1NGPH

N1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3-nitrophenyl) acetate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
215
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of the Fab fragment of murine N1G9 antibody from the primary immune response and of its complex with (4-hydroxy-3-nitrophenyl)acetate.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords N1G9 (IGG1-LAMBDA)
total genus 39
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 1995-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH02
1MFEL 1JZ8A 3VG9B 1RJYA 4JKPH 3MMEA 3IDUA 4OF6A 1JK8A 5DMIL 1QFWH 2VQTA 3K8MA 3R0MA 5E8PB 2RJMA 3VRJB 3KLHD 1U3HD 1BOGA 1RZJH 4XAWH 1L0XA 3V7AE 4U4BA 2HT4C 4XHQA 4EEEA 2Y07H 3ILPA 3MV7E 3TJEL 5ACZA 4LSUL 4R3SB 4QXGH 5F96L 3JUZA 5FOBB 3HUJF 1XZ0B 3TP4A 4JFFB 1INQB 1WGOA 1MRCH 2XA8H 3THML 4AIXA 3BPNB 4AIOA 1NFIA 3TVMC 3T09A 4ZSOA 2MQ3A 4ZUVB 3U4EB 3KPOB 1OT2A 4I18A 3A6OA 1WZMA 1K4DA 4M6ML 5F7FA 4DVRH 1TCRA 3M8OH 2HH0H 3INUL 5DMKA 2R9HD 3L9RB 5D8JH 2HG5A 3SCMA 3ULUL 2FJFB 4QO1A 2GTZA 4P5TB 1G0XA 3NZ8B 1CVSC 4CVZB 1CVRA 1N8ZB 2J6EH 4LLVB 2NY7L 5BW7C 1BZ9B 3FFDB 3L3KA 1HHIA 1AY1H 3Q2CA 5F72S 4LCCA 5T1MB 4FP8H 1ZT7A 1GGYA 5DI8A 4BK5A 3OAYH 1CU4L 4D0DB 2VZ3A 4DGYL 2XXCB 1BPVA 2IQAB 3MXWL 4GMSH 3QXDB 1FJ1A 4PJCF 1K6QH 3LMJH 3SDAB 3P9LB 3TBVA 2FHCA 5EU7E 3FFCA 3LY6A 4FFYH 1J1XH 1ZEAL 3B5GA 2XRAL 2X1WL 1NEZB 3W0WB 1LP9E 1V7ML 5HGBA 1ZSDA 4FG6C 5DFTA 4KJYA 5EPMA 2DTSA 3LEYL 3QEQB 2C4FU 4JGUA 1S7SA 4GAJH 5EO9B 5FM4A 3VG9C 4YIQB 3W82A 5IHLB 3RWHB 3WDJA 5EWIH 4I8DA 1XH3A 4NJ9L 5EN2B 5IF0B 3PWVA 1A6PA 4N8CH 5C0RH 1FV1A 1RZ8B 2VR4A 5KW9H 3VD5A 2P7TA 2GITB 3FO1B 4XCNB 3O3AB 4XNMB 5HY9A 4J6RH 3EDJA 4OI9A 1JWMA 1BOGB 2G9HA 4ZQKB 5GZOC 4YWGH 1H0DB 2ZG3A 1URLA 2DQFA 1CICC 3LEXA 5AYUL 5KSUB 5HDQH 4ZPVB 3CDFA 3WFDL 3KYOB 3WS3A 4CDHA 1FGVH 4JFQB 5C09A 1A6UL 2IFFH 2QHRH 3SJVA 3AFLA 5GZOD 4ZPTA 4ORGA 5FKPB 4Y5YB 3MRKA 4ZFGL 1I4FA 1BZ7A 1YMMA 4OFKA 5J12C 5GS1B 1H3XA 2FJGA 2OCFD 3AMLA 4IRSA 3C2AH 1NLBL 2VDMH 2WBJB 3QDJE 1FNLA 2LU3A 1ZLSL 4FMFA 1GGBH 3L3HA 3BEWA 5J3HC 3DSFH 4KI5C 2JCCB 1RV6X 3I2CL 4W81A 3L7FB 1TCRB 3IDIA 4LPTA 2IWGA 5CJOH 2D3VA 2F5BL 1MIMH 3QNZB 1WCBA 3BP7B 3TN0B 3WE6B 4ODBD 4ONGH 5EOTA 4A6YA 2VERN 4OIIH 1DDHA 1VFAA 3IFNH 4HUXA 5JR1L 2FEDD 3LKSA 4WU5A 2GFBB 3ARRA 3CMGA 2HFTA 5JXAH 4KKAC 1DTUA 3CVIH 3BKCL 1IKNC 4NQCB 4YDIL 1EHXA 2X6MA 4NM8L 1U8NB 1G7MB 4PJHA 4PJ5E 3CGTA 3LKQB 3QQ4A 5HGDB 4DKDC 1S3KL 4MHHG 4NN6C 3WIHH 3HPJB 5KAQG 1A64A 4PS4H 2BSRB 4YWGL 2EIBA 3IFLL 3PWUA 4BSJA 3IS0X 1D9KB 3VI3E 5KANG 1IEAB 3QBTB 4Y1AA 3GRWL 1R5WA 1VKXA 3I3EA 3GNML 1ACYL 1ZVYA 4KTEH 1XF2B 3NA9H 3BXNA 4YDKH 1KTRL 1HH6A 3C09B 5BRZD 1TITA 3ZT5A 2DF3A 5MP6H 2GW5A 2O5YH 5EPMB 3NCJL 4P57A 4JE4B 3DX8B 1JZ2A 3SE4C 3QUKB 4I3RL 5KN5B 3MC0A 3GMMB 1GOGA 3KPQB 2HKHL 3ARFD 4RMTA 3KWWB 1U8OB 3O2WL 5IVZB 4GUPB 4PR5A 2HJKB 3CLEH 5J89A 1KJ3H 4JO1L 2PW1A 4P5TD 2JE8A 1PKQB 2HLFC 3FN9A 5JQHC 1W0VB 5HDQL 5E08H 1L4IA 3I9GH 4HIXH 5FK9B 4WNQA 3L6FA 3I75B 1BHGA 5IQ7L 1P7QA 5EBMB 3KPMA 1INDH 3ZL4H 1DQMH 3FZUC 4PJIB 4JFPA 3OF6D 4FZ8L 4Y4KD 3LEXB 3IYLW 4PLOB 1XF1A 3MCG1 1L7IH 3UTZA 2XTJE 5E2JA 1FNHA 1JN6A 1HHGA 5LAXB 4EUPB 4PJDE 1G0DA 5DRWA 3EKCA 1WAAA 1ADQA 4R2GC 3ARBB 2UYLA 4OZFB 3FKUS 2X4SB 3TVMD 2F19L 2GJZB 1HQ4B 5E94A 4EI6B 1SBBA 3LRSB 3S3SA 4NN5B 3FTGA 2ZNWA 1RUKL 4G9FE 3QDGB 1MCPL 1IRAY 1G7PB 1MFAH 3JWOH 3MV9E 2BNUB 3AXLB 5CJ5A 4XMKL 3ZKMD 2NZ9C 4G7VL 1LE5B 4Y0GA 1DQQA 1DQTA 5TPWH 4BZYA 3WJJC 3MYZA 2WBWB 5IFHL 1N3NA 5CJ8A 1ODAA 1JZ6A 1M6OA 2IALB 1CGVA 2AEIT 3KDMB 3O8XC 1PDKA 4OBRA 3DRQA 3N85H 4HK0A 3RBSA 4UTAH 3MYJB 1LO2H 4GW5B 5I16A 3SOBH 1KN4H 3V6ZB 4HW6A 3DROA 5DSCB 2CDEB 5FYKD 4BUGA 3ULUE 3KJ4C 4HIIB 2H45A 3QRGH 5EUKB 3TA3B 1NEZG 3QA3A 3SE3C 1JWUA 1YEJH 2IEPA 4ESKA 1CFTA 1SBSH 4Z7UB 1VACB 3CSGA 5IW6A 4W6YB 3WN5A 2I5YH 2COQA 4JPIA 4LBEA 4RBPH 1OQXA 3HMXA 5D7JB 3TBSA 4EBQH 3MMEB 2Y36H 4I3SL 5D7KD 1RMFL 5CEXB 5DGRA 1G1CA 4K94L 1WISA 3MLXH 1NCNA 4S1RH 3QIUB 2WP3O 4ZFOL 3MRLA 4X6BA 4YHML 3SE9H 1KNOA 5E9DD 3BGMA 5HI4D 3U79A 2DMKA 3MOAH 4U1HB 1EFXA 2F74B 1J12A 2Z0BA 2MTPA 4KI5F 5GJSH 3RA7H 1UKTA 1MVFA 2DKSA 4G80A 4OKVA 3SKUD 2Y07L 4WI5A 2ERJC 3G6DL 1HQRB 3RDTD 4R8WH 4E5XB 5DUPH 1U8IB 3SDDD 3WXWH 1QKZH 1V05A 2BNQB 3A6BL 2BC4A 3DUSA 1T20B 3L3DA 2VITA 4OCYH 4ZS7H 4NPYB 4R7NA 4NZJA 5C70A 4L8SB 4NO2B 1PGRB 4JQXC 5E1HB 2YPLB 1NL0H 5C9JB 4NQXB 5E8PA 2H9GB 2NX5A 3LN4A 4G5ZH 5E24E 3RTQC 4YDKL 3QG6B 5I1AA 1J5OL 2ESVB 2NY4C 4JVWA 4PJAB 4HZLB 4PJBE 4Y19D 3S8WA 1RUPH 1DZBA 1EJOL 4JO2H 4D2NA 4OFYA 1CGTA 3BVNA 3S88H 3KPRE 4I48B 1DR9A 3QH3B 1XMWA 4JZOA 4YHPA 4KKBC 5JNYA 5AD0B 3I3BA 3VXUE 1QFUL 1OAYL 4FFWD 3CZJA 5IJKC 2FR4A 4MA1C 1JNLH 1UWEH 1JVKA 4X9HA 3DUUB 2G5RA 4IJ3C 4MZ3A 4YUEH 3GJEB 5KBNC 5ITFB 4OBSA 3D9AL 4NO3B 2OK0H 3U4EA 3BRDA 4Z7QF 1EHLH 2Q20A 4QCIA 4EUPH 1EVTC 4NZUL 4CJ0A 4NRZA 1HK6A 2X1QA 4JZNB 1U95B 1NH6A 2R0LL 1R3KB 3CXHJ 2GCYA 5I18L 3DO7A 4U1NA 2L7JA 3MLTA 4HFWA 3CDGB 1MRFH 1KELH 3UTOA 4BUHA 2PXYB 4FN0A 4NCDA 4KVNL 2Z31C 2J2ZA 2VYRE 2HFGH 4PTTA 3MLZL 3NFPB 