1NGPH

N1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3-nitrophenyl) acetate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
215
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N1G9 (IGG1-LAMBDA)
publication title Three-dimensional structures of the Fab fragment of murine N1G9 antibody from the primary immune response and of its complex with (4-hydroxy-3-nitrophenyl)acetate.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 39
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 1995-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH02
3R06A 3QDJE 3IVKA 3RWEB 1V7ML 1OT1A 1HXYB 2XN9B 3PDOA 1SM3L 2EH7H 4PJGB 2V2TB 1JK8A 4ZS6D 1KB5L 3L1OH 2A6JB 2H45A 5DUML 3K8KA 1QVOA 4UIKH 3NA4A 4YJZL 4NKDB 5JDSA 4MD0B 3QEQA 4Q0XH 5SV4A 2MHAB 4PTTA 2AK4A 3C5ZD 3KXFA 4ONGH 1XIWB 2H3NB 1KB5A 3DGGA 3A6CL 2FX7L 3SKUD 1OY3B 1J0HA 3GKZA 4OZGA 2XNAB 5AYQA 5L0QC 5DDHA 3T8XB 1TPXC 2VZUA 4NZRL 3MUGA 2NMSA 3GI8L 4PJEE 4RIRA 3LAFA 5DVLA 2R2BA 3L3JA 4JDTL 4GAFB 2OK0L 2BSSA 3O81A 4PLNC 2BRRH 4XMPH 2VDLH 1PW3A 4N0CC 3O3BA 1KPRB 1VEPA 2VDRL 3WDHA 1TDQA 3MODL 4JPVH 3JV5A 1CLZL 1HILB 3DX8A 2K1MA 1L7TL 3PP4L 3F7VB 2EIDA 5BZWA 4DQOH 4JRYB 4MD5B 1J9CT 4DEPC 3FO2B 5KG9B 3DTXB 3TCLB 1SVCP 4L29B 1AD0A 2GYSA 1R3IH 1FGNL 2ZUYA 2ICEA 5I16B 3RGVD 4F7MB 1F6LL 3G6JF 5IB1B 4H8WL 1QTYT 2VB5A 4HFUL 2YA2A 5E8PB 3ARTA 3GB7B 1LP9F 1G6VK 3HPJB 1O7VA 1MIML 4GS7B 3ULSB 3MBED 4CDHA 1WITA 4UDTB 3RWHB 4F15B 4M7KL 4QHMB 2A73B 4JFDA 3B9KA 4RDQF 2CR6A 3QEUA 1U41A 2BOBA 1LGVA 2CLZB 3ZLQC 1BFOA 4QRTA 3MRCB 1TQBC 2CK0L 5A1AA 5I9QC 3HI1B 3T04D 4MVBD 4YFLI 2XWJA 5BS0A 1JF6A 2BNRB 3DUUB 3G5YB 1QLRB 5DMJB 1UB5A 3N9GL 5F7KC 4R7DA 2R15A 2HT4D 4F80A 2V2XA 1GH7A 1J05B 4Y16D 5EOCH 4Z6AT 1S7TA 1A6UH 3MCLL 2PKDA 3WEXA 3VJ6B 3SKOA 2Q3ZA 1YJDL 2P5ED 1N3NA 3IFPB 1UWXK 2VR4A 4S1SH 2BSRA 2DS4A 5DJ6A 4R3SB 5DMKA 3C08L 3ARXA 3VCLB 1YY8B 4OD1H 1YUHB 2HT3C 2EDYA 3GMRB 1JNLL 4RNRB 4P5TD 5E2WL 4M43L 4OCWL 3WD5L 3V8OA 1FSKC 4PGBB 3U9UA 4HPYH 3E3QE 5DJ0A 5HY9A 3JVGA 3MRHA 3F6IA 2DQGH 3FQTB 3WS6C 3TBVA 1YEEL 2Y06H 3S37X 2FR4A 2PO6C 3BPNC 2VJXA 1CXFA 4HAGA 4J3VA 3SDDB 3JV0A 1N5AB 4O2FA 5T3XH 3MNVA 3QUYD 5CFHA 1UWEL 1AC6A 4FZ8H 4WO4A 5GS1B 1Q9OA 3MRIA 3OB0K 3EHBD 2QSVA 2HFGH 3QIBB 1OVZA 2WK2A 2VQ1B 3ZHDA 2B1AH 4I3RH 1C8PA 1BVKA 1EK3A 5I74B 4Y4HC 4R8WH 4YUEL 1VFBA 4IS6B 1W0YT 1GC1H 1MCLA 3QA3B 4PLJD 4GKSB 1DBMH 3TJHD 1UM5H 5TF1L 5FDWB 3QNYB 2PW1B 3CFEB 3AS2A 3Q48A 3QWQB 5GGVL 3VFPB 2AJZA 12E8H 2MJWA 1I85C 3REWB 5IVXF 3BKJL 2P8MB 3CSYB 2ERJB 1M7DA 3RDTC 4I8DA 1KTDA 2HT2C 1HHJB 3OKNA 4UV4H 4MNQD 2FHBA 3HB3C 2VKXA 3U4BL 4NUJA 1XR8B 2X42A 5CHNA 5TPWH 3IDNA 1BJ8A 2CH8A 1DBKH 2PW2A 3MGOB 2OCFD 4I1NB 4HXBL 3GSXB 3PGDB 1OB1A 4ELMF 3VXRB 3ZE1E 1NBVH 3KGRA 4QHNA 3SGEI 3BQUD 5DLML 3U30C 4TN9A 2AERT 4HMEA 4QRRA 4G7VL 3WFDH 4AIZB 4NNXB 1MFEH 4PJ9C 3IDGA 4KMLB 4ZO8A 5IVOA 5ISZB 4KZDH 5L7XL 4LLAA 1IC5L 4PRPE 1G9NH 1OD7A 4V1DD 1JWMA 2NX5A 5DVNA 5CEZD 5EO0B 1S9YB 3ARVA 1DQLL 5IW6B 5D7IF 3WO4C 5DQJA 5FKPA 4I5BB 5JOPE 1U92A 4HKZB 1A7QH 4NC0B 1CXLA 4OLVH 5HHPA 4NPYA 3GNMH 4MLSA 4RFNC 1FZJA 5DD1H 4CW1B 3ARBA 4H0HB 2OR9L 4OSUH 3CFBA 4KK6D 1KLUB 2GFBB 2EC9U 4UT6L 4WV1A 1EA9C 4U1HB 2EDJA 5EB9A 4DK6A 3EOYG 3UPCA 2H1PL 1RU9H 1JPTH 3RHWK 4IHOA 5DQ9B 2ESVB 3X3FL 4ZPTB 1JV5A 1FZMA 2DWDA 4CMMA 1BQHA 3V0WL 4F8QA 1I1CA 4U31A 4G6KL 3PQYE 4ZFOL 3V7MA 5E4IA 3IKKA 3HG1A 5HYQA 2F8VA 1QSFB 2BHZA 3F7YA 4XB8A 1FZKB 3VGAC 4FQQB 1UFUA 5D93C 4ZFOA 2R1YA 3QHZH 4XMLL 4HIHA 1QFUH 2DLHA 4MAYD 3MRKA 3FN3A 3KG5A 2EEBA 1UZ6E 3OGCA 2EDOA 4L3EE 3SDYH 3MV9B 1VHPA 4OFYA 3RPKA 5LXGH 4A6YL 1IGCL 2RFXA 3KYNA 4XRCB 3CVIH 4NM4H 1QACA 4ERSH 3T0EC 4LLDB 4GBXD 3L3IB 4P2OD 4X80H 4JE4B 1AGEA 5AUMA 5CEXB 3QEHA 5HYSA 1TTGA 3QUXA 5I71C 1HZHL 2A2QT 4KAQH 5D1QD 5DR5L 2JB5H 4JAMA 4A6YA 1DUZA 3HNTL 1W8NA 1X6NA 2FBJL 3GZKA 1U8KA 1HSBB 4KUZH 1FRGH 1KCUL 2O61B 3WV0A 4JFED 3GSVA 4Q7DA 5TGBA 1FFNB 4IRSD 1T1ZB 3BP5B 4KRNA 5MI0C 1MHPL 2NLJB 3VWJB 2MKWA 5DC9B 1FVEB 1MIEH 5JR1H 5E94A 2BMKA 1MCSA 4ZDHA 4DOHB 4E42A 3DROA 4LARH 2M2DA 2VXSL 1BLNA 2QHLA 5IBUG 5CUSL 1KJ2L 3IDIB 4YZFF 1K5NB 4UOJA 3WLWC 1V8HA 3TVMD 4Q6IA 4HBQA 2PYEB 2D03H 2DD8H 2HN7A 1KJ2A 1A7OL 2LTQC 3WXWL 4DUWA 3GK8L 3ZE0F 5I1IL 1T0PB 1TZHA 1JPGA 3GFUA 5C09A 3C8DA 3T3PF 4LLUB 4WHCA 4XP9L 1SQ2N 2O93L 3FFCE 2FWOB 4ZUWA 5EZLB 1RI8A 1PBYA 1T04A 4XVTH 2EYTB 1R5WA 4KQ3H 3UZQA 1MRDH 2UY6A 3EJJX 1QLEL 1U3YA 3B2VH 3ISWA 3O45B 4AL8L 3TT3H 4GO6B 4TRPL 1CFQA 3DUSB 4NNYA 1CICC 1C16B 3ULVF 1TJHH 4G8GE 4FTVD 3QNZB 1A7NH 5FO8B 1S3KL 3P9WB 4Y4KB 4YDVB 2P24B 5F7MC 3ZTNL 1IEAA 5GSRA 1F3DJ 4OJFH 1I8IA 2A83A 3O6KH 3SDCA 3DPBA 1JUFA 4MJIE 5D72L 2Z91B 5JNYA 1FORH 3LEVH 5C0BD 2EE9A 5GGVY 2CO7B 2UUDK 4MX7B 1XGPB 3S4SB 4MGXA 3AFLA 4HIXL 3VFWA 1M7IA 1U8HA 4JDVB 4NC2B 3DI3B 1F8TL 4QHUB 4XVSH 4ODSL 4YBLB 4MCZB 5H37G 4KXZI 4LSTH 1H8NA 1BGXH 2R56H 1AR2A 1JYVA 5GGSA 3K8MA 3RWIA 2K7PA 4OD2B 4S2SB 4AZ8A 1RAMA 3QG6B 5EN2A 4Y5VA 3KWWB 3TH2T 2AV1B 4LCCB 1FFQA 5DVMA 3QDJD 3KPMA 3O3AA 4XVUC 5E0QA 4JCMA 1YYML 2FD6L 4ZSOE 4CU7A 1NH6A 1AP2B 1OP5H 3PV6A 3FB6B 