1NGPH

N1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3-nitrophenyl) acetate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
215
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of the Fab fragment of murine N1G9 antibody from the primary immune response and of its complex with (4-hydroxy-3-nitrophenyl)acetate.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords N1G9 (IGG1-LAMBDA)
total genus 39
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 1995-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH02
1BF8A 4JB9H 2P7TA 4F15B 3LEVH 4HKJB 5TE4H 2GKIA 1NCDL 5DI8A 1A6WH 3ZE0E 3GMOA 1Z3GH 2VERN 5B39G 3NIFF 5DO2D 3R4DA 3HR6A 3ARBB 5DD5H 1D5ZB 3QULA 5JUEH 5D93C 4F9LA 3ABZA 4MD0B 3SO5A 2MNUA 3D39A 2NNAB 2UYLB 2VXQH 3VA6A 3WXWL 4L9LA 1XGQB 2Z31A 4J8RB 4RISH 1H15B 5MENA 4V1DB 5D71H 1WCBB 1JPTH 3ORJA 2B4CC 5D7SH 5GGUB 3HN3A 5LWYL 4OF0A 2ESVB 1D6EA 4E41D 4LCCC 4OFDA 1YNLH 1QSZA 4OFPA 5EORL 1DVFB 4P46B 3OXRA 3CDCA 4MXQD 5ACZA 1VENA 4KAQH 5J6HB 1N6QL 5C8JB 2E6PA 2DLEA 4LSPH 4XNMB 2DQFB 5T1DH 3ULUL 4RIRA 4JKKA 5I8EA 3VE0B 1T83A 3VWKC 2WP3O 1UM6L 1JNHB 1T0NA 1I1AA 3ARWA 4CVXB 4P2OC 2DQCH 2LABA 3OJDA 1H8OA 3WJLC 5I73B 2JELH 4HCRH 4LBEA 5EIVA 1FL6B 3NIGF 2XTJE 3T3MF 5I15L 1FO0A 1MJJB 5IWLA 4GQ9L 4KK8C 3K8MA 1R3KB 3I6KB 4FQIL 4ZSOA 4N1EA 3MNVA 3WUZA 2HJFB 4UB0H 4HK3N 1X5AA 1TJHH 1MAMH 4L3CB 2V9TA 2C4FU 3IDIB 5CZXC 3TBYB 1D5IL 3LS4H 4ISVA 2ZOKA 4L5FH 4OGAD 2DTML 3LPWA 5BJTA 3MJ7A 2J7LA 1RZJH 2VL4A 2H2SD 1UACL 3BDYH 4AIZB 5BXFA 4UAOC 3JWOH 4PYGA 5JOEA 2HFTA 2F19H 3SDDC 3BO8A 5C0JB 3HRZB 3MLRH 4GAJH 3JWDH 4HJJH 1BM3H 1NDGB 1CDBA 2YPVL 2MCG1 1SY6L 1UM5H 5FO9B 1EH9A 2FD6L 1J1OL 4FQ2H 1T03L 2VDRL 2DM7A 2ATKB 4OZIB 1KLGB 1AFVL 3GBML 3TBYA 4U1LA 5E7FA 3ZL4H 1AIFA 3VD3A 4HWNA 2EDFA 4JDZA 1FH5H 1N3NA 1RIHH 2DJ4A 1IL1A 1I85A 2PYFB 3NFNA 4TUKH 5I8KH 4QRPB 4U1JB 2VXQL 4P5TC 1OTUC 4Z77B 4M6AA 2QQNH 1H0DB 2A1WH 4LRIA 3I6LE 4GSDL 5EU5A 3VXPB 5GGSA 2VR4A 5FM8A 1U8IB 3BP6A 1HXYB 1OAUL 4WFFE 1J5OL 2E8YA 3MBEA 3O8XA 4KDWA 5E8DL 1L7IH 1T04A 1MLCB 4HC1L 4WEBH 3TA3C 2ARJQ 1MCWW 1NFIB 3IGAA 5HPMB 2YA2A 1B2WL 4BM7A 3LZFH 2D7PA 4UV7H 5LXGL 7CGTA 1UADC 5HDQH 5FYJE 3MUHL 1S7SA 1IEAA 5F7WC 2G2RA 2GK0A 5SWZD 5JXEA 4OCNC 4MSWA 1UH3A 1P84J 3A0OA 3ULUF 4X6CF 1NBYA 2CGRH 3EAKA 3WNPA 5IVXF 1WWCA 3MROA 1D9KC 4J8RA 4OTXL 4C83B 2BCKB 1ZHKB 2GW5A 4DEPB 4L9LB 1HHHA 2AJUH 4PB0H 1A5FL 4JZJA 1YZZA 4P23A 4ZODA 3TF7C 1ZA6A 2OK0L 4HIXH 1CFTB 1NSNH 5IFJA 5DJXA 5D7JB 3SKNA 2W9DL 2OMBA 4X6FB 3FT4B 1DP0A 3RL2B 4LAQH 2M26A 3MBXL 4P9ML 5KJRH 5MI0B 4MNQB 1KLGA 3WMSA 1MEXH 2XZCL 4UBDD 3UBXB 5J89A 1W72H 4FFVC 5DJCB 3VXUE 1IAOB 2HTKD 4L5FL 2GTWB 2BC4B 4LQFH 1NBZA 4LCWA 5SWSB 5IW1A 4AJ0A 2AV1B 3ELAT 3OKMB 2EE6A 5K9JL 4KI1A 1DQJB 2R69L 1YEIH 4HEME 3T0WA 1EEUA 2BRRH 2BY0A 1MAJA 1W0YT 3KYNA 4JM2F 4PLKC 1KCVH 1NUDA 3T0VA 1MWAL 2ZCKH 5D1QC 1JWUA 3BPOB 5KOVC 4F33B 4QRSA 2IC2A 1FNLA 2Q3ZA 4D8PB 4YNYB 1P4IH 4LSQH 5I19H 4P0DA 3WIHH 4P4RA 4NCC2 1ZV5A 3B4NA 1TVHB 4HXAL 3QG6A 4WV1C 5IHUH 1UENA 3FFDB 4H5SB 3I6KA 1WAAA 1G6RB 2Y06H 3INUL 4G6JL 5L2KA 1F90L 3DYOA 3QEUA 3OGCB 3SY0A 4PJIF 3WJJC 2OZ4H 1T80A 1HSBB 2AI0L 5GGTA 1FZOB 3C8HA 3HMWH 3RDTC 3KNBB 3EO9L 3QXAB 1I7ZA 1QP1A 5IOPA 1YEFL 1C5CH 5DC9B 3FB5B 1FL5A 3O2DA 5KSBB 4ZTPL 4CNIA 1Q0YH 4G6KH 5IROC 4KKNA 5IBTH 1WSST 4OLVL 3T09A 5T1MB 1QBLH 4O51A 4YWGL 4HFWB 5DJAB 1UVQA 1JUFB 3QXWA 3TIEB 3WLBA 3JWOC 3MV8A 1JNNL 4OZFG 3LPFA 3V5HB 2CLVB 3IU3A 3GDBA 3IJSB 4HEPG 3LKPA 2Z92A 4Y4KD 2OR8A 3FHAA 4PJ5B 3KWWB 3ULUC 5CGYC 2PYEE 4FP8H 1U58B 4G9FA 4GRWF 4MD0A 1Y6KR 4M6MH 1MCHA 5LGJB 2X1XR 3L7FA 1VFBB 5DQJB 3L3KB 4POZC 2VDPH 2I07A 1A6TB 2P5WA 1EHLL 3M07A 1LE5B 3CVHH 4DGYL 3QH3A 2VMFA 2WUCH 3MFGB 3D0LA 5TF0A 15C8H 1B88A 3CFJB 5DJ2A 2XKUA 4Y5VC 4PGJA 1IGCH 1S5HB 3MA7A 3T0BA 3JVGA 5HGAA 5FOBB 3NIDF 1FORH 5HHMB 1INDH 4PJ9A 3L3HB 3ZKQD 5F8RC 2IAMA 1F3JA 4G3YH 5E2WL 1LO5B 4ZUUB 4BZ2H 2D4DA 1GHFH 5F9JB 3GSUB 3D2UA 3QQNA 5EFIB 2VLJB 4PV8A 3WS3B 1VKXB 1S78D 1OP3H 2V5SA 3BE1L 1IQDB 4Y8AA 4P2QA 3X11B 1CXHA 2YMXL 2FEDD 1NUNB 2W91A 4HX1B 4NFDA 4NQUA 1MFEH 4I4WA 4PG2A 5I1CH 3W82A 2F53D 1RJLA 3QWOA 5L9DL 1TTFA 2H26B 1F4XL 2YPKB 4U0QB 2FO4A 3TN0B 2MPAL 2OZ4L 4LSTH 4YEEA 4APQA 1TQCC 4K94C 4M48H 5CIPB 4HH9A 5IUSA 3KPSE 3SKOB 4FTVA 4G43B 3E6FB 4XCCL 5KOMC 2UY7A 5JHDA 4GRWE 3VXMD 3UAJC 2UV3A 5HHOA 1MIEL 5EC1A 3D25A 5I8OH 1KCSH 1ZHLB 4DK6A 4XCFL 4DVBA 3GHBH 1YMMA 4J2XA 2JJVA 3ULUD 3KLDA 3WHXA 5ACMA 1UWGH 4N0FB 1IEHA 2ARJA 3BP4B 3EZJB 3PV6B 4X4XB 1JZ2A 1WIPA 3PL6D 1R3IL 4XCFH 2CUMA 4XPBL 5FYKL 3CMOH 2P24A 3SDDD 4LQ1A 1HKLH 1V3MA 4XCYB 1A7OL 3CFIC 1G9MC 2DWEA 3HKFA 3KYKL 2RFXA 1J0JA 4X83A 5F1NA 1YPZB 4PS4L 2YWZA 2EKSA 1A3QA 5B8CC 4QEGA 2O5XL 2BVQB 1HZHH 5JA8B 2NXYC 1NCBH 3QEHB 3H6JA 4N5ED 4WW1B 1DVFD 3SDAD 1EXUB 1UKQA 5SX5H 1CT8A 4LGRB 4RMQA 5IVZA 3ZYJA 4C58B 4OQ1A 3VJ6A 4FQJL 1EV2E 4R4FH 2J8UF 2GSGB 4JY6A 4H0HB 1MY7A 2BNQD 1SYVA 3D1MC 4PJ8B 5F1NB 4WGVB 1EEYB 4OLYH 3CDFA 1VADA 5E8OA 4BFEA 4Z7NE 5D2LB 1WK0A 3WS6A 1V5JA 1FORL 5CILL 3P4LA 4Z76A 2DQIL 4Q58C 1ZEAH 2EYTA 3RVWC 