2WLZA 5D7IE 3LQMA 2QSVA 4HJGA 3LEVL 1HHIB 4YX2H 3JTTA 2J8HA 1T1XA 4PRIE 3EGSB 5BZDB 3T0AA 3J8F7 3TBYB 3WKMH 3RWGA 3REVA 5KVFL 5EU4A 3VXRA 3VFOA 1U8MB 1MCSA 4LVOC 4XWGL 1EO8H 1RUMH 4X4YB 4X9IA 3S4SG 2VC2L 1LK2B 1TMCB 2IPKA 3QT2A 4OQTH 2CO6B 3CXDH 3KLDA 3VD4A 3T1WA 3ZZ1A 4GXUM 3LDBC 3CH8A 3T4AA 3QULA 3GIZH 5E95B 5SWZE 2V9RA 4MB3A 1BQLL 2PTUA 1P7HL 2EDHA 1QLEL 4I0PD 4RFEA 5JDSA 5ESQA 2JIXB 4LLUA 3LN5B 5GJSL 3G5ZA 1L6ZA 4L8SC 2NY0B 2Q7YA 4F57H 3C6LD 4OKDA 3WXVH 4OZHA 1BWWA 2OQJB 1EAPB 3P0VL 2ZUQB 1G7JA 1BX2B 2X7LA 5EO0A 1UEMA 4M93C 4L9LA 1C7TA 4LEOA 4NGHL 3V0VB 2DDQL 5D7IA 2NY2D 1Y6NR 4HXAH 1T21B 4KRPC 3W9EA 2VLRB 3KXFE 3B2UD 4WHTA 5HPMA 4WU5B 2I25N 1H5BB 2H9GA 3A6BH 4PJBF 5HVGB 1A6TB 5BV7C 1W0YT 3TYFA 3RVTD 5HYJA 5DZNA 2YUZA 4I48A 5FUZL 5DGQA 4NC0B 2IG2H 5IR1A 3WSQL 1U8HB 4MAYD 2YSSB 3STBA 2Q8AH 2DM4A 1M1SA 4I9WD 4GT7A 2AEPL 4MQTB 3MRJB 3PQYA 5FYKU 4F9PC 3KG5A 3HE6B 2NY6B 2PO6D 4HT1L 1F11A 4P5TC 1EH9A 1CK0H 2E9JA 1KIQB 4JFEA 3P9MA 1A7PH 5K9KB 5MENE 1T0NA 4YZFF 5CUSL 3R06B 4ZFOA 4RFNB 3BMWA 4HJ0C 4H26A 1AI1L 4NKMB 5KS9A 5T5NG 5EBLB 1K4CB 1K8DB 1BVKB 3MO1A 4RAUB 1YNKL 2VXVH 1KEMH 5JW5A 2DI7A 4U6VH 4U0QB 1D5XA 2W0FA 4UV4H 3VXSD 1RIHH 2F8XC 5C0CE 4ZYKA 4AEHH 3JTTB 4RRPG 5EC1A 2PNDA 3AUVA 4TQEL 2XKNA 5FHBL 1FZJB 5ADOL 1FP5A 3QSKB 4PJIF 4Y5XB 5ESAA 1UZ6F 3GHEL 1YEHH 4D9LL 1KTLB 5C0JA 5CP3H 5T3XD 1IGYB 2Q8BL 3G5XA 3GSRB 1YEFH 3O3BA 4XPFL 2V2TB 4JO1H 4PJEA 1T7VA 2AV1B 1CD8A 4U3HA 4QTIL 4K2UL 2EDOA 2PR4L 3LB6C 1D6EB 1I8IB 5F9JA 4UQ2B 4MA8L 4OLEA 2ARJB 5I75B 5JW4R 1WIPA 3GBNL 1T4KB 5GIRB 4LLYA 4MNQA 1SVZA 3KHQA 4NUGH 4JHBA 3KS0H 4JY5L 3FTGB 1JF6A 1HCVA 2A73A 3LZFH 4HWBH 1EAPA 3MLRH 2BY1A 1VA9A 4LPUA 5EO0B 1YN6B 3VCLA 3QUXC 4I1NB 4HKJA 1BM3H 3MGOB 32C2A 4L8BB 1I7ZA 5J1AB 2YUWA 1TQBB 5IV2A 5H37G 2VR9A 1ZHBA 2VN7A 8FABB 1F58L 1E27B 2FIKB 3OR6B 4AM0A 2YD7A 4FQ1H 5J11B 2W07A 2V2WA 5EOCJ 5E08L 1JIBA 2VRAA 1RK1B 1ZS8A 3HE6C 3O9WC 1A9BB 1YEDA 4NKQB 1DQJB 1HE7A 3OG6B 1CE6A 2VDLH 4PJEE 5K93A 1Y0LA 4YXHL 1JWUB 4G43B 1CGUA 4WFHD 5TDNA 3LB6D 2QSCH 1SJEA 3VWKD 3VXSA 4PJAE 1K8IA 1F5WA 1G7IA 3WFZA 1AR1D 2LV4A 3HKFA 3TJHD 2FBOJ 3VFNB 3FMGH 2DQCL 3SDXF 4MXVE 5D1XD 3MLRL 4ODVL 1MSPA 5I30L 4HS6A 1L9MA 2BK8A 3QDMB 3OKKB 1I8LA 3QG7L 4RAUA 5CILL 4NQDE 2LU4A 2NCMA 1NLBH 4NM4L 5I8CA 4WWKD 3KJ6L 3MBXH 3D0LA 4XPBL 4AL8H 3STZB 4GW5A 4NKIH 3B3IA 3WFBH 1EPFA 2FD6H 3SKOA 5A1AA 3HG1B 4YHMH 1NCWH 2BOBB 5E8OB 1T0PB 2PYFA 2XIDA 5I75C 3O6KL 3I6GA 3E1F1 1CD0A 1ZA6A 2G2RB 1KTLA 5C0JB 3LIZL 4HLZH 1IGYA 5IQ7H 3ARXA 3IDGB 4H0IA 4R96B 5HHXL 3F7YB 3PWLB 1N6QH 4NCC1 4U1LA 4NO2A 1S9WA 1YJDH 4PRDB 4KWUA 5E6IB 3W39B 2DMCA 3KPSD 1KFAL 3WJLA 5KW9L 1QPPA 2P5EE 1QSFD 2R1YB 3K1DA 3GO1L 4Z7NF 4DJMA 2CD0A 2CIKA 1R3IH 1KJMB 5IB3A 3V5DB 4LCYA 2A73B 3JSSA 3RPIA 3CVHB 4HWBL 5KOVC 5H35A 3V52L 3H3PL 5H2BA 1KG0A 3TO2A 2FR4B 5T1LA 2B4CH 4L3CB 5KZCD 4HKJB 1FNSH 4B41A 3HE7A 5FGBA 4P23D 4UNUA 5T5FH 1OAUL 4LRIA 2NY2C 1KB5B 2VKXA 3V7MA 1AFVH 1U3YA 5IHUH 4X6DE 1W8OA 3DHMA 4JVPA 4MYWB 5ICXB 4APQD 1V7MH 1LNUA 2BHYA 4LQFL 4HEME 4N0FB 3D0VB 4R2GB 2XWTA 4QT5A 5I1JL 5HGAA 3HB3C 3TIDA 2FWOB 2B1AH 5JPNB 5TFSL 3TNMB 4IRJA 3B43A 2NX5B 3LN4B 1JPSL 1EEUA 2XV6B 4NM8H 3JV4A 1XR9B 1RZIB 3DX6A 4MDIA 5IB5A 4Q7DA 3V79C 4HKXA 3EGSA 1F3JA 1P4IH 1N0LA 1S78C 3SKJL 5CD5D 5DTFB 3ARED 2FLBT 3P4LA 4O5LH 1XF3B 5I1KL 3U7WL 4GW4A 2Q6WA 4BZ1H 2PYEA 1EVUA 4XNYL 1HOCB 3BW9A 4IRZL 4XPAH 2GSGB 3U82B 3BRGC 5H94B 3DUHA 1PQZB 3U0TA 3WNOA 2MHAA 3BE1H 4Z7VB 2WW8A 4LSRH 4OUUB 4MXWL 4IMLB 1XT5A 2BX5A 1P2CA 3BZ4A 3SPVA 3N1QC 4N90D 4AL8L 2CGRL 2HKHH 4LCWD 3F12B 4P5MB 3D3VE 2UY6A 1DANT 4JM2A 3ARUA 5IBUG 5DEFA 4X6EA 3H3PH 3HNSL 4JFDD 3EAKA 1Y6KR 5DJAA 7FABH 4C58B 3D85A 2VDNH 2B39A 5DJZB 5TDOA 4WHTB 3L7EB 5HPMB 3VXRB 2A83B 5ENWB 1A7RL 3LD8B 1NBZB 3C6LA 5IROC 3MRHA 4QWWD 2H8PB 4OLUH 2WBJC 1R3LA 1GL4B 2R15A 4XPGL 4AMKH 5J13B 2YMXL 4D3CH 4UAOB 3MLWL 3VWJD 4Q0XH 3VJ6B 1IGIL 4EJ1C 1AXIB 2KQMA 3F6IA 3CFCH 4ZNEA 3IVKB 5FOBA 4YDIH 4MJ2A 5EU6A 1N64H 3QFJE 1OGAE 4EDXA 1OAZL 5EU6E 1PG7W 1NGXA 3SQBA 2BSSA 1C16A 1MRDL 1UZ8A 1BQLH 4D9RE 5F7MC 4XPBH 3S97C 4XGZB 1JL8A 3D48R 3S36L 5HHOB 3SGKC 1JCKA 1K4DB 3N50A 4F37F 2DWEB 3BP6A 3UDWC 5CJXC 1HINH 3QG7H 5EBWA 3V6FA 4JDTL 4P59L 1OAZH 4L4VD 4MAYA 4FABL 1G7LA 3C9NB 4FQCH 5HI4C 1OCWL 5F89A 3JV5A 3LN9A 1WBYB 4FQXB 4DTGH 3RVWC 2IH3A 1LEIB 4IOSD 3ZE0E 3H7LA 4Y88A 1H3VA 3OB0K 3C09C 2JLLA 4FQCL 5FXCH 1DEEB 1F3JB 2GUOA 4JCMA 2H1PL 3RY5A 1NAML 4NUJB 5ACZB 5DTFA 3PXJA 4ZS7L 4MCYB 5CGTA 1FDLH 1CGWA 1DSFL 5F6HI 4HUUB 3GBML 5CEZL 5DVNA 1YEFL 4R4NC 4P2QE 1XF4B 2P47B 3O4LD 5CHNA 4KZEL 4C4KT 4NT6B 4OV5A 3AMKA 5C0AA 5KVGH 3MRRB 1AQDA 3QR2A 2HWZH 3ES6B 2HT3C 3VDCA 5K9OB 3PHOA 2GQHA 4OUUA 1U58B 4WUUE 5LXGH 3BP5A 1FYTB 4NOFA 4PPTA 3IRPX 3G6AB 3RWCA 4AEHL 3N9GH 4K3HA 1DQDH 3TBTA 4GKNB 2UWEE 1OTTC 1E28A 1OSPH 3U46B 2PTTB 3QXUA 4V1DA 3WO4B 3J7HA 3IB4A 1F4HA 4U6XB 3CSPA 2IBGA 2IADA 4X5XA 3PWVB 1WC7B 4XAWL 3VFGH 5HYFA 4ZYKB 3K80A 3DXAD 5K9QG 3QHTC 4KKNA 2R4SL 4PJBA 1W0WB 4RAVB 4XPGH 4KHXL 4JR9H 4QHUA 4CN6A 1P6AB 1BEYH 3SDCA 1A7RH 1NBZA 3M1BB 1QOKA 