2CUHA

Solution structure of the 31st fibronectin type iii domain of the human tenascin x
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
115
structure length
115
Chain Sequence
GSSGSSGPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDIQVTAPGAPPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tenascin-X
publication title Solution structure of the 31st fibronectin type III domain of the human tenascin X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 7
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cuhA01
2WWKT 5CZVH 2J8HA 2P5WB 2X41A 1MJ7H 5C7XH 4PD4J 4MD4A 5H35B 4PRHD 1TCRB 3MRFB 1C08B 2ATPA 5DS8B 4NQEE 1QRKA 3LKPB 2EDHA 4HC1A 1UZ6F 2VSDA 3AROA 4MCZB 4Z76A 4R4FH 1KEGH 3V0AC 4DGYH 3FQNA 3ARWA 5DRXB 1EXUA 4Z7VB 3WO4C 1NKRA 4HJ0D 3B5GA 1CLYL 2JCCE 4JFDE 2HJFA 4ORGB 1L0QA 1OAKL 1LP9E 2VXTH 2E8ZA 3LMJL 3QQ3A 3STLA 1OTTC 1QFWL 4JY4B 3Q6FA 4LRNH 3T0EE 1Z5LA 5EB9A 1F3RB 2OL3A 4PJFE 5C8JB 1R3LA 2CDEB 3GMRA 4Y4HC 3U36B 1NJ9A 32C2A 4P9HH 5GGVL 3SE9L 3AXLB 5KSAC 5LVEA 2P5WE 4CW1B 3M17B 1X5GA 1RMFH 3SO3C 4HKXB 3RX7A 3SY0A 4HT1L 3V6ZB 1FE8L 4QRRB 4HC1H 1OARL 1N2RB 1X5KA 1JZ8A 3LQAL 3EIFA 3L5IA 4KI5F 3CXDH 2KL6A 4Z7VE 4P5TB 4DW2H 2PO6C 4H0IA 4OZHF 5A2JH 3HE6B 2B2XL 3KPNA 2HFTA 1NMCB 2V5TA 4R97C 2VIRA 3IDJB 2OL3H 2GSIA 5C0GB 4RA3A 3ULVH 2VDKL 3N06B 1JL8A 4L4VD 1JHLL 1UH3A 4LP5A 3HAEG 3S34H 4O02L 4K8RH 1W2KT 4F8TA 3FRUA 2B1HL 2VLJD 1W72B 4FG6D 2W07A 4TPRL 2AJSH 4V1DA 5GRUL 3TT1H 5HDQL 4LRIC 3DX7B 5I16A 4G9FA 3WFDH 2XPGA 4HX1B 2K1MA 5JORB 2P46B 5T3XH 4MGXA 4X6FB 3QXWA 5F3HB 1JWUA 2MPAH 3PP3H 4F8QA 2NZ9C 3VD7A 3O4LD 2RAMA 4XP6L 1MCBA 3PIQA 3ZE0E 1VKXA 5DJ6A 4GT7A 3M45A 1J88A 2JELL 5KSUB 3PJSA 1G7LA 1T1WB 4IMLB 4NYLB 3TCLB 5IHBA 1MQKH 5IFHL 5L0QB 3D48R 3K1DA 3GMOB 4XMPL 1IQWL 4CVWA 1MFDL 4H25A 5DEGB 5MHSE 5ALBH 4YGAB 1AY1L 4FS0A 1QQDA 3R1GH 1FNGB 1HHJB 4MSWA 3RWCA 1TZIB 1JIBA 1G1YA 3GJFH 3PWJA 4HUVB 3V79C 3LEYH 2OJEA 4S1SL 4PR5B 1TJHH 1IC1A 2HP4A 3UJJL 4YHYB 4JM4H 3QEUB 2PF6A 4FP8L 4M7ZC 3TC9A 3CFCL 3D25A 3OJMB 4NQED 3RZCD 5J6HA 5BV7H 2QHRL 5T5FH 2CIKA 1JMZA 3MXWL 3SQOH 1SMAA 4Z18A 4UILH 1WIPA 4O51A 1DANT 4MD0B 1LMKA 2XTLA 1MRDL 4LBEB 1OAQL 4MNGE 4JFDD 1KFAL 4YHMH 4WFFE 4N0YH 1ROWA 2MMXA 3L1OL 2OSLB 2WK2A 3O6ML 3CMGA 2CDFB 1CL7L 3T0ED 5FUOH 1TTUA 4ELKA 4LLVB 1FJ1B 5DVMA 5GRVL 4I18C 1T0NA 3BUTA 3U4EB 1KN4L 3KYOA 4YC2C 2MTPA 5IVXA 2F58L 1PKQB 2R0ZL 5BVJA 2P5WD 3BYTA 4PJAF 5CEZE 4P9MH 5LAXB 4U7SA 4P3WA 3P4MB 1F4YH 2Z0BA 2Q7YB 4HS6A 5DEZA 2F9BT 3HR5A 2VZ1A 5F3BB 2JKXA 2R1XB 2V2XB 3V4VH 1Q9WA 4JDVB 2FEEL 4M02A 2IEPA 3PG2A 2D0FA 3RP1A 1UACL 1MI5B 5GS0C 3B9KB 3HZMB 4Z78A 2FGZA 5I18H 1CD8A 4I48A 4FQCH 3BFOA 3KPRB 5TDPB 3O45A 1CQKA 1BOGA 4GKNA 5D1ZA 2H32B 3EDFA 3FO0H 1SJVA 4XPFL 2E27L 2X44D 2FL5B 4N8VB 1Q1JH 2QSTA 2ICWJ 3ZO0A 3RWFB 3MJ9A 2DWEB 4IOFC 4NOBA 1PSKL 1HIMH 5LGHL 3FOLA 5IJVB 1NBZA 4NGHL 5JOEA 4RQQB 2CIIB 5I15H 4MJ4A 4QRRD 3WJJC 3A6OA 1ZVYA 4WW1A 1CI5A 4JB9L 3QNYB 3LIZH 2CLRB 1MI5E 4JFEE 3GI8L 4FFZH 4P5TD 1GAFH 2YBRB 3MCKA 3HE6D 2BFVL 5EU3B 3SE8H 3O2WH 4TVPH 3VMNA 3LKRA 4PG9B 3HC0A 2LU7A 2V7HA 2VABB 3VFUA 2OZ4H 4M5ZL 3D1MC 1EEUA 4L3EB 5E5MB 2R29L 5H8DA 4LPWA 5DGQA 5T1DL 3MXVH 5MHSD 2EYRB 3VI4F 3MJ9H 3IAPA 2YD2A 5HGBB 2GJZB 1YEDA 1FYHB 2DKSA 3ULUH 2HVKA 1N64H 3S96B 5E2UH 4NUJA 2GY5A 3GHEH 4WTZG 3OJVC 5BS0B 3H8NA 2OR7A 2QHLA 4G6FB 1DBAL 4XMKL 4JPVL 1T7YA 2X4UB 4PGBB 5B39B 4QCIB 1NBVL 4DTGL 1NFDA 5C0RH 4QXUH 3KR3H 5CD3B 1GZPA 1D9KA 1HXMA 3KYKL 1MCDA 4L3EE 1ZTXL 2NYYD 1RZGA 4KROC 4S1RH 4YEEA 1SYVB 4JFYA 1F00I 2OQJB 2BSSA 4WFFD 4DKFL 4UQ2B 3W11C 4MAUL 4E5XB 3ZL4H 3SOBL 3DUUB 3G6JA 1QVOB 1XH3A 2RB8A 4KKAD 1DQLL 5BS0E 5EN2A 1DQQA 2JK5B 4ELMA 1V5JA 4PJEA 5CEZD 3KDMB 3VE0B 4O9HH 1LEGA 3P0GB 2YMXL 4H1LA 2FH6A 4RMUA 3FQXA 4HCRL 4JHZA 1UWGH 4HW6A 1RFDH 4YXKH 1NAMA 2NY4C 5F1NB 4RMWA 5BOPA 1BX2A 5DD5L 1QLFA 4XPBL 1MJUH 4PJ8C 2ZUQC 2VR5A 5I74B 3TNMB 3OJDB 3BWAA 3RKDC 3QFDB 4EQ2A 5E8PA 2VLME 2H2PC 3MLRL 5EA0L 4FFVD 1GYAA 3N50A 1SM3H 1UENA 4KQ3L 3AS3A 1QOKA 1WV7T 3ARYA 3FFDA 5CILL 3VFWB 3QDMA 4G8FB 4KVNH 4JHBA 3NA9H 3BE1L 4FXKB 2BOBB 2HFEB 3AVEA 3PQYA 5IHZB 1NAMH 2A6JB 3ECBB 4LCIH 3SJVA 4Q0XH 4RGMC 4DKDC 4PJIA 1FBIL 1MI5D 4JFED 4OSUH 4BK5A 5C0JB 2BC4B 4LSRH 2V5MA 3UC0H 2EIZB 2OM5A 2GTWB 1AGFA 4YDKL 1J7VR 1JZ5A 3G6DH 1F3JB 3NFSL 3CFJB 2M2DA 2Y36H 1WAAE 2CMRL 3ARBC 5ID0A 3DETD 3FONB 2R0WL 1EUUA 2DJSA 5DQ9A 4KJPC 4ERSL 2V9RA 2CSPA 4X6CF 5CINL 2W65A 2XWTA 1NUGA 3B5HA 3X11B 4JQIL 5I76B 3GJFB 3MRDB 4CL7A 5DEFB 4Z7UA 4LNVA 1AXSB 1MAKA 2PYEA 4P2QA 3QUML 3UTQB 1JZ3A 2VLRA 1A1NA 1IQDA 3JSSA 1CLYH 1FSKC 4LASL 1SJHA 3LMJH 1XIWB 3W39B 4G6AD 1QFWH 4JGJA 1MLCB 2H41A 3W0WB 2IPUK 2FJGA 2UY6A 4L3ED 3RGVA 5J11B 1IM3A 4LLWA 3MJ8A 3LD8B 2A38A 5ADPL 5GGVH 1CGWA 4XMLL 1IKNA 3MC0A 3WSQL 1CGXA 1XR9A 4ZPTB 3JWOL 4Z9KB 4HT1H 3NFPA 4QY8A 1T5WB 4IRSA 1A3RL 1FE8H 5BS0D 5IG7A 1OARH 3H9SA 1PX4A 2DM4A 3LQAH 4L8SC 1Z9SA 4NQXA 3B9DA 1NL0L 4LCYA 3NCYP 5HVHC 5GXBB 25C8L 2W0KA 3TO4A 3KG5A 2B2XH 4G8IB 3P4OB 2G5BA 4X7DC 3W0WE 1KOAA 4I3RL 3V7MA 3CH8A 1H0DA 2X70A 3DPBA 1ZMYA 1HSBA 