4TQEL 4X9IA 5MENE 1FIEA 3K3QA 4IMLB 5DGQA 3C60B 3KYMA 1RUAL 4MS8C 2R0WL 2XZZA 2A77L 1IM9B 4NO2B 1NKOA 5DUPH 2BOCA 1V7MH 5D6DA 1RUPH 2Y1VA 2XWJB 4X9FA 2N7AA 2X1PA 2J88L 4X7SL 5FHAL 3WO4B 4APQB 4FFWC 1YUHA 1CF8H 4KMLB 3EOBB 1V8HA 3QRGL 1KCRL 1LEGA 4HX1A 4GSDH 3FO9A 4K07A 2A6DB 3BYYA 5EZOH 1MFDL 1B0GB 3I2CL 2DQDH 2YEZA 2V2WA 1OAXH 2JLLA 4HLZH 4O58L 1YEGH 2GUOA 4YHML 1F11A 3Q5YA 5BVPL 5IB2A 1UQSB 3SE3C 4IIQB 1RZKH 4Y2DA 1JHKH 1KN2L 2CK2A 4D0DB 4M6OH 4OD1L 3HPLA 3ARRA 4QOKE 4K7PH 1Z5LA 4LLWA 3ZKXC 3N9GH 3B9AA 2ZG3A 2OTUA 4XWGL 5T3XH 1KIRA 1INQA 3WXVL 3KJ6L 5A16B 2DM4A 5EUOA 1LP9E 2ILLA 3HI6H 5F9OH 1JPFB 2EDDA 2ZUWA 1WZ1L 3HPJA 2D9QB 2PR4H 5TDNA 2Z91A 1PLGH 2IJ0C 1QBML 3MV7A 6FABH 5DEZA 4X5WA 4DZ8B 5JNYB 4R97B 4ALAH 5JHDE 4M1GL 1Q38A 4EXPX 5IMKB 4PJEF 2F54E 1RJZA 1W72A 4LVOC 2V7NB 2IH3B 1J1PL 3FTGB 4P2RB 2HT4D 3UBXG 3TO4A 4ODWB 3MODL 4NN6B 2Q86B 2VLRE 3IKKA 4ZYKB 3WFEH 3TVMC 5T3XE 1UVQB 2D7NA 1KNOB 2Z8SA 2VITA 4EZMA 5B39B 1FFPB 4LHJB 1QO3A 4PRBA 2DRUA 5L0QC 4Z95L 3UPRB 1A6VH 2Y5TA 1DANT 1MPAL 5ADPL 3F7RA 3TBTA 1DFBH 1CDIA 4XCEB 3P40A 3C60D 5BZDB 4GMTH 3ZT6A 1JYWA 1NGXB 4OKVA 3NH7H 4NNXB 1T7XA 3GKZA 4Y2OA 4NT6A 4N90E 3CC5A 3AM8C 4L4VD 3ROOA 3HG1A 3RL1B 4GKOA 1BECA 2JK5B 4JE4B 4ZUTB 4KK9D 4G7YL 1MCJA 3HR5A 1G6RA 4UQ3A 4NP4H 1QG3A 3TZVD 4RAUA 5FKAA 1OF2A 4JY5L 4HJJL 4I13B 2AKRB 4Y4FC 3O4LE 5CAYB 2PETA 5DJDA 1J8HB 2COQA 5E6YA 5C08A 5HYQA 1ETZA 4GBXD 1AC6A 4V2CB 4GW4B 1MFAL 1LE9A 2LFGA 4OI7A 1VSCA 3RNQA 3UYRH 2FH8A 5GS2D 3SOBH 1ITCA 3WKNA 4S1DC 3DYMA 1G1CA 3RNQB 5IVXB 1BVLA 3DPBA 3P30H 1I3UA 4NQVB 3N85L 2W9LA 4OZIF 1QEWA 3QXVA 1WT5C 3OAUH 3TWCL 5C3LD 4Z78A 3MJ9L 1IFHH 3UJJL 5HYIA 5J7CC 4XMLL 3DSFH 2E9BA 1AGEB 3MRMA 1MOEA 3DX6B 2HTLD 1D5MA 1K4CA 2VOTA 3EZ8A 4HC1H 5DVLA 5BW7A 1T7ZA 1ZANH 3IFLH 3KPLA 5HDBE 5C0CB 4C57C 4ZTOL 3W9EA 4JFXA 3QUXA 4JZJB 1HYSC 1P4BH 3O11B 1A1MB 4PJGA 3RTQC 1MELA 1UWXH 3NCJH 5BZWB 2DD8H 1NGXA 2IGFL 3P0YH 5HHME 4XCEA 4YZFE 2ENSA 1HEZA 2CUHA 2IALA 4F7PB 1UZ8A 1CT8B 5AZEH 3KPMA 3LV3B 5DJYA 3EO1A 4HKZA 3U6RA 4Z0XB 1UB6B 3IFPB 4ZTOH 3NCYS 4ELMA 1L7TL 4CKVX 4KRPC 3U7WH 1T7YA 2IGFH 2ITDB 2P8PB 1HYRC 2ERJB 5D8JH 2Q3AA 5D1ZC 1I1AC 3QEQA 2VE6B 1GAFL 4JHAH 4CVWA 4LNRB 4LKCA 4NSKA 2VXSL 2YPVH 5IFHH 4HCRA 1P4BL 5C9JA 2BY1A 4YBLB 1ADQL 3WFCH 1FGVL 1FRGH 1MNUL 1WV7T 4OZ4A 5KVDH 2NY7H 1GC1C 2DLTA 1HDMA 1R5IB 2XICA 5CJXA 2DLGA 3S6CA 4DWHA 2ARJB 4PR5A 3VI3F 1OAZH 2Z91B 1DBJH 1TQCB 4XXCA 3KLAB 5I76B 1JV5A 4GRLC 4JRXE 1IL1B 5E6IA 5E6IC 1ZTXH 3D85A 3GM8A 1W72L 1WBYA 4U3HA 5F93C 2N4IA 4RGNE 3B9KD 1GJIA 3V52L 4P9HL 5D5ME 5EPMA 4JRYA 5JA9A 3TNMA 4KXZI 4CMMA 2YPKA 5MEQB 3VFPB 3G6JE 2IADB 3LKOA 3AS3A 5DMJB 3VXSA 1A6ZA 2GT9A 3QI9B 3ULSB 4YHIB 3HE6B 1RZKC 3RU8H 4MQSB 4OJFL 3PXJA 3SDCA 1RK1B 2FO1A 2JCCB 2HKFL 2DQIH 3BO8B 4HUUB 4RFNC 1BHGA 2OR7A 3O9WC 4JFDB 3G5XA 4YX2H 2Y9RT 3W39B 4MA3B 1KENH 4Y5VA 5EOQH 4LEXH 2Q20A 4TNVK 4G7YH 5H35B 4J3OC 3MRCA 1B6UA 5EOCJ 1UZ8B 1X5ZA 1IAKB 1NCWH 2HA1A 2IALB 2VXVL 4NWTL 1MLBB 4B53A 4TSBH 3ZE2E 3KPNA 5BO1L 3MRCB 5E70A 2APBA 4PUBH 1ZT1A 3BPCB 4HS6A 1A0QH 1IC1A 4Y0GA 4YHLH 1OP5H 2CRMA 3OKYA 4HPOL 1YMMD 3IJHA 4PJGB 3O4LA 2GTZB 3Q6FA 1EEZB 4Y16D 1QZ1A 3UTZB 3QXDA 1FN4B 3HNSL 4N8CL 4YFLF 1YEJL 3OZ9H 2E7BA 5HHOE 2P5WB 1U8HA 4GG8B 1ZGLB 4WEBL 3PL6A 1QFUH 4GMSH 4HZLA 4JFEA 3MQIA 4M8VA 4CU6A 3D69B 3RKDD 1QSED 3ALPA 1U8KA 1WFUA 1F02I 3ARFC 4MNHA 4XB7A 4R26L 4PP1C 5DHXB 3IFNH 1LILA 5I1HH 5E7BA 2WUBH 2EH7L 1JV5B 4XP6H 3BKJH 1DVFA 4MMXC 2XZQH 3ZKSD 2Q7YB 3MLWL 2J6EL 3VFVA 4U0RC 5B39A 5JW4Q 4HGKC 2BVUA 4W70A 4NGHL 4OZIE 4L29B 3UTTE 4ONFL 2X41A 4PG2C 5ANME 5SX4H 3UXFA 4OI8A 1HHKB 4ZAKC 1P7QA 3LHPH 4OV5B 1FPTH 5DLML 3U36A 1A7PH 5KS9A 3EOYG 4WDIB 5D6CA 4JREC 1FZKB 2EKSB 1NGPL 5C09B 1MFEL 4J6RL 3SCMA 3E2HC 3TA3A 3DECA 1AI1H 2PW1A 4HJGA 1MSPA 4YXKH 5HVWA 5JHLH 2WSKA 4NYLB 5BW7C 4XVSH 1IM9D 3S34H 4Z5RB 2IFFL 3EDEA 1X3DA 3TH3T 4MGXA 5CBAB 4ELME 3WN5C 1OAXL 1C5DA 1U9KA 3GBNL 5C92A 4KH2A 5GIRB 3RPIA 4AG4L 1M7IA 2V17H 5F7YC 1NPUA 4L8SC 1G9ML 2W9EH 2HFEA 1BZ9B 5EZIL 4YPGA 5TPWL 3VGBA 3L9RA 1RIUH 1C1EH 2FIKB 1F4YH 1EMTH 1OPGL 5DFVC 1RVFL 5HPOA 3V5KB 2HRPL 3OG4B 3AMLA 5F7EL 3X13B 1UWGL 4I2XE 4X7DC 3LKQB 5BCAA 4GAGH 2Y7QA 5CHNB 5KSUB 3MUGA 4U7KA 1CXIA 3BZEB 4PRAB 4XMPH 3EYUL 3IT8D 3EYFB 2ESVE 4X6FA 5D1XC 5FDYA 2X4RB 1G0DA 3AAZB 3LN4B 5BV7B 2B20A 1LO4H 4WO4D 2XWJA 1ZHNB 4PJ7F 1PKQB 2D31A 3GMMB 4EI5C 2FSEA 3E1F1 1NLBH 2KZWA 1ETZB 4BQ6A 1INQB 2Z8RA 3IXTA 3SGKA 2BVEA 5IB4B 3G9AB 5HI5C 3WHE1 1CDJA 5EU4A 4P5TB 1CVRA 4WJ5A 4QOKA 4LHUD 2RB8A 4PJ8D 1LP9F 4Z7VB 3LKRA 4ZPVB 4QHNA 4B0MM 3PWJA 5D5MA 3VGHA 4X9BA 3MRNA 1X4YA 4NDMA 4U6YB 1UEYA 1F11B 4HPYH 5KZCD 1AKJB 3E3QC 1UGNA 3VRJA 1VFBA 2BSTB 3OKLA 2PO6D 2D4FA 2I60L 4OZHA 4BH7B 4IEFB 3OAYK 3V4UH 5ICYB 3LCYA 3IS0X 4NBYB 1SYSA 5E00B 3WUWB 4ZOAA 3ARBD 4U6XA 4EIZC 2ZPKL 4Y1AD 1I1RA 4S1RH 1HHKA 4DGYH 2OQJA 1LHZA 3SEPA 4Q9RL 5D1XA 3R0MA 3V95A 3FONA 4GXVH 1U93A 2EDEA 4YHPA 4MLIA 3GUTB 4NNYB 5DD6B 1NANH 4JN1L 4OZGA 1T0PB 1DQML 4DEPC 4PGEA 4M6NH 3EJZC 2RR3A 4KTYA 2E6JA 5MHSD 3BKCL 4Q0XH 2ZUQB 4IOSD 1LO0H 1BD2A 