F7CB 4M7KL 3ZL4L 4TYUA 2VDLL 4WW2C 2VLKE 3G6JF 4M5ZH 2Y25A 1V3KA 1OAZL 2H3NA 5MENB 4LVHC 3JTTA 5T1KB 1KIPB 4OM0L 4MA8L 4OCYH 2UWEF 2FEEL 3P3YA 3G9VA 1DBAH 1YPZF 4ZUWB 1DEDA 5TF1H 3BSZH 3TF7C 4OGXL 4QHLB 1QRNE 3SQOL 4XNYH 3NACL 3ALWA 5EO1B 2HTLC 5ICZB 5IM7A 4WUUA 2HKFL 3LS5H 3U0TA 3I9GL 4Y5VB 3UTSA 1D5BB 3QDMD 5GSVB 3UO1L 3QDJB 3JWDL 5CZXC 4X98A 4ODSL 5F7EH 1CICD 2DIJA 5HVHC 1I1AB 1T7VA 1A8JH 3TO4A 5IQ7L 2X7LB 1CE6B 3ARFA 4G42A 3K4AA 4WI9A 4QF1A 1A1OA 4UT9L 2FO1A 1MJJB 2HFGL 4WW1B 4XC3H 3NMEA 1FRGH 5K9QG 4JCLA 3H42H 3RU8H 4N8VG 4JFQA 5EO0A 4L8BB 1GVIA 2BP3A 3EYUH 3MUGA 1MCBA 1D3CA 3C8HA 3L9RA 1YEHH 5D1ZB 2F58H 4ZS6D 1LO0H 2X4TA 1IAIL 4YHIA 1MSPA 3A0OA 1AI1L 2YBRA 2XN9D 2P5EA 5FYKD 4ZFFB 4N9OB 3O9WC 2X9XA 5E8EB 4LGRB 5F9JA 4X5XB 1G84A 1GGIH 3U30C 4LK4A 1JNLH 1KOAA 4E0RA 1ZGLB 4PRNA 3GSNH 1A6VH 5MHSE 1R3KA 1U8JA 5BO1H 3F8UB 3GI9H 4IEFB 2R56L 5KBNC 3OKMA 4IRSD 4X0KB 4MXWL 2A0LC 3FZUD 5TQ2L 3L6FB 3RUGA 2AS5M 5C3TA 1NGZB 3AGVA 5D7JA 2UYLB 1ZT7B 5C8JB 5MEOB 1TJIH 5DJAA 2R1XB 2VZVA 4N0YH 5EU7C 2A6DA 1F11B 2F5AL 2YEZB 4ISVB 1CFNA 2E27L 1A7BA 5F89A 3ARBD 1T1XB 4YQXH 3V7AE 1S9WB 2N56A 1S9XA 3FO2B 3S36X 3T77A 3ZDYF 4MA1C 4XP1H 5F1IB 4OV6F 3JXAA 2LU4A 5M94B 2AXFB 4AG4L 2XPGA 4ODVH 2D31B 3WD5L 1MH5A 1WIUA 4W81A 4J8RB 4F37F 4U7KA 1P84K 3U83A 4MWFA 4YHPB 4FQLL 1U41A 4NZTL 7CGTA 1NEZB 2ZJSL 4P5TD 4PJFA 1YEDB 4EBQL 1IARB 2BNUA 4ZUSA 2RIKA 3ARGB 4X5WA 5IIEA 5IFJA 4CMMA 2CR6A 1U0QA 3UC0H 4NQXB 2GEEA 1J0IA 3SDCC 1MCPH 3DPBA 5DEFB 5DMYA 4U0QB 1GC1L 3AFLA 1QO3B 2GCYB 2NY1B 1CU4L 3K2MC 5D7IE 1JZ2A 3D39A 5EFIA 35C8H 3BUTA 3WFDH 1NFIB 4YBLB 2EC9T 5KANI 4IDJL 3GJFA 3PHSA 4PV8A 4G8EB 3UTSD 1IQDA 4XT1C 3TT1H 1UACH 3LRSB 4O58L 3UEZA 2F54B 1C16A 1SYSA 2DWEA 2X70B 2BJMH 3NCEB 4QRUB 4YK4B 1WFNA 3RWCB 3S37X 1DVFA 4JG1L 5FGCE 5FKPB 5K33A 3MV01 1OP3H 3QJHA 3T1FA 3MV9B 4GH7B 1L0XA 5HD8D 4L9LA 3K74B 3VGAC 5E00A 1PDKA 2HN7B 1N5YL 2FLBT 4LBEA 3T0VA 3ARPA 4O2EA 3RX7A 3DX7A 1ZA6B 4L4TA 1IEHA 4S0TD 2XWJA 5ANMB 2UWEB 3VMPA 1B88A 3J8F7 4RFNC 4F3FA 1F4HA 1HOCA 2YPVL 2J4WL 1YMHB 2B5IC 4MB5A 4Q9RL 4Z7QF 4Z76A 1I7TA 2C3VB 5CD3B 1J05A 5I1CH 4D3CH 3ZE0F 4HXBH 4MLSA 3MRBA 1ZVHA 1T2JA 3UJJH 4L3AA 4Y16A 1W0VB 3QQ4A 1LVEA 1RZ7L 1WWAX 1MPAL 4JFHE 3ALPA 3KJ4B 1LILA 2ICEB 3MA7B 1T89C 4YFLI 1AKJA 4WFEE 5I66A 5JIKA 4PYGA 3IGAB 3TPUB 5K9OB 2AJZA 3QIBD 1ZSDB 5CSZA 3D3VA 2EDOA 1HHIA 3G9AB 3MOAL 4G6ML 4OF5A 5E9DB 5M95B 1RUKH 3BMVA 3BYTA 3NCJH 1EFXD 1UA6H 5E24E 1E6OL 4POYA 4NFCA 4P46C 1A7PH 1HINL 5HYSA 3GMQB 1S5IL 5BV7L 2M2DA 1XGPB 4J3UA 2FDBP 3LZFH 5EU4B 4OZFH 1RHHA 1KN2L 3BP5B 3TBSA 4I18A 3X11B 3DTXA 2UY6A 1IM3B 4I4WB 3TO2B 3IAGC 1KULA 1DBBL 1AO7D 4MCYB 3K46A 5C6TL 2CIKB 5IFHL 4HPYH 2PTUA 1NSNH 4ZAKC 5I8EB 4HKXB 1FL6A 1LP9F 3CLFH 2VDQH 5CZVL 2AJVH 1RHFA 2DKSA 4RA3A 2EH7H 2H1PH 4DGVH 3KYKH 3VRJA 1D5ZA 4TSBL 4C4KT 4YXHH 2XZQL 3ZZ1A 1KSRA 4A2MA 3EDDA 4CADB 1Q94B 5JQ6L 1ODAA 2ATPA 5ETUA 5D4QA 5C9JB 1JZ3A 4F7TB 2FB4L 2EDKA 2V7NA 4Z5RA 5TPWL 4Q9BA 1ZS8A 3S5LG 4P3DA 4PG2C 5DD3H 1RUAL 3MNVB 3PF2A 1INDL 3L3DB 3WKMH 4QRSB 4CW1A 4E41A 2XTJB 3VFTB 3T8XB 1OHQA 1WCBA 3PP3H 1ITCA 4UQ3A 2ZSVA 4NNYB 3BGMA 5I9QC 1NCTA 4JN2B 2IGFH 3D39D 4PJEE 2DTSA 2FZ3A 3ILQD 2Z92A 4KV5E 3GMPA 3IFLL 3UTTE 5MEQA 3STZA 1GOFA 3RIFF 3FN9A 4EXPX 1HILA 4XCFH 5CD5C 1OM3H 3VG0L 5ESVA 2F19H 3QUKA 3IFOB 5C0CE 1DSFH 1HSBA 5IMMB 4NGHL 5H2BB 3O2VH 2ICCA 5FYJL 5F7LB 2IPTL 1A6TB 5D1QB 3RGVD 5GGTH 2ADIB 2NZ9C 2HTKC 3LHPH 4NM4L 4HX1B 3K0WA 4XRCB 1YEKL 2JJVA 5GGSA 2R4RL 3JSSA 5DR5L 3B2VL 1RK0B 2FH6A 4PP2B 4C56D 3MA9H 3OQ3B 5T1LA 4AIXA 3K1KC 4L4TD 