3G08A 2Q8BH 3VI3F 2DYPB 5T1LA 1KIQB 1A1OA 3G5VA 3BP7B 1XMWA 1ZGLB 3U6RA 5HHMB 6FABL 1UKTA 3LMJL 4XNYH 3OHXB 3W0WA 3SCMA 3HNVL 4ZQKB 1RULH 5KS9B 1IL1A 1A6AB 5MP6H 2OI9B 4F57L 4L8CB 4D0CA 3QI9A 4RMSA 2CR3A 4IDJH 2Q87A 4WUUD 2Y5TB 2K7QA 1Z3GH 5IHUH 4RBPH 4G6JL 3LS4H 4Z77A 1RZIB 4OQ1A 3TJEH 2VLJA 1BBDH 3IS0X 4P23B 4U1LA 2B20A 2AXJA 4X9GA 3PXHA 4I4WB 5AG9A 3NTCH 4N1CA 4O2EB 1CU4H 2WWKT 4MXQC 4JDZA 3ZDXF 4DUVA 3PGCA 2V7HA 4QCIA 5KBNC 4ELKB 4TSAH 3QEQE 4PB0H 2ARJA 1GOGA 4HLZH 4M61A 1V3KA 2O5XH 1WZ1H 1F97A 3IRZA 4UAOC 2YN5A 2NY5C 5BW7A 3D5OF 4UT7H 1KJ3L 4DN4L 4OZGE 2APBA 5FFLA 4WUKH 5CCKL 2IAMD 4DGIL 2UZIL 5FA3B 3NFNB 1KG0A 3QZWA 1YY9C 3Q1SL 2Z31A 2VABA 2DJSA 4HUNB 4D3CL 1MLBA 4XNQB 3I50H 1HINL 1DVFC 4AT6A 1EFXB 3ZHLA 3OBAA 4N8VB 1VERA 3FO9A 5ESVA 2E6JA 4QYOB 3N1QC 1A6TB 2B1HL 4K7PX 4KMTL 3I02B 5EUOF 3Q5OA 3PHSA 1OAZH 5ACZA 1DSFL 3SY0B 3FONA 4J2XA 4LSSH 3GSUA 1NEUA 5I8OH 1N59A 3O6LL 1CF8H 5CKAA 3U0PB 2IWGA 3GMOA 3W39B 1YEIH 4M8QA 2J8UF 5JQ6L 1PZUB 4AG4H 1XH3A 3IT8D 1U3HC 3DXAB 3GM0A 4U1GB 1C1EL 1EGJL 3JUZA 1VGKA 5IFJA 5EZIH 2V17H 3MACH 5J06A 1UACL 4FMKA 3HFML 3QUZA 5C0AA 1FVDB 2LFGA 4H1LA 3RKDD 5GXBB 1KFAL 5CP3A 4PGEA 1KCLA 1EGJA 4JFDE 3LEYH 4LQFL 4P48A 3UTZA 3O9WD 4U1MA 2VDNL 2UV3A 4HIJA 3FO1B 3CXDH 4XP6L 1OTSC 5BS0E 3QJFB 1BX2A 1DBAL 1UJTA 1WFUA 5JW4Q 2HLAB 4RGOH 1M7XA 1T7ZA 3AMKA 1QR1A 1JL8A 4C4KO 3KPRD 3MV01 4JJ5B 5DJDA 1RIVL 4PB9H 2P8LB 4PJFA 2I25N 4O58H 3G5ZA 3VGFA 3MLYH 4LPTA 4XT1C 2CRYA 4J6RL 1UZ8B 5F7EL 3PL6B 4H8WC 1RK0A 1U8LA 4Y4FA 3B9KC 3VGDA 1R3HB 3DIFB 3IU4L 3H0TB 1Q9KB 3LN9A 5HI4C 3O8XC 2VLLA 3HZKB 1FAIH 1S9VA 4G6MH 3KLDA 3UBXG 2HH0L 1F11B 5E7BA 4HHAA 1NBZB 2Q76B 4Z7UA 3BW9A 1QRNA 4XCYA 5DQDL 3BEWA 2NY0D 3TIDB 5F1IB 1ZANL 2HJLB 5JZ7D 1RHHB 4LCWA 3TYGL 1UQSB 2P7TB 3TZVC 5E1AA 4ONFL 4DZ8A 3DARA 3NOIA 1TETH 3DX6B 1TCRB 3F58L 2ZCLH 4AJ0A 4OZIE 4E41B 4MNHB 5FYJL 3KPSA 1JNHB 5JHLH 2VYRE 3OB0H 2CGRL 5D7JA 2J12B 5GGSY 1FH5L 4PJCB 2IADA 1HQRB 1IAIM 3P0VL 4LDOB 2HFEB 4Y19A 5CBAB 5F9JB 4JZJA 4P59L 5TE7L 2DAVA 3U0WL 1E6OH 2PXYC 1UJ3B 4PV9B 4XCFL 1YJDC 3IXAB 2XICA 1RHFA 1MCRA 5E2TH 5JXAL 1JGVL 4HGKC 4CN4A 3MV8E 1KEMH 1L4IA 3TPKA 3ZL4L 2X4RB 3MLSH 4MA1C 1T1WB 2KDGA 5E70A 1RK1A 2YA0A 1AXTL 5EA0L 3RZCB 4MLIA 4RAVB 1FNEB 3W82A 1EVTC 5K9OB 3NZ8B 4WO4C 1FPTH 1BFSA 4XXCA 3LKNB 1T21A 1G7QB 3W9DA 3GBMH 3VDBA 2AJ3A 1P7HL 4NQCE 5JOPD 5ESAB 4NQEA 4UINH 4G6AC 4JHZA 2EYSB 4RGMB 4FXGA 5BV7B 1L0QA 4MWFA 5B38A 1N0LA 3P4OA 4YHLH 5B8CB 1OD9A 5DO2D 3RQ3A 5D70H 5J1AA 5JUEH 4R90L 1PEZA 1MUJB 2W9DH 4R0LA 1I7TB 2PYFA 4HC1L 4K23L 3STLB 4EVNA 2NY4C 1CWVA 3L3GB 2MQ0A 2ZKHH 4L8SC 1P6AB 3GSRB 2GK2A 4YHPB 3QRGH 4IRJA 1BF2A 5D2LE 4DTGL 3GKWL 4XVJL 1DLHA 4KDTC 4HPOH 2R2HB 4Y2DD 5F6IC 3IETB 4HC1A 4ZXBD 3FQUB 5DD6B 1H5BC 1PKQB 1XGTB 3VFNB 2R8SH 2Z93A 4X8XA 4NUGL 3R1GL 5E24E 1SJHA 1RZ7L 1IZJA 4JQIH 4NN5B 4KI5C 3T09A 2PTUA 1TNMA 2GI7A 4FXLA 3BWAB 3CZFB 2AKRA 5EBLA 1G84A 4Q9RL 5I19L 5BJTA 3F5WB 4G8EB 5DMGD 4KY1L 2P49B 1G7JB 2QR0A 5KSBF 4PJ5A 5C07A 4L3ED 2NY1B 1P7QD 3TH4T 3IJSA 3IFNH 3SO3B 1NMAL 1HHKA 4NHCL 1JRHL 5I1CH 1PX3A 3NA9H 5JA8B 1MREL 1A3LL 3SE4C 3B83A 4CKVX 4LGPB 1CFTA 4BA8A 1T2QH 1CDBA 4ZUSB 3U79A 4V2BA 1IM9D 1UB6B 4I77H 3MLRH 4J23A 1S7UB 5JOFB 4IRZH 1NC4D 3ME0A 8FABA 3ZKSD 4F58H 4X6BB 1CD0A 5EU5B 2ZSWA 4W6XB 2R4RH 1ZWIA 4UNTA 3QFJA 3EYVB 1G7HA 4JFFB 4WV1C 1T66D 1I9EA 4E5XA 5MEPA 1TVBB 1J11A 4BH8B 5J89A 2A6DB 5HHXH 4P2YA 4YH6A 2C1OB 3WXVL 5DRXA 2FJGB 3VFVB 1NUDA 3BKYL 2FJHB 1IGJB 3X14A 1HKLL 2F8OA 3OL2A 3EJYC 4FFZH 1XCQB 3BRDA 4R2GD 4P9HL 1H9VA 3V6ZA 4YDJA 4PJ8A 4KJWD 4ISVB 3OKEB 3G6JA 1A9BB 3MV7B 3KR3H 3NFSL 3WMSA 1U36A 1LP9A 1A7PL 1R5VB 2YS4A 1JHTA 1A5FL 1S7SB 2ADGA 3X11B 4GUPB 3FFCD 3LH2H 3MUY1 1BQLH 4P5KB 4TSCL 4YXLH 4OLWH 1QNZL 5LCVH 1LO3L 4QO1A 1I8KA 2CDFA 5DS8B 2Q86A 1NUNB 5ADOL 2R23A 7FABL 5IESL 4G8GD 4X4XB 1X7QB 1SYVB 2Z92A 4JB9H 1HK6A 4LIQH 1B0GB 5FIEA 2VDKH 1FP5A 1GPOL 4KDWA 3QUXC 4YNYB 4MQ7B 4M6NL 1Y0LA 3OX8A 3D39A 2DLTA 2YKLL 3T4YA 2Y7QB 5C09E 3QCUL 5I18H 1VENA 4MJID 2XTJC 4RGNE 3LSOA 4HK0B 2VL4A 2GY5A 1EJOL 2N7BA 1P7KA 4U0QB 2ZG1A 2W9EL 1KYOK 4GRLC 5C0JA 1J1XL 3E1F1 1REIA 4IIQB 1T80A 5ITBH 1D6VL 2B2XH 4NKMA 4JEGB 2HAZA 3ZHKA 2I27N 1TJIH 4JO2H 2NXYB 4IJ3B 4O02L 3NIFF 2IBZY 5CGTA 1NFIA 3G6AA 4M5YH 3IXTB 4FP8H 4WGWB 3HRZB 5JPNB 1RJYA 7CGTA 4XBGA 3BVNB 3I6KA 3FQNB 3QO1B 3MLZL 1N8ZA 1FYTB 3IDYC 1QP1A 2H9GB 5GSVB 1JF5A 5FGRA 3LD8B 4I9WE 3U7YH 4FS0A 4YK4B 2DQIL 3LKPB 4RGNC 3IGAB 4QRPE 5I1LA 2UUDH 2GW5A 3BZFB 2VXQH 2W60B 3MOBL 5E2VL 5HVWA 4P2CG 4LAQL 3LPGA 2C3HA 3DVNB 5DUBA 1VACA 4APQA 1CVRA 2D0HA 3FO0H 5FO9B 2ENYA 4MB5A 4G3YH 2AJVH 1AFVH 5BXFB 2Z8RA 1E4XI 4N5ED 3V52H 1NBYB 5GGUB 4Q9BA 5B39G 3CDYA 1Q94B 2P45B 2X41A 3HE6D 5E5RB 2WBKA 4J4PA 2AXGB 4NWUL 5IVXA 3LPFA 2Z8WC 1A1NB 2BNRE 4N8PA 3UTSA 3SDCC 5HDBE 4XBPA 3T2QA 1RVFL 3MV11 4I2XB 3IJYA 1RV6X 1RIUL 4FNLH 4JFOB 4KKAD 3W0WE 1H0DB 1JYXA 5FHAH 4NNPH 1WWWX 3BH9B 4NO0D 5FO7B 3K3QA 5IG7A 5KJRL 4ZS7H 1IGYA 4FN0A 1AGCB 2G75B 4GAJH 4C56B 4ELMA 1JWUB 1YPZB 1VFUA 1MWAB 1T0MB 4DZBB 2VDPH 2Y36H 5EPMB 5JW3L 1LEKB 4PJBB 