1J8KA 2D7TH 1G7HA 3S36L 4AENA 4HWEL 3GSWA 3F65A 1NKRA 4WW2F 1MI5A 5CZXD 5L9DH 4DKDC 3WFBL 1KIQA 4XNUL 3WLWD 4OFKA 5E8OB 5J57B 1S9VA 4L8DA 3HAEH 2Y72A 3PGFH 3ILQD 1K4DB 4TVPD 1FGNH 5BVPH 4EN3B 3V6BR 1FNFA 2EZ0D 2L7UA 3V4PH 3GJFK 2DWDA 3WIFA 4CN1A 3WFBH 2DBLL 3SDCC 1BLNB 3DMMB 4D8PA 3TN0A 3QHFL 2ARWA 4ZQKB 1T1XB 1EO8H 5L6YH 1MLBA 4NO0B 4AEHH 2ZSWA 2ESVD 3WNMA 2FHBA 2GY5A 4M4PA 5E4EC 1C08B 2E7HA 4UTBH 5HHPB 4IRSA 3IAPA 4GKSB 4KROD 5E5MB 3OKMA 5FYKH 5IMOB 1K3ZA 1YY8B 5IW1B 5SWSA 4PY7B 3ZDYE 4P5TD 2BHUA 5HDQL 2BNRE 4UNVA 1N0LA 3UPAA 3SE9H 1LEGB 3CXHJ 3FB7B 2YS4A 4RGOH 1MWAH 3K7UA 3MYJB 1G7LB 1KJ2B 2KL6A 5DQDH 3T0EC 2HG5B 3TNMB 1RUAH 3QUXD 1EBAA 3V79C 2VLRB 4AEHL 5D7JA 5IFJB 1AKJD 4DVBB 5JZ7D 4EUPB 1MCNA 1R5VB 3C6LA 3V4UL 3EDFA 5CP3A 3MACH 3QUZD 1NCTA 3E6FA 3BEVB 1DQLH 3BMWA 3QG7L 3RY6A 3PNWB 3VFWB 3CX5K 5BRZE 1TETH 5CIPA 1GGCL 5D7IA 4E42A 2HLFC 5CJQH 2CJUL 5J9PB 3THML 4U6HA 1QRNA 3P4NA 2XG4A 3V8OA 1LP9B 2ICEA 4JG0H 3UJTL 2D7OA 2NNAA 4ZDHB 1AFVH 1PVHA 3GBMH 5C9JB 4QYOA 4OJFH 4JHBA 3AREB 4YDJB 5E9DB 2WIIA 5IBLC 5CSBA 4LLAA 4F7MA 4DZBA 5ESQB 2H41A 3RUGE 3TPKA 1PEWA 4P5KB 1CU4L 1KBGH 5F1KC 1OP3K 4ODUA 3OAYH 2CXGA 3RVUC 3QFJE 3SE4C 2X44D 4DUXA 3OB0H 3I6LD 5HYSB 3QPQC 1MF2H 3VFUB 3GSRB 5CMAA 3VXME 4I0CC 3B5TA 1AGDA 4R3SA 1U3JA 2UWEE 3V9FA 5EOTA 4UV4L 3IDJA 1I1YA 1TITA 3HUJE 1VGKA 3KG5A 5H37H 1OAZL 2NY2D 4YPJA 5L2JB 2I07B 1S7QB 5JW3L 4AQ1B 3HE6D 3TH4T 5IEKA 4P4KD 1OD7A 3DRTA 3I75A 1YN7B 1JPGA 4LU5L 1DEEB 4OQTL 4NC0B 3QISA 1R3LB 3PF2A 1RV6X 2R29L 4J23A 5I1IL 5IFHL 4JM2A 4PJ7A 5MEND 1PG7W 3WNOA 3MLXH 3TJHC 4TPRH 2QSQA 2ZUXA 5ETUA 5C6TH 3GB7B 4OD1H 4N0CC 4UDUB 1DUZB 4WI6A 4ZTPH 4OTXH 1Y0LB 3QXUA 1Z0MA 2BSSB 1WFOA 4XVTH 4KDTC 5E1AA 4FMFA 3HCVA 3GJEA 1NFDE 4XB8A 4RBPK 4G9FD 1I7RB 2VWEE 4YK4B 2XACC 3PWNA 4XX1G 1AO7E 1I7ZB 4ONFH 2P5WD 3QNZB 4I4WB 1E4XL 5JORA 4JO2L 1B9ZA 3QDAA 4WI3A 4FQ1L 1CDUA 4XNXH 4OFYD 4JFED 5F70A 1FL6A 3MXVH 2C3WA 3L3JA 3HZYA 3QIWA 32C2A 4RZCA 2ORBL 2IAMD 4OCLC 1S9XB 4RGMB 1J87A 2H32B 1CS6A 4MNQD 4P3WA 4UB0L 1RU9L 5HYSA 1NBYB 4PLJC 2CK0L 4OKVB 3ZE1E 2VLMD 3LIZH 3QFJA 1BJ1H 2FECL 3FRPA 1S5HA 3MA7B 4NO3A 2DQFA 5C8JA 1RY7B 1AY1H 2BDNH 1WIOA 1DQTA 5E9DD 1KJ3H 2XXCB 1IC7L 2ITCA 1U8NA 3QUYD 5C07E 4ODTH 1CFSA 4KJQD 4ZFOL 1T21B 4XP9H 1MCRA 1MEXL 9CGTA 2E27L 2QHRH 4U1HB 1P9MA 1EAPA 3T4AB 3ZKMC 5IG7B 1VFOA 1NFIA 3A6CL 3UBXA 4TN9A 5JHDD 2SEBB 4NM4L 3UMTA 1A7QL 3MNWB 1XGQA 2Z31B 5T1LA 3TBWA 4BA8A 2DI7A 2X4SB 2P5EA 2R2BA 4HWZB 1A02N 4JFPB 3HZVB 4N90D 3FOLB 3BP7B 1OARH 3MGTA 5L88H 1KB5L 4PJ5D 5GISL 2XWBA 3BPNB 5ID1B 3U82B 2DQEL 2X9YA 3SQBA 3HMXL 4NO3B 3SDDA 4P23C 2XPGB 5K9QG 4U2ZA 4IM8A 5GGVH 3CUPB 4C56D 2FHFA 4B7LA 5K9QI 5DRWA 5HHVL 4Z8FH 3CZJA 4P5KA 2F74B 2GK0B 2AGJL 4HUKB 4L3EE 5FUCC 4X6CE 3WFZA 3H9HA 4MXWL 2C5DC 4KROC 1HQ4B 2GFBA 3P9MA 4KK9C 4G6AC 5I6XB 4IRSB 4KHTL 1X6LA 1CK0L 3RWHA 3OKNB 4F15C 2ZSWB 4U6HB 4QCIA 4AIOA 2VDML 4AT6B 4ZXBA 1INEH 5JXED 2E3VA 5TPWH 1HXYA 4HJ0C 2A1WL 1HK6A 3IS1X 5BOPA 5IW6B 4KVNL 3RI5K 5LKNA 4G5ZL 3RWEB 4FQHA 5D7IF 3GBNH 5IB3B 4X4ZA 3FQWA 3FAXA 2ADJA 4ONOA 3QIBB 4MS8D 5TE6L 3WL9A 5ETUB 1U3YA 4P46C 2AXFB 4QOKD 4Y8DC 2FECI 3VFOB 2HVKA 4JFFE 1NSNL 1OOAA 4LBEB 4NN6C 3SGJC 1T7WA 4E5XB 3ARGD 4MAUL 4U3XA 5DA4A 4NZRH 3STZB 5B4MD 1QPPA 1ORSA 1XIWB 3MV9B 5I71C 4PB9L 5FGCE 3VWKB 4LVHC 2J6EH 4NQSA 1I1CA 2R0LL 2UUDH 3GI9H 3FN9A 4X0KA 1NDGA 2DLHA 1T2JA 4U31A 4S1SH 2H45A 1DL7H 3EYVA 4PJAF 1VADB 5KVFH 4JB9L 4LDEB 3UTTA 1L9NA 2VQTA 2VZ1A 5CJOH 5C0EB 2CR3A 3DROB 5E08H 2DB8A 4ISVB 4FXLA 2LQRA 2VUYA 1N0XH 2NY3D 1DBJL 3EHBC 1PG7H 1WCBA 4FQIH 4WHTB 4LLQB 2HJFA 5ESQA 1OTSC 2EC8A 3BSZH 1RU9H 2B39A 2WIIB 2BJMH 3RWFB 3Q1SH 2GFBB 4LSUH 1FO0B 1CL7L 1KLFA 1A6UL 3F6LA 4F3FA 3NAAH 4M9PA 1Q1JL 1OGAE 2NQCA 4I3GA 1HHGA 4FNLL 3GSNA 5MEPB 5I1DA 5IHZA 4RMRA 2QBWA 1LQSR 1K5NB 3NIGE 3T3ME 4JVUA 1Q0YL 3SDDB 4GW5A 5I30H 1NL0L 4OLYL 4XP5L 5KW9L 2J4WL 2VXVH 3W81A 3C6LB 3LN9A 5CD5D 2BVOA 3GUTA 1J0HA 3QIBA 2YC1B 3VXQB 5C2BH 4QRPE 4KKCD 1ZSDA 2R2BB 3RVUD 1GGIH 1BJ1J 3LKNB 2ESVA 3DVNB 2CQVA 4ETQA 4FTVB 1MHPL 4M7ZB 2VLKB 1C16B 5T3ZL 1ZS8A 4YO0A 3QG7H 4Z9KB 1IE5A 3MXWH 1E4XI 4ZXBB 1RZFH 4Y5YA 5FDWB 3MACL 3PUCA 5F6HJ 4R90L 3ARUA 3MJ9A 4PRIB 5EIIA 3KPRA 1KB5A 4QRRA 5FAAA 3Q3GA 4ZD3H 2NY4D 1A6WL 1UWEH 4M7LH 4OUOA 3F5WA 2X05A 3WFEL 3BJLA 1KG0B 3SO3C 3HMXA 5D72L 1NEZG 1A3LH 1T89A 3AREC 1RUKH 5HSFA 3NCCB 2F5AL 2HN7B 2OI9B 3G6DH 5I17B 5IP4A 1IGTB 2AEQL 5GZNC 1AJ7H 3SOBL 1I3VA 5HJ3A 5T1KB 3DMMA 1BLNA 2R8SL 4KMTL 2A83A 4YQXH 4B41A 3G6AA 1C5DB 2OYPA 3NZHH 4WWID 3AUVA 5TDOA 1QYGH 2VQ1B 3S37L 1YEEH 3VG0H 3WV0A 1IGTA 5D2NB 1HHIB 1WIUA 2HLAB 1J1XL 5EU7E 2XWBB 1LO3L 3I02A 1F3RB 4H1LG 1BIIB 1HCVA 3OF6A 2C3VB 5T3XL 2W38A 3QDME 3F5WB 3OGOE 2VISB 2AJZA 1E4JA 4D9LH 2GJ6B 1TTUA 1YJDL 4WDIA 4JFHE 2EYSB 1VHPA 3AB0C 1QKZH 4MWFB 1JHKL 1KN2H 5CGYD 4UDTA 2K9UA 4OZGE 4YUEL 2IANA 3X13A 2R2EA 2Q8BL 4M02A 4W4OA 3MV8B 1MQKH 3GSVB 1AGCB 5ISZD 2ED8A 3GRWH 1GVIA 1Q94B 5FM5O 2XG5A 1NAMA 2XRAL 3U4AA 1NFDF 3NAAL 1ONQA 2LAAA 3RVXD 4PJXF 4RMWA 4DJMA 3TWCH 1NGYB 3G04A 5IEHB 1MFBL 4HFUL 3AVEA 