3T0EC 4NHUB 4G6JH 3GMRB 2DQFB 1HILA 4MLSA 3W2DH 4PLJD 4PJ8A 1UWGL 2I24N 1NUFA 3FT2A 4PRAA 3CFJB 5ESVB 1IEBB 3HNTH 1NC2B 1B4JL 2C3XA 5D72L 2FGWH 1LD9A 3U0WL 1QFPA 1AXTL 3U4BL 4DOHE 3O8XB 2HJLA 1KCKA 4Z8FH 4OQTA 1YN6A 3BP6B 4XXDB 1ZANL 3AS0A 3HN3A 2V5RA 5ISZA 1U3HB 1AFVL 5IHUL 5FYKL 3ZKNC 3EDKA 4JGMA 4Y5VC 2IMNA 1CGXA 2HTKC 5CUSH 3EDFA 3N1PC 5DXWA 1LDPH 3V0WL 3ARFC 2CR3A 5F89B 3RUGF 1A6VL 2W65B 3LS4L 3SDYH 1FCCA 4X6DB 1JPFA 5D7SH 2QADB 1K6QL 5AZEL 1O7VA 2A74B 2AVGA 4GRMB 4H20L 3EJZD 1RURL 4GXUN 4RWYL 1DUYB 1K5NA 4KGLA 3IJHB 5HHMB 4L8CB 2EDDA 1E4XI 3MA9H 1YN7B 3MFFA 1AY1L 4Y1AB 3W2DL 5TDNB 3IJYB 1MHEB 2BVYA 2IQ9L 2BFVL 2DI9A 2CK2A 3GSNB 2DQDH 2DMBA 4DZBA 1KLGB 4KUCF 4GJTB 1MFEH 3MRDA 5F70A 5C0AB 4O58H 4OD3H 4LASH 1DE4B 3C5SB 2OZ4L 1VFUA 3P4OB 1F00I 3MRNB 4XWOD 1MFDL 3RGHA 4YLQT 4C54A 1OP3K 2Z4QB 4LQ1A 5CCKH 3I6LE 5FV1L 1VADB 3BPLC 3HZYA 5FUOL 4XPTL 3U83A 1I9RH 4YZFE 4NJAH 3CFIC 3T0EB 2E27H 5E7BA 1KG0B 1OWRM 2EKSB 1Q9OA 1VSCA 1ZHNA 3CZFA 4R4BB 4YEFA 3RGVC 5C0CA 4I77L 5IEHB 1CD9B 1UFUA 1KJVB 1D5MB 1RU9L 4P2OA 2XTLA 2DQTH 2XI9A 4M7LH 5FK9A 1KJ2A 4OCXL 5DHVH 2EE3A 1NSNL 1VKXB 3EBAA 1DQDL 3M1BA 3CVHH 2DOCA 4KK8C 3VRLF 2QADD 5E2UL 1CD1B 1NGYB 2QSCL 2AK1H 3SKNB 4UBDD 5DRXA 1UXWA 4MMZC 5GGRA 1Q0YL 4OSUH 3VDBA 2FWOA 4PIRF 4HBCH 4P57B 3CSBA 1JZ3A 4TTDC 4N1CA 5DQDH 2ICWJ 3FRUA 3WKML 4MD0A 2OX5A 3GMMA 3QHFH 3WNMA 1DSFH 1AE6L 3JTSB 2AJVL 3QQNA 1J0JA 1A7NL 4N68A 3WFBL 1CG9A 4PJ9D 3D5OF 3MODH 3U2SB 4J8RB 4Y89A 3T8XA 2H26B 1G9NC 1XF3A 2MNUA 4J3SA 2VKWA 1A1NA 1QBBA 2W59A 5CILH 4GBXB 2DM2A 5ISZB 4H1LH 4FXGA 3FT3A 4IRJD 2DLHA 2VLJA 5F9WB 1X4XA 5E2VL 4EN3A 1VGEL 3CIQA 2M8XA 3LKPA 1KB9K 1CI5A 5IEKA 1QR4A 4NZTH 4P4RA 1L7TH 2KH2B 4K7PH 2ZUVA 4JFDA 5EU7C 3TT3H 4Z9KB 35C8L 4K71B 1P2CB 3BZ4B 3QIWD 2EH7L 3S37L 4KDWA 1N59B 3OGCA 5SWSA 5JOFA 5I15H 2IAMC 3F12A 4P5MA 3VFPB 1A3LL 4M7JH 2GJ6E 3WFDH 4QGYA 1SJHA 5B3NA 5EDXA 3RBGA 5I1EH 4TVSa 3CFKA 2IBBA 3PGFL 1Q0YH 4OSUL 3ZHLA 1BQSA 3ESUF 5T1LD 1CBVL 5C07B 2L7UA 5I15L 5DI8B 3D85B 3TZVB 2YC1B 3BKCH 1F4YL 1JJUA 2HKFH 2CUHA 3DIFB 1E0OB 5TDOB 3SO3B 3SE3A 3GHEH 3S35X 1TPXB 2AK4E 2PYEB 1YEKH 3QFJD 1ULVA 3D2UD 4HG4K 3GFUA 3QJHB 3RGVB 1LE5A 4KMTL 1HSBA 3LQZB 2BNRD 4F2MB 3CJJA 4MAUL 5L6YH 3ETBF 3RVVC 4IDJH 5HGBB 1JGVL 4LKCA 5F7LB 1A4KA 4QXUH 2FECI 2OTWB 1YPZB 4YFDB 5HYQA 1CN4A 1IAIM 3GBNH 2WSKA 4BFEA 1UACL 2YXFA 4YIQA 1GPOH 4P49A 2Z92A 4JPVL 4YC2B 3PWPD 1G9EA 1J1XL 1MI5B 1ZEAH 2C9AA 4YXLL 1SMOA 1X5AA 3CFCL 1PLGL 4K55A 4MX7B 4ZO7A 1YECH 1JZ7A 3EFFB 4PJFF 3AROA 4O51B 4JHWL 1NJ9B 1Z9SA 3SE4A 2Y06L 3EO9L 3HZVB 2AXHA 2V9TA 3ZE1F 2Y72A 2ICWA 3O11B 3GI9H 3KPLA 5C9KA 1JNNL 2LQRA 3OJ2C 3H9SD 5DRXB 2EH8L 5KSVA 5ICYA 3CVHL 2A83A 4PBWD 5EA0H 4S1SL 1EFXD 4C59B 2Y36L 4I3SH 4ONFL 3HZMA 4U6VL 5BJTA 5J12B 4HX1B 3WUWA 3KYOA 3WS3B 5E5MB 4XBGA 4MJIA 3MRIB 1EO5A 2SEBA 3JXAA 1S7VA 5FYJU 5I0DA 3HPLB 2Z35A 2XNAB 3U9UA 3IU3B 3NIDF 5FKPA 1CWVA 3P40A 2JJSA 1ZE3C 4GBXA 5AZEH 1CZ8L 1F6LL 1ZMYA 4F8QA 2FO1A 3NZHH 3SOBL 2WBJA 3H3KA 2GSIB 4JKMA 1RHHB 3H9SA 3PGDB 1QNZL 3BIAX 4JJ5B 4Z8FL 3WEXB 2X70B 2JCCA 4P4RB 2HMIC 3BRFA 3NTCH 2R2BB 5C0GB 4EIGB 3RZCD 4DOHB 1RPQA 3RKDC 1DLHA 4L3EE 4PJ7A 1ZT4B 3FONA 3Q5YA 1QRND 5GRXG 3HZKB 4DFIA 3V95A 3GIVA 4O2EB 3IDXH 3QAZB 4XI5D 5E4EC 3VXRD 1JHTB 1RK0A 4F7EA 2G60L 4NNPL 3EFDH 1U8QA 3SBWA 3VXSE 1N7ML 3T2OA 2R56H 5FA3A 5CGMA 1MQKH 1BAFL 4YGVA 1GC1H 2J6EL 4ZOBA 2GUOB 5KSBE 1QLRA 3U7AA 2B2XH 5EIQA 5KG9A 3EZJB 3RWGB 2ENSA 3GRWA 1MAJA 4NWTL 3LKNA 4U6HA 1YEKL 3RZCA 5TFSH 4KPHL 1MJ8H 1IM9A 4Q9QL 5BVJA 4Z95H 1YA5A 5B39G 2VUOA 1L7IL 2C7UA 4NFDA 2NLJA 3VFTA 2YD4A 1HSAA 3QUYA 4YHNA 5IB4B 4NRXB 2NY4D 3IFLH 1NC4A 3CUPB 4HFUH 1SY6L 3RTQD 3NCMA 1NGZB 4U1NB 2PN5A 5E8DL 3I02B 2ZUXA 4WW2C 5HVHB 2XG4A 2FGWL 4N0CD 3SQOH 2R0LH 1Q9WB 1XGRB 4G42A 5LVEA 1NFDE 4XPHH 1UGNA 2WUCL 2ITCA 2HT2C 1OSPL 4ZO9A 3EFFA 3MRBA 1CS6A 2XPGB 1L6XA 1AO7A 3FQWA 4XMPL 3T0EE 4YO0A 3O11A 3KPTA 3L3GA 5J4MA 3X14B 5J1TC 2MFNA 4JRXE 3LVEA 1ZWIA 5L9DH 1FZOB 1G6RL 2HFGL 5HYJB 3UPRA 2VDOH 5B8CA 3WUWB 4NN5C 3NA9L 3C5ZB 2X4PB 3BWUC 3B83A 1EXUB 4H8WL 4KROD 5GZNC 1H3UA 3HMWH 3LOWA 3BH9A 4RNRA 3HPLA 2P5EB 2ADGB 2R2CA 1TJHH 4N9GA 2X10A 3VXQB 3DBXB 5DD3L 4P23B 3DSNA 4JDZA 2G75A 3RL1A 3VD3A 1J1PL 4WW1B 4XCEA 1C08A 1TJIL 2OQJA 1NKOA 2HJLB 4JQXA 1FNGA 1AC0A 2F53A 2VAAB 1OT1A 4FQXC 4JFEB 5K9KA 1QSFB 1BQHG 1NFDA 2YN5A 3VH8A 1PBYA 5CZXD 1MH5A 2IAMA 4AEEA 1MIML 2Y9RT 1Z5LB 3HC3H 1UJ3C 3VG0L 3PQYE 2UUDK 4YE4L 4JRYB 3KJ4B 4G6AD 4H1LG 4L4TE 5F88B 5JLZB 5JXEA 4L29B 2EICA 2YEZB 4NBZB 4CVWA 1U8KB 5I1IH 1J5OH 1QFWM 3RZCC 1ZVHA 2P8PB 5E03A 4A2MA 1V3KA 4GSDH 4OLUL 5D7LA 5AZ2H 3TM6A 5CIPB 5KAQF 5E6IC 1EMTH 4QOKE 5I1GH 5CWSB 4F7MB 4LSTL 4I3GA 2IQAA 3QJFB 4HIJA 3KHOA 4Z7UA 4PRHE 4HGMA 12E8L 4MQXC 3MBEC 2QQKH 3WNPA 3FRPA 5I8OH 5EOCL 4DK3A 1G6VK 4BH7B 2VLLA 1DANU 4K8RL 1FH5L 1MLCB 4PY7A 5LWYL 3S36X 1MQKL 2F53E 3OXSA 2X09A 4NQED 4NQVB 3OR7A 4ENEC 4QRRA 3CCHB 5MERB 3NACL 2E6JA 3SKMA 3KPPB 2C1PA 2VDRH 4KTDL 3HUJA 1KULA 4K3DH 5I1DA 4YFEA 1LP9A 2ERJB 1YQVH 4BSWB 2Z8VC 1HYSC 4Z7WA 2R23B 3FN0L 3MRBB 4HCRA 