1Z2KA 2DQHH 1CBVL 2LVEA 5D7KE 2VLJE 3V4PL 2VN7A 2IFFH 3RWJA 3N1PC 2BVPA 3H3PL 4YGVB 1WC7B 2B4CC 2H6PB 4Y5VC 4U4BA 1H8SA 4JFHD 4OLXH 3ZYOA 5GZOD 1D9KB 2Z8SA 4IOIB 1UYWH 4FXKA 4Z7WB 3RU8H 4XPBL 5EIQA 1ZT1B 3FOMA 5I1EL 2D3VA 5D7SH 1I7ZA 2GSGA 2VOTA 1HE7A 5D7IA 1JPSL 2YD3A 5FYLL 1XAUA 2XA8H 3JV4B 1FL3B 5HTSA 3P73A 2AJUL 2AI0L 2LAAA 2AGJL 2GK0A 1ONQB 4X7DC 1DQQA 4LGSB 4MD4A 2IEPA 3QI9C 3V9FA 5J6GB 1EHXA 2B39A 2JJSA 1DUYA 2CMRH 3F7QA 5AZEH 5H2BA 3CFCL 3D0VA 5AYUL 1TVHA 3H9SA 3CFIC 5EO1B 3O4OB 1I1AB 3I9GL 3HE7A 4KTDH 3MCKB 1LNUB 4PUBH 4WEBL 1AHWA 4FOMA 2PTTB 5HPMA 2EIZA 1E4KA 1MSPA 5TFSL 1QKZH 5IBLD 3GMNA 1YEGL 5T1KB 1Q9WB 3DV4A 3ARPA 4HWBL 4DAGH 1KPVA 4R4ND 2FDBP 1UWGH 1FVCA 1NCBL 1FJ1A 4ZFGL 1AXIB 1BZQK 2E9JA 2NQCA 3JTSB 2K9UA 4HJJL 4OV5B 5BW7C 5D1XC 4HWBA 3MRRA 5FGBC 5HYFA 2NPLX 2WUBH 2J6EL 3ARGC 1T4KA 2NYYC 4LAJH 5D1ZA 5J1TC 4OCSL 2KKQA 4YHKH 2DQJH 3KDMB 4XPHH 2PN5A 4YQXL 4DGVH 2BVQB 3GO1L 2WINB 2Z31C 4RWYL 4O5LH 2Q3AA 3S6CA 3CMGA 4K7PY 5C0AE 2BVTA 3IAQA 1HQ4B 4YHZL 2J6EA 4EI6B 5SWZA 1VGEH 4QRQB 1I3VA 4GRWH 4XH2A 5HDOA 3FL7A 5BRZD 5E6IA 3I85A 1M71A 3M17B 1BOGB 5CINL 1J5OH 4QXUL 1ZEAH 3JSSA 5F9DC 5FEBA 2G5BB 4YLQT 2CLVA 4EUPH 4LOUC 5EC2B 2ZG3A 4P46B 2WBJA 1GOFA 2YC1A 3VG9B 1C12B 1W0WA 3HS0B 5CILL 3O41A 4NO3A 3OXRB 5LG1A 5TDPB 3BIKA 2IPUG 4Z7QF 2D31B 3ALPA 4OQTL 4ZTPH 4MMZC 5CEZH 1MEXL 3OWEA 1G7MA 1DQMH 1KYOJ 5T1MB 5FHBH 1MFCH 2A38A 3QUZC 4ZUVB 3UJJL 4OQTA 2WM0A 1IKFH 4Y88A 4YIQA 3BD3A 4OM0H 1GSMA 1HIML 3RUGB 5KSAB 4LPYA 5E9DD 4W6YB 1A4JA 2D9QB 3O4LE 1ACYL 3TWCH 3EO9H 3GSNL 1V7NL 5J3HD 1S7RB 4PJAB 5AD0A 3NCCB 1ADQL 2CJUH 5FOJA 5BVPH 4FA8A 5GRUH 5HBBA 1OGTA 1LVEA 4Z7UE 3T77A 3CD4A 3GSNA 5IBUB 2AJYL 3ULVL 5IR1A 3BZDA 1D5IL 3MV8D 4JHWH 4LCWE 3OR6A 4YHNA 4QXTA 1ADQA 4OCYH 5A2JH 2H8PA 4LPXA 4JY6B 1B0WA 5IKCA 2BRQA 2D7QA 1WQVT 3TBTA 1K4CA 3KLAB 3UBXI 4JHAH 5CZXD 5HYJE 4HS6B 2VE6A 4U1KB 5FB8B 2HLFC 3VGBA 3UO1L 4NQCD 4Y19E 3RPIA 3RBGA 4YFDB 4ESKA 15C8H 3ILQC 2YD9A 4EQ2A 2ICWB 4Y4FC 3K2UH 5JW4R 2M8XA 2XWTA 2YBRB 5IT2L 1JZ5A 2Z0BA 1XF2A 4HT1L 3TCXA 1IGTB 5A2KH 3MFFB 3HUJB 3T1FB 4HUVA 4R97B 5MEQA 3WN5B 5IVZA 1T03L 4BUHA 1OL0A 1C5DA 4EIZC 3UTTB 2YMXL 2QTEA 5F1OB 1CLOH 4OLEA 4DVRL 1X3DA 4IMKC 1XGYH 5K9JH 1NEZG 4LK4A 1ES0B 3MRBB 4LSPL 5D7JC 3WL9B 5J11B 1MCJA 1ZVHA 5IEKA 1HYRC 4NJAL 5EZOL 2X09A 1QSEA 4JZJC 3K81A 3K0WA 1KPUA 3QNXA 2AQ1A 4YO0B 3UC0H 3ARBD 1F13A 1WZLA 2FATL 4NZUH 1EFQA 4A2MA 3LEXB 1LD9A 1TXKA 2X7LA 3E8UL 1QFWM 3VXQB 2B4CH 3IFLH 1WCBB 2FLRT 5KAQG 3RY5A 1KLGA 4ODBD 4DCQB 3UDWA 1CLCA 4O51B 4BSJA 1P1ZA 2F58H 5L9DH 4X6FB 1HHIB 1S5IL 4XXCC 3L5HA 5GJTH 4TUKL 1T1XA 4H20H 2VDOL 2BOCB 4ZYKA 2CIKA 2EE3A 4H0IA 4FG6D 3BIBX 1LO5A 4UNVA 3B3IB 1YMMA 2BNQB 1AE6L 4F9PC 1NFKA 2OQJA 1K8DB 5C0IB 4UOW0 2X4UA 5HI5C 3MLXH 3B9EA 5F7YC 3TN0A 1I3GL 2WSKA 2XKNA 1PYWA 4JZNB 1B2WL 4P4KB 5KSUA 3VXNA 5F44A 2X05A 1FLRH 3FQRA 2OL3H 1DEEA 3WHXB 4PJ5E 5C07E 3VWKC 5GJSH 5ENWA 1K8IA 3U83A 4IRJC 4D0DA 3LN5A 3L3DA 1X5ZA 4OLYL 1DN0B 4WRLA 3MRJA 1A6VL 2V2WA 4UTBL 5E7FA 4U1IB 3BDYL 1KN2H 3BE1L 4I18A 5FGCE 3QH3B 4NO2A 1TTUA 3GUTA 3QDMA 4ZPVB 3FB8A 1PGRB 3C6LB 4YEEA 3FRPA 1JZ6A 5IFHH 4F7CB 1NCWH 5CJOH 1FE8L 3QFJE 4UUJB 4LFHD 2CKNA 3CJJA 4P2RE 4Q6YA 1BVZA 2F54B 5AZ2L 1MH5B 4TTDC 2AP2A 1X4YA 4M62H 4AMKH 3LKRB 5EUOA 4I3GA 4L8DB 4KJPC 1G0XA 4KMQA 1YN7B 3MZGB 4D9RD 9CGTA 4JN2A 4YWGH 1NC2A 4TUOB 4MXVF 2FECL 1IRAY 1KXQE 3GHEL 3SE9L 5F1NB 4H5SB 3QIUB 4NRYB 4KVCH 2J8UA 4XWGL 5I8CA 1DFBL 3O2VH 3G6JE 3CFKA 3MJ7B 3CFJA 5F3BB 1LP9E 2CKBH 5C09D 2DLFH 5MERB 4RGND 4HS3A 3BP6B 4CN6A 2ZSVB 3AB0C 3EYOA 4NSKA 4X8JA 4YHMH 1MVUB 2ADFL 1A7RL 4GMTH 4K3DH 2ADJB 4GW1A 1BFVL 5DVKA 2Y07H 4N0YL 2IPTL 2FB4H 5E8DH 3ZDZF 1NAML 1T5WB 1SHMA 4TQEL 5I75B 2F5AL 4K94H 4L4TA 2JK5A 2P8PA 4XHJC 2MOVA 4XAWL 1AD9A 5TE6H 4DKEH 3D39E 4PJ8C 3C09B 1NAMA 2VWEC 3V5KB 1EEZA 5HGAB 2R29L 1MNUL 4M6OL 2D7TH 4I9WD 3CK0L 4P9HC 5D7LA 1LO0H 3P0GB 3H6JA 3O2WH 2AV7A 4QRPD 4XB7A 1BEYL 4M93C 2B7DT 4ONHB 1KJMA 4Q2ZB 4LKCA 1TZIB 2XN9A 1A14L 2V2TA 3GSQA 4PJHF 2JELL 3N1FC 4OT1L 1KCSH 3T0DA 2PCPB 1QFWL 4MD0A 3TBWA 4C54A 3CVHL 2X4PA 1XIWA 2H3NA 4LLYA 4I0PA 1CZ8L 4LRNL 5IOPA 2BNRD 2VXVL 4GXUM 3MBEB 5KW9H 5TDNB 3NZHH 2NY3D 4X83A 2XNAA 4G42A 5T1LD 3CVHA 3UBXB 1KIPB 3T8XA 1K6QL 2HKHL 1BQSA 1Y6MR 1F3RB 3OJ2C 4AENB 4C4KT 3SCMD 4N0UB 3IDXH 3JWOL 1KTLA 4QF1B 4L1DA 3DVGA 4XC1L 5TH2B 5DHYA 4PREA 1G7PB 5SX4I 1KPRA 1IAOA 2EXYD 2JIXA 5J6HB 5D7KD 3DI2B 3WFEH 3WS3B 1S7QB 1AR1C 2VLJD 2VZ3A 2YPVL 3UJTL 5KVGH 1YEKL 3CCHA 2AEQH 4HJGA 4JPWH 2EIBA 5DJYB 4ZAKA 5IVXE 4Y16B 2JKXA 1ZT4B 4MD5A 5K9QI 3F7RA 3FO2A 3DO3A 4LGRB 3SE8L 3G6DL 3MLPA 4L3CA 1YMHB 3F6LA 4FABH 2P5EB 1ND0B 3TCLA 1CE6B 1NGXB 1UXSB 2BCKB 5I1GL 1HN1A 2GT9A 1N64L 3P77A 3WIHH 4XPFH 4P5TB 3OPZH 3TBYB 4CVXB 5IP4A 5E8PA 2V7NA 3U1SH 4LVHC 1UGNA 4X5XA 5E1HB 1FIGH 2FEDC 2ZJSH 1JI2A 4QHMA 5C0FA 4ZO9A 4LCUA 2VZSA 5A40E 3WKML 2VLRB 4J4PC 2PETA 4PRAB 2NY6B 1FFPB 1IFHL 3EOTL 4UQ2A 2EXWC 3FOLA 3NCFB 3KPOB 2BY0A 2Q8AH 3HZYB 3X17A 4XNMA 2DKMA 1SBSH 3U46B 2ZP0T 3G5YA 5EIIB 4YHIB 5DFTA 4M6MH 1WBZA 4YXKL 3KLSA 4FQ1L 3MXVH 