3N85H 1X5YA 2Z4QA 5B38G 5I1DB 5IBUB 3TP4A 2ZCHL 4JQIH 1JMXA 4OBRA 2J8UB 4GXVL 1AQDB 2FGWL 4Y7MA 1EHXA 4UV4H 1E0OB 4U6YA 5MEOA 1AO7D 1I1YB 2ICWJ 4M5YH 1HE7A 1YYLH 3H9SB 4JR9L 4WJ5B 4WWKC 4R7NB 2DQTL 5IEHA 2A83B 4RX4D 3RFZC 5T33H 4LFHG 2QHLA 3U4EB 1IAKA 1D5XA 1JF5A 5EZJB 5DMYA 5GISH 1QHOA 4KY1L 1ES0B 4LLVB 1UM4H 3HCVB 1PKQA 3BX7C 2DM3A 1FLRL 3DVGB 5C0EA 3G9VA 1QFPA 4QTHA 3QDJD 4IMKC 2XKSA 4L3AA 2A9ML 3GO1L 3NH7L 4NP4L 1OT2A 4NQEE 1I8IB 4LSSL 4U05A 1JCKA 1AP2B 2A38A 4NCDA 1IZKA 3D69A 4XP9L 4HWEH 1C16A 1YQ2A 4MJIE 4ETQB 3EYSL 3RVXC 2NW2B 2NZ9D 4G8GE 4URTB 3B9KA 4PTTA 1IGMH 3ECBA 3F7YA 1R24B 3ALXA 3Q6FB 2AVGA 1ED3A 5EBMA 5FK9B 1VEPA 2VXTH 4NC1C 1X44A 2DLIA 4LVNC 3K0WA 4DFHA 3T65A 1KJ2A 1J8HE 1A8JH 1HDMB 4AH2A 2EE9A 1MF2L 4AT6A 5I17A 2HN7A 3EW3B 1GOGA 4ERSH 3CPLB 4JPWL 5E56A 2OBGA 2UZYB 2WP3T 1T6WA 4O2FB 3MA9L 3GMNB 2VE6A 5T1DL 1UJ3B 3WXVH 4OFIA 8CGTA 3KLSA 4LHUG 3KPRE 4QRRE 1U2CA 2X70B 1H3GA 1P69B 5DK0A 3EO1B 4LAQL 1TJIH 2PTVA 2QSTA 3S35L 5F6IB 3G5YB 3P4NB 4UI2A 3CX5J 4F7PA 1X6NA 4CMMB 2DTSA 1PEZA 4EXKA 1W0VA 2XNAA 3PP4L 4MJ4A 1RIVL 3MRGA 4JGUA 5JW5A 2G5RA 1D5BB 5FA4A 3NCMA 1JYNA 1TETL 5ESAB 4XHJC 3W9EB 1A7PL 3GIVA 4WTZG 3RGVD 4NQEB 1ZT4B 5D1QA 1NFDB 5BV7L 4JFPA 1CCZA 1HHJB 1XFPA 2YKLH 1FLRH 4PV9B 1AGEA 4KZDH 1F4WH 3U46B 1Q72H 1EJOL 3HE7A 4JGMA 4JFEB 1YN6A 2X4OA 4UT6H 2WQ8A 4E5XA 1S5IL 5JMRA 1H8NA 2Q8AH 3RX7A 3TO4D 2I9TA 4TTGA 5K9OA 4RGOL 2XA8L 2P46B 1JZ6A 3WE6B 3O3AB 5IMOA 4U6VH 2DQUH 1CDYA 1CFQA 2AEPL 4NO5A 3AU1A 4U1GB 3KS0J 1UB6A 2B1HL 4ZFGH 5D1XB 3FB8A 3NGBB 4GW4A 1NLDL 2NTFB 3GI8L 3U7YH 5KAQG 2NXYB 1MY5A 4JCMA 4NZUH 3LKSB 1J8HA 3TFKC 3ZDZF 3E3QE 4L8CB 3SJVE 1CDCA 4PBVC 5LGHL 3WIIH 1FSKC 4YXLL 2FIRT 3WIFB 4J4PA 5AYQA 2HH0H 3OMZA 4DKFH 3TJEL 3T2OA 1YQVH 1J12A 4YHZH 32C2B 4RZCB 2XTJD 4ZSOB 1U6AL 2AQ3A 4L4TE 3DMMC 3M8OH 1N5YL 3EFDH 5JQ6L 1CDGA 5J1AA 4KZEL 5DJ8B 3V6FA 1WF5A 4WRLA 2IBZY 3BUYB 4KXZH 3NCYP 2N7BA 4NQSB 1Y6MR 2ICCA 4IOFC 2A6KB 4AENB 1BJ8A 4UIMA 4JRYB 1YYMH 5D70L 3STBA 2VDKL 5HTSA 4TULL 3HAEB 3QI9D 2RQ8A 2XPGA 4NKMA 5I8EB 3VE0A 2R4SH 4XHJD 1XH3B 3MOBL 2Y06L 2YPLB 5T5FH 1KYOK 3S35H 4OZGB 2R0KL 4IRJA 1T2QH 2V7HB 2C4FT 2ADJB 2KUTA 4MXQC 3GJFB 5EO9B 1M7XA 3U79A 1CD1A 1CBVL 2KPNA 4PRAA 5I0DA 3BZEA 2AV7A 4EI6B 2WUBL 4HMDA 4QT5B 3TCXA 3PHQA 2W0FA 1C12A 3H3KA 5SWZA 2R1YB 3FCTB 5DRZA 3MCLH 3WUWA 4YBQD 4M1CD 1F5WA 2AKRA 1JPGB 1FFQA 3UTSA 4WEUD 1MRFL 3NN8B 25C8L 2N56A 4LKCB 4NSKB 1HCFX 1H3XA 5IEKB 1KFAL 3OR6A 3CIQA 1T1WA 3MPCA 3KVQA 3L7EB 1RZ7L 1FZMB 3TFKD 2BNRB 4GH7B 3EFFB 1BBJB 3ZLQC 2H8PB 1F4XH 3ILPB 4DFIA 4GJTB 3WD5L 1IGFL 1TJGL 1HEZB 3P4OA 1LK2B 1FVEA 4LQFL 3F6IA 2XRAH 3QIBD 3NTCH 5I75C 3IJYB 1E4KC 1AI1L 1MJUH 4TSBL 1XEDA 2MQ3A 3FN3A 5DMKA 1A7NH 1NGPH 2X4NA 1I9RH 2HYMA 2D31B 2PW1B 4HJGB 3S3SA 4NHUA 1FFPA 5AAMA 1QNZL 5IFAH 3WDHA 3RA7L 4ZYKA 1H3VA 5E4EB 1D9KB 4RGNB 3OAZK 1S7TA 4ZNEE 4D9LL 3QDGD 3SKJH 5D7LA 1A5FH 3KPRD 5JORB 3IDYB 1KV3A 2MOVA 1NL0H 4HK3J 4IJ3C 5E2WH 3I84A 4I1NB 4W6WB 3K46A 1GPOL 3O6FC 2IF7A 3P4MA 1HWGB 4PRNA 4RWYH 2I25N 1IKFH 5AWNL 4Z6AT 1P1ZB 3BIKA 3MLTB 3GJFA 5EO9A 1F6LL 1CFSB 4HIHA 5EZLA 2UY6A 1TVDA 3VRLE 4NKDA 2OX5A 4LVOB 4N0CD 1LD9A 4WGWB 1RVFH 4A6YL 1ACYH 4X6DE 3MGOB 4ELMF 1XH3A 1OGTA 3MOAL 3OAZH 2EXWD 2ADIA 5HGDA 1YC8A 2AJYL 4IMKA 4G42A 1J18A 4KKLD 2EYTB 4ZG1A 1TCRB 2WBJA 5FUZL 1Q9LB 2UVFA 3DRTB 3I75B 4RAUB 5FKAB 5H2BA 3V6OE 5CEXB 1I3RB 3QIUC 5IBTL 3BQUA 5C0NC 4YHLL 3CLEL 3BZ4A 5DEFA 3CC5B 4PGCB 4RBPH 3JZ7A 4KUZH 1NCWL 5ISZB 4WV1B 3OXSB 5HGBA 4P57A 4PJIA 5F1IA 1M71B 5DFWH 4PLJD 3EOBA 2P8LB 4PB9H 3LRGA 5HHNB 3QCUL 5AEAA 1LO3H 3ARDB 3HLAA 2YRLA 3NPSB 3L3OA 5KW9H 1CFQB 2VN7A 3EGSB 3WFHA 3RGVC 4K8RL 2JCCA 1Q9WB 4YDJA 5SX4I 5IESH 4XCYA 1JGUL 5GS0L 1SM3H 3QFDA 3SGEH 2P24B 2MFNA 3BGMA 1IGFH 1TJGH 4P2RA 3MO1B 4F80A 5DHYB 3KPTA 3QCTL 1QSEA 2DDQH 4JO4L 1BBDL 4HG4J 4MAYB 4K9EL 3QUZA 3VD5A 1WBYB 3PNWA 4I0PC 3EIFA 5CWSA 3WNKA 5AZ2H 5MHSE 3PDGA 1FJ1B 5FYLE 3U2SB 1VGKB 3QCTH 3HE7C 3EGSA 4RX4A 3WFHB 2GTZA 3QUMA 1C5BL 3QQ4B 4GAYB 2XNAB 1U93B 1KIRB 5ENWB 5E4IA 4XX1E 2WWMC 3RWJB 4ZUWB 1GC1H 3MYJA 4UILL 2F53A 2MCPH 4QXTB 2OR9L 2QKIB 3VI3E 4H8WH 2NY0B 3O9WA 3N1QC 4L3EB 4WI4A 3HI6L 5F9OL 2PXYC 4UIKL 1V7NH 4YK4C 1T3FA 4F7MB 4APQD 5F89B 4ODXB 4WW2B 4J12A 2FGZA 4J3SA 5EU6A 5F8QC 4O2FA 2WV3A 4Z7UE 5CLTA 4ZUSA 1HINL 5C0CE 3G6JF 4ZPTB 4QYOB 5D1ZB 4RRPG 4WCYH 5TF1L 2Y07L 1T3FB 4YHNA 4HS3A 4JDVB 4NRXA 3LQMA 4BSWA 1TCRA 2WBJB 2NY2C 1RHHB 2XYCA 1QRNB 3WXWH 5IBUG 4XHQA 1X7QA 3CMGA 2QADD 2KZ1B 4N8VG 4X6EA 4OLXL 3C5ZD 4PJCA 2X1WL 3DYPA 1EUTA 5LWYH 4PP1D 4ZFOB 1YUHB 3ESUF 3UJIL 5M95B 1RULL 2RCSH 4O58H 1CGTA 3D39E 2APWA 4JR9H 2MQ0A 3I3BA 3CFCL 3GSOB 5GRJL 4BH8A 1EPFA 2C3GA 2JCCE 1KIPA 3F62A 3O6FB 4JM2D 5CGTA 3NZ8A 4I48A 4IMLA 1N0XL 3A67H 1RZ8A 2W92A 2BFVH 1G7LA 3MGAA 4RA0C 4PRHE 4X6EB 1LEIA 3MUGB 2CLVA 2DLFL 5TQ2L 3B5GA 2Z93B 2DQCL 3WO3B 3ESVF 1QEWB 1C8PA 4P2QB 3X11A 3P77B 5D1ZA 1XF2A 4AZ8A 4KK5D 1XCQA 5GGRY 1I4FB 3CLFH 2P1YA 1FH5L 1RIHL 1ZVSB 3P11L 4QTHB 2EDYA 3DVGA 4NN7C 3U0PB 1BAFL 1EDQA 3SGEI 2FL5A 3FONB 5C08B 5D8JL 3BH9B 2OJEA 1T1XA 4MA7L 