2CUHA

Solution structure of the 31st fibronectin type iii domain of the human tenascin x
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
115
structure length
115
Chain Sequence
GSSGSSGPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDIQVTAPGAPPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tenascin-X
publication title Solution structure of the 31st fibronectin type III domain of the human tenascin X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 7
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cuhA01
1YEKH 4LSPL 5DURB 4MGXA 1C5CH 3QUZD 4MD4B 4I8DA 2KZ1B 3O6ML 1S7TA 3RIAF 1PLGH 3H3BC 5F88B 5IFJA 4MDJA 2AK4E 2BK8A 4L29A 4Z7UE 5D4QA 5DC9B 5INDA 3DX6A 5FYLE 3CNKA 5H35A 3AS3A 3HLAA 3DSNA 2VZVA 5AG8A 1U8OB 1RK1A 4AG4L 3U30C 4BQ9A 4LCCA 1VESA 1L0XA 3ZHKA 3WLBA 3HFML 4U6HA 5CEXA 4JFYA 5I1GH 5IB2A 4P46B 4NJAL 4Q9RL 4YXLH 5DD3L 5HHXL 4C55A 3V6ZA 4HIHB 2ZSVB 5D7JA 3UTPD 3I6LD 1Q94A 1S7RA 1ZA3B 5DJAA 3MJ6A 4EDXA 3FQRB 4MA8H 3IU3B 5HY9A 3MV7A 1XCTB 3HZVA 4LKCA 4N9OB 3TGXA 3PUCA 3BKYH 2VDKH 3PWLA 2FYYB 3MXWL 4H1LG 5HYSA 4Y4FD 1FV1B 2OTPA 3MOBH 1T1XB 1IC4L 4KWUA 4YO0A 5I1GL 3CVHH 1AXSB 5HGBA 4LCIH 3D25A 1GGUA 5ITFB 3WJLA 4NYLA 2ZUXA 4HJJL 5HYJB 1FYHB 2BNRB 5DFVD 1LEKA 4Z7UA 3GRWH 3JUYA 2D7PA 3GBNL 3D48R 4KRLB 2JJWA 4EI5C 4X5XA 1K3ZA 1XF1A 1QLRB 4ONGL 4NO5B 4MCYA 4LL9A 3ETBF 5LBSL 3KS0J 2HFTA 3U2SA 3L5HA 3IDGB 5CJXC 2HLAB 3L3GB 4WEMB 1RIVH 4G43A 4OF5A 4M1GH 4G6FD 4W4NA 4S1DD 5D71L 3MUGB 2QTEA 3FQXA 3VFWB 4NOBA 5E56A 2YN5A 3FO0H 3N85H 3ULVL 1RZGA 3GMNB 1IGCL 3IJHB 4HHAA 3BHBB 3IDJB 4YE4L 1DQLH 2CMRL 2R0WL 3OX8A 1CXLA 4R7DA 5SV3A 3LKSA 4QHLB 5D7JD 5BOPA 4HUVB 5BRZB 5HHNA 3AC0A 4QHUB 5T3ZD 4PREB 5I1LB 3MV7D 3I3DA 2OI9C 5BZDA 4D8PB 5CJ5A 4HWEH 1F8TH 4LEOA 1E4XH 2GK0A 2F54E 1CD1B 4JFEE 1NCAL 3FO0L 3N85L 1CFTA 5FCSH 4N9GB 5ECJE 5HI4C 2J8UE 2R69H 2DJ4A 2MCPH 1CDIA 3EZJB 1AGBA 2EXYC 3IETA 3EOTL 5B38A 4U1LA 1G6RB 1NKRA 1P4IL 3REVA 2V5RA 4X0KA 4XGZA 5FIEA 2CPCA 2BSTB 2XICA 3WUWB 2BVPB 1X6NA 3UDWA 2XNAB 2Y5TA 2HT3C 4HWEL 4I3SH 1HDMB 3MRBB 3UTTA 1ZE3C 2OTWA 1P53A 3C2AH 4KRNA 1HSBA 1A3LH 3FO9A 1W0VA 3DYMA 1DLFL 1F02I 4HIJB 4OLYH 3QYCA 4XMKH 4U6VL 5I8OH 4PV9A 3DURB 3D3VE 4PJBF 5J4MA 5TJWK 5I1EL 2J12B 3UMTA 1NLBH 2A9NL 5DHVB 2H9GA 4Z7NF 5L0QB 2IANE 3D39E 4G6AD 1IGJA 3QB7C 5C9JB 1OAXH 1KB5L 5EIIA 4XHJD 5CILH 3HE6D 4PB0H 3S36L 4TOYH 4OCRH 1JMZA 3OAUH 4XXCC 2AQ2A 3DXAE 5KSAC 2F54A 3VH8G 4P4RB 1CFVH 2Z92B 3CLEH 1A3LL 1N0XH 5F1OB 3BI9X 3SOBH 2HJKA 5CJOH 2VZ1A 4RAVA 5KSBB 1ZHKB 4DAGL 4Q9QH 3KJ4C 3OKDA 5DYOA 5FO9B 4UDUB 4PJAA 4QT5B 5E5UB 4G9DA 3ARBC 4NFBA 4NKDB 2X2YA 1KCKA 1MRDH 5JW4M 1MHEB 1BF8A 3NFPB 3N50A 4U0RC 3VWJC 2A6IA 3U7WH 1EFXB 1Q9KA 3B2UD 1UEYA 4HIEB 5CILL 4TOYL 4X7TB 3BFOA 4RISH 4HH9B 2VN4A 3ULUC 3MBEA 5EO9B 2D31A 2H8PA 3CLEL 1XH3A 5DJ6B 2EC9T 4UNUA 4GRWB 1YNTA 3OSKA 4TTDC 4HC1A 5ETUA 3S88L 1BD2A 3UTTD 4NQVA 4YXKH 3RKDC 4KKAD 1I3RA 1MRDL 2VLKA 3X11A 2AEWA 5C70A 2OQJA 3MJ7B 1MWAA 4J12A 5GISL 3FQWB 1T22A 3GSUA 3RDTC 1OARL 3MBXH 4ZFGL 4X6DF 3DXAA 4RISL 3V5KA 4PUBH 1PG7H 5KTEL 2BRRL 2X42A 35C8L 3WBDA 1A1MB 2FEDC 3BW9A 3FN0L 4XCNA 3GMOB 1I8KA 1ULVA 4M62L 1KTLA 1NEZG 3MRHA 4DN4L 4F7EA 1RURL 1INQB 2F54D 2K1MA 1IKFH 2WUBH 1F90L 5KVFH 1ZGLA 4TRPH 1KCSH 5IG7B 1RULH 2F5AL 3LS4H 3LKNA 5GS3A 4IRJC 1HNGA 1W72A 4E9LA 1MIEH 2IPUG 1NBQA 5IQ7L 1JZ4A 3MROA 4NSKA 5EFIA 3MNVA 4CNIB 2D0FA 5E99H 5TQ2H 3ZKXB 1CXIA 1HILB 5FO7B 4D9LL 4XZUB 3MBED 3AU1B 1RQ5A 2ZG2A 1EJOL 3OL2A 3HE7A 4TRPL 5C0JA 3LS4L 3M07A 2Y6SD 4F9PA 3RHWF 1S9VA 1BD2D 3O2DL 5CJ8A 1G7HB 4HKJA 5DUBA 1T1WB 2VLKD 4L8CB 4BYHA 3EYQC 1CFSB 4EN3A 5CFHA 4XBEL 3MLYH 1FL3A 1OF2B 4JY5H 3UJIH 5E99L 3SY0A 1A47A 1OT2A 4WCYH 1BBDL 3DXAD 3F12B 3QCVH 3P9MB 2Z35A 3SKUD 3H9YA 4NUJB 3QUMB 1TDQA 4RZCB 4KVNH 5DJDA 4BQBA 1FHGA 5EBWB 2X41A 1NJ9B 5HVGB 1N64H 3ZE2E 5FHBL 4LSSL 1JFQH 2X4UB 1Z0NA 2F53B 4QRSA 3L5IA 1UC6A 5D2NC 2IBZX 2D7NA 4JGUA 2W60A 3TBSA 2VZTA 4R0LB 2Q3AA 4JY5L 4LARH 1PSKH 4UT9H 3JWDH 5DK0B 3D2UB 5B4MD 4WCYL 1JF6A 2R1WA 2AV7B 3VGBA 5DMKA 4QHKJ 4O2CA 4RBPK 1CI5A 1JTOA 5LWYL 1OLZA 5I8EA 4FFZL 4KQ3H 3EBAA 4KVNL 2GJJA 1NFDE 4PS4H 3WDHA 4JFHD 5ID0A 4G8FA 5SWQB 1OB1B 1FAIL 4LPVA 2C3VB 4O00A 2JB6B 1K4DA 3MV8B 1S9KC 2CD0A 3FO2A 3HE7D 1EIBA 4DKFH 3WNNA 3O4OC 4OCXH 1YN7B 2DTMH 1OAQL 1T80A 4UT9L 3JWDL 3C6LB 4LLYB 2HKFH 5HGAB 3LH2H 4P2QB 5EOTB 3AREC 3STLA 4KQ3L 4EN3D 1FCCA 2PO6B 2DQCL 1ZVHA 4OBRA 3NZ8A 5ICZA 2ZJSH 1N59B 3VMNA 1GIGH 3P9LA 1SJEB 3WEXB 2C7UB 3BAEL 1YECH 1O7VA 3NACH 5GS0D 1M6OB 4GG6E 1A3RL 3AB0B 1I7UA 4PGZA 4DKFL 2GT9B 1XT5A 1CD8A 2DS4A 3OB0K 1FH5L 4P5KA 2A83B 2J6EL 2QBWA 2HKFL 3LH2L 1QSFB 4YHIB 5DRNA 5IVXF 1Z5LA 1TJGL 3EGSB 3NAAH 2ZSWB 1I4FB 2PR4L 4WHTA 3EYFB 1Y6NR 3FOLA 1T5WB 5T1MB 5T3XD 4MQTB 1RHHB 1CLZL 2X7LA 4Z77A 2IBBA 5L2KB 5I1JL 4QY8A 1QVOB 3R8BB 4KZEL 1BIHA 4TUJA 1HOCA 4M3JA 2JCCB 4UINL 5J13B 5EO1A 3DVFA 3MRFB 5DRWB 5CD5D 1G7IB 4JZJC 4LOUD 5L9DH 1F3DH 1H3XA 4L8SC 1A7NH 4JRXB 2IPTL 1UQSB 4XBPA 1EXUB 2RR3A 5GSRA 2X70A 3U36A 4Y5YC 5KVMC 1YY8B 1EPFA 1UWEH 1AR2A 1NC2B 4G42A 4G5ZH 4BH8A 5CKGA 