1MHHA 4MNHB 3NTCL 4NJ9H 3WYRA 5HHQA 3C5ZC 1C12A 4P9HH 32C2B 3QWOB 3MXVL 4Y4FD 4CW1B 1R6VA 4M43H 3VU2A 3C8HA 2EDTA 5TE4L 5DRZB 3TF7C 4P3CL 3THMH 1YEJL 4X6FB 2YA1A 3BKMH 5E99L 1WSST 3DJ9A 3FQXB 1CD1A 5GS1C 1LDSA 4PJFB 3VXRE 1QACA 2AXJA 4N8VG 5C9JA 1A9BA 1MFBH 4WTZG 3QCVH 4F7PB 5FIEA 4MA1B 1I4FB 1YZZA 2FCBA 2D03H 1N5YL 3X12B 2ZKHH 2CDGA 4GG8B 2NY5L 2BHZA 5T3XL 3TN0C 4JZJA 4LHQB 5KANI 1INDL 3ZL4L 1SQ2N 4PJGB 5C0FA 3Q1SH 3BHBB 4IS6B 3HFMH 4GRWH 5HJ3B 4CDGC 1KTDB 2QQLL 5DUBB 1TVHB 5E1AB 1KEML 5J6HB 3QFJB 1JRHL 5JZ7D 4J3XA 4LSRL 4LGPB 4U1IA 2NW3B 2XWBA 4NGHH 3TZVD 4JFXB 3V5KB 4J1UB 1RUQH 1YEEL 5IEKB 1NGPL 4WHDA 5D8JL 4NN6B 3OKKA 2A9ML 3DI3B 4BQ8A 5JLZA 5CP3A 1JHLL 3U30C 4JG1L 4ZUWB 5D2LB 2YKLL 3MNZA 1KTKE 1KPVB 2GHWB 3GSNL 3MR9A 1T66D 4H1LA 5ANMB 4XVUD 2QKIB 2D7MA 4JDVA 2R2HA 2DKUA 4TUKL 1SJHB 1RULH 4L3EB 4U1GC 3N1FC 5D5MF 4A2LA 4IIQB 1QFHA 2NNAB 4TSAH 1BQHA 1X5JA 1C5BL 2V6HA 1CDGA 4E42A 5J13C 5F6HJ 4PTUB 3VXSB 3MA7B 4L4TD 5LGHH 4HBQA 4GBXD 2OXHA 1K2DA 3DVIA 1R5VB 1ZK9A 4NNYA 4PY8I 1TJIH 4HCRH 3OXSB 4PGBB 2J6EA 2M1KA 2N1KA 5F7UA 4YJZL 1JWSB 3CNKA 4G6KL 4JHWH 1XF5A 4P46A 1Z0MA 4YDVA 1I8MA 3IKKA 3MV7B 4WW2A 3BISA 4LPXA 1E4WH 4YXLH 3CU1A 1DVFB 5GRZA 5JO5A 1I7RA 3OL2A 3GMQA 4UOW0 3MCLH 2DQGH 4HF5L 5IJVA 2CMRL 2GJJA 2AABL 1CFSB 1INQA 4ODTH 4K94C 4ODSL 3B3IB 2JB6A 4JPKL 4LAJH 5SX5K 3F8UB 2Q7YB 4KZDH 3U0PB 2DBJA 4PRNB 5E8OA 3G6JE 4RBPK 1HNGA 4FFZL 3OAZK 3GDBA 4LHUD 4PREA 4WNQB 3U7YH 4UAOC 1G7JB 3NIFF 1HXYA 1CLOL 1NCUA 2Q3ZA 2XFXA 4JY4A 2J1KA 1FIGH 3QUXD 4JPWH 1D5ZB 3OKOA 4YUEL 5BV7B 3ARBC 3C2AL 1S9XA 4QT5B 1LHZA 4RWHA 5DO2D 3C60B 5HGHA 4LSVL 3KPLB 3SCMB 8CGTA 4NDMB 1HHGB 2WWKO 4D0CA 2D7TH 3BKJL 1CLZL 3TNMA 3UBXB 4OTXH 3MBED 1EEYB 4XNUH 43C9A 2GK0A 4BQCA 2M26A 4PJEF 3OKEB 3DXAB 5BCAA 1IM3A 2ITDB 4H8WH 4ONHA 5F9WC 3ARDC 3CVHA 5H35B 2ZUTA 1MY5A 3E0GA 1TJHL 2NY6C 2AQ1A 5IVNA 1ED3A 3GK8H 3CSYB 4PRBA 2NY0D 3ZTNH 3QZWB 4OB5L 3HE7B 2HFEB 1DLFH 1I1FB 3UTTA 2XZAL 1TVDA 3U6RB 4W6WB 2W9EH 4PUBH 4YHNB 2I07B 3PDOB 2CLZA 4N0FA 2ZCHH 3P9MB 5D2NA 5DMGC 3DRQB 4XPHL 4NNXB 1NGZA 2BVQB 1R3JB 1HHKB 1NDMA 2HRLA 3ULVH 5GGQL 3O3UN 3LEYH 1FN4A 4L3EA 5B21A 5IF0A 1YUHB 2FB4L 1S5IL 2NQCA 4PRHD 4OFYD 3V2AR 1YY8B 4KC3B 3K81A 1T22A 1TETL 5L2KD 1MHPH 3FQWB 3LCYA 2CLVB 3HAEB 4F58L 2ZUWA 1T89A 5KG9B 3L7EA 1IGCH 4HFUL 5TQ2H 5HYSA 4PGBA 2G9HB 4ZQKA 4BZ2H 5I2IB 2B2XL 1XF5B 4P46B 5KJRL 3AS3A 4ZPVA 3B9KB 1OW0C 5I19L 4G9DA 1EXUA 5DD0H 3W0WE 2Q76B 3QEHB 3ZT6A 2MJWA 1I7RB 3KLHC 4CJ1A 1J11A 1LO3H 3F62A 3DNKA 4M5YL 3R1GL 4WUUD 2Z93B 4YHOL 2JB6B 4MWFA 1RIHL 3LRHA 3G5VA 5KSAC 3QPQC 5GRWA 1FG9C 3OBAA 3BEWB 4KRPD 1WQVT 2E3VA 3EFDL 2O61A 1ACZA 2J8UF 4DN3L 4OLZL 4S1QL 4NOBA 4U2YA 4UV7H 4ETYA 4NC1E 4HT1H 1WWAX 2F54E 5IV2B 3WBDA 5JMRA 1FNSL 5HHME 5IBTH 1EEYA 4N0YL 4Y1AE 1RUKH 1CGSL 3S35L 2EXYC 1H0DA 1YEHL 4R4FL 4F9LA 2V2WB 1GIGL 5B8CB 2OL3H 3MRPA 4KJQD 1ZTXL 1RK1A 2ENYA 4KQ3H 1U42A 5JNYB 1DEEA 1J7VR 3OX8B 2X44D 3TCLA 3E6HA 2YS4A 3QNXA 1JGVH 4UV4L 3B6SA 3AAZA 3BD3A 4G43A 4KTYA 5EOCH 3ARFB 1UA6H 4P3WA 1XF4A 3B9DA 2FJHB 4ZOEA 3SBWC 2VLME 3QDJB 4M48L 1F6AB 3L3IA 5FA4B 3ES6A 4HIXL 4U3XA 1Z6JT 1EUTA 4I13B 2Z31B 1NCDH 1B6UA 3MLSH 1BIIB 4Y4FA 1HYRC 1R3KA 2D7QA 4QRPD 2WWMC 2YUXA 3CX2A 4YHIB 2A0LC 3C6SA 1PD6A 2Y06H 4Z5RA 4XBPB 2VLMD 5F88A 2W38A 1CLCA 1E4JA 2AJXH 1BBDH 5I8CB 3ARQA 3L5HA 4NQCE 4GUPA 4DK6A 1MF2L 4LVOB 5EUOB 1YY9D 1JTOA 3O2VL 1P7QD 5DDHA 3KNBB 4MA7L 3T3PE 5I8OL 4FFVD 4M7KH 4DUXA 3TA3D 2ADIB 3JWDH 3RUGA 3REVB 2RR3A 2EXWC 3BPLB 2UY7A 1MCKA 1BOYA 3NCYP 1MREL 2NW2B 5JDJA 4R96A 4X6FA 5JHLL 1JUFA 4DEPB 3PQYD 3B9KA 4DGIL 6FABH 1YC7A 4KV5F 2HTLC 3QEHA 3DPBA 3HMWL 1W72A 2V5TA 4M5ZL 2VISA 3RY6A 1UENA 1WFOA 1SHMA 3EJJX 3GK8L 1SYSB 1KJMA 4KK5D 5FFLA 4OZHB 4HBCL 1Y6MR 3ISWA 4ELMB 4JREC 5LGKA 2IPUK 1SEBA 5I1EL 3UEZA 3K8KA 4K7PL 5B8CC 2O61B 1LK3H 5I1CL 4LCIL 1MI5E 4JZJC 3LQAC 4W4OA 1BLNA 3KPSB 4ZUVA 4LLAA 3GSXB 3GSUB 5DRZA 1VHPA 1RI8A 4Y2DD 3G6JB 4PJIA 2XN9A 4KRMB 5D9SB 5EZJB 3MRMA 4JRXD 3B4NA 4HIHB 2OP4H 1U8JA 4FQLH 1QZ1A 5T3ZL 5GSVA 4EUPA 2AJZB 5F93C 4HIIA 1U8HA 3ARWA 5IQ9A 4N5UA 4IIQA 4MNQD 2X4SA 3QIBD 2AXFA 3F5WB 2VZSA 3OWEA 4NQTA 1F13A 1D5IH 3QISA 3P4NB 2V2XA 1A1MA 2I9LB 3D6GA 3E8UL 1WTGT 2IAMD 2H2PD 1IC5L 1OY3B 2M2DA 5CD5C 1U2CA 4NWTH 4UILL 1UJ3B 3UTSD 3TT1H 3MV9B 15C8H 3BFOA 3WFHB 1C5DB 4G8EA 1YEIL 2EDLA 4KU1A 3UZQA 1M7DB 3T1FA 2Y7QB 3DMMA 4XBEH 3V5KA 4LL9A 4P2OD 4LHUA 5E2UH 5ITBH 3D3VA 4YHZH 1JF1A 4H26B 2LTQC 4U49A 5JMOC 1K4CA 2AEWA 1B4RA 2ZOKB 3QPXL 5DFVC 4P0DA 2VAJA 2W65A 1EFXB 2F74A 3H9YA 5EWIL 4R9HA 4MD4A 3BPCB 1D5XB 1CXEA 3VFRB 5D2LA 5F9OL 1N64L 1HHHA 3DETC 3RHWK 3SQOL 2X9YA 3DROB 5D7SL 4LRNL 5I76B 5IEHA 3WLWC 5FO9B 3WDHA 1MAML 4XPAL 4WU7A 2Y1VA 4ZFGH 5ESAB 4X6EB 1KJ2B 2BNQE 3I85A 5IWLC 5CZVH 4LLWB 4AG4L 4OLVL 5EORL 2OR9H 1MCWW 4KY1H 3TBSB 3BPOC 5DMJB 3MA7A 1S7UB 2W9DH 5C08D 4U7SA 4D0CB 1FQ9C 5IK3A 2EO1A 4WFFE 3QG6A 5I1AB 3MRHB 2E7HA 4Z77A 4OD3L 3UTTD 5MEND 4PP1C 4LOUC 3OZ9H 1I8MB 2JKXA 3OB8A 1KNOB 4LVEA 3PNWB 2FL5A 2IQ9H 2HN7A 1SMAA 1CDBA 1TCMA 4WRLA 5FUCC 3ULVF 1QSEB 3P11H 5IB1A 3NPSC 2D2OA 