5HGHA 3S5LG 4JHZA 1P4LB 1OSPL 3BKYH 4IRZH 1CGSH 1T22B 4ZO6A 1M7DB 2G9HA 2YN3A 4MJ2A 5MEOB 5DEFB 3EYOA 3UEZA 1RURH 3BDYL 3OR7B 5TDPB 3SGKC 3VRJB 2C7UA 1OTTC 1SVZA 4HIIB 2EDBA 4NQDB 1NEZB 1BAFH 5F9WB 2MCPL 5CEZL 1QACA 5BS0D 4OCSH 2PO6A 2R1XA 3CLFL 3PP3K 1MPAH 3MUJA 3S35X 5ADPH 4X6DF 3IU3B 3QNXA 4IRSC 4KJYA 1ZANL 3IFLL 4DK3A 3QUYA 4ONGH 3WHXB 2OR9H 3HAEG 2Y5TB 2K3TA 1B3JA 1MH5B 4OCMC 4Y1AA 3GMPA 2QQQA 5IM7B 3SDYH 1SJXA 4L29A 2JJTA 4HCRL 1F45A 3HI5H 2YZ8A 3TN0C 2W60B 5IVXA 4O51B 1J8HD 5CD5C 2FX9H 2VH5H 2ZNXA 4I9WE 4AMKH 1UM6H 3KHOA 5FGCB 4ODWA 3O81A 3BISA 3QIBC 5D2LE 1SY6A 4UDTB 4KKLC 2Z93A 1N64H 3R8BB 4OCSL 5E00A 3UJIH 4X5WB 4DZ8A 2AJZB 3B9VA 2NXZC 4R2GC 1CXEA 1D9KA 4QHKI 5TQ0L 4NPYB 4IBLT 4JFHD 5F71A 1N59A 2CDGA 5ESVB 5DFTA 4PJEE 1UKSA 2F53E 1HOCA 3BZFA 5CEYA 4G6FD 4ONHB 1NUGA 4LF3B 1JPTL 1ZHKA 1QA9B 4PJBE 5JPNA 4NT6B 4JREB 1OWRM 2NY3C 1FZJA 2Z8VC 3K81A 5IB4A 4YHMH 2N1KA 1RUQL 1ZA3A 3F8UB 2XFXA 3P11H 4TUOB 4QXWA 3P2TA 3EYQD 3BEWB 3B3IA 3QH3B 2HAZA 2HH0L 1AHWB 1TQBB 4L4TA 1P1ZA 3BIKB 3MLTA 4WFGE 4IRSD 3O3AA 5J3HC 3HC0A 4HUUA 2EIBA 2MKWA 1WAAF 4X7TA 5DQDL 4G9FB 1B4RA 1NBZB 4OLUL 3RZCA 1CLOH 2NZIA 4X8JB 3TO4B 4QXTA 2E7MA 4UMGA 3LKOB 4I77L 5AD0A 3S8WA 3CU1A 4WENB 1NAKH 4G8GB 4EI6A 5GRJH 2OCFD 5DO2C 3ARYA 4UU9A 4L9DA 1PG7L 4WFHD 2FRGP 1DBBL 4QHKJ 3SJVD 4M93C 1E27A 3VXQA 1ZT4A 3QWRD 3LRSA 3MZTA 4K3JL 2AQ1A 1ADQH 1F58L 4UT6L 1CBVH 3MV7D 3ARFD 2EIZB 2MTPA 5C0GB 1CFVL 5EUOE 2WWMD 3SDAC 3TZVA 5A16A 2G60H 3KYMB 1FLTX 2R0KH 4K7FA 1G84A 3S97C 1ZMYA 3HPLB 2H1PH 3MO1A 3BXNA 5HD8D 4EI5D 1H9VA 1ZGLA 3SY0B 5C0CD 1WZMA 1YNKH 2ZJSL 3O4OB 4OAWB 4X4YA 3E8UH 4PGDA 4P2YA 5FA3B 4KZEH 3RZCC 4HF5H 2G9HB 1IKNA 3IGAB 4LLQA 4Z7WA 2NCMA 4L4VE 2QSCH 4K3DL 3LV3A 5DJYB 4YNYA 1CE6A 1KTKE 4Z7VE 3WNNA 5IQ7H 4D9RE 1M71A 3IDIA 5HI3D 1SBSH 3JV0A 2DQJL 4L3CA 3ARXA 1DLHB 2E6QA 1CQYA 4WW1A 2J8UE 3OXSA 1INDL 5D93B 2K1MA 4PYHA 4J3XA 4O2EA 1H0DA 4JKPL 1IT9L 2Q7YA 4NO5B 1D3CA 4N68A 4N9GB 5CLWA 5FIEA 5D2NC 4JDZB 1G0XA 5EA0H 2E7LC 3HE6A 4NKMB 4KTDH 5LJYH 1EFXD 2ZCKL 1U8KB 3DX6A 5DDHB 1K3IA 4AEEA 4Z7NF 3ARQA 3IDXL 2ATKA 4OZIA 2CRZA 5GGSY 3FT4A 2ADIB 5HGDB 4FS0A 5TGBA 5CUSH 4K7PY 3D85B 5C0RH 4OSUL 1U92B 3RPKA 5E0QA 3VXOA 2FX7L 2FJHA 5ID0B 3MRGB 3QEQD 3QT2A 1FIGL 3MJ7B 3U4BH 1NC2D 1CE1L 4G9FE 1JNJA 4DGVH 2EIEA 1KPRA 5SWZE 1I9EA 3ZHDA 3QO0A 5EU3B 2PTTA 1VFAB 3U9UA 2JJTC 3H9SE 2NTFA 5KANI 1FCGA 1IC5L 2E5EA 3MLUH 2FZ3A 1CQKA 2AP2A 5C0RL 4PB0L 1YQVL 2NY0C 4FZ8H 4NQDE 5CUSL 3EBAA 1CE1H 4C54A 4KTEH 4UQ3B 1HSAB 2O5XH 3GSUA 4NNPH 1FQ9C 4FFYH 1CGYA 3SBWA 1LO5A 1ROWA 1YN6B 2X4OB 1ZHBB 3U46A 1NFKA 4PFEA 4LCWD 4RMTA 5F21B 1NGYA 4YEFA 3GSXB 4K7FB 4LLUB 2Q7NA 3ARVA 4ZNEA 4PRIE 4X7CC 2AK1H 5JO5A 1ED3B 2VWEC 5EBMB 4GRMA 1NLDH 2BNRA 4PRBB 1EFQA 1JK8B 1TZGL 3KLAA 5I76A 3K1KC 3L3KA 5H94A 1N6VA 5LGJA 2P5EB 5IQ7L 4MJIA 1KCSL 3VGEA 4YHYC 3CAFA 1ZEAL 1QSEB 2FEEI 4K3DH 1BP3B 5KTEL 2D0GA 2IH3A 1WICA 2EYSA 5I2IA 2V17L 3QUZC 3TIEA 3WLBB 4U3CA 1QLEH 4X7TB 2AXJA 5JIKA 3Q5OA 5DWUH 1WWAX 4M3JA 3W9DA 3K8LA 2ITCB 2H1PL 3L3OB 5KVMC 2IAMC 1C5CL 4MVBD 5SX5K 1QBBA 1TLKA 4ELMB 1QPXA 4HKJA 3NIDE 5F9JA 1CGUA 3TC9A 2BNQE 3U6RB 4S1QL 4WFGD 2I26N 4LSRH 1UWXK 2HWZL 1OGAB 1XR8A 4ZS7H 3UYPA 3HAEA 5JTWA 1JGLL 2LV4A 4X6BA 4BZ2L 5C09E 4PJCE 4UOJA 1B4JH 1SEBB 2W65A 3HZYB 4OD2B 1AD0A 2QSVA 2NYYC 3ROLA 2EKJA 3BRDA 3PIQA 1A4JB 5FF6B 2NPLX 3HR5B 3QBTB 3UYOD 1DEDA 1GOHA 4E41A 1S7UB 3MLWH 1UH2A 5EC2B 1ZLVH 2IPUG 3DBXA 2O5YH 3Q3GB 3QPQD 4X6CA 2X42A 5GRZA 2H32H 3BGFB 1MCEA 5DD3H 1MAKA 3OJ2C 5ICZA 2F5AH 3D3VD 1RK0B 4J7RA 4LK4A 4G8EA 3P73B 3PDDA 5D72H 3S98A 2GHWB 1UKTA 2CO7B 6CGTA 4TQEH 2KQMA 2HTLC 5AG9A 4J1UA 1QFUL 5I74B 3FFCE 2I60H 4NC2B 4NHCL 3TA3D 1AGCA 4JJHA 2EDHA 3MXWL 1OAYH 1DUYA 5IM7A 1U0QA 1BWWA 3RY6C 3GFUA 1QQDB 5T3ZD 2DQHL 4R9HA 2CD0A 3MYZA 1IM9A 4NO2A 1MHPH 4M8QA 3P9LA 4K3EL 4OF7A 4Z0BL 2G75B 1MCPL 2EXYD 1FNSL 3ARGA 2Q8BH 4GRWB 4HBQA 4MJ5A 2MHAB 2LAGB 5D7JC 2FX8L 5BS0A 3NGBC 3V6ZA 4D0CB 2MWCA 4F3FB 2AJXH 4X7EC 1EO7A 1ZA6B 2DL9A 4OF5A 5HVHB 3TT1H 5D7SL 5L2KB 4K3GA 3EYOB 3MLRL 2VTFA 3DUSB 5HI3C 3BT2L 1VEMA 5F7EH 2ZSVB 3SPVB 1RI8A 1P4LA 3P9WB 2I9LA 3LH2L 2EDQA 4EJ1C 1IQWL 1HQRA 3MLYH 4I3RL 1JWSB 4KGLA 3MRQB 4NFCA 4D0BB 2FGWH 3H0TA 3PDOA 5KZCB 1OAKH 2Q8AL 1JJUA 3GSNH 2PW2A 2LU3A 2W9EL 3VFGL 1OGAD 3UTSB 4GAFB 3TZVC 4PRIA 5EIIB 5I16B 1HYSD 3A67L 4GQPH 4PJAA 5J9PA 3T77A 3TBVB 1S7XA 3MV11 3WYRA 5I1EL 2DDQL 1ZAGA 4LPCA 4ONGL 5ITFB 1U8IA 1W8NA 2FB4L 5TJWK 1QR1B 2X9XA 1KCKA 5D1QD 2PYEB 2ZOLB 1MQKL 4LPYA 3MFFB 4GUPA 1LNUB 2APTA 1JPFA 5IVXE 1CFTA 1Z9LA 3PJSB 3TESA 1PGRB 4S1DD 3MFFA 3SDAA 5C2BL 1IEBB 4MA8L 2BSED 2PYEA 4IHOB 1ORQA 3MROB 3MUZ1 4PTUA 2I24N 5EU7C 1QLEL 1ITBB 1UM5L 1WTLA 2AI0H 4WI5A 2WLZA 1B0RB 1TZHB 4F58L 3GSNB 1O7SA 3WUWG 3VFSB 1ERNA 1XGRB 4H0IA 4MA7H 4YXHH 1U8MB 5TQ0H 3GMRA 5ALBH 1YYLL 4GBXB 1QFHA 4M6NL 2VLJA 3HHRB 2FH6A 2YEZB 4U1KA 1VA9A 3RVWD 1LDPL 4NQCE 1XGUB 1IAIL 4NO0A 4WHYG 4YE4H 5I1KL 4GKZB 1D5XB 1KELL 3BAEH 1AXIB 4XNYL 1EXUA 2BVTA 4NZDA 3HI5L 1MCQA 1L7IL 4MD5B 2UUDK 4J4PC 2VKWA 3TBSA 5L2KE 3QUMB 1E6OH 2FJGB 4MQ7B 4TRPL 