4OIAA 3PL6C 4HPYL 3OBAA 1JHLH 3S5LG 5HD8D 4O02H 2FIKA 3NZ8B 4ESKA 3HHRB 4P48A 4TPRH 2VLMD 5GRUH 5HDQH 4B53A 2ICWA 5IF0B 1UJ3C 1K5NA 3SKUD 1UYWL 1VEMA 1LE9A 3NIGF 1DJSA 2J6EL 4YPGB 3GKWL 3V5HA 3QIUB 3FO9B 5ETUA 1VFAA 4OJFL 1FVCA 1ZHNA 4XP6H 1I1YB 1X9QA 1PLGL 3NCEB 4UIKL 2JELH 4RFEA 4CJ1A 4XAKD 3HFML 1KB5A 1JGDA 2D0GA 5GS1B 4BH8B 4QF1A 4WW2C 4Z78B 5IFHH 2P7TA 4PJCB 4POZD 2NX5A 4XMPH 2BCKB 3FFCA 1IQWH 5DUBA 3BO8A 3KJ6L 3M1BA 1X5IA 1CE1L 3P9LB 4LLUB 1MFDH 5IQ9B 1FCCA 1PEWA 4UT7L 4NPYB 2BMKB 3QBTB 4HWBA 1AY1H 4KY1L 3GMPA 3NMEA 4AK1A 4HK3J 4FG6C 1RK1B 1QKZL 3MO1A 4F2MB 4U6YA 2EDOA 5T33L 5EDXA 4Z77B 4S1SH 3RJQB 1T6VN 2Q3AA 3UJJH 3G5VA 2FX7L 4FP8H 2PXYA 2YEZB 4YDVB 1RUQL 2XN9A 3CFCH 4K23L 4NSKB 1S9KC 5EO1B 4NFDA 2QHRH 2XY2A 2XKNA 4UTBL 4PJCE 4ZUSB 3KAAA 1KN2L 3SDYL 3DVNB 5JW4N 1MRDH 4U1SB 1OAQH 2F8VA 4WFGE 2Z4QA 4U1KA 1KFAH 3DYOA 4PBWD 5DK0A 3L1OH 3LHPL 4NFBA 4XXCA 3O6MH 5IMKA 5FV2A 1YMMB 1CL7H 2ZOLA 2XXCB 1DBKL 1JTPA 1Z3GL 4D0DA 1I7TB 3QIBC 3BGMB 5FO9A 4PJDB 1KN4H 1B0GB 2Y6SD 2F58H 3QUKB 2R0ZH 1ORSB 3DMMB 3WFEL 2K3TA 1F45A 1WVZA 4ZO7A 3TN0B 2W92A 3BP5B 5DJ0A 4P2YA 1KPUB 1EZVX 3RIFF 1U36A 5JO5B 2IH3B 4RBPH 4KMTL 3VFNB 4NRYB 4OLUH 1UACH 2X4QA 3QFJE 4LFHD 1PBYA 1WBZB 1Z6JT 2VZTA 1EJ6A 3UO1L 1D5XB 1R0AL 2YR3A 1NGYA 1XIWD 3ZE1E 5AUMB 3ZDXE 3W0WD 3C8KA 5TQ2L 3TV3L 3F7YB 5IUSA 3TLRA 2Q3ZA 3WLWD 3KPSA 4WEUD 3NPSC 1UM4L 4XPFH 2E27H 3O3EB 4PJDE 2XNAB 4PG2C 4CNIB 3T0EC 3V6OE 1RUKH 3CFKA 4KRPB 3KXFA 4GRWB 3HZKA 3B6SA 2Z93B 1TTGA 3SKOB 1PSKH 5LGHH 2MCPL 2SEBB 3TYFA 5BW7C 1EFXA 3VW3L 5E9DA 4NGHH 1R3JB 4DOHB 3TA3B 1IFHL 4JB9H 3IJYA 4R0LB 3GI8H 2E7LA 3W2DL 2AAVA 4ZFZB 4MB3A 3QDJB 4U6XB 4IJ3B 4N0CD 1GC1L 2BFVH 4Q9RL 5J7CC 3SGJA 1T89C 1JPTL 8FABB 1T1XA 4M5ZH 2V2WB 1CDIA 5E4IA 3GSNA 4WEMB 4OCYL 2EYTA 1MPAL 2R29H 4W4OC 4ZUTB 5IWLA 1SVCP 1X7QB 3KWWB 3ZKMC 3ME0A 4GRWE 5D70L 3ARED 5T1DH 5EC1A 5EWIL 4OZIF 2I27N 3BHBA 5F7FA 2JIXD 2VLKE 2I5YL 3KGRA 1LILA 4WGWB 1HHGA 1ES0A 4XVUC 1AGDB 5DT1L 3VXSA 5FK9A 2ZUTA 3O6LL 2OMBA 1FFNA 1DBAH 4XMKH 4JPVH 3QHFL 1I1CA 4F7EA 1NCWL 3KPMB 5D6DA 1NBVH 1ZS8B 2H6PA 4DTGH 4P5TC 2R0KL 4XRCB 3HE6C 5ANMA 3GIZL 2D9QB 1NMCC 5DZNA 3KYKH 1ZTXH 1ND0B 3RWHA 1N8ZB 1JFQL 2GHWB 4FQ1L 1M6OB 3R0MA 5I66B 4WFGD 3HRZB 3HE7B 4DKFH 3MV9A 3VXUA 4MAUH 4Y4KD 4JVPA 3SOBH 2W0FA 1BZ9B 1ZHBA 4NNPL 3MRBB 1N0LA 1G7PA 1D5ZB 1DQLH 3IDNB 5C6WH 4Y5VA 4R4ND 5KW9L 1HHKA 5I73C 2IANA 1FL3A 4U1NB 5B8CB 4C57C 3ESUF 5BO1L 2YMXH 2ICCA 3NN8A 3VH8A 3V5KA 4HCRH 4RNRA 4P59L 1GZQA 3BVNA 4L9LA 4XBGB 4HUWA 4GKOA 3V6FA 1CGSL 5DD5H 3QFJD 4XPBH 5JXAL 4Y4FD 3PDGA 2G60L 4ZNEA 2A83A 5L0QC 3GM0A 1JPGB 2GSGB 2ADIB 3ELAT 4J2XA 2NMSA 1TNMA 2A6KA 3OAYK 4PGJA 3QJHB 1OT1A 1ACZA 1JNHA 3OL2A 3MLRH 5EA0H 4TN9A 4BZ2L 4KQ3H 5MEQA 3OXSA 3NAAL 1S9VB 5CILH 2Q87A 4KKAC 3TN0D 4OUUA 2HT2D 3BE1H 3G5ZB 4UAOB 1TVDA 3P4NA 2DQUL 3MMEA 3P9WB 4CVXB 4YHYC 2DKUA 1ZGLM 3LKNA 5C6TH 2XKSA 3K2UL 4OKVA 1FBIH 3H3PL 5JW5B 4K3DL 4LNRA 5E24E 4D9LL 5J57B 4JRXB 2XRAL 3HNSL 4OV5B 4QWWD 5HI3D 4YDKH 1QHPA 1DCLA 2HKHH 5K59E 2O93L 5K93A 5DYOA 2XTJC 1I9IL 3NFSH 2CMRH 2EDNA 5ISZE 2R0WH 3KJ4B 4OLXL 4FFVC 1X5HA 4LLDA 3VFOA 3TNNA 4ERSH 1QFWI 5D1XB 3G08B 5CINH 3RUGE 1RZKL 2BY0A 5EU6A 4JQIH 1OOAA 2B4CC 3BGFC 4P46B 2F5BL 2FR4A 3QNZB 5J6GA 4EBQL 5SX4H 4APQA 3CFDA 4GRLC 3H9ZA 4J3TA 1R6VA 4JRXE 3QUMH 4MA1C 2PETA 2DQFB 1WUNT 4LASH 5FYLE 5AYUL 2HA1A 4HZLA 1I85A 3EFFB 3OAUL 3T0XA 4R26L 5HPMB 2VKXA 2VL5B 4RMVA 5IV2A 3Q3GB 5ADPH 1EH9A 1CF8L 4J4PA 2XKUA 3VXNB 4XMLH 3ZKQD 3IU3A 3WSQH 4ODXB 2NXYB 3JWOH 4LCWA 2XG5A 4M4RA 2J6EA 1A3RH 4L8CB 1LO3L 3FO2B 4OCSL 1ITCA 1NL0H 4LVOC 4CN6A 5DQJB 25C8H 7CGTA 1FFQA 5F72S 2P5EE 4YHPA 3ARXA 1NCDL 4I3RH 5CFHA 2FHCA 3WO3B 3HE7D 2MHAA 4Z7WA 5FM5O 3CFIC 4JAMA 4BFEA 2ARJB 1GHFL 1UYWH 4K55A 3WNOA 2J6EH 4G8GA 3GKWH 5IKCB 2GEEA 2L0DA 4DZ8A 5DJDA 5JIHA 4GW4B 5I30L 3FJTA 4FQQB 2CKNA 5TE6L 4WIQA 4M1CC 4XPAH 4WHYG 1PLGH 4OQTL 3SGDH 4UIKH 3EYVA 5E08H 3HFMH 4F7MB 5T3ZL 3KPQB 4YHZL 4OIBA 5EUOA 1BF2A 2DTML 4BUGA 5HYSA 4OV6F 3KJ6H 1CE1H 3I02B 4XBEL 4LPXA 4UT7H 5B38B 3KPPA 5DRZA 3CZFB 4OAWA 3IAGC 4KY1H 3PV6B 2RHEA 1MELA 1ULVA 1QKZH 4NZUL 2VITB 1QPXA 2H2SD 3KHOA 2X4TA 3GMLA 5T33H 1C16B 1CFTA 4Y5XA 5DDHA 4Q7DA 2VDPL 5EUKA 3MFFA 3OG4B 4V2CB 2FX7H 4XH2B 35C8L 5MENE 4F33A 1RUQH 4OZGB 4K23H 4UV4L 2C1PB 1FV1A 3U6RA 5IMMA 4UTBH 3FB8B 2WV3A 4OQ1A 4JRXD 3MSPA 3SDYH 1FZJB 2Z35A 4KXZI 4D9RE 5FYLD 1H3TA 2NY3B 4HZAA 3LPGA 4MS8D 4LVHB 3LHPH 4PGEA 1RQ5A 5SX5H 1JNJA 4J12A 3C87A 1T0PB 5DVLA 1K4DB 1DBKH 1Z3GH 2KKQA 5E5UB 1BLNA 1B4RA 3VU2A 3BN9D 1N3NA 3IS0X 3WFEH 3OGCB 5IROC 4JM2F 1FNEB 5D1XD 5HHXL 5HGDB 4D0BA 3MUGB 1I8KA 2ARWA 4O5LH 4P46D 4PY7A 3NVQA 4OZGE 3G6AB 3KLAB 4YLQT 4KMTH 3H0TA 2VB5A 3ZTNL 4EUPG 5JIKA 3NCJL 4KUCF 1UZ8A 1R0AH 2J88L 3BP4A 3VGBA 1XCQA 2C3XA 1TZGL 4YBLB 5TF1H 1BGXH 1CTNA 2QQNL 3MNWB 3TV3H 5TQ2H 4OF3A 4LPCA 4D3CL 1FL5A 4FOMA 2ZNWA 5I71B 4JKPL 2G2RA 5I17A 1UM4H 5ICYB 4S0TD 3IS1X 3QCVL 5E4EB 1BFVL 5CJBA 1BIHA 3BXNB 2MCPH 2YD4A 3BKYL 3VXOB 3N0PB 3VW3H 2VZVA 1U8IB 4RRPA 3GO1L 3D2UB 5CLTA 2A74B 1JWSA 2JJTA 4WFHE 1IFHH 3HZVA 4X7FC 