5CINL 3VXNB 4IJ3B 2YSSA 2CKBA 4L9LA 1JGLL 4LCUA 4ZAKC 3V5DA 5HHPA 5EB9A 1CDHA 5C71A 4RA3A 2XZQH 4H1LA 4PGJA 4FA8A 5C0CB 1S5HA 3PE9A 3I9GL 1AD0A 2EDNA 3BWAA 2J8HA 3SKOA 2OXHA 3MRRA 4HCRH 3AAZB 4TNWF 4NQTA 1MRCH 5C6WH 5JNYA 3QIUB 5KSVA 4PJ9B 3D69A 5BVPH 2P7TB 2HTKD 4JANA 4IMKA 5E8OA 1M4KA 2VLRD 1MFAH 4LCWB 2LFGA 2DN7A 3BUYB 4RWHA 4RFNC 2VL4A 2R0KL 5CIPA 4PJIE 3FZUD 4D0CB 1A7PH 4DKAA 3AM8C 1KXVC 4H8WC 3S96B 5AWNL 4YDVB 3QH3A 3U9UA 4HEME 4CW1B 1NL0H 3W11D 1K5NA 5F89B 3TPUB 2FJFB 2X1PA 4R4BA 1XIWC 3BN9D 4QYOA 4BUGA 1QPXA 1UKQA 2EEAA 5GS2D 1TNNA 3CX5K 3V5HA 5I19H 3VXME 3UJJH 4NZDA 1BOGB 4ZUUA 4QXGL 4JFOB 2BVYA 4MXQD 4NPYA 2CO7B 2DQJL 5KSUA 3FQNB 4WVRA 5EU6A 3BQUB 3HS0A 1VFAB 2ATKB 3C5JA 1GGBL 3CIQA 3ARDC 3EOBB 4U1GC 2APBA 2J88L 1DBBL 1DQJB 2VISB 2FO1A 4F37F 2SEBA 5E1HB 1CIDA 1A6AA 2AJVH 1VEMA 3QFJA 2NXZC 3V0VB 2B39A 4HFUL 1WWBX 1C7TA 3VFTA 5B8CC 4GKZA 2P8LA 1ZT7B 2NY3C 3NZHH 2GJ6E 2Y72A 4KMLB 4MAUH 1YEDB 4JJ5B 4TNVF 4EVNA 1U91B 3QQ9C 4QHNA 4N8PA 5I17B 1U41A 4HXAL 5EBLA 2EEDA 1DUZB 5F7DB 4Y2DC 3WFHA 2X4PB 1N5AB 3BIKB 4O2FA 4DUXA 3CVIH 3GMLA 2XPGA 4NRYB 1BF2A 3MPCA 4LSVL 3LHPH 1KB5B 4JAMA 4F15B 2I27N 3VFRA 2AVGA 1X5KA 4HGKC 4M43L 1U8IA 4NIKB 4GLRH 1KJ2A 4JFFB 3GBMH 5FFLA 43C9B 1NCCL 2DQDH 3VWJA 4OLEA 1DQDH 2R2BB 2ED7A 3BGMA 4PJ7F 1LP9F 3UZQA 4KJPD 2HT2C 2Z91A 3RX8A 4NT6A 3CVIL 5ALCL 1I7ZA 2AK4B 2EIZB 3VGGA 5F7UA 4LIQE 3OR6A 5EU6D 5B39A 2R0ZL 3H7LA 2G9HA 4EZMA 4KKCD 2GJ6A 3VH8A 3ZYZA 2VR4A 2KUTA 5BV7L 2DQDL 3FB7A 3G08A 3QHTC 3X13A 4Z7OF 1MCQA 3QFJD 4Z7VE 4NQSB 4Q9BA 2YOCA 2DIBA 4PD4J 2X4NA 4Z76A 2PTTA 5CWSA 5D6CA 1L7IH 5I74B 2AGJH 3X12A 1JUFB 5DK3A 4AJ0A 5D70H 4F7MB 5IEKA 1TTFA 4MDIA 4P5TB 4CDHA 3P0YH 4I48B 4PJ8B 3KYOB 4ODVH 1IT9H 3SDXA 3WIFB 1U2CA 4IRJA 3OHXA 4UB0H 1CU4H 2R4RH 1I1AC 3HMWL 1JPST 4H88H 4M61B 5FKAB 1FFOB 1NDMA 3E8UL 4DCQA 4K7PH 5D1ZB 1L7IL 1VFMA 5D2NE 4JR9H 2DQEH 1I8IB 1MI5B 4JO2L 3CK0H 4XC1H 3VWJD 2W38A 5JIIA 1HKLL 5E2VH 1ZEAH 3RHWK 3P40A 4YHLH 5D5MF 3VFPA 1NBVL 4IRZH 3PP4L 4JZOA 5D96C 4O5LL 5BVJB 2LAAA 2ADGB 1EEZB 1IGML 3GGWB 4OFDA 4GKSA 3BZ4B 3OGOE 4Z7VA 1DE4B 1UACH 4UB0L 5EUOA 3QWOB 1CU4L 2R4RL 2C3WA 2BVEA 3RVWC 1NEZA 3IXAA 4K7PL 4TPRH 5K9JH 2GJ6D 2UWEF 3BOVA 4CRPA 1CE6B 2HJFB 4OUUA 5J3HD 3CK0L 2YS4A 2GUOB 5DQDH 5FKPB 1XF5B 4CMMA 3O6LH 4IRZL 1NMCC 2Z4QB 4O9HH 4EQ2A 3RVTC 5J1TC 1I1CA 4PLKC 3C09C 2ENYA 1FVCA 3VWKC 4TQEL 4PLNC 3RU8H 4DKDC 1ONQB 3TF7C 5FDWB 2V7NB 2X89A 4MNGE 3VXTB 5CD3A 4PRBA 3DSFH 3JSSA 5IW1A 1VADB 3AFLA 5BMFH 3EJZC 4CADB 4U1MB 3QISA 5J0BA 5BS0A 4JFEB 2HLFC 2IADB 1CFNB 5F96L 4LVOC 3ZDYF 5H2BB 5C8JB 4Z78B 3G5XA 3CAFA 2J8UB 4IDLA 1KN2H 2XFXA 2QSVA 5KS9F 2IBGA 4UIKH 5CP3H 2OJEB 5C09A 3O6LL 5GZOC 4M8VA 1YEFH 1FVEA 3TO4C 4BSVB 5IBLD 2D0HA 2QQKH 3QIWB 1OVZA 3IT8D 1MLCB 3EOAA 4J3TA 3W0WE 3CPLB 1A3QA 1GYAA 3ARRA 1BFOB 1ACZA 2X4RA 3KPPB 3D18B 3CFIC 1BLNB 3QCUL 4RMUA 4XVSH 3B9KC 2BVQA 1R3LA 2ESVE 2JTDA 4NC1C 3NPSC 1S78C 2Q7YB 4NWTH 1ZTXH 3D3VB 1AGCA 1JYXA 1G7JA 4LLMA 4S11A 1G6RH 5F6HI 5H94A 3AREA 4GKNB 2W0KA 3ZE1F 2XKNB 5HI3C 3ZKMC 5C92A 2FX8H 4XAKE 1M7IA 3MRPB 1J1PH 4FOMA 1WT5C 1OGTB 3LQZA 5EPMA 4KGLA 1JGVH 5T1KB 1B2WH 5JQ6H 5TDNB 4I18B 1J1XH 3W9DA 1X5JA 4PGBA 4WNQA 1EO5A 2X89D 4NRXA 1RJCA 4HDIA 1QSZA 3DROA 3VXOB 3DUSA 2PW1B 4S1SL 5BS0D 4OV5A 2LU4A 1P6FA 1SM3H 4QRUB 5DD5H 3DGCR 3W0WA 1ZS8B 3BP5B 4TVSa 4QWWD 5J9PA 5MENE 4N8VB 3BIAX 1Q0YH 1T6WA 1SJHB 5C09D 2HKHL 2EYTA 1J1PL 1C12B 3WFEH 1QBML 4JG0H 1I9RH 2DQIH 1QEWA 3W5MA 1RZJH 4AEHL 1J1XL 1PY4A 5IM7A 4JFDB 4JRYE 3MLRL 5TPWL 2ESVA 4POZD 4R26L 1DSFL 3IJYA 4HUUA 1OCWL 4JN1H 4QRQB 4TVPH 5T5FH 4L9DA 4KGJA 1X3DA 3HMXL 3KLDA 1MPAL 3GKWH 1G7LB 5DD5L 5ENWB 5I2IA 2NY0B 5ESAB 3S3JA 5CJQL 3G9VA 3UTQA 4TNWK 1LNUB 1WBXA 2IAMC 3MRJA 4WFEE 1DL7L 3TJHC 4UV4H 1R3JB 3WN5A 4JG0L 4WW2C 1HNFA 1I9RL 3JVGC 2DQIL 3ARED 3FB5B 5KVDL 3OKOA 2JLLA 1S7VB 4N68A 4GRWH 4LLWB 1EBPA 2IQAB 3IDMB 3BMWA 4FQLH 4JN1L 3ZKNC 2QV2A 4ETQA 2W07A 3NH7H 1DBJH 5D7KE 4O02L 5HD8C 2FL5B 4LRIC 5FHAH 1MCPH 2NY5C 4PJEB 1IQWH 1AC6A 5MENA 4Z0XA 1O7SA 4N0CD 4X4YB 3I2CH 1AFVL 2OP4H 3WYRA 3PHOB 1YMMA 4P9HC 1DQTA 4UV4L 2UZIH 4FQIL 1CIUA 3W0WD 2JJUA 2G75B 4ZSOA 1FSKB 2FWOA 2NW3A 2V2WA 4ODWB 3TIDB 3RUGB 1XGUB 3LAFA 1FNHA 2RQ8A 1BJ8A 3C60C 1P4LB 4NQXA 1MCPL 3QEHB 3HI6H 4OTXH 1IQWL 1HINH 1M71B 2ESVD 2ZCKH 4JVWA 3E0GA 1PQZA 1ACYH 3UPCA 3GMMA 1W0WA 5FA4A 4F37K 2OP4L 4MJIB 2F19L 2UZIL 1DZBA 3HKFA 4M4RA 3C5SB 3P4NA 1BVLB 4PJHE 4MJ4A 2QADC 5I1HL 4LPYA 4OIBA 2G2RA 4JY6B 2Q6WB 5HDOA 4U1IA 1AKJA 3CXDH 3EYUL 2EE9A 5JOFA 1IGIH 5CSZB 4KQ4L 4EJ1C 1HINL 1OAUL 4XB8A 3TZVC 1T0NB 5KSBF 2ZCKL 3H9HB 5FA3A 4H0GA 3DIFA 1UZ8B 5D7IB 4MAYC 4RMTA 4JQIL 3CSYB 5MEND 1JWUB 1CWVA 3ARQA 1OAYH 1NAMB 3BPCA 2Z8SA 1SY6A 4KJYA 5J7CC 2R4SH 1JYWA 1QHPA 1YMMD 4L4VD 2FD6L 4OD3H 5E00A 4FQXB 3IDYC 1AGEA 4QF1B 3QUMH 1NFDB 4RQQA 3QA3A 5DZLA 1BZ9B 4WJ5B 5DQ9B 4D0BA 1YJDH 1FE8H 3MRDA 1NLDH 3UJTH 3HAEB 4JB9H 2A73A 3VFMA 4GRWF 3N1PC 5HHMB 3FQUA 4PLJC 1U95A 5SX4H 4KDTA 1MHPH 3GDBA 4YZFE 3WCYA 1X5AA 1E4WH 4U49A 1CGVA 4PJHA 3O8XC 3LN9A 3GJFH 4ZDHB 3G6AB 4KTEH 4G8EB 5E8DL 1BHGA 