2IPUK 2QJDA 1YY9D 3MGTB 1EHNA 3OKDB 3P30L 1GZQB 3FOLA 4Y1AE 3OJDB 1AGBB 3UYRL 1UWEL 5BOZG 3TBWB 4MB5A 3H9YA 5SWQA 1IARB 2XTLA 3QDMA 3RGVB 1XGUA 3PV6A 4HUNB 2FWOB 1DLFL 4U1HA 2I5YH 4JFFA 4U1NA 3QFDB 1RJYB 2AJUL 4KI5C 3T08A 3UBXI 4FQ2L 1T03H 3TBSB 1IC4H 2I27N 1IRAY 4PD4K 5EUKB 1BM3L 1JGDB 4R0LC 4XWOD 2M1KA 1D6EB 1CTOA 5K9KB 1RZJC 4UINL 4UOW0 2HT2C 1K9TA 1UB5A 4DCQB 4H8WC 1F8TL 1U3ZA 5GZOC 4JEGB 3B6SB 4NJAH 1URLA 4V1DA 3G5YA 4JRYE 43C9A 2H26A 1NJ9A 4XBGB 1TFHA 4LARH 3JTSA 4FQXA 5DURD 4K23L 2YHGA 5EDXA 1PX3A 1HIML 4Y4HC 5AG8A 4P9HH 5J06A 1LNUA 4GUPB 1AKJA 3ZHKA 4IDJL 1ZXQA 1A4JA 3PIQB 5FF6A 4P59H 4X5LA 3C8DA 1E4WH 5E8DH 5BMFL 2PXYB 5DHVB 1LMKA 3CDGB 2FBJL 3CCHA 2R69H 5C07D 1A1NA 1K6QH 5LCVH 3SJVB 3L3HA 3GZKA 3MLSH 1T0NB 5GGQL 2YOCA 1ORQB 3D48R 3T04D 4Y5XB 2NLJA 4OV6F 2PW2B 2FSEB 4NJAL 1FRGL 3V0AC 1BQHA 5IMLA 1P5UA 4MX7A 4CVZB 3ZKNC 5DQJA 4MAYC 1KB5H 3VWJD 1WFTA 4HIXL 5FYJU 3MUY1 1P9MC 3MNWA 1SJEB 5HYJB 2SEBA 4DQOH 5MENB 1H15A 3OKNA 4YO0B 5IG7A 1XF1A 3ZE0F 1FHGA 3RI5F 3FN0L 4WUUB 3T0XA 4M7ZC 4D0CA 1TPXC 3FO1B 5DYOB 5E2TH 5E95B 3IFOB 4NGHH 1K8DB 4YDIL 2AS5M 2JB6B 4G8IB 4KJPD 4LU5H 4XGZA 4RQQA 5DF0A 2BCKA 1IC7H 4X5XB 3FB5A 1BD2E 3CUPA 3CGTA 2XN9D 4I5BB 4P48A 5IOPB 1FBIL 3H3PH 3DARA 4V1DE 1K5NA 1FYTB 2BNRD 2EDXA 2OXHA 5LGHH 3FJTA 4MSWB 1DUYB 4HMCA 1G6VK 2J3SA 4XGZB 1BX2B 1NMBH 4APQC 5FB8B 3C08L 1D6VL 4MJID 4MJ6B 4IS6B 3DX9A 3BP5A 2R0WH 1AQDA 3V6ZB 4RWHA 5DRNB 2X4SA 1BQLL 1P53A 5LQBL 4N0UA 1K2DA 4JFZH 1YPZF 5HHOD 1OAQH 2B4CH 3V5HA 2P42B 4FQ1H 4RFOL 2PTTB 1T04B 4KDTA 3LD8B 3PWNB 1CFNA 3H7BA 4GOSA 4JPIB 4LARL 4X6CB 3I6GB 1E4XH 3LRHA 1HI6A 5GGVL 4D9QE 2WBJC 5D7IB 3ULVC 1T21A 1SMAA 1I9RL 3VFVB 4JFYB 3FZUC 1A7NL 5GHWL 2QTEA 3T0EB 2A6IB 1R3JB 4N0YL 1KLUA 2B0SH 3AB0B 2BMKA 4JQVA 2YR3A 1BFVH 3QIWD 3HUJA 4LPTA 3RWGB 5JIHA 3VFTA 4GRLA 1PQZA 1RK0A 2I5YL 2QQKL 3CFKB 4JDTL 4MNQA 3HC3L 4KVNH 3OV6A 4R96A 1NCAH 3FQXA 5EC2A 1EZVY 1HSBA 1UZ6F 2UWEF 3LOWA 5DJXB 2AABL 5GRUH 3BGAA 5ANMA 4UTAL 3IAQA 1MRFH 1I3GL 4MD4A 2DF3A 4NOFA 3CSYB 1YECL 5GSVB 4XVUC 4RGND 4H20L 4Q2ZA 5GSRB 4E0RB 2HFGH 4OB5L 3JTSB 2VXUL 5IVOA 3RUGF 2JKXA 1DDHB 4O9HH 1PY4A 5EU6D 2NY5L 3FO0H 2QADC 1C1EL 1X5GA 2P5ED 4PJ9C 5GQBA 1MWAA 4U4BA 4HGWB 3RX5A 1BOYA 2ED7A 1G9MH 3MRIB 4JZOB 4P4KC 4JPKH 2VDKH 5C1MB 3GSQA 2RJMA 4Y4HA 3L1OH 2I9TB 5IJVA 5T5FL 3FRPG 3NFSH 4X80L 4FFVD 3MOBH 5SWQB 5AAWA 3DHMA 3RWIA 4LCUA 4TULH 4MJIB 4C56A 2HVJB 1YNKL 4CL7A 1N5AA 1A4KA 4ZS7L 2P44B 3IDNB 2Y4SA 5HI4D 5ID1A 1ZK9A 5GRXG 3TNNB 1MIML 2E27H 2R4RL 4NUGL 5J6GB 3IDNA 3WIIL 4NHCH 3NFSL 1INEL 5IIEA 4MD5A 3VFUA 3CXHK 2F54A 2ZUUA 4Q0XL 2EE3A 5HHMD 1VFMA 3CXDH 1W0VB 1HILA 5DQ9B 4M1DH 1A9EA 4U1LB 4Z18A 4I18A 1DJSA 3OBAA 1D7FA 3OJVC 1KPRB 2ZUYA 4NUJA 3L3DA 3K4DA 4KVCL 4KK6C 1AGFA 1OB1B 4XBEL 4XP4H 4XXCC 2AK1L 1WBZA 1IGCL 2VLKD 3OKLB 1FV1A 5HVFB 3OB8A 4M6ML 3HRZA 1D5ZA 2A77H 4PY8I 5D96B 4IDLA 4A6YH 2LU4A 3IETB 2Y36H 3LDBB 4L8BA 4YH6A 2BVPB 3MBEB 3O8XB 1AHWC 1TQBC 1J7VR 4RNRB 4KVCH 5E99H 4FFZL 4DOHB 2HLFD 2ERJC 5BZWA 3BRFA 5EU4B 3L5HA 5B3JF 3DROA 3VGDA 1DTUA 1BJMA 3VXMB 4N9GA 4FQQB 4HWUA 2FJHB 5ID0A 3O2DL 3K4ZA 1PG7X 3SQOL 1G7MA 5GGRA 4MD4B 1IC5H 5ESVA 3NA9H 5KG9A 5ANMB 1YEHL 2HJKA 4MDJB 3LSOA 1DLHA 1FNSH 1HINH 2HG5A 3MRMB 3VGFA 1KC5H 2YMXH 4EVNA 1I1AB 5ECJE 3MLUL 5J56B 3O45B 4JRXA 3DHJA 1T20B 5IHLB 1I85C 4P2QE 1ZVHA 1P7HL 4K3EH 2DYPB 1UJTA 4Z0BH 3GHEL 5ADOH 4K2UL 3BPLC 1CD0A 4LHQB 4UDUA 1X5XA 3V4VH 4YHPB 1R3IH 1BVZA 5BRZB 4JLRA 4HZAA 3VXSE 5IW6A 5C0FB 5J12C 3CK0H 3O2VL 1Z0NA 2YRZA 5CZKA 2V2XA 5DC0A 1TXKA 2BY3A 1GSMA 4AM0B 2R23A 5FGSA 1BBDH 4LHUB 4JO3H 1YN7A 4UTBL 1CFBA 1R3KA 3X3FH 3ZDZE 4ENED 3QULB 1M05B 3P9MB 5I9QC 1CLCA 4X8XA 2VLRD 3Q5TA 1E27B 1EO5A 1KIQB 3DX9B 4F8QA 4M7LT 4FQLH 4UU9B 3ULVE 4NDMB 3RJQB 3LQAH 1FZKA 5FECB 4OLZH 3PWJB 4FABL 3PWPD 1LGVA 3VCLB 4M1CC 4X99A 5CMAB 4JFFD 5AUMA 3S5LA 1I8MB 4QHUB 4NFBA 5E2TL 3RDTB 4WUKH 4X5XA 1ZVYA 4JRWA 4BSVA 3HC0B 3S9DB 2WANA 1F13A 3WN5A 1SEQH 3GMMA 2E9IA 4WI8A 1JF1B 4TTDC 4AEIL 1YDPA 1ZVSA 4F57H 3TEUA 4ODSL 2FLBT 4HUVB 1JTPA 4EKXA 3PGFL 4HHAA 3QUKB 4P23D 3N1FC 4G8GA 3FQNB 4ZDHA 5FOJA 3KXFA 3U30B 4CN4A 8FABA 2AXHA 5EO1A 5CHNA 4FQLL 1FVDA 3LKQA 3DETD 3T4AA 3O6KL 2GJ6A 5JIPA 5CIPH 3NZ8B 4XP1L 3VFWA 2X7LA 2IQAA 2Z31C 1DBBH 4RAVA 1K8IA 2CDGB 2IEPA 5KSAC 4WNQB 2BZDA 4NRZB 3SKMB 4NPYA 4C56E 3RIFF 2DKSA 1EVTC 3ZSSA 2EECA 4KC3B 4QXUL 3L9RB 1HNFA 2P7TB 3MJ9H 3NVQA 3T1WA 1SJHB 3OAUL 1RUMH 8FABB 1KBGL 2X4TB 3G6AB 4PRHA 5DZLA 1TVBA 1NBVL 3PQYE 4XPFL 5D1XD 2ICES 4G6FB 3O6KH 2FEDC 3JUYA 5F72S 1OVZA 2VC2L 3BW9A 1KN4L 2IAND 4Y19B 3UX9B 5KAQF 4S0SD 3BN9D 1N7ML 3QJFB 1CG9A 1JPSL 5HYJD 3ZTJG 3BESR 3KYOA 1F4AA 4KROB 5F88A 3EYFA 1B0GA 4KKBC 3HFMH 4P9MH 3EDDA 5CGMA 1I8MA 5FO7A 1JGVL 2XTJC 1S9WB 4U1SA 5E6ID 3U9PH 1UZ6E 4CDHA 43C9B 2Q87A 3VRIB 2GYSA 4ZUWA 4U33A 4NKQB 5E1AB 1EZVX 4JRYD 5INDB 1Y0LA 1YJDH 4XVUD 5I1AB 1Q9OA 3FAWA 3H9ZA 4PJDF 1FP5A 3RGHA 1KJ2H 2Y23A 2IQ9H 1JZ5A 3FKUS 1MH5A 4POYA 4YPGB 3SDCD 4JFFB 4G6AD 1T22A 4BQ8A 3QUZB 3E6HB 1RZJL 5E8PB 4PR5B 2OL3B 1DZBA 2XQBH 4UT9L 4F8TA 4ZMAT 2PUQT 2FJFA 