4LBEB 5EBGA 3DUUA 2OR7A 3MRCA 2A6DA 1ERNA 1ZA3B 4FTVD 4EDWL 4EDXB 1V5JA 2GKIA 4AJ0A 2PF6A 1MJUL 5GRJL 4EN3B 5CFHA 5K9QI 2FO4B 3UC0L 1WT5C 3TV3L 4B7LA 4JHZA 3WIIH 4XMKH 5EB9A 2CDFB 4RIRB 4X7TA 1OAUH 4JR9L 4KJWC 4JZNA 2X4TB 2LABA 3MREB 3V8CA 3DLQR 4IOFD 5B4MC 3DV6B 4NNXA 4KHTL 1RUQL 2OSLA 1J0HA 3SY0A 2BRQA 1G7LB 5A16A 1T1ZB 3SGEI 3VFPA 1UM4L 4PRPB 3TJEH 2BVPB 4Y4HC 1T3FB 2CLRA 4HZLA 4IM8A 4LAQH 1WIUA 4DCQA 4DN4H 1TVBB 3LKRB 3X3FH 1TZGH 3PABB 5TDPA 4WEBH 3KPRB 5AD0A 3TZVA 3GMOB 1FORH 3PWUB 5D1XB 3MLUL 2JB5L 1NKRA 4XHJD 4MCYA 3ZE1E 3V4VH 1BP3B 1FC2D 1VFBA 5HVHC 1ES0B 5EUOF 1V7NH 3LQZA 1V8HA 4CGTA 2E8YA 2YK1H 4HIEA 1TETH 5IW1B 2DLEA 4UDTB 3QDMA 1AP2B 3WO4C 3HE6D 2APVA 3W11D 4U1GB 1FYTA 4M8VA 1F3DJ 2R0WH 1FNAA 3BPOB 4JEGB 4C4KO 4RFEB 3BDBA 5JDSB 2K7QA 3MV11 5TQ0L 4NKDA 1Z2KA 2ZCKH 3IETB 35C8H 4YPGB 5F7DB 3LSOA 4K8RD 5BOZG 3UMTA 5HBBA 4GSDL 4OF7A 3L5WB 2DQCH 1MWAL 4MSWB 2WIIA 3N1MC 3V7AG 4W68A 4LLDB 4L1HA 1J87A 5JUEL 2XQYG 1RJYB 1FG2A 1S9WB 4MDJA 4YDJA 5DF0A 4OUOA 1UYWL 2VDQL 1OSZB 5BQ7A 2YRPA 2WMPA 3T0ED 1D5BB 1O5DT 1TZIA 1FNFA 3EOAB 4JFOB 3REWB 3ILQC 2MOVA 4O2FA 3TT1L 4HLZG 4X8XA 3DTXA 1AGCA 1A3LH 3T4AB 2SEBB 3OX8A 5I0ZA 5IR1B 4XNUL 5JORA 1R0AH 1EJOH 5TH2B 3AAZB 4OIIL 5JR1H 2APTA 1V3LA 4OLYH 1BQUA 3O6LH 1YMME 4CMHC 2R2EB 4PJ8C 4P4KB 1ZLVK 3QDGA 1LNUB 4HUWB 3LQAH 1IGJA 1KPUA 5DZOA 1AGEB 5HI5C 3U1SL 4ELMF 2CJUH 2AJ3A 3IDMB 3R06A 2XZAH 3O4LA 3Q5OA 4NZUH 4XP4H 2AABH 5H8DA 5FO8B 3FQUB 3RWDB 3UJJH 5KSAA 5FM8A 1I9JH 3FB5A 2E6PA 2P5WA 4QRUA 4PJDF 5DJYB 3ABZA 3D18A 4HG4J 1H3PH 1UWXK 4PJCB 5KVDH 5ICZA 3IAPA 1WUNT 3FCTA 5AG9A 3GEWB 5D1XA 4CU7A 5EZLB 3RTQA 2P46B 4GW4B 2IANA 2H32B 3ARFA 4E0RB 2I9TB 5AYUH 1CFTB 1HOCA 2LE9A 2APBA 4F3FA 5BVJB 4OCLC 5F1KC 4PLKD 1WK0A 1Q72L 2YZ1A 4XT1C 4ZUSB 1X3DA 2BDNL 5C0GA 4OF8A 2H41A 3X3FL 1KPRA 5D1ZA 3PIQB 1QG3A 3FL7A 1IBGL 3GSWA 3CXHK 4G6FD 3FONB 3RX8A 2AQ2A 5SWZD 5E0QA 4FXKB 3S37X 1WBZA 3NABH 1U91A 4YPGA 3M07A 5DURB 5F7DA 1OP3H 1AKJB 1PSKL 2A1WL 1G0YR 1NANH 2VWEE 5DEFB 1WFNA 3WJLC 3FO0L 2DQGL 3P0GB 2W0FB 2R9HC 1NGPH 5ANME 4GG6B 5C0CB 3T0VA 4XPTH 4PV9A 1A6UH 2IFFL 3EHBC 5DRNB 1I75A 4PJFE 1FVDB 3MRGA 3MX0A 3QUZC 1I1AB 4YBLB 4XCYB 5E2WL 3EYFA 4QYOB 3F7RA 3RY6C 3SE9L 2PR4H 3CFBB 2OMNA 3L5XL 3WO3B 3NIFE 5IMOA 2XN9B 1CZ8H 5E7FA 1WZ1L 4JGJA 1CXFA 1JUFB 2ZKHL 4GQPH 4CVXA 2P42B 4IRZH 1D6EA 1IFHH 3VFVB 2DM3A 2DQDL 1MJ8L 1FVCB 1IC4H 3QHZH 2H2SD 5DD6A 5FKAA 1NC4B 5ALCL 4MQSB 1CE6B 2JJWA 1CTNA 2AXFB 2VZOA 4GBXC 4DUVA 2B1AL 1RURH 2P8MB 2DKMA 4CUCA 5IMMB 4HS3A 4Z7VF 4HXAL 2OL3A 1YY9C 1IAOA 3UJIL 4BSVA 5J57B 2DWEA 3ULUH 4CRPA 1KPUB 4E41E 3H9HB 1A7QH 3P77A 3VXUA 1FFPA 2IAND 3QUMA 3KYKL 4QGTA 3P0YL 4X9FA 5CS7A 4IIQC 3ZSSA 1J0IA 3KPNA 3HNTL 4NRZB 4N0UA 5E00B 5BZWA 1UQSB 3FO2A 2YEZA 4U1MA 4RFOH 5D9SA 1DN2A 3D25A 1H3PL 3CDGA 2AK4A 3TZVC 4YQXL 1S78D 1QHOA 3S3JA 2PYFB 2X41A 4HLJA 1NCAL 1RFDL 1R3HB 5I8KL 4U33A 4XH2B 2APWA 1KGCD 4GMTH 3QQ3B 3QIUC 3NGBB 3P4NA 4H25A 5D1QD 3GBMH 1F4WL 2WUBL 5DMYA 1YYMH 2H6PB 4LEXH 1ZHKA 4PRDA 1J05B 5EA0L 4U31A 4GO6B 2BMKB 2YK1L 1WTLA 4BZ2L 3O41A 5CEZE 4OM0H 3MLZH 1L9NA 4JRWA 1LWRA 4YBLC 4I2XE 4KHXH 1C1EL 1YQ2A 3DX9B 1RZKL 1I9EA 3PNWA 4PJGF 2NR6D 1MRCL 1AKJA 2HKFL 4GXVL 3TCXA 4OFDA 3IKCB 1WC7A 2KL6A 3C2SA 3MJGX 5C0EB 1EA9C 3G5ZB 1OHQA 4FZEH 4GG6F 1S5IH 1RZKC 3HG1A 2AJYL 2LAGB 3QWOA 4EXKA 5FOJA 5JW4N 4X4XA 3HG1E 4WU7B 2ILLA 3FOMA 2J8OA 1XCQA 3BH8B 5KOMC 4BELD 1P7QB 3TGXA 3WMSA 1I9JL 5GS0C 4EQ2A 3RDTB 3MV8D 4L4TA 1HILB 3OXRB 1AD0B 4HJJH 5FYKE 1I1CA 2FJFA 3T2PA 4YXKL 3L1OL 5DD6B 1GRWA 3HE7C 4JREB 4NQVA 1MCCA 1OAQL 1HWHB 3LV3B 3OJVC 1F2QA 1YNLH 4I18C 3K74B 4IJ3B 2YD6A 2CKBH 3OAUH 5IBLC 5IB3B 5CP7A 1PX3A 3UYOD 4M8QA 4MQXD 1O0VA 4R3SA 2I60H 3QDJD 2AJVH 4HV8B 4LU5L 1MRFL 1OGAA 2G5BA 1QKZL 1OCWH 1YMHA 3QFDA 1FHGA 1M7IB 1Q9KA 4BH8A 1NFIB 3MLYH 2RGSA 1P1ZA 2PXYC 1CQKA 4XNZC 4N0UB 5E00A 5ILTL 3D9AH 2OK0L 3MACL 3D0VA 2VLKE 4LCCC 4M9OA 5GGTL 2P5ED 3QEQA 4PJ7B 2ICEA 3FQXA 4UINH 5BW7A 2JJSC 3H0TB 2EECA 4OLVH 3QIBB 1A2YA 3TVMA 5I6XC 4NO0A 3RI5K 1AR1C 1DBKL 4UT6L 1K8DA 1GGBL 3X17A 4NYLB 2V17H 5FO7A 4POUB 1P6FA 2NY3C 3PG2A 4UIKH 3LKRA 2VIRA 1S7TB 1TJGL 2DWDB 4GG8A 3EOTL 5CGYC 2A6JA 5F3HB 4APQB 5JOPE 3NAAL 5J6GA 1A7PL 3BUYB 4H25B 3RAJL 2OZ4A 3D3VD 4ODUB 3ZYIA 5FHAH 2BJMH 4XPFH 1XEDA 1LMKA 1KT2B 5E6YA 1UA6L 4OGAC 2Q6WB 1J05A 4N90E 3QXDA 1GHFH 1VFBB 2QHLA 1CDUA 3LS5H 4K7PX 4JFOA 3REWA 1I3VA 2JB5H 4C83B 1R24A 1RZ7H 1A47A 2EEAA 3DVFA 2FEDC 3MV7A 4OQ1A 4WW2B 2MCPH 4HC1L 3HZYB 3BDXA 3QWRD 3OSKA 4PG2C 1S8DB 3VI4E 4Y5YA 3D39D 1FGNL 3QI9C 1S7SB 5EU6B 3GI8L 2WAHA 5CBEA 5SV3A 2MWCA 3KVQA 5D7KE 4LP5A 1PG7X 4IRSB 4R90H 1MCBA 2NTFA 3HMXL 5JIIA 3U0PA 1BBDL 4PRNA 2XZCL 4HEPG 5DLML 3IAGC 1JFQH 2P5WD 2MQ0A 1JPTH 5L88H 2C4XA 2ITCB 1BQHB 3L5WA 3EO0A 4XNYH 1BWMA 2Q86B 5EBWB 1K85A 3I50L 2QL1A 2OJEA 4TVPL 1KIPB 2AJ3B 4HC1A 3OXRA 4XCFH 2C1OB 5CCKL 1I85C 3QUML 5JHDA 5FO8A 4Z95L 5KSAB 3OAYK 3PHQA 2GAZB 3N0PB 1CICD 1ZHLA 1NDGA 2OZ4H 1AXTH 5HHVH 4RDQF 4YDLB 3WV0A 3VH8G 3FRUB 5HYEA 2CK0H 5B39B 4O2FB 5FGCB 3MGTA 3UYPA 4ONHB 1RIVL 1H15A 3STLA 3C08H 3VW3H 