2MOVA 3O3AA 4OD3L 1O5DT 2Z8WC 4QTHA 3WHE1 4S0SD 4RMWA 1A2YA 1ZK9A 3QI9C 1U3HB 1J5OL 1LD9B 1YJDL 5C2BL 1TVHB 3L5JA 4K3EL 3V2AR 3NCFB 3WV0A 3KS0H 1AKJD 1MHPL 4J2XA 1T3FA 3ZDZE 5HHOB 3OKEA 3Q6FB 3BRDA 5IB3A 1LE5A 1WFUA 3B9AA 1U8JB 1RVFH 2R2HB 2G60L 2J5LC 4N90D 1GL4B 1U8NA 5CMAB 1NCTA 3NFNB 5I1IH 1A7OL 3K4ZA 1ZT1A 5H37G 5HGDB 2OI9B 2X1OA 2NYYC 3GMPB 2IG2L 1A6VH 3Q3GA 3FT3B 1GSMA 5F9OL 2DBLH 4PY8I 5IBUB 3LV3B 4L8BA 2QHRL 4HKBA 4CN6A 3GSOA 4F80A 1T7ZA 4MLSA 5IP4A 3GSWB 3HC4H 4GW4B 4XP9L 3BDBA 2ZOKA 5JW4R 4YHPB 4O58H 3P3YA 1X7QB 1RVFL 2H32B 2XWTA 1E4XI 1G1CA 1A4KA 4WHYG 3BXNA 1J7VR 2UZXB 5JMRA 3G6JB 1QLEL 3AS0A 4GBXC 4UT6L 2CLRB 1LHZA 3NCYS 2BOCA 2COQA 2CXGA 3U0TA 1WIPA 4NO0B 2LVCA 2I9LA 1LEIB 3K81A 5B22A 2R56L 4FZEH 1EZVY 1JPFA 4YPGB 4MQXC 2AP2A 5F93C 3Q0HA 1T21A 4NC1E 5DS8A 3C2SA 3RWJA 1H3UA 4I9WE 5FOJA 1CL7L 2VDPL 4ZPTB 4LLAA 4FABH 3NABL 5ESQA 4M00A 1I85C 5GGTA 2R0LL 4OFYA 1WBYB 1FFNA 1L6XA 3EO0A 3MYJB 3TEUA 1XR9B 2R15A 4PJIB 4WTXA 5KSAB 4KZDH 1IM9A 1U8PA 5D8JL 2WINA 5JR1H 5EC2A 5IMLA 1Z9MA 1QPPA 3KJ4B 3L9RB 1EUUA 1BMGA 2Z8RA 5FUZH 3TO4A 3ARBB 3LB6D 1XCQA 1UYWH 3VXMB 2AEIT 3QG6B 3MRQA 2HFEB 4PJ5A 1BQSA 3H7BB 1WITA 5HPMA 1EGJA 1BM3L 4NJ9H 2XY1A 4J3OC 3V4PL 1IEBB 3HPLA 2C5DC 2Q76A 4Q6IC 3QXTA 4WO4C 3B9KA 3L3JA 2VXSH 1PKQA 1S9WA 1FBIH 3L6FB 2X5PA 2CUHA 1CF8L 4WI4A 2ITCA 2YD3A 3Q5YA 2B1HH 5DJYB 4HJ0D 2VC2L 1KXTB 2M8XA 4QCIB 1QHOA 3G5ZB 1FO0A 1ZVSA 3QEUA 2EICA 4YUEH 4Z7WE 3RDTB 1WT5A 5D7LB 3RGVC 5CEZD 1IAKB 4GXUN 4NJ9L 4FFWC 4NRZB 2VXUH 4K2UL 2FGWH 5E2UH 2NXYD 2VR5A 2PCPA 5C0DB 2IH3B 4TSCH 1NH6A 4JO1L 3FN3A 4PRDA 1BGXH 4JFZL 1TPXB 4I2XB 4ISVB 4CU8A 3I02A 1UVQB 3KLHC 3K8LA 3KJ6H 1IM9D 2P5WB 1I1RA 2VKXA 4NKOB 3ZMRA 4QOKB 1SVCP 2DM3A 2VAAA 4MXVE 4OQTA 1ZAGA 3VXPB 2AJZB 1HCVA 4Y5XA 1KOAA 3TWCH 3GBLA 3O3DB 3GJEA 5IFAL 3DTXB 3TO4D 3KPSB 3D0LB 5L8KB 5DMIH 5LGHH 5E2UL 1ZHBA 2FGWL 1T0MA 1KIPB 3C9NA 3CFCL 4PJ5D 5FM4A 1HIMH 3PGCA 2FHBA 3J8F7 4XVUC 2X1QA 2BXZA 1BGXL 1HHIA 5IKCB 2HRPL 3ES6B 4E42B 2X4QA 4LLVB 3H9SB 1UJ3A 5HDLA 4M5ZH 4ZMAT 3BPNC 2NY7H 3L3KA 2CIKB 3O4LE 4I9WD 2GY7B 4U1JB 1AHWB 4JLRB 4OI9A 3JVGA 5GGVY 1E0OB 2QQLL 3MRIA 1LO3H 1MH5A 5I8KH 3OKNB 5ACLA 3CFBA 5FYLH 1HIML 5LQBH 3TT3H 3V0WL 2AW2A 3PABB 3FTGA 1DVFC 2DQFB 4UNTA 4XPFL 1UZ6F 3TFKC 2DMKA 4KXZH 4OGAD 2BNUA 1G0DA 2EDFA 4PG9B 3L3DB 1TJIH 3UYPA 2NQCA 3UROR 5D2NB 1KPVA 3EO1A 4XHQA 1TITA 1LO3L 4QXWA 2YA1A 3PDOB 4Y16A 5FV2A 3ARVA 3AMLA 5A1AA 3BP6A 3TT3L 4J3XA 4FQCH 4MWFB 3FCTB 3DBXB 1UM5L 4G3YH 1WZ1L 2YRZA 3HUJE 2HH0H 43CAA 2YC1A 2EO9A 3ZHLA 3HB3D 4U6YB 4NWUH 1JF1A 4A6YB 3LN4B 5FCUL 2PW2B 2NLJA 4KHXL 4JKLA 5K9QI 1G84A 1KACB 3QSKB 5F7WC 4ODSL 4LDLB 1EEYB 5DLMH 5FAAA 1BJ1H 5IUSA 2N7BA 2DDQL 4NZUL 5F7MC 4YWGH 3TJHD 1U3JA 3KXFB 2A77H 3MLSH 4FQCL 5DWUL 5FM8A 3MFFA 1FG2A 3CCHB 5DRXA 1MREH 3QO1A 3KPRE 3KYMA 4P57A 4F58L 5GS1A 5DJ2B 2CR6A 3KYAA 1UH2A 4FFVD 2HH0L 4MNGB 3TZVA 3QQ3B 3SGEI 5L2JA 3EHBD 3I6KA 4NWUL 3TBYA 1NC4A 4YHYB 5DD0L 5IEHA 2JELH 2VITA 3MZTA 3TH2T 4NGHH 5C0EB 4L3CA 5BQ7B 2G5BA 4OM0H 1AGFB 4LDOB 3OKYA 1FLRH 4P9MH 1QFPA 1N3NA 4Y5VA 5EZJB 5DT1L 2LABA 3VGAC 2O61B 3FO1A 1X5XA 3MLSL 2MFNA 4X7EC 1VGEL 2EDXA 1YPZB 1W2KT 2KQMA 1QO3A 2ENSA 1MREL 3U0WL 3HUJA 5HYQB 2EDKA 2ZUTA 3T0VA 5GGQH 2OL3B 3HI1B 4Y16D 3PL6C 4MNHB 5IQ9B 4ZFZA 2AXHA 4U3XA 3SDCC 1P7HL 1QBBA 4FNLL 4PGEB 4R7NB 4HIXL 1C16A 4J3WA 4PJGE 3RJDA 1IM3B 3OJ2C 1OPGH 2VE6B 2YUXA 4FG6D 1X5ZA 3BWUC 3ESVF 4G6ML 3LKOB 4U33A 1LO0L 2F5BH 2M26A 3ZSTA 4Y5YB 4AY0A 1NFKA 4MNQB 3GHEH 5GGQL 2Q8BH 4FZ8H 4ZOCA 2CK0L 3WO4C 3CSBA 5IJVB 2X1WL 3DX8A 5D6DC 1A7QL 2NY4D 4ZAKB 3FRPG 1F4XH 4J6RL 3L3OB 1ZHLB 2NY6B 4QRRE 5DFWH 3REWA 4EUPH 5ID1A 3TZVD 1UB6A 3ARFC 3T2NL 4X8JA 2GI7A 2EC9U 3RFZC 1NC4D 1OPGL 3ZSSA 3HR5B 4F3FA 2P24B 2MQ3A 5IMMA 4KUZH 1BREA 1FNSH 1JF5A 3GHEL 1M05A 4FZ8L 3QG7L 2BFVL 3E1F1 5CZXC 3L1OH 4GAYB 3BZEA 2J8OA 4OJFL 4HLZH 1T04B 5TE4H 4C56B 1SMOA 4WFHE 2BHUA 4PRNB 5ADPH 1QFUL 3V6FA 2DQTL 3K4AA 4HC1L 5IHLB 1CGTA 1F2QA 4XVJH 4UMGA 4CJ1A 2P8PA 2NX5A 4M02A 1LDPH 4HWZB 5TGBB 3OG4B 5I76B 1HQ4A 1MWAL 4PG2C 1CICC 4F8TA 5K9QG 1EA9C 3G9AB 3P73B 1H0DB 3L1OL 1G0XA 4QRRA 1QR1B 5F7HA 4YX2L 1FL5B 2EE6A 1S8DB 5A16B 3T0BA 3GJFK 5ADPL 1CBVH 3ARDB 1YC7A 3B5GA 1YEIH 4XWOC 4J8RB 2NXZB 1RJYB 4PRAB 3CU1A 1S7QB 2JB5L 3B2VH 5IB5B 5B8CB 5HI5C 1ZLWH 1LDPL 2NY3B 3MUY1 1HHJB 4GAJL 1Z9LA 2J8UF 1JHTB 2A6KA 2QR0B 1W72L 1DBKL 3GHBH 5AUMB 4AH2A 4N0UB 4I3RL 1A6ZB 2V7HB 4RNRB 1I85A 3P30L 3V52H 3GNMH 4LBEB 1WTLA 3LEYH 1PG7X 3UYRH 1AR1D 4P2CG 1CBVL 3WHXB 3QIBB 5FF6B 3SE3C 4DKEH 4GW5A 4YHOH 4CKVX 5J11C 4X98B 1YEIL 3W9EB 4HUWA 4PLOB 2B2XL 1XF4B 1NMBL 5E5MA 3QUKB 1MLBB 1RD6A 5C0BA 1T7WA 3U9PH 2ZCLH 1T5XB 4FQHB 1I1FA 3DRQA 4MZ3A 4PJBE 3GNML 4Q2ZA 2AJ3A 4ENED 2NX5D 4NN6C 4WI2A 3VG0H 1JK8A 1YYML 2R2EB 4Z7NE 4AENA 2MPAL 1I9IH 4HV8B 4GLRI 3DI3B 4DKEL 4EIGB 2E7CA 4PJCB 4Z8FL 1F3JB 4QRRD 5HJ3B 5I71C 1CGSH 5GS0L 4LK4A 3NPZB 2PTUA 4DQOH 2OJZH 1KTRL 1TCRA 3KLAB 1KYOJ 4DGYL 4JY4A 4U1HB 1T4KB 4K8RC 3OZ9H 1GZPB 2ZCLL 1B6DA 2VN7A 1PFCA 2XTLA 1I7RB 4PBXA 1AP2B 4XI5D 3RGVA 3TBTB 3S37H 2P43B 4CN4A 4FQ1H 