1NGPH

N1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3-nitrophenyl) acetate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
215
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N1G9 (IGG1-LAMBDA)
publication title Three-dimensional structures of the Fab fragment of murine N1G9 antibody from the primary immune response and of its complex with (4-hydroxy-3-nitrophenyl)acetate.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 39
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 1995-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngpH02
2P8MA 2V5SA 1U6AL 3RGVC 1FGVL 1G6RB 3P4LA 5I75B 2FX8L 1ADQL 4WHYH 5HTSA 5CEZE 4GAGL 1CE6A 3KPNB 2WZPD 3DXAA 5EU6D 1MFEH 4JDZA 4PGEA 3V5HA 2EDDA 3FT2B 3DGGA 3GGWB 3EYSH 4KGLA 4KXZI 1OAXH 3ARBA 2CJUL 1MHEA 3VXRD 2O61B 1WF5A 4S1DD 3U30C 1GZPB 4WCYL 4H8WC 4L3AA 4KUCD 4M7LH 2XACC 1HH6B 4M4RA 4RGOL 1AO7D 3RJQB 4FZEL 1NBYA 1G84A 4AL8H 2DQGH 3CZJA 4ZS7H 4JFEA 1DBMH 5ESAB 4P2OC 5J1TC 5DMKA 2GTZB 3C2SA 5F9WB 1T2QH 1OCWH 5D8JH 5TQ2H 3INUL 5ITFB 5MEQB 4JHWH 2G2RA 5AD0A 3OF6A 3IFLL 4M62H 5I75C 3QI9D 4A6YB 3CSYB 1EAPA 2H1PL 5JW4N 2Z92A 3L7EB 2IH3B 1JZ4A 5GGRA 2K7PA 1E4JA 5CINL 5DHVH 2C3VB 1A6TB 2OR9H 3UDWC 5H2BB 1EZVY 3TBTA 5LWYH 4JAMB 1MJ7H 1I8IA 1ZHNA 1P5VA 5IK3A 5C0BD 2NY2B 5D71H 4XVSL 2OMNA 5LGJA 3V0WL 1BECA 2ERJB 3SDDA 4NC2B 4P4RB 2X10A 1LP9B 5FDYA 4MAYB 1KCSL 1Z9SA 3P9WB 1MHPH 3D25B 3BUTA 4LSDA 5F9WC 3O3BB 4DKFH 4LQFL 3SCMD 2JK5A 1YYLH 2JJUA 43C9A 1X5ZA 4M1GL 1F6LL 3DUSA 5TH2A 1BEYH 5GRXG 1YEDB 2IPUG 4Q9CA 4XVJL 2XRAL 3TJEH 2XWJA 2VL5B 4MSWA 4HHAB 2C1OB 5ANMA 1GIGL 1FORL 1U58A 3HZVB 3MRBB 3K80A 5F8QC 5D7LB 4AK1A 1CGXA 1MUJA 3CMOH 3I6LE 4L29B 5CHNA 1LEKB 2NY2C 4QRSA 3U0WH 1FO0H 2GITA 2GI7A 1YMME 1IQDB 5FM5O 2GEEA 4CVUA 1KACB 3ARED 3QXDB 4NZUL 5I1AA 1ZLVH 5IOPA 1RZ7L 4Y19E 5IW1B 1KLUB 4ZYKA 1QRNE 4X5XB 5A2FA 4FTVB 3UBXA 1MSPA 5DS8B 3G9VA 1GPOL 1PZ5A 4LCWD 4TVPL 2YD8A 1JVKA 3QUKA 4G43B 5EORH 4NRZB 3LZFL 2OSLB 3BFOA 1MFDH 4LFHD 5ICYA 1G9NC 4U6YB 3ZZ1A 