4P2QD 2A73B 5E8DH 5C86A 1CLYH 1RIUL 4WFGD 1CFVH 1PSKL 1KXTB 4HGKC 3CH8A 2CUHA 5FF6A 4ODHL 3BP4A 1JHLL 2R69H 2BSTB 4JPWH 5HVWA 1BLNB 5DHXB 3T4YB 4G8GE 4JFYA 4HKJB 1KEML 1BQLH 5ISZA 5K93A 4Q97A 2KZ1B 1M6OA 4NKIL 3WXWH 3HZKA 3HE6C 3WFBL 4QTIH 5EH1A 5D96C 5DFVC 5HHNA 2W91A 1IGCH 4Y1AD 1WF5A 2ADGB 2W0FB 3ARDA 3LEYH 4JAMA 1YPZE 1U8LA 5F3BB 3X14A 2EYRB 3SDAA 2RHEA 1I3VA 2NY4B 2FYYB 3HTLX 2BNRB 3HHRB 3UMTA 1UGNA 3VFUB 1RURH 1SM3H 3GBML 3EJYC 4LPVA 5J12C 1IFHL 4JO3L 3V5HA 3O0RH 4JQVA 3AM8C 1T66C 4PP1D 4BUGA 1RD6A 3P9WB 1C12A 3QH3A 4MMZC 2CKBB 5KSBB 1MHCA 2EYSA 4WVRA 1A7OH 5F3HA 2C1PB 1KCLA 4DAGH 2WUBL 2VITB 1CR9L 2AEWA 3WS6C 3DX9A 3IDGA 2Q87A 4ZUTA 4OLXH 5BS0E 4IMKC 4XPBL 2HG5B 3GIVB 4FZ8L 5DK0B 4YIQA 5HI5C 1I9JL 4P2RE 4POZD 1OAYL 4H1LH 3CC5A 3FL7A 3SBWC 1XGQA 1ADQA 5L8KB 5IP4A 5I1LA 1MFAH 2ESVA 5C71A 3O2DA 3ARXA 5CKGA 4QHKI 1IT9H 2NXYB 5DJ6B 1CFTB 1FBIH 3DYMA 3DX6B 4NJAH 1U95B 5CGMA 3GMMB 1MY5A 1W0WB 4MQTB 4N1HB 2YD6A 4LMQE 1B0WA 5JR1L 1D5IL 1P7KA 2ED7A 3LPFA 4Y19A 5E95B 1X4XA 3N9GH 3OAUH 5DJZA 3K3QA 1FNGB 3F7YB 2AQ3A 1AP2B 3VGDA 1BIIA 4LDEB 3H9YA 1AQDA 2J6EH 4JDTL 1EJOH 5F9AC 3GKWL 1J88A 1FAIH 5E6ZA 5JXEA 5F72S 4HIEB 1FHGA 1GZPB 3KJ6H 2IQ9L 1S7UA 1Z5LA 2PW1B 4U49A 4DFHA 4CGTA 5JLZB 4OLZL 4AT6A 4BKLB 5L2KE 3SOBL 5C1MB 1NC4D 2NY0C 1C08A 3KYMB 4JPKH 3FO0H 1CGWA 4XGZA 5CEZE 5IR1B 1B4JL 1UJ3A 4LSQL 5FA4B 2QKIA 1T83A 2AV7A 5I8CA 4LMQI 1MOEA 1XGRB 5I1IH 3LD8B 2ZPKL 3LKOB 4MA7L 2N1KA 5F1NB 4JO2L 4WGVB 5GZOD 4L8SB 3EJZD 1J1XH 3DRQA 3PL6D 4OGYH 3VGEA 1FC2D 2GJ6B 2OL3A 3RL1A 1GAFH 4YO0A 1ITBB 1MCKA 3F5WA 4XCYB 3D2UA 3UBXB 4NZUH 5ESAB 4PJCA 5C07E 4RMRA 5IFAL 3HI6L 4LCCA 5CGYD 3W2DH 2KKQA 5TDNB 4I0PA 2DQEL 5B38G 3NPZB 1CXLA 2QQKH 4GKNB 5EUOF 5GS2H 5HYIA 5IEHA 1MJ7L 3F6IA 2Q8AL 5ID1A 3KYNB 1CZ8H 2PTVA 2NY2B 5DJYA 1RVFL 4M7JL 3K2UL 2PO6C 4OT1L 4PBWD 5HHMD 5TH2A 2QHRH 1MIEH 3VGHA 5DHVA 2JB5L 2X4PA 5JTWA 4UB0H 4PRDA 4PJAB 2MOVA 2GK0B 2HRPH 1QOKA 2AKRA 1R5WB 2IAMA 3LQAL 3QIUA 1RZ8B 4QRQA 4MAYC 4APQB 4IJ3C 1Q0XH 1JTOA 4Z7WB 4R97C 1ZHLB 1X5IA 5HHQA 3MRKB 3F58H 1QLRB 5D70H 5DD6A 5AYUL 2P46B 2W65A 1MREH 5E6IB 5TE7L 3DVNB 3IDNA 3QXAB 3OR6B 5T1DH 1G7QB 5DRXA 1EHAA 3QEUA 2UV3A 4YAQA 4G6AC 4XBPA 3BEWB 3MGTB 3MRJB 1OSZA 4NJ9L 1C5BL 1M7IB 1QLEH 1Z9SA 4BQ6A 4GMSH 4MJIA 1J1OL 3O6FA 5DVMA 3P77B 3MLVL 5DJ0B 1CD1A 1UM5L 3LEVL 4LGSB 4UI2A 3H6JA 3BDBA 5ITBH 2X1PA 4YC2C 2WWKT 3RKDC 4N8VB 4NWUL 3QDGA 5D7LE 3QWQB 3WNKA 3VXRE 4X6DF 2HJFA 1HIMH 2XFXB 2ARWA 4OFYA 2NR6D 5E8PA 2ZSWA 3P4NB 1TITA 3Q3GB 3P11H 1TVHB 4WW2A 4DGIH 4CL7A 2P43B 2YKLL 2W9DL 1YNLL 3GFUA 1AGCA 5DGQA 2R1WB 3DRTB 4XPGL 1W72H 1INQB 4K3EL 1KB5L 1JNHA 4X83A 5CCKH 2DWDB 1QBMH 3MX0A 3QWRA 6FABH 2A9MH 4NQDD 3DROB 1OP3K 4R8WH 1CDGA 4JANA 1OGAE 4TVPE 4GLRH 5EWIL 1MFEH 4PRIE 1CBVL 4K94H 4D9LL 3GIZH 3MJGX 4XNXL 1DDHB 2E9BA 3O3EB 3U2SA 1YYML 3UCRA 1HHJB 1P1ZB 2QSQA 4G7YH 5AZ2L 5F7HA 4BSWB 4JFDB 3MLUH 1IAKB 4ETQB 3SDDD 1DQTA 2OK0H 2AI0H 4Z7VE 5JOFB 4OQTL 4MNQE 1QSZA 3SCMC 2AXHA 3FMGH 1F3RB 4HGWB 3CDCA 1LEKA 2FSEA 3HC0B 4XMKH 4XWOC 1AHWC 4PR5B 1EGJA 1JHTA 3I2CL 3I84A 1LP9E 3L3KB 3D2UD 3NABL 4OZGA 5JHDD 4K7PX 4KZEH 1MCHA 1WZKA 3EKCA 5L6YL 1QVOA 2DBLH 1BX2A 3MLWH 1G6RL 1SY6H 1KPUA 1ZXQA 2ICWB 4Y2DC 4DGYL 3O9WA 2AK4A 3OAYK 5DJXB 2JLLA 4NQCD 2LU3A 3IKCA 1J0KA 1QR1A 2HJKA 2R2HB 4M7KH 2Q8BH 2W0PA 4LDOB 3ZL4H 2VDLH 4M3KB 3QAZC 3PG2A 2EXWD 3MRHA 4PGZA 3B5TA 1OAZH 3VW3L 4HT1L 5CEZL 1LO2L 4L4JA 3HS0A 1YECL 4MA8H 5BJTA 3VFSB 5KSVA 3T0AA 5GS0L 3IXAA 1TPXB 1ZVSA 3ARED 3SQOH 1E4XI 3DGGA 1J5OL 1HYSC 3NACH 2CRZA 2DKUA 1NH6A 4ZODA 4NO0D 