4WFGD 4HUKB 1INEH 2WWMC 5C0FB 5T3XL 4EI6B 1F4YL 2BOBB 3MA9H 4PY7B 4KJQC 5AG9A 4WWKA 5KANI 2QEJA 3HZYB 4PRHA 4WFHD 1LO5B 1ES0A 4YBQD 2OJZL 3MLUL 5HPOA 5DEFB 4HQQL 4HEPG 3CVHA 3QNXA 1K6QH 1EHXA 4PJBA 3P4OB 3FT4A 1ND0B 2FEEL 4HPYL 1H8SA 1I1AB 3D9AH 4UOW0 3MX0A 5MI0C 4FQ1L 2OR9H 3HNSH 4JJHA 3GRWA 4DN3H 1NAMH 2YZ1A 3RTQC 5C0BD 3TA3A 1KFAH 4POUB 4OZGE 4PGCA 3VD7A 2ED8A 3WLWC 1JGUH 1A9BB 5F6HJ 1E28A 2FATH 5CBEB 1A4JB 1S7TB 5KG9B 1Q0XH 5D96B 1QKZH 5GIRB 5IGXH 4TSAH 2F15A 1A1NA 1W8NA 1K6QL 5ICYA 3AXLB 3ZTNH 3HLAB 4OZ4B 3EFFB 4FTVE 4PJEF 1M7DB 2CRMA 3HNSL 4CN1A 3MRMA 1S7WA 4UQ2A 4JFYB 4Y1AE 1TETH 3V6ZB 3D6GA 3QDGE 1NMCB 3ZT6A 2FATL 2H2SD 2VO5A 3L7EB 2R9HC 2XKUA 1QKZL 3RBGA 2AS5M 3MRCA 1QYGH 1JPSL 3VWKB 2ZKHH 3U7AA 4ZYKA 2OK0H 2CKBH 4WWKD 4WHCA 1F13A 1NGZB 3ME0A 4PRHD 1VB9A 4H1LH 3LZFL 2YD8A 5IF0A 4YO0B 3BP7B 2DKSA 1K8IA 4KTDH 2P44B 3QDHA 4X6DA 1FORL 3MRNB 5IB4B 4OF3A 4JM2C 4YFLF 5K9KB 3WFDL 1R6VA 3H6JA 5IIEA 1A14H 1HH9A 1AIFB 1MVUB 1NBZB 3TA3D 1MEXL 3LEXA 1QYGL 3C08L 3LQAH 2ZKHL 5J1AA 1MJJB 4OCLC 1KN4H 2CKBL 3D0VB 2MKWA 4MCYB 1UM6L 1LO4L 4S1QH 5CIPH 3VGHA 3MNZA 1CR9H 5BO1L 4DGVL 5HHVH 3DO7A 2FO4A 1MRFH 2OYPA 4C83A 1K4CB 1Q9WA 3GK8L 4GW1A 4QXTB 3ZE2F 3B6SB 2PETA 4XP6H 1V7NH 3NPSB 3QDGA 3DX9A 4C54A 3T2QA 1PBYA 1MCOH 1Q8MA 1KIRA 2BNQE 4YEEA 3WXVL 2VXQL 2DD8H 3TO2B 1RZGB 3RPIB 3ESUF 3LQAL 3QZWB 4U31A 5ACZB 4OFPA 1FZMB 3OX8B 3HE6B 3E2HC 4R7DB 4QRPA 4C4KT 3T0XA 4S1QL 4R2GD 2XZCL 1CR9L 1RZ7H 1NFDF 5CGYD 5HHVL 2MHAA 5CP7A 1MRFL 1I1YB 4LLUB 4OLXH 1C08A 2XXMB 4OD1H 4MD5A 1V3KA 2IPKA 5KN5A 1V7NL 2D7TL 4LEOB 2J3SA 1MCOL 1OSPH 3MCLH 1IAIH 1Y6KR 2J4WH 3O9WB 4MS8D 5KAQF 2AI0H 4HUXA 2JJTC 4XPAL 3S7GA 5FGSA 2GTWB 2RGSA 3L3HA 4MXWL 1LK3L 3FRUB 3IETB 1AD9B 1IC5H 3QHFL 5JZ7D 5ISZE 3H42L 2ITDA 4GMSH 3I75B 3L3IA 2JJSC 3EW3B 1JPTL 3GO1H 4WW1B 2EZ0C 4OLXL 5GJTL 1BEYH 1U3ZA 2Y5TB 3H3KA 5CS7A 5I75C 4XNMA 5JIHA 3HN3A 2IQ9H 2HWZH 4GG6F 4LVEA 4UT7H 3FMGH 5JPMB 3FHAA 3MCLL 4IS6B 1U36A 3DO3A 2V5TA 1W0VB 3EYOA 3LY6A 4GSDH 4I77L 5GGUA 2CJUL 3QDGD 2GQHA 2IAMB 5IVXE 3FOMB 1CLYL 3ULUH 2DQGH 2H3NA 2XTJD 1K9TA 2C3HA 5CCKH 3X3FL 3U6RB 2EYRA 5I9QC 5FYKE 3ARFA 3N0PB 4PRPE 2N1KA 3ALWA 4QRPD 2HWZL 2H2PC 5JXEA 4OB5L 3ZO0A 1KJ2L 3RNQB 3KR3L 2ATPB 5IK3B 2HJKB 1DEEA 2VQ1A 1GC1L 3IGAA 5C3LD 1WZKA 2MWCA 2DQGL 2ERJC 3UTSA 3JV0A 2QQNH 5F71A 3C8HA 3RRQA 5E8PB 2BVOB 1G0YR 1NCNA 3CX5J 5EU4A 4LLQA 4POYA 1CK0H 5IHZA 3GSNB 3FRPA 5TF1L 4XNUH 1U8MA 1BBJA 4HG4J 1CFQB 3PWNA 1YDPA 5F9AC 4HJGB 4R8WH 4LSUH 1QQDB 5CEYA 3FB6B 3O4LB 5ETUB 5IVXA 3MNWB 1BD2B 3D1MC 4Q7DA 3T4AA 5J6GB 2GITB 3JV6A 5FGRA 3BMVA 2VLKB 3PWUB 3DX7A 3MOAL 4G6KL 3CFDA 3HHRB 4LGRB 1MWAB 4ZXBC 4LIQH 3LKRA 4MYWB 5MEQA 4PFEA 2OR8A 3RWIB 2VERN 1PZ5B 2OSLB 4XNUL 4PJIF 1IBGL 3BJLA 5C0AB 4LQFH 5DEGA 1NBYA 2EXWD 4XCNB 2VDNH 5IESH 4E0RB 3P11H 3BO8B 4IOFC 3FFCA 3WJJC 5DXWA 5F1KC 4AIZB 1KTLB 4OLZL 3WS3B 3SHSA 3EDFA 4PY8J 5JXED 4Y4HC 4AIOA 4KI5C 4MAYB 3WUWG 4YDIL 1S7SB 2BVTA 4GQ9L 3RWEB 3AS1A 4X6EA 1NAKH 3PGFH 4KK9C 2VDLH 4HGWB 4LIQL 4APQC 1UA6L 4Z95L 1MCHA 6FABL 1R5VA 3VXSB 5I1KL 3UTSD 1FFQA 4OFIA 3KPQB 4NSKB 3L5XH 3C6SA 3IDYB 4JQXC 5EFIB 5LCVH 3ULUF 1T6VN 3GUTB 1FDLH 3QUYC 1JTPA 4HK0A 3RVVD 1IL1B 3SPVA 2L7UA 5E8EB 4RFOH 5IESL 4HKZA 5IT2L 4KMQA 5JIPA 3KPOB 5JMOC 5EZOL 2ZP0T 4R3SB 4LSTH 1NANH 3K1KC 4M8QA 3QXUA 4ETYA 2BC4B 4KK6D 2EDQA 2VAJA 2ICCA 4LSRH 3O8XB 1FZOB 2Z9TA 1FYTB 2OCFD 1NAKL 2VDLL 4OT1H 4OZHB 4X5WB 3QEQB 1ZANH 3VFOA 2OZ4H 1EO8L 4OZFB 3IAPA 5SX4I 1FDLL 1J9CT 1RUQH 1KPRB 2PYFA 3QI9B 5EUKA 2GJZA 1A0QH 4LFHG 2H6PA 2GCYB 2NW2B 2F8XC 1IGTA 3QPXL 4A6YH 2HT4D 3QNZB 4MA3A 3O3EB 5FGBC 1WC7B 1AGDB 4D0DA 1D9KA 1JWMA 1RPQA 5DJ8A 3IDXH 4XC3L 3TBVB 1PEZA 1XEDA 1I3UA 4HFWA 3QP3A 4D9RE 4WY7L 1KV3A 3PWVA 5DO2D 4LSRL 3UC0H 5BXFA 3BGAA 4M1CD 5D2LE 3V7MA 3FFCD 4X7CC 2AABH 4LNRA 2XZAH 25C8H 1IEAB 4JDVB 3AGVA 2ICEA 1I7TA 3R1GH 1LP9E 5L0QC 4OM1L 3DUUA 3S4SG 3TBSB 4B5EA 2J5LB 1ZLWK 4QKXB 4PJXE 2DL2A 3KVQA 1T66D 3FQTA 3V8CA 3HPJB 1MFBL 4NHUA 3WDJA 2PYEA 3MGOA 3K74B 4PJGB 5HGGS 3RA7H 3IU4L 1GAFH 2AABL 2VDRL 3ZKSD 5IROC 4N8CH 3BRFA 4BSWA 3CUPA 1FFPB 2YPLA 2VXVL 4XX1E 2OL3H 3L5WA 3LS5H 4ZFOA 2ZUSA 3R4DA 3GI9H 1TZGL 4GBXB 3CGTA 3BEVA 5C86A 1CT8A 1CYGA 4XP1L 3F5WB 1RIUH 3QDMA 2IH1A 1FIEA 3WL9A 1VA9A 4AEIH 3RA7L 1DBMH 1CLOL 4HCRA 1MSPA 4K8RD 4JG1H 3VW3L 1HH6A 5CZKA 4PJ7A 1D9KD 1LP9A 2DYPB 3P4MB 3OMZA 4UAOB 2V2XA 5HVWA 3TVMC 5D1XA 4MA1C 4ODXB 1NFIB 4P5KB 4YNYB 2DLFH 5A2IH 2KZWA 3NIGE 3IVKA 2P4AB 4F9LC 1QUNA 4ERSH 1MHHA 4NP4H 2VLRB 4OUOA 5E4EB 3VE0B 2FSEB 4FQJH 1R3KA 1A1OB 1F4WH 3VRJB 3FOLB 1B90A 5EOQH 5IVZA 3T0EE 3U1SH 4AEIL 3KPMA 5IHUH 3EO9H 2W0PA 4PD4K 4CVUA 4Q58C 1JGEA 4JHZA 1VFBB 1DN2A 1EVUA 3P77B 2XYCA 1U8KB 5D1QC 2PYED 2QJDA 4KKBD 2VSDA 2GY5A 2DLFL 4RGMB 1MY5A 3T4YB 2KH2B 3MO1B 1CG9A 2ADIA 5FEBA 4KRPD 4NP4L 3GSQA 4V2BA 4HT1H 2X70B 4CVWA 2BCKA 3UX9B 2YMXL 2YR3A 2Y25A 4MVBC 5MP6H 2YPLD 3LIZL 4KKNA 3OWEA 3S35H 3ARTA 5EOQL 4H8WH 5IHUL 4X4ME 3EO9L 4Q6IB 4YQXH 3BYYA 2WWKO 5HHPB 2AEPH 2FIKB 3QO0B 3WKMH 1WWCA 4GH7B 3LKQB 3VDAA 2GKIA 2VH5H 3QDMD 3IKCA 1OTTD 4JFPA 1IZKA 3ZDYE 