1NGPH

N1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3-nitrophenyl) acetate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
215
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords N1G9 (IGG1-LAMBDA)
publication title Three-dimensional structures of the Fab fragment of murine N1G9 antibody from the primary immune response and of its complex with (4-hydroxy-3-nitrophenyl)acetate.
pubmed doi rcsb
total genus 39
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 1995-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH02
2FSEB 1FNSL 1GGBL 1T0NA 1OGAA 3EYFB 4RZCA 2BNRB 3O8XD 4NFBA 2EYTB 3QDMD 5FYLD 3DUSA 1CD8A 2DOCA 3C6LA 1ZS8B 1QSVA 1NUFA 5EH1A 4YJZL 2ZKHL 4HPYH 3T77B 4XPTH 1G7HA 3PGFL 5DSCB 4QT5A 4P59H 4PJDB 3CMGA 4DEPB 1FNEA 2R2EB 3WE6B 1HQ4A 3QZWG 1EMTH 1F4YH 4LSVH 3RTQA 3PF2A 1D6EA 4TSCL 2QQKL 2EECA 3H42L 3GMMB 1YEJH 4IOIA 5D2LF 3RVTD 5J6HB 5KN5B 1S7VA 4PLJD 1T5WA 2GK0B 1EXUB 5IOPA 4RBPH 4XVTH 4HS6B 4OLZL 5C0CB 4R96A 3JWDH 4Z7NF 4HIIA 4RA3A 2DIJA 1EIBA 1Q1JH 3QH3A 1LEGB 1C1EH 4PD4K 2DM7A 4MX7B 5C09A 1EK3A 3IAPA 1IMHC 2Q7NA 4PJDF 3RWDB 3BZFA 2FEDC 3HKFA 3G5ZB 1ZT1B 4KKAC 3T2OA 3MLYH 1V8HA 4KKLD 1L0QA 3UBXA 1MJUL 5FKAB 5GRJL 4EKXA 3L95B 2X41A 2NY4D 2C1OA 1HEZA 4ZNCD 3QXAA 3WSQL 4HCRL 3VFPB 4EI6A 1WFTA 4P5TC 3DXAB 3TYGH 1T1ZA 1M1SA 5FEBA 3I6GB 2FH6A 4O2CB 1PYWB 1XZ0A 4O9HL 4IRSC 1U8NA 3OX8A 3VXQB 3CX5J 1NCUA 1XGUA 4ZPVA 3X3GH 4DUVA 1JNNH 5DHVA 4XVJH 5ANMA 4OFDA 1MFEL 4KV5F 5F9AC 2FBJH 4X6DE 5EUKA 4G8GA 3WFZA 4LSSH 2NYYC 4RWHA 1OB1B 3BH8B 4HIEB 3ARRA 3PWJB 3ARGC 5ILTL 3FB6B 2AEPH 3HUJA 4OF3A 4X0KB 1MAJA 4GS7C 5I1JL 3FQXB 1A6VL 1T1YB 3FHQA 2KUTA 4TNVK 1QLFB 2QJDA 1H5BC 1LEKB 3UTZA 5D7LA 1FVCA 5L7XL 2Q76A 3G04B 4WI9A 1NKOA 4PGBB 4GG6F 4TULH 5DJAB 3B9EA 3CXDH 3HZMA 4R2GD 3QDGD 1AQKL 1OAUL 4U0RC 1DE4B 4JLRB 4PJFB 4IBLT 1R0AL 4LDOB 3VXUB 5E5MA 1EEYB 5K59F 2BK8A 1MLBB 3BD4A 5ALCH 2RHEA 1XGQB 2OJZL 3H9HB 4XPBH 1H3VA 3FZUD 3QJHB 5E4EC 3REVB 4IMLA 3QG7L 2VZTA 3BJ91 1CG9B 4FXGA 4JHWL 5F8QC 2OK0H 2E9JA 4Q0XH 4XBPB 3MJ9H 2JF1A 4OUOA 3WUZA 3GM0A 3VI4F 4AIOA 2X5PA 3GSQA 4Y5YC 2NY2D 3QEUB 4R4BB 1F8TH 3O3UN 2H26A 2VDKL 3MZTA 3UTTE 1A6WH 2W9EH 3U82B 4M1CC 3NZ8B 3WIIL 3A6BH 4QXTA 3BISA 1FFPB 4P4KD 4E42B 1PD6A 1MHCA 5DJXA 4Z8FL 4PJFF 2FGWL 4RFNC 4GRWH 1WBXB 2AK4B 2CDGA 1A22B 2VXUL 4F58L 3SCMB 2C1PA 4C57C 1CLZH 4P2RA 3RIAF 3GHBH 5MEQA 1CXFA 1V3KA 4JM2B 1RZIB 4PG2A 5GGQL 1HWGB 3F7YA 1EEZA 1II4E 3ULUC 2F5BH 1PGRB 3QO0B 4MJID 4YHZH 1JPSH 1A1NB 1JIBA 2FHFA 3BT2H 5H35B 5I0ZA 3G6AB 3QISA 5BXFA 2F58H 2MCPH 2X6MA 3HNTL 5CJXA 2R2HA 3OV6A 4PJAB 3MV9B 4PB0L 5AAWA 3BEWB 4HKJA 3T0EC 2WIIB 5KVDH 1IAIM 4QXUL 1OLLA 4LLDB 1S9XB 3QYCA 4RSVA 5D1ZC 1F6AB 1CGSL 3DPBA 5CUSL 2AJUL 4DZ8A 1YEHL 5I1HH 2QTEA 4HG4K 4OZGA 5GZOC 5HYJD 1FVEB 1NFDA 2IFGA 4JM2F 5EBGA 4HKZB 4NQVB 3KPQB 3MRHB 2P1YA 5CHNB 4ELMA 3T1FA 1FNFA 2F5AH 4OIIH 3V5KA 2AXJA 1V7NL 5TF1L 2IFFL 3H0TB 2XTJB 3PWVB 4PJAF 2X7LB 5IJKA 3Q6GH 2ICWJ 4LSQH 5C0BB 4XC1H 1CXIA 2R1XB 4PJ8C 4LLQB 1JWSB 4QNPE 2UWEE 1Q9KB 2IG2H 3QQ9D 4KDWA 4NO0D 1RUML 4U4BA 1BQLL 4KTDL 4XC3L 5HHQA 4PS4H 5HDQH 5KSBA 5F1IA 2WMPA 2ZUQC 4M5ZH 4D0BA 4M03A 1A1MB 2VABB 4Y16D 1IGMH 3ARUA 1QSEB 1A7OH 4OCYH 5C2BL 5BO1L 1K8DA 4NYLA 3MRCB 1FL5B 4OBSA 2IBGA 3N9GH 3EYQD 4XVUD 3TT1L 3JTTB 1JRHI 1MCOH 1LNUA 4RGMB 5FYJH 4KK9C 4HV8B 4Y8AA 1F11B 3OF6D 3TIEA 5FYKE 4Z7VF 2H6PA 4JFOB 4DKEH 2ITCA 4AEEA 4AMKL 2GFBB 4LSTL 1FV1A 1ZANH 4R4FL 5HGGS 4PV9A 1NFIB 4QRTA 1BM3L 1DQJB 4GBXD 3MRKA 5FO7B 4YHOH 4F3FB 5F9OL 4HS3A 2NY1D 4JZNB 4KRPC 1KJ3H 5IQ7H 3UZEA 5EU3B 5EO1B 4YHLH 2A1WL 4Z7OF 1R5IA 3P73B 5SX4I 3WIHL 3GMOA 5CILL 5GRVL 5A1AA 4OD2A 2OTWB 2DBLH 2FWOB 2Q20A 3S88L 2GYSA 1CZ8L 4GKSB 4QHNA 1CFQB 2Z8RA 5DUPL 2A77H 4Q74A 2CK0H 5EU5A 1YYMH 3LB6D 4YO0A 3FN0H 4MZ2A 1AKJD 5C0NC 2BSTB 5J8OA 2XNAB 4HKXA 5GGSY 2IQ9H 4GRWF 5DWUL 5C07A 2YD8A 3KPPA 4U1IB 4E41E 5F7YC 2R69L 3LZFL 5GSRA 3K3QA 5MENB 1MHHA 1R3KA 3LPFA 4JZJA 5SX4H 5DD0H 4LNVA 5MP6L 4N0FB 1PY4A 1D3CA 1A5FL 5SWSB 2OL3H 2Z91B 1DBMH 1KPRA 1KLGB 1IKNC 1RURL 4HK3N 3LV3A 3WO4C 3QHZH 4NO5A 4V1DE 3L3DB 1JYXA 3CVHA 2LU7A 5GIRA 2IANA 3FOMA 4Q6IB 1VSCA 1D5BB 4MDIB 3OAZK 3MLPA 4I4WB 1DZBA 2HKFL 1TVHB 5AZ2H 3SBWA 2X1PA 5E9DD 1VADB 2AABL 3QXUA 4J4PA 2ZOKA 1KENH 5JW5B 3D5OF 4NZUH 4X6FB 3IF1B 1ZA6A 5TDNB 1Q9WA 1A7QL 3H3KA 3Q6FB 5HYQB 1CN4A 2DQCH 5KSAA 5T1KB 4Y4KB 1CTNA 3SGEI 2NY6C 3VFGH 2YMXL 4IRJA 1TDQA 1FDLH 3UTSA 1SHMA 5DUBA 4NWUL 1E27A 4LCWD 1IEAB 1A6PA 5EOTB 5FYKD 2ZUSA 3IVKB 3ULVE 4XMPH 2VLLB 5A16B 3TYFB 2ARWA 1MCCA 3MYJA 1BFOB 1RK1A 2QSCH 4JFPB 2GUOA 3OGCB 4NQCA 2BHYA 1M71B 4NNXA 2VDNL 4BUHA 1OAYL 2Z31C 3T0BA 4HZAA 2IALB 3NABL 5D2NB 1BGXL 1AXTL 3QWOB 3SGEH 3NOIA 4UU9A 1QR4A 1AHWB 2FJFA 1JPTL 1RD6A 4ORGB 4GAJH 3VXPA 5E08L 1S7TA 2J7LA 1F3JA 4NRYA 3NACH 1FYTB 3DMMB 2X4SA 4WFHE 2YD2A 4ODHL 4L8BA 5FB8A 1EUUA 3KHQA 4PB9H 5MERB 3V4VL 2EEDA 4YGAB 4F57H 4I0CC 1A6ZA 3VGGA 1E4KA 3D3VD 3RX8A 3CFBA 4Q2ZB 3QNYB 5C8JB 4K3JL 3VXOB 3NIFF 1B6UA 4UOJA 2NQCA 1M6OB 2W9LA 3PGCB 4YXKH 2J88H 3IJSB 1A3LH 3B5TA 3KPMB 3U46B 3MMEA 3E3QC 3V0WL 