4RZCA 3MBXH 1J05A 1OTUC 1W72H 1YECH 2ATKA 4R4BB 1AO7A 4GAGH 4JKWA 3BH8B 1XGQA 4G9FA 1GGCH 1RIHH 2DM4A 2D0FA 1GIGH 5DD5L 3H9SE 3GMRA 4JRWA 4S1DD 4M03A 4RNRA 4PY7A 1EUUA 5KSBA 3INUL 3RTQB 5C0AD 2E27H 4NC1C 3EOBA 2HJKB 3E6FA 4PGBA 1RUAH 2DKUA 2BVEA 4X5WB 3FQTA 1L0XA 5F3HB 4C83A 3EYUL 4J8RB 4Y5XC 4CVZB 5DJZA 1OM3L 1CDHA 3MRFA 4HIIB 2FIKB 1UH4A 2FSEB 5IIEB 4NJ9L 3SDDA 3ARFD 2Q6WB 3BQUB 3P2TA 1EHLL 4BKLB 1I1YB 3BGFB 4EUPB 4PYHA 4PGJA 3QIBA 2JJSC 2E8ZA 3NPSB 3MRGB 3ILPA 2UZXB 3OZ9L 5L88H 1UM6L 4BFIA 4GKZA 3VFRA 2O26U 4V1DB 1CDGA 1D5ZA 4LSVL 4IS6A 1WEJH 5SWZE 2RGSA 3HE7C 4K3JL 5C8JA 3BYYA 4PV8A 5GS0L 1AHWC 1UCTA 1OF2A 3MA7B 5C2BH 1HYSC 1A21A 3MCG1 3LDBB 5FDWA 3IDMA 3KPNB 4JGUA 4HGWB 3P4NB 2PW1A 4OV6F 3O4LD 5LQBL 3SKJL 1BIIA 1I75A 3A67L 1OPGL 3WNLA 4YBHA 4XCNA 3VFPA 1CGSH 5C0EB 3ZTJH 5DRZB 4JY4B 3CSYA 4LASH 4YAQB 3S97C 4NT6B 3PF2A 2Z8VC 3GI9L 1D5MB 2A0LD 1IQDB 5FECB 3KJ4B 2E7MA 5JW4N 2ZNXA 5C92A 2LABA 3A6BL 3BHBA 4BSWB 5D1ZC 2DQCL 2AJSL 1FL5A 3OKOB 1FL6A 4LCWD 4LBEB 3GSXA 3PGDA 4M5ZL 3VXRA 2MPAH 3MLVL 4ZTOH 1WVZA 4HH9B 3H7BB 4PJBF 4ETQB 2CUMA 5HYJD 3DRQA 4YZFE 3QO0B 5D7JD 3C60A 5EFIA 4JM4L 3F12B 4NNXA 5E6IC 3MV9D 3L3OA 1DTUA 4Y19D 3CMOH 2KPNA 3PNWA 1EHNA 3SKMB 4GG8A 2XV6B 3FZUD 4JN1L 3U36B 4Z7WF 4PLKC 1NUGA 3TYFA 1CG9A 4OB5L 4OF5A 3ZE0E 3VFSB 5I1KL 4G7YL 1I1FB 4Q9CA 3T3PE 3CLFH 1IAIH 4MAYB 1AKJB 3RIFF 4XP4H 4UIMB 2Q7NA 5CMAB 1JF1B 2VISB 5SV3A 5I2IB 1J0IA 5TQ2L 1KCRH 4HV8A 4U1SA 3ZKND 3DNKA 2YUWA 3ULVE 4NQDE 4JFFE 1A2YB 1N7MH 5DD0H 4GBXB 3S34L 1E28A 1U3ZA 4JO1H 4N1HB 3VE0A 1GZPB 5EBGA 4Z7NF 1T0NA 4P2OB 3MGAA 1KTRL 5IV2A 4HAFA 1MI5A 3ARDA 4MA8L 4TULH 5DQ9A 1RJZA 2EZ0C 5HGDB 3BEVB 3CH1B 1FO0L 1YA5A 4XPTL 3GIZL 1ZGLM 2HKFL 5SX5K 1Y6KR 1UH2A 4X4MA 5DUPH 2MCPL 4IRSB 2R4SL 4XP1H 1M6OB 2A77H 1I9JH 2CDEB 1QYGL 1OCWL 3HR5A 1FO0A 3EO0A 2HRPH 1CYGA 4MA7H 4GFTB 1J1OH 1FZKA 4M6AA 1RZ8B 3QQ9C 2AABL 3UPRA 1CTNA 1U3JA 1B4RA 3IB4A 4DVBB 3L5WB 2F74A 2XTLA 3TVMB 1N5YL 2O5ZL 5JLZB 5DURD 1A1MA 3PP3K 5E4EC 4KJQC 2VXTH 4GAYA 4W6WB 1ZLSH 1GGBH 2BJML 1IGIH 1X5IA 4LLDA 3VXOB 4JG0H 4I48A 1MAMH 5I1DB 4HCRH 4ZD3H 4F9LA 1YQ2A 3Q5YA 4PJ5D 5C07D 3KYKL 1JGDB 3GMMB 4YPJA 2NZ9D 5B39B 1KELH 3OJDB 2GSIA 5CWSB 3MYJA 4D0BB 4FTVB 2BVUA 3SEPA 1FN4B 1NDMA 2X4SB 5B4MD 2EDDA 3VWJA 3VFGL 3HC0A 3UZEA 4QY8B 4BZ2L 4QTIH 4P9ML 4LEXL 1MCPL 3KYOA 2NXZD 4CADA 5DFVC 1J86A 1CIDA 5DF0A 1RZJC 3QFJD 4ORZC 1UG9A 3ZDXE 3RUGF 5C0BB 1LO2L 1GVIA 4M4PA 4P2RD 3HNSL 5T33L 3GIVA 2BP3A 3MA9H 2YD6A 35C8H 1FYTE 1HHGA 4CGTA 3C8KA 2BSTA 4N9GA 3OB8A 4WU5B 1DLFL 5I6XC 1KN4L 3UDWC 4YC2B 5IMOB 1R0AL 2VL5A 3C2AH 4GW5B 4AM0A 2MWCA 4OGAD 2X89D 3OKKA 3QDME 4U6HB 5E08H 1T7XA 3RVVD 2VC2H 1BQHG 2YZ8A 2NY7L 3QDJB 1NLBL 3ROLB 1MFAH 3B5HA 2A1WL 1Z5LB 4P4RA 3AVEA 3QUML 1J1PL 5FO8A 3WO3B 4OM1L 4P23D 4YDVA 1Q1JH 5JPMB 5EUOE 1NLDH 1G7LB 4MA3A 1B0RA 1G7IA 5A16B 3HLAA 3QUMA 5DYOB 4HK3J 5T5FL 4K3EL 1IKNA 4H25A 4RFEA 3ZDYF 2Z91A 4X7SH 5I17B 2WWMD 5ID1A 4HWZB 4CJ0A 4N1EA 5EU7E 5CP7B 1IT9L 2J8UE 3D69B 4I18C 5F70A 4JM2D 3ZT7A 4MX7A 1XGPA 4PJEB 1TITA 1S7WB 3G9VA 5E99L 3D18B 1XZ0A 3SDAC 1BZ7B 2XZAL 3D39D 4NKQB 4AEHH 1U58B 1X4XA 5GGRY 4TOYL 2CLRB 4MCZA 5DJCA 5HYSG 1SM3H 3BT2H 1UA6H 1ED3A 5DWUL 5EO9B 2RJMA 4OD2A 3K8LA 5ETUA 1MY7A 1C5BH 2YSSA 3V5DB 1PSKH 1TQBB 4LSDA 4P49A 3VGHA 4FQXC 2EH7L 3AM8A 4LFHG 2SEBB 3L1OL 2A6KA 2WUCH 4F37K 2JCCF 3FCTB 5DT1H 3FB6A 2IAMB 4UIKL 4L4TE 1KIQA 4Q0XL 4Y1AE 2ADIB 3NGBC 1ZGLA 3U82B 1U8IB 4GH7B 3HKFA 5ABDE 4G6FD 4ONGL 1A6AA 1J0ZA 3L7FB 3FQXB 2DN7A 3C5SB 3KPQA 4X9FA 2R69H 3RWGB 3P3YA 3RHWF 5KN5B 3VRJA 5DHVB 1JCKA 1WFOA 1IAKB 1LEGB 5D5MF 1RZIA 2UYLB 2NY2C 2BRRL 3RVUD 4XMPL 5CGYC 2VDLL 1H15A 1JE6A 5DEFB 4I4WA 2EKSB 4APQD 4QLRA 2J5LB 1KIRA 3O11A 2C4XA 5T1DH 3JTTB 4JPVL 4ODWB 3RIAF 1ZVSA 3TA3D 2EDEA 5TDOA 2XXMB 3WIFB 4ELKA 3DRTB 4DQOL 1H3WM 3UXFA 3TV3H 1HEZA 4U0RB 4PGZA 3QFDB 1R3IL 2VH5H 3AREA 3NFNA 3O9WB 4WW1A 3T2PA 3T65B 3L7EB 1N2RA 3D0LA 5T5NG 4F8TA 3T4AB 3RX7A 3L95B 2FHCA 3PL6D 1G9EA 3CSGA 4X6DF 3KPTA 4QYOA 4UDUA 4EN3A 1A6TA 1HSAA 2X1PA 3BI9X 4CDGC 5HHVH 3I02A 2OTWB 1ZT7B 3VXMA 5GS2D 5D6CA 3RDTB 3LKSA 1JN6B 4WEUD 2YD8A 1XIWC 4I0PC 2ILLA 1QZ1A 5LAXB 3IU3B 1JMXA 5EBWA 4OCNC 1HXMB 2HG5B 3QXDA 1P69B 1WZKA 1T7YA 2XRAH 3DXAA 5KSVA 5I0DA 5EOCL 1OSZB 3U30B 4S1SL 2X9YA 4OD1L 3AGVA 3QDAA 1VPOH 2BX5A 5CJ5A 1NEZB 4YGAB 1YEEH 4PJAE 1YDPB 3E0GA 1WBXB 5INCA 3BP4B 2ED9A 1MJ7H 2UWEF 2GUOB 4HPYL 3HE7D 4C55A 1EV2E 2F19H 3OKDB 3MUHL 2DQGL 2EE2A 4MJ6A 4G9DB 4BQ8A 3QJFA 2Y06L 4ODXB 2ZWLT 1R24B 4TUJA 4L9LB 1JZ3A 1YEHH 2JB6B 2EEAA 1RZFH 1IM3B 2C3VB 5T3XL 1U93A 2NNAA 2W65B 4FZ8L 2XWBA 5EU3A 1SBBA 5D2NA 3LQZB 1EAJA 1I7RA 2OTPA 4PRDB 4KV5F 2HFGL 3QIWA 1AO7E 1KC5H 1O7SA 4GS7C 1JPFB 4G9FE 4F15C 4KI1A 2C1PB 4MZ2A 4R8WL 2YXMA 4U6VH 4YDIH 5KSBE 3V5HA 1GC1L 1R3HA 4PRPB 3QCTH 3H0TA 5GGTL 2DIAA 1DBML 2Z4QB 5SWZD 2DM2A 3ET9F 3WCYA 3QZWG 5DJ2B 2VITA 1NBZA 2R9HC 3K4ZA 2I5YH 1INQB 5BO1L 1EZVX 2MKLC 1ETZB 5CJXC 5DGQA 5GGTA 5F1IA 2XG5A 4L4VB 4JO3H 1EEUA 1FCGA 3AAZB 1EEQA 4KK8D 2WBJD 4HXBH 1GZQB 1NCCH 4UV4L 3OR7A 3T2OA 1NKOA 4LSUH 4DFIA 5TPWL 3MR9A 1DBKL 