4JLRB 3IDXH 4YHYB 1N64L 2WINB 4I77H 4XVJH 1KJMB 2K7QA 1S7QA 4NQDA 2CIIB 5BVJA 3MODH 3OKDA 4LVHB 3EOAA 3LEYH 3EDKA 5C07B 3QIUB 4I18C 2P8MB 3QDJA 3MRFB 3O4LB 4BKLB 2D0FA 3AFLA 1I3GH 3V0WH 1IAIH 2IG2L 4YDKL 2AABH 5GRUL 3V6OA 4TSAH 3SO3B 3ZDXE 4XZUA 1P7QB 3QUXC 4K71C 5CJOL 4OIBA 5A3ID 1GGBL 2DL2A 3B43A 4F37K 1RFDH 4WV1A 4TUKL 1YYML 5I8KL 4DZBB 2HKHL 2QSCL 1Z9SA 4JFDA 2BSTA 3F58L 4WWKA 4F58H 3DJ9A 2BNUA 3P77A 3GMRB 2H2PD 4GS7B 3JV6A 4FMKA 4ZAKA 3MRNB 3MRLB 1P7KA 5IR1B 2IBBA 4FNLH 3TJEH 3NPSC 5I74C 4KI5E 1P7KB 5IR1A 4N0FA 1XCTB 1S9YA 4M7KL 4OZFB 3PWPE 3O6FA 2H6PB 3T1FB 1YEDA 4OZGF 3MLZH 4N8PA 4Q9BA 1H3TA 2XIDA 5IBLD 5EU6B 2CO6B 3O3EB 2W59A 3LZFL 3H7LA 1R5VA 3WL9B 4NJ9H 1ZHNA 4CU7A 4EUPA 4PJ8C 3K4AA 5C08E 5CJXC 1O7VA 5DRXB 2HMIC 1EMTL 1OPGH 1E6OL 1F6AB 4M9OA 4ZFOA 4H26B 5KVGH 1PJ9A 3ZO0A 2W0KA 1X7QB 5KSUA 1XGYL 1SBBA 4R26H 1JTTA 4QNPE 2H3NB 1S7XB 1MHEB 4P99A 4G7VL 4JDVA 3LIZL 5L7XL 3NCBB 2VJXA 5B22A 4MXWH 3VG9C 2AK4E 4RDQF 5BQ7B 1U95B 2YKLL 2ORBH 5BVJB 5C0AA 4WW2C 3SDCB 3VI4F 4GLRH 5AYUH 4N1HB 1U41A 1XZ0B 1G6RL 3Q48A 4M43H 1KJVB 1UYWL 1XF4B 2P5WE 4JM4L 43CAB 4ZQKA 3ULVL 5F6HI 3RA7H 3RWJA 2B2XL 2YRPA 2V6HA 3BGMB 2DJSA 1GZPA 3OL2A 3EHBD 4JCLA 5BO1H 4EN3C 1OLZA 4N0UE 4FXGA 4G9DA 3TZVB 4NWTH 4B50A 4U7SA 4XPTH 3LHPL 4BJLA 4KWUA 4OLEA 5C0GA 1G7PA 4G5ZH 4WFED 1KENL 5CJBA 4JFXB 1S7WB 4EOWL 5INDA 3D3VA 3VFNA 1GGBH 2AXGA 1MI5B 2K7PA 3A6CH 5F97E 3D5OF 3NN8A 4YDKH 4PBXA 2HKHH 4ORGB 1BOGA 1G6RH 2W0LA 3LKPB 4M43L 4GT7A 1RFDL 4XTRD 3RRQA 3VXNA 4HXAH 1RZ7H 3BHBB 4R97C 2NR6C 3L95A 4NM8L 4W68A 4HT1L 2EEAA 2ZG2A 3KYKH 5KSAD 3BIAX 2BFVL 4XPAH 1RIUL 4NNYA 4WTZA 1JHTA 4K3HA 2GJJA 4DAGH 3IF1B 3BPLB 3DOSA 4UT9H 3J8F7 2Z0BA 4NN7B 3KS0H 4B7IA 4QGYA 4TUOA 2IWGA 2XQYG 3QFJD 4CN6A 5E08L 4YDVB 4ELKA 4MNHB 4KKAD 1FO0H 1JWMB 2V5MA 1OGTB 4R90H 5DUML 4LIQL 1VB9A 5ICYA 4MQXC 4PG9A 2ZCLL 3RWDB 4XAWL 4QWWC 5J3HD 1SM3L 1OW0C 2VRAA 5C0CA 4ZSOE 4N1CA 1T5WA 4KKBD 4YX2L 3TT1L 2NY1C 4IRJC 4OIAA 4PJAE 1F00I 4LSRL 4NNXA 3MJGX 4MA8H 3MRHB 3O2WH 3DX8A 4YGVA 1K2DB 3ETBF 4F7EB 5BRZD 4PJHE 4YDVA 2P43B 4YR6A 5DJ6B 1OGAA 1I7RA 3F12A 1JIBA 3FB8B 3S4SG 3MREA 2F5BH 2D03H 1JF1A 3D3VB 4I9WD 4HIHB 3V52H 5FUZH 1MCCA 4QHLB 4Y4FD 5FB8A 4XXDA 5KTEH 1FL3B 3I85A 3FT2B 5DT1L 1U8QB 1U2HA 2EYRA 4YHIA 5C0IA 4JM2B 2J88H 3VFGH 5D9SB 4LCIL 2DN7A 3CFEB 3X17A 1DE4A 4P3DA 4R0LB 5I1LA 3UPCA 2CKBA 2R15A 4DKEH 2PYED 2QQLL 4YE4L 3TLRA 1W0WB 2YA1A 1TNNA 2FLRT 1IVLA 4LCYA 5FUOL 3RY5A 2R0ZL 1I9IH 5EIQA 4HAFA 1FAIH 1PY9A 5D7KD 3U1SL 5IK3A 5TDPA 4P3DB 5I1LB 2GSIA 2C1PA 4ZFFB 4K8RH 4KQ3L 4ZXBD 5D6DC 1RMFL 3QNYA 2OTUB 4FN0A 1NGZB 1RULH 4JKMA 4WCYL 5TF1H 5ABDE 2CLRB 5CBAA 1HH6A 4JAMB 4MHHI 4XWGH 1PBYA 4OLXH 4XXDB 1KJVA 5GS1A 4JZJC 3LMJH 4MHHG 4NZRL 2CUIA 2BSRB 3OKOA 1ZLWK 3QAZC 3TA3B 1H3UA 3MLXL 2ZZUT 3GNML 2YPLA 2A73B 2DWEB 4O5LH 5IB5A 3U83A 2A6DA 4Q7DA 4YGVB 3DX8B 2ICEB 4NBZB 3MRKA 2NW3A 2DQDL 4LIQH 1JL8A 3HZKB 2O61B 5J1AB 3MV7E 3LAFA 4LMQE 1A7OH 4WO4B 5GRVK 1DBKH 3TVMA 1TDQA 2WBJD 5KS9F 3ULVD 4EEEA 4GG6A 2JF1A 3SE8L 1QRND 3QEGH 1TCMA 4BH8B 1CF8L 5A2FA 4KRPB 3RWDA 3O3EA 3TO4C 2VABB 2E7CA 3LQZB 3MRPB 4FQXB 1QR4A 3BQUD 1MREL 4MA1C 5DTFB 5EUOB 1VGEL 2H6PA 4OLWH 1OAKL 5DD3L 4HH9B 1XCTA 1AO7B 2JELL 5DJ0B 1H8SA 1CLYL 3MJ8A 4BZYA 2ZPKH 1WLHA 4R8WH 4M62H 3SE8H 3UTPE 2YUZA 4Z78B 2ADGB 2W1NA 5E8EA 3JV6B 3IF1A 4YHNB 4I2XA 3PWVB 2JIXB 5FGBA 1UG9A 2F8VA 4EDXB 2L7JA 4XT1C 3EOAB 2J2ZA 3QSKB 4Z7QF 1JGUH 4PV8B 2ZKHL 1AGFB 1A14H 4WHCA 3WS3A 4L1DA 3DI2B 5EG6C 5C71A 4O2EB 4JY6B 4JVPA 2GSGA 3BHBA 5CJQL 4PPTA 3QDMB 3VXNB 4L3EA 3O9WB 2LTQB 5EZJA 4HLJA 1PZ5A 3C9NA 1BFOA 1IBGL 5F7DB 3QPXL 1DQLL 4P4KA 3O4OC 1CE6B 5I30L 5A2JH 2R1WA 3GMLB 5D1QB 3SQOH 5HHQB 3W39A 4Z7WB 2DWDB 5HHXL 4WI7A 1Z9MA 2BVQA 3TNNA 1N7MH 3QCVH 4TPRL 5C07A 4KGJA 3RBSA 3OPZL 1MVUA 3SDXE 1IAMA 4RFNB 4XC1L 5DD1L 2ZUTA 1AXTL 4P3CL 1QVOA 4JVWA 4XTRC 1CICC 4TNWK 3VFPA 5MEQA 4X4XA 1FNEB 3I2CH 3ZMRA 1BIHA 2VB5A 4PV9A 4Q6YA 5HDOA 3BP4A 4QRRD 5C0BB 3GSQB 4UZGA 1KCRH 3BAEL 4GXUM 1A21A 1S7RB 4G80A 4Z7OE 5D2LA 5ACZB 5GS3A 3VWJA 3GMNA 5CP3H 1W2KT 2EDKA 4MVBC 3ARGC 2VDOL 2QLVB 1X5FA 3GM0A 4IJ3B 3WJLA 4GG6E 4PJHA 3PWLB 1U8JB 2VAAB 4TSCL 2VLKE 1GL4B 4ORZC 3DMMD 4HLZG 2IFGA 2IPKA 3ARFB 3QYCA 1Y18B 4XP1H 4PJFF 2IANB 1QLFB 4JFDD 4U6XB 3RKDC 5HGBB 1RJZB 1SBSL 1U8OB 1WZLA 1IGJB 1G9NC 2JJUA 4XNUH 4BH7A 4M03A 2EH8L 3IYLW 3CDYA 3ECBB 4WU5B 5JDSA 1EGJL 3VG9B 4YUEH 1FGNL 5JOPD 4RSVA 3PG2A 1QOKA 5D2NA 3QP3A 1AR2A 3QG6B 4Y88A 3TBVA 1KT2B 1FVDB 2NMSA 2WBKA 4PJ9B 1RD6A 5ERWB 2KBGA 2ZKHH 1P6AB 2VR9A 5E24E 3QUKA 3ZTNL 2NX5D 4RA3A 1TJIL 3MGOA 3WFDH 3QO1A 1UQSA 3SE4A 5T1LD 1CFVH 2GUOB 4D0BA 5EZLB 3KPLB 2NW2A 3I50H 3DV4A 3WN5B 1DQJA 3D9AH 3SKOA 3I6GA 4OCYH 4PRPD 4Y16A 2OZ4A 3FOMB 2BC4A 3JUZA 4PJ5A 4XZUB 1J05B 2DM2A 4C55A 1I1FA 3N0PB 4JY4A 1S5IH 3I50L 3OX8B 4LDLB 5C0AD 1EFXB 4N5UA 3PXHA 5DZNA 1Q72L 1IQDA 5LVEA 1UXSB 3BH8B 3HI1B 2HFGL 1EAJA 3ZTNH 4IS6A 4WHYH 3S37X 2MSPA 1V3JA 4OD3L 1YMME 4PJFB 5DS8B 3NACL 3RIAF 2EICA 5IHBA 1PKOA 4PP2A 3TYFA 3GIZH 4MCZB 2C26A 3MRJA 3C6LC 5C0BD 3IKCA 4RQQB 2DIAA 2PN5A 4Y5YC 4AIXA 