2IADA 4E0RB 2MPAH 4QRSB 3SJVA 1XGPA 2A83B 5D71L 3S5LG 4V1DD 2PXYC 4YXLH 4WO4A 2GSGB 3QO1A 4PRHE 3HMXH 3BIAX 2VH5L 4LGRB 4JO4L 1U8IB 3DYMA 1OL0A 3I2CH 4JRYE 1WAAF 2NY0C 4JB9L 4PJIA 2YKLL 2YWZA 3CUPB 4EIGB 3WEXB 5IB1B 2E3VA 4QY8B 5T1MA 3VI3E 5FHAH 2R15A 2A0LC 1KC5H 1PFCA 3RIFF 2MKLC 4ODSH 3BJLA 4L1DA 3HE6B 4M7JH 3SKNA 1IC1A 3KS0H 3JXAA 5KVMC 5L6YL 3KGRA 1FGNL 3RJQB 3M17A 4TSBH 3ULVD 4N0YH 3ZLQC 2A2QT 4F7EB 3NFPA 3T4AA 3ECBB 5L8KB 4QWWC 4LVHC 3LKOA 3VGHA 3PP4H 2AI0L 4PJ7A 2Y36H 2W91A 4XP6L 3LKSB 1G7IB 1MCBA 3SKMB 1NCBH 4KZDL 4GW1B 3PHQA 3DIFB 4DGIH 1G7LA 2FBOJ 3CX5K 1WZLA 1BX2B 4IEFB 4NCC2 3X12B 1JJUA 4LQ1A 1I7ZA 1BBJA 4LVOB 1CFNB 5EOCL 1OM3H 3QFJA 5IK3A 5HI5C 3A6CL 3ARQA 3RL2A 4JY4B 4YBHA 3UZVB 2C4XA 5DGRA 4KQ4H 1S9VB 5EA0L 1T3FB 1FLRH 2XKUA 4JDVA 3VFTB 1LO2H 4U7MA 1IGJA 1IGTB 2YD4A 1K3IA 4ZO8A 3EJYC 2XWBB 3CC5B 1XT5A 2OTUB 4NNPH 4LU5H 1DLHB 2BNQA 4ZQKA 2EKSB 2FB4H 2VIRB 1ZVSA 4ZUTA 4LDEB 3T2QA 4BSJA 1YEDB 4OKDA 4PRHD 1UJ3B 5CCKL 4PRNB 5GS1A 3L7FB 4MHHI 2OBGA 3QI9C 3VWJB 5F21B 4JRYD 4N0UB 5F6HI 1T04B 1JHKL 1QNZH 5D1XA 2HMID 3FT3A 2YPLA 3WS3B 2ZPKL 4Y4FB 2HG5A 1B6DA 1F45A 4ZOAA 3RDTD 3OJ2C 1OGAD 2CSPA 4LFHD 4ALAL 1DUZA 5IB5B 4U1JB 1MUJA 1MF2L 3D9AH 5AYUH 2VLRA 3Q5YA 3VFSA 1CE6A 3S8WA 4QRPB 2D03L 3O4LB 4QXWA 4PJGA 4DN3H 2WQRA 5C0RL 4PLNC 1P7QA 2HRPL 2AJVH 1K3ZA 3RZWA 1I7UA 1F00I 1I7RB 5T1DH 4XPGH 5T5FL 1KB9J 4WTZG 5ISZE 5ACZA 1H9VA 4PGEA 4R26L 3AXLB 1U9KA 1L7IH 1JTOA 3RWIB 4H5SB 5KSVB 5FM5M 5GS0C 4CMMA 2AJXH 4WW2A 3PGDB 1EHNA 1HDMB 4B7IA 1KJMA 3TPUA 1KJ2L 2P8LB 4HWUA 1ACZA 3LQAC 1MWAB 1G6RL 1FH5H 4PJHF 3BESR 1H3UA 3NCMA 1AGFB 1CFVH 3P77B 4JCMA 1CT8A 5C09D 2FCBA 2P5EB 3FQTA 1J87A 4IDJH 2XZQL 5DVLA 3EDKA 2BSRB 5HHMD 4KKBD 3QIUC 5IJKC 2PYFB 2R1YB 1T7WA 2GTWB 1LP9A 1HHKB 4LKXA 2IQAB 2D4FA 4LEXH 25C8L 2O5XH 4EUPA 3NGBB 5DEFB 3D87B 3GBML 1ZHKA 5EOQL 1W0YT 4JRXB 4TYUA 3W39A 3VD5A 4YDKL 4JFDB 1SJVA 1I8IA 4Q9RH 3M8OL 2UZIH 5C0AE 3GSUA 3MV7A 1BIIB 5DGQA 3LS5H 4JQXA 4OQTL 5KAQF 2V17H 2JJSC 4TOYL 4HQQH 4APQB 1AXSB 1IAKB 4L8DB 5F9WB 1YEIL 1FBIL 4OGXH 4N9GB 4XGZA 3STLA 3WIFB 2OI9C 3ARFB 4PJBA 4ZUVB 4LCIL 1TZIA 3FONB 5DRXA 2J2ZA 1S78C 5CZVH 5I1GL 4G80A 4OZ4B 1TQBB 3NA9L 2E9IA 3H9SE 2DDQH 4GUPB 5JLZB 2KQMA 1EVUA 2UYLB 2E8YA 3VXMA 1QSFE 3IJHA 1RULL 43CAA 3FAXA 4JREB 4HIJA 1C08A 3UPCA 2PW2A 2R23A 4NQXA 1AIFA 3EYSL 1IZKA 4UT7L 3RWHB 5ISZD 2ED8A 1UM4L 1JPFA 2YD5A 3MV8B 5GGTH 4QYOB 3T4YB 2YD3A 4LCCB 5DMIH 4G6KL 3BH9A 1RZJL 5D1QA 1GXEA 2DWDB 2YA1A 3QCTL 3HTLX 4Z7WA 4R0LA 3EFDH 1HINH 2GAZB 2R4SL 2NXZC 1MJ8H 5BV7H 1IEHA 1I8MA 1WFOA 3TBYA 5FO9A 4ZXBD 1LMKA 1BBDL 4I13B 2FO4B 1S5IL 4IM8A 4FABL 5D96B 1HXYA 2EE3A 2DICA 2P5WA 3B3IB 1HH6A 2OSLA 3MROA 1JYNA 4YHKL 4CBPA 2FECI 2GJ6E 3DRTA 1GGBH 1LDSA 1XGYL 1CXLA 5E70A 3O45A 1LO3H 5C0AD 4U2YA 2QLVB 2IAMA 1HSBB 3SBWC 5C1MB 4P57B 3GMQA 2ZKHH 3PGFH 3MQIA 1YQVL 3X14B 4G5ZL 3QQNA 3VRJA 1WTGT 4LIQH 3RGVC 3SKOA 1IAMA 5CFHA 4OZIF 3BP7B 3AS3A 4F7TB 4TSCH 4XWOC 4QTIH 1X44A 2J4WL 3S36H 3H42H 4XPHL 5GISL 4J2XA 1NGPL 5I73B 4H8WC 3MOAL 2VC2L 3PWUB 4U1LA 2YUVA 3BZEA 4OLZH 3H9SD 3WNNA 5B21A 4N0CC 4UNVA 3EGSB 4L4JA 2APXA 4ONGL 5EU4A 3IDMB 3CU1A 1QSFD 3CX2A 2X1XR 1PX3A 3QULA 2AKRB 4R97C 4GOSA 3CDFA 1BOGA 1XMWA 4P4KB 5J4MA 2CUMA 1CL7L 5KAQG 1K8IB 3WHXB 4WHTA 5IMKB 2X4OB 3X13B 1MJUH 4HUMB 1F3RB 3AAZA 3MJ7A 3TIDA 1T22B 4MQSB 5FUOH 5GRJH 1R3HA 3GUTB 1VKXA 4XMKL 2CIKB 5C9JA 2XA8L 1S7XA 1P2CB 3WSQH 3FT2A 1BMGA 3EO1B 1H8OA 3OWEA 3PV6B 1OTUD 2ERJC 4WTZA 5I1LB 5CGMA 1HYSD 3O3DB 4O9HH 3UAJC 3BAEL 3OBAA 3QCVL 3GZKA 2I07B 3WD5L 1E4KC 5GGUB 5BOPA 1MFEH 2BOCB 4MGXA 1WSST 5GRYA 1WITA 5CP3A 4X6DB 2K7PA 3O41B 4P4RA 2DLHA 4H88H 5DC9B 5EIIA 2GJ6D 5FYLL 3WFCL 5ILTH 2FHCA 1A64A 2EDYA 2R2BA 4KVCL 4ZFOL 5I1JH 3WDIA 1WVZA 2L4OA 1DLFL 1V7MH 4LBEA 3RVUC 4Z78B 1XCTA 1HI6B 1XIWB 3V4PL 4QHLB 2R0ZL 4P3DB 2E5EA 1ZEAL 4JY6B 5L7XH 3GJFK 1ZMYA 3IFLH 2VLJE 4KDTC 1A6TA 3MXVL 1QEWB 3BIKB 1AQKH 2XACC 2XFXA 1PQZA 1JYVA 1ZHBA 4ZTOH 4EXKA 2AXHA 1OSZB 5DFWH 3BHBB 2WBKA 2OJZH 1FNGB 1NCCL 4UT9L 3TGXA 3T8XA 4ODVL 3V6ZB 4X6DF 2OMBA 4LARL 2HJFB 4HUVA 2E27L 4WU5A 5HPMA 5CEZD 3QG7H 5IMOB 5JQ6L 3ZKMD 4JHWH 4I48B 3W82A 4J8RB 1HCFX 3MRNB 2Y7QB 4UQ2B 4GJTB 3TT3L 3KPLA 4K9EC 1BEYL 1F42A 4PG9B 4BM7A 3MGOB 3U2SA 2H1PL 2VDKH 1WBZB 5BVPL 4D94A 3REWA 4O2EB 3UTTB 3WIIH 3I84A 2W9DL 3CXHJ 5HI4D 3NCJH 3AREA 1KXQE 1YZZA 4F15B 2AEQL 4Z8FH 2FGWH 3ZKQD 5DO2C 4F58H 2DMKA 4WI8A 4MS8C 5DYOA 4L3EA 4JM4L 2PW1B 5GGQH 3BZ4A 5DRZA 3V6FB 5IB4B 4HKBB 4J1UA 3FO1A 3ROOB 5L2KE 3RY6C 4L4TE 3P0GB 4NQTA 3C5SA 4J4PD 5IP4A 1T80A 4YEFA 4RGOH 3ZKND 2F53A 3HNTH 5CIPA 4PB0H 4CL7A 2EXWD 1BF8A 5F1OB 4ETYA 4XXCC 1NC2A 1XR9B 1H3PH 4UV4H 5K9QG 5FDWA 4LGSB 4QXUH 2CXKA 1U3HD 1INEL 4IRJD 3C5JB 4U05A 3BQUA 1KB5B 1CGSH 5CUSH 2AJUH 5A2JH 3V6OA 4JO1L 2WQ8A 5DFVC 1T21A 12E8L 1YN6A 4P23C 5TDPB 4M62L 3WLWC 5DQJB 3I3DA 1UCTA 3QIWD 3L3GA 1EFXD 3CH8A 5IVXA 1G7JA 2VLJD 2ZCKL 1ND0B 4XRCA 5EU7C 4G7YL 2MNUA 5INDB 2ZP0T 1V7NH 3MLUL 5INCB 1T1WB 2IFFH 1JV5A 4PFEA 1S9WA 3SKJL 3E1F1 5CLTA 3JWDC 5I75B 1WICA 2YK1H 3OXSA 3DJ9A 2WANA 4H25A 4JJ5B 