5CSZB 5FM8A 3NBNA 1HQRA 4GQPH 2HFEA 4LVNB 4Q9QH 1NBVL 1PZ5A 3F8UB 3TFKC 1UJ3A 5L7XH 1QBBA 4X4ZA 4Y2DB 3DX9A 1D5BA 3PWLB 3WFDL 4HDIA 5B21A 3PQYB 1BJMA 2P5WA 1MFEL 4ZUTB 1DQLH 3GSWA 5GZND 1B4JL 5EOTB 4QKXB 4HUXA 4UU9A 4KZDL 3BUYA 1H3XA 3MNWA 1G9NL 4JLRA 4NRXA 3OKMB 2CQVA 1RY7B 5I76B 1MAKA 3SDDC 1T1WA 4BK4A 5ADPL 4RAVA 1J8HA 5IMMB 2KZWA 3NZ8A 5K9OA 5GS1C 4XBEH 2X1OA 4KI5F 3GBNL 4LP5A 4PJIF 4Z78B 3MROA 3QIBC 3Q3GA 5HVFB 2C3XA 1I9RH 5ESAA 4KKLD 4OLVL 4M7ZB 4L3EB 4XHQA 5CZVH 3GNML 4WI3A 1G0DA 5DD1L 2CUIA 4OSUL 4BSVA 3ULVD 4NQDD 4PJ7F 4JFFD 3MC0A 3WDJA 3EDEA 4TNVF 5A2LH 3HCVB 4OF0A 3DV6A 5BQ7A 4G6KH 4MDJB 4CAGA 1RU9L 3STLA 5GIRA 1JPTL 1NDGB 1CLYH 5IB3A 2DTSA 3FTGB 1NC4B 3GSRA 1S9XB 1BZ9B 4YHPA 2LTQB 8CGTA 3ZMRA 3BXNB 4U1NA 4WI4A 5GS0C 1CDIA 4URTB 2NR6C 2R2HA 4TNWK 3FQUA 2FEEL 3D85B 4LHUA 1AGFB 5DHXB 4MSWA 5T3ZE 4GSDH 3VA2C 5J9PA 1JTTA 3MV7D 1J8KA 1CICB 2E7CA 3QHZL 4FQCH 4GXVH 3BWAA 1QFUL 2YD7A 2DB8A 2A9NH 5GGQH 4PJHA 3S3PA 2X4QA 4Y2OA 3C60C 4R2GB 1E4WL 1G7JA 3SDYL 3NIFE 4WW2B 3P4MB 4LLWB 3ARWA 5LXGL 4ZOAA 5FKAB 3U7WH 3FN0H 3CVIL 4NM4L 4ERSL 3KPLB 2A74A 5SX5H 3X12B 4OLUL 4X80L 5E2JA 3FFCB 1WAAF 4KAQL 2JB5L 2BVOA 4D94A 2BY3A 1Q0XH 4GRWF 5IF0B 4HKXB 3LQMA 5C71A 3I3BA 4X99A 5GRWA 4KUZL 2B5IB 1FRGL 3MJ6A 4MJ5B 4Z7VF 3RA7H 4GOSA 5LGJB 1TQCC 3ZKMC 1JWSB 3REVA 1AJ7H 2Z9TA 3IRPX 3B9DA 4X9IA 1YC8A 1EAPB 1PKOA 1MIEL 5JR1L 1CT8B 1LHZA 5D71H 3ARDC 1YN6B 5F8QC 1GHFH 3RWDB 4LARL 5C1MB 2C1OA 3FT4B 4WTZA 1RZGB 4NCC2 2FJGA 2JJUA 3SPVA 3TO4A 3VFVA 3PP3H 3TN0D 3VD9A 5I1IH 2FJHA 3GK8H 4MJIB 3PHOB 2H32A 4QXGH 2BFVH 4ODUA 5C0CA 1NGPH 1T6WA 2W0FA 4XP9H 5L2JB 4CVWA 4EEEA 3GMPA 3WFHA 5B38G 2D03L 4QTHB 5DSCB 4X0KB 1RFDH 3E6HB 1FYTD 4ISVA 1IC1A 2OJEA 4MCYB 2BVYA 3MJ9H 1KACB 2IANA 1F58H 1R5VA 4AEIH 5GRVL 1OWRM 1B6DA 4XVTL 4RQQA 3VMNA 4KQ3L 1MRDL 4KROD 4RAUB 5L8KB 3B2VL 4P5KA 4PG9B 3TT3L 3SDXE 3QDMD 1NCDH 4M1CD 2YPLA 3KJ6H 1P9MC 1TJHL 1F3JA 1L0YA 5GRJH 5B3NA 2VERN 3SGDH 1A7NL 3MO1B 5IK3B 4I13B 3PWVA 1EPFA 3EAKA 5D72H 4WY7H 1NQBA 2E9WA 1CK0H 5ICZB 3ARQA 4ZFZB 3UCRA 4F9LC 1KT2B 1NGZA 4OJFL 3STZB 3ZO0A 4MS8C 4UAOB 3CC5B 3JZ7A 4HIXH 1F6AA 1OLZA 2XPGA 1MFDH 1ZA3A 1VKXB 3GJFB 5JXEA 1NC2D 3LEVL 3WNNA 2D0GA 3V4VH 2FGZA 1LEIA 3S37H 4Y4HA 3GMLB 2VIRA 4NZDA 3VWJC 4C56D 2NTFA 3HE6B 3QWRD 4KQ4H 2X40A 3DMMD 1DEDA 1PVHA 3IVKB 4XVSL 4CNIB 2QQKH 2LU7A 4KK5D 3PDOB 5D8JH 3VXSA 3ZKXB 1JK8B 1BGXL 1CL7H 3RVTD 3MLWH 1QVOB 4WIQA 4GG6E 2W59A 4OZHF 4TSBH 1FFOB 4EI5A 5JDSB 3UMTA 3QEQB 4NO0B 4PTTB 4QNPF 4PJXE 3NAAH 1A64A 1S7VA 3BVNA 4A2LA 5BMFL 4UOW1 3T0XA 2H9GA 2Q8BL 3L3HA 4OZGB 4HQQH 3CFDA 4K3GA 2WMPA 5DDHB 4NIKB 4XNYL 3MUGB 4L4TD 4Y1AD 5MP6L 1QR4A 4KH2A 2R2BB 3L3JB 3BZFA 1IC7H 3EYQC 2WWKO 4IDJL 3S36H 1OOAA 2FZ3A 2HJFB 3R8QA 1Z3GL 5IHUL 2OTUA 1NGWB 4OCLC 1S78C 4UI2A 1A6PA 1MF2H 3LS4L 3U9PH 1QFHA 3TJEL 5HGBA 1BBDL 4Y4KC 4IMLA 5DGRA 3DX8B 4R7NA 1Q94A 4F7PA 5BZWB 2V5RA 1CU4L 4XWOC 3CDGB 2ED7A 3RAJL 3B6SA 1KIUA 1A1NA 5T1KD 4TVPL 2GJJA 5D6DA 1KJ3H 1AD0B 1INDH 2GHWB 4Z7QE 2YK1H 3D25A 4TSAL 3GSOB 4PB0L 4RDQG 3N50A 4DGIH 2ICEB 1WIUA 3I6GA 2O5XL 3BH9A 3ECBA 4LSQH 4NP4H 3NCMA 1T5XB 4UT7L 2G75A 4D3CH 1HCFX 1T0MA 4DZBA 4WUKL 5HJ3A 1LEKA 1QHPA 4PJBA 4QHLA 3DURA 2Z35A 4JFDB 3R0NA 3B9KB 2APXA 1T89C 3QEUB 1RUQH 2BOBB 4YGVA 1X5LA 3NIDF 4OGYH 1ZSDB 1BFOB 1U6AL 5AWNH 4QRTB 3I50L 4UB0H 1D9KA 4IOIA 4Z7WA 3AM8C 2XWJB 5BS0B 5C9JB 3O6LH 5JHDA 3ULUC 1Q38A 5CEYA 2GJ6E 2PTVA 2R0ZH 1OAZL 3Q6FA 4OBRA 1UB5B 1ORSA 4R7DB 4XTRC 1C5CH 4ZAKD 3UTPD 5I8OL 1ONQA 2OI9C 1EGJH 1CF8L 3WUWB 3WEXB 3QULA 1C08A 1ZTXH 3SKOB 1N3NB 3L3KA 3QG7H 2BSRB 4I3SH 5DJ6B 5DMKB 4AG4L 3D2UD 2CK2A 4G8FB 4HULB 3D1MC 4OKDA 4QWWD 2RR3A 2V17L 3MACL 5EO1A 3OJMB 3T0EA 4OUUA 3U9UB 3IFOB 3MCKA 5DJ0B 5HY9B 3FB5A 5KSAD 1CR9L 5E8EA 2AAVA 5DRNA 2PTTA 1TCMA 3TBVB 4XNZC 3LEYL 4JKPH 4XPGH 1Q9WA 2FR4B 3VXME 3MREA 3CXDL 1GJIA 2VAAB 2HMIC 3MNVB 4WO4B 3B5TA 1S9KC 4RGOL 4YX2H 1GYAA 2EEDA 1Q9OB 4OZIB 3MRIB 4KZEH 3BPOB 3GRWH 4ORGA 1B90A 1QBMH 3STBA 3LKOB 4KRLB 3AREC 1ZHNA 1BVKB 4PB9L 4J6RH 3FB7B 3AU1A 2BVQA 1VFBB 3OF6A 4EI6A 3SJVE 4O58L 3MLYL 3BPLB 2W0LA 1LK3H 2NY4B 4G9FD 3QHTC 5ELIA 3X13A 3MV8B 3B2UC 4EN3C 1JGLH 2BZDA 1IGMH 3TT1H 1ZANH 4M3KB 4KRPC 4G6ML 1M7DB 5F6IB 4P46A 5DZLA 3HN3A 4ONFH 3IKCA 2OYPA 3OKNB 2Y6SC 5TDPA 3OXRA 5DMYA 2H2PD 4D9QE 1CFSA 5K33A 5ACLA 4NUJB 1WICA 5CHNB 3IDNB 1CFBA 2A6IB 1OB1B 1TETL 4U1GC 2ZCLL 3VFMB 4QHKJ 4QHNB 5D2NE 4B7LA 4NN7B 4XMKL 5T1MA 4KGLA 5JHLL 4PJDF 3W9EA 5IJVA 3M45A 3MRDB 3RUGA 4XI5C 1ZLVK 1QO3B 4BZYA 4LEOA 2GCYA 1JGVH 3C87A 1E6OL 2CRIA 5EU4A 1S7RA 4M7LT 2XQYG 3N1GC 3WYRA 4P57A 3W5NA 5E2TL 3OG6B 3AC0A 4P2QA 5DQJB 1NCNA 4J3UA 1KEML 3QPQD 4AQOA 1U92B 1GOHA 1R3JB 3MLSL 5HHPB 3O6FD 3ETBF 4NPYB 1FPTL 2VLKA 4P0DA 5D2NC 3DO7A 3ARBB 3RY6A 4X6CE 4TTGA 3GBML 5HGGS 3ZYJA 2XQBH 4YFEA 1EEYB 3WHE0 2DQFA 4UINL 4K23H 2P1YA 2J8OA 4IHOB 5IW1A 4MNGA 1KEGH 4YHLL 1FZMB 3GMQA 2YBRA 1EZVY 4CMMB 1JHKH 1BQHB 4ZOEA 4P4KD 5D70L 5JUEL 4DTGH 3HHRB 3GKWH 2W9DL 4MXVE 2P5WE 1IGTA 2N7AA 3MFFA 2ZKHL 3HG1B 1GC1C 5FK9A 1AY1H 1TLKA 1IEBB 3F7YB 4F7EB 4KVNH 3W2DL 3UTTA 4HPOL 