4MNQA 2WP3O 5IVNA 3MOBH 3W2DH 3C60B 4YHIB 2V17L 4HMEA 1FFPB 1KIQB 4Q9RH 5C09B 3UTZA 2IH1A 3VMPA 1XEDA 3C5ZB 2GYSA 3DUSB 1XIWC 3ZDYE 4OCYH 4PLOB 1K8DB 1L0YA 2BVOA 3CFEA 5J11C 1XGRB 5D70H 2ZJSL 1IEBB 1TVBB 3Q5YA 5EWIH 2YPKA 1YEKL 4GW1A 4KKCD 2I5YH 1FDLL 1FG2B 3NA4A 1LK3L 5DJXA 3BZDA 2J12B 2NY1B 4XNQA 5DT1H 3O6LH 1UA6L 1QFHA 4DEPC 2ESVB 3RNKB 3W82A 1VACB 3QHFH 4MWFA 5C09E 5DA4A 1NCWH 4P4KB 4R7NA 5D8JL 4HWZA 1BFOB 1KJ2L 1RD6A 5TDNA 2R0KH 3ZKND 4N0CC 4U33A 3WFHA 3GIZH 5E95B 3QUMB 4I0CC 5CJXC 5L8JB 1JFQH 2HT4D 4FQ1H 4TUOA 4D9RD 1S3KL 2ORBL 2QEJA 1SQ2N 5D7IE 3N1PC 4DK3A 4JJ5B 3HMXA 4GAFB 1DUZA 5IESL 3AREC 3R06A 2O5YL 4JZJB 4NNPH 1A14L 4X5XA 1T1YA 1FNHA 5ENWB 4NQVA 4J8RA 1P9MC 4ZS6D 4F7PB 4LIQL 4TQEL 2ZSWB 5KW9H 4F3FA 3LRHA 2ESVE 2P43B 3RDTB 1X5LA 3BD3A 3RTQA 2WINB 4GG6F 5BO1H 4Q9QL 1YEGL 4OLEA 2O5ZL 1E28A 3I9GL 5LXGL 4P59H 1A7NL 2UZXB 1JGEB 4NO2B 3CH1B 5CCKL 1CGSH 3D69A 5JXAH 4YHKL 3HTLX 3T2PA 4P2RB 5DFVC 4XC1L 3D85B 5EOTA 1G7JA 3Q48A 2NY3D 1F8TL 1OM3H 1X5JA 1I7UB 3HMXH 2WIIB 4R4BB 1YPZE 1P1ZB 3FT4B 5KSBA 1KYOK 3VCLB 3O81A 3LKSB 2EXYD 4IHOB 4U6TA 3DX8B 4DJMA 4Y4KC 1T83A 4BZ2H 3T2NL 1HH6B 4PP2A 5EOCL 5KZCD 2AW2A 3NAAH 3LZFL 3FQRA 5IMLB 2APBA 1NMAL 1V3MA 4P23B 5DD1L 3SDDB 4R4NC 2A6DB 3OKLB 4MQSB 3BD4A 4JRYA 1Z0MA 2DQUH 4X4ZA 3LS5L 1EGJA 3KYAA 2NTFA 3T04D 4JO4L 4WFHD 2D03L 3K2UH 3UCRA 3BPOB 3AB0B 3H3PH 5HHOA 1OGAB 4K3DH 4LKXA 1B9ZA 4D9LH 4OFYD 2XRAH 2XFXA 5CHNA 4AT6B 3S4SG 3BW9B 4Y4FC 5HI4D 3C6LA 4NQSA 5EIVA 5FB8A 1T3FA 5ICXA 1ACYL 1I9IH 2ZSVB 4MYWB 2MQCA 5I75C 1I1AC 4OLXH 1FAKT 3MRPA 1KJMB 5EZJB 1UB5B 3V6OC 1MCLA 3BPLB 3MRGA 1RZKH 3VD4A 1FGVL 5C08E 3D2UD 3TN0C 2F5BH 2HT2C 3QG7L 2C7UA 4K3GA 1LEKB 2QKIB 4EBQH 3R8BB 1OGAE 3C60D 3OKNB 4EI5B 5I1IL 5FOBB 5JOFB 4ONOA 5C09D 5KS9E 3ISWA 3D18A 4KDWA 5AYUH 3C5ZD 2XZQH 5E8OB 5I1CL 3WLBA 1X3DA 2PCPB 3GMNA 4L8DA 4M3JA 3FL7A 3OAUH 3GBLA 1H3WM 5F8QC 4QWWC 5HI3C 5F93C 4ZD3L 4R26H 4I0PB 4LCCB 1CE6A 1XF4A 4OLZL 5KN5A 1XGQA 3QXTA 3PGFL 1YJDC 2RFXA 4WENB 1CF8H 3MV01 3C5SB 1OSPL 3SDCB 2WBJB 4QYOA 2HJLB 1TZHB 4G6KH 2HT3D 1BQUA 5E0QA 1RJZA 5KG9A 3VFSA 2NY1D 3GMLB 1AD0B 1RURL 2CLVA 1CDYA 1UQSA 2DWDB 1U2HA 4OZFG 4Y89A 1LO3H 3JTSB 1EUTA 1YNLL 2ESVD 1WSST 2OJZL 4R0LC 3CXHK 2IBZY 4P4KD 4YHNA 43CAB 1UCTA 4Z7VF 3ARTA 4IJ3C 4YNYB 1ERNA 5JHDB 1CFSA 2CKBL 3T4AA 1V7NH 3F7VA 3VDBA 1NCDH 4UNVA 4KTEH 5C07A 1U8JB 3MLVL 1WC7B 5FF6B 4PY8I 3KYNB 1JN6B 4OZHA 4ZFOB 5HYIA 1F4XL 5JA8B 3EJZD 1I8IB 4PRIA 5D1QC 3REWB 1VGKB 2HWZL 3T1FA 1HI6A 1HHHA 1JGVL 1GHFH 5J8OA 4DKEL 4OCMC 2NW3A 1TQCC 1U8PB 1WCBA 1AKJA 1MEXH 3ARFC 4YAQA 5MEPA 2LV4A 3DRQA 5DURB 5IK3A 4NNYB 5I30H 1DBBL 3RDTD 4RA0C 1EVUA 2FDBP 2PNDA 4ZTOL 1ZLWK 2J5LB 4TULL 2YZ1A 5DD6A 1ZLVK 3VXMB 1U8QB 3L5WA 4NC1E 5J1SC 4YHZH 5DJYB 3L3DB 2AQ3A 3O8XB 2DTMH 2XOTA 3BZ4B 3D85D 2EDEA 3SGKA 4KAQL 3BAEL 3TJHD 3VFGL 4XBEH 2FYYA 2DIBA 1U3HC 3HE7C 1AJ7L 2L4OA 2CDGB 4C83A 4NZUH 4PLJC 5HYJA 2COQA 5EU5A 3ZYOA 3EO1B 2GUOA 3JWNC 4I3SL 3S35X 4P23D 3SDDD 2PTVA 2VDPH 1M7DA 4ZXBD 5C08D 3QIWA 35C8H 4CMHB 4UT9L 1J87A 3MYZA 4DFIA 4UV4H 1YDPB 1OGAD 4LEOB 5EPMA 1FC1A 1R24B 3HG1B 4RISL 3D39A 4P5MA 3PGDB 5T1LA 2DTSA 3ARZA 1INEL 3KLDA 4U1GC 2IALB 3VGAC 3JV0A 2DRUA 1TDQA 2BVUA 2KDGA 3OJ2C 1MREL 4R90L 4GH7B 5HHXH 2CGRL 3KPTA 3RPIB 4N9GB 5LJYH 2X7LA 1NGPH 3BH8A 5F1OB 4N5UA 4UAOC 5C92A 5IIEB 4XCEB 1FVDA 3HUJE 2X4SA 3IF1A 4Q74A 1UVQB 4XNYH 4LARL 4YPJA 4X9GA 3L6FB 4NC2B 3ZTNH 1IGTB 2GFBA 5J12C 3L3GB 5HGAB 2J88H 3TBYA 1M7XA 1TZGH 1ZHKB 4B7LA 2QQNH 2Z31A 3VFMA 1CD9B 4D3CH 3UTSB 4I0PD 2A6IB 2CJUL 2YSSB 4J6RL 4JKPH 4MS8C 1JZ4A 3L5JA 1BJMA 3AU1B 3NTCL 4AQOA 3G9AB 3K8MA 3SDCD 4KKLC 5AYQA 1AI1L 3QCVH 3QXUA 1BFVH 3CDCA 2ZCKL 4F7TA 3BN9C 3BKYH 3PP4H 5EFIB 2C1OA 1NLDL 3GO1H 3GSQA 1RZIA 3MRRA 1E4JA 3GB7B 3S37X 3QJFA 1PEZA 2A0LC 4BH7A 4X6DE 3DV6A 3PV7A 2V17H 1CYGA 5EBMB 1IBGL 3B3IB 1I9RL 2HLFD 3CZJA 5JHDD 4WTZA 4DWHA 1YN7B 2PTTA 1KJ2A 4ZOBA 1JZ2A 1BOYA 3UTSE 3EJYC 3OKOB 3RVWD 2VUYA 5EO9A 2VDLL 4ALAL 3P73B 2OR9L 1FCGA 1P53A 3SDAA 1KIPB 1CK0L 2ZJSH 1QA9A 3DLQR 4BUHA 1A6ZB 1YEKH 3BZFB 4EN3B 1EHLL 1FDLH 4ONGL 2H26A 1LK3H 1XGTA 1D5BB 3X3GL 4KK5C 2FZ3B 2C4FU 3BRDA 1ZLSL 1UA6H 4JRYB 3TVMA 4G80A 4XPTL 1IGYA 5D8JH 4ZAKA 1KJ2H 4GAJL 4C56A 1TTFA 4AMKH 3ILPB 5KVFL 5ESAB 4FQXB 3VWJC 1QO3A 4YK4C 1S3KH 2OLDA 2ORBH 3VGFA 4QRSB 1MCWM 1TPXC 3DO7B 5AAWA 2FECI 5IESH 4LGRB 4QGTA 1UXSB 2O5YH 1A14H 5IEHB 1UC6A 3T0AA 4KKCC 4LIQH 4TQEH 3RY6C 5CZXC 3DOSA 5J0BA 1G7IB 4Y1AA 4Q9QH 1YEGH 2R2CA 3MLTA 2V2TA 4S2SB 4WWKB 1FZMB 2O5ZH 2VWEE 3QH3A 4I5BB 1U91A 3I9GH 1IJ9A 4U49A 1EVTC 2ADGB 4R7DA 1A7NH 5IMOB 4X9FA 1KBGL 5BJTA 1U9KA 3ESVF 5CCKH 3ZKNC 1U3YA 1T2XA 5CSBA 5CGTA 1D6VL 4YHKH 4NCC1 4KDTC 2NLJB 3E6FB 4XC1H 1M71A 1UWXK 1F8TH 4OFVA 1S9WA 2YRLA 3WUWG 2HMIC 5BZDB 2EDQA 1P7QB 3U48A 1KLGA 1PKOA 3AS1A 3RRQA 3ARGC 4LVNC 3T2NH 5EOCH 4NO5B 1HDMA 3LZFH 2G75A 3CCHA 4MZ3A 4D94A 1CICB 1NMAH 3PWPA 4LPVA 4ZS6C 5DD1H 1ETZB 1FP5A 3LS5H 1NGXB 3CC5B 4M61B 3BIKB 3BGAA 4JO4H 5B39G 2D03H 1MJJB 1QPPA 4JLRB 3BP6B 4MA3A 4G8EA 2MCG1 2DM2A 4YFLI 4C58B 3JTTA 3NCMA 4XP4L 5FM4A 4PTUA 3N85L 