2UWEB 1RUMH 4FFWC 1BQLH 4KTDH 4RRPG 5F3BB 1B0RA 2XIDA 1U92A 5CJBA 1GHFL 1PSKL 3TO4A 2D7MA 4AT6B 5C2BH 4C56B 1CYGA 1QFPA 1TVBA 5BO1H 5IW1B 4X5WA 3O3BB 3TT1H 3GMPB 3VXRE 3RIAK 1JK8A 1KB9K 4S1QL 3KXFA 5BZWA 5ITFA 2HT3C 4AMKH 2F74B 4ZOCA 3TBVB 5JOEA 4R4FH 5L2KD 4U1KB 5E00A 1BM3H 1FG2B 4RCAA 1A6AB 3WKMH 4YPGB 4NKMA 5F9OH 4KGJA 4PRDB 2Z93A 4MVBC 3OHXA 1CFSA 3K7UA 4NUJA 4C59B 5J06A 1MH5A 2A1WH 3IU4L 2FDBP 1MHPL 1E0OB 2XTJC 5D9SA 1OOAA 3WIHH 4NWTL 5CILH 4M7LL 1GZPA 5F89B 3GMRB 3F6LA 3IDGA 5LJYH 1NFKA 3F7PC 2EIZB 1IEBB 3LKNB 1C5BL 3IRPX 3TZVA 1KNOA 3S88H 1CZ8H 5DUPH 5C0FA 1GVIA 4U7KA 5J6GB 2XZAL 1CF8H 4KXZI 3JTSA 1PKQE 3VXSB 3JV5A 3R06A 5DWUH 2H9GA 3STZB 3DO7A 4ZSOA 2R69H 3LZFH 2NZIA 1YJDH 4PJXA 4E41B 2OZ4A 1A5FH 2FGZA 3OKDB 2V7NA 1FE8L 1XF1A 5I16A 1RURH 4OCWH 3HG1E 1J8HA 1ORQA 4OFYA 5MEPA 1HOCA 4Y4HB 1I8KB 3KYOB 3VFVA 4G8IB 1JFQL 1FZOA 3V7AE 1ZAGA 4GW4A 4KXZH 3ROLA 5IJVA 2AV1B 2VTFA 2HKFH 4HWBL 2V5SA 1CFTA 4CVZA 5DHYB 1DBBH 5JNYA 2AABH 2DWEB 3OB0K 5IEHA 1C12B 2V7HB 3QIBB 3EYOB 4IOFD 5D6CB 1ZLWH 3FAWA 3LQZA 5GGRY 1A7QH 4P9HC 1VEOA 3EZ8A 2H2PD 2A6IA 2YD7A 2FX8L 1TXKA 4R0LC 2YMXH 3VXRD 2NY3C 3KYMA 5CD5C 5CEYA 3WXVL 2EC9U 1G7QA 3F7RA 1RHFA 4NDMA 3MREA 5J3HC 4BZ1H 2APTA 1VFOA 4Y8DC 2G2RB 3FTGA 2Q86A 3LKQB 5T5NG 3GGWB 5D1XD 4ODWA 3DV6B 3H7LA 3I3BA 2YN5A 3GSNL 3BO8B 3LKPA 2VE6A 1NAMH 1X5HA 3MJGX 1KB5L 2VDNH 1OAYH 5FGBC 1X5FA 2CDFB 1BGXH 1AXTH 2VLRD 4I0PD 4KUZL 5FK9A 1JPTH 2MKWA 4X4MA 5ACLA 5E08H 1Q9LA 1CGVA 1YEEL 3SPVA 1F90L 3HCVA 3L5JA 4LNRA 4X6BA 3TLRA 5JPMB 2ORBL 3KPSE 3HS0A 4ODHH 3OXRB 5DD3L 2B5IB 2ID5A 2NLJA 4K94H 1AFVL 1AGEB 4IHOA 4UB0L 4U1HB 1EZVX 3V4VH 1DQQA 2APVA 5F6HJ 1BFVL 2FX9H 2VZUA 3TF7C 4M9PA 5FDYA 1G9NL 4J3OC 1MLCA 3QAZC 1TCRA 4K3JH 4DTGH 5DA4A 3V0WH 3QQ3B 4P2OC 4WV1A 3U0PB 4CW1A 3B2UD 5IB2B 4UDTB 4HSQA 3HG1D 5B8CB 1KCUL 1OVZA 1QZ1A 5D71H 5B3JF 4LLVA 5AUMA 1T0MA 2QADD 2VH5H 4LHUA 5E4IA 5BZDB 1JGDA 1FO0A 4UUJB 3ALWA 5JW4N 1DFBL 3O9WD 2RBLA 4JB9H 4R4ND 1JHLL 4BH8A 2YKLH 3QP3A 4JRYB 1IL1B 1IQWH 5FA3A 3LN5B 4XAKD 3O6KH 4BKLA 2D0HA 1U8QA 4YE4H 4GRLA 3HNVL 3DX7B 4HC1A 2JCCB 4OTXH 3RDTB 5A2KH 3PWPE 4GXUM 4N8VA 2B1HL 4YK4C 4MNHB 5FYKL 3VFUB 3MV7D 2VITB 1T20A 1KCKA 1V3JA 4P48A 5HDBE 1FGNH 4XH2B 4NN7B 3LVEA 1IT9L 4FQQA 5DK2A 1RZKL 3QEQA 2RCSL 2W65A 4EI5C 1BP3B 3MLXL 1NEUA 3BKML 4JFHE 3RZCB 1QBBA 4WNQA 1FSKB 4NKDA 4WJ5B 4C58B 4LLWA 3BOVA 4P2QE 4WTXA 5E6YA 4YXHL 1IM9A 2AI0H 2W0PA 1GAFL 2EDQA 2P44B 4XP6H 2GJJA 3WJLC 5LGJA 4LP4A 4HMDA 4QHMB 2DQDL 3G6JA 4JFFE 4KZDH 4RAUB 1KN2L 4OF0A 4RQQB 1VGKB 2YC1B 2JCCF 3CK0L 4YX2L 3ZT5A 3O3EA 3CDCA 5EOCH 4AIZA 4JFYB 5DF0A 5DMKB 3BW9A 4IJ3C 3WO3B 3S36X 2G9HA 32C2B 4X4YB 3A6CH 4IMKA 4P46B 5DJYA 2MHAB 4OAWA 5A3IC 3CFCL 3GI9L 3GIZL 1SYSB 1IGFH 4YQXL 1CICA 2DTMH 1IZJA 5FFLA 3P4NA 4KH2A 3LEXB 5D1QD 2K3TA 1EPFA 3KVQA 1W72B 3F5WB 4A6YA 3AM8A 1AGDA 2CIIB 2GTZA 2E7CA 3QR2A 4LCYB 1A3RL 4MA3A 4PTTA 5SX5K 4F7PB 1FNAA 4NRZB 3OPZL 1OHQA 2XYCA 4U0QB 3PL6B 4ZG1A 5CCKH 1P5VA 3I50L 4ONHB 4MQ7A 4TUKL 3ULUE 4R7NA 5C71A 3AB0B 1JHKH 3TNNA 1Z2KA 1XF4B 2ZPKH 1N3NB 1QYGL 3IFPA 4PJEA 2DI9A 3BKCH 4U1GB 1ZWIA 3RIFK 4ALAH 3BVNB 4XNZC 1MF2H 3ZZ1A 5KVFL 3MRMA 3AS2A 1KJVB 2IAMD 3ULVL 2H41A 3MX0A 2X05A 5DMGD 1A9EB 3S37H 1ZVYA 5C0RH 4J3WA 4LGPB 3SHSA 2RIKA 1K2DA 2QHRL 1HHJA 4LVOC 1J05A 1P4LA 3RRQA 3I75B 4HZLB 4TTGA 5T5FH 2FJHB 1IARB 3OL2A 5IVOA 4JFHD 1UCBH 4HGWA 3T0XA 4R26H 4YHPA 5ISZB 4P2QD 4J3SA 4Y19E 2J5LB 3MV11 4M6AA 3TBWB 4OM0L 4QRUA 4JFFD 4L29B 4MAYC 4JN2B 5C70A 1S7QB 1NEZA 4HCRA 1KJ2H 1G7PB 1G6RH 1KPVB 1MQKL 5IQ9B 3MGTB 1XGTB 4I5BB 3OR6B 3MZGB 8FABA 2XZQH 4OV6F 4JHBA 2X4TA 5C0IA 4HPOL 3HAEH 4X6CA 5HVFB 3VWKA 1VFAB 4YBQC 4QTHB 25C8H 2QKIA 2OYPA 4ELKA 2CKBL 3CH1B 3GBMH 1E4WH 1EBAA 5EOQH 4D9RE 2JIXD 3QDHA 3MRIB 1T7ZA 4YDKH 5I17B 4ZAKA 2J6EL 1HNFA 2JELL 1FRGL 1V3LA 2CDEB 3FQUB 2WBJA 3MFFB 1PDKA 1KTDB 1DL7L 3QUKA 4OZHE 3AS1A 5HDLA 5KOMC 5C0AB 2DYPA 4OQTH 1KLUA 3FQWB 3T65A 3A0OA 2JE8A 4I3SL 1YEIH 1FBIH 1DANT 1QKZL 1DTUA 2X4NA 5EBLA 3QUYD 4LCIH 2BZDA 3G5XA 5IHUH 1INQA 4KI5F 5I30L 1QA9B 2LAGB 1DVFB 5I1DA 2XQYG 1GGTA 3NPSB 1S7SB 2J8UA 1NBVL 4QOKA 2GK2A 1QOKA 1IRAY 2O5ZL 1RJZA 4HAFA 5F7MC 3C5ZB 5GZOD 1MCLA 4MAUL 3CLFL 1BZ9B 5K9KA 4YHML 2GCYB 4WI3A 1CS6A 5I1KL 3EYSH 3MBEA 1BVKA 4X6EB 1P84J 2FEEI 1CD1B 1A0QL 4S0SD 3MUGB 1FHGA 4DGYL 1UM4H 2P42B 1U8LB 4LP5A 4Y19D 2LTQC 1I1AA 2BC4A 2AJ3A 5TH2B 4G6KH 3NGBC 1RZJH 1SBBA 2X89D 3QCTH 1RZ7L 3SDDD 4CDHA 5I18L 5EC2A 3H9ZA 2WZPD 3JWNC 2HN7A 4L8CB 4TQEL 1Q94B 4CUCA 3P0YL 2R4SH 3TPKA 3WN5B 1VPOL 1JGVL 1JPGB 1LE9A 5D6DA 2G75B 3C8KA 5JORB 5D2LA 3ARED 2HFGL 2FSEA 1BBDH 2MSPA 3EIFA 4ZUWB 4APQC 1JNHA 1S5IH 4GAYB 1HE7A 3EYFA 4FABH 1UH3A 2X1QA 3U4EB 1PZ5B 1I3RB 2BNRA 1R24A 1Q38A 1YC7A 5FUCC 1JMXA 3ARFC 3O6MH 3JWOH 4YHKH 1ZS8A 1ZT7A 3PDDA 1D5XB 4P3WA 5IROC 4UIMB 3WHE1 3TJHD 1XGYH 1NL0L 4W81A 2IBZY 3E6FB 3WE6A 3CJJA 3VE0B 4GW5B 1U8PB 1HQRB 1HZHL 1D5MB 4FTVA 3K74B 2F53D 3TFKD 1YQVH 5DR5L 1NC2D 3GMMA 4JREC 5J6HA 3RPKA 5GQBA 3U4BL 2BVEA 1EXUA 4HS6A 1MJJA 1OF2A 4YDLC 4B41A 2J4WH 4JHZA 2Q3AA 2RQ8A 5KSUB 1OP5H 4LCCC 5GISH 