3VI3F 2QSCL 1OTUD 3BRGC 5CMAB 3L3GA 3TIEB 2HKFH 1NFDA 4NKOA 1NGWB 3I9GH 3STLA 4PLNC 4WDIA 1BOGB 4ONFL 3UYOD 3UO1H 3RX8A 5DA0B 2Q7YA 3HZYA 3MLTA 1EO8L 1KTLA 4TNVF 3QCUL 1G9ML 4ODSH 3PHOB 1FL3A 2XOTA 1KT2A 2DI8A 1S9KC 4YNYA 2A74B 3TA3B 5LKNA 1TNNA 1G9NC 5CUSL 1MUJA 4UT9H 2EYTB 4LAQL 2HFGH 2FO4B 4OKVA 1KXQE 2BVQA 2NYYD 4KU1A 3I85A 2J7LA 3GHEL 3UPRB 1FGVL 4GW5A 1BVLA 4L8CB 3IJYA 3SDCA 3GO1L 4BFBD 2V2XA 1IGIL 3MMEA 1AGDB 4HUVA 3BJLA 1IAIH 1AI1H 3LY6A 1KTKE 1UZ6F 3UZQA 4UIKL 4M3JA 1YDPA 4GG8B 3WL9B 5GGRY 1K9TA 3GHBL 1R5VB 2HTLD 1CVSC 1JZ5A 3SE8L 1FG9C 5BRZA 5TFSL 5F8QC 2R56H 1DJSA 4HS6B 1KJ2B 3CDGA 4MXWH 1NC2A 5TQ2H 2KBGA 1I1RA 3QXDA 4GQ9L 1IGTA 3T2NL 2GJZA 1FO0L 3B4NA 4GFTB 1IMHC 5I0ZA 5ICXB 3RNKB 3WJLC 3J7HA 4TSAL 3ZKQD 1AQKL 2F5AH 4GAJL 5BCAA 4PTTA 1S78D 2E27H 3FOLA 5D2NE 4I9WE 5F9WC 3MUZ1 1WSST 3BXNA 3RX5A 2NY3D 4QOKD 2JIXB 3S3PA 1SJEB 1SBBA 5E08L 4AG4H 1T80A 3WD5H 3T4AB 4ZYKA 5I6XC 4X5LA 3OX8B 3FQRA 3BGFB 4XPAL 2X4OB 4J1UB 4KTEL 5D1XD 5AG8A 3S5LB 1VACB 4N8PA 3FQTA 4ZD3L 4HS3B 3P4MA 4PRPE 4FQLH 5GGUA 3RWHA 3PWUB 1FV1A 1NPUA 4NZTH 4KK9C 2ZJSH 4KZDL 3BPLC 4EBQH 2VLKB 4PJ5E 3B2UC 3RUGF 3QI9B 3MO1A 4F8QA 5JMOC 3FT4A 3NCBB 5EIVA 3IKKA 1WLHA 4EQ3A 1NCCL 3ZLQC 1T89A 3ISWA 1CDUA 3MLZL 1HHHB 4ENEC 5C7XL 1QRNB 4DEPB 3LH2L 1GC1H 4YEEA 1OP5H 4HLZH 5IB4A 3C6SB 3MJ9A 1E4JA 2B1HL 4JFPA 4P46A 1CU4H 5L7XL 1MCNA 4ZO9A 3FFCA 3IDMA 1T1WB 3VFVA 3QA3B 3D0LA 2Y5EA 4IDJH 1N59B 1CD9B 3BZDA 5DMIL 4O58H 2LQRA 4XB8A 5SX4I 1U9KA 5C0NC 1E4XL 1EK3A 1U42A 1V3MA 4ZAKA 3FB8A 3KNBA 4JG1H 1MRDL 3IT8D 1CG9B 2CJUL 4J3VA 3LN4A 3FTGB 4JZJB 3BZFA 5J1TC 3D25A 5DK2B 4PJFF 3C2AL 3RY4A 4F33A 2FJHB 2RAMA 3RP1A 1CDIA 1NMCC 4PJ8C 2YRPA 4MHHG 4WI5A 5E6YA 1N5YH 1CGYA 3LDBB 5HYFA 3F6LA 1CXEA 2CIIA 2RCSL 3KLSA 4U1NB 4PRHD 4PG2A 1CYGA 3QG7L 3O11A 3Q6FA 2IBZY 4U1MB 4AZ8A 1X5XA 1K3IA 3ARRA 1OTTD 4O51B 3TN0B 2C26A 2YPVH 3B3IA 4EDXB 2J4WH 5MI0B 2GSIA 3KVQA 5DO2C 4Q9RH 2D0GA 3TBTB 1F8TL 4M7LH 3IJSA 3ZE2E 4MS8C 4M1GL 3MRRB 1LE9A 3MACL 3PGDA 2BOCB 1F02I 3BQUD 4YR6A 1U92A 1H5BB 4HIJB 4U1GB 1RZ7H 4YDIL 1MPAH 5C0DA 4BSJA 3BIAX 5T3XD 2CMRL 4ERSL 3VG9C 3HPLB 3O8XC 1FLRL 1TTGA 3CFJB 2EDJA 4MDJB 2ADFL 4IRZL 3MOAH 4G6MH 3OHXA 5D6CA 4FABL 5ID0A 2Y6SC 3D1MC 1E6OH 3HLAA 3QUZD 1HINH 2H3NB 2QR0B 1S5IH 5BV7H 4PRAB 1K4DA 1KN2H 5T3ZD 4RAHA 3WHE1 2VDNL 5C6TH 5IFHH 5EU3B 4LVEA 1NBZA 5CBAA 3EOTL 3GMLA 4ETYA 5AAWA 2N7BA 5CLWA 3B9KC 5CZVH 1FJ1A 4WUUB 1WWCA 3RVWD 1A3QA 3V4PL 4WNQA 3HE6A 4TSBH 3V4VL 3DV6A 2MFNA 2OCFD 5EZOL 4DVRH 4OJFL 2MWCA 4X98B 5JQ6H 3M1BB 2OLDA 2PCPA 2FB4H 5TPWH 2IMNA 2HT4C 3WN5C 1ORQB 1RUAH 2H8PA 3JUZA 5CILL 1INDH 3ARFB 3X3FL 4KROB 4EN3C 4M1CC 1HXMA 4ZNEA 4QF1B 1A1OB 4U3CA 3QDME 1CDYA 3LKQA 1DQML 2WSKA 4KK5C 1KNOA 3MCG1 1BGXL 4P46D 3AM8A 5D2LF 3MUGB 3P0YL 1HN1A 3IFLH 3L9RB 1X5JA 3H2WA 5JZ7C 4LPXA 3VG0H 4YHIB 3ZKND 3WS6A 2BFVL 3I6GB 2P5EB 2C1OA 4JFXA 1J0YA 1WGOA 1IE5A 5C0AA 4G6JL 5F9JB 1RU9L 2YUVA 4L3EA 3QQ9C 5FYJH 4IMKA 4PRNB 2IPTH 5EBLA 2CDFA 1WEJH 1T03L 1R3KB 1U8JB 3HZVB 4ZSOE 4NM4H 2YD7A 4Z78A 3SBWA 3NFPA 2Q86B 4YHOL 2VXTH 1YEKH 3OSKA 5CSBA 3OKMB 4Y5VC 2R4RH 4MAUL 5EO9A 3B2VH 3RUGB 5EU6D 3F7VA 4RZCB 3RFZC 1VCAA 1XEDA 3WDIA 5D7JB 3ZKSD 3IVKB 1HH6A 5B38B 5FDWA 4J4PC 4JKMA 1RIUH 4PY7A 1U3ZA 5DJAB 1I1AC 1PG7L 4ODHH 2O26U 2EDFA 1JHLH 1CFNB 3DWTA 3N50A 2IALA 1IEBA 3M07A 5F89B 5HYJD 3KPLA 4NUGL 2DYPB 4ZMAT 1KEMH 1AJ7H 1RJYA 5DVOA 1N2RA 3OKKA 4I0CC 4TUJA 5IB2A 1QLFA 2SEBA 1QD0A 2JJSC 4NKIH 3VWJD 1NCWL 1N6UA 4HMCA 3PWJA 3WFBH 4PTUB 3BVNB 4R4NC 3ZMRA 2VAJA 4JFED 2XPGB 3LQZA 2NY6B 5CD5D 4OZIE 5D1ZC 