2APFA 2V9RA 2ZUQB 5ICYB 3KYMA 1A3RH 5HD8D 5J12C 1J8HE 4LLVA 4KTYA 1CE1H 4HIHB 2CIIB 2XZCL 4JPKH 2R8SL 3MRKB 1JP5A 4WU7A 4JQIL 5T3ZD 1OW0A 4XCCH 4KC3B 4PRIA 2CUHA 3LRGA 2A9ML 5I1HH 3F7PC 1FNHA 1MCQA 3NMEA 1UJ3C 2NY5L 4WI6A 3QXTA 2RFXB 1MAJA 2X4NA 3ZDZE 1NGQH 2E8YA 1H3VA 4MB3A 4CMHB 5IB5A 5HPOA 5L2KA 2JCCA 4FFVC 5MENA 3RVWD 2JJTC 4JG1H 1AGEB 5AUMB 5HYSB 4AIOA 3QUXB 4JAMB 4A6YB 3IFNL 2WNGA 3UYOD 1FIEA 1DUZB 3VXQA 4ALAH 5I1CL 3O6MH 1G1YA 4LRIC 1U8KB 1T2QL 3C6SB 3RZCC 1J10A 5TGBB 4IDLA 2HTKD 4I77L 1HHIA 3MLRL 3HPLB 4H88H 2RIKA 1G9NC 4JQXC 1QLFB 3EGSB 4IRZL 5HHOA 5D5MA 4F58L 4KTEH 4LPUA 5F1SA 1JYNA 3B3IA 2R4RL 4LNRA 2BMKB 1DVFA 3ZE1F 4E42B 3DROB 1MRFH 1BLNB 3B43A 5B8CC 4OCXH 4PJHE 5CLTA 2X4TB 1ZS8A 4UBDC 3GGWA 1OGAA 4NHUA 4AH2B 2EO1A 3QP3A 3SGEH 5HHXL 3WHXA 4PBVC 4M4RA 5F9AC 1K3ZA 4J3TA 4Q6IB 2Y4SA 5FYKE 1OARH 1KJ2B 5IEHA 1TZHB 1JPGB 1XGUA 4FFZL 5C09B 4ENED 4RGNB 1U3HA 4ZUWB 4K7PH 1A7PH 2XKSA 1T04B 4NM8H 3EOAA 1DQJB 1R5WB 2C4FU 5SWQA 2Y9RT 1PY9A 2YA1A 3JWDH 1CFQB 3KR3L 4NNYB 4NN5C 1WWAX 2YRPA 32C2A 4J3WA 2BK8A 4R4FH 5GRZA 4OF6A 3RNKA 3WDIA 3LH2L 4X4YA 1BQLL 5IHBA 4DN3H 4YXLL 2F54A 1ORQA 4OLWL 5LCVL 1JGEA 4X6DA 2HFFB 3NH7H 1VA9A 3LKRA 2OZ4H 4YHOH 1MJJB 1RD6A 2NY1C 2B8OT 1I8IB 3SO3C 3ZZ1A 4EZMA 1WV7T 4LIQL 5JNYB 1DQDH 2VDKL 1MFNA 5C0CE 4X9HA 3UAJD 4YDLC 4QRPB 4NRYA 1ZK9A 4E9LA 5HVGB 3PWJB 3CUPA 3VFWB 1M7IB 5FAAA 1U8HB 2OMNA 2X5PA 4P99A 5EORH 5I18L 2F5BH 1ZE3C 5EU6E 2IANE 4KKCC 3V6OA 2Y72A 3LIZH 1WLHA 5GGSB 2ZSVA 5I1JH 3O8XA 3QJHA 4M7LH 1LDPH 3GJEB 2WW8A 1QD0A 3TF7C 3C5ZA 2LQRA 3H2WA 2WAHA 5ITBL 5MHSE 2UWEA 4XC3L 3KPMB 2B2XL 5KVMC 3O3AB 2D7NA 1EHAA 5IWLA 3MLZH 4KKBD 1KTKE 1TJIL 2GJZA 4JO2L 4M48L 3TO4C 3PV6B 5ID0A 3G08B 43C9A 2NY3B 5T1LB 3TZVA 3G5VB 1A1OB 5FM4A 3U6RB 4M5YL 2YPKB 4FP8L 3FRUA 3W0WB 3SCMB 1LO4H 2XI9A 4BJLA 3LOWA 3BDXA 4D0CB 4G80A 4XXDA 1YNKL 3NPZB 2QADD 1LK2B 4KUCF 3U7YL 3PWUA 4XPAH 3AS1A 1OTTC 4AEEA 1FC2D 4IOFC 2PXYA 4WWKD 4Z77B 2VXQL 2VLJB 3X3GH 1A4KB 3KS0J 4K8RC 4ONHA 2NW3A 3FO0L 2DLGA 1HH9A 4G3YL 2AJVL 3NCJH 1AFVL 3VXSE 3V52L 1OAUH 2V7HB 4GKNA 1RVFH 4QCIB 5KTEH 3JWNC 1HKFA 1NGYA 2VLRD 1Z9OA 3FRPG 4M61B 2NY6D 3RGVA 3OV6A 3QB7C 1CDJA 1F4YH 3EBAA 1X44A 2HRLA 5JW5B 2GITA 4W68A 2FIRT 5JXEC 5DEGA 2C4FT 3BYTA 4ODTH 4FNLL 1ZHLB 5GS2H 4HWEH 3L5IA 1JRHI 1KG0B 4M9PA 5FHAL 3QZWB 4POZD 4AENA 3P9MA 4ZS7L 4N0UA 2VABB 4GAJL 25C8H 1OP9A 2VDPL 2Y36L 1Q0YH 2JJVA 5TH2A 4GW4B 1MLBB 4M9OA 4IIQC 4N0FA 4AT6B 3W11D 4L8SA 2DQHL 2FO4A 3B8YA 4HXAH 2HTLD 3FO9B 5ESVB 2IFFL 1F4HA 1K2DA 2XXCB 5J6HA 4E0RA 2NXYC 4EI5C 4KDTA 3RTQD 2FBOJ 2ITCA 5ACZB 4OLXL 3UJIH 1UC6A 1G0YR 1UYWL 2EICA 4OCMC 1H5BA 1IILE 1VDGA 3FONB 3RU8L 5F96L 4UTAH 1NFDF 5D7SL 1N59B 3CU1A 4HJ0C 5DMIH 2QLVB 1SY6H 1ND0A 3GMOB 3LD8C 2UY7A 2XA8L 4M8QB 4YBQD 5CD3A 4YK4C 2GJ6D 3LCYA 4HX1A 4JKLA 2VDQH 4PJIA 4PTUB 1I1RA 3SO5A 3BISA 2BERA 5I8EA 4TVPE 5IFJB 4R96A 4O9HH 1I9IH 5C0AB 2H2SD 3IDJA 5ACMA 2V5YA 1MHCA 1CXHA 1AQDB 1FNGA 1ZHBA 4PJ7A 4PGEB 5HI3C 2CMRL 5AZEL 2RAMA 1FBIH 1I8LA 3OAZH 5L6YH 3ARED 4HBCH 3UTZB 3QDGE 2EECA 4U1MB 4FQHA 4KTDL 1KNOA 4B5EA 4KXZH 1QSVA 3KLHC 3SE4A 3VXPA 4PUBL 3ARFB 1KOAA 4J1UA 4PRAA 4ZFGH 3QUYA 1CQKA 5BV7H 1OAKL 1BX2B 3IF1B 3HC3H 1QKZL 3CH8A 3WJJA 3KPOA 4Q74A 4LVOB 3T3ME 5HYIA 5D6DC 4BYHA 4N90E 4DAGL 5I30H 5L8JB 1QR1B 2XG4A 1UWGL 4L4VE 3H9HA 5EIIA 5DJDB 4WNQA 1BAFH 4KHXH 2XZZA 4PP2B 5FUCC 1NL0H 1G9MH 4YQXH 1ACZA 1VFAA 1ZLWK 2Y6SD 3BRGC 4NWTH 2WUBL 4KFZC 4BK5A 2VZTA 3BH8A 3J8F7 4Z7NE 4YHKL 2DQJL 2R0WH 4Z18A 5C6TH 3O4LB 1X6LA 4DGVL 1BD2A 1RK0B 1U8LB 4O5LL 4QXUH 5HDQH 3T0EE 3F65A 2VLLB 4RFOH 2DWEA 1VGEL 2HJKA 1S9VB 1D9KC 1DDHB 3SJVD 4P3DA 4MNQA 4HS8L 4RA0C 3KPPA 1J5OL 4Z7UB 1GAFH 2DQUH 4J8RA 4XCYB 3BEWB 1ZEAL 4QOKA 1WAAA 4LCWB 4HIIA 5CD5C 1IAMA 5E1AB 1LE9A 2D7OA 3HI6H 4DZ8B 5EWIH 3O0RH 4LMQI 4CRPA 1VEOA 2Q6WA 4Z7VA 5JIPA 5A3ID 1AKJD 2W0PA 4BKLA 3EYFA 5HYJB 2YRLA 3NFPA 3KPSB 4ZTPL 4D9QD 4EUPA 5D7JB 4YDKH 2IADB 3B9AA 4Y19B 1DQML 3CDCA 1F2QA 2VXUH 4FQ2H 4JZJB 4RMRA 1MFCL 2YUXA 1I8MA 3O4OC 4RMUA 1BJ1J 1X5HA 1I1AC 4XX1E 3RWFA 3QIWD 3BN3B 1GXEA 3RL1A 3TWCL 3EO9L 2MFNA 3QRFM 3P4NA 2AJYH 3ULVH 4EQ3A 5KVEH 4LU5H 2CJUL 5BVPL 4JY4A 5DI8A 5C3TA 4YAQA 2ICES 4QHKI 1D5MA 1VADA 5FECA 1T21B 5C08A 3VFOA 4GRLA 2C26A 2AJ3B 3MRPB 3MRLA 4DFHA 3PDDA 3TH3T 4OCYL 4JANA 3MRMA 4FXGB 4MWFB 3AROA 5B38B 3QWOB 4MDIA 1N6VA 4JHAL 5CSBA 5ALBH 5J1AB 1S7XB 1P4IH 3CXHJ 4R0LB 1JI1A 4ETQA 2PYFB 4EVNB 15C8L 1RUPL 2RB8A 1ZLVH 2YUVA 3VGGA 2AXFB 4M1DH 3K2UL 4PP1D 1GGYA 4IRJB 1VESA 4K8RH 3U36A 1DLHB 1EH9A 4LCYA 4P46C 3VG9C 1K3IA 4XZUA 4P2QE 2F53E 3WNOA 1JHLH 3QISA 2P5WD 1U8MA 3SKNB 1NANH 1IGFH 4MAYA 4HK3N 2Z93B 5EC1A 5C0ND 3OMZA 4JPIA 4Q97A 5CMAA 4N0RA 1WGOA 3PHQA 1BFTA 1UEYA 4FFWC 3L9RA 1XGYL 1QPXA 5DURB 5K9JL 1UKQA 2AKRB 3RVXC 3AY4A 5I8KH 5EBLB 1J8HD 1T2JA 2C7UB 1XR9A 2ZOKA 1A8JH 1KB9J 1G6RL 1A2YA 1IC4L 4Y5YA 5BJTB 4LLQA 3LHPH 4LSRH 1S9WA 2QR0B 3VW3H 2P4AB 2PUQT 4OZHA 5D1QA 4MNGE 3NCYS 4PJ5B 5C07B 1AI1H 3IJSB 1DCLA 1G6RA 5BZDB 1HHKB 3UC0L 3PXJA 2IQAA 5J0BA 3VFTA 1HWHB 4M3JA 3TC9A 3RWCA 4NZUL 1E27B 4JFEA 1CFTB 2CD0A 