3M8OL 5MEPA 3ZT5A 1N5YH 3VXUD 4O4YH 3CFJA 5FO8B 4Z76B 4NM4H 3ZZ1A 1Q9OB 1BBJA 2XA3A 1L6XA 1JI1A 4DKFL 5DSCB 3CSPA 3MBEC 3O8XC 1R3HB 3UO1H 1WBXA 2J8UA 3DIFB 4N0YH 3EFDL 4OD3H 5C09A 4G8EB 4EI5B 4JFDE 4GKNB 3C2SA 3DX7B 4S2SA 1PW3A 5F3BB 4P46D 3BGFC 2HFFB 3FMGL 2E9WA 1U3HC 4JHWL 4HWBL 3QA3A 4IIQC 2C3VA 2FL5B 2NY6B 3C08H 4MX7B 3VMNA 4CVZA 5I1HL 2EEBA 3KYOB 4LPWA 4KTDL 3CSBA 2WWKO 4Z77A 2VITB 1XCQB 3VDAA 4X0KB 4YHKH 2D0HA 5KVGL 4LL9A 2FR4B 4KZDL 2UWEA 3C5SB 1ZWIB 3SDYL 3MV9E 4JRXB 2ZG1A 1KT2A 3PQYB 4PLNC 3V0VA 5CILH 2GAZB 3CFDA 2WMPA 2Q6WA 1ZLUK 3L5XL 1MRCL 4NJ9L 4LASH 1KPUA 3BMVA 4JGJA 4LSVL 1MCDA 4NC1E 1ACZA 5FO9A 1A1OB 3V6FB 1KG0A 2ICWA 1ZHLA 3S34L 3ULUE 5A2IH 3PGCB 1HHIA 4M5ZL 4XVTL 4LFHD 4OQTA 2R4RH 1WT5A 4ZO8A 4JHAL 1QSVA 1IAII 4HBCH 5EUOF 4Q9CA 4J6RH 2ZOKB 3UZVB 2WWKT 2EXWC 3RVTC 2VLKA 1IMHC 1UB5B 4DCQA 3WJJA 5IV2B 3IXAB 3WO4C 1MCOH 4BFGA 3VFMB 3IETA 1OTUD 4GLRI 4LLYA 5KANG 3NCEB 3TV3H 4PJBF 4HG4K 2V2WB 5B8CA 5GGQH 1KGCE 4LGPB 4WW2A 4JFOA 4O9HL 4WEMB 4J3VA 2X10A 4GAGL 1CZ8L 3IRZA 3IDMB 5HPMA 4OB5H 4ZUUA 1WAAE 4XC3H 3IFNL 3W5MA 4TVPL 2Z9TA 4BUGA 2X1QA 4HD9A 2BRRL 2NY2B 4LCCA 4NN5B 2R8SH 5I8OL 1T0MA 5F7LB 3GK8H 1YEIL 1I7UB 1FE8H 1CXLA 3DO3A 4NM8H 4U1JA 4WO4C 1KCVL 4M61A 5ESAA 4UAOB 1LE5A 1U8LA 4PUBL 2R1WB 3GMLA 4JDTH 2GY7B 4YAQB 4AG4H 2XWTB 5ICXA 1MNUH 3F7VB 3W2DH 1FDLL 5IT2H 4C56B 2F5BL 5GS0H 5GGUA 1O0VA 5EOQL 5E94B 4J4PD 4OCRH 2YD2A 1H3PL 3FQUB 3FN0H 4PGZA 4CDGC 4QKXB 3VXOB 3W0WA 3VD7A 4XPTL 4QHMA 2J4WH 1NUFA 4OM1L 5C7XL 2JIXA 1U8MA 2DJUA 3QEQB 1JFQL 3NA4A 5D2LF 2PO6C 1N26A 1CICD 4HV8B 3FQXB 1RZGB 2P5EE 2GQHA 3VJ6B 5GXBB 7FABL 4XAWH 4EVNB 3PHOA 3SGDH 4AH2B 3OF6D 3V0VB 5A2KH 4QGTA 5EBGA 2LTQC 2XN9A 3TIDB 3DUUA 1RZIB 1A7BA 2AXFA 1S9XA 1RMFH 5C0BE 1ULVA 2AEQH 2A6IA 3VGAC 3QUXB 3MMEA 1R24A 4FQQA 2VSDA 1U3HA 4LCIH 3HZKA 4D9RD 1SVCP 4ZOEA 2O61A 1XGYH 1CL7H 4HKBA 2L0DA 1T7VA 3LVEA 3Q1SL 3VH8A 1A22B 4KUCF 5DT1H 3PHOB 4HWBA 1D5MB 1K4CB 2A2QT 2NW3B 4GO6B 4LSDA 4NZJA 3VWKD 3UTSD 4Q74A 5L8JB 2FDBP 3EKCA 4MQTB 1FC2D 1MFBH 1F3DJ 1GAFH 1JP5A 5H8DA 5IB1A 1KLUB 1WBZB 4L3ED 4PRPE 3AS0A 2IPTH 3KGRA 5JHDB 2YSSB 3O3UN 3HS0A 4MNGA 1AR1C 4XNQA 4YXKL 1MIMH 3FQTB 1R0AH 4O02L 1ES0A 5E94A 2ZSVA 4ODVL 3C09C 5GS0C 3HB3D 3S3JA 1IC4L 3O41B 1NH6A 3IRPX 3LPGA 5J0BA 5MI0C 2C1PB 1VFUA 1BQUA 4JJ5A 5EO0A 1QKZL 5K93A 1MHHB 5GJTL 4RISL 3C87A 5GGVY 2V9QA 4HBCL 1J86A 1OF2B 3QDGE 3HZVA 3TO2B 2RBLA 1CLYH 4QY8B 1YEGL 4JJ5B 5EO0B 5MP6L 4KMTH 1FSKB 1FDLH 3MLPA 1AGDB 1A6VL 4C83A 5DK2B 2Z4QB 3O0RL 5DGRA 3K1DA 3S37H 1SJEA 5HYJA 4UUJA 1Z9OA 5I8CB 5J4MA 3CH1A 3N1MC 3P4OB 1YEKH 5DJ2B 2X1OA 4UQ2A 4XPAL 4QXGH 1DBKL 3KPSD 4HUWA 4HGWA 2CDEB 4P49A 4K71B 2G2RB 3D18A 3F12B 5F7NC 3L7FB 3W11D 3O0RH 2VLME 2CKBH 4HC1A 3FQRA 4RMSA 1CYGA 3RTQA 1GGYA 7FABH 5KSVB 4U1MA 1IQWH 3H2WA 4OF3A 2W0FB 5GSRA 5SWZB 3UTOA 2PNDA 4ONHA 4TYUA 1Q0XL 2UVEA 2YD3A 4QY8A 4M3KB 4YXHL 5IMMA 1CD1B 3FT3B 1A1OA 4WY7L 5TH2B 4OD2A 1H3PH 5T1MA 1NQBA 3DTXA 3S4SB 3ZDXF 1KPUB 3JTTB 4LPUA 4GMTL 3F58H 5E2VL 1S8DA 2KH2B 1UCTA 4NQTA 2F8OA 2VIRA 3EUUA 5LBSH 1E28A 4R4FL 4XMPL 1Z5LB 4LLWB 1JZ3A 1EEQA 5I66A 3DGGA 3CX2A 5J11C 2OL3H 2FB4H 1YY8A 5E8NA 3FFCD 1OAYL 1BGXH 1X5IA 5IMMB 5CFHA 5IB1B 5E99L 4NQCB 1KB5B 1CFNB 4QRRB 4R4NC 4TRPH 5L8KB 3QUYB 3MLVH 4DN4H 3OJMB 4Y16C 2VR5A 4P4RB 1R3LA 3RGVA 1ND0A 4GKNA 3EO0A 1UFUA 4FQPA 3D3VE 1OD9A 3VH8B 3PE9A 4IOIB 3CFCH 4HKBB 1U3HB 5L2JA 1ZSDB 3RHWK 4ZAKD 3MNVB 4ALAL 3D9AL 3IDYC 4OCXH 4TUJA 1G7JB 1NMCC 3FL7A 2VXSH 5EN2B 3QR2A 2BOCB 3QDHA 3CH1B 1S78C 3BT2H 5E03A 3B2UC 1J0IA 3O6FD 3C6SB 3T2QA 3TH2T 4XAKD 5DK2A 3V4PL 3VA2C 2FD6H 1XF4A 4JO2H 4ODUB 1GIGH 1XZ0A 5F1SA 3KPSB 5E5UB 3OHXA 5IJKA 4HUXB 1KOAA 3U9PL 1HSAA 1GGTA 4ODVH 2JB5H 5D71L 3WDIA 3FO1A 5DYOA 4DGIL 1RIVH 2Z35B 3PP4H 5M94B 4YC2B 4POZD 3B2VH 5DD6A 3NTCL 2F9BT 1MRCH 3OXRB 4P46A 3PWVA 3H9SD 2EDTA 3FQUA 4CVUA 4RAHA 1XGRA 4YDLC 2V2TA 2AJ3B 4EIGB 3C5ZA 1B0RA 1TZHA 1U8PB 4PRID 12E8L 5DJ0A 5BV7C 2R39A 3LEVL 3QQ9C 3F7VA 5B4MC 5I1EH 1RJCA 4YAQA 1HNGA 4GQ9H 3MLSL 5FHBH 5T5NF 3V5DA 1QFWH 4OQTH 1K6QL 2UYLA 1MFNA 3D39D 5I18H 2IG2H 4XVJL 4PRPB 4ZO7A 1BQHG 3GMOB 3REVA 2VLRA 2FYYB 2DQUL 1ZLVK 3A6BL 4IRJD 5J1SC 3ZKMD 4QHNB 4CADB 4HKXA 2YD6A 3DI3B 2V5TA 1XIWA 3MV9A 4DN3L 4QOKB 4BSWB 4PJAB 2ICWI 3FMGH 3C5SA 3AM8A 4KK5C 4WU7A 5IB5B 2C3HA 1KEGH 4PJ5E 1F8TH 1F6FB 5ELIA 3UJTH 1XGPA 2BSRA 3OKOB 1AR1D 1J0ZA 3O6LL 3LN4A 3B9KB 3HG1E 1RZIA 1NAML 3LY6A 3RUGB 1QHPA 3RWEA 2VLJD 3T0ED 3IXAA 1JWSA 1DQQB 1JMZA 3C60C 3FB6B 3VXUB 3RIFK 4G8GD 5KSAA 1KIUA 3U4BL 3IDGB 3JV5A 3RU8L 3NACH 2E9JA 1G9NL 1JGDA 3P0GB 4FQXC 4ODTL 3WEXA 3EJJX 2YXFA 5KSBE 1KULA 1IGYB 5IK3B 3VU2A 1GGCH 4GKSA 5E5MA 3ARTA 3EYUH 4NKOA 2ICWB 5HHPA 1HKFA 3L5XH 4G80B 1NBVH 3UTQA 4ZFZB 2B4CL 2FJFB 1RUML 1JPSH 3OWEA 5EBLA 2MHAA 5TE7L 4JPWH 4LLVA 5KN5B 1FNEA 2E7LA 3VXTA 5DRWB 2HFEB 1AY1L 2BDNL 3MCG1 3LDBC 1QSFB 1AGBA 3RY4A 1P2CA 4PRHD 1V05A 5IF0A 1EIBA 4PGEB 4PJGE 3RKPA 1U8LB 1P4IL 1DCLA 1MVUB 4MZ3A 1Q9WA 4HDIB 5KVEH 3AS1A 1XF5B 3VMOA 1FGVH 1S9VB 4L8DB 4HS8H 5DD0H 4FP8L 5LAXA 4JHWH 4OUUB 2XKNB 4PY8J 2DQJH 4CBPA 2D2OA