3VD9A 1YNTA 4P4KB 2VLJA 1HNGA 4X7TA 4YHYB 5EBWB 3INUL 4WU7A 5HI3D 4Z7UE 3QCVL 5ALBL 1BFVL 4HLJA 2EH8L 2YD3A 2G75A 3L7EB 3VD3A 3GBMH 1S7TB 1BZ7A 2BNUB 2QHLA 1IFHH 4JO3H 2AEPL 5IFJB 4EJ1C 4KRNA 5IHZB 5LQBL 4FMKA 4CMMB 2OTWA 4W70A 4OV5A 2CRYA 3BD3A 5GGVH 2OQJA 4OD3L 3T2PA 3LKNA 3OF6A 4PJ9D 4HCRL 1YYLL 2WUBH 3EYSL 3RZCD 1EHXA 3MRMB 4AK1A 1FN4A 2DIAA 4WTZG 1BIHA 5EFIB 5DD5L 3BO8A 5BZWA 4XPBH 5I16A 3GJFB 4FZ8H 1I9JH 4PV8B 4ODXA 1OAYH 4NIKB 1IQDB 2F5BH 4WHTA 2YZ8A 3QEQA 4J6RL 3VXSD 1C16B 2DWEB 4X4ZA 4P48A 5D5ME 2DLHA 3RIAK 2PO6A 1DVFB 3O6LL 3QJHB 3T1FB 1E28A 1ROWA 2NTSP 32C2A 2PUQT 5JR1H 2A6IB 1DBKL 3RPIA 5EOQL 4MAYA 4QRPA 3F7PC 2WINB 3DX7B 1NDMA 1JN6B 4N1EA 3RTQC 2DQDL 4GMTL 4ELME 2XWJB 5TF0A 2CSPA 4JDTH 3BKML 2FHBA 3ARGC 3GKWH 3V6BR 1HOCB 2EICA 4MCZB 3BKYL 2IQ9H 1SJHA 2BZDA 4OLZH 3K8KA 1IKNC 3SOBH 2DM2A 5CBEA 5F1OB 5L8LB 3MRBB 4CUCA 5CEYA 4Y16B 4PJHA 1B4JH 2AK1L 4LSQH 4NUJA 3KAAA 3QQ4B 4YBLC 5EG6C 5CJQL 2ZPKH 1BEYL 4MA7H 3L5HA 4JO2H 5C3LD 1I1FA 1K2DA 2QJDA 4KRLB 3VU2A 5EC2B 1AKJB 4YK4C 2AJZB 3EYQC 3D3VB 1HHIB 4QCIB 4I5BA 5E2UH 5IFAH 4QRTA 1MRFL 2XXMB 3KPSD 1T20A 4PJ7A 5KAQG 3MV8A 5DMGD 4JHAL 1UC6A 2DQEH 1VDGA 4EI5C 4ZPVB 4AQ1B 1ZWIA 1KIUA 5KSUB 1RHHB 4JY4A 1HWHB 2P47B 4HW6A 3DTXB 1I1YA 5GS2D 1MJ7H 3OL2A 3KPTA 2Q8AH 1MWAB 2NW2B 1NMBL 3EYOA 1RVFH 4M7JH 3K2UH 1UXSB 1FL6B 4OT1H 3S6CA 3N85L 2JB5H 4CBPA 3TBVB 3H9SA 3KWWA 5DMKB 3VRJB 4FN0A 1D5ZB 2DBJA 2XZAL 4OFVA 3LQAH 3HAEA 3ES6A 5IJKC 4F2MA 1W0YT 1MFDL 2AGJL 2ATPB 4QGTA 2H41A 2NW3A 3SCMA 1HK6A 4JY6A 1IKFL 1AO7E 2V7NB 5GISL 4Z5RB 4P3DB 2VQUA 3WXVL 5AYUH 4JDZB 3X13A 2ZUTA 3CVIL 5TE7H 4E41B 3NBNA 5FYKL 1AHWA 2GKIA 1F3DH 4HWBA 3HE7D 3BJ91 4OI9A 1WCBB 4UQ3B 4MXVF 1EZVX 2P5WD 2DMKA 1EEYA 3A6BL 4NJ9H 3GSOB 2H26A 1C5BH 2X44D 4ZDHA 2WNGA 2CLVA 1J1OH 5HGHA 2FZ3B 1B2WL 4ONOA 3RBSA 3MLVH 4P2RB 5MEQB 3STZB 3T0EC 1UM5H 4OUOA 3LEVH 3EDFA 4Y2DA 3HR6A 5ESVB 4Q0XL 3QUKB 2FJFA 4NWUH 5SWZD 5DC0A 1BBDL 4RGNC 1DEEA 4KKLC 1S7SA 3RPKA 3IU3A 5J89A 2W9DH 1YNLH 4LQFL 5EIIA 2J1KA 4XPGH 2B7DT 4ZO7A 4Y7MA 3DIFA 4K3EH 4XVTL 1KB5H 1IC5L 3LKRB 2DJUA 1XF4B 4N0CD 4JVPA 3G5ZA 5L2JA 3C9NA 3VH8A 5E03A 3BPNB 5EWIH 2F8XC 5FF6B 3B43A 3KLAA 1CBVH 4GAFB 2I26N 4NRZA 3U4EA 2XQBL 4DZBA 1Q9WA 5FYKU 4D9LH 4G6AD 1I7RA 4XNXH 3ECBA 4PLKC 1YJDL 4TTDC 1YYMH 4HUWB 2DLEA 5AZ2H 2V2TA 4C56E 3HZKB 2NXZC 3O4LA 4P2QE 1HDMA 4MZ3A 5HHNB 4YHZL 1R3IL 3AS1A 4OQTH 1CGXA 5FUOL 9CGTA 3D9AL 3ARDB 3HC3L 2E6QA 2VXQL 3AC0A 4WW2F 1PEZA 3X14B 5J9PA 5IB1A 3PQYD 3SDAB 4RFOH 3U46B 3I2CH 3BWUC 3NABH 2CO6B 3KDMA 4OF8A 4ODBD 4QHMA 5IB5A 1S9YB 4I2XA 3V5HB 3THML 5L6YH 4Y1AE 5CJOL 1G6RH 4H26A 1F90H 5L0QC 3NH7L 1I8KA 1MHCB 1NLDL 2EYSB 3CAFA 1F00I 2ZG1A 5FOJA 4MD5A 4DGYH 1HQRB 4ELKA 1FNFA 1AIFA 5F3HB 3QRGH 1FYTA 5BXFA 3DX9B 3KPRA 1F4XL 2JK5A 3IDGB 1NJ9A 1V7ML 3GSUA 1Q8MA 4D0DA 5FK9A 1II4E 1KTDB 3IDXL 3VW3H 4HT1H 1PQZB 3CC5B 1ETZA 1LO2H 4N5EC 5CEZH 5D2LE 2AJUL 5EOTA 1YECH 1N3NA 2E8ZA 4L9DA 5FHAH 1A21A 2ESVB 5GS0H 1XT5A 3AS0A 1G7HA 1D7FA 3OKOA 5ADPL 4B7IA 1A7RL 3UTZA 3WJLA 3PV6A 1J5OH 4L4VD 5DDHA 2O61A 4OZGF 5SV3A 1YC8A 1T1ZA 2QSCH 1G0DA 1IZKA 1S8DA 4OIAA 2DL9A 5DJZB 3LS4L 4LARL 2NY4C 4ONFH 5B4MD 2FEDC 5F9DC 5FM8A 1BIIB 1QUNA 4JHZA 4N0UE 4I3RL 1AQDB 1EO8H 1AD0A 4KY1H 3QCUH 1G9MH 3CVHL 1FFPA 3UZVB 5ACZB 5HYEA 5D7LB 4PGJA 3HMXA 3FN0L 3VXRB 5CUSH 1S7UB 2AQ1A 2GT9A 4HD9A 1KV3A 3VI4F 4AT6B 1NEUA 4DKAA 4UTBL 4LAQH 5IW6B 2BVPB 1BFTA 3DMMD 2YRLA 5CIPB 2AV7B 4KPHL 5I8CB 4N90D 1N7ML 3GHEH 4LPWA 1WBZA 4IOSD 3GO1H 2PETA 3AS3A 1IGIH 2W0KA 1PZ5A 3PWVA 2R4SH 4FHBD 5J56B 3UPCA 1J18A 1DL7L 3K1DA 