4U3XA 3HNTL 1DFBL 3PUCA 1QBLL 3MRLB 4OD1L 4X9HA 3UTSD 3U1SL 4QRPB 4JR9L 1ACYH 3OAZH 1O5DT 2EXYC 1FZOA 2D4DA 4Q2ZB 5C9JA 1V8HA 1OT2A 1QLRA 4HKBB 5D7JB 1FGVH 2IQAB 2YA2A 3QG6A 5IK3B 2A73B 4YBQD 3MBEB 1KYOJ 3QG7H 4U1JA 2OR8A 3F12A 4NFCA 1BVKB 2P44B 4PV9B 2XWJA 5I1IH 2B5IB 1CG9B 2Q76A 4G6JL 1YY8A 43C9A 1T7VA 4X6CA 1OQOA 4X98B 5GRYA 4CU7A 4YIQB 2R9HC 3HC4L 4UDUA 1K2DA 4RAHA 1S7WB 3WN5B 2MKLC 2WNGA 5I1CH 3QA3B 4IIQB 2HFFB 1SBBA 1JMXA 4G9DB 4QRPE 3DHJA 1IEHA 4ZD3H 1AO7B 4FMFA 5HI4C 1CD1B 5IB5B 4OLZH 3QDAA 3PGFH 5FO8B 4HUUA 1A9EA 3MACL 3E8UL 2BHUA 5F7WC 1OSPH 2BP3A 4EN3D 4ZG1A 1QFWM 3LKQA 1ZT4A 3DXAB 3FOMA 5E4EC 2N7BA 5EU5B 5E8NA 3U4BL 3GMMB 3QCTL 4LDOB 4NQCB 3FB7B 2UY7A 1RURH 3IRZA 4X99B 4CMMA 5IB4B 3G04A 1PD6A 1YNLH 1KCLA 2R56L 2OJZH 1DVFB 4MVBC 3C60C 5AZEL 4H5SA 1OAUL 3K46A 5ICZB 4Y5YB 4ZSOB 4P5MB 4FQXD 5E2TL 5GS0L 5INCB 1K6QL 2HN7A 2H45A 3MLVH 3SBWA 2DQEL 2H8PA 1Y0LB 1OWWA 2IG2H 4WV1B 4IRJB 1VDGA 1F4XH 2B20A 3O9WA 3IJHA 2GIYA 1ZT1A 2HWZH 5IM7A 1WGOA 1JGVH 4RMQA 4ZOEA 4C54A 1TXKA 3DJ9A 4DKEH 4NQCE 2X89D 4P99A 4MB4A 5CEXA 4XHQA 3C2AL 3F6LA 2NY1C 1DBBH 3CSYA 1MCWW 1ZWIB 3WBDA 4KUZL 4WUUA 4ZTOH 3V4UH 4TULH 2OTWA 3VXTB 4P5KB 1HSAA 4YR6A 2BVQB 4MHHI 1NDGB 4QTHA 4P4KC 1BD2B 4FQHB 4QRQA 5A43C 3GJEB 2FX8L 3QSKB 5MI0C 4X7TA 4ENED 1G7MA 4KAQH 3VFGH 4U6HB 3GSUB 3IRPX 3CXHJ 2F74A 5C0AB 4DUXA 1QSFB 5H94B 1AJ7H 3SEPA 4HK3N 3WS6A 4D0CA 5LGJA 5DJZA 3WJLC 3EJZC 3MODL 1NFDE 2YPLA 1CXIA 4MAYC 4QHLA 1U8KA 3IDXL 5E5RB 1IZKA 4I3SH 1CR9L 2EKJA 2YD5A 2DYPB 3MRIA 4L8BB 3WNMA 4NRZA 1BBDL 1WZLA 3RDTC 4UT9H 4AQ1B 5DK2A 3KS0H 1BD2E 1H3XA 3EYOA 2YN5A 1NGWA 1QFUL 4OLVL 3G6JE 2M1KA 4RISH 1WTGT 3RWDB 3L7FA 5D72L 5T3ZD 2ICEA 5I2IA 4PJEE 4HWEH 1INEH 5C0AE 1QSFE 4QRPD 3T08A 3ZSTA 4QHKJ 3VWKB 4YXLL 3QXDA 5ID1B 5HVGB 2YN3A 2I9TA 3TPUB 3C9NA 1KXVC 5E2VL 3T4YB 1WEJL 2AEPL 2R2HB 1OW0C 1MREH 5F7KC 5F7NC 1VFUA 2J3SA 4HIEA 5GQBA 4JN2A 4R90H 5HGGS 2CGRH 5SWZB 4JO2L 3VD3A 1QBBA 3ULUF 1J11A 1CD0A 1HQ4B 3CGTA 2DBLH 2R2EA 3MBED 3BQUA 5DMKA 4ZXBC 4P2OB 4LARH 2BNRA 1OTSD 4IS6A 1I8LA 4JCLA 4P2CG 1A7PL 2R4RL 5J9PA 1EAPA 3ZE2F 1XCTB 4UDTA 3SE3A 4HJGA 2BRRL 2OMNA 2G9HA 4NZJA 5J13C 4ZUWB 3TZVA 2ITCA 3ZE1F 4X4XA 3OPZH 4ZPVA 4H8WL 3PQYE 2CJUH 4J6RH 5C0BB 3WE6A 4CBPA 4TNWK 3SJVE 3NTCH 4FXLA 1KT2A 4PJDF 3T8XA 1UH2A 2BZDA 5TH2B 4L9DA 4U1IB 5SWZE 1AI1H 2R23A 2ZCKH 3RI5F 4HXBL 2W9LA 4XNMA 5D2NA 5ELIA 4NQCD 4HIJA 1NLDH 4TNVF 4PRPA 2E7MA 1E4KA 4GQ9L 5IB3B 4PJ5B 1MAJA 5FOJA 3S35L 1DVFD 5DSCA 1IBGH 3MREB 1S7VA 1I9RH 4ODWB 5L2JA 3EOBB 4PJ9B 4M9PA 4FXGA 2BNQB 2O26U 5EZIL 4YFEA 1ZA6A 4IOIA 2VDLH 3F5WB 4ALAH 2XZZA 2OR9H 3VRLE 1C12A 4F9PA 4AENA 1MFBL 4Z7UE 3SKNA 1CK0H 1MVFA 1XGUA 2BOCA 2PYEE 1NGZB 3L3HA 1DN2A 4GRWF 3QI9A 4LF3A 1EHLH 1MLBB 4ONGH 4GKZB 1QR1A 2DOCA 1EBPA 5BRZA 1F4WL 4LSUL 4PJ5E 3X3GH 5GGRA 3K4ZA 4U3HA 2IPKA 3VG9C 1JP5A 3N1FC 1ZLSH 2UYLB 2XQBL 4FFWD 5GS2D 4F9LA 2XYCA 4H88L 1NC2B 4XPTH 4JFOB 5E2WL 1BJ1H 1BD2D 2BNQE 4GAJH 1X4XA 5IB2A 2HLFC 5KVFH 5IR1B 4NC1C 1IGML 3SPVA 3MA7B 4UUJB 2PO6A 2Z9TA 4GW5B 3ES6B 2D31A 3QPQD 3CUPA 4IM8A 3H9SE 1NEUA 3IDGA 4E41B 4WEBH 1RUPL 5C0AD 3PWUA 1QSFD 3NFNB 1KJVA 2XIDA 1AIFA 1LVEA 2FJFB 2VSCA 5EC2B 3QWOA 4LLYB 1QUNA 4Z7QF 1IGFH 2PN5A 1S9YB 3L9RA 3G5XB 3RIAF 1C1EL 2DYPD 4AH2A 1F11B 3LAFA 4U2ZA 1Y6MR 4HGWB 3L5HA 1KG0A 2WBWB 4GLRI 1EPFA 4WU5A 3VJ6A 3S37L 4GFTB 4MDJA 2Q6WA 4PJIF 1AGEA 2NW2A 1JVKA 1NKOA 5DA0B 2AV1A 1D6VH 3VDAA 5IBLD 3O41B 1BZ7A 2CKBB 4PYHA 4LSSL 2MJWA 5GS3A 2EKSA 5C2BL 5KTEL 3QDHA 3VWKD 3PQYD 1DN0A 2GTZB 1ZVSB 4DCQB 1S7QA 5IVZA 3SJVD 5F9WB 1P4LB 1YUHB 4JQVA 4PGCA 5SWZD 3VRIA 1S5IL 3QEQB 3RNQA 4TTDD 1QFOA 2NX5E 2YC1B 1T7ZA 4QO1A 3H9HA 3IDIA 4JPWL 2VERN 3MRHB 2GAZB 4DN3L 3TBWA 3MTRA 3QNXA 4P2OD 1Q0XL 1MCCA 3MJ7A 4CMHC 1RIUL 2FX9L 5CZKA 2APVA 1KLUA 3BPCA 2FO1A 1CDHA 1JWMA 4XP4H 3PDOA 5JHLL 3N85H 3PGCB 4ISVA 5KSVB 3GIVA 1I3RA 2PR4L 3WL9B 1KPRB 1J05B 1DFBH 2FWOA 1QBLH 5E94A 4OD1H 4KWUA 3C6SB 4HFWB 5IJKC 3GGWB 3O0RL 3D9AL 3U1SH 2UZIL 4EXPX 4EDXA 4QHMA 4GKSB 2AP2A 4JR9H 3CLFL 1NEZA 1HXYB 1F42A 2BNUB 3JV6A 3RQ3A 3WHXA 5K9KB 4JZNA 3QEQE 5DJAA 5AD0A 5FUCE 1Q0YH 5I1AA 1JYVA 4S1QL 4M03A 1QBMH 4PJ5D 5BXFA 3C09B 1AD9A 3LCYA 1FYTA 1IAMA 4YH6A 4G6JH 1R5IB 5HY9A 4X6BB 1NH6A 3QP3A 5CWSB 5ITFA 2HH0L 3FB5A 4PJ9D 1YEJL 1S7UA 3HC4H 3VXRA 1H5BB 2BNQD 1Q9OA 3LS4L 2ZOKA 3ARRA 3ABZA 4NO0A 1L7TL 3QUZB 4HIIA 1ZA3B 4MJ6B 3MACH 1FNLA 2Y9RT 3E8UH 2DQDL 2LQRA 3H2WA 4QT5B 1WFNA 4GUPB 4X4YB 3L3OB 5SWQA 2EH8L 5E7BA 3U4BH 3IFOA 4HH9A 1T4KA 3QCTH 3IXTA 3LN5B 5DTFB 4YDLC 4G5ZL 3O3DB 4YBQC 2FB4L 5GISL 5GS0D 4KVCL 5JQHC 1NC2D 4H0GA 1U58A 5F8RC 2C4FT 5AZEH 2CUMA 3LRSA 1XZ0B 3WJJA 3GUTB 3ULVC 1OAUH 1JNLL 2X4NB 1B0RB 4XCFL 1T21B 4AM0B 1NC4A 3R8QA 5E2TH 5GS0H 1YEHL 3TJEL 1K6QH 1HOCB 1WWWX 3FQTA 3RWEA 1WWBX 1ZLWH 3DVGA 4Z5RB 1OLZA 4J3VA 1DQJB 5TGBB 5CUSL 4JGUA 5FFLA 4TTGA 9CGTA 1QSEB 1EO8L 2VISA 4PUBL 2J7LA 1E6OL 1IM9A 2P1YA 3QUYD 3C2AH 3PP3K 1PW3A 4PJ7A 3LQZB 2WAHA 3PNWA 4KUZH 5KVMC 4OCRL 4D8PB 5EBGA 4OGZA 1T20B 2X4PA 4LLMB 4NNXA 4ETYA 3V0WL 1UB6B 3JV4B 3F7RA 3LB6D 2VWEC 4TOYL 5F7UA 5FKAA 2FX8H 3NZHL 