1NSNH 1XF3A 1IAIM 5L88H 3MV01 3Q1SH 1J0ZA 4L3EE 4XAWL 3U0PB 1JV5B 2ICWB 5D5MA 5ALBH 1YPZF 3MMEA 3MLTA 5D1XD 4D9QE 3T0EA 3U79A 5EIVA 3V4VH 4EEEA 4NQEE 1IJ9A 4YQXL 5KW9H 1OWWA 1CVRA 4WUUA 3TLRA 2C26A 1KEGL 2UWEA 3U7YH 2AEQH 2CLVB 3VD9A 3IJSB 5KBNC 2AKRB 4UU9B 4J4PA 3QJHB 2EDYA 3EYSL 3PNWB 4JPKH 5C6PB 3UO1H 3U9UB 1IGFL 5ALBL 3IXTB 5EO0B 4ONOA 4HXBH 4R0LC 2MKLC 1SY6H 1BQLH 4WDIB 3O3BA 3PIQB 4NPYB 1TENA 5KSUB 3HA0A 1OQOA 4YHMH 1RU9H 1P9MC 2R29H 5C07D 5M95B 3N1QC 4L3EA 5LAXB 4JPKL 1MCFA 3SJVB 5KS9A 3BH9A 3CZFA 2FBJH 1MAML 1RUAH 4MD4A 3HNVH 4BZ1H 5KVEH 1T2QH 4HXBL 2KKQA 3A6BL 4F7TB 5F88A 1T83A 3R8QA 5IV2B 2BNRE 1FL6B 5J89A 1XMWA 3QAZB 1SY6L 4EVNB 4ODHL 2LAGB 1MQKH 1BQLL 1RZFL 4QHNB 1I8MB 1AY1H 4HK3J 1U8OA 2PXYC 4GRLC 1LDSA 2ZZUT 2PO6C 1RU9L 1DVFB 3T0ED 2R29L 4GT7A 4O2FB 4RA0C 3GMLB 2DLEA 4P46A 2FBJL 1KCVL 2VLLB 1RUAL 4RWYH 1KBGH 3GB7B 2ZSVA 4WUUD 3VFRB 1G6VK 4M6ML 4BZ1L 5KVEL 3WNPA 1T2QL 4ZNEE 3V79C 4P5MB 3IU3A 3OKMB 4Y8AA 4J4PD 4KI5E 4XP4L 1LILA 1VEOA 4XNQA 5JXAH 5I1CL 4KXZI 3P2TA 3BGMB 4LHUG 2GAZB 2VUOA 2FYYA 3C8KB 3VDBA 2EIDA 1FV1A 1T1XA 2R2CA 4NT6B 3BH9B 5A2FA 4ZO9A 3LN5B 1AXSA 5K33A 1MNUH 5ITFA 4NHCL 4RWYL 4GXUM 2Z93A 3RVUD 2UV3A 3AY4C 5GRXG 5HYJA 1TVDA 2BNRA 1D6EB 4WEUD 3ROLB 2W0FB 2DIJA 2FX9H 4P4KD 1QLRA 4PRIE 3X13B 4EDWH 4Y1AB 5DURD 4ZUVB 4NO5A 4ONHB 2X4NB 3D85B 5J8OA 5D6CB 2C1OA 1U93B 4H5SB 3CSPA 3IDGA 2HLAA 2Z31B 3L3GA 3X12B 3MA7B 2DM7A 5SWSA 4NCC1 1FRGH 3ZZ1A 5LVEA 3MUGA 3TPKA 4GG8A 2E9IA 1S3KL 5JOPD 1NCBL 3MLXH 4P46D 1KJVB 3IJHA 3BHBA 1CDBA 3IDJA 3MJGX 3O6KL 4EDWL 3PP3H 4QHLA 2OLDA 1J1OL 3VGAB 5BRZA 1SEBB 3JWOL 4J3UA 3QIUC 4QHUA 4XWGH 4PREA 3ULVC 1AXIB 1P7QA 4PJ9C 4NOFA 3SE9H 2CGRH 4GFTB 5E2WH 4JO3L 1QR4A 2CKNA 4X6CB 1FRGL 5DQJB 1A6WL 4PJCF 2NY2C 1U8QB 2W9EH 3DJ9A 4ZS7L 1CD1A 5CKAA 4N9GA 3OJDA 1H3WM 4MX7B 4V1DE 5KSBE 2GW5A 4ZO6A 1T20A 5HDQH 2A9ML 3IXAB 5I8CB 3M1BB 1G6RA 5HYJD 1C7SA 3KPTA 2I60L 4AMKH 5JHLH 2BNQB 1WIUA 2BNRD 4CGTA 1JYVA 4XWGL 2FRGP 1J0YA 3JV4B 2BSTA 3WUWA 1Q9LB 1KNOB 1WISA 1WTGT 3VJ6B 3QPQC 4PYGA 3OPZH 1HDMA 5GGTL 5C3TA 3WO4B 3DV6B 3MRBA 5DJ0B 5EZLB 2W9EL 1RFDL 3TC9A 3ELAT 4P2OC 1FVCB 2NR6C 4XP5H 5E6YA 5FYJE 5SWSD 4IOFD 4GRWE 5KVGL 3DURA 1F6AB 3BSZH 1MOEA 4YZFF 3WFCL 5HDQL 4BA8A 5DHVA 3TCXA 4AMKL 4O4YL 1BIIB 3R0MA 4CVZB 2FLRT 4C59B 5C9JA 1HE7A 4DW2L 4X6BA 4YHZH 2VXTH 5E6IC 5BRZD 3AVEA 4P4RA 1EGJL 1P7QD 2Z92A 4PTUA 1IGYA 1VGKB 3IFOB 4P3CH 4P49A 1FAKT 5KSBA 1ZHKA 4F15C 2DJUA 3MFGB 2IPUK 5IROA 4LSDA 2IF7A 4FP8H 5FO9A 4UDUA 2ZNXA 4QT5A 3V6OC 4NKDA 1IAOA 1MHEA 3T08A 3MV9E 3NFPA 5JA9A 1EFXA 2BVQB 4HIEA 1FO0L 1OD7A 4X7TA 1AGCB 1CICB 4LLMB 4HH9A 1OP3H 4LAQL 1O0VA 3V0AC 4LPXA 5IW6A 5FM5M 3SGKC 4NQCB 4Z5RB 4BKLB 5EPMB 4WFFD 2Q1EA 4UV7L 4IRSB 3B4NA 3MJ7A 3W9DB 4OQTL 1EHLL 3FQWA 3IS0X 5I18L 1WF5A 3C5ZC 3DROB 4KVCL 4Q9CA 4HK3N 2D4DA 4WTZG 1D7FA 3CMOH 1A1MA 3N1MC 2HVKB 3GMOA 1EO7A 2GK2A 3MLZH 2RIKA 1NDGB 4OFVA 2P49B 2HP4A 4PJ8C 5J11B 4WEBH 5IG7A 4FRWA 3VD4A 3TN0C 4LFHD 3H9ZA 3GMRA 3HZKA 4TVPD 3IJYB 4HUUB 5CSGA 3VXRE 4P9HH 1YEEL 4XMPL 3KWWB 4J7RA 4PTTB 1SBSH 4JZNA 4YHNB 3CMOL 4CNIA 4NN6B 5IOPB 1EFXD 2B0SL 4BK4A 1VSCA 5DHYA 4U1KB 3OKKB 1HILA 5FO7A 4XZUA 1NCWH 3AU1A 3PG2A 2VL5B 1JHLH 5F1SA 3GSNH 3WS6C 4R4FH 1OGAE 4KJWD 4R9HA 3GIZL 5B3NA 3SBWC 2HN7B 3SCMA 2RCSH 1G7HA 3VFVB 4AIXA 2DQUL 4G6JH 1OTUC 3MV8E 1T1WA 1CFSA 5F3HB 4GXVH 4P59H 4H26B 4FXKB 2XT1B 3F12A 4ESKA 1A64A 4G7YH 3LMJH 4L4VB 4P2QE 1JHLL 4NKMB 4NUJA 4MB4A 4WTWA 4EUPG 3QUMA 3NN8B 4RZCA 3T09A 5EBWA 2NW3B 3OGCB 1NJ9A 1IKNC 4I0CC 2I07A 2RCSL 2X4UA 3OAZH 2EH7L 3WE6B 2F53A 5AZ2L 2HVJB 2OXGA 4JDTL 4NQXB 1BX2B 1YEJL 5EBMB 1DP0A 2WIIB 4R0LA 4K3HA 5MI0B 3RQ3A 3GJFA 2YRPA 1V5JA 1KENL 4P59L 1DCLA 5DK0A 1XGPA 3D2UA 5J6HB 3RTQB 1PQZB 4Z7WF 5DHXB 1I3GH 1L0YA 1QFWI 1QSFE 3IFPB 3JBG7 2I24N 4HLZG 4HS6B 4KK5C 5EZIL 3QIWC 4BZ2L 4WW2F 4DTGH 1LEGB 3HRZB 5SWQA 4EQ3A 1OB1A 1BP3B 1UWXH 2C3VA 5J06A 3JTSB 4NC0B 2JB6A 3MUJA 4GJTB 1FNLA 3MV8A 5LGJB 5L2KE 3DGGA 3B83A 4NO3B 1AKJB 4CMHC 1V8HA 2JCCE 2AXGB 3BKJH 1MJ8H 1P7KB 1YN7A 2HTLD 2APWA 4MXVF 5D2LB 3SCMD 3C6LA 1R3IL 4LLYA 1SYVB 5B21A 3M8OL 4P2QA 4JRXE 1JRHI 5EOTA 1U8LA 3CFKA 3CX2A 3VRLE 5C0GB 5A43C 4PJXB 1ETZB 4NZRH 4OCMC 1N59A 1VFUA 4OGXH 3K0WA 1SJEA 3WEXA 2C7UA 4QHMB 5DR5L 5T33H 1KCRH 2B5IC 4K9EL 2V2TB 4ZD3L 2VMFA 1IC7H 2W9DH 4I18C 2GT9A 2VZSA 5JW3L 3C8DA 4JHWL 5C0CE 4OGYH 3BKJL 1MJ8L 1T7VA 1U2HA 3MRDB 2A83A 3J7HA 1GGCL 4YHIA 2F53D 3EGSA 3C87A 5DGQA 3O6FC 5IVOA 2ZSWA 1I4FA 3LVEA 5F7LB 3EYFA 3QBTB 4JM2B 1MFCH 2VDQL 1T5WA 3ARYA 15C8L 3MJ8B 3D2UD 4JPVH 1RHHA 4OCYL 3ULVE 5AYQA 2EDBA 1D6VH 5SV4A 4LQ1A 1JTTA 2RFXB 2KL6A 4M3KB 5L2KA 2VIRB 3QULB 2PNDA 1SVZA 1ZHNB 4LCWE 5CJBA 3TH4T 4M7JH 3F6LA 1URLA 3AY4A 4OIIL 4XNXH 2XA8H 3MC0A 3MRFA 5DRWA 1G7IA 1LWRA 2H45A 5DDHB 2FCBA 3E6HB 4CDGC 3RZCC 4JRXA 2QKIB 1UQSA 3MV8D 1X6LA 1EXUA 3NCBB 3V4UL 4TUOB 5FUCE 1TIUA 4K3GA 5D9SB 3O2WL 3OKEB 1G7PB 3O0RH 2FR4A 3C6LD 4TUKH 4JPVL 3VXNA 4ELME 1A6PA 2FHCA 4K23L 3F7YB 4M6AA 4ZOEA 5TDOB 4DFIA 5DF0A 4TULL 4X4XB 4UIMB 4LHUA 2CDEB 2NZ9D 3NIDE 4KK8D 4M7JL 5E8NA 2M1KA 4R4ND 1U8NB 