1X5GA 3SBWA 4XGZA 1IE5A 3TBSB 5FGCB 4MZ3A 2PR4H 2CDEA 4TUKH 4RA3A 3OJVC 2B4CL 3IFLL 8FABB 1T20A 4PRNA 1QBLH 2ZSWB 1FZOB 2NXZB 3ARZA 3ESUF 2G9HA 1ZWIB 2F58L 5CIPA 5L9DL 4X7TA 4OZIF 3QFJB 1S5HB 1BVLB 5GJTL 1G7HB 3RY6C 5HVHC 4LHUD 5IMLA 4P2RB 5CGMA 5F7DB 4XNUH 3VG0L 4AY0A 4N0CD 4PRIE 4M02A 4RMTA 3EKCA 3O2DH 3MLXL 4U7MA 5IM7B 5KOVC 5L2KE 3O3EA 3X14B 4OLYH 5MENE 1CDUA 3VXOA 1FLRL 2M26A 2BNUA 2Y23A 2OL3L 3D9AH 2R1WA 3BDYH 4R97C 5GJSL 2NCMA 3BE1H 3WN5C 4YDJB 4JFQA 4PJ8B 4R26H 3RI5F 1JGDA 3GMMA 2D7MA 5FYKD 5GQBA 3G6JB 1DJSA 2NW2A 2OL3A 1LP9B 1KN2L 4FTVA 3TEUA 1JHTB 4LF3B 1TMCB 1MPAH 1F4XH 1FN4A 2IJ0C 3BMWA 1WF5A 2YD1A 5IQ9B 2X4SA 5HHOE 1N4XH 5D5ME 1QOKA 5BVJA 1RUKL 4OFKA 3OAUH 1I8KB 3EJZC 1NCWL 1OW0C 4JGJA 2RQ8A 5CJOL 3VI4F 2Q86B 1T1YA 2R23B 3B9VA 1X5KA 5DA4A 4ZO7A 1X5YA 1Q9LA 3DYOA 1MWAH 4M62L 4NFBA 4AMKL 4F2MA 2AK4E 1DL7H 3KXFE 4JM2B 1I3RA 5DK0A 3MXWL 3KNBA 1MQKH 3V6FB 3L6FA 1Y0LB 5FOBA 5D2LF 3OX8B 5D1XA 3D39B 5FGBA 4YWGL 5HHNB 4OZ4B 4ODVH 3T4YB 3ARGA 1F90H 4HWUA 4R6UA 1DE4B 3LSOB 5IMOA 4KVCL 1P7KB 1OAQL 4U6HA 3O2VL 1W0VA 2Y5EA 4QRUA 1H3UA 1CD1A 2CKBL 3V0AC 2DLFL 1FNFA 1U0QA 4MQXC 4IOSD 5EU6D 2IAND 2HT3D 3WFCL 3RNQB 2W07A 4F7TA 4TQEH 4X6DE 4XCEB 1KXVC 1O5DT 3U48A 1NFIB 1EJ6A 4G6FB 4GMTL 2BXYA 2CKBA 2F5AH 4K3DL 5JPMA 2Y07L 5J57B 4Y8AA 1NPUA 4XBGB 2CXGA 3I6KB 1U8PA 2IFGA 2FB4L 1TTFA 5E8DL 5MHSD 1N8ZB 2G60H 2XOTA 4HIEB 3VMOA 3SQOH 4WUUA 1R5IA 2PO6D 3VH8B 5HHQA 4RSVA 4OTXH 5I1LB 5D96B 5F93C 2DM3A 1M1SA 5TE6L 3HMXH 1S7WA 4BZ1L 5DK2A 4LIQE 3C6LC 1EUTA 1Y18A 4OFVA 5DUBB 4APQB 3HI5H 1YEJL 3LB6C 4FQIH 1NAKH 1U58A 2D7TL 2PNDA 3E2HB 1LO0L 3ES6A 5SWSA 2CLRA 3DYPA 1A14H 3O2WL 4Y4HD 3TA3B 3TO2A 5C7XH 2V9QA 2UWEE 1K4DB 3CLEH 5IVXB 4YPGB 3DETC 2BHYA 3VXSD 2VAJA 4XBPB 1CZ8H 1SEBB 1U8JA 3BX7C 2OSLA 1KCSL 5DRWB 4WCYH 4JQVC 1U8IA 3QIUC 4W4NA 3RDTD 5C6PB 1JTOA 4UV7H 2HT2D 2HKHH 5EUKA 1S8DA 3HB3D 3FQXA 2BHUA 5KW9L 1I4FA 1UWXH 2KZ1B 2ORBH 3NZHL 3PIQA 3IS1X 5MEOA 3WLBA 3V6OC 3BMVA 4ZS6C 3DHMA 4PJDA 2FYYA 3V79C 2OR7A 1LEGA 3RWJB 5A43C 2GTZA 3IDXL 3FAXA 2UYLA 5KZCD 2DL9A 2YPVH 3O3DA 4PJGF 5ERWA 4H0GA 3C5ZC 1RSFA 4C57C 4FXKB 5J4MA 4PJ9D 43CAB 3FOMB 3GHBL 1MVFA 2GSGB 5IWLC 1HCVA 1DR9A 5C6WH 3WFEL 4IM8A 5KVGL 4ODWA 5I75C 4J3SA 1JNNH 2AEQL 4JPWL 1A3QA 5C0GA 5KANG 4IMKA 5JIKA 2P43B 2GK0B 2VUOA 4ZFFA 1QA9A 1QQDB 3C09C 1DQQB 1PQZB 4MD4B 3RKPA 1YC7A 4G43B 3V8CA 1MHEA 3QFDA 5DTFA 3WIHL 3UTQA 4XPFL 3HMWH 3D0VB 1TVHB 3PWNA 3H9SB 3O9WA 4HZAA 2BDNH 4TVPD 3U1SL 3HE7B 3T65A 3B5GA 4CL7A 1AHWB 4DKAA 3WIHA 1FIGL 4PR5B 5HPMB 2FX8H 3WFBH 2ZJSL 2AEPH 4WHTA 3GMNB 1Y6NR 3DV4B 5DJ8B 5EZJA 4N9OB 1KPVB 2OR8A 4PRPD 3KPRA 1FQ9C 3QDGD 1F3DH 1ZT7A 1FVCB 3H42H 1FJ1B 3RGVC 5E8OA 4JY5H 3RRQA 3MRRB 2Q8AL 5KVDH 3IU3A 3P30H 1SBSL 1AGDA 4UQ3B 5ANMA 1T4KB 3MBEC 4KI5E 5D1ZB 2ITDB 4N90D 4PJIE 4F9PA 2FECI 4M6ML 1HXMA 4P3CH 4L4VD 3PABA 5ICXA 1W72L 4HW6A 1YECL 2X4OB 3VD4A 4QRRE 3BN9C 1A22B 1OSZA 5SWZB 5IJKA 2DBLL 4GAGL 1L9NA 5FGSA 3ORJA 4PJ7E 5J7CC 4OBSA 1GGCL 1RIHL 4MVBC 1FNSL 4XH2B 3VWKA 5E6IB 1P84J 1GIGL 4EBQH 4JREB 1M71B 1NEZA 3MNZA 4K3HA 1RZKH 3FMGH 1W72A 5FUOH 2X9WA 4K71B 2NX5E 1QEWA 1H3GA 2CLVB 4POYA 3LV3B 5F9WB 2E27L 3BP4A 2HT4C 1E4XH 1PDKA 3SE3C 3T0ED 2GUOA 2WBJB 4I0KA 4W81A 2YC1B 4J3XA 3V7AE 1RUAL 1W0WB 3OKDA 3PQYD 4Y16C 3O41B 4NO3B 3BIKB 3DUHA 1IQWH 1V5JA 2RHEA 3H3KA 1IM3A 1A6WH 3QQ3B 4X7EC 1G7MB 5H37H 3K4DA 4P5TC 2W65A 5IHZB 5K59F 1EVUA 1D3CA 1P4BH 1ZLWH 4PRDA 3LVEA 1Z9MA 1A4JB 2ZUSA 1I8LC 1BD2E 5L88L 1JFQH 3C9NB 4Y7MA 2C1PA 1FDLH 2AJXH 2GKIA 1WEJL 3M1BA 3A67H 2R0LH 2DQDH 1EXUA 3Q5TA 3ROOA 2Z4QA 3DBXA 3WLWD 5C2BL 3QUYC 1WK0A 3M8OH 3HG1E 2MMXA 3GSNB 3WJJC 5DJ2A 3EHBC 4UILH 3KAAA 4QOKE 3S5LA 3C5JB 3OR6B 2DMBA 1Q72H 4LASL 1QFWI 4LQ1A 4Z7VE 4DKFH 5IKCB 3D85D 4UT9H 3TBTB 4NQDB 5LWYH 4PLJC 1DBBH 3TJHC 2VE6B 4DKDC 3RPIB 1CICD 2IH1A 4X6EA 3TIEB 4F37F 4EOWH 5CJBA 2ZCHH 5E4EB 5J56B 3LQAC 1HOCA 4Y2DA 1XF2B 5T3ZH 3NN8A 4PRHA 4ZXBA 1D5XA 4G7YH 5MEQB 3CMOL 5IVZB 5EOTA 3OXSB 4OF7A 4FZEH 1C5DB 2XTJE 5ILTH 3TNMA 1KXTB 4KHTH 4M1GH 1SEQH 1IAIL 5ALCH 5LVEA 3BQUC 4GJTB 2F53D 5C08E 4XP4L 1GGIH 3BGFC 4KRMB 4Z78A 2BC4A 3HC4H 1CGWA 3S35X 4HUUA 1KCRL 1P7QA 3UPAA 4X7FC 3SGJC 3WKNA 1MFBH 1N7ML 3QNXB 5DD0L 5LGHH 4JO1L 4ODHL 3GIZH 3FFDB 4LKXA 2P46B 3PWPA 2VKWA 4TULL 3NVQA 1IM9A 1LD9B 3DLQR 2AQ3A 4XVUD 1NC4A 3RX5A 3QYCA 1S9XA 2IGFH 1RURH 2WIIA 5EOCJ 1DZBA 3HZVA 1KLGB 3VA6A 2EYRA 3MLTA 1P1ZB 5GHWH 4LHQB 3N85H 2A77L 4KK6C 3KJ4C 1I9JL 4Z76A 1T1XB 5K9KB 2IQ9H 2HRPL 4B7IA 2RBLA 5IB2A 2I07B 2CIKB 4MA7L 2DRUA 1AQKH 1J1OL 3CX5J 4BFEA 2OQJB 2MQ3A 2EH8H 4Z0XB 2HVJA 3NABH 2N4IA 1PG7H 1SJEA 3TN0B 2XKNB 1PYWB 1RJCA 1YEFH 1T3FA 5KSUB 2BJMH 4Z5RA 2X70A 1HI6B 3FQRB 4OZHE 1GGUA 1DEEB 5BOZG 1FV1B 2IPUK 2DTML 3P4MA 5ENWB 1K8IB 4MXQD 4QNPE 3LN5B 1ZLSL 1GGBL 3L3DB 1IGIL 2FL5A 3MRJB 4JG0L 4JFEE 4NYLA 1AIFB 5L2KD 3X12A 5GRVK 4HCRL 1WBYB 5MEND 4I18B 4KROB 4ZD3L 4MAYC 5IMKA 3FFCA 1TZGL 3GUTB 2OP4H 4POUB 3QDMB 4AEFA 5E5UB 4HKXA 5K9QG 5K93A 4HCRA 1PEWA 2ZG2A 3AY4C 4LEXH 4G8GA 2IPKA 2L7JA 1YY9D 4Y5YC 4GBXC 3BKCL 3QHFH 4P2OC 5HHOD 3MJ8A 1YYLL 1URLA 5T33H 