4ORGB 3RNQB 3MLZH 1S78D 4XHQA 4OQTL 3H2WA 4LPTA 3SHSA 3VFVB 4UT6L 4QHLB 1HOCB 3Q6FB 4WO4D 4LOUC 1S8DA 3N9GH 4ONFH 4JQIL 4GKSB 4KJQD 4EDXA 3RL2B 3OWEA 2MSPA 4D0BB 1S7SB 3LEYL 5JMOC 2J2ZA 1CQKA 5J6HA 5CP3A 4O4YL 3RIAF 1VCAA 5DQJA 4NZDA 4I5BB 4O5LL 1YYMH 1FDLH 1PYWA 5E4IA 1D5IH 3RDTC 3AXLA 3WSQH 4ZOEA 3RWCA 3C8DA 3TO4A 1CIDA 1I7UA 3GKZA 5E2UL 2M8XA 3KHOA 1DBAH 2ZWLT 1PG7L 1A9EA 4XXDA 3D18B 4HS6B 3WO3B 5JR1L 2Y7QB 1P4BL 1K2DB 2XWBB 2EE2A 2J8UE 2YEZB 4P5TB 2AXJA 3JTTB 1J0YA 1NGPH 4PRAA 4WW1A 1T1YA 2F58H 3GSNA 1S9VA 2O5XL 4F3FB 2R9HC 2CDGB 2CKBA 5J1AA 1OD7A 4HWUA 5I1HL 4YGVB 2NY5C 1UENA 5GISL 4QRPA 3ZKNC 4BQ9A 3WDHA 2AQ2A 3U7WL 4M48L 5BW7C 3RX5A 1IGJB 5DXWA 1YEJL 4KI5F 3JWNC 4PJ8D 4J8RB 2L0DA 1YEHL 2GAZA 2J8OA 4RDQF 3SDXB 2PO6D 5D9SA 3MV9E 4JVPA 4FMKA 1DQDL 1C12A 2F9BT 5JPNB 4TVPE 3ARFC 1IC4L 3H3BC 2VB5A 3S98A 5HDBE 3S97C 2A6JA 4HWEH 1BIIA 4MQXD 3IJSB 1A7QL 3MJ8A 5E8PA 4K9EL 1RUAL 4C4KO 1P9MA 2EEDA 2R29H 5I8OH 3WFHA 1FPTH 3PGDB 2F19H 2BNUA 4XWGL 3RBGA 3F65A 2HKFH 2CQVA 4EN3C 4R8WH 4GRLC 1U8MB 2GJJA 4U1NA 3QUMH 2YK1L 4Y4FB 1SQ2N 4ZUWA 5IBLC 4ODUA 5EU6E 1ADQA 5C0FA 2WP3O 5F9OL 3LIZL 4DVBA 1T1XB 5KSAD 4UAOC 3EAKA 1GAFH 3K46A 1DQQA 2G60H 4MNHA 5C0CB 3V9FA 3VXRE 3CXHJ 2A6DA 3V0VB 2C7UA 3BIBX 4XBGA 4OI8A 5J4MA 1AO7E 3QNYB 2Q8BH 1Y6KR 4GMTH 3AB0B 5IVXE 3C08L 5CWSB 1QQDB 4OLXH 2C1PA 4GBXB 3X11B 1FSKB 2K9UA 5IFHH 2I5YL 1D9KA 3RVWC 1I4FA 4XGZB 4NM4H 1NUGA 5DEZA 1EMTL 4FXKB 4LLUB 3I02A 3KJ4C 3H3PL 5LQBH 2CUIA 5ERWA 5CCKH 1JHLH 5D96B 3QYCA 3ZKMC 1C5BL 1U41A 1AR2A 2QQNH 3TVMA 5KTEH 5C0BE 3KGRA 5GGTH 1AKJB 1FYTD 1QSEB 3OSKA 1UVQB 2W0PA 3ZLQC 1HXMB 3EYVB 1YC7A 3DARA 1LO4H 2OTWA 2CLZA 5SWSD 1UKSA 4NBZB 4H8WH 1O0VA 2WV3A 4R96A 4TULH 1DFBH 5FYLH 1G0YR 3RU8L 4PRPD 5IJKA 1NLBL 1HDMB 4EUPA 3O8XD 2ZUYA 3A6CH 3QH3B 1KULA 4W4OA 2J8UF 4TUJA 5DEFA 1GGUA 2A6KB 2K7QA 1BFTA 3B6SA 1RJCA 5JW5A 2VSCA 3G5VA 2VZ3A 5F7DA 1EVUA 4RA3A 1ZLUH 3IFPB 2DQFA 1WBZA 1D5XA 4O2EB 4N90D 2Q8AH 4PRNA 4HKJB 1A0QL 4LCUA 1TJGH 2FJFB 1XF5A 3SE4C 1G7MA 3BP5B 