5J11B 1NGPH 3MOAH 2VC2H 5I66B 4BZ2L 3TWCL 5GRXG 1IC4L 2FATL 4MX7A 4FQHB 5ADPL 4GKNB 3RWDA 1FCGA 4CRPA 2Y6SC 1QFOA 1ZT1A 2XN9E 4XP5L 1UM6H 4K7PL 3K46A 1UZ6F 1KSRA 4ONGH 1T0PB 2VDPL 3N06B 4KJPC 3UO1L 4BQBA 1OWRM 2Y07L 5EO0A 3MOQA 4AL8L 4OI7A 4XPFL 3CAFA 4WUKL 2XA3A 1CL7H 2HTLD 3KDMB 1QRNB 3VFPA 4DGVL 4PY8J 4G6ML 1QO3B 4EXPX 1TQCC 4O2CA 1PYWA 1KF9B 4XMKH 2XA8H 3VXQA 1AGBA 2QV2A 2GSIB 3B6SA 3HR6A 4Y1AE 5AWNL 4DN4L 3LD8C 4K3GA 3E3QE 4JVUA 4OFVA 1YMME 1GOHA 3FFCB 5F71A 4OCNC 3KWWA 4TVPE 3TO4D 1TMCB 3QCVH 2F8VA 3P30L 1F02I 1OB1A 1YDPA 1A7RL 1NDMB 1AR2A 3FB6A 4X0KA 1WCBB 5B38B 3WIHA 1F58L 1T1YA 4W6YB 3VFRA 1P4IH 2GITA 4RMWA 4WI5A 1MIEH 3B9KA 1LEKA 1JZ8A 1OAZL 4GAGL 1JZ7A 3G04A 1KIUA 3KXFD 4PJ9A 5FYLH 3WFCH 4WUUA 1GH7A 3IFNL 5DJAA 1DQDL 4ZFZB 1DLFH 4PJFA 2R0ZH 4IRZL 4WWKC 2W0FB 3VXUA 4LEOA 1ZEAH 4U1NB 4LASL 3QDAA 4PRIB 3SDAB 5IESL 5DJ0B 1Z3GL 3MXVH 3QJHA 1RK0A 4JDTL 4M93B 4XP1L 1YECH 2DIBA 1CG9A 4JANB 4PGDB 5IG7B 2DI7A 3L3KB 1RPQA 3UX9B 4JPIB 3VG9C 1N0XL 4UT9H 4ODVH 2FHBA 4OLXL 3AGVA 4LARH 3TZVD 2E27H 4R4BA 3QEUA 2Z31D 1FQ9C 2I24N 3MRPB 5JQ6H 4CMHC 3ZL4L 2A74A 3TT3H 4CVXB 3FO2A 1FFPA 2RFXB 2R9HC 2AS5M 3PJSB 15C8L 4EN3C 4MA1C 2EEAA 2WV3A 5AG8A 1WBXA 3C60C 2AK4A 3T0DA 2XKNB 3SCMA 2W9DH 1X5KA 2R8SL 2YA0A 4JM2A 4NC0B 1RZIA 1RZ8B 3HC4L 1PVHA 3SDCC 1J8HD 5D7SL 3T2NL 1J0KA 1A1NA 5H35A 1UH4A 4NKQB 5BV7C 3G6AA 3IJYB 2AQ3A 5L2JB 4JM4H 4W4OA 4Y1AD 3RNQB 3MV9A 5ESQA 5GGSB 1JI1A 3F12A 1YMMD 4EQ2A 2GJZA 2WIIA 3QUMB 4XZUB 3OTTA 5L2KB 1S9YB 1G0DA 2VDML 4L4TB 4LLDA 1S9XA 2PXYD 5EZJB 1F6AA 5GRUH 4NT6B 4F2MB 4XT1C 3MJ6A 5GHWL 3AMKA 3HAEG 5E2WL 3U7WL 1FVEA 1MOEA 2NY0D 4NQUA 2CXGA 4HKZA 4NQVA 5CHNA 3BP6A 3LAFA 3T2PA 1MCHA 4JO1H 4CU7A 2A0LD 3N85H 4WVRA 5CSZA 12E8H 1KN4L 2V5YA 5C6PB 2ZOLB 4M62H 3H8NA 3C6SB 5ESAA 4U6TA 3H0TA 3PWVA 2X7LA 4YPJA 2ZCKH 4G7YH 4KC3B 1I3GL 3RGHA 3U36B 3GSXB 3MLUH 3L3IB 1Q9KA 4QWWD 2CGRL 5CEZL 3K81A 4GMSL 1I85A 2E6PA 1DQML 2R56L 3VDBA 4HJGB 2H32B 1X9QA 5TGBB 3ZDZE 1FC1A 2ENYA 2Z35B 1A1MA 2VABA 1SEQL 3ZYZA 1QSEA 4ISVA 1FL5A 1ZHLB 2JJTA 1GHFH 1NC4D 2ESVE 1PSKH 5HI5D 5D7IB 4HV8A 3Q0HA 3C08L 2CD0A 2FR4A 3CVHL 4JFOA 1J9CT 3TN0C 2GFBA 3G5VB 1KTLB 1NFIA 2CJUL 1DQJA 2PYEB 3WL9A 4FXKA 4F3FA 5IGXL 4JZNA 2AXGA 5EU3A 1NSNH 4Y2DC 5EO1A 2VLKE 1MAML 2W1NA 1KCRL 3WNMA 4RGNC 3H3PL 5DDHB 1T4KB 3P11L 1I9JL 4MXQD 1J0YA 4W4NA 1MCSA 4G8FB 5JDSB 4POZC 2OTWA 4GKSA 3V79C 1CU4L 5D7IF 1CFQA 1KBGL 3KR3L 4NWTH 2AQ2A 3RUGE 4FP8L 1KCVL 4I1NB 4KQ3L 1FJ1B 3BGFC 2D4DA 3DROB 3EFFB 4K3DL 5CP7A 2XNAA 1OP3H 1E4JA 1OPGL 3K4ZA 2RGSA 4UAOB 3V0VB 4U1IA 1NCDL 3KAAA 5MENA 3D69A 4OZFB 4HGKC 4N0FA 2XZAH 3QT2A 5SWSA 5EG6C 2Z91A 1IM9D 1PKQB 4M61B 1QLRB 2YUZA 1BREA 2I27N 5IF0A 1FFQA 3S37X 2COQA 3IETB 4YNYB 5E1HB 4N0RA 1BD2A 4FFVC 4Q6IA 5I0DA 1FE8H 4MDIA 1D5BA 4I4WA 1FYHB 1B0GA 1SJEA 2AQ1A 5D7KD 4JO3L 2DLTA 5GS0D 3E6HB 1VADA 1JFQH 4X6FA 1L9NA 3BYYA 1NBQA 2P8PB 5H37H 5TDNA 2PO6A 4HWBH 4L9LB 3RPIB 1U91B 5HYQA 1O7VA 5C9KA 1KCLA 4KJWD 4Y4KA 3O9WB 1T2QL 5JXEC 2ESVD 3K1KC 4HLZG 4JFQB 5IBUG 2CKNA 1IEAA 5EOTA 4DZBB 1E6OL 2VLLA 3KYNB 4YR6A 5A16A 1BFOA 1H3GA 2FX8H 4PJCE 4F9LC 1OTSC 5B4MC 1R5WB 2W92A 5LBSL 3V7MA 1I75A 5HGDB 5J56B 3WXVH 2H3NB 3ZT7A 1P84K 2VN4A 3ARBC 5ELIA 1K5NB 2VLKD 2IALA 2FYYB 2GQHA 4XBGB 3QWOA 5JHDB 2PTVA 4RNRA 3GSNH 1AHWA 5DJ8B 1X3DA 3F7VB 4ORGA 1T5XB 1KB5H 1S7RB 4MCZB 3OKYA 1MCQA 3DMMA 4ZFGL 1WAAA 5J7CC 3BKYL 5DVKA 4YDVB 1H0DB 4LPVA 4ODBD 3UCRA 4NQDE 3ESVF 2K1MA 4L5FL 1YEEH 1JGUL 1S78D 1F90H 3FJTA 1G0XA 1W0WB 2ORBH 3TA3A 3W11C 1NMCC 4ZFFB 4O2FA 5DD3H 2EIDA 1QLEL 3KPSB 4K23L 5FOJA 1M6OA 5L9DL 4UB0H 5CAYB 3IJSA 3WFEL 3L5WA 3KPMA 4BFEA 2UVEA 4E0RA 4MNGB 1BFVH 1T7VA 4U2ZA 1RI8A 2A83A 4KI1A 1TZHB 1WZKA 4UOW1 1RUPL 3DVFA 5BRZB 1TJHL 4AG4L 2GSGA 1DDHB 5KVGH 4I0KA 1ZLVH 5D8JL 3DVNA 4U6YB 1U8IA 3MCLL 2EKJA 5EU6E 4LSPL 4MJ5B 1KCUH 1KEML 3ARDC 3IKKA 3WEXA 5IB1A 1J12A 4QY8A 3UDWC 4X99B 3SDXF 5LG1A 3VWKD 1WWBX 1DFBH 3C8HA 4Z7NE 4G3YL 2NXZD 2CR3A 4P5TB 5D5MB 1T83C 3MJ8A 4HIHB 3TBTB 4IRSB 1JWMB 3HNVH 4KUCF 3PQYE 4PJDE 4N1CA 2B1HH 4F7EA 5FYKH 3PWPB 4D2NA 3ECBA 4JCLA 5J9PA 1L7TL 5E94B 2Z4QA 2DYPD 2HA1A 3LHPL 2ICEB 1IT9H 5IW6A 3KNBB 3ARGB 2LE9A 3LKSA 1G7IA 2RCSH 3ULSB 2QQQA 3QXVA 1HHHB 3QCUL 3MLXH 4GS7B 3BKMH 4FN0A 1GC1L 3DIFA 3NIDF 2B5IC 4K55A 4KGLA 4PYGA 2R2CA 1H5BB 5C0CE 4W68A 3JV6B 3LKRB 3B9KC 4YDJB 5MEOA 1QVOB 1A9BB 1NGYB 5D5MF 4PJ9C 1KN2H 1CFNA 3TESA 1RVFL 4U0RB 4NN5C 3CK0H 4HUXB 4YX2H 5BW7C 4JY4A 4XWOD 2DM4A 2MJWA 3R8QA 3WXWL 1XF5B 5EIVA 5E4EB 1N6UA 3VFTA 1FN4B 5FKPB 2I9TB 5IFHL 1YJDC 5DURD 2B8OT 2EDWA 1QPXA 4EIZC 3CFCH 5JIKA 3GI9H 3GIZH 5DTFA 4X4XB 3H7BB 3JBG7 4YQXH 4LCUA 3M07A 4GG6E 3CU7A 3DXAE 4FQLL 1M7IB 3FL7A 5HHNB 4Y5YB 4BSVB 4RDQF 5IVZA 1DLHA 3MRFB 3D39B 2EKSA 2OLDA 2VIRA 1OARL 2JIXB 1UJ3A 4M9OA 1FFNA 1OT2A 3UEZA 5EU6D 2Q3ZA 3L7FA 3VMNA 5GGVL 5HD8C 1HXMB 2D3VA 4PV8B 1A3RH 3VWJA 4N0UA 2FD6L 3ISWA 3OAYH 1T04A 2NXYD 3FB7B 4RFNB 4URTB 5ETUA 3OPZH 3WS3A 4Y4FA 3WFHB 2IPUG 3T09A 1MCPL 1IFHL 4P5MA 3V2AR 4TUKH 1HNGA 4H1LH 1AD0B 5IB5A 4U1JA 3S9DB 5HHOB 2FNBA 4JN1L 1QYGH 4QRPA 4Y7MA 3O4LA 