3GM8A 2XA8L 3HUJF 2WW8A 5GGVH 2N56A 5E70A 5EU5B 3AAZA 2X44D 1SBBA 1HHHB 5I15L 2V6HA 2B1AH 1JI1A 3HRPA 3RZWA 1JGDB 4Z18A 2XQBH 4PJ9A 1VKXB 4NUGL 2P7TA 5I0DA 1RK0B 1XGYL 1KJMB 4BQCA 2D9CA 4OZHF 4LCWA 4M7LT 3BUYA 4AK1A 4XCCH 4S1RL 5F1IB 3LRSB 2F58L 3HCVB 2BY1A 4P3WA 3LSOB 4D0CA 1A9EA 5F8RC 1A4KB 2DF3A 2JKXA 5INCB 3S96A 1G9NL 1ZSDB 4YDVA 4Z0BH 1IAII 1OP5H 4CW1A 5DJXB 1MAJA 5L2KD 5F89A 4PGDA 3O11B 2FJFA 2W1NA 1W0YT 3PWPE 2BY0A 1X5FA 3G6DH 5HHQB 3V6OE 5EWIL 4JFFE 1A7BA 1MCRA 3RWDB 5IMOB 4KKLC 4JRXD 5AAMA 2AJSH 4JFOA 1KEMH 5M7QA 2GYSA 5A2KH 3FQNA 5DS8B 3MTRA 4M6NL 3BQUA 1VFAA 2ATKA 1EEUA 2NTSP 3EOBA 1DQJA 1P5VA 2VISA 3WSQL 4NQEB 4Z0BL 4DGIL 1WFOA 3LOWA 1A7RL 2NMSA 5I9QB 1MCIA 3SDYL 3ZL4H 1ZLSH 3TNMB 3V0VA 4K3JH 4OCSL 4LHUD 2DLGA 3G6DL 4LPUA 1YEHH 1TQCB 1ZT7A 1IC1A 4YAQB 5KAQG 4PJGF 1R0AH 1YEDA 4JJ5A 7FABL 1U91A 4DVBB 4R90L 5I17A 2AJSL 1I9JL 2ID5A 1G9ML 5EC2B 1CN4A 2IJ0C 1YEKL 2V5MA 5F7DA 1C5CL 1K2DB 1T7XA 3CD4A 3IFLH 2D3VA 3QRFM 2X4PA 1N5AA 2ERJB 3BIKA 2ADFH 1PLGL 4PJ9D 1NGWB 1NKOA 3A0OA 5DMGD 1CVSC 3QQ4B 4RGOH 4FQXC 4AT6B 4LCWD 3RY5A 4PP1D 5E9DE 1FZKB 4DFHA 1HYRC 5HPMB 4PP2B 3RJQB 4JFFA 4G8GE 43C9A 4ZPVB 2BSSB 2Q76B 1J87A 2M2DA 4PR5B 1DFBH 4YXLL 2R2BA 3V95A 1JN6B 1AO7E 5I1DB 2XQYK 2ADFL 3VMOA 2EIZA 1KLGB 2A74A 2AK4A 4MA8L 4X7DC 1MI5E 1VACB 1B0WA 1MCSA 4RGOL 4LPCA 4P2YA 4ZXBB 5C08E 5IBUG 3BQUD 3BKYL 2VDKL 2AERT 1GOHA 1U3HC 2EKSB 4HH8A 1N4XH 3MOBL 1SYSB 4YHKH 3Q5OA 2E6JA 2PCPB 3CVHL 4LCIL 1OSZB 1R24B 3ILQD 2AQ3A 5DSCB 4Y4HB 5GGSY 2ICES 5BV7C 3GRWL 4I5BB 3S37X 1KUMA 2VAAB 1JUFA 1Q9OB 4F7MA 4APQB 2YD7A 4D3CH 2MQ0A 4P5TA 1CDGA 5AD0B 2I25N 3GJEB 4I48A 3KYOA 1XGTB 3WIFA 3QUYB 1FVDB 2VWEC 1RUPH 1T0MB 3VCLB 1RIVL 4M1GL 4M61A 5FKAA 1FFOA 3VA2C 5C0RH 1CZ8H 2L0DA 5D1ZA 1KLUA 4P23A 5FK9B 4Y19E 1KTDB 3T04D 1I8IA 2ADJB 4UBDD 5JPNB 1EVTC 4PRIB 1H9VA 1MFEH 3H8NA 2WV3A 4N5EC 1DQLL 3WNOA 3LCYA 1WZMA 2CLZB 3STZB 5BVJA 3QFDB 2JE8A 2DMBA 2ADGA 1EEZA 4WTZA 1NANI 2FJGB 2AK4D 4JCMA 3GGWA 4NNYB 3TV3H 1PVHA 3BZ4A 5FYLD 5TE7H 1DE4A 4MMZC 1ZA6B 2FB4H 3QWOA 3BDYH 2R1XB 3UAJD 1F8TL 3VFSB 1E4XL 5I16B 5IBTH 1OP3K 3RX5A 3X14B 2EDOA 1KGCE 1JHKH 1NPUA 3EJYC 1CE6A 1JNNH 2HJFA 1RZKC 4ZTPH 1OW0A 1HYSC 2GUOA 1MFEL 2R69L 1I8LA 4U4BA 5FKPA 5LXGH 1XF5A 1DLHB 2MCPL 2Z4QA 3VD5A 4FS0A 32C2B 5SX5H 1KC5H 3QWQB 4E41E 3TV3L 3EO1B 3QNYB 1L7TH 1ONQA 2HAZA 4G9FE 3MLWH 5FDWA 2V7NA 3VXTA 3DVGB 2FB4L 4Y16B 1VADA 5C0IB 1WEJH 2D7QA 4I3SL 1U8HA 2N7AA 4IIQB 4P5TD 1N6QH 5B39G 4HAGA 2JF1A 3T77B 4JFEA 2IADA 1CFNA 1XFPA 5T1DH 5C8JA 5H2BA 5F9WC 3C2AL 4DEPB 1JNNL 4QEGA 2J8UA 1F00I 1JZ3A 4V1DB 3RVXD 2YC1B 2OJEA 4OLYL 4X99B 4XMKL 5I8OL 1JF1B 3BPLC 2IC2A 5D1ZD 4P23D 5F9JB 4BSVA 3NMEA 3U4EB 1NLBL 5DA4A 1QLFA 1D5XA 3V9FA 3OKLB 3CPLA 4R96B 2DIAA 3MLWL 4OLUH 3VMPA 3MLPA 1OAXL 3WNLA 4BELD 4PB0L 5I73C 1WBZB 1MAKA 4OCRL 5DC4B 5A40E 3OAUL 4QXUH 4Y4KB 3KPPA 4EUPA 1CFVL 3D18A 2YA2A 3RL1B 1N0XL 3WXWH 4JFDE 1IMHC 2EDTA 4PJFE 5DUPH 3SOBL 5CJOL 4ZUTA 2Q7YA 4EOWH 5E1AB 3CZJA 4Q9QL 1ZMYA 2CK2A 3D3VA 3I6KB 5GXBB 5KOMC 1MCWM 4ZS6C 2VITB 2A0LD 4GKNA 2IANA 3D39A 2XKNA 2MMXA 2RB8A 3EYVB 4JREC 4RGNC 3BT2H 3TVMB 2O5XH 3EDEA 4MA1B 1WAAF 4BQ8A 3U7WL 1ADQH 3MRPA 4OZGF 2E7LC 1MUJB 1OGTA 4KAQH 1TJHH 2IEPA 1LK2B 3B3IB 5T1KA 1MCCA 5TDNA 4X7SH 1CDCA 1AE6H 2XA3A 1KYOK 4OF0A 1JWSB 4BFGA 4HKXB 3VXOA 5D72H 1TPXC 3BP4B 2PW1A 5ILTH 1JE6A 4MQ7B 4JFED 4YXKL 4LCYB 4XPHH 2FLBT 3MV9B 4PJEE 1ZS8A 5D1QB 2WSKA 4N8VA 4F57H 5I66B 4JQVA 2O5XL 3ZYOA 2CR3A 3ROOB 3THMH 1FIGH 4YGAB 3MBXL 1C12A 4K7FB 4PUBL 1PG7L 4X7SL 4U6XB 4JFDA 1ORQB 4U05A 1S7XB 1RIHH 1U92B 3RUGE 5GZND 2AV1B 5MERA 2V9QA 2AXJA 3PF2A 2VZ3A 4AQ1B 3W5NA 1IKFL 1INDH 1G7LA 2WUBL 3K80A 4XPBH 5ENWA 3REWB 5KVFL 4UOJA 5GRYA 1KCSL 5ID1B 1RULL 5ESAA 4IDJH 2CRZA 1UB6B 1MIEL 1UWXK 2CDGB 3D3VD 3THML 1LNUA 1I3VA 1R3JA 1AHWC 4MJIE 2IAND 3FB5A 3D39D 3V8OA 1S7VA 5FYKH 3OXSB 1M05B 4LLWA 5TQ2L 2NNAB 2IQAA 3IDMA 4X6CF 4K7PY 4WI9A 2BMKB 4YC2C 2FL5A 5T1KD 3I3BA 3BZEB 4XPBL 4PJEA 4M5YH 5EOCH 4X4YA 1CXKA 2B4CC 4XTRD 2GSIB 3V6FB 2VR9A 3IKKA 2VQTA 1TVBB 3PHOA 3VXRB 1J0HA 1H5BC 1EAJA 1FC1A 3ZYJA 4GUPB 5D7IE 1ZT4A 1J8HE 2G75A 5C7XH 3MLYL 1CXFA 1ZLUH 3TIDA 3UJIL 4DZBB 1XGUA 3SGJC 2Q7NA 3SE4A 1YNLH 3WUZA 2X9YA 4WV1C 3MRKB 3QCVL 1P4LA 3TJEH 3QEHA 4JKPH 1OGAB 3RIAK 4M5YL 1S7UB 1M71A 2XKSA 4AL8H 4RIRB 5BJTB 4N0FA 5K9OA 1N64L 1JFQL 5HHME 1BJ1J 4ORZC 1Y0LA 5L6YH 1RZIB 2NY0D 2A1WH 5MEOB 2ZOLB 3C5SA 5C0ND 5L8LB 1BVLA 4X80H 5D7SH 3SGEH 4LARL 3DLQR 1PSKL 2A6KB 1E6OH 5DA0B 1YNLL 3FT2B 1OM3H 2VJXA 1ORSB 4WENB 5L8JB 4JY6A 2Q6WA 3CLFH 2KPNA 5EC1A 2OMNA 3SGDH 3IDUA 3MYZA 3UBXB 2PXYB 1TQBC 4GRLB 1F97A 5CSZA 3EJJX 4PS4L 4AL8L 1T0NA 2XWBB 5DRZA 2XV6B 4YHYC 4K8RH 5ACMA 4GW5B 5IR1B 4LF3B 4RDQG 1FNGA 3I85A 1H3GA 3CSYA 2X40A 1JWUA 4HUWB 4K94C 5HHOE 4X80L 4OCXL 4QRTB 1EH9A 1NAMA 3PV6B 1OLLA 2DTML 5JIKA 4QO1A 1XGQB 4QTIH 5FO8A 2AJ3B 4W4OC 1NFDA 3K7UA 1BZ9A 4P0DA 5DQ9A 5J12C 1OTSC 3ZKQD 2ZJSL 2VWEE 1GIGL 4K8RL 2XN9E 1YECL 3NACL 4DUWA 4N5UA 3LPGA 3WKNA 3IAGC 2E27H 5BW7C 4I0PB 3SKNB 4L4TB 4KU1A 3G5YB 3CH1A 3RWGB 1U3YA 4XCEB 4G8EA 4EI5A 4QTIL 