3JVGA 4MNHA 5IFAH 4UNTA 5KVDL 4XP9L 5F7DA 2WWMC 1MCRA 3B2UC 4MDIB 2Y25A 3ZYJA 1WT5A 5GSVB 1YYLL 3MODH 1YMHA 1A7BA 3PHOB 4M6NL 4NRXB 3MLWL 3GJFK 1NANI 5ANME 3VGDA 3JV5A 3V6BR 3IDXH 3U9UB 3QEQD 3TBTA 3BP7A 1CR9H 1KXQE 4Y16B 3ULSB 4EEEA 5BV7C 1P7HL 4HIJB 5JDJA 5E8EB 1BBDH 2WBKA 4PFEA 1FFOB 2AK4A 3QDGB 4U1MB 4HMDA 3MV9E 1SBSL 4P0DA 2EICA 2RJMA 1QFUH 4OLVH 5IB1A 3WKML 2Y1VA 4L29B 5I8CB 3RY4A 1AGCA 5A2IH 4UMGA 3O6FA 4UI2A 3CD4A 5D72H 4O2CA 4X8XA 1T03L 2IANE 4ENEC 4GBXA 3ARDA 3LH2L 3B9EA 3Q1SH 2AXGB 3WO4B 5HDBE 4YXLH 1BECA 1M7IA 5E2VH 1WEJH 2AEPH 2ENYA 3IGAB 1KACB 4JO2H 5H2BB 1AHWB 1W72L 4Y4HB 3DSFL 2V7NB 3U4AA 3QDGE 5KSAB 1G0YR 3BZEB 5FUZL 3TIDB 1H15A 3GMQA 4MXVE 1EEZA 5HJ3B 4LSTL 3L3JA 3MV8A 4X7EC 2NXZB 2HVJA 1A7PH 2R4RH 1M05A 4KJYB 1IVLA 1I1FB 2EDDA 2BRRH 2DQCL 4KJQD 1Q9LB 1A6WL 1GOGA 2YWZA 1L6XA 3LN4A 2O61A 1GVIA 5B38G 3VXQA 1WFOA 4QNPF 4H8WH 3QUZD 1A6TA 3U83A 5C0CA 1CQYA 4CDGC 5TF0A 4R97B 2Q86B 2Y7QB 2ITDA 3U0PB 1IAIL 4B50A 4Q6IB 4HXBH 5E6IA 5GIRB 1DLHB 2QQLL 4NKOA 1ED3A 1Q94B 2DLHA 4GQ9H 4OI9A 1OSZB 4MX7A 1D5MB 4AH2B 1U95B 1H8SA 3S35H 4G3YL 4LCUB 3MBEC 1JF5A 5D2LB 1F3DH 1KCVL 5D1ZC 4Z8FL 5CEZL 1MOEA 5EZLA 4ZUUA 3GSVB 3I6KB 3TO2A 1SEQL 1MHEB 5EZIH 4PGZA 4NCDA 4NZRL 4IEFB 4GMTL 3L7EA 2ZWLT 3QEHB 2ED9A 1KELL 5J1AA 1MFBH 1MHPL 3ROLB 1N59B 4MA7L 5DC9B 5E6YA 3IDMA 1B2WL 1F4WH 5C86A 4LSUH 4ETQB 1PVHA 3FCTA 2KPNA 3O2DL 2XQBH 3BI9X 5D2LE 5MP6L 2F53B 4G6ML 3KPOB 4LK4A 5IEKA 2B4CL 4H88H 2GCYA 4OUOA 3RZWA 4MLIA 4E42A 5E2WH 4PRHA 3F6IA 1N5AB 2H3NB 3RX5A 3X12A 3CVIL 1FIEA 4M7ZB 3L3KB 2P24A 3BEWB 1IGMH 4Y5YC 2EC9U 4KPHL 2RIKA 1F4AA 1BVLA 2VLLA 3AY4A 2YPVL 2IAND 1RUPH 2W0LA 1AGBB 1IC5L 2EE9A 3RI5K 5K9OB 3BX7C 3TH2T 1MVUB 2EDXA 2EIBA 3MNVA 4TNVK 4YO0B 3X13A 2AEIT 5I1LA 1RAMA 1UM6H 5DMJB 1RV6X 1C1EH 3BUYB 4Y16D 4HDIB 4FZEL 2F53E 2JB6A 3DYMA 3H7BA 1D9KC 4I18B 1S78D 4PRBB 1UJ3A 4NM4H 5M95B 3QDGD 4MA8L 4FFWC 5IW1B 3S37H 3TPKA 4WUKL 4KV5F 2AJZA 1J10A 3HZYA 5HYFA 2VTFA 1X6LA 3UPCA 3FO1A 3IXAB 4G8GE 1KF9B 4GG6A 3DUHA 1CLOL 1WBXB 4HK0A 3VXRB 3P30L 4L4TB 4LSSH 5JPNA 1EX0A 1U8MB 4PJHA 5F1SA 5C2BH 3SKMB 5KTEH 3IFPB 3QPQC 2R4SL 3BSZL 1DBJL 3MRNB 3KNBA 5HYQA 2FSEB 4XPHL 2BVEA 4X0KA 3LSOA 4A2MA 3MCG1 1OTTD 1JYNA 4XCYB 4XZUA 1S5IH 2GJJA 5E1HB 3V4PL 4L4VA 4Y4HD 1BQHB 4JPWH 1MUJB 3SGEI 4DN3H 5KSAD 1X5XA 1Q0XH 2PKDA 4GO6B 1RIUH 2FX9H 1A6AA 2NXZD 2P8MA 1D6EA 5HHVL 1B90A 3MV11 4KU1A 4LU5L 3U2SB 4ZQKB 5JHLH 4L4TE 2DM3A 4MCYA 3O4LA 1OHQA 2PR4H 5IBLC 1BVZA 3O0RH 3D9AH 3WIFA 2DLTA 4M8QA 2UZIH 1FHGA 1S7RA 3EBAA 3WKNA 3CLFH 1P2CA 4XX1G 2LAAA 2IBZX 3MFGB 2E7HA 5CEYA 2VISB 4X8JB 4YGVB 1XGPB 4S1QH 3LEXA 1MHHA 2F8XC 4TTDC 3HI1A 5JQ6L 4I9WE 4PREA 4LLQA 4KGJA 3OR6A 4PYGA 5CP7B 4MQTB 3VFRA 1CT8A 4A2LA 4QXTB 1V05A 1JUFA 3MNZA 2HH0H 1YEJH 1INQA 2NZ9D 4YX2L 3HPLA 5DHYA 5CJ5A 2P8PA 5I1HL 4I1NB 4R96B 2DMCA 4QHNB 3LS4H 4F15C 3RZCA 4NQEA 3P9MB 3RY5A 1L7TH 2NNAA 3EDJA 4M7KL 3MGTB 3NIFF 4RAVB 1HWHB 2DQDH 1T22A 1KLFA 1BHGA 1AP2A 2ENSA 3BIBX 1JHTA 1R3KB 4KROB 4JFDA 2B7DT 4OIIL 3VFVA 1LP9A 4N0UB 2EH8H 5CBEA 3MGOA 3AAZA 3PWVA 2OX5A 5DC0A 4X6EA 1S7XA 1K9TA 4G5ZH 2F53D 5ADOL 2FB4H 5GISH 4KVCH 2X1PA 3RGVC 2P5WA 4QTIL 1BWMA 4BSWB 5H35A 3MRFA 1TCRA 4KRNA 1BBJB 1C08A 1JNLH 1I75A 4XCFH 5DS8A 2ZG2A 3LKPA 1YEHH 1JRHI 3WNNA 5JNYB 1IKNC 5F88B 3TJEH 4PTTB 4MCZA 1WQVT 3FN0L 1A7QL 4IBLT 1A1MB 2BHYA 1A6VL 1I1RA 2NY4B 4MNQE 4U6VL 5DRXA 3V7AG 4Z7VA 1VADB 5E8DL 4ORGA 5CUSH 4PJ8B 1ZAGA 3F58L 1EO8H 1W0WB 4JY4A 4DZBB 1EHNA 4NM8L 4PUBH 1E6OH 3CJJA 5C8JA 4JFQB 2CDEA 3U36A 2YKLL 2BX5A 5EORL 5A2KH 4PIRF 3AXLA 4OCRH 3PWLB 4CW1A 1N6UA 2EDFA 3M17A 3T2QA 4Z7NF 2IWGA 4KZEL 4QEGA 4HKXA 1PQZB 2Z8RA 3V0WH 2J1KA 5F7LB 3V6ZA 1QNZL 3PWNB 4QRRA 5CBAB 2UWEB 1N2RA 3NZHH 5HYSG 1I3VA 5KVDH 3MROB 4L4TD 4RGMB 1WCQA 3SCMB 1PX3A 1SEBB 1JTOA 4P5TA 4XP9H 4JY6B 3HE6A 2GITB 1NQBA 1IAKB 2BXZA 3JBG7 4ZOAA 1YYLH 3IDJA 4BELD 2ITDB 4KDVA 4M6NH 3JWDC 3MLWH 4NHUB 1QR4A 3ARPA 2YD6A 1NCUA 2QSCL 5C0GA 2X2YA 4OZ4B 4TSAL 4BZ1H 3G5YB 3QUYC 3S9DB 2V5YA 4JE4B 1W72A 3ARBB 2JJVA 3DX7A 4I9WD 4CADB 2WUBL 1SBSH 4HX1A 5CSZB 5JORA 1OQXA 5CJQL 4ZTPL 3WKMH 4X6FA 5F3HA 1KIRB 2UWEE 2QR0B 3LB6C 5DC4B 1YQVL 4M5YL 1T03H 1U3ZA 2ADFL 3WYRA 3PF2A 5SV4A 3LH2H 1OTUD 4LKCB 5KSUA 2MWCA 3RL1B 1T1WA 4IMLA 4NYLA 5ESQB 2H1PL 3TCLA 4BFGA 1FSKB 5GRVK 2XI9A 3TFKD 3GMOA 5DJ2B 5JA9A 5E00B 4MJIB 5F9WC 2NY6B 5DEGA 2C3HA 4GXVL 1W72H 1GXEA 1NBYB 5T1MB 3DSFH 1OF2B 5FUCC 3DX9B 5FUZH 1FNGA 1HHJA 4K3HA 5KSBE 4RBPK 1TZIA 3U0TB 4LSTH 4HUVA 3RBGA 4XXCC 3DI3B 1HE7A 2EE6A 2VZ3A 2ZKHL 4PR5A 2DQCH 3QEUA 1A6WH 4MXWL 4L8SB 1J9CT 2DM7A 5HVHB 1ORQB 1AC6A 1JNNL 1V7ML 4HHAB 1AH1A 3WDIA 3QPXL 2WLZA 2ATKB 2PYFB 4MD0A 4LBEA 4MJIE 5HHOE 3LV3B 1IAIH 3GHBL 2C9AA 1VPOL 1DSFL 1PG7W 2XA3A 3PL6B 2OSLA 2CDFA 1T2QL 1UFUA 2QQLH 4LLVA 4RRPG 6FABL 1FJ1A 1IL1B 3GBML 3U4EA 3F62A 4G3YH 3O2DA 1PKQA 3B8YA 4WO4B 1KCVH 4Z8FH 5CEZH 1EERB 5LAXA 3CDGB 3P4MA 2Q7YA 2EDKA 5L9DL 1SEQH 5I19L 5ITBL 1RVFL 1VCAA 2CLZB 4KJQC 4MJ2A 5F3BA 4HG4K 2R1XA 2V2XA 1CGYA 4NZRH 4JDVA 2AJYL 4NDMB 2VQ1B 4GMTH 4J3UA 1MI5A 1RIHL 1G7QB 2FRGP 2NY4D 1KELH 