1TJGL 3ZKXC 2QL1A 1WFUA 5E24E 3KPRE 3V4UL 2A6JB 4OUUA 4W4OC 1BJ1H 1XF3B 5KVFH 1VESA 1I7RA 3LS4L 3T0EB 3MC0A 3ULVH 3STBA 1MCIA 4LHQB 1D6VL 1S7WA 3L7EA 4MWFA 1UA6L 3L3JB 3AXLA 5DC4B 5D1ZB 4KK5D 4U1MB 2QHLA 1NANH 2QHRH 5KSVA 4OGYH 4MQXC 2C26A 3MXWL 2BJML 1HDMA 5F6IC 5JOPD 4MD4A 4PJ5E 4IIQC 5C0CD 2P8LA 1R6VA 3ULUF 4D3CL 1T03L 1QPPA 5EU7E 5IKCA 1AGFA 1OWWA 3P77A 4OM0H 1YPZE 3UTPD 3PDOA 2NY7L 5E8NB 2DQGL 1NDGA 5HGBA 1YN7B 1M7DB 4K94C 4GXVL 5TQ0L 1MQKH 2M26A 2PYFA 2R1YA 2VL5B 4ODUB 1P1ZB 1YMHB 4PJ8B 5DEFA 2VQ1A 4LLYB 3V6BR 1S3KL 4HPOH 4JFDA 4FZ8L 4BQ6A 3AB0C 3DXAD 5T1LB 3EJZC 3O8XA 3NCBB 2CKBH 2CLVA 1BIIA 4PRAB 3P40A 4JGMA 4NHUB 4Z7QE 2ZUQB 2J6EH 4PJAE 5LAXA 2VISB 1FRGH 2I5YL 4L8DA 1DL7H 4N9GA 1S8DA 2OCFD 2WM0A 1IKFL 4OZHB 5EUOF 1EZVY 4ZUVA 2CRZA 3FONA 4HXBL 2MQ0A 4I3SH 5H37G 4Z76B 1G84A 1T1XB 1T2JA 1QKZH 4OZ4A 4NJAL 5KS9B 5I8EB 1Q0XH 3DVGB 1QG3A 2ADFL 5JLZA 4KRPB 5IFAL 2UYLA 5FA4B 1I8LA 2NNAB 3WUWG 2CRMA 1WJ3A 2XTJE 4XNQB 4HH9B 3HB3C 1JNJA 5ICXB 2IGFL 5HHXL 1WZ1L 2DQFB 4D0DB 1M05B 1NBVH 3CVIL 3RWHA 1MFDH 3MLTB 4NZJA 3MV8A 5I2IB 1Y0LA 3ILPB 4QYOA 2D31B 1MCWM 1H15B 4Z7VE 4MAUH 5C0BE 3CLFH 3MNZB 1H3TA 4YHMH 2NX5B 4P23D 3UROR 5I1KH 1NGXA 1SEBA 3UBXI 1Q8MA 4N8PA 2DWDA 4DGYH 5IM7A 1NAKL 3IXTB 3OB8A 5KS9F 2VO5A 4X7TA 4X9BA 2CMRL 2BERA 3GNML 3P9LB 4HUUB 2FIKB 4Z7OE 5I18H 1RZ7H 1ZSDB 3MODH 4CU8A 2AJZA 2FO4A 4TQEH 2MCG1 3P0YH 4Y5VB 1VPOH 1JGVH 1RUKL 2ADJA 3SCMD 1CWVA 3WO4B 4IOSD 1NJ9A 1EERB 1J8KA 4OFIA 2HFGH 4JM2D 1QFWI 4JKKA 4LOUC 3RL1B 4FFWD 3DV4A 5F97E 3OJDB 2B20A 4GRWE 1FORL 4R7DA 3S7GA 4RX4A 4LLAA 4P57A 3MV9D 5T33L 4DVRH 1NL0H 3X14A 4ODXB 3P9MA 1BZQK 1DVFC 3FB5B 4HHAA 2PO6C 3BP7A 1WC7B 1HZHH 2NY6B 2ED7A 3THMH 4F7TA 3U1SL 4NM4L 5DD1L 2ZUUA 1QFWH 3HE7C 5DR5H 3KYKH 4WTWA 3U4BH 2NTFB 4MVBD 4TPRH 4QHKI 3TVMC 3O6FC 2ZZUT 2BY3A 4BZ2H 1IC4H 2FATH 1LILA 2XTJD 4CN4A 5ADPH 4FQCL 1X4YA 1QUNA 3T08A 4P4KA 3OJVC 1OLZA 3GMLB 3PE9A 1LHZA 1R3IL 5DQ9A 4XP5H 3WHXA 4K7PH 5HYSG 5IMKA 5C0BD 2X4OA 2VDPH 2XN9B 2AW2A 3UO1H 3X13A 3IDUA 2Y07H 1T22A 3GUTA 5ICZB 2CIKA 4XPFH 3UYPA 1P2CA 4WUKH 1DBKL 1QRKA 3BPLC 3OSKA 3RTQB 4WEBL 4DGVH 3PV6A 3C8DA 4G6MH 1IGCL 5IB3B 5I1LA 3MLWL 3O3DA 3U6RA 1AJ7L 2I07A 1WIOA 4IOIB 2HLFC 1FZMB 3TA3C 5GGUA 2DMBA 4BH7A 3GK8H 4NOFA 3DX6B 4M3KB 4X6DA 5IOPB 1TZGL 3O41A 3P30H 2BHZA 1A7RH 2PXYB 4JEGB 3IDIA 5LGHL 3OAUL 2V5MA 4C4KO 1F3DH 4P5KB 1F58H 1G9MC 4Z78A 1HI6A 4QHLA 4P3DA 2XWTB 5DJCA 1OAZH 3MPCA 4GAGH 3B9VA 3U9PL 5FYJE 3UBXB 3IFNH 3NIFE 4O51A 2LVCA 5I1AB 1DQDH 3BIKA 5D2NE 4NQSA 3I9GL 1HEZB 4IRZH 3QNZA 3EDJA 5T3XD 1Y6NR 2JB6B 4LASH 2NY3D 5CD5D 4AJ0A 1TNNA 4MA8L 1FNGA 3V6ZA 5IESH 1T1ZB 1Z3GH 2HT4D 2WWMC 2HTKD 5CBEB 3MUHL 4JDTH 2HJFA 5J3HD 1U8NB 2V5TA 5IMOA 1FYTE 4ZPVB 5TPWL 4I48A 4J8RA 5DHVB 3MRNA 2X70A 1N0XH 5GRWA 1CBVL 4G8GB 4BSWA 4DWHA 4OLXH 5ESVA 4LVNC 1ITCA 1WFNA 4M1DL 1I3VA 2V2XB 4O2EA 1IQDA 1UB5B 3UTTA 5GSVB 2CLZB 3ZL4H 5KW9L 3HUJB 1EX0A 5SWSD 1ADQL 1K85A 4XX1G 3NN8B 3GSOB 15C8H 1P9MC 4Y16A 3OKOA 1P5UA 3UTZB 5D7LB 1X4XA 2Q76B 3HRPA 4YHNB 2D9CA 1NC4B 4P2CG 2R8SH 1J0IA 4U33A 4YHIB 1SJXA 3V8CA 3HC4H 5FO8B 3OF6A 3FCTB 3V6FA 5IB4A 1UZ8A 4HKBA 3ROOA 5D7SH 3T2NH 2VZSA 1AI1L 1MY5A 4X7EC 2E7BA 3MRGA 4AK1A 3L3HB 3N1GC 4GRMA 5E99L 2EYSA 2WWKT 3CD4A 3O6LL 2VKWA 3VD4A 4KHXH 1JI2A 5CBAB 3QUXC 1XR9A 3GHEH 3HUJF 5T1KD 3GSNA 5E8EB 2VDMH 3C5JA 2IH3B 5H8DA 3SY0A 3GSQB 2KDGA 1CXEA 1KB5A 1SY6L 3JWOC 4LHJB 1VERA 5GHWH 4JR9H 3N1PC 5E2WH 2W60B 3LEYL 4FQXC 3U7WH 5IBTL 4MLSA 1LVEA 3QI9B 5ALBL 3KJ6L 5FGSA 3UJIH 5DJDA 2NW3A 1MCFA 5DJXB 4HAGA 1T66C 4K3HA 2B1AL 1JHTB 3OKEB 4LK4A 1EO7A 1KN4H 3MCKB 4P2RB 2X4RA 4XNYL 5JMRA 5MEQB 1G0YR 5INCA 1T1WA 2PNDA 3OR7A 1ZA3B 3MRRB 5J13B 4G6AC 1I3GH 1AR1C 1JN6B 5GGRB 4JPWL 1FYTD 3DMMD 4EOWL 4QHUB 2LFGA 2R2HB 3CGTA 3W0WE 3O0RL 2CGRH 4HUWB 5CEZH 5DC0A 4GMSH 1H3XA 4JJ5A 2UWEA 2X9XA 1DQMH 2F8XC 4M43L 3VD3A 4Z5RB 2R56H 3S96B 1YC8A 2DS4A 4OLUL 1UKQA 5B39B 4W6XB 2ZUXA 4OZGB 4KHTH 5J1AA 3QSKB 1WIPA 1SEQH 2HJLA 2OZ4L 5D7JC 4AIXA 2ZNXA 1UGNA 2QSVA 1EO8L 4PY7B 2IPTL 5IHZB 1A6UL 35C8H 2N56A 3C08H 4PLKD 3CVHH 2RB8A 4I18C 1CDCA 2F74A 4YEEA 1LGVA 5MI0B 1EUTA 3VDAA 3QIUB 3ME0A 4JPKL 2KZ1B 3LH2H 4YPGA 3KPTA 1DQTA 2PR4H 4PRDA 5I15L 5KANI 5F9JA 3NFSL 3HE6D 1U58B 4OZGF 2VLKB 4PJHE 1KCRH 4FMFA 3H3PH 3BE1L 1R3JA 1NFDF 3QZWB 3P11H 3O8XC 3UBXG 1N59B 5KSBB 2EIZA 1IEBA 1E4XI 4ZO6A 2QEJA 2DQEL 3QXWA 4OSUL 1CU4H 3NPZB 4D0BB 3O2DA 1JTTA 3HNSL 3KR3H 4W70A 4FP8H 1KCVH 4MSWB 3GKZA 4K3DH 5J6GA 4OIAA 3RUGB 2C9AA 4NYLB 4LF3B 2N4IA 2OI9B 5DUML 2IPKA 1U2HA 4GMTL 3ILQD 5LKNA 3STZA 1CDGA 1F5WA 4E9LA 5AD0B 5IR1B 1F2QA 1NCDH 4KK8C 2D7TL 2ZSVB 4E41A 2ITCB 3PG2A 3D18B 2I9LB 3QQ4B 3OKDA 3RVTC 3ZTNH 1Z0MA 3L5IA 4PLJC 1YNLL 3FRUB 4Y4HA 3CSPA 3F58L 1I8LC 1I8KA 2P5EE 3KYOA 4JQVA 5KSBF 2BVOA 4V1DA 3S98A 3W0WD 4G8IA 3EO0B 1A7NH 1R5IB 2AV1A 1IAIL 4DQOH 1Q0YL 1Q9OA 4JO3H 1NLDL 3K1DA 1KFAL 2KL6A 4MNQE 5DHYA 3RUGF 3W5NA 3SGKA 4JRXE 2ZNWA 1EEUA 3HC0A 4H1LA 1HHIA 4NN6C 5IHBA 5D6CA 3GIVB 3VH8G 5EU5B 2NY4C 1ZVHA 3VA6A 5IBLD 1T2QH 2Y06L 3NZHL 3WS6A 4HKXB 2DMCA 3GSVA 1OP9A 1MREL 2FL5B 4CN1A 