4KTDH 1YEDB 2F5AH 3VXNA 5KJRH 3V4PL 4LFHD 3U0WH 2PUQT 3ARSA 1JNJA 3CDYA 1S7QB 2IANB 2NY5H 4V1DE 5HDBF 3NPZB 1X44A 5F9DC 3RGVD 1RIVH 1MCOL 5EU5A 1QVOA 4KXZH 5JHDD 4F58H 1FNGB 2KQNA 4AIZA 3L7FA 3ZDYF 4KMLB 4Y4HB 3V6FB 5D2NB 4G6JL 3AM8C 4IHOA 1U6AL 1IM9D 4KUZL 2H32H 1P4LA 3ARGB 4JVUA 4KKAD 4JM4L 5SWSB 5EORH 3FB7A 1AJ7L 2XTJD 4OLWL 3FB5B 3AS1A 2V17L 1GGUA 1P84K 1CF8H 1T6VN 3CFKB 4FQLL 2VLKD 3SCMD 1TPXC 1T5WB 5IESL 3NIDE 4DEPC 5L6YL 4L1DA 2NY1D 2VO5A 2J5LB 3QO0B 1B3JA 4LSUH 3HI6L 4RAVA 4PB0H 3OMZA 4EI5D 5GGSB 4LOUD 3QI9B 4G3YL 3VFOB 3CSYA 5KVGL 4JO4H 3UTSE 3QZWA 1IKNA 1SYVB 2X4QB 3PWPB 4L5FH 5LXGL 4C83A 1J8HA 4XNXL 4YHKH 4OZHE 4WI3A 3VFVA 4PJXF 1N2RB 3BWAA 1YEIH 3NN8A 1D5IL 1PX4A 3WS6A 2CLZB 1X5KA 2PW2B 3PP4H 1VGKB 4WUUB 5EU6D 3CH1A 4JKKA 3RAJH 2BCKB 4R6UA 2XY1A 3VGGA 1KELL 4MXQC 3RX5A 4MNGE 5CKAA 1FN4B 1HYSD 4F7CB 4DZ8B 4U1SA 5KVEH 4YDLC 4ZNCD 4MX7A 2R4RH 1REIA 1BFVL 4XXDA 4QNPF 1J1OL 1NAKH 5FDWB 3HZVA 3HNVH 5DFVD 1J8HD 2J3SA 4Q2ZA 1T21A 3W9EB 3MUY1 1YYLL 2KDGA 5ELIA 3O9WB 2CO7B 3PHQB 4JPKH 4KZDL 3AU1B 5HYSB 3HS0B 1IL1A 2VB5A 1N6UA 2P5WE 2A38A 4CVXB 1WEJL 1OP9A 4P2RB 1QR1A 4PJ8B 4WI8A 3OJDA 4QHKJ 4GS7B 5L2JA 3QNXB 1BJ8A 4OAWB 2VH5H 4FS0A 1M05B 4OJFH 2AQ3A 2E9BA 3DX6B 1A3RH 2EYSA 4ZDHB 4MJ4A 5D7JA 2GT9A 1OP5H 5F7WC 1W2KT 5LGHL 3ARPA 3MRJA 1DBBL 5DK0B 3S37H 2H6PA 4LEXL 1IKFL 1TVHA 5E1AA 1C5CH 5IIEA 1JGDA 4YBQD 3U30B 4WCYL 2BMKA 3SDCD 5CZXC 5L9DL 4DUWA 4LPCA 3BSZH 4EI5A 1FIGL 3LZFL 3WHE0 3WIHA 4CN4A 3GIVB 2CXGA 2FX9H 4DFHA 1A9EB 2DB8A 3DSFL 4OZIF 3V6BR 4LFHG 1SVCP 1UQSA 3FO2B 2EIZA 1JI2A 3EIFA 3D25B 5T3XE 3CFDA 4NKOA 3BX7C 2EDEA 1IAKB 4R4FH 1S9KC 1FC1A 1U8LB 2XRAH 2OTPA 1A5FH 1DEDA 4PJ7E 4FQHB 4GAFB 1KIRA 5HSFA 1NGWB 1OTUD 1T03H 3GSOB 1S7XA 1U8PA 1JRHH 1T20A 4RSVA 4MVBC 1CICB 4HKBB 2YD5A 3RVWD 1FNEA 1F45A 3MJ9A 5L8JB 4J3UA 4Q9CA 1MNUH 4NQSB 3TFKD 2UZIH 4NQXA 4WTZA 2F5AL 4EOWH 4PJAA 4Y5YC 4EN3C 2IG2L 1F4WH 1X6NA 3HC4L 3HI6H 1C5BH 2EXWD 4KQ3L 3WHXA 4NQEB 1HZHH 3VGEA 2DI8A 4HQQL 1JPSH 3ULVC 4DZ8A 2BVEA 4MA3A 5CKGA 1A3QA 4E41A 4MJ6B 4AH2B 1TQCB 2ED9A 1KN2L 1T2QL 4XNXH 1LGVA 3VXPA 1SM3H 3I84A 4YPJA 4Q2ZB 4LQFH 3SCMC 4GAYA 1HQRA 4KUZH 3MROA 3M17B 4P9HL 3BIBX 4TSBL 1P4BL 1AHWB 1BF8A 1FZOA 4UV7L 4Y19E 43CAB 4C57C 4GMSL 1FL3A 2GJ6B 4YNYA 5TJWK 2X4PA 3TEUA 1MVUA 1LEKB 1D9KC 2B8OT 3O81A 2D7NA 3BP4B 4FFZH 4GAGH 2ADGA 5T3XH 3JWOL 4OIBA 1MCHA 1G9NH 4N9GB 3VXQA 5JZ7C 3SKJH 5C07E 2BOCA 3RU8H 1U6AH 4FOMA 3TWCH 1IBGH 5J6GB 1MCFA 3BIKB 5LKNA 2CKNA 4YHOH 4M8QB 1ITCA 1MCLA 4H5SA 2ARWA 4WI6A 3CMOH 1KF9B 3VXMD 5C8JA 1XGTA 1ORQB 3TIEB 3O8XD 1I1FA 5E99H 1RSFA 4JN2A 1MHCB 3DVGA 4G9FB 4DVRL 1TTUA 4HPYH 1YPZE 3OKLB 1CL7H 2Y25A 5D6CA 1YPZA 4R0LA 2VL5B 4MD4B 1UB6B 5J9PA 1U8KA 3I9GL 4ALAH 5DQJB 3H0TA 3S5LG 4HUVB 1E28B 4P3DB 1HKLL 3NGBC 4RA0C 1VENA 1NMCB 1BZQK 5L2KA 1S9VB 1MI5A 2B4CL 1LO5A 3VFSB 4XP5H 3PWNB 3BKJH 1QFWI 2EDYA 4PJDA 5EOQH 3NCJH 4K9EL 2KKQA 2VIRB 3T77A 1CIDA 4R97B 5C07A 1EHNA 1ONQB 2C4FT 1JHLH 3GSQA 1JF5A 2WM0A 1A1MB 2I9LA 2PCPA 4RGOH 3U7YL 1JK8B 2CSPA 4LDOB 3AS2A 1TQCC 1RZFL 2VDML 1C5DA 3ARTA 2R1YA 4Z7UE 5FHAL 3AREA 3HUJB 5DR5H 5T3ZH 4NWUL 4LKCB 2FL5B 5L8LB 1FYTD 2Z35B 3EYOB 4NSKA 4JANB 1CL7I 1XZ0A 2YSSA 4M9PA 1S7QA 5BS0A 4PRAB 3KYMA 1YNTA 5ESQB 2FD6L 3G5VB 3MV9D 4MJ5B 4N5ED 4PG2A 1RHHA 4MS8C 1IVLA 2CDFA 3B9KD 1ZVSA 4OZFH 4GG6E 1AR2A 3EW3B 2B5IB 1TDQA 4LEOB 2D7TL 2CIIA 2FECL 2PTVA 4CMHB 4JHAH 2E7LC 1RK0B 1JPGA 3BUTA 4LPWA 1ZHLB 4TVPD 4X4ZA 2BVPA 1FE8H 4CVZA 4U7KA 2P24B 2ATPA 4OM0L 5D7JC 1CXLA 1F3RB 3BD4A 5JHDE 3BT2L 2IMMA 5I8EB 3RJQB 4WJ5A 2VSDA 4WFED 3HI1B 5KSBF 3QFJA 4V1DD 3LKNB 4QTIH 3ALXA 2EC9T 4PBVC 1NAMA 2FGZA 3G5XB 1NUDA 1ES0A 1SYVA 1Z3GH 5FYJE 3QDGD 2V2TA 5K59F 5EU5B 3HC0B 3QIBC 5IBLD 4UDTA 1FL6A 2DQUH 5F1NA 1TZHA 1ZSDB 1FFOA 5D6CB 3IDJA 3ARBD 4G8FA 2NY3B 3H7BA 3OPZL 5DC4B 1VGKA 5FUCE 1N5YH 3BOVA 4G8GD 1BD2E 4O2EA 3BAEH 3K4ZA 1UT9A 5JW3L 2X9XA 4DW2H 1OM3H 3QCVL 5FV2A 3P0YH 3W9DA 2RBLA 4PJ8D 3KR3H 5INDA 2AJSL 1GJIA 1CDYA 4JKLA 5B3JF 4J4PC 1F4XH 4PJ9C 3ULUD 3V6OC 1MWAA 3RWFA 5DT1H 1A4JB 5KSBB 4O5LL 1BD2D 5I1KH 3DI2B 4NRYA 4QRSA 5C6WH 5ENWA 4FQQB 3PL6C 5HYJE 1T04B 4LGRB 2YPKA 4X0KA 4DGYH 1J8HB 1NGYA 1NEZA 2F8OA 4YEEA 3RX7A 1DBAL 5IHZA 1YYLH 2QQNH 3HRPA 2OJZL 2D03L 1EERB 1IE5A 3MRKB 1KIUA 5IJVB 1PEWA 1LEGA 2BCKA 4FRWA 4ZS6D 5HHPA 4WFEE 3DECA 2ATKB 5T5NF 4CU8A 4UTAL 4QRTA 5SWZB 2V9QA 1SEBB 4PY8J 3TPUB 2FBJH 3VCLB 1C7SA 1KB5L 1A1OA 2WNGA 2XPGA 1JYXA 3IDMA 1I7ZB 4OGZA 3T0DA 4OZGA 3VFWB 5IP4A 3O3AA 4NO5A 4MNGA 1WT5A 2EE9A 5CJQL 4ZMAT 4A6YB 3DX7B 3W11C 1JPGB 3V52H 1HH9B 3MJ6A 4QRUB 4P5KA 3WIIL 4JO4L 5KSUA 1U92A 2GY7B 1DBKH 4JFZL 4ZODA 3SKOB 4FZEL 3KXFB 3P0VH 4OD2B 5B4MD 3SJVB 1DQJA 3UXFA 4R0LC 5I8EA 5E8EA 3KS0J 4DGVH 4FQHA 2WIMA 2F19H 3TBWA 2XOTA 1ED3B 1I3RB 2L4OA 1NBVH 1NAMB 2G75B 1J0KA 5INCB 1PAMA 3QXVA 4G8IA 4WW1A 4XCEB 4XCCH 3D1MC 4HUKB 4J3VA 1G7IB 4RMQA 2F53B 2I07A 3QI9D 4ZUSA 1MLCA 3PHOB 5BOPA 3SDXB 1ORSA 1C8PA 1FRGL 1CLYH 1S3KH 1LE9A 1E4KC 1DQLL 4OZFG 5D7LE 2D0GA 5EOTB 5F7EH 1XCTB 1UG9A 3WFCL 3OAUL 4JB9H 2BVOB 2DDQH 1QUNA 2QSTA 4WDIB 3B8YA 