3B9KA 3DV4B 3HZMA 3QUZC 1J8HB 4WW2B 1MHPH 4FFYL 4QRTB 3M8OL 5GJTL 4MA7H 4O58L 3KPRA 5TDPA 4PJ8D 3RGHA 2E7LC 4HWNA 3ROOB 3NPZB 4Y19B 2IBGA 5IVOA 1B2WH 4J7RA 2H32A 4S1DC 3DIFB 4ODBD 2FL5A 4N8VA 5HHPB 3O2DH 1U41A 1UT9A 4XGZB 2VLJB 4XC3L 3O3AB 3EHBD 3QWRD 5MP6H 3RWFA 5JXEA 3PXJA 1W8NA 4G6MH 4EXKA 1MH5B 2DWEA 2B4CH 2FJHB 2ZCHL 2IMMA 1MCJA 5IWLC 5IJVA 3JUYA 4RQQA 2CIIA 5BCAA 4D9QE 1CIDA 3VI3F 3CVIH 3QNYA 3FMGL 2CLRA 1JK8B 4KPHH 2YS4A 1YA5A 2C4XA 2DF3A 1EHAA 3SCMD 1J8HE 2YBRA 2YPVH 5EU3A 2J4WL 1LWRA 1IC5H 4PG9A 2VABA 4Y19E 3C8DA 4HV8B 3R0NA 2H32H 5C9KA 1YJDL 4L3EA 5E5MA 2P4AB 4J3OC 5D6DC 2OXHA 2XZAL 4PJXB 3V9FA 4YFLF 1DUYB 4FZEH 2EYRA 3QIBB 4BQBA 5DI8B 5HGBA 4OZHE 2IBBA 2GJZA 4MA8H 4KJPD 5CGMA 3S96A 2DQIL 2HLAB 1H3PH 5BS0A 4KHXL 3UZVB 3OZ9L 1CLOH 1A7OL 1DR9A 3P30H 3K80A 3OX8B 2R69L 2X4UA 5CIPB 4PGBA 5B39A 4QCIA 3U9PL 1KTLB 1G6RL 1SHMA 3TM6A 4Y5VC 5CD3A 2FBOJ 3QWQB 2R4SH 3BSZH 1DBJH 4XPHH 4RCAA 1EEYB 1SYVA 2JCCB 4MJID 2CQVA 2A9ML 4L3CB 2NY6D 3MX0A 5IW6B 4L9LC 2OQJA 3NPSB 4FQIL 3V4PH 4UQ2A 3T0EB 4X6EB 4Y16C 4E5XA 1IAOB 4PJFB 3DUUA 1S78C 3UYRL 3E6HA 4HAFA 5C1MB 1QVOA 4EQ3A 1MCKA 5HHVH 4NKQB 2JK5A 2J8UB 4PJGB 5I0ZA 4LU5H 4X7SL 3ZKXC 3KDMA 3O3UN 3VE0A 7FABL 3T65B 1E27B 5F1IB 4YQXL 5GGSB 4NKMB 5F1NA 1P7KB 2B0SH 2XICA 3OKDB 1NLBL 5ABDE 3S98A 3LQMA 3TNMA 1S7TB 3OJDA 4PJAB 3PL6D 1R5VB 2Z92B 3QFDA 4RIRB 1AHWC 5JQ6H 4NKDB 5IROA 2YRPA 3L5XL 1WAAA 4K7PY 2J8UE 1P84K 4WO4D 4PJGE 3U82B 3VFWA 2BSTB 1CU4L 4G8FA 2NXZC 5J3HC 1F2QA 4W6YB 2IAMB 4YX2H 3P77B 4FXKA 2IGFL 1RHHB 2BOBA 2HFEA 3TBVB 5I1HH 2YUXA 3QXAB 2A6JA 5IHZA 4D9QD 3ECBA 2Q1EA 3QRFM 4M7KH 4WNQB 5C0JA 1J8HD 2BC4A 3K81A 2EIZA 4LAQH 2GTWA 2GK2A 1I7ZB 4PJAE 1F2XK 4X83A 1PZ5B 1PYWB 2XT1B 3HCVB 4OIIH 1CFNB 4Y19D 2ERJB 4Q6IC 1EMTL 4C4KO 3QUXB 1CDJA 3FT2B 3CX2A 1F3JA 3CFJA 3RL2B 3FONA 2JTDA 5ADOH 1I85C 1MY5A 1IEAB 2BSRB 4W6WB 4QTIH 4V2BA 3VRJB 1IGIL 4JKLA 3X11A 5I76A 5I73B 3GJFA 3MRDA 1K8IB 4FTVB 3P2TA 5DEFA 3UPAA 4RMSA 5GPRA 3C08H 1TENA 1QD0A 4QOKB 1AKJD 1AXSA 3FN0H 1A7QH 3O3BB 3I2CL 4N8CH 5C3LD 3UTQA 1A6VH 4U6VH 5E8DH 3OKMB 4HBQA 2C3VB 3HC3L 5FYLL 4R8WL 2CRYA 1XIWA 3W39A 3F58H 4NM8H 1MLCA 3W0WA 3CVHB 4ZUVB 4MNGB 4MHHG 5EORH 3QIBD 5T1KB 1V3LA 4XPGL 4N1HB 4KZEH 3INUL 5AAMA 4ZPTA 3DTXB 4FTVE 3MPCA 1TJIL 2QV2A 4HWUA 1T5WA 4BSVB 2EDJA 1FL6B 4QOKE 4GAYB 5F96H 2IMNA 2AQ1A 1RULL 5D9SB 4JZOB 3KLHC 1Z9MA 4G8IA 1B0WA 3P4OA 4Y2OA 1U42A 5I1EL 3DVIA 4HUXB 4XWGL 1HINL 1T66D 4Y2DB 1MCSA 3REVB 4HH8A 2QSCH 4JQXA 4TSAH 1CTOA 3CDYA 4XVSL 3ALWA 2XTJB 3NZ8A 4KKBC 3SKJL 5F6IB 5IF0A 1MFAL 2WUBH 1P9MA 1ZHLB 4YPGA 5CJQH 4ZTPH 3QIUA 4RSVA 3OB0H 3FO9A 4TVSa 3MRMB 5D6CB 3ZT6A 3BGFB 4OGYL 2RGSA 1QACA 1YQVH 1NFKA 4M5YH 1QZ1A 4OD2B 2YUZA 2MFNA 1HHIB 3DARA 1I1YA 5C0IB 2AJ3B 2ADFH 4GRLB 4Y1AE 4KTYA 4TUJB 5ESVB 5SX5K 4DQOL 4MA1B 1IE5A 1X5FA 3H3KA 1A0QH 4JFEB 5GS1A 3BRFA 4BH8A 5JZ7C 2H1PH 3GSOB 4PJCA 5IT2L 2BY3A 2BCKA 3P9LA 4LLUA 5IQ9A 3E3QE 2VC2L 2XTJE 3MA9L 2OZ4A 3CPLB 4GXVH 4NPYA 2BMKA 3ZKMD 1R5WB 1Q9KB 3WDHA 2GT9B 4GRMB 3TH4T 1F90L 1JI1A 3T0BA 1RK1A 3MRKB 4F2MA 4M9OA 1MCPL 5EIIB 1IAII 3D0VB 4XVUD 4Z77A 2IAMD 2ZKHH 2DL9A 3RWGA 4U1HB 3Q5TA 3RWIB 4MXWH 2YEZA 4PGDB 3A0OA 4YDVA 4NSKA 3O11B 4JRWA 3OKEB 4LVOB 2Z91B 4M7LT 4QRUB 5EO1A 1V7MH 5D5MB 5I1GL 4JG0L 1OTUC 4S11A 3QPXH 4ZUSA 5DHVB 3DVNA 4NQTA 2OXGA 1M1SA 2QQQA 4U1SA 3TFKC 4JKMA 3GHBH 1VPOH 1DSFH 1BJ8A 3QZWB 1XFPA 3QUXD 5C0EB 1S5HB 1YMMA 1T2QH 6FABH 3ILQC 1ZOXA 4URTB 1I7TA 3GBMH 3BGMA 4HJJL 4PJDA 3BD5A 1B0GA 1IKFL 3QUKA 3HNVL 5DVOA 1ORSA 3DMMA 4XNUL 3DECA 3TN0A 3B5TA 4BQ6A 3WIHL 3HMWL 4FTVD 1QRNB 4WHTB 5L9DH 3BP5A 4HS8L 1KPUA 1B3JA 4H26B 1RVFH 5I19H 4JFXA 4QOKD 5ITBH 1CZ8L 1SY6L 5JO5A 2IH3A 1R3HB 5D5ME 3VFNA 2ED7A 2AJYH 4NRYA 3S5LB 2V6HA 2R1YB 1NMBL 1MWAL 1WBZA 4FFYH 3VRLF 3M8OH 2JJTC 5GJTH 3FHAA 1D5XA 4O58H 2GJ6B 5AUMA 4GQPH 5JUEH 3F7YA 2MSPA 3O3EA 2XNAA 4CNIA 3AM8A 4JREC 5T1KD 4XC3H 4CAGA 1Q38A 4FABL 1KNOB 2Z93A 3SKOA 2ZCHH 3E6HB 3HPJB 3MLXL 1QRNE 2SEBA 1J0KA 1J1PL 1R3JA 1PG7X 1ZEAL 2VAAB 2X4RB 3TA3A 3D3VB 5D4QA 3FMGH 4R0LA 2WMPA 5H37H 4ZFZA 3GSRA 5JR1L 4U6XA 3QDJA 2J4WH 4Y1AD 1I3GL 2GJ6E 1F6LL 3L3IB 1DQTA 4GXUN 8FABA 2V2WA 4Y2DD 4PV8B 1YJDH 4ZUTA 2ZUYA 1GH7A 4HG4J 2DAVA 2XZAH 1X7QA 3KWWA 2BHZA 2XTJD 4NT6B 4GRWH 3RVUD 3BJ91 4YDIL 1AE6L 5IBTL 3K7UA 1VEPA 2AXJA 1UH4A 3EHBC 1DEDA 5F9AC 4GAGL 4U2YA 2HG5B 2DQIH 3B4NA 4JFFB 2NR6D 3D3VE 1AGDA 1YEFL 2AK1L 5K9QG 4PRNB 4KHXH 2L7JA 5EULV 3OZ9H 3ZMRA 1A7OH 2VR9A 2R69H 4L5FL 4GRLD 3U9PH 3KPMA 1ZS8A 3FTGB 3SCMC 4TYUA 4XRCA 2Q8AL 3WIIL 3DNKA 1WICA 1ND0A 1N8ZA 5FYJE 1M6OA 4NCC2 2A9MH 5LKNA 4HD9A 5I66A 5F1KC 2D7OA 2E7CA 4NN7B 3HRZA 3HE7A 3A6CL 2VL4A 4FQIH 5A3IC 4LSDA 5F6HJ 3DBXB 2H9GB 2GY7B 1TIUA 3OB8A 3AGVA 2HRLA 2D0HA 1BZ9A 3UYRH 1IGJB 3MRBA 4JFFE 4PLNC 3VGHA 1T04B 1D5ZA 3IDNA 2FO4B 3QHTC 4BA8A 4G43B 4X7SH 2AXFB 2DN7A 4U1NA 5B8CA 2CXKA 1QSZA 4FQLL 1T83C 1LD9B 5J06A 3MZGB 7FABH 1GPOL 4K3EL 5BMFL 4M7LL 4U0RC 2C5DC 4XBGA 4YQXH 2UVEA 4UQ3B 1LQSR 5GGTL 1XF3B 2IFFL 1NLBH 1OAKH 1YNTB 3MV7B 1OWRM 1JPGA 2GSGA 2ADIA 2ARJQ 5D71L 4PPTA 2YD7A 3QJHA 2NY6C 3S6CA 