1O5DT 2E7LA 1R3KB 4O5LL 2Z92B 5C6TL 2R0KL 4H20L 5LBSH 1FO0L 5FUCE 3GGWA 4PJCB 4UT6L 3O2VL 4PTUA 4Y4FD 3BO8A 4DOHB 3TM6A 2F54E 1TJIL 2IANB 2CDFA 4RMRA 3FOMB 4A2LA 3FQRB 4XCNA 3O4LD 3MOBH 1UXSB 1JZ6A 1O7SA 3E8UL 4R90L 3AY4C 2OXGA 1P69B 2BNUB 5JPMA 3JSSA 4ZFGH 3HZVB 4KROC 3RGVB 3BKYH 3OXRA 3QG6A 1YY9D 4R2GC 1AGEA 5E5RB 4XXDB 4L5FH 4Z0BL 1JGUH 1UM5L 4NQDB 3UTSB 3DX8A 2ILLA 1OCWL 1E27B 1MFAH 3L9RB 5C08E 1QLEH 4HEPG 1CLCA 1NPUA 4K23H 4AQ1B 3VGAC 3MNWA 3PUCA 4FFYL 5L9DH 3WFEH 4KMQA 1BVLB 3QQ3A 3WNPA 3U0PA 2OS7A 2JJVA 5IB2A 4FG6D 2K9UA 4NQCB 3BD3A 4KK6D 4NRXB 2P5ED 4XMLL 1TJHH 3QJFA 2NY2C 5JPNA 4OZIE 4G9FB 5D8JH 4R97B 5GS0L 3A67L 3AUVA 5I8OL 4LRNL 4PRHA 4WFFD 4UUJA 4LSPH 5DT1H 1LDPH 1KEMH 2EYRA 3NVQA 1NUGA 4JRYA 4CU6A 5DS8B 4JRXD 1N7ML 3LN5A 2ITDB 3WHE0 1JWUB 2YS4A 1RFDH 4JFDD 2KKQA 3RDTA 4A6YL 5MHSE 3GSWA 2X4SB 4G3YH 2R0WL 4L8BB 1J0HA 3R1GL 5CJQL 3DSFL 4HWEL 2VITA 5CEXB 2ERJB 1EA9C 1WT5C 2EDTA 4RWYL 2ZJSL 4APQD 4ERSL 1A6ZB 3ET9F 4PRPE 5KOVC 3CFBB 3PQYB 5IMLB 5E2TL 4FXLA 1CD9B 4WEUD 3I6LE 1L7TH 4L3AA 2AK1L 3MMEB 3ARFD 3B83A 1U8JA 2IADB 4WJ5A 3NAAL 2XZCL 4RAHA 4U49A 1FPTL 4NNYA 4QHMA 4WO4B 1PLGL 3QCUH 5C0GB 3PABB 1GC1H 1VGKA 3VG0L 4ZS7H 2MOVA 1DP0A 2C7UB 3B43A 3I6KA 2VXQL 1EO5A 2YUWA 4PJIB 3ZTJH 3QUZC 1BOYA 1GL4B 4JGUA 5T1MB 3G5YB 4G6JL 4JFYA 3IDYC 2HT2D 3ALXA 1RVFH 32C2A 4X4YA 4P46A 2MHAA 1B88A 4AM0B 3UTOA 3U0TB 3QEGL 3MV8D 1SYSA 3WXWH 3RWEB 3RVXD 1LO5A 3BWUC 3ABZA 3IS1X 5IFHH 1W72A 3F5WA 4EJ1C 4GT7A 4ZMAT 3BWAA 1WWCA 2Z8VC 3AMLA 4MB3A 3JUZA 4ZDHB 3T4AB 1LEIA 4K71C 4JPVH 3QRGL 3GB7A 4LCYA 4GG6B 3DI2B 3OKMA 4ZYKB 4YGVB 4F7PA 4NRZA 3PNWB 4K7PX 4PJ7B 1OARH 4PJIF 1B9ZA 2DD8L 2WP3T 1HHGB 2VDOL 3PHQB 5GGVH 4UILL 2HFFB 3LMJL 4YAQA 4Q9QL 4Y16C 5ID0B 5IFJB 1XF4A 1N3NA 1MCPH 1IFHH 4EUPH 4P99A 3BMVA 4FQ1L 3BVNA 5IK3B 3U30B 5MHSD 5DQDL 1ZE3C 2DL2A 2NMSA 3SOBL 4WI7A 3RL2B 1T6WA 4MD0B 4RX4D 1KJVA 4QEGA 5F96L 1TJGH 2B0SL 1A9EA 3MRDB 1NGZB 4GBXC 2IBBA 3V4UH 4JE4B 1OGTA 4PRPD 2D0GA 2NY1C 4PJ7F 3KPRB 3LS4H 2FJHA 2YR3A 2AV7A 1D6VH 2GIYA 3VH8A 1CIDA 1PW3A 3UJJL 5ISZA 2BNQB 4ZQKB 4HLJA 4HT1H 5HHVL 3C2AL 1S7UA 1WISA 1ZVSB 2OP4L 4ZUTB 1NH6A 3MXWH 2BJMH 5F88B 4LPWA 5BVJB 3WJJC 4LIQE 5GS1B 4P23B 2EDEA 4WWKD 2RJMA 4JN2A 4MA7L 1S7QA 4ODTL 1N4XH 5JA8B 4D3CH 4PJ5B 4ZNEE 1T03H 1KPVA 4X9FA 1F13A 3IS0X 3MGTA 3FT3B 4I5BA 4NHCL 5IQ9A 3LB6C 2HG5B 2M1KA 2NY7H 5FUZH 2DQGH 2F15A 1YPZB 3B9AA 1AXIB 4I2XE 4X4ZA 5A2LH 1DUZB 3DETD 2GEEA 5JO5B 5F7KC 4GXVH 4ZXBA 4Y2OA 2BVQB 1J0JA 5TQ0H 4DFIA 1ORSB 1F97A 1VFAA 5E6IC 4YC2C 3RNKB 5KANG 5DJZB 2GHWB 3CH1A 1ETZB 4OBRA 3WNOA 5DD6B 1BFSA 1U8KB 3MRIA 5I17A 1S3KH 1I7UB 4FZ8H 3F65A 2CDEA 3FQUA 1BWWA 3ZSTA 4EN3D 3MFFA 4J6RL 1KTDA 5I1IH 1INDL 4PGEB 1V3MA 1RU9L 5C0AA 5E2VL 3FQWA 1QFWM 4CMMB 2I5YH 4WDIA 4WW2B 3SDCD 1YPZF 4DCQB 5TE7H 5F1SA 1A1OA 1A4JA 1IKFH 1MPAL 5IWLC 1UKTA 3VD9A 3JUYA 1S5HB 3BD5A 1ERNA 3WMSA 4L9DA 4NJAH 2VWEC 4F9PC 4J3VA 3R4DA 1XIWD 4LRIA 3MBXL 1T2XA 2C3VB 2ADFH 1S7SA 2AXFA 1PG7X 5IFAH 3H9SA 2D7OA 3C5ZA 5E8OA 1BZ9A 1Z9MA 1SQ2N 3W39B 5C0JB 1QSFA 1U93A 2Y25A 1FIGL 2GCYA 2IGFH 4Z7QF 5HHXH 1WZ1H 3L1OL 1CD1A 3CVIH 1WBYB 3GKWH 3MUGA 4JY5L 4WW2F 4JFEE 4X8JB 3S34L 4RISL 1ZGLP 5EC1B 1JTPA 2PCPB 1S9KC 3BZDA 3CFKA 4X9GA 3JV4B 5TH2A 3UPRB 3X11B 4Z7VB 4WHYH 1ZV5A 1Q72L 1GPOH 3TEUA 2I26N 1W8OA 1NAKH 4XVSL 2X1WL 4L8CA 3VMOA 2YZ8A 1Q94A 2DM2A 2CMRH 3RQ3A 3GNMH 4HXAL 3KJ4B 1JPGA 2APFA 4MYWB 4PJBB 3UTTD 2G75A 3VGBA 2Y72A 3CFJB 4K8RD 5JORA 1NCAL 5DRXB 3S5LB 3RX7A 4C56E 3D0VA 1PZ5A 4OJFL 1RUKH 5TJWK 3ZDYF 1MSPA 4OIBA 4NFDA 2VQUA 1KXTB 3VXMB 1D5XA 3SE8L 4UIMA 1WF5A 2GJ6A 4HIJB 2R0LH 4NQXB 2R23B 5CZXC 2ED9A 1I9IL 3E6FA 1FORH 3VE0A 4GRWB 4GW5A 1JPFB 2ADIA 1U8PA 4XHQA 4YBLB 1AGCB 5FGRA 5F7DB 5T33H 4PJBF 5HYFA 5EWIH 4D8PB 1OW0A 3QPXL 4LDLB 4S11A 4Z7WB 1JZ2A 4OLWL 4DUWA 1K4DB 4R0LB 1IGIL 5CP3H 3U1SH 3BXNA 1CGUA 4U1SA 5DJ2B 4NM4H 2NY3B 5DD1H 4LLUB 5KSUA 1I8MB 2EH8L 3ARVA 3TBYB 3DUUA 4C55A 4FQHA 3ULVC 3VXSE 5LXGL 1YUHA 3SE4C 2P5WB 1HH6B 3MROB 4OCSL 4XCCL 1HSAB 4N90E 1EDQA 4FQCH 3R0NA 5J1TC 2QSTA 4MCYB 1R3IH 4Y5VC 3KDMA 4Z7WF 5H2BA 2VLME 4NIKB 4U6XA 2YEZB 3BEVB 2DL9A 2GSIA 4CDGC 1DBKH 3L6FB 4OFKA 4WEBH 4CADA 5F7WC 3ZTJG 1IGCH 3MLWH 1AJ7H 4XHJD 3O4OC 3QAZB 1NDMA 4LPYA 4HS8L 4C56D 5K9OB 5B38A 4U1LB 4P2OB 1C5CH 1WCQA 3BZEB 1TZGH 1U3HA 5EBWB 1UWXK 7CGTA 1R3LB 4Y5XA 3LDBC 5EU4B 1QFUL 4PIRF 3OAUH 5LGHH 3IKCB 4ZFZA 1D9KC 3HI5H 1OD7A 5E1AA 2W0FA 3WDHA 3FFDB 3QIWA 2ZCLL 4WHTB 5J12C 1EFXA 3AAZB 3MJ7B 5JUEL 2HMIC 2VLJA 3C09C 1U2CA 5CIPH 5C9JB 3HZKB 5FAAA 3I9GH 4YK4B 1S7XB 3GO1L 1OTSD 3EYUL 2XG4A 2SEBA 4XVJL 2EDFA 3FT2B 3L3KA 4JPIA 4X83A 3OAZH 5B3JE 5KJRL 1VFMA 4EUPG 1LD9B 3PWNA 1TPXC 3C6LC 3MRPA 1DQLL 2NZ9D 5CZKA 2Q87A 3GDBA 1MFNA 4EI5B 1ZLUK 5F70A 2RFXA 1CBVH 2XZZA 2MQ3A 3VXSD 1UXWA 4N5UA 2MTPA 3RTQC 1RIHL 1X6LA 3MUJA 3PJSA 4P4RB 4UOW0 2WAHA 5ERWA 4M1DH 4EDWL 2XKNA 4E41D 5H94B 3EOYG 4N90D 2VQTA 4WRLA 1ADQH 2VAJA 3CXDL 1RZ8A 3BP5B 1T89A 1CDHA 1UB6B 2N7AA 2Z0BA 4Y4HD 2VLMD 3W11D 4ZS6D 1A6TB 3IJYA 4PRBB 4IJ3B 1HH9B 3KPOA 3FMGL 4PR5B 2PF6A 1KEGL 1X7QA 2OL3B 5FV1L 2OK0L 