2OL3B 3BUYB 4XXDA 3GRWL 3RL1B 3TH2T 4YO0B 4C58B 5FO9A 2ZUXA 3IFNL 4UIKH 4PRIB 1NFDF 2NXYC 4Z7OF 3GHBH 4PJCB 2VSCA 4LCCB 4XP9L 3V8CA 4KKNA 3CNKA 1AC6A 1IL1A 1WZ1H 4ORGA 5TFSH 1HXYA 2FX9L 1BVZA 3D85A 4J12A 5IEHB 3RWJA 4RBPH 5D6DC 5FA3A 3O4LD 1U93A 4GQ9H 4MNQB 4LEXL 1K5NA 3T2NH 3S35L 5I2IA 2Z8WC 1U8OA 1KJVA 4RAVA 1MVUA 5DHVB 1VPOL 2X4PB 2EE2A 3FOMA 3SO3B 4TSAH 4PJ8A 1AQKH 4GAJH 1A02N 3FONB 1XGTA 3EGSA 4OI8A 3OXSA 2IAMB 5F7FA 3QQ3A 4S1DC 4Q2ZA 1MAML 3PXHA 3QIUB 3TH3T 1FL5A 1FSKB 1DQQA 3DHJA 1LQSR 3EFDL 3O4OC 4JM2B 4KJYA 2Y36L 5GPRA 2NTFB 1FZOA 1UEYA 3KR3L 5DD6B 3VMNA 5E08H 4JPVL 5HHME 3AAZB 3H0TA 5D7SL 3IDNB 4FQXD 4XPAH 4KKAC 3O45A 5KS9A 1CK0L 4KTEH 5BOZG 5AUMB 1B0GB 2R23A 4XBPB 4ZD3H 4RAUA 2D0FA 4MJIB 4KZDH 3ARWA 1OWWA 3O6FB 1TMCB 1CD1B 1T4KA 4KI5C 4XMPL 4EXKA 4GAYA 4M6NH 4WY7L 1NCCH 1I8MA 1FNLA 3MLZH 5IG7B 1P2CB 3O8XA 5A2JH 5C7XH 2VE6A 3LH2H 1SYVB 2ZSWB 2JCCA 4YH6A 5AD0A 4WW2B 5L7XH 2VJXA 4K7FA 1AGCB 4LVHB 4OGAD 2BVOB 4HQQL 4JR9H 3RI5K 1JNHB 3PWPA 3E6HB 2E3VA 2ZCHL 3VFGL 4YHML 4KHTL 3SY0B 2YS4A 2AJSL 1E4XH 2ED9A 3DNKA 1EAJA 3B9KA 1MRDH 2CJUH 4WFFD 3O41A 3TYGL 2ADJA 4AQOA 5J1AB 3RDTB 3C2AH 4HAFA 3ROOB 4DW2L 4FRWA 5C0BA 2DLIA 2EE9A 3U2SB 1F2XK 3R1GL 3MCKA 4JN1L 4ODWA 4GXUM 1Z3GL 5IWLC 3BDXA 1FORL 1HH9A 4XBEL 3B2UD 2O5YL 1IZJA 4NQDE 5IF0B 4LASL 4UIMA 4YDVA 1AE6L 4FQIL 1FIGL 4ZUVA 2RCSH 3CSYA 5EBGA 1RV6X 3WN5A 3QUMA 3QG7H 2P7TA 3BPOC 3JWOC 4EN3A 2Y06L 4ENED 4JHBA 3HRZA 4YDLB 1LEKB 3MODL 3S96A 5B3NA 1T7YA 5GGRB 1EBPA 4Z6AT 1JHTB 3MOQA 1F8TH 4F7CA 4NHUA 3VA2C 4M1GH 5DJDB 4FTVE 3MACH 3SPVA 1OPGL 3ZKXC 1JZ6A 5IBTL 1F3DJ 1QVOB 4K3GA 3VFOB 1BX2B 3L5XL 5MENA 3QUXD 1KPUB 1PLGL 4I0KA 2CRMA 4YDIH 4M03A 3SKOB 3O9WB 2AK4B 1S7XB 4ZUWA 1J0ZA 2AW2A 2CMRH 4ERSH 4QHLA 3PP4L 3IKCB 4E42B 3NCYS 1FLRH 1VFMA 5JHDE 2MCPL 2HJKB 4MD0A 1BQUA 2ADFH 4IRZH 4OAWA 4UILL 2O5ZL 4I1NB 4FABH 4GKSA 4MX7A 5DZOA 4FZEL 4MXVE 5F1SA 3MRHB 1DR9A 1V8HA 3HI5L 4U1SA 4Y5VA 1T7ZA 5D2NB 1D5BA 1RUPL 3VFPB 3WHE0 5GSVA 1CQYA 4OCLC 2YPKB 5FUCE 2FX7L 1MI5E 5BJTB 1Z9LA 4WO4B 4OD1L 3IXAB 2W60A 4NQCE 4J4PA 1I1AA 3DXAE 2FIRT 2VDNH 1MNUL 2J8OA 4Y5YC 1CE6A 2H2SD 4LHUD 3WFZA 1QSED 3DETD 3GSWA 1BD2D 2NZIA 3L3GB 1MJJA 1NFDB 4MA1B 4NKOB 1WWBX 4WW1A 3V4PH 2JJSA 3B9EA 4OZHE 2UUDK 3V4VH 3NCYP 4PJ5B 2Q7YB 3MLTB 4IRJC 2OZ4A 4L1DA 1D5MA 5EZOH 1KTLB 3ABZA 1A5FL 3JWDC 2DQFA 2X9YA 3QEHB 1FL3B 2H2PC 4F7EB 1KT2B 5D1ZA 4YNYB 3QHTC 1GCFA 5CILH 5AAMA 3G6AA 4L8DA 4P23B 3SJVD 4CU6A 2XRAL 1FIEA 4F9PC 4OKVB 2V17L 4PFEA 1DQMH 3ZT5A 2FECI 3L3OB 2C4FT 1BGXH 2IJ0C 1D9KC 3P0YH 1CD0A 1BVLB 1ERNA 3SDCB 1C5DA 2V2XB 5FM4A 4X0KA 3MMEB 4OLUL 3WMSA 1NGZA 2BFVH 3C60C 1TPXC 2DF3A 5C8JA 1YDPB 5MEOA 4G6JH 3HG1A 2Z8VC 1RU9H 2R1XA 3OAZK 2IANE 5FYJD 1CDJA 4ISVA 1WCQA 5HSFA 4N8CL 1T03H 1S9WA 3MQIA 4UT7L 1I8IB 3WIHL 4MAUH 5F1IA 4LF3B 3CDGB 3QXDB 12E8L 2AXFA 4K9EL 1A3RL 5HDLA 1RIVL 2VWEE 2HT4D 4ZXBC 5LAXB 2GJZB 2GHWB 3DUHA 4F58H 1PG7H 4M1CD 4B7LA 3TA3C 3VGAB 3HNTL 5HI4C 4NC1E 4PTTB 5KJRL 4NUGH 3JV6A 1ZHKB 3FOLB 2H32H 5E1AA 2FJGB 4R26L 1FCGA 5EZIL 3RTQA 3CD4A 3BESR 1M7DB 1NCWH 1PKQE 3ARGA 2WBJB 4X4ME 4JB9L 3GSXB 5MEND 3O3DA 5T1KD 4ZYKB 1ADQL 4H20L 3FQRB 1IKNA 4RSVA 2LTQC 4DK3A 3VXME 3FQTB 3INUH 3P4MB 1QO3A 4S1QL 5GGUB 3QCVH 5E1HB 5ALBH 1BFVH 1FV1B 2EH8H 4XBGB 5E94A 1NFIA 4QOKE 3RAJL 1CXFA 4K3JL 1RK1B 3D18B 1OF2A 1RPQA 2AEPH 2EDNA 2JJWA 2MCG1 5LQBH 1IGYB 5FGRA 1C7SA 2VLLA 3QDJD 4NOBA 3LRSA 4XNMB 4UT6L 4YEFA 1CDBA 2J2ZA 4OD3H 1MCQA 3RWCA 4J4PD 4HCRH 1YYLH 1RFDL 2JJTC 2E7MA 3EYSH 4WGWB 4WEMB 4CDGC 3FFCB 5J6GB 3IDMB 5DD5H 4I77L 2YRZA 4EI5A 