5BZWB 4NO3B 1NCTA 4MQ7B 3SE9H 4JFHE 5FYKE 3L5XH 1S9VA 3C6LC 5ERWB 2I07B 1CU4H 4G7VL 1WWCA 5DLML 3I50L 1QRND 3G5ZA 3C5JB 4DEPB 4CVXA 4WI5A 1GL4B 2B39A 4M1CD 5EO0B 2IF7A 1CVRA 5JW5A 1FAIL 2LABA 1DE4B 4JRXA 4RGNB 3DX6B 2UUDH 3MV7E 4OV5A 1VHPA 2GJ6D 4AEHL 1U2CA 2JLLA 4BFIB 2B1AL 1WK0A 2DKMA 2CXGA 2VDKH 4A6YB 4EVNA 4X5WB 2B1HH 2NY2B 4POUB 3UP1A 3AREB 3N1QC 1NBQA 5GGSY 2JIXB 5D1XA 3G08A 1QP1A 1GJIA 4WO4C 3O9WD 3S97C 1OP5H 5HBBA 1DEEB 4P46A 1MRCL 3QNZA 3D3VD 5D2NE 3QQ4B 5INDB 3ZYIA 1U8HB 3AUVA 4M1GL 2BVYA 1CBVL 3I2CH 4RGNE 3IYLW 3EYFB 1MJ8L 1P84J 2DQFA 3T1WA 4N8PA 3HC3H 5FYLH 4R8WH 4OZIB 4O2EB 4WI8A 4JPKL 5HDLA 3EFFA 1EBAA 4LDEB 1S9XB 5FYJD 3D6GA 5HPMA 1JBJA 2VL5A 2PW2B 3Q3GA 1MFCL 3DGGB 4Y4KB 3EO0B 3VXNA 2O61B 4XPGH 5FECB 1QHOA 4ODXA 1RJYB 1EIBA 4KI5C 3EZ8A 4P3DB 1TJIH 4PS4L 4JFFD 4KK6D 4L8CA 1MHCB 4JANB 3RWGB 4TRPL 1RULH 3FO2A 4TUKL 5F89B 5BQ7B 5DQJA 5FKPB 3CNKA 4OZIE 3MXWH 2ADJB 1RI8A 5DRNB 1SJEA 2NCMA 2WIMA 4JKKA 5I1EH 4F7CB 3ET9F 3I85A 2V5RA 3QFJB 1HINH 4XWGH 4Y4FB 4MMZC 5GJSL 4B0MM 1OLLA 1ONQB 4ONHB 4M93C 3HI6L 4XVSH 4LL9A 3HKFA 3NH7L 5I75B 1I1AB 3SKJH 4J3XA 1RZ8B 2ARJA 1MFAH 2JJUA 5JW4Q 1A7RL 1N0XL 4JFHD 5FYKD 3EKCA 5IKCA 3QXVA 4HEPG 1EFQA 1S8DB 1UEMA 1Z9OA 4GW4A 4HXAL 4OGYH 1SYSB 1IGCL 2ZP0T 4FQQA 3DWTA 4KXZH 1C5CL 4JFXB 4WTXA 5F9JB 4DQOH 4F7MA 1VEOA 1A64A 3KPQA 4KDTA 3DO3A 3MV7D 1T66C 3I02A 3GNML 3MA9H 4ZFOL 5B38A 1TVHB 1JF6A 3CZFA 2DICA 3W9DB 4QGYA 3TIEB 1F90H 3PV6A 2FD6L 2DD8L 1KB9K 2VITA 3VFPB 3QISA 1BFSA 1MCPH 1RIVL 1C16A 2Y5EA 2VLKB 4MD5B 5MEOB 1A6UL 4XH2A 3M07A 3KYMB 4WJ5B 4CVUA 4OZGA 5FGRA 2EO9A 3EOAB 4LOUC 2C1PA 3N1MC 4LHUB 3GSRB 1F5WA 3FB8A 5I1GH 4JG0H 1P4BL 4MJ5B 4WDIB 4RGND 2F19L 1G6RB 2O5XL 1FZJA 4XXDB 1A4KB 1KCSL 4GS7C 4JDZB 3ZDZF 3QO0B 3H42L 3EOTL 5FGBC 5GZOC 1K4DA 1PGRB 1U92B 3TBSB 2J8OA 2NY2D 4HJJH 5D1QB 3TH3T 1MCFA 3UTTB 3HNVH 2Z31C 2VMFA 1TQCB 3OGCA 1I8MB 4FQ2L 1FNEA 5DJ8A 5HGDA 4XNUH 2OP4L 3ARFB 3MUGA 1T5XB 3ZHLA 3WIHH 3HMWH 1XF5B 5B4MC 1HILB 3QI9D 2IAMC 3G6AA 1CZ8H 3OR7B 3KLAA 4PJBB 3I6GB 1SY6H 1E4XL 5CGYD 4P4RB 4Y7MA 4LP4A 3BJLA 3I75B 1OAZL 2F5AL 4JPIB 1LEIB 1NMBH 4HCRA 4OFYA 1MWAH 2EE3A 2FCBA 3IVKB 2Y5TB 5DFVD 1RK0B 3MNWA 3VA2C 2D7NA 3B8SA 2ERJC 3NIDF 3QUXC 1AQKL 1GRWA 1U3HB 3AS0A 1FO0B 3UTTE 5ICYA 3MZTA 4AIOA 4E0RB 3X17A 4R4FL 5D2LF 1C5DB 3BXNA 3MLXH 5CP3A 3VXOA 1U8IA 4AIZB 3FHQA 4M6ML 1J1PH 3D2UA 4PJBE 2A74A 1ZEAH 5GRXG 2UZYB 1F58L 2VYRE 1RPQA 2R2BB 3C60A 4YHIA 3S3JA 5JR1H 1FFPA 4G42B 1KIQA 4YZFE 5C09A 1I3GH 2FECL 2W38A 3FB6B 3C5ZA 3SE4C 1AFVL 3DUSA 4M3KB 3MQIA 1O0VA 3PDDA 3TVMC 4U1GB 3VGAB 1K8DA 1XGRA 5LBSL 1IEBA 1TVBA 4YDIH 1AE6H 2Z8WC 3TYGL 5IBTH 1I1AD 4RDQF 5CP3H 2HTKC 1FG2A 2AABL 3D87B 4GAGH 4WGVB 1F6AB 1CXHA 3Q0HA 4DGVL 5ISZB 3BDXA 1MSPA 1YEFH 3NCBB 1HCVA 4N5ED 2ZG3A 4KK9C 2W60B 4J23A 3RUGB 1A5FL 4PRDB 4CU6A 2ESVA 3RNKA 1OL0A 1VACA 4L5FH 2X42A 1JV5B 1OB1B 1OGTB 1QEWB 2VN4A 4P4KA 4OCNC 2P8LA 1LNUB 1BFOA 2Q8AH 4ZDHA 5J12B 2V5SA 1BREA 3WIIH 1I3UA 3QUMA 2K7PA 4MXQC 4AY0A 1FVEB 4RFNC 1LK2B 4Y2DC 4Z0BL 1P4IL 3A6CH 2EXWC 4JJ5A 2EEAA 3MRQB 3WJLA 3MOAL 1JPFB 2FBJL 3E3QC 4EVNB 4IMKC 5B21A 3RVUC 3WS3B 4JZJA 4RDQG 2W59A 5F6IC 5ENWA 3EJJX 1I4FB 3BH9B 5C0DB 4F7PA 4EUPB 2ZSWA 2VLKD 3IB4A 4U31A 4C55A 5I8EB 5CJ8A 2DQGL 4FZ8L 4W81A 2NR6C 3RDTA 5E1AB 2WINA 5IOPB 4X80L 2E6QA 2WZPD 4FQLH 4BYHA 4XWOD 1CLCA 1GPOH 4K3EH 4NP4L 5BMFH 1PG7L 4M7LH 2ZNXA 4LHUD 1JGEA 1HK6A 3OAZK 4NO2A 2AK4E 3CH1A 4OCLC 1E4WL 2IFFH 3EZJB 5FM5M 3OKKB 1NEZG 4P2RA 3D85A 5DQDL 2M8XA 3X3FL 1I7UA 4JM2B 2P5EB 1U93B 5JW4R 5D71H 5K9JL 1CWVA 2WIIA 4R4BA 1P1ZA 3FT4A 4YDJB 3VCLA 5DVNA 3LKSA 4G7YL 4IHOA 1OW0A 3DX8A 2DB8A 5D1QD 5JLZB 1HH6A 3UTTD 1Z2KA 3PHQB 5IMLA 4H20L 2E9JA 3ARFD 5DFWH 4G7VH 4P23A 5DLMH 1DQML 3SDDA 3I50H 3S36X 2A6DA 3OKLA 4QXGL 1RHFA 1WZ1L 4P57B 2Q20A 4EIZC 3EDEA 1G6VK 1JF1B 1OGAA 1FAIH 4AT6A 3T77B 1SJEB 2NY5C 3BW9A 3VWJB 1A1OB 2JB5L 5ALCL 2DDQL 3T3PE 4YK4B 1HN1A 2B1AH 1BQHG 1A9BB 1U3HD 4HPYH 1TPXB 3UAJC 2Y72A 5I8OL 2ZSVA 4PJ7F 1D7FA 4PLJD 5D93B 3FQWB 1KJMA 5EZJA 5C0CE 1UB5A 1UG9A 3VXPB 2VXVL 2E3VA 4PRAB 2HKFL 4IDLA 1KTDB 4Z0XB 2C3GA 2PW1B 5DMIL 1MRCH 1YN6B 1LEKA 1HZHL 1AC0A 2QKIA 3EYUL 1MY7A 2MQ0A 4OJFH 1IM9D 1EHXA 4M1GH 3IU4L 3OKNA 4EI5A 1CBVH 4BZYA 5FOBA 5JOFA 4RFOL 5MENB 1MJ8H 1QYGL 5E8OA 4JPKH 5GZNC 2PCPA 1MNUL 4K7FB 1YNKL 1GOHA 1ZGLB 4DVBB 4I0PA 4LCCA 1L9MA 1AQDB 3MLSL 2BVPB 2YZ8A 1MFCH 3C5SA 3DRTB 3SDCA 3ARGB 4J1UB 4LVNB 2WBJA 2HJLA 3GSXB 2W9DL 2XWBB 1GAFL 1TZHA 4XBPB 4HKJB 2Y23A 1HQRB 2EIDA 5ISZD 4PS4H 2DQJL 2VZSA 1AD0A 5GRWA 4WI6A 3IJSB 3O9WC 2DWDA 3L95B 1CFQB 3JTSA 4TRPH 5L88L 4JFPB 4TUKH 1YZZA 1T0MB 3QULB 3SDXB 3AC0A 43CAA 1DP0A 4YNYA 3MXVL 5JHDA 2VE6B 1ZLUH 2P42B 1KN2H 2AK4D 2LFGA 5GJSH 1Y18B 1MWAB 3BEVB 2DS4A 1U8JA 1WC7A 5FF6A 1WTLA 5DK3A 1TQBB 3HI6H 3KYNA 3QQ9C 5TE4L 1JN6A 4UBDD 4ZFOA 3HLAB 1XR8B 2GW5A 1I8IA 2E5EA 4K9EL 3NH7H 1J0YA 1J8KA 4ONFL 3REWA 3WXVL 1VGKA 4KKLD 1AXIB 3VD5A 1NUDA 2P45B 2HFGL 1VGEL 4GBXD 3ARDD 1A7RH 1N0XH 1U8PA 5KZCB 5C0RL 1QFPA 5IBUG 1LO5B 5DJ8B 1A22B 1YC8A 4NNYA 4KK6C 4I2XB 3WS6C 2A0LD 1IGCH 1A2YB 2UWEF 4B7IA 