1KEGH 5IVZA 2R1XB 3GKWH 3D0LB 5B3JE 1JGEA 3HRZA 4OLXH 1E4XH 2XZQL 4OFIA 3IXAA 1IGMH 4RX4A 4K23L 4P46C 4X98B 3VGHA 4QY8A 3EYFB 3M17A 1F90L 4IDJL 5GJTL 2YA0A 4KDTC 4FQQA 1IQWH 1WFTA 1AXSA 4PJ5A 4LSPL 4FMKA 1XGPB 5DVKA 4RMWA 4OQTL 3B8SA 4LPVA 2BVUA 4BA8A 1FL3B 1B0GB 1KENH 4UILH 4LARH 1I9IL 2VNCA 2AJUL 1IEBA 3RZWA 2CDGB 3NH7H 4DQOL 5IMMA 4TULL 1S7VB 2VDQH 5DFWH 3RPIB 5C0FB 4MA3B 3E6FB 3QEUA 3KWWA 1QSEA 3P2TA 4H5SB 2BNUA 3AXLA 5E9DE 4BSVB 5I1HL 1HI6A 5I6XB 1QLFB 4GQ9H 2K3TA 5F3BA 4RGNC 3C8KB 4MMXC 1KCRH 4L4VA 1A8JH 1I1AA 1WWCA 2VDOL 7CGTA 3BKYL 1MELA 4I18B 4RIRA 4X7TB 4ZFFB 3OKLA 1VDGA 5DK3A 3RI5F 2JJVA 2BXYA 1OLZA 3O4LE 4NP4H 1KUMA 5DQJA 4TVPE 1OPGL 4NUGL 1U92B 1I9RL 2J4WH 2R56L 3O6FA 1JYVA 1LO4H 5DUPL 2GTWB 5I1CH 5D1XC 3HI5L 3BDYH 1RZJC 1U8QB 4R4ND 5IOPA 3VFSA 3GMLB 4E41D 4WV1A 1MY7A 4MDIB 3DURB 4LCCB 1VACA 5T1MA 3QQ3A 3MLXL 4B0MM 1FSKC 5HJ3A 4B7IA 4Q9QH 3X3GL 4PGJA 1AGBB 1G9MH 4TNVF 5E5RB 4P9ML 3SDXA 5CMAB 2VXUH 3CX5K 4RCAA 3QIUA 4FP8L 1SBSL 5IW1A 3PGCA 2GSGA 3VFTB 3RWJA 3GJFH 5DK2A 4AENA 5GS0D 4FA8A 1GC1L 3GGWB 3IGAA 1P7KB 4IOIB 4KK9C 1R0AL 4X83A 5JO5B 4Y2OA 4FTVB 2EDFA 1QQDA 4LIQH 1ZHNB 4BQ6A 3MR9B 3RWHA 3MJ8A 1EEZB 2XYCA 4JDVB 2BSSB 3S9DB 1Q9WA 1XGRA 4G42B 1LO5B 1TQBC 2B20A 1KXQE 2XFXB 3GI9L 3VWJC 1P4BH 2P48B 5GRJH 1QD0A 1YECL 5J56B 4PLNC 4UUJA 2Q8AL 1QO3A 5DS8A 3QWQB 5HY9B 1ITBB 2J8UA 3FB8B 3C6LB 3FB6B 3GMNA 1A7QL 3OKEA 2GY5A 3DX9A 1OQOA 3QH3A 2R0WL 3DTXB 2JJTC 1MCJA 5GS0L 4MCZB 1UXSA 3E6FA 2P5EA 3QEUB 5TH2A 3HI1A 3PJSB 4KKLD 4YGAB 4LCWE 1FZKB 1QLFA 2F15A 2UZIL 3OKMA 4TUJB 2NMSA 2R2EA 1M7IA 2X2YA 1E4KA 2FYYA 1FL6B 1J88A 3LHPL 3IF1A 3GSUA 2OTUA 3RKDD 2RCSL 5IM7A 2CKBA 4O4YL 1D5ZA 3OKOB 3PWJB 3O6KH 4LRIC 2GCYB 3NIGF 5D1QB 1AD0A 2B0SL 3VH8B 5C08A 1XGUA 1CBVH 1VCAA 2GFBA 1WLHA 4PB0L 5C6TH 3BDYL 4XRCA 3N9GL 1VERA 2P5WB 2X4RA 3NACH 4LIQE 4QTHA 4ODXA 1A7OH 2X9WA 1OAKH 2P24A 1JYWA 1B88A 4LNRA 3MQIA 2GEEA 3HPJA 3EJYC 1RFDH 4QNPE 2YD1A 1UB5B 3PUCA 4NUJA 2EYRA 5HHOD 2NX5E 1WZKA 12E8H 5EU4B 2ZSVB 4R7DA 3MUGA 4G8GA 3QJHA 3RGVA 2HFEA 4NHUA 3WNLA 3UBXG 4W6XB 4HPOH 2APFA 1X6LA 3HC0A 2HJFA 4XC3L 1JF1B 3QO1B 5FECB 4KK9D 3KYKH 4KXZI 4IOIA 3VWJB 2C3VB 2BY0A 3BMVA 4UQ3B 3QUKA 4KTEL 3GSWB 1AE6H 1OD9A 3SKMB 2W0LA 3LIZH 4L9DA 3TBTB 2Z93A 3HTLX 1WEJH 4WEUD 3QUZB 25C8L 2E7MA 5FO7B 4QRRE 3JV0A 5GRYA 3QEGH 1KJ2L 3RRQA 4HUNB 3O2WH 4P59H 2E5EA 5FYLL 1BX2A 1KCSL 2X7LB 1GZQA 1IMHC 3HI5H 2HRPL 1EHAA 5HHQB 3DWTA 4OCWL 2R29L 4YK4B 3SN6N 2AERT 3B5TA 1FVDA 3MRGB 1NMAL 4PJBB 1I7TA 4AG4H 4XBEL 1OPGH 1CLOH 5GJTH 3DX7A 1A14H 4I0PC 3TT3L 3KR3L 1JTTA 2B1HH 2Y23A 2X05A 3NPSB 3B2VH 4TSCL 5B38A 2P8LB 1KB5H 2RQ8A 1UH3A 4ODTL 1N5AB 3BQUB 1N0XH 2DQIH 1JN6B 1H15B 4JY5H 5MHSD 1ACYH 3RWIB 4MCZA 3ZKQD 4HAGA 3BN3B 1JPST 3IJHA 3TBWB 5D71L 3CFJA 1QYGH 4KH2A 2A9NH 1MCRA 4RGND 2VUYA 4MWFB 4OCYL 5INCA 3ALPA 4DZBB 2IJ0C 1TXKA 2XN9D 2IBZX 3ECBA 4N8VB 3ZKSD 4LVHB 3FQRA 3T0BA 2GI7A 5L8KB 4KI1A 3EO0B 2AAVA 4OTXL 4LVNB 4GS7C 2VE6B 1KCRL 5EC2A 3ULSB 4G6ML 3T2QA 3L9RA 1T0NB 4ZTPL 4NN7B 2DLFL 4JFXA 2VLRA 2EE6A 3RL2A 1Q72H 1GYAA 5EFIA 2BJML 4F7EB 2FSEA 5HHOE 2R1WB 3EOYG 4EVNB 5D5MA 4QEGA 3NFNA 2IGFH 5HYJD 3O45A 3QXAB 4OLWH 2V5YA 4WFHE 2MPAL 2R2HB 4L8DB 4Y4KA 4Z7OE 3VXNB 5E8EB 1MPAH 1AGDA 5DUML 5IBUB 3MCLL 4HF5H 4LDLB 4HHAA 5HGGS 4N5EC 4KFZC 5C2BL 4U6HB 3MUGB 5GS3A 3D39E 4M4PA 1NL0L 2A6IA 2I5YL 4OCWH 2BNRA 2HJFB 1F97A 1UM6H 4K3JH 3TYGH 5AYQA 1K2DB 5GS2H 3CUPA 4TYUA 5BS0E 3TH3T 4WO4B 2Z9TA 4WUUA 2Q8BH 5AUMA 4OLXL 4NC1C 3S4SA 4V2CB 4YHLH 2D31A 3QCUH 4OD1H 1ZGLP 2P45B 3IDXL 5ADOH 1MF2H 4LPYA 4LSDA 1WV7T 4ELMA 5TE6H 3TESA 3D69B 4C56B 2W91A 4DGVL 1JGEB 3PL6B 1GC1C 1F4AA 2E6QA 3RDTC 1LDPL 4WFGD 2P7TB 2UWEB 2HH0L 3NH7L 3ZE2F 4DQOH 1MREH 4Y2DA 1FZJA 5I71C 1CFNA 3GJFK 4KY1L 4ZXBD 1ZHBB 3QI9A 3Q6GL 2BC4B 4XXCA 4JY6A 4XP6H 2WV3A 3L3DB 4P4KD 2YHGA 4WWKB 4LVHC 3GHBL 1G6RA 3PF2A 3LMJL 5EO1B 2CRZA 2HYMA 3IFOB 2XTJC 3AB0C 2Q7NA 3NIGE 4Q97A 4JFHD 4OAWA 5DHVA 1N4XL 4KJWD 1QRNB 4AEFA 4BJLA 3R8BB 1U93A 3RWEB 4UI2A 3L3OA 3MRFB 3OPZH 3OKDB 4F7TB 4OZIB 5ALBL 4GW1B 1IAIL 5IVOA 2V2XB 2ZWLT 4CBPA 5JA8B 4P2QB 3B5HA 3U2SA 1PG7L 4KKLC 1IGCL 1I8LC 3ESVF 5IIEB 1S7RB 3U36B 2FATH 4N0YH 2QQKL 5C0DB 2QQNL 3QNZA 4KJQC 1ZKAA 5LBSL 4X4ME 4ISVA 1IC5H 4W70A 4PGCB 3K3QA 1FYTE 1P69B 3VFMA 3KLAB 1X5LA 3AY4A 4S1QH 3FQUA 4Z7UF 1Z9LA 3CFEA 3K46A 4U1JA 4J12A 3M8OL 3UTQB 1KC5H 3AU1A 4ACPA 3MRQA 4QLRA 2XY2A 4AM0B 1IT9H 2VDNL 1T1WA 3ULVD 1U95A 3NFSL 4LCUB 2ICEB 5FB8A 4QXUL 3O45B 3QXAA 1IJ9A 4NO0B 2N7BA 1FE8L 1X4ZA 2Z92B 5CIPA 3OJDB 4Y4KB 5DWUL 1AKJD 1P9MA 4O00A 4TUOB 5CBAB 3G9VA 4ETQA 3ROOA 5DD1L 3BUYA 1KFAH 3VRIA 4QXTA 3DIFA 1UM5L 3NMEA 3HA0A 3DETD 5DS8B 5MEQA 2ADJB 1KV3A 3SGDH 4PY7B 2VZVA 1MJ7L 5A43C 4X4YA 4LU5H 1BFTA 5HHXH 1OAYH 4EI5B 3ZDZE 2H1PH 2D4DA 4HS6B 4N8PA 5JPMA 5E5MA 5KVFH 5DJ8B 2Q76A 4UOW1 3DYMA 4ENED 1KCUH 1ZLWK 2XNAA 3U9UB 3VXOA 4I0PA 4CADA 3CFDB 1QBLL 3GBLA 1FFNB 3CK0L 5DRNA 3RKPA 1PZ5B 4Y5VB 3C60C 5CEYA 1U8LA 4S0TD 3KPOA 4Z7OF 3ARGD 5ICXA 2JK5A 2DQUL 1XIWA 3ZDXF 5C07D 4PJHE 4QXWA 3V0VA 3VDAA 3LPGA 5D1QA 2XQYK 4K9EH 2EDQA 4Z78B 