5L88L 4JO1H 4NQXB 4OGYH 1NC2D 2AERT 1WZ1L 5BV7L 1V3JA 1LDPL 1WSST 3PP3H 4Z6AT 3EHBC 2J8UA 1HHGA 1YNTA 2FX9H 3GMPA 5HHPB 5H94B 3S96B 3GK8H 5HDBF 4RGMB 1XGQB 4WI3A 4HIEB 2H9GA 3S6CA 1JMXA 2EC9U 4U6HA 3C6LD 1KB5B 5IROA 4NKIL 5CJOH 3C87A 3TEUA 2EE9A 4Y5YB 4QWWC 4N5UA 2VXSH 1HCFX 4LCWE 3O2VH 4OZFB 3U6RB 3SDCD 4KPHH 2YS4A 4XTRD 3K2UH 3O6LL 3HHRB 3UTTB 1T03H 2OTUA 4ZDHA 2YHGA 3BVNB 2P7TA 3MGTB 3SPVA 2FBJL 4Q9QL 3CDCA 5IBTH 5I8CB 1ZT4A 5HHOB 4JHZA 1TCRA 1FVDB 1A4KA 1IE5A 1RK1B 5FV1L 3FCTB 2FL5B 3IDNB 2XN9D 5E95B 1JGVH 2EKSA 1MCQA 2HA1A 3SQBA 3QDGD 1JK8A 4KUCF 1S7TB 4UINL 1QLRB 5KN5B 2XZAH 4BZYA 4PJHE 3V7AE 3TCLB 3PHOB 1I8KB 4FQCH 3HPJB 3FTGA 3F58H 5IVXF 2E27H 1INQA 3EYSL 4P5KA 5EU6A 3BEVA 3V8OA 2XZCH 4JRXD 2LVEA 3T0EC 2HVJB 3WFEH 5BJTB 3G6AB 4M7LL 3VXSD 3VXRA 5EA0L 2MHAB 3UXFA 2R2EA 5DMGD 4AL8L 2JJTA 3F7QA 1K3ZA 4ZS7L 1J8KA 1G9NH 4WENB 5E2TH 1URLA 5ICXB 5BZWA 3P9MA 1AO7A 2DI9A 5KSUB 2A6IB 3S3SA 1T2QL 4PGZA 1OCWL 5D8JL 1NUFA 5C0IA 2WQ8A 4JHWL 4WNQB 5IVXA 2BOCA 1RJLA 2NW3A 3LDBB 4HKXB 1P4LB 4M62L 4FXGA 4EQ3A 1AP2A 3NCCB 4KK8D 2A38A 3MV7B 2ZOKB 3QI9A 4PIRF 3WIIH 2OR9L 3C5SA 5E7FA 2D7TH 3U0PA 4Y1AD 3WJLC 5LWYL 1MJ7L 2QSCL 2FGWL 5I17A 1QVOA 4NC1E 4IRZH 2MQ3A 1CXEA 4HS8H 3CVHB 5HHQB 1RUQH 2AJZB 2OCFD 5GJSH 2XKUA 5C0BA 3SGKC 5TQ0H 2AK4B 3GO1H 4NT6A 3WNMA 5B38G 1H5BC 3F7YB 4LLQB 1G7QB 1MHPL 5FM8A 5F1NA 3VG0L 4JRYD 1CFSB 5HD8C 1HHJA 1CFVL 2D9QB 3FB6B 3MA7B 3ARGD 2YZ8A 4DKFL 1XGPA 3CDYA 4CAGA 1YYLL 3TT3H 2E7BA 1A22B 1F4AA 2NY5H 3HE6D 3BH8B 3UZEA 1BEYL 1N7ML 4O9HH 5SWZD 5HYJD 4ZPVB 3SCMA 4CU7A 4OAWA 5C6WH 1PLGH 3TJEL 1YY8A 1VERA 3EO1A 4MD4B 4MMZC 4P59H 3ARWA 3FONB 1JWSB 1AI1L 5DJZA 5DMYA 3W11C 4NPYA 2BVPA 3V52H 4HIHA 1BOGB 3P3YA 2Z31B 4HKBA 5B3JE 3MRRB 1FO0L 3I3DA 2X4RB 1A3LH 1Z3GH 1L7IH 1OTSC 4E41E 3HMXH 3AAZB 3TN0B 4HG4J 3NCBB 1JJUA 1KCUH 1FZJB 3VH8A 4MS8C 5CZKA 3AREA 5CGMA 2DI7A 4QTHA 3W0WE 3GJEB 3OZ9H 3BWAB 3TFKC 4QHKJ 3S34L 5EORL 4LCWA 5GGSY 2VDLH 3FB7A 1MFDL 3OKLA 4X5WA 4K3EL 3G5XA 1MH5B 4PJHF 2O93L 3FN0H 4FXLA 