3S4SB 3U46B 4UTAL 1C5CH 3SDXE 3UDWC 4C4KT 1BQSA 3I3BA 3VXMA 1U8QA 3STZB 4Q6YA 5DJYA 3UTOA 2AJVL 3L3DA 1FZKB 1I7RB 3O8XA 3UO1H 4BJLA 2D7PA 3QEGL 3BZ4A 3EJYD 1QG3A 4R2GB 2MOVA 1S7SB 4JM2D 2P5ED 3GNMH 5C0FB 5EU4B 4ZO6A 4GG6E 3HR6A 3K8KA 4NN7C 2W0PA 5FDWB 2FD6H 2CDGA 2Q7NA 1FN4B 5IFJB 2DD8H 5ACMA 2X1WL 4WFEE 5D7KE 3EO1A 4HIHB 1RIVH 2F54B 4I2XE 1VERA 5EBWB 4KK5D 4KUCD 1LE5B 1A6UH 1HH9B 5E6ID 3DI2B 2OTPA 1JGLL 4OB5L 1BPVA 3UPRB 5A16B 1YDPA 3MYJB 4JKWA 5SWSB 4LEOA 4QHUB 1P4BH 1GC1H 4I8DA 1R24A 2F19H 3HG1A 2O5XH 3DURB 3T3ME 3PGDA 2D7TL 1JPTH 3BQUC 2D2OA 3VWJD 1KCSH 1P5VA 5IJKA 4UU9B 2M26A 2GQHA 1I8LC 1MPAH 2IALA 3H42H 3EOTH 1U8LB 4XHJD 3SE3C 4OZFB 5D7IB 1BMGA 2F54E 3OKYA 5DUPL 1IAIM 1IMHC 4BSJA 5KANG 3MJ6A 4FQ2H 4ORZC 1KTKE 3RPIA 2OP4H 4N9GA 5CZXD 5F21B 4ODUB 4CVZB 5JPMB 3BT2L 3RIFK 5KVGL 3S3SA 5IIEA 1E4XH 4XCEA 3G6DL 4RMRA 5SWSE 1UVQA 1OAZH 5F7YC 2F5AH 5D2NC 3L6FA 1KB9J 5MEND 4YHOL 1IGTA 4M48L 5DO2C 2P8LB 1E4KC 2A9NL 3DYPA 3L3GA 4ZDHB 5HGAA 2I26N 4RGNC 5DMYA 3WFCL 5MI0B 3FQUB 5FEBA 1ZHKA 1BAFL 4LPYA 1C7SA 3H3BC 2HMID 4HUKB 3UTSA 1BIIB 1WF5A 2A6IA 2YSSA 3D5OF 1AQKH 3AU1A 4RAUB 4HFUL 1YPZB 4BKLB 5FM8A 3ARGD 4L4JA 2NY2C 4MAYB 2VDNL 2VR4A 5EFIA 4Q97A 4F9PC 1NFIB 4M6MH 3GB7A 1F58H 1N4XL 3QI9C 5CGYC 3GSWB 4PJHF 3B3IA 2QBWA 5EBMA 1IILE 2D7MA 2AEWA 4WW2F 2QADC 1G9NC 4NIKB 1YN7A 4NN6B 1AFVH 3QR2A 1WBYB 2G60H 1B4JL 3OKOA 1ZXQA 4F9LC 3P73A 5LBSH 1KIPA 1IC7L 4OM1L 3TYGH 2YOCA 1A6ZA 3BZFA 4EN3A 1QSVA 2AABH 1NDMB 2EYSB 4R3SB 5DMGC 3DGCR 3O4OC 4DGVH 1D5BA 1LO0L 4WFED 5D7KD 2FZ3A 1CLZL 4NQUA 4ZXBB 1A5FH 1AXTL 5C08B 1G9MC 4U0QB 1XF2B 1ODAA 2VRAA 2R9HD 4K7PX 3ILPA 1YYML 5ESAA 4FQXA 2BSED 4NKIL 5J13B 3HNSH 4W70A 4RX4D 1P6AB 4R2GD 5KS9B 3W9EB 4DK6A 1K4CB 4Z0BH 2IADB 4QRRE 1P4IH 3P11L 4PJXF 5FIEA 4QRSA 3TT3L 3DO7A 3MOAH 2FBJH 3BPNC 5EZOL 2OYPA 5IQ7L 1UXSA 3LDBB 1CCZA 5IEHA 2HJKB 1JZ7A 1F6FB 2X89A 2F54D 5IHLB 5L2KB 2DQGH 4FZ8H 2Y4SA 3NGBC 1G7IA 2E9IA 4X80H 3IT8D 4N5EC 4OTXL 4UIMB 1RJLB 4FRWA 4S2SA 2AKRB 4WWKA 3UBXB 1FZMA 4I5BA 3BKJL 4NP4H 1PG7H 4MVBD 4JQVC 2ADGA 5IMOA 5SWSD 3MRJB 4OLYL 1E4WH 1KV3A 3IFLL 4HS3B 2NLJA 3E6FA 5ACZB 5DQDH 3X3FH 2JCCF 1LP9F 2BVTA 5BZDA 5K9JH 5TQ0L 1P7QA 3JWDL 1NUNB 4G7YH 4PJFF 2BDNL 3ARUA 1L6ZA 2VNCA 4DVRL 1KB5L 4WU7B 4NO5A 1LGVA 5L2KE 3MBXL 2X4OB 5GGUB 5ILTL 1U8NB 5EOCJ 1CICA 1JCKA 2IPTL 4H20H 1U6AL 2J8UF 4PJGF 1DQMH 1UJTA 3PABB 3VG9B 4TSBL 4QXGH 1ETZA 1MIML 2HRPL 2OK0L 1WZ1H 1NGXA 3CC5A 4M61A 2KH2B 3BIKA 3K4DA 3LKOB 1MJJA 4OCSH 4XWOC 4HWBL 4JLRA 3BP6A 3WEXB 3MRCB 4N0FB 3OHXB 5D96C 5DRWB 4OQTA 5JDSB 1UXWB 5IW3A 4NQDB 2ZUWA 5DJCB 1KCUL 2JB5H 5ALCH 2DDQH 3MRLA 1G7HB 4GMSL 1KPVB 1W0VB 4QRPA 3ZLQC 3QQNA 4EOWL 1OPGL 5I8OH 1Y6NR 3V95A 1NCBL 4Q2ZA 4MAYD 4OLUL 2VXVH 4HKBA 2EIEA 3OXRB 5KBNC 1AR1C 3AS2A 3RWJB 2HKFH 5D7JA 2IQAA 3IETB 5DMIH 2DI8A 4M1DL 2A73A 3MBEA 1HZHH 3EYUH 5TE6H 1BVKA 4KC3B 5FO7B 3IU4H 4PV9A 1X5ZA 3DROB 1CG9A 3ZE0F 4OQTH 4RFOH 1GIGL 4X98A 4NQDE 1RUKL 4YIQA 5T3ZH 1PKQE 4KMQA 3KPLB 1HYSC 3UBXI 1S7WA 1QYGH 3D0LB 5HHQB 3WN5A 3MR9B 3QA3A 1MNUH 4IIQA 2HFFA 1YNKH 4G9DA 3RAJL 4I0KA 1OAXL 5DZLA 5AWNL 1AO7A 1CD1A 3T2OA 5IB5A 3CDFA 3MLSH 2I60L 5FO8A 5DF0A 2QSQA 1VFBB 5CMAB 1U8OB 3HS0B 3UZQA 2W9DH 5I1DB 3V5DB 3DXAA 2EEBA 4ZFFB 3KPRE 2DQJH 3GMMA 4NQCA 3E2HC 3FB7A 1XGYL 3EGSB 4X99A 5IB4A 2AV7B 1I9JL 1T6WA 5L88H 4KTDL 3WUWB 3S36L 3K2MC 1DVFA 2RR3A 2GK0B 3X14B 3Q6GL 3HUJB 2OTUB 2Z8SA 3J8F7 5MERB 4I4WB 3TGXA 5DD3L 5ICZA 4Y5YA 4ZSOA 3FT3B 4KMLB 4EI6B 5INCA 5D7LB 2D3VA 3BWUC 4GG8A 1Y0LA 5TE4H 4WV1A 4IRJA 4YFDB 4NJ9L 4QKXB 4K9EH 1LO4L 5FA4B 4ONFH 3WXVH 4ZYKB 3JVGC 1T1ZB 2HFGH 3V52L 1VGEH 5HGHB 5FCSH 5FHBL 3VFTB 3CFBB 2D9CA 5L2KD 2D7QA 4U3CA 1WT5C 3IKCB 3GSNL 3FAWA 1ZWIA 3V0VB 1PAMA 4UTAH 5E56A 2R1WB 3JXAA 4UOJA 3VXTA 5EBLB 1EAJA 1SVZA 4P5KA 5JW3L 2BVQA 1ZSDB 1N7ML 4X6DB 1NDGA 2EZ0D 5DGRA 1BD2A 1DDHB 4FQHA 4RZCB 2N56A 2AJVH 4U1LB 5HHNB 3NCJH 3GJEA 4O2FB 5D7LE 3WNPA 1E6JL 3QEGH 2FGWL 3MLZL 4M62L 4U6HA 3GSUA 1J5OL 3K1KC 2R8SL 4MD4B 1G0XA 5C0AA 3O6FC 1QSFA 5H94A 4K07A 4UBDC 2ATPB 1YQ2A 4NJAL 1WLHA 4Z76B 4K94L 4GBXC 3ARDC 3FQNB 5E03A 5I1KL 1EXUB 3FAXA 3ALXA 2DYPA 4H8WC 4L8BA 2HJFB 4YDLB 5GS2H 3B9AA 3QQ3B 3STLB 3Q6FB 4M6OL 1Z5LB 2YD1A 1JGLH 4OB5H 1RZFL 2OL3B 5F44A 3KS0J 4DGIL 1R3LB 1NGQL 3K74B 1UKSA 3GMRB 3U0WL 1NJ9B 2EDBA 4WVRA 32C2B 3U30C 1MQ8A 2D7TH 3QT2A 1BF8A 4N0RA 1GGCL 3RWDA 4NQDD 2JJWA 1U3JA 3LVEA 1FNFA 1E4XI 3SY0B 4JM2C 4H1LH 3VWKA 2NY7L 5ID1A 4EIGB 3TPUA 4DAGL 3F7PC 3T4YA 2R2HA 4XAKE 5C6TL 5DUPH 2DQTL 1NCAL 5SWZA 3B9KD 3IKKA 5TPWL 3KPNB 1HQ4A 3BT2H 1EK3A 5IGXL 3KPRD 2VIRB 3B2VL 4WI2A 5KVGH 2AXHA 4Y8DC 4P2OA 4RWYL 2KQNA 2HKHL 2GSIB 5E6IC 3ULVE 4KZDL 5D5MF 4FMKA 4YHOH 2E9BA 4M48H 1XCTA 3HI5L 3FRUB 2A9NH 5A1AA 5JXED 3ZTJG 3WFCH 4V1DB 4ZUWA 1FC2D 5I16B 1BAFH 4G9FB 5AG8A 2XPGB 4XCNA 5T3XE 5C0BA 2FEDC 1JWUB 4XHJC 3RU8L 2BY2A 4N8VG 4OF7A 3B43A 1O7VA 1WWAX 4HFUH 5TH2A 4U1IA 3PIQB 4EKXA 1VKXB 5DJ6B 5KVEL 2VDNH 5D93C 2A1WL 3WV0A 5BV7B 3PJSB 1G7LB 1UWEL 4HLZH 1EV2E 5IB3A 1CXKA 1MFEL 4PJ5A 1N4XH 4H25B 3MREA 5LXGH 4ODWA 2YD9A 4KRLB 3F65A 4V1DE 3EOBA