5JHDB 2GJ6A 4YNYB 5ACLA 3FT4A 4JQVC 2J8UB 3HCVB 1QSED 4Q74A 3MCKB 1J8HE 1UCBL 5CINL 1DBJH 3MNWB 5DJ6B 3QEQD 4OF3A 3A0OA 5E8DH 5C2BH 1CIUA 3MLWH 4FQJH 3STLB 1FIEA 4JRYD 4D94A 2ZOLA 1I85A 3I6KA 4Q6IB 1S7RA 3QDME 3U36A 1FJ1B 3OAZH 3QZWG 1DQQB 4JN2B 2FJHA 4ZAKD 2W0KA 4LSVH 1SJXA 2FYYB 3Q6FA 3BQUD 1MNUL 4TQEH 1RY7B 2BRRH 1M6OB 2RIKA 5CJOL 1FL5B 3R4DA 4TUKH 5JTWA 4HGKC 4TULH 4UQ3A 1UB6A 5J9PB 1QBML 3MNZB 4NJAL 3JV6B 2X4NA 3E3QC 5IFJB 5FGSA 2EEDA 4ZD3H 3HNSH 5EBLA 1RUAH 1CFBA 3N85L 5JW5B 3O2VH 3RP1A 1N8ZA 4KKCC 5SWSD 1AD9B 2KPNA 3MBEA 5IMLB 4LLDA 1UB5A 3VRIB 2ADIA 1CT8A 4FXLA 1TIUA 3IRZA 5C0BE 2MSPA 1LILA 4DN3H 1QBAA 3GSRA 3UZEA 4S1RL 4AY0A 1FAKT 4HIEB 3OGOE 3HLAB 1CR9L 4K3GA 2NR6C 5F9JB 3RQ3A 3RIFK 2VL5A 4DKAA 4JANA 3VD9A 3WIFB 3WFCH 2ARJQ 1YMMB 1NCTA 1A21A 4JLRB 2B4CC 4HUMB 1WAAF 4G80B 4OKVB 5CSGA 4ZOCA 2DN7A 3H9SE 4MB4A 4RZCA 2LAAA 2RB8A 1WBXB 1S9VA 1X5XA 1OAXL 3TC9A 2GYSA 4Z7WF 4WHCA 1T5XA 1IZKA 5TQ2L 3MFGB 3DUSB 1W72H 3EYSH 4XMLH 2VITB 4L8BA 4FQ1L 3GSQB 1EDQA 1I7TB 1LP9F 4XVUC 5DYOA 3L3GB 1JGLH 5J1AA 3SJVE 2IAMB 2YPLA 1SEQH 5ABDE 4YAQA 5DVMA 5C0ND 1KBGL 1OSZA 4L29A 3HNVL 5JIKA 4H8WC 4HWZA 3QYCA 4OI7A 3TNNB 1BFVH 4HIHA 4RISH 1MJJA 2FZ3A 1AJ7H 5I66A 2YWZA 1GCFA 3BH9B 3JZ7A 2AJZA 5EZLA 1RAMA 1KC5L 1JP5A 4ORGB 5EOQL 5IVXE 4F7MA 4HHAB 1BZ7B 4JKPL 1R5WB 1OAKL 4PRBB 1AC6A 4E0RA 5IKCB 2ZCLH 2MKLC 1SJEB 2VZTA 1YJDL 2A6IB 5A2JH 2EDXA 4N8VA 4Z6AT 1RZGA 1HH6B 4NCC2 1P1ZB 4S1SH 4UT7L 3RNQA 4G8FB 5MERA 1M7DA 2BVQA 3TPKA 1HXMA 3WJJA 4MAYB 1OF2B 3VE0B 4APQC 2P49B 4HUXB 1DDHB 3RWDA 5FYLE 1NFDF 2FSEB 2Z91A 4PGEA 2IADB 4XVSH 4JQIL 4MVBD 2OS7A 4PR5B 4J4PD 4ERSL 1QLEH 2A6JB 5D6DA 3KAAA 3RU8L 2BSTB 2AV7A 4Q6YA 4AK1A 5C3TA 4ZTOH 4NM4H 4RISL 4HUUA 4HIJB 2MMXA 3MXVH 4WI9A 4I3RH 3SEPA 2NXYD 1LQSR 3ZYOA 4OV5B 4LP4A 4MD5B 3RFZC 4URTB 1AQDB 4JN1L 2W9EL 1CCZA 3V6OA 3Q5TA 3DX8A 1IKFH 3ZE0F 1G9MC 2V7HA 3EYUH 3KPPA 4PRHA 4GKNA 3SDCC 3LRSA 5HHPB 3MRFA 2XZZA 5ALBH 3PP4L 2DBLL 4FXKA 4QHLB 4JZJB 5F1IB 2HLFD 4QF1B 1QRKA 4BSWA 4HJJL 4W4NA 5T1DH 3DO3A 4E41B 4WEMB 1RJZB 2ZP0T 1I8KB 4Z7WB 2AI0L 4OM1L 3VRLE 2Z31D 1RIUL 3NVQA 5CGYD 3HC3L 4ISVB 2UUDH 5E6ID 2K1MA 1G7HA 3DYPA 2YPVH 3QUMB 4Y2DB 1HHJA 3QP3A 4OCXH 1CE1L 5E4EB 3I75A 5DQ9B 5EU3A 2EDRA 2X4TA 2XWTB 1KLUA 5EZIL 4JFPB 1H3GA 3ARYA 4HK0B 1RULL 3DYOA 1A6WH 4BFGA 1T7WA 4PFEA 1KPVA 4U6TA 2VH5L 5JPNA 1J1PH 1MVUB 1WZLA 4L8CA 3V6OE 3GZKA 5EZIH 3ZYJA 2GJZA 2R69H 3EDDA 1T7ZA 1ZV5A 1KLGA 4WGWB 2ESVE 5HHNB 5JIHA 1XAUA 1RZGB 3Q3GB 3ARGC 1KXVC 3O8XA 1JZ5A 3BHBA 5DD5H 3JWOC 1V7NL 2XA3A 3P77B 2F58H 4OCRH 2MKWA 2AEQL 5ISZD 3HR5A 4PJHF 4IHOB 3VXUB 5LGJB 5CEZD 1PG7H 4PGCA 5DO2C 4YHIA 4NO5B 3MRLB 3K2MC 4U0RB 3HE7D 3FB7B 2CGRH 2IALA 2N7AA 5E2TH 4HD9A 5C0CD 5EIIB 4XNQB 2EKSA 1RU9H 1DBBH 3ZTNL 4JFEE 4O9HH 3DHJA 4B5EA 1AO7E 3RA7L 5FB8B 3IXAB 3QO0A 2BSTA 5MENA 4X5WB 1FFRA 5LQBL 4R26H 3MOAL 1D5MA 3AY4C 3G6JF 2JK5B 3BKML 4CAGA 2HVJB 5E6ZA 1JRHI 3MGAA 1MJ7H 3UO1H 4AT6A 2BNQA 3Q6GH 1AXSB 3MLVH 1NBYB 4WO4C 5IW6B 3O3BB 1AI1H 1NCBL 5ECJE 2CR6A 3IXTB 3WKNA 4JKWA 3TV3H 3VMOA 2W0PA 1SJVA 2A9MH 1Z9OA 1ZLUH 4OZ4B 5DD1H 4I5BA 4LCWB 2XZCH 5DLMH 5M94B 4LCIH 2JTDA 3L5IA 4ZAKA 3VWKA 3CH1B 1R3LB 4JO3H 1LE9B 4PRHB 1I1RA 1VADA 5EULV 1IC4L 3QHZL 4ALAL 4FQIL 1JHKL 1CU4H 1L0QA 4QRRD 1WZ1H 1CL7L 2FX8H 2E7CA 3GM8A 4HC1H 5D1QC 4Q6IA 2B5IC 4R4BA 3HRZB 4NBXB 4UT7H 4MNQE 5F3BB 3C08L 1NGXB 3SJVD 2HVKB 1KCUL 1G7HB 4QOKD 4Y5VA 5E5UB 3GUTA 4NO3A 1CDCA 4UT9H 1ADQL 1U8IA 8FABA 3O3DA 3CD4A 5FCUL 1IGJB 2UVEA 2EXYD 2DRUA 2ZJSL 3KLSA 1X7QB 5I1GL 4L4TB 4GH7B 3DO7B 3C60A 4JG0L 4Z78A 5HHMD 3MPCA 2Z8WC 3O6FB 1CXKA 1ZS8B 4M1DH 2Y5EA 2QQQA 3VGDA 1QFOA 1JTPA 2F8VA 1B0GA 43C9B 4BYHA 2BXZA 2IH3B 4QOKB 4PB9L 1AGFA 1MCNA 2EE2A 4PJCA 1XR8A 1EV2E 2X4OB 1ZOXA 4Y4FC 3MBEB 3G5YA 3FFCD 5J0BA 1PJ9A 1C1EH 3GNMH 4B53A 3GIZL 2ED7A 3PV7A 5CHNB 4F2MA 5I2IA 3T1FB 1NCDL 5FDYA 4EN3D 2WLYA 4LHUB 3U6RA 3Q6FB 1UWEL 2Z8SA 5F1NB 4QCIB 1FDLL 4KKCD 5E56A 4G9DB 2H2SC 1P7KA 2XT1B 5DHYA 3FZUD 1P5VA 2VLKB 4OCSL 2JIXA 3JV6A 1RUPL 3U9PL 1EZVY 1IAKA 2PTTA 4OD1L 4PJ9B 2DQIL 3L3JA 1DVFD 3Q1SL 1TJGH 5MENB 5I18H 1KIRB 4X5XB 2ED8A 2EH8H 3P9WB 3DVNB 1ZTXH 4LLWA 3BQUC 1FO0L 2DLTA 3T3PF 5C6TL 5F6IB 1CICA 2CLVA 5GRUH 1ZLSH 1GZPB 1SEQL 1LO0H 4M61A 1IGFH 4XVJH 3WD5H 6CGTA 4NRYB 4I5BB 1FYHB 1NDGB 3EYVB 2AJYH 4O2CB 1JNLL 3GMRA 5BO1L 2VDPL 1LK2A 2X1OA 3FAWA 3S7GA 1GOHA 3HLAA 4GKZB 3S6CA 1T89C 4Z76A 3T3ME 4XBGB 4YK4C 4BFIA 1WJ3A 3KPRD 1QTYT 5H2BB 2Q3AA 4P2OC 3PJSA 3FT2B 4UDUA 4M03A 1QQDB 4EKXA 1NC2A 5GGRY 4PRPD 1V3MA 2VXUL 4K94H 4HS3B 1OAQH 1Q9LA 2JELL 3CC5B 4M3KB 4XB8A 5DC9B 2X1PA 2D9CA 4AIZB 4YHLL 3MLPA 5E2TL 1L7TL 1MCQA 3PHSA 2OJEB 4Y4FB 3SE8L 3JWDL 2W60B 1RZ7L 5DYOB 3NOIA 2CRMA 2F54D 1U3JA 4GRWB 3F7VB 3MJ7B 4K3JL 1BAFH 1EBAA 3GM0A 2GTZB 3DRTB 1PY9A 2OR8A 4M6OL 3RHWF 4X6DA 2FDBP 4ODXB 4R8WL 1TVBA 3WNKA 1LO2L 1OL0A 1XR8B 2AK4B 5J3HD 5EUOA 3ILPB 1BMGA 5FGCE 4CKVX 4ZO6A 3BIKA 2P44B 2R8SL 4X7SH 3VXTB 2A1WH 4D0DA 3TCLB 4Y19A 1NPUA 1FGVL 4JN1H 5HD8C 2J4WL 3LQAL 4UT6H 5D6DC 3P4MA 1NGQL 1IQDB 2GSIA 4PJEB 4HMEA 5GISL 1B2WH 4BKLA 1TTFA 1NMAH