1L6ZA 4JHAL 1WIUA 1FL3B 1HN1A 4XZUA 1J88A 5L2KA 1S9YA 3I3EA 3T8XB 1SBSL 4L4TA 3BPNC 1RSFA 3LPWA 4KKBC 4WI6A 5EZJA 3QIBD 4WU5B 4NT6A 2JCCE 4U6VH 4NC1E 1U6AL 2DQJL 4F8TA 1A4KB 3FOLB 2J12B 3U2SB 1SY6H 1DCLA 1I1YA 3ZE2E 3HI1B 1EAPA 3LEYH 1B90A 1CLZL 4QF1A 5ALBH 3KJ6H 1WTLA 2ZOLA 4D9LL 3C6SA 4R6UA 3SGJA 2FZ3B 1MFBL 2ZUWA 3EHBD 5JW4R 2WSKA 4DW2L 1N64L 4P9HL 4JAMB 2B1AH 5GJSL 4K07A 3SE9L 4YHZL 3EDDA 5T3XL 5DYOB 1JUFB 4GAFB 4L3EB 4XNZB 3LIZH 2F58L 3L3IA 4PGZA 5DRZB 3IDNA 2O5YL 4F7MA 3MRJA 3TV3L 4MDJB 2GT9A 1VFBB 2DLIA 5TGBA 1WEJL 2JJWA 4JPWH 4HK3J 1B4RA 4EOWH 4J23A 3MLVL 3O0RH 1P7KA 2IBZX 4WFHD 3W0WB 5EZOL 3RWGA 4M43H 3UP1A 2VXVL 4OLUH 3BQUB 4Z9KB 4WHDA 3ZHDA 2EDHA 4L3CB 3VJ6B 2F5AL 4AEIL 4QGTA 5DMJB 4MAYB 1YN6B 5FHBL 2OZ4H 3ZE0E 4ZUUA 1N5YL 3OKKB 5DZOA 1KTLA 1EO8H 3BI9X 1JNLL 2IPTH 4WHYG 1A6UH 3M1BA 4P9MH 3VXRA 4AEHL 4XRCB 2VDQL 2EXYD 1MI5E 5KTEL 1ITBB 1IILE 1U95B 3SGDH 4HWZA 2BP3A 4JPKH 2VN7A 3BYTA 1T4KA 2EE9A 3O3AB 4G8FA 5JDSA 3NFSH 5EPMB 3SE3A 3MRQB 2B4CL 3ZSSA 5C3LD 4PG2C 4H25B 2VDRL 1REIA 1JGLH 3BE1H 1EVTC 4I0PA 4PJHB 1P6AB 1FJ1A 3QDJE 3DROA 3HLAB 1IGYB 5J13C 1Z9LA 3Q3GA 4CAGA 1U92B 1N8ZB 4RMTA 2DQEH 4OFPA 1CVSC 4OSUH 5F1KC 3V0VA 3HNSH 4M8VA 5CJXC 3RZCD 4OZFA 2CH8A 5ADOL 1CCZA 4X5WB 4GMTH 1UWEL 4WEMB 1PKQA 4M61A 5K9QI 4MJ4A 1JK8B 1FNLA 2KBGA 4YHOL 2D7TH 5FF6A 2ATKB 3SN6N 1KACB 3K4AA 4KZEL 4L4VE 2J8HA 1QBLL 4GH7B 1JRHL 3O2WL 1YNLH 4MQXD 3HG1A 3E6HA 3F58H 4P46D 1CFSB 2BHUA 5GPRA 2HVJB 4CNIA 1MH5B 3PXJA 2P8PA 5A2FA 5D9SB 5MI0C 1UYWL 2X4PB 4L9LA 3RPIA 5DRWB 4UTAL 2JK5A 1GZPB 1Q0YH 1RQ5A 2Y9RT 4J3UA 1NLDH 2LTQB 5AZEL 2H8PB 3D1MC 1J86A 3FN0L 3O9WA 1EV2E 3P4LA 4KI5E 3MO1A 4MNQB 5IT2L 2IQ9L 3VU2A 1KNOB 2DLGA 1WUNT 4DZBA 3HZYB 3OKNA 5B22A 4WIQA 1IE5A 2Y06H 1R5WA 3NZHH 5HGDA 3PL6D 3MSPA 2H3NA 2H9GB 1MREH 4ZSOB 2BCKA 1FZKA 1MFCH 4O5LH 5A40E 4PJXB 5C6TH 2R0KH 4XBGA 1FO0H 2V7NB 4UT6H 4M6OH 3O2VH 4JFZL 5I16B 2Q7YA 3HPJB 5DJ8A 3C87A 4ZPTB 3BPCB 4XNMB 1ORQB 1T5XA 1HOCB 1DJSA 2BXYA 1S7RA 4AENB 1TJIH 5E03A 4MCZA 3VFWA 1QBAA 2F54B 4HMCA 5FIEA 4BJLA 3MLRL 1KENL 1FZOB 4HC1H 3MRBA 4ZD3L 2R1WB 1UEYA 1J10A 3ROLB 1C5DB 4YDVA 4I9WE 1H0DA 4CVZB 3E8UH 4R90H 1DSFL 2DQCL 2CO7B 3QEHA 3KLHC 1E28B 4WHCA 4ZFFA 5EIQA 4Z18A 4RMQA 3KPSA 4PJXF 1I7TB 2VXSL 5IIEA 4Z0BH 1NUNB 4YDLB 1UM5H 3IDXH 1OCWH 5CD3B 5CEYB 4M48H 4JFXB 1IBGL 2BVPA 1DDHA 5C08B 4FFYH 4U6YA 3ZKMC 4MJ5A 3K4DA 4LL9A 1N2RB 2VE6B 2D2OA 3HC3L 4UQ3B 1AD9B 4KTYA 2O61A 1ZOXA 4OZIB 4LRNH 4X99A 4JZJC 5HI4C 4KDVA 2EC8A 4XI5D 4KI5D 1N7MH 2GI7A 1MCJA 1TQCB 4IRSA 2NCMA 3HCVB 1JWMA 1OY3B 1FNSH 3WFDL 4A6YH 4F57L 1VENA 2A73B 3LD8B 4JDZB 2YRPA 3PWPA 4YXKL 1UZ6E 5CJQH 3DSFH 3BIBX 5E94A 1A3LL 4RWYH 4NQEE 2ICEA 2ZJSH 4OD1L 5EULV 4ERSH 3P9WB 3ARGA 4J4PC 3ULSA 5FYJU 5E2TH 4PRPB 3ZKNC 3BX7C 2AK1H 3RY4A 3NAAH 1H5BA 4HEME 3RVVC 3JV6A 4F37F 5KSAC 4TVSa 5F7UA 1U3HC 2QQKH 4IRJC 1FPTH 4P2QA 3VFMA 4Y5XC 1PLGH 2A6KA 1T0MB 3V5DB 4LHUB 3AU1B 1DVFD 5HJ3B 4JFFA 1LK2A 3BDXA 5JDJA 4HUXA 4WWKB 4I9WD 1GIGL 2DQHL 4HJJL 2VXQH 3MV01 3V0AC 1HCVA 1GRWA 1XF5A 3C5ZD 4G6JH 4PP1D 2UZXB 3T3MF 4MD5A 4BKLB 4DKFL 2Y5TA 1FN4A 1GOFA 4X98A 2A6DA 1RIUL 2X4QB 4KJQC 4N0YL 1V5JA 1U8OA 3QEGH 3I02B 4X4XA 3H7BA 1QRNE 1B0WA 3VG9B 3IXAB 5HHNA 4BSVA 1M7IA 2O26U 4YHYC 4Y5YA 1MWAL 3MRFA 2DLFL 3FT4A 2RAMA 4FQQB 4CMHB 3QEQB 4C83B 2JIXA 1I1FB 4HCRH 3QRGH 3TBSB 3FFCE 1HXMA 1KT2A 4PV8A 4EN3B 4MA1B 3IYLW 3FB7A 3C60B 1FG9C 5LGJB 3PP3K 3WFHA 2DD8H 2H2SD 5BCAA 4XP9L 1YNKL 4R3SB 2VDOH 1PZUB 1AD0A 5DMYA 3LMJH 3DGCR 3MLZL 3SDCB 3EOAA 4JO2L 4FHBD 3Q1SL 5BV7B 1TLKA 2QR0A 3QUYA 4AIZB 3NFNB 4FQ1H 4AQOA 4GG8B 3BW9B 4WO4C 2G9HB 2A6JA 5DQDH 2L7UA 1ZHNA 5DJYB 4OAWB 1A6VH 4F33A 2QBWA 2DKSA 4GKOA 4PRIE 1CICB 1FAIL 5IW3A 4G6FB 3L3JA 2B0SH 4K7FB 2X10A 1MCEA 5EO9B 4U1MA 2X2YA 2FB4L 1OAUH 1AGDB 3BN9C 3RKDC 1R0AH 3G6JF 5I74C 2VR5A 4LPCA 2GTZB 3UJJH 5ICYA 5HHVH 4PTTB 3VXNB 3C2AH 4N9OB 2OP4H 4Y19A 2EC9T 5E8NA 4X7FC 4FQ2L 4MQ7B 4H26B 1M7DA 2X89A 4OI9A 2GW5A 2IH1B 3SDDA 3SGJC 3IDJA 2LVEA 5F72S 5AYUL 5I1EL 4ONFL 2G5BA 2WWMD 2R29L 3CLEL 3PDGA 4NHCH 2BOBA 2VL5A 1MY7A 4OQ1A 5D93B 4ODUA 4U6HB 4PJEB 1URLA 1P1ZA 2C4FT 4PJ8A 1NBYB 4J3XA 3U48A 2AJVL 3DSNA 4I2XB 3D85B 1U42A 3MRMB 1QRND 2HFEA 4XPGL 2Y4SA 4J12A 5T1LA 2HP4A 2BY0A 2VXUH 1TTFA 5I1CL 4PRAA 4NHUA 5L0QB 3GJFH 1L7IL 4CJ0A 3RBSA 1P4LB 5JR1L 3U30C 4J6RH 1ZK9A 3FFCD 4HGWB 4NO3B 1INDH 1MIML 1GGUA 1JGEA 1RU9H 3JV0A 1XH3B 4OZHA 1CFVL 5SWQA 1AC0A 2DJ4A 4QRUB 4PJEF 1T1XA 5FGCE 4LQFL 3TN0B 4HUKB 4IOFC 5JZ7D 5GS2D 5I8EA 2BSED 1MPAH 3DVGA 5EBMB 4RFOL 4XCEB 2H2PC 1KG0B 1YEHH 1X5ZA 5FA4A 1RZFL 3DLQR 1ZGLA 1MCNA 2NNAA 4Y2DB 5EZLA 3MA7A 5IMMB 1FGVL 3MBXH 5GS1C 4XNQA 3QFDA 4S1DC 4EVNA 2DQFA 4RGNB 4D0DA 4PRID 5GZNC 5I8KL 3SDAD 4ENED 3QDME 3MLTA 5I2IA 5FYLE 3ILPA 3DRQA 5D1XC 4ELKB 1NBZB 2OM5A 5EB9A 3MNZA 4FQXD 4LHUG 1ADQA 1FIGH 5TF1H 1GC1C 4HQQL 4KMTL 3S4SA 1U0QA 3L1OH 5DZNA 4JY5H 3S34H 1UENA 3MR9B 3BGFB 4P49A 4RISH 4Z77A 2P49B 3OGOE 2UUDK 4JFEB 1BJMA 4M7LT 1JMZA 4KU1A 2YSSB 3P9LA 3BN3B 4HUUA 5T5NF 1Q72H 3HMWL 1KLUB 3Q2CA 3ZE1E 2MWCA 4N8VG 1ZSDA 2CO6B 5FOBB 5CZVL 1VGEL 