2EIEA 2QQNL 5EUOB 5D1QC 2IALB 3RWDA 4WI5A 4OKVA 3S88H 1DVFD 2WLZA 5IBTH 1WWCA 3FT4A 4JN2B 1NC2B 4K7FA 1WCQA 1NFDA 4D8PA 1X5FA 5E6ZA 1IJ9A 3MRQA 2WQ8A 3K1DA 3QEQD 1R0AH 4JVWA 2AK4D 3SBWC 3MA9L 2J8UB 5HYEA 5L2JA 35C8L 3KXFD 2FX9L 3WHE1 4OFDA 1N0XH 4QTHA 1DBJH 3CFKB 4DW2H 3DMMB 3CZJA 4D2NA 4IEFB 3QQ4B 5DA0B 3CFJB 2QKIA 3DWTA 4O2CA 3C2AL 3BD4A 4NFCA 2CDGB 1U3HD 4O4YH 2A1WH 3CPLB 4HS3B 3EFDL 4ZUUA 1I7UA 3V6BR 3QUMH 5E08L 4RAUA 1M05A 1J1PH 1MCNA 2NY2B 2VC2L 3EYOB 3QUKB 4NSKB 4X8JB 4B53A 4JR9L 1ZXQA 1WFTA 3P11L 4GW1B 3NIDE 5FYKU 4U1JA 2ATPA 3D3VA 1MFAL 3RFZC 4GKOA 3I6LE 4LHUG 4BH7A 4Y5XA 2XZQH 3G5XA 1R3KB 4ZSOA 4K3EH 5F7HA 4L4TB 3MPCA 2JK5B 2P8PB 4OGXL 4Y1AB 5JDJA 1NLDL 1OTSD 1IT9H 5ICZA 1U8NA 1AD9B 4ZFZA 3STZA 3UYRH 3CC5A 1NAMB 1FG2A 1EEZB 4U2ZA 4X7SL 4TPRH 3DECA 1EO7A 3MMEA 1XCTA 2FJFA 1Z0NA 5D7LB 5I73C 4HFWA 1SYSA 5JO5A 5E5MA 1KJMB 4FQLH 1X5XA 5FA4A 4AEHL 1RJLA 1UCBH 4CNIA 4K9EH 2QQQA 4EDXA 3GSQB 5M95B 3BT2L 1UA6L 4JFDD 1X4ZA 3B9KD 4U2YA 4OZFA 5EBMB 1FFOA 5HI4D 3O8XD 3TBWB 1OAXH 1C5BL 1SJXA 4Z7OF 5FCUH 2X4PB 1PSKL 4NO0A 2YEZB 1FG9C 3ZE2F 1YEDB 5BS0D 4LLYB 2WUCL 4I0PB 1PG7W 3EDDA 3LQAH 4WUUE 5IOPB 3I75A 5DT1L 3GBLA 2EE6A 2E7LC 4G42B 4YC2C 3TZVD 3CVHB 3BZ4A 2CPCA 1TENA 1AC0A 4WTZG 1U91A 4X5LA 1KTLB 3DVGB 5E8NB 3RIFK 2R69L 1FCCA 2HJFA 5DHYB 4PREB 3MGTB 5SWSE 4GRMA 1NGWA 1YQVH 3U2SA 3Q6GH 5C70A 1IAOB 4NO5B 4MXWL 2JIXB 3VRIB 2PXYD 3CCHB 4TNWF 3MLUH 4HJGB 3JBG7 3TPUA 4ZAKB 2GTWB 5FXCH 3ULUF 1EX0A 3CDGA 3OKLA 4G5ZL 4L3CB 5T1DL 4X98A 4JHBA 4LDEB 3BGMA 4M7JH 4LLMA 1MCFA 5KS9F 2AQ2A 4NQVA 4S0SD 3D2UB 2GT9B 3GSOA 4KJYB 4ZOCA 3P77B 2QBWA 3TV3L 4PJFE 4WO4D 4HLJA 1T5XA 1ERNA 5DVOA 2V7NB 1BBJA 1NSNH 1PLGL 1C7SA 4K94C 2VH5L 4X5XB 1P4LA 4KKNA 4PJDE 4G6AD 4JGMA 4NCDA 5BCAA 1GRWA 1D6EA 5C0FB 4JKKA 3GEWB 4LCUB 4DGYH 5IFAH 3BN9D 5EG6C 1ZSDA 4UQ2B 2D9CA 2OMBA 3J7HA 1QRNE 3FOLB 2NY4D 2MSPA 5C9JA 1K9TA 5TJWK 3B8SA 4XNMB 3S35L 3H3BC 2ZOLA 4JM2F 2IAMC 4Z8FL 5HHVL 4OI7A 1WBZB 4RZCB 1OSPL 4OAWB 3KPSE 2ATKB 3WUWA 1AO7B 3WE6A 4NZJA 1A0QH 3LN4B 1XGQB 4G9FB 4KI5D 5BRZA 1QSZA 4G8FA 2W0KA 2XRAL 5KANI 5FYJE 4PY7B 5KSBB 2P47B 3UTOA 3EOBB 4QRRD 3E6FB 5E95B 3IFOA 1PD6A 4Z95H 1VPOL 2J5LC 4C83B 1T2XA 5F89A 1AXSB 3EYSH 5DJZB 3KPRE 3MRFB 4NRZA 3F62A 3VDAA 1MJ7L 2NX5D 1CD9B 4WJ5A 4YEFA 2F19L 2VAAA 5F8RC 5FF6A 4NQXA 4OFIA 1RZJL 4U0RC 3K1KC 3A6OA 4RRPA 3WSQH 5ANME 4OZIA 1YEHL 4NQEE 3RKDC 1RZFL 5E9DA 3QAZB 3LKOA 3WNKA 3ILPB 1CFNA 1HDMB 3O9WC 3BSZH 3FB7A 2PF6A 3P9LA 4GKZB 3VFRB 4BFIB 4YHYB 1D5ZB 1EO8H 5C8JB 5GGTH 1KC5L 4PV8B 1OF2B 3E3QC 3EO1B 3IDMB 3FT3A 1UT9A 4U6VL 5CBEA 4JO4H 4YDIL 1BD2D 3MV8A 5BO1H 1BIIB 2ED8A 3QCTL 5SX4H 4XCNB 4U6YA 4ZOBA 4PLOB 1VEMA 3O6FB 3EJYD 1MLCA 4HLZG 4PRBA 5H35B 1FNAA 3S36X 2I5YL 3LRSA 3VRLF 3HG1D 1ZVYA 3BHBB 4QOKD 4NQCA 1FL5B 1CDCA 2APWA 2QSCH 1FL6B 5DK3A 4JO3L 1NCCL 2A6IA 4NQUA 2DQTL 3VFMA 1ZLUK 1FAKT 3DHJA 3AXLB 4LSUL 5IJKC 4NZTH 5GGRB 3DRQB 2QJDA 4WFFE 3C60B 3MRDA 5DJAA 2QQLH 5EFIB 5BOPA 1QO3A 4U7KA 5HGHA 3RJDA 1BM3H 3L3OB 5C0DB 4OFYD 4Q9QL 1IBGL 2NY0C 2OJZH 1QRKA 1B4JH 1SMAA 4MAUL 1HHHB 1UVQA 3PNWB 4PPTA 1P53A 5JZ7C 4GG8B 4JFPA 5D2LA 3TYFB 1CG9B 2FCBA 3IAPA 4WDIB 5ADPH 4LDLB 3V4UL 3QUXD 5INDA 5H8DA 4G8IA 3VXUA 3SDAA 3GBNH 4L9LC 4CU8A 1CGYA 4EKXA 1R3JA 2Q7YA 5I1AB 2XTJD 4LCIH 4HV8B 4OLZH 4U1SB 2I9LA 1TQCB 4PG2A 4NDMA 4XBEL 3GJFK 5IB4B 2ZPKH 3I3EA 4PJCF 1E28B 3VE0B 5C08D 4GRLD 1T0NB 4FFYH 2DLEA 5DZNA 1I9RL 1EEYA 2I60H 1MJ8H 2VMFA 3HA0A 1MI5B 3ARDB 4FQJH 4FQXA 4QGTA 5CZVL 5IV2B 1RJZB 3BESR 1CDYA 4PRHE 1R6VA 4JFYB 3DX7B 3PE9A 1W2KT 1CLYL 3EFFA 4P5MA 2DBJA 4JRXA 3GM8A 2EDNA 2VWEE 3ALWA 3HR5B 4UZGA 1FO0B 3EO0B 1IEBA 2R2EA 4XX1G 4F7EA 3RIAK 1CFVH 5ICYA 4BQ9A 3KVQA 5KVFH 1QBAA 2XIDA 2CIIA 5E00A 3UPRB 4H26A 5DO2C 1BECA 5FYKH 1ZA6A 3T2NH 4BQCA 4GSDL 2F74B 4S1RH 2VNCA 4M00A 1KLFA 3L5XL 3G04A 3QR2A 4FQCL 1E4WH 4GXVL 4HKBA 4LVNC 2QEJA 4JFXA 1A1MB 4GAYB 5IQ7H 2A9NL 2C3WA 4Y0GA 5GGQL 4Y2DC 3V0VA 4ZXBC 1B6UA 4I48B 2AW2A 3PWPE 1VCAA 3P0YH 4OLUH 1ITBB 2EC8A 3U7WL 3FN0L 3SDCD 2IMNA 1ZHKA 5F9OL 2X1QA 2GSIB 3MYJB 4XNXH 3C6SA 3PV7A 2QHRH 5CKGA 1NDMB 1XF3A 1Q0XL 3HPLA 1QLFA 2MQCA 1MRCH 3EGSA 3LZFL 5DMGC 3SDXB 3HC0B 4F3FA 1U2HA 2H32H 3RWEA 4M7ZC 3RA7L 1HXYA 4PJGA 3KYOB 1J0KA 4CADB 1AJ7L 2A6JA 1JMZA 3BFOA 5DD3H 3DVIA 1MY5A 4NKDA 2X4TA 1OAYH 4P3WA 1CGUA 2MHAA 5DHVH 4AH2A 5D71L 4OD3H 3GIVB 1U8OB 1AH1A 1GHFL 1HHGB 4F33B 5J8OA 3C8KB 2BSTB 4LL9A 4LMQE 4N9GB 1L7IH 4QXGL 2BFVL 1KJVB 2IBZX 2VL5B 4ZMAT 1NGPL 1YNLH 1MHHB 5DEZA 2OS7A 3W0WD 5J1SC 4AM0B 2RCSL 3OKKB 1DQJA 1RFDL 1T66C 4XP5H 1MELA 3QI9D 5FUZH 3MJ9L 4NBZB 4NKIH 2EC9T 4HKJB 1F58L 4AEIL 4P4RB 4HD9A 3HAEG 1NCDL 4GG6B 1HILA 2YD5A 3MJ9A 3PGFH 3F7VA 3KJ6L 4R2GC 2HFFA 4JRYA 4GMSH 5GRJL 3UTSE 4MA3B 4WW2C 1B0RB 1G7IB 1MJJA 4PJXB 3HLAB 3QUMB 4KJWC 3T0BA 5KG9A 3DTXA 1N6UA 3CSBA 3I6LD 4JFZH 4L29A 2QADB 1NFDE 4H25B 4RFEB 2ICWJ 4WY7L 5ID1B 1CK0L 5F7NC 5I16A 4WWKB 1KBGH 4QRPA 5IB1A 4NBYB 4F7MA 4ELME 3PWJA 1XZ0B 3GB7A 1MFDL 5D1XD 3FJTA 3FQWB 3HPJA 3ULSA 3ARGD 2NYYD 3V4VL 2B5IC 4UDTA 4LPCA 3RWHA 1UM4H 2MCG1 2J4WH 3S37L 3LY6A 5DJCB 2A73A