4POUB 3VXQA 3N06B 4JO4L 3WEXA 1ZA6A 4J6RH 5HVFB 2P4AB 3UPAA 5ANMA 4ZAKB 1G1CA 3FB8B 2ZUUA 2QBWA 3DI3B 4AY0A 2R8SL 3BZFB 3FFDB 2E5EA 1YMHA 2KQNA 5EC1B 4F33B 1J8KA 2BCKB 3I75B 1DBKH 5IJKA 5EOQH 1AR2A 5CZKA 4GRWF 4Y2OA 1R24A 1W0VA 2F53D 2UZXB 4HBCL 2DQDH 2HT3C 3RVVD 4GMTH 1JIBA 3NIGE 4G8FB 4NBXB 3BKMH 3QI9C 3MXWL 2ICEA 1L4IA 4S1SL 3B3IB 5FGBC 1S7QB 3A6OA 2GTZA 2GSIB 2VXUL 4UBDD 3BKYH 5FCSH 2FECL 5I9QB 3C6LD 1WK0A 4DEPC 3ULVC 1H8SA 5MERB 2DIBA 4KQ4L 3EZJB 3SKMA 1LE9B 3PGDB 2JF1A 2NNAA 1QYGL 2DLFL 2D7MA 4PRHE 2DM7A 3T0EA 2AK1H 1BQSA 4YR6B 3GMQA 1U92B 1F5WA 2A1WL 3LKSA 5CJQH 1XGPA 2IFGA 1HZHL 4X80H 5C0DB 3BP5A 3AY4C 4I4WA 3TO2A 3LB6D 4MCYA 1JPSL 3AROA 3TWCH 2B8OT 1T0PB 3JZ7A 4HKXA 3AXLA 4P5MA 3OHXB 3BH8A 3DVIA 4RDQF 5ID0B 4JRYA 3CFIC 4JZJC 1MRFH 4X7EC 3ROLA 2PTTB 2ORBL 4JHAH 4H5SB 1MJUL 4GRLC 1DP0A 1Z6JT 2YA0A 4CADA 1JYXA 1Q94A 5BQ7A 5GQBA 1FNEA 5T3XE 5F7EL 5DS8B 1VKXA 3MOBL 3QDHA 1DUYB 1CI5A 1U8PB 4OZIB 4K71B 1LMKA 1NMBH 1NBZB 3W0WA 3GMLB 4JKWA 2J88L 3DX8B 3T8XA 4NO3B 3WFHA 3N85H 4MGXA 4GS7C 2YPLD 4PJHF 4WNQB 4Z7UB 4JRXD 4NNYA 1OAQL 3HE6B 5JOEA 3MPCA 5GRWA 2XZAH 2NY1D 4FXLA 4FXGB 1VADB 1J86A 1MFDH 2R29L 4QXUL 2AGJH 3EYFB 1H3UA 2PCPB 1IKFH 5GISH 5DURB 1PG7W 1A6AA 3WXVH 2NY7L 1H5BC 1A9BB 2H8PB 3CVIH 4U1GC 5FYKH 4XP5L 3HUJE 2F54D 3I3DA 3QHZL 1NQBA 1HXMB 4XHJC 3ELAT 4X99B 3ESUF 5DQ9A 4PBXA 4PJ7F 3S9DB 2BC4A 3LKQB 1FGNL 4EDWL 3EW3B 5J12B 4KVCL 1A6TA 1ZKAA 3A6BH 5JNYA 5JW3L 5D8JL 3MV9D 2BERA 4NSKA 2YUWA 1F6LL 4O2FA 4HX1A 1B2WH 4PLJC 4PJXE 3GM8A 3FT2A 3L5JA 4HK3N 1RK0A 1RZKC 4K23L 4Q0XH 1KCVL 3LPWA 5D5MB 1BBDH 4N1CA 4JFXB 5ERWB 5C0AB 3QPXL 2X4RA 4LKXA 4ODUA 4S2SA 1GGCL 3O3BA 1XF2A 1TJGL 5EBLB 1ULVA 1BLNA 3T4YA 1EGJL 3Q5TA 4HKJA 1RZGA 3U4AA 4LQFH 3NN8A 4Z78B 3NFPB 2ITDB 1Q9OA 3OR7A 4H1LA 4XVTH 1J8HA 1IC5H 2LVEA 4S0SD 5IMKB 5EA0L 4NQSA 3RIAF 4ELMB 3RVUC 3TVMB 2R15A 5SWSD 2W0FA 1HH6B 2BNQD 2R2CA 2OJEB 2VOTA 1VSCA 4QRRA 3F12B 3DVFA 5DLML 3I6LD 4KROC 2IALB 1IEBB 2XQBH 1BBJB 5C09D 3I6KA 1RJYB 1CIDA 1YJDH 5IB2B 2MKWA 4LLYB 2SEBB 3OWEA 5E9DD 1YQ2A 5EU6E 3PWJB 1RZIB 5LGHL 4YHZH 1R3IH 4WJ5B 2CKBA 5KSBA 5FUOH 3CSBA 2OX5A 3D9AH 4JZOB 4AEEA 2BVEA 1YNTB 2VXQH 2VLJB 2C1PA 4X7TB 5HYJE 1UCTA 1JJUA 4WU7B 2DAVA 4N0FA 1QFUL 3TBYA 4W6XB 1WZLA 4NDMB 4F7MB 1E27A 1BZ7B 3E1F1 4JFEE 1N26A 3Q2CA 3THMH 1G0YR 5CJOH 2OTWB 5A2KH 3PWNA 3NH7H 4OV5B 3KXFA 4LPYA 1BFOB 2OQJB 4PGBA 4CVZB 2OI9B 3QIBB 5DJ6A 1I4FA 1FN4B 5I73B 1F4XH 2XTJD 4CVUA 4PJIF 3BO8B 4PLKD 5BZWB 5FXCH 4ODXB 2ENYA 3CMGA 3HB3D 2EEBA 4YWGL 5D6DA 3H9ZA 4WHTB 4FXKA 1AP2A 2AJUH 5ESQA 4XPTL 3CFDA 1AO7B 5KVGL 2R2BB 3MV7A 4U0RB 5JA9A 5TGBB 2VUOA 2HLAA 1P5VA 2OSLB 3TYFA 5ADPH 1A7RH 4EVNA 2X4NA 4HIEA 1MCCA 3CPLA 5E4EB 1E28B 2PW1A 4ZPTA 5BW7C 2GUOA 4P4KC 3RPIB 4YHYC 4PS4L 4MAYB 3KYMA 4IJ3B 3E3QE 2ICWJ 2YD4A 1OARL 3LS4H 4LARH 4QRPB 3TJHD 1QQDA 3VXSE 5IR1A 4XTRD 1NDMB 5D1QD 3H7LA 1BECA 4I3RH 1A4JB 1XGRA 2AJXL 1NKOA 1DQDL 3KPOA 1F4AA 3DO3A 5T3XL 5J57B 4KUCF 1RQ5A 3FQXA 2JJUA 4PRBA 4NHCH 2GJ6A 3FN0H 3MFFA 4HIHB 5CP3A 1SJHB 5F7MC 1SJXA 3ZKMC 5GS1B 1EVTC 3DURA 4JM4L 1SJVA 2ILLA 5CEYB 3VXTA 2W1NA 4NUJB 5C08E 5GRVK 4KPHH 1SVCP 1N7MH 3X3GL 2YWYA 5FM5M 3EOYG 2H6PA 4JJ5A 5CINL 2APBA 4KJWD 2VQ1A 5T3ZL 4RIRA 5INDA 4GKNA 3VMOA 3OB0K 3U1SL 5E5UB 2YK1L 1DL7H 3GRWH 1JK8A 5IJVB 1B6DA 3V0AC 1R5IB 3IFNH 4NN6C 3TNNB 4DQOL 4Y4HB 5JW4R 5HGAA 5JQHC 1R3LA 4X9HA 4PJBE 3ULUD 4PJAA 1T20B 4XP9H 5DMJB 3LQMA 5J13B 1W72A 2GK0A 1D6EA 3MV8B 1R5WA 4PJGE 2NY4D 1UQSB 1X3DA 1UKSA 2BNRD 4L5FL 3VJ6A 1XF5B 4JY4B 4P2QB 2FX9H 4Z7WA 3TNMA 2V5RA 1ZHLA 4CVXB 3PHQB 3D69A 