2X4NB 3CZFB 5EBLB 1WV7T 4HMEA 4HXAH 2VNCA 4LKCA 4XC3H 2LQRA 1UACL 1NCAH 5D7IE 1INQB 1C16B 4WW2C 4OJFH 4TUJB 3UZQA 1B3JA 3OJDA 5TDOB 2DTSA 2J8UB 2PYEE 1SY6A 1K4CA 4LLMA 4B7LA 4JZOB 2DLEA 3N1FC 3CDGA 4XNUL 3SE8H 4JVPA 5K9KB 4I8DA 1I9IH 2WINB 4LSTH 4NGHL 3MBEB 4KRNA 4ODXA 4EEEA 3FB5A 2QQLL 4L4TD 1WC7A 2HJKB 4YH6A 1I1AB 4BQ8A 2XG5A 3CMOL 3ORJA 4R4NC 3HPLB 3ZHLA 5BV7L 3QPXH 4OLWH 4G7VL 3K8LA 3V8OA 1FCCA 2HN7B 2NTFA 4RBPK 5F1NA 5I76B 1X5GA 2Q6WB 2J8UF 5SWZE 2YPVL 2EH8H 2BMKB 5EFIA 2EH7L 3KS0J 4JQXC 4K7PY 3VD7A 3ARBB 4FQIL 5BS0E 2Z31A 4BFIA 3VXTA 1JNHB 3RVWD 5C3TA 1OSPL 5LXGH 2N1KA 1FC2D 4OF5A 1LO3L 1R24B 2D9QB 3GMLA 4E5XA 1A14L 3I85A 4OCSH 4QCIA 3KJ4C 4XCCH 2XN9A 1ZT7B 1JL8A 3GRWA 5KG9A 1YYLL 5DI8B 5ICZA 2R4RL 5MP6H 3QDGE 4G8EB 3DTXA 1J1OL 4LIQL 6CGTA 5HI3D 2V2WB 3IU3B 3VRIA 1U8HB 5IB3A 2WUBL 4FTVB 5T3ZE 3ALPA 4KK8D 2Q8BL 2FECL 4MZ3A 4QTIL 1QQDA 3S36L 1NMCB 2DKMA 3ARZA 4FNLL 5CSGA 4UINL 1FZMA 4R9HA 1MRDL 4K8RL 4Y1AA 3DX6A 1BLNA 1YMMA 1MJJB 1OF2B 4YBLC 1FIEA 2Y23A 3TNMA 2PXYA 4G42A 3QXTA 5E8PA 4HS8H 5D1QC 2WW8A 4P5KA 2PYED 2EO9A 3ARDB 1J1XL 2XWTA 2APBA 4NWUH 1QFUH 1MCDA 4RIRB 4OGAD 4OCMC 3QPQD 5I1AA 5EO0B 3TCLB 4GO6B 5FUOL 1NEZG 5KZCB 4HK0B 2P24B 5JHDE 2YHGA 3QWQB 1TTUA 2JB6A 2ZCLH 1JVKA 1VB9A 3CZJA 2XXMB 4MJIE 4WU7B 5C0DA 3SO5A 1UQSB 5JUEH 5CBEA 1F4WL 2VUYA 3WYRA 1ROWA 1RHHB 1AGBB 3NABH 3GO1H 3ELAT 3ZYIA 3B6SB 3KLAA 3EYUH 1G7MA 1LE5A 5KJRH 3FN3A 4QRRE 3C9NB 5E95B 2FJGB 3KWWB 2IAMC 5SWZD 3SDXE 3OB0H 4H88L 5BS0D 1DQLH 1CE1L 2V2XA 4XCYA 1YDPB 1UB5A 2EDOA 5DMGC 5GSVA 2CLZA 2PTTB 5I6XC 1T7XA 5HYJE 1NKRA 4M02A 1BF2A 1EGJL 3LOWA 1FAKT 1M4KA 1V7ML 3NN8A 4WW1B 3FO9B 1RIHH 2FLRT 3GSOA 3VFRB 2GITB 4MNGE 2ADGB 3B9KB 3QXDB 1VACA 4EDWH 4PJ9B 4WUUB 4YHNA 2F8OA 3IFLL 5BRZE 1NC4A 4S1RL 4KROD 1JZ5A 4YHIA 5HHPB 4NN5B 2XICA 5DRNB 5FO8A 3FCTA 1EJ6A 4UNUA 2NW2A 5ACMA 3ZHKA 4ZTOL 1CXKA 4LEOB 1X6NA 1NMAL 3L3HA 5T3ZD 3J7HA 4KJYB 1RK0B 3MNVA 5K93A 3NIDE 4YZFF 3EYVA 3FMGH 4JO4H 1KEGH 4L8SA 4O4YL 4JHAH 5CBAA 1CD0A 4RFEA 5D5ME 5E8EA 1SBSH 2IH3A 5DA0B 3UYOD 4RMSA 1GZQB 5FV2A 4G43B 1NGWB 1OD9A 3W5MA 1SJHA 4MJ6A 2A74B 2W60A 3KLDA 3FO2B 1U6AH 2DQJH 3NCJL 1TITA 3QI9A 1FL6B 3DBXA 4HFWB 4JKLA 3RU8L 5L6YH 2YD1A 1OTTD 5AG9A 1JHTA 3OKEA 1ZLSL 3MCKA 3PHOB 43C9B 3LCYA 3FRPA 4D9LH 5JHDD 1Y18A 1MFBH 5CJOL 3LRSA 4DW2H 1N64H 2XRAL 4P9HH 1HILB 3F8UB 5GJSH 3VFNB 5JIIA 2LAAA 3SE9H 1ZA3A 1ZT4B 3MRRA 3ARYA 5T3XH 3ZMRA 3ZKXB 4MXWL 2YBRB 2W0KA 1JN6A 2HVKB 3QUYC 5GGRA 3BMWA 4RGOL 3S3JA 4XP4L 4QHUA 2VR4A 4Z0XB 5SV3A 4HUWA 4M4PA 2O5YH 3O2DL 2ICWA 1G6VK 2VDLL 4I77L 5ESQB 4EDXB 3F12B 3X3FL 3TV3H 4QRRD 1C7SA 1H3PL 2GJZB 4S2SB 4UV4L 2CUHA 2HYMA 4Z5RA 1NAMB 3S96A 1WEJH 4XAWL 1Y6MR 5B39A 1WWWX 1Z5LB 3MLVH 3VGDA 3KPSD 3ZE2F 4FZEL 5EZOH 5F6IB 2VXVH 4IIQB 3QUZD 2JJUA 4KUCD 1BVZA 5EA0H 4I3RL 1FLTX 2JB5L 3BP6B 3D39E 4PY7A 5IHZA 5BRZD 2ESVA 5CSZB 4AEIH 1BQHA 1YY8B 1JBJA 2YRZA 5FHBH 2FEDD 3EDEA 5ESAB 3TO2B 4NPYA 4XPAL 2OMNA 3SDDC 1N5YH 4KKAD 1JNLH 5I8CA 4QGYA 3LSOB 3T1WA 3QIUA 2KH2B 2VXTL 3P4OB 4AEHH 2VDQH 5K9JL 3Q5OA 2Y1VA 5KTEH 3E0GA 2BVYA 2YK1L 4BELD 1MI5B 1KPUB 5HVHC 5HHOE 1U58A 3AREC 2VLKA 4P5TD 2L0DA 3QZWA 5EZIL 1H3WM 4HW6A 5J0BA 5TE4L 4IRSD 3DHMA 4AZ8A 4QKXB 1N59A 3BUTA 5E9DE 2CR6A 3VFOA 2JJSA 2B4CH 3PWPD 1SMOA 4OKVB 2VDRH 3T0EE 4MSWA 2NYYD 1EJOL 5DK3A 3TJHC 4ISVB 1KGCE 2D03H 3RUGA 3CXHK 4LF3A 5E56A 3QDJB 3ARGD 3ZE0F 1MHEA 3ZYOA 3UXFA 2VWEE 3QA3A 2HRPH 5AD0A 2CLRB 5IR1A 4LCWE 3TFKC 2FR4B 2ZSVA 4LPTA 1LO0L 3D18A 2ZG1A 5ADOH 2I9LA 3QQ4A 3EOBA 1MVUB 1JZ3A 1UWEH 1PAMA 3BQUC 3WL9B 4TTDC 2P43B 3WKML 5SX5H 4FXKB 2DKUA 1BZ7B 4UDUB 1AO7E 2AXGB 3FRUA 3V6OC 4QO1A 3VCLB 1LO4L 3QNXA 4PBWD 4JKWA 4KZEH 3EO0A 3TH4T 1QBLH 5EUOE 4L4VB 3WFBL 1JRHH 3O2WH 4N8CL 5FCUL 1XF2A 3L3OB 3CCHB 3GIVA 1UYWH 2V6HA 4UTAH 5AZEH 5CP7B 1CF8L 2VJXA 3D39D 3OKLB 2HTLC 4HUNB 5IT2H 4M1CD 1FVDB 2FL5A 2XI9A 1PKOA 3D3VE 4OCXL 1YJDL 3D69B 2VZVA 2Z92A 5E6ID 4S0TD 4N5EC 5M94B 3M8OH 4PJCA 5EN2B 4OI8A 4OCWL 5IF0B 2XPGA 4TOYH 3BPOC 3TO4C 3PWLA 1CGYA 1L4IA 2X1OA 3TJEL 1MRCL 4PP2B 4UTBL 5HHOD 5KS9E 3ULUD 1BD2B 4IS6B 3G6DL 3ZYJA 4JFZH 3FQRA 4MB4A 1FFOA 1UXSA 1B0GB 1SJEB 3UC0L 1XR8B 1DBBL 2Z9TA 4Z7UE 3MLRH 5I1GH 1IVLA 2BNUA 4ZD3H 1U36A 3NA9H 3T0ED 1RZGB 1RMFL 3OG6B 3HZVA 3RGVA 2PO6B 5JW4M 1KGCD 1U8MB 5D1ZD 1DSFH 3KPNB 4XXDA 1MCKA 5E7BA 4OV5A 2VRAA 3HE7B 4NQDA 1DUYB 2NX5E 1RULH 3L9RA 2C5DC 2P7TB 2OQJA 5CMAB 5LQBL 4BZ1L 4YR6B 1UC6A 1X5JA 2XTLA 5F3HB 2VXSH 4UT7H 4XX1E 4M6ML 1RJLA 1MRFL 1BVLA 2F9BT 1P53A 3EDFA 3GJFA 3TVMB 4WI4A 1NAML 1IBGH 4HX1B 1AO7D 3O6FB 3NCYP 4OM1L 5BOZG 4NRXA 3TZVC 1EFQA 4G9FA 5DHXB 1W2KT 2CK2A 3V5HB 4PGCB 4D0CB 4RNRB 5EU6A 2VKXA 2A38A 3HC3H 4PJ8D 5DS8A 2ITDA 1JWUA 3GSRB 3MRLB 2WBWB 1W72L 2DN7A 5HY9B 1KJ2B 3BPLB 5T1LD 1G6RB 2EYTA 4K94L 5CEXA 2XWJB 4D9RD 2FX9L 3RWJB 3WFDH 3T77A 3TA3B 5A43C 4O2FB 5DSCA 4PJDA 3PQYA 5IMLA 2R2EA 1UEMA 3HAEB 4DTGL 1MNUL 4H0GA 3L5WB 4OD3L 4KK9D 4WWID 1EBPA 4OD1H 4NZTL 4POYA 4NQEB 1RIVL 5CZXD 5C0GA 4G5ZH 3PABA 3DVNB 2P47B 3DHJA 2BSSB 1CQYA 5KN5A 3G08B 2GK0A 1CL7I 2C7UA 4KRPD 4F7CB 4PGJA 1SYVB 5C0CA 5CKAA