4YLQT 3BISA 5A3IC 3NAAL 1GOGA 5C6TH 4J23A 3EUUA 1U3HA 1LD9A 1IARB 3MXVH 4XCYB 5F7EH 5CJXA 2IGFH 3G6JE 3BZFB 5BZWA 4GG6A 1N8ZB 5FB8A 2NY6C 4G8IB 2GFBA 5JO5B 1Y6MR 3Q6FA 3HG1B 8FABB 5DVMA 4CL7A 2ZUYA 5L9DL 4QLRA 4Z6AT 1A7NL 1U8JA 5DI8B 2NY1C 4NDMB 1Z3GH 2R2HA 3OAYH 5ADOH 1QD0A 3PWJB 1UWEL 4KUCF 4JPWH 2HRLA 3I84A 5CMAA 3OJMB 1JCKA 3NFNA 4G5ZL 2GEEA 5HGDA 4ZFOL 4EIZC 3GMPA 3KDMB 1KCLA 2IGFL 3FT3A 4WUKH 4TYUA 5E7BA 1DUYB 2XZQL 4I4WB 2NY2B 4X9BA 5MEPB 3SDDB 3WO3B 1D5IH 2ARJB 3GSWA 4GW4A 3SE8H 4HCRL 4F33B 4YHPA 2I9TB 5EU7C 5ICYB 2EDWA 1MRCL 1X7QA 3ARGC 2H32A 5JORB 5JW4Q 3JTTB 4ELMB 1NUGA 4YDKH 3MRMB 5BVPL 4UQ2B 3SDAC 2WP3O 4EI5D 3KGRA 3BESR 2CLRA 1MFAL 4OIAA 4HG4K 4NO0A 3ULUE 2K9UA 3HTLX 1FJ1B 1A7PL 1S9XB 3OB8A 4P2OB 3QUXC 4YPGA 4KHTH 1NL0L 1YNKH 3UTOA 3E3QC 5FYKU 5TQ0H 5EU3B 4ODUB 1RI8A 5HBBA 5I19L 3UJJL 4RGNE 2AJYH 3DETC 1XAUA 4TSBH 1WBYA 4NM8H 5E6IB 3MYJA 1V7MH 1XR9A 5D7LE 4XXCA 1T03H 4PJIA 5KSAA 5IIEB 1HH9B 3WFBH 3IDIB 3LEXB 3QIBC 1Z9OA 1T89C 4KHTL 3L9RA 2AJVL 1YNKL 3PWPB 4RMQA 5FOBB 4I2XE 4KDVA 3MNZB 1E4KC 1P1ZB 2ZCHH 2RJMA 3ARBA 3NZHL 3DO7B 3VXMA 3T0DA 2P5WE 2EE3A 3QG6A 4MAUL 4QOKE 5D2LF 4C83B 2J1KA 5HI4D 2HFEA 1KJ3H 2AJYL 1VERA 1GPOH 4TSBL 4LSQH 1A5FH 3H7BA 4H20H 2EXYD 3QUZC 1UXSB 1QBAA 1D5ZB 2XTJB 3KPSE 1IEBA 1BWWA 2E6PA 4PJXF 5FUOH 1DQMH 3LHPL 2HT3D 3S35X 3GI8H 3L6FA 4LU5H 4NO0D 1A6UH 3A67H 1BFVH 4CVXA 3BKCH 3BX7C 2NZIA 5DJYA 3H9SE 3H0TA 1BWMA 3GBML 4QCIA 2YPVH 2R1YB 3G5ZA 1IAMA 2HJLB 2BVUA 1RJZB 1DQDL 1GPOL 3RDTA 5ICXB 5KN5B 4H20L 3C5ZB 5D7LA 5E5RB 1IAKA 3LKPA 3VRIA 3F8UB 4NRZA 4JM2F 4HIIA 2X09A 4JM4H 1AQDB 1KULA 4HUXB 1DQML 2IH3A 3GI8L 2DJSA 5E9DB 4ISVA 3MACH 2GSGB 2FNBA 1UVQA 5KSAD 3A67L 1BFVL 2YK1H 1WFNA 3IF1A 4G8GB 1BJMA 2P5WA 3NA9H 4Y4FC 4AQOA 4QOKA 2XOTA 3TN0B 2OR7A 4ZUSA 2AJZA 3WNKA 1ZXQA 4AM0B 5MHSE 1AO7B 4ZO7A 4LLDA 3BH8B 3D0LA 3ARBD 1QTYT 3CDGA 4GRMB 3VXMD 5DFVC 2D7MA 4E5XB 2AGJL 2NPLX 1KIPA 3NIGF 4P2RB 4CUCA 1B4JH 5D70L 2LE9A 5C08B 3AS2A 4Q74A 3ULUD 5EULV 5IKCA 3ES6A 5E94A 4NZJA 2XQYG 1ITBB 4GMTH 4LLVA 3UTZB 4JDZB 3P0YL 3NA9L 1NGPH 3KYNB 3JWNC 4ODVL 1IT9L 2EYRB 1DDHB 4X7FC 5AZEH 1XF2B 3U83A 1CFBA 2CIKA 4TTDD 1HXMB 2D03H 3W39A 4H88L 4S1DC 4U1JA 4JLRA 3RKDD 1IFHH 4ELKB 1HSAB 4IOIB 1J8KA 4LCCC 4JR9L 2DQEL 3OKNA 1GZQB 4XC1L 2JK5B 1U0QA 5DJCB 3RDTD 4JFXB 5E2VL 1ZEAL 5D7LD 4YHLL 5D7JC 1QNZH 3KXFE 3PABA 3VXUE 3PXHA 1EV2E 4MZ2A 2FEDD 2O93L 3RBSA 1UACL 3T65B 4NBXB 4PG9A 3L3DA 3TT1H 4TPRL 5K9JL 5D2NA 2P5WD 4Y19B 4QOKD 4GAFB 4H25B 1U8MB 1JZ7A 4YGVB 2VNCA 3QZWG 4IRJD 3PDOA 1XGRB 5HYIA 5DQDL 3SGJA 3WJLC 4MWFA 5IFHH 3FCTA 4O9HL 1UCTA 3DBXA 2OZ4A 1YPZE 3EDJA 4FHBD 4WHDA 3WMSA 3RU8L 5L7XH 2ARJQ 1B0RB 1DN0B 4DOHB 3DSFL 2KQNA 4U6YA 5E2JA 5F6IB 3I3EA 3LN4A 4A6YA 1Q1JH 5BMFL 4YR6B 2DICA 1BVKB 2PW2A 1IQDB 3MOQA 4KI1A 2DI7A 5EA0H 3HI5H 1D5MB 4CMHB 5DEGB 1QRNB 1FQ9C 1YN6B 1KN2L 1EEYA 3Q2CA 4UIKL 4IOSD 4MSWB 3TNNB 3GSVB 3KXFA 1JMXA 4S0TD 1AQKH 1YEFL 1YMHB 3G04B 3CCHA 5E95B 4E41B 3EYQD 2QQKL 2UVFA 5DJ2A 2CUMA 4G6AC 4G9FB 4KH2A 4MNQE 4MNGA 5L7XL 3QCTH 3QQ3A 3X3GH 3DMMB 3KYKH 4XHJC 3HE6C 4XBGB 1NUNB 4G7VH 1R5IA 1NCUA 1Q1JL 1YYLH 4YDJB 3K2UH 2B5IB 2P5EB 5FECB 5C0EA 3UZVB 5BQ7A 1HI6B 3PHSA 1DBAH 3BEWA 1MHCB 1AGFA 2EDLA 4XVSL 3K46A 3O41A 1AI1H 1Q72H 3PJSB 5EZJA 2O61A 1X9QA 1ZTXL 4HUNB 4NWTL 4YXHH 1G7QB 4RSVA 1YPZA 4M8QB 1G6RL 3I50H 2Q8AH 3O6FB 3LD8C 5DHVH 3O9WC 5HYQA 2AJXH 2AJUH 2OL3A 2FX8L 4HGMA 5IQ9A 3QCTL 4HX1B 3B2UC 3K2UL 5SWZE 1JGVL 4PGEA 5BCAA 1B2WL 5JQ6L 4R7NA 1VPOH 5H8DA 1PY9A 3KPLA 1T1YA 4U1NB 4WI7A 4LRNH 4PJFB 4C56E 1IM3A 1ZLUK 1Q72L 4JZJA 3WHE0 5T1LB 4L8SA 2EH8H 1RV6X 1IZJA 3RZCB 4I1NB 4D0DB 3LKOA 2W65B 1OT1A 2VQUA 3F6IA 4KKAC 5EU7E 4ALAH 1TXKA 4Y5YA 1SM3L 1J86A 4KI5F 4LPWA 3WIHA 1Q0YL 4RRPG 2EDHA 4LNRB 2XWJB 5IJVA 12E8H 3KXFD 5JUEH 4ZAKA 3WFEL 1I7TB 3L3OA 1ZHLA 1RZJL 3WIIH 4XVTH 4LRNL 1KF9B 5FYJH 3NCJH 4NN5C 3RGHA 5GGSB 5I6XB 4TVPL 5T5FL 2EH8L 2DWEB 1HHGB 1NGYA 2YA0A 3E3QE 3GKWL 5DD6B 4MJ6B 1RMFH 4KPHH 3RNKB 1ZV5A 1NQBA 4K3DH 4N0UE 1NGQH 1FGVH 4GAYA 4FXGA 4HPOH 3CUPB 1T04A 2DMCA 4MJ2A 4GQPH 5E2TH 4HWBH 4C56A 4BK5A 1MFDH 4JRYA 5JTWA 4PRNA 3ZT5A 1X4ZA 3AM8A 3F65A 1TNMA 1HCFX 1D5BB 3QRGH 3Q48A 4L4JA 5F1NB 3GFUA 4FQLL 2F74A 3MBEC 1U58B 3NH7L 1DBJL 1WZLA 5JHDE 5FHAL 2YHGA 3BEVB 4Q0XH 1XIWA 3MR9B 3VFNB 1YZZA 3AROA 5I76A 1UXWB 4HS8H 1RZ8B 1RMFL 4KPHL 4M7LH 2Y6SC 1OY3B 3I2CL 1OAKH 3P73A 1H0DA 4PJ7B 1QR1A 2C4XA 5E2TL 1FL5A 5KJRH 1S8DA 3MJ9A 3RWFA 4XAKD 3ARDA 1YQVH 3QRGL 4TNVK 4XNYH 2BX5A 4DVRH 4IMLB 1TFHA 1HHKB 4ZAKD 1MHHB 5DK2B 2EC8A 4CU7A 4WU5B 2BSRB 4PJCE 2NY6D 1AH1A 1XR8B 1R3KB 5B8CA 3HI6L 4OTXL 9CGTA 3H3PH 4LAJH 4OKVB 4OF7A 2YPKA 1EBAA 3NGBC 3RI5F 4HS8L 1JHTA 2QR0A 3P0VH 4N0UA 1ACYL 4RBPH 1A6ZA 2V7HA 3NVQA 1FCGA 4RNRA 3HZMA 4M1DH 1LE9B 5GJSH 4HWNA 4LBEA 5CUSH 5CSBA 1J8HB 4Y2DA 3UTPE 1UFUA 1FN4B 2HFFA 2Y07H 4OV6F 4XNYL 2J2ZA 3GMQB 3WHXA 5J56B 3DRTA 3QIBA 4P99A 5F3BB 1C5BH 2ADIB 2DQHH 4L1DA 3MUHL 4JCLA 5HYEA 2ICWI 3CXDL 5TH2B 4C56D 4JRYD 3BE1H 1XF4A 2HG5B 1IGIL 3U46B 3QUKA 1MLBA 1PD6A 4LASH 5GHWH 5C07B 1S9YA 4A2MA 4NNXB 2CSPA 1T5XA 4FQHA 1B6UA 