1QLRA 1KFAH 4LEXH 5IGXL 2BK8A 4FFVD 2J3SA 3EYOB 1U3HC 3QXAA 3OR6A 1VENA 3CFEA 4YDJB 4XC1L 2HMIC 1B4RA 3KPSE 1VPOH 1TLKA 2FHFA 1MF2L 3H9SB 3KWWB 5IWLA 4NQTA 1ZK9A 3Q5OA 2BSSA 2WIIA 1J11A 1MAMH 3RVTD 3ES6B 4F2MB 4ZG1A 3NIFF 5HHOA 3P77A 4FQ2L 3SCMB 2NW3B 3QUYB 3EFDH 3B8SA 3FQUA 4JY6B 3GJFH 4Y1AB 1KLGA 5GS3A 4RISL 3X13B 4RGMC 2MHAB 4Z0XB 4O9HL 5D7SH 3KPPB 4CDHA 1AHWB 4J3OC 2LV4A 4OF3A 3FB6B 4P3CH 1CK0H 2AXGA 2XFXA 5JHLL 3C09C 4WI8A 3ZYJA 2Y23A 1EEYB 3VXNA 2IEPA 2WIMA 4ZDHB 3V5DA 1TQCC 5BOPA 5HGHB 3T04D 5E56A 3UX9B 2DQJL 3IF1A 3K81A 4Y2DB 5FYLH 3CMOL 4WY7H 1NAMB 5IBLC 5IVOA 2FJFB 1KC5L 2ZUWA 2YD8A 4YHNB 1DEEB 2X1XR 2FBOJ 2P5WE 2K7PA 3NCMA 5J3HD 2E7BA 2VN4A 2WLZA 2QQLL 3CK0L 4RFEB 3QAZB 4YBQC 3IU3B 1GPOL 1WFTA 2V9RA 2XKSA 4OZFG 2KL6A 1KN4H 3MBEC 1DDHA 5EIIB 1C1EL 3O3EA 3RVXC 4S1DD 4HQQH 3DIFB 4UDTB 1HHGA 3CZFB 4BSWA 3ZDZE 2B4CH 5SWZE 4K3DL 2ZCHH 4QTIL 4YHMH 4N0UB 4KHTH 1PX3A 1IAKA 3KGRA 3VFGH 5IESH 1OTSD 4G6FB 4Y4FC 3H8NA 1G7MB 1IGCL 2EDEA 1Y0LB 5L2JB 2AJSH 3C9NB 4Y5YA 1NLBL 3IDYB 1JYVA 3KLAB 4HGWA 1JI1A 4JQIL 4G9FE 3TYGH 1E4KC 4KJPC 5IUSA 1XH3A 4PR5A 4QNPF 1I7RB 3H9HB 5D71L 3ECBB 4DW2H 3RWEB 1EA9C 1NCDL 3R1GH 4IRJA 3VFWA 5HJ3A 1FORH 2XXCB 2IC2A 4XBEH 2O5YH 3KPNA 1HDMB 2IFFL 4LASH 1AE6H 4FQIH 3G08B 2HJLA 3MNZB 5E7BA 2YUZA 4B50A 2V7HA 4KGLA 2Y7QB 2Y06H 2JCCF 1R6VA 3DARA 1NCAL 3QNYB 2BSRB 5KOMC 5DJXA 4ZO6A 3MODH 5J9PB 5IB1B 3O3AA 4F9PA 4LOUC 4LCWD 5I15L 3HC4L 2NY2D 2VDKL 4AH2A 4LSRL 5J11C 2R2HA 3KDMB 4QHMB 5IB5B 1D9KA 3GJEA 3SDXE 3PNWA 4I2XB 1PG7X 3VRLF 1YEFL 1OPGH 4YGAB 5IBTH 5DTFA 2VH5L 4H26B 3C5ZB 3L5XH 3PL6B 2GK2A 1I8KB 1MCDA 1PLGH 3GI8L 4KC3B 3C60A 4APQD 2BDNL 4ELKB 1U36A 3PQYE 4MD4A 2YMXL 2PXYD 3PP4H 1YUHB 5BXFB 2MCPH 2CUIA 5E6ID 3BPNC 15C8L 1NJ9B 3GSUB 1PX4A 3JVGC 4KK8C 4UILH 2O5ZH 4C55A 4D0DB 5CMAA 3TIEA 3MUHL 4FZEH 4LRNL 1ND0A 3HI5H 1K4CA 4OCWL 1RUPH 4M7ZC 1BOGA 4DTGL 1ETZB 2FX7H 3TV3L 5EOTB 5B3JF 4X6CA 5JW4M 4FFYL 2ZWLT 4OD1H 4ZXBA 3UTQB 3GK8L 2CUMA 1G7HB 1MNUH 3NIDF 4M6ML 3UTZB 3TA3A 2DQCL 2O61B 1T1ZB 1X5GA 2PKDA 2IBZX 1FFOA 5F9WB 4V1DD 1QSVA 4HK3J 1PBYA 4P3WA 3WSQL 1H3TA 4YE4L 1A5FH 3MRLA 3PDOA 1W8OA 1G9MC 4L4VE 4GG6A 4KFZC 5CGTA 1AR1C 4R4BB 1YMMA 2GT9B 1JF1A 5IBUG 5ACLA 2FIKB 5AWNL 4GAGL 1NL0H 1JRHI 2V17H 2B1AL 1QEWB 1ZGLP 5DEGA 3W2DL 1EBAA 4AYFA 4C57C 1N8ZA 1TZHB 3GSQA 3EZ8A 4XVUD 1WBZB 4DFIA 4PJDA 3BIKA 4JFDD 1KJ2A 1LEIA 3NA4A 3PWVB 4OLUH 4EKXA 2FEEI 3S4SA 2JJTA 4E9LA 4NZDA 5FO9B 1GSMA 2OYPA 5IOPA 3FN3A 4WV1B 4H1LG 1EHNA 5ICXA 4N90E 3RI5F 1T1YB 3IAQA 3MLSL 1IL1B 1U6AL 4N8CH 5CSGA 3D6GA 4UT7H 4RX4A 2L7JA 2BVYA 2E9IA 1HXYB 3WIHH 3D85B 3RWJB 5FA3B 3OB8A 5GZND 1U93B 12E8H 4ACPA 5CJ5A 3IAPA 4K9EH 1MREL 1A3RH 2VKWA 3QFDA 1RIVH 3T4AA 1WAAA 4I3SL 3OG4B 1U8OB 2BY1A 2D7NA 4H0IA 1KJVB 4RAVB 1MVUB 4XWGL 3FOMB 3S36L 1U2CA 1NMCB 1QSFD 2QEJA 4PJ8B 3HNTH 1VACA 1XGTB 3EGSB 3UJTL 5KJRH 3QQ3B 5IVXE 1YQVL 1ZT1B 4FTVB 1FL5B 4R26H 5EZIH 2X42A 5EZLA 4YXKL 4PJIE 2VLKA 3IU4L 4MQXC 4X6CE 5FGSA 3QI9A 4KJYB 1UB6A 1FZOB 3RA7L 4KTDL 4XCEB 5A16B 3UDWC 3BD5A 4Y8AA 3H0TB 5FGBA 1JMZA 3RWFA 1ADQH 1UADC 4JFFE 4AMKL 3O45B 4HG4J 5KS9B 4RWHA 2ZOKB 1QRNA 3NOIA 2R23B 3C6SA 4RAUB 3DBXA 4S1QH 4LLDB 4FFZL 1V7NH 4NPYA 1OGTA 3QIWB 3VDAA 4K3JH 4NWTL 1T4KB 3D0VB 3VWKC 5JORA 4P2OC 1OQXA 1MI5B 3UP1A 3VG9B 4YXLL 4NP4L 4UT6H 4XZUA 1F4YL 5LBSL 4NQCB 1ZT4A 2VE6B 3EO9L 2DI7A 3DXAB 4NM8L 1MFEL 4L3CA 4UOW1 2DMCA 1RFDH 5AD0B 3BD4A 4JZJA 3GIZL 1YEJL 2WW8A 4I77H 2NY5C 4MLIA 4GRLA 2OTPA 2VYRE 4JO4H 2ICES 5FO7A 4F7PA 3TFKC 4U1NA 4W4NA 1ZLVK 1I3UA 3RWIB 1HSAB 4PD4J 4JM2C 3FMGL 2XY2A 4K07A 4U1MA 4KKCC 5HTSA 3V2AR 2FLRT 5T1MA 3B9KB 4O51A 4KGJA 3O41B 2R8SH 2ADJB 3MV11 5DVKA 4D9RD 4YZFE 3C08L 4MQ7A 4AM0B 4LHQB 5C0BB 1H3VA 3MCKB 4ODWB 4HG4K 2EC8A 4Q6YA 2ID5A 2P42B 4FA8A 2P8MA 1HH9B 4D0BA 1LEGA 4UIMB 1YEIL 4YDVB 4WWKC 1P69B 4HBCH 4OLYL 3QUMB 2EDLA 2ZCLL 5DRWA 2P7TB 2UZYB 3MXWH 4WFFE 4EN3B 2VXVL 4NN7C 4YBHA 5DJ8A 5F1KC 1BAFL 3S96B 4S1SH 3BN3B 3HPLA 1JRHL 5T5NG 2VXUH 3V52L 4MVBC 2X41A 2Q8BL 4MDJA 4NHUB 1MCFA 4KQ4H 2IANB 3SPVB 1FLTX 4XVJH 1QYGH 2DLFH 2QR0A 4XI5C 2A1WH 4PRAA 4BSVA 1HZHH 3L95B 4WHDA 1JTTA 4WI3A 4LCIL 1YY9D 2YN5A 2JIXD 1JPSH 1P7QD 5EU3A 2ZG2A 3VD4A 4MD0B 4PD4K 3GSNB 4OAWB 2VLRE 4GKSB 4MX7B 1N0XL 4W4OC 4U1SB 3RDTC 4OLVL 4BH7B 1A47A 2ORBH 4ZOAA 1MJUH 4DOHE 1PKQB 3C2SA 1UFUA 1ZANL 2I60L 3M1BA 2VLKD 2HT3D 4QLRA 1A0QL 2W60B 3MOBH 5KVDL 5EU5A 3V4UL 5JA8B 3R4DA 1U8IA 3TESA 4IDLA 1ORQA 3QG6A 3HRPA 2J88H 5IW1B 1TETL 4YDLC 5ELIA 3GSWB 3VXMB 1PW3A 5CAYB 3S98A 5I17B 3ULVD 3JWNC 4PV9B 5ACMA 1KG0A 1OAQH 4GXVL 5D7IA 1LDSA 3LMJL 4D9QE 2NY3B 1MFNA 2X40A 3GJFK 3TZVB 3VD5A 1D5MB 3QCTL 2EDHA 1ONQB 2R29H 4QXUH 2DQFB 4YUEH 1P84J 4OCRH 2NY7H 2OR7A 1A1MA 3BI9X 2ZUQC 3G6AB 1QSEE 3I6GA 1BD2E 2XA8L 4XP5H 4L8DB 3B5HA 3QHZH 4JJHA 3WO3B 4J7RA 5F21B 2CDEB 4Z7NF 5CJXC 1FGNH 5GHWL 5GSRA 4EDWH 3RWDB 2C4XA 4KVCH 3L5WA 4MB4A 5JW3H 3CIQA 5D8JH 3HZVA 2Q86A 1FNHA 4XNQA 3RWGB 3OBAA 3HFML 1C5DB 5D2NC 2J8UE 5C0EA 1XGYL 4GBXC 4K23H 5C70A 1KCVH 3SJVE 5I76A 4RZCA 5D93C 1B9ZA 4WO4C 5DYOA 4ZS7L 3IVKA 5B38A 1G9NL 3FJTA 3HG1B 3QPXH 2C7UA 1GGCH 1RJLB 3NPSC 4LGPB 3TN0D 5CEXA 1TJGH 1KJMA 3RNQA 1EGJH 5HY9B 2DYPA 1GGYA 2WMPA 5JDSA 3AMKA 5LJYH 1FFRA 1G7PA 2IPKA 1F58L 1XIWC 5EA0H 4PTUA 3BVNA 4QTHB 3HI1A 4ZFOA 1MIML 4EZMA 4OD2A 1Q9LB 4ZFZA 1J10A 4PGDA 4KDWA 5FYJE 2XYCA 1CXHA 5BW7A 4P4KA 1JE6A 4HWUA 1A6ZB 1YN7B 5DLMH 5EBWA 1CS6A 3JV6B 4P23C 1T5XA 5E1AB 3WFEL 3L7EA 3RTQB 3BWAB 1S7TA 3NZHL 2OM5A 4PRHB 2EKSA 2HT2D 3W11D 5IHZA 1CGUA 4UQ2A 1CQKA 5HVGB 5LGHH 4L1HA 3O3DB 1S3KL 3FRUA 3EOBB 1FE8L 4LPTA 5EORL 4ONHB 3MGOA 4C4KO 4QWWC 4GT7A 5F7UA 2HAZA 1QFUH 4LLQB 3MRMA 3B5GA 1PAMA 4U6VH 4WI7A 3S35X 5E94B 1ZLWH 5F71A 1OF2B 4WUUD 1EHLL 3Q48A 4AIOA 4IOIA 2VLLB 2K7QA 1I7UB 5DRZA 5C92A 2G60L 5F6IB 3ULUF 5I1DB 4UV4L 3HMXL 1IEAA 1JWSA 3TO4D 1YNKL 3QUZB 2YHGA 3ARFD 3L3IB 4KROD 4X9IA 5EULV 2BHZA 3FRPA 4EI5B 2A6IA 3BP6A 4NCDA 3VXQB 4MNGE 3QDJE 4M61A 4M8VA 2WINA 4YWGH 4OZFB 4PJEA 5HDBE 3WEXB 2VR5A 5CWSB 1JN6A 3EHBC 5KSBF 2DQUH 5GGVY 4XPTH 3UTTA 5IKCA 1G7JA 1T2QL 5KVGH 4J2XA 2WBJC 1U3HA 4KJQC 2WWMC 1I3GL 5IB3B 4HKZA 5C0CA 4DK6A 2VL5A 3HUJB 4YX2L 4MCZA 2XNAB 3U9UB 4U05A 5HHXL 3WNPA 2P5ED 4M7LL 4PS4H 5A2LH 1R24B 1OARH 4AEHL 4HUUB 2FHCA 2ERJC 4PJXB 2OR8A 2CLRB 1X9QA 3RGHA 2AJXH 2HRLA 1A22B 1DQDH 1BP3B 4M62L 5T3XH 5ADOH 1WBYB 4HV8B 2L0DA 5TQ0L 2AERT 5EC2A 2GTZB 3Q6GL 4ZOCA 2NLJB 1FZJB 3OAYH 3BZEB 5D7JD 2Z31A 4QCIA 3SKMB 4WTXA 1T5WA 4U3XA 3G5XB 4JM4H 2F53E 2NNAB 4G8GA 3T0EB 3SE3A 3V95A 3X3GH 3LKSB 1KENL 3S4SG 5FOBA 4HLZG 4ZPVA 5CINH 3L7FA 1VFBA 5KSUA 5IHBA 5T3ZH 4RGNB 3DYOA 3U1SH 2YK1H 1MWAA 5KZCB 2NW2A 1KACB 2NY6D 4DQOH 1YPZA 1UXSA 2VISB 3AXLB 4P5MB 3MBEA 3BH8B 4JRYB 5I1JL 5C0GB 2VRAA 4ODTL 3TBVA 2C3WA 5DMKA 5E2JA 2QQQA 3ROLB 5BZDB 5SX5H 1UXWB 5I8OL 4DVRL 4Y4FA 4L5FH 5BQ7B 1FNEB 4HDIB 5FIEA 1VKXB 4S11A 1CICC 2XQYG 2X05A 4JDZA 5IGXH 3FAWA 4X8JB 1E4KA 1RJZA 2OS7A 4RQQB 5GJSL 3W0WB 1MCEA 2B0SL 4XC1H 3U7WL 2YOCA 3WFHB 1MF2H 3ZT6A 2AVGA 2QTEA 1H0DA 2NXZB 2E9JA 3GSOA 2E7LC 2C9AA 5BS0A 3FO9A 5T33L 1ZHBA 4QKXB 3FT3A 4FQ2H 1S5HA 4P2RA 1DQLL 1VGEL 2X4UB 2P8LA 4H8WC 3ARQA 1LDPL 2DTML 4HWNA 3SHSA 1A6A