3NFSH 2YKLH 1XIWD 5CUSL 3HE7C 2R2EA 2GTZB 4OSUH 4HV8A 1OAYL 1XF3B 4Q97A 4F9PC 4FFYH 4WFED 3M17A 2R4SL 2I5YH 4PJCA 1X5YA 1F3JA 2VYRE 5HJ3A 4YFEA 3HC3H 3EZ8A 3CFEB 3UEZA 3QUML 4EN3C 4NZTH 1E27B 3BE1L 3OB0H 2CXKA 3KLAA 1CTNA 3ARDD 3ECBB 4U1HA 1FE8L 4G80B 1NLDL 1T4KA 1UWGH 4JB9L 3RWCA 3UJTL 3VG9C 5D7KD 3CFJB 3QR2A 5GS0C 1I7RA 2NXZD 1AP2A 3TBTA 1T7YA 4MCZB 1E4WL 1HN1A 3BIBX 2NY3D 5C0FA 2APFA 5BV7B 2YD9A 3QQ9D 4FFYL 4KTEL 3B8SA 4XH2B 2BOBA 2N4IA 1HZHH 4PY7A 2YRLA 3LDBB 3HZYA 4BH7B 1LO5A 3O6MH 4Y2DD 3M45A 3KNBB 1NEUA 5DEFA 1L9NA 5T3ZE 1HXYB 1UJTA 3MV7E 2XN9B 3P4OA 3UCRA 4P3DB 1I1AA 1PYWB 2X4TB 4WRLA 1FNEB 4AG4H 2BXYA 5IMKB 1WCBB 2HMIC 3HFMH 5CD5C 4LOUC 5T5NF 4Q9RH 2EO1A 5HHXH 2YXMA 1HZHL 4P4KB 5GRZA 3TCLB 1A9BA 5CBEA 1A4JA 2Z0BA 2HT2D 5KG9A 4YIQB 5GIRA 5I1IL 4FQQB 3SEPA 1A6VL 3AXLA 2DBLL 4OZ4A 3MXWH 1BZQK 3EFFA 2UYLB 2LTQB 1M7DA 2E7HA 1WQVT 1IC4H 3IDNB 4ORGB 4U7MA 1F45A 1KIQA 5BOZG 3HC4L 2QLVB 2DOCA 4O58L 5FYJU 3ULSB 4HJJH 2BHZA 4L5FH 2FZ3B 3L7EA 4UAOC 5ANMB 2A6DB 3R06B 3GBNH 3VWKA 2HTKC 4U7SA 2ZPKH 3AUVA 3MRGB 4WI6A 4XNQB 3VXQB 2XZZA 3VI4E 5E4EC 4ONGH 3T8XB 1NGZA 4AEEA 4UDTB 2YBRB 5LBSH 2X9XA 4OBSA 3FZUC 4XXDA 5F9WB 2O5ZH 1AC0A 3BP7A 4FZEL 3GEWB 4MJ5B 4OD2B 3W11C 5IB4A 3MRNA 5I1AA 1I1AD 4PV8B 2Z93B 1UB5B 5D71H 3BPLB 5K9KA 4L5FL 2DAVA 3BN9C 3VA6A 3ISWA 1AIFA 1MVUA 1NBZA 2X4OB 3ULVH 4RGMC 2FIRT 4FABL 1IGCH 3G5VA 3NCMA 1YUHB 2ZPKL 1MJJA 4YE4H 2CMRH 2R0WH 3D0VA 4MXQC 1KIUA 5I73B 4B7LA 2C1OB 4KZDL 3KPNB 3V6BR 4ZFFA 5E24E 2DTSA 1TZHB 4B0MM 3QJFB 2O5ZL 1K4CA 4O2EB 4QXTA 4GAGH 4L9LC 5JR1L 3B6SA 5SWSB 4X6FB 3RVWD 1RAMA 3KG5A 3IYLW 3L95B 2V9RA 4GG8B 3UTTE 5FUZL 1NCAH 5CHNB 3CU7A 3TO2A 1MFNA 1UYWL 1HEZB 3K8MA 3QZWA 3RPIA 4BJLA 1C5DB 4JREB 4RGNB 5E6ZA 5ACZA 1GVIA 5DC0A 1FZMA 3W81A 3HE6A 3RY6C 3EOTH 4KFZC 2WM0A 4OF8A 1P4IH 3RVTD 4PLKD 1P5UA 1I1YA 1P7QB 1ZWIB 2X9WA 2EECA 2APVA 2YEZB 3VWKD 3LQAC 4IMKC 4LLUA 1H3PH 2EYSA 4GAGL 4OFYD 2VXSL 2CIIA 1FBIL 1G7MA 3EJZD 1A02N 1A8JH 2DM4A 2HLFD 3E6FB 2JCCF 2AXFB 2B1HL 3O9WA 4UNVA 3OJDB 1KG0B 1DLFH 3B43A 4U6VH 2GTWA 1SHMA 4YUEL 4RAHA 1CQKA 5GZOD 1T20B 1Y18B 3FRUA 1AD9A 5I1EH 3ARUA 1QSEB 1EMTH 2DI9A 4KJPC 2A9NH 2RBLA 4PJAE 1P84J 2VXUL 2D7OA 3I75A 3SO5A 1JZ5A 3VRLF 4YEFA 4WW1A 1H3PL 5F7KC 1KB5H 4Y89A 1F11B 1HKFA 4TSCL 3S36H 4DK6A 5I30H 5JPMA 1LVEA 4KKCC 4IS6A 3KJ6L 5HGHB 1KB9J 3B9KD 4DAGH 3MRLB 4Z7WA 1PX3A 1DQQB 1S78D 2OTUB 5TF0A 4R97B 2IAMA 4ZNCD 1BD2E 3FOMA 3TWCL 3ARWA 3TIEB 3VFUB 1EMTL 3O45B 4WW2A 3U6RA 4N0YH 5DMIL 5LGHL 3ZKMD 5HI3D 2VLKE 3QAZC 3ULVF 1B0GB 2J7LA 4X6BB 1GHFH 5I30L 4OZIB 4B50A 2FJHB 1RJLB 3B5HA 4YC2B 4LRIA 2R23B 4PTUB 1IGYB 3RNQA 1B88A 1EAPB 2WBJB 2ATPA 5C0AE 5IK3A 4M5ZL 4CAGA 3RAJH 5JQHC 2NY7L 1BZ7B 3S88H 3N9GH 1H5BB 4Y88A 3IRZA 4JKKA 1IAOB 4N0YL 3O9WD 2W92A 4ZTOH 5E8PA 2BVOA 4ELMF 5CBAB 2H26B 3UYOD 5I8KL 5JDJA 3PQYB 5GISH 5FYLL 1GC1C 1OARH 4RRPA 4ZFGH 5LQBL 3MREB 1GHFL 3QXAA 5DJZB 4WWID 4WV1B 3C60A 3GSNA 3NIDF 4NO2B 4X4ZA 3VXSE 2FECI 3OBAA 5KTEH 3VD3A 2BRRH 3S4SB 3SO3B 2F8VA 1CFQA 35C8H 4ZUWB 1KTKE 3VFGH 4HJGA 3FN0H 2MNUA 4JFHE 3RAJL 1QQDA 5IW6B 3FB6A 3O4LA 4M62H 3CJJA 3MNWA 3N9GL 1YC8A 4DN4H 1P2CA 1RURH 3A6CH 4F7PB 4Z7QE 1TJIL 5J6GA 2GITA 1F90H 3PWUA 1KCUH 2F5AH 4ZTOL 3OR7B 5J3HC 5DVNA 3RI5K 2P8MB 3QDJB 1P6AB 5DMJB 3S9DB 1FYTE 5IQ7H 2IAMD 1K8DB 4OZHE 3RWIA 1NGXB 3BVNA 3QEQE 4BM7A 5M94B 2VABB 1WGOA 1PZ5A 3VXUB 2OSLA 1XZ0B 4G3YL 3VGFA 3CDCA 3QXDB 5C0AA 3VFGL 2E6QA 1TQBB 2Z31C 3CXHJ 4E0RA 5GPRA 3BO8A 2C1PA 1TZIB 4KRMB 4AIZA 3ZKND 4D9LH 5EDXA 3WS3A 1N2RB 5HD8D 3A6CL 5JLZA 1EJOH 4MAYA 3SGDI 5IB1B 1S7SA 1KCUL 3RWEA 2EKJA 4LGPB 3GMRB 4HGWA 3HZKB 5DLML 3O2DH 2RHEA 4YWGL 3VXSA 2A77L 3KPQA 3TBWA 4PJDB 3GUTA 5IBLC 1IE5A 4XBEH 4JZNB 2EDRA 3GSRB 1IL1A 4W6XB 5E8EA 1DR9A 5T3XE 5J12B 5DHYB 1BBDH 5HDBE 5AAWA 1H15B 3KPOA 3FFDA 4UILH 4R3SA 3C60D 2WMPA 2BC4A 2JELL 1FZJB 4JKWA 4NGHL 3O8XA 5E4IA 4OM0L 1FZOA 2AQ1A 1FYTA 3O4LD 5ESVB 1FLRL 3SCMB 4P9ML 4X5WA 4OZHA 3QEQA 4J1UB 4LSSH 5FHBH 3TP4A 4NCDA 3NIFE 1FC2D 1QZ1A 4OLVH 4OZFA 1FFRA 3KPRA 1H3TA 1KPRA 4IHOB 3QI9A 2QADD 2NW2A 2GCYA 2A38A 2Q86B 1EHNA 3QNZA 5LWYH 3O3EA 4UILL 1WC7A 1AGDA 3DV4A 3LPFA 1A6TB 5IVNA 3TBVA 4FFZH 4CBPA 3HC0B 4OKDA 5C0AD 4MD0B 7CGTA 3CDYA 1FAIH 3T3PE 2I07B 3OXRB 1IEAA 4JDVA 1I9EA 4NKIH 3TYFB 4HAFA 4OLVL 2NY1B 4X8XA 4MAYD 4LVNC 2F5BL 4M4PA 4WI3A 4JPIB 1F6LL 3RL2B 4QWWC 3GJFB 1J10A 2Q8BL 1OAQH 1OP9A 1XGPB 3F7VA 4JO4H 4ZQKB 3VXSD 1JZ6A 2VLRE 5SWZB 4W81A 1F4XL 3HPJA 5JW5B 3MCKB 2DQCH 4PJGA 3LRHA 4YFDB 4POZC 2ARWA 3BAEH 5IW3A 4BFIB 4PLJD 4NKIL 1QFOA 4UTBH 3DGGB 2Y23A 1A3RH 1FFPA 3GIVA 3ARGB 5GRJH 4KUZL 1FNSL 3MQIA 4I3GA 3O8XD 1FH5H 1UKSA 1FYTD 4LVHB 3F58H 4JO4L 2J6EH 3QEQD 3T1WA 3SDAB 1TJGH 1Z6JT 4GBXA 2VLJB 4NBYB 4D2NA 1U8LB 3KPRD 3F5WA 2PR4H 5TE4L 4RMVA 1MCBA 3CFKB 2DLHA 3QI9D 4KC3B 1G1YA 4XRCB 4EXPX 5GSVB 2IBZY 1CLZH 1KPUB 3MCG1 3QUXB 4XVJL 4UTBL 5I1JH 1U42A 4KZEH 2DYPA 3P4MA 4JGJA 5E7FA 4IRSC 5GRJL 5C1MB 4UINH 4ODXA 1T1ZA 1NFIA 4M48H 4NQDB 4LKXB 4N0CC 4YNYA 4FN0A 3F58L 4N0RA 4HF5H 4FQPA 4F7CB 4JN2B 2VLRA 2IPTH 2E8YA 3VE0A 4RAUB 3UPRB 2FSEA 1QP1A