5DJ6B 1F3DJ 2AXGB 5BZDB 3IDIA 2EIZB 3MLZL 1YN6B 1FYTE 3PL6B 4DN4H 1NANI 3GI9H 5IR1A 4I4WB 1FFNB 4PGBB 3QXAA 4NO5A 2DS4A 2WUBH 1I7TB 5FCUH 2X2YA 5FYLD 1FP5A 3CFJA 2HTLC 5J57B 1UB6B 3E3QC 4GMSH 4WO4A 2O5ZL 5GZNC 1SJHA 1NBVH 1JTPA 4QRUA 4JG0L 4XH2A 4P2OD 1YYML 1FDLL 2AEPH 1D5IL 1YJDL 3WSQL 2P4AB 2EYSA 2P8PA 4N0UE 3MJ7A 3Q3GA 4PJHA 2YD2A 2V7HB 4UUJA 4P23B 1TZHB 3HMWH 5TFSH 4YHML 5ID1A 3STZA 1L6ZA 1MCKA 4DVRH 5H37H 5HYQA 2P47B 5EIIA 1DBAL 5HJ3B 4N90E 3O6MH 3T65A 4HXBH 5J1SC 4GAJL 3KPPB 1FL5A 3GMRB 4WGVB 1RVFH 1ZHBA 4WWKB 5C0EA 1CXIA 4WTXA 2BSRB 2N7AA 4JFDB 1YEGL 3VE0A 2BY2A 4M9PA 4R2GB 1NGPL 3P9LB 1ZMYA 2F58L 2HG5B 5SX5K 1KIRA 2WIMA 2OL3L 4ZXBB 3IF1A 5GGSA 3CD4A 3N0PB 1BJ8A 1NANH 1JNJA 5D7IB 1EEZB 4PS4H 1IGTB 4JHBA 4PY8I 3LCYA 4E42B 3EYOB 1CWVA 4JZJA 3SGJA 3MV8B 4HULB 3LQZB 4QYOB 1NC4D 4HLZG 4PJ8A 1XH3B 3MUJA 4P23C 2PCPA 1IBGH 1TVBA 2PO6A 3QFDA 2AEQH 4HWEL 3V6OC 2ED7A 1G7HB 4M7ZC 1JUFA 1FZOB 4WWKC 4X4XB 4BFIB 1FE8L 1FL6A 3F12B 1MCIA 2DWEB 2AAVA 1YPZE 4JANA 2J4WH 3SKNA 5IQ7H 3OGCB 2AJVH 3IAPA 3MFGB 3QUXC 2R29L 5I8OL 5BQ7A 3BI9X 3MRKB 1K3IA 3L6FB 1YZZA 3MCG1 4P2RB 4L9LB 1JWUA 1GSMA 2HKFL 3H8NA 3C6SA 4IS6B 4K3HA 3SEPA 4R8WL 1N64L 4IIQA 3QDGE 5B3JF 4OCWH 1B0WA 1R3IH 2E9IA 5DFVD 3QPQC 5DEGB 5BOZG 4NYLB 3DWTA 1GAFL 3FN3A 1CT8B 3QEQB 1P7KB 2W0FB 2C4XA 1UM6H 4V2CB 1U95B 5IMMA 2G5BA 3CFKB 5KSAA 5IFJA 3VDAA 3IYLW 3W39B 4ZFOA 3QWOA 4ODXB 4HUVA 2GUOB 3NFPB 1MCBA 3VXSE 3SN6N 1GH7A 2Q8BL 3ARRA 4BKLA 2F8VA 4GMTL 3RKDC 1MFNA 1LMKA 2YC1A 3BIAX 1DLHA 3G08A 3QR2A 1KTLA 2O26U 5CSZB 3UZQA 4OM0H 5IFHL 4YHZH 1R5IA 1T04B 2H32B 2VLJD 4NUGL 1KXVC 1HH9A 1LD9B 5LQBL 2PXYC 3RAJH 3OMZA 2C3HA 3JV4B 3S37H 1UEYA 5CCKL 3FZUD 1JHLL 5FUZL 4JVUA 1NCTA 4WI6A 4G8GB 4Y1AE 5E6YA 2V9QA 2QQNL 5CJQL 3MO1B 5MERB 4DCQB 3HNTH 5KTEL 2FH6A 3GMLA 5C2BH 1A6WH 1GGCH 4M93B 1LO4L 1M7XA 4NO0B 4OZFH 1E27A 1NFDB 3BPLC 5DHYB 2JF1A 4H8WL 3QO0B 1FYTA 1EEYA 4TULL 1DFBL 5FYLL 1SM3H 2X9WA 5SWSA 3QFJD 5E4EC 1XF2B 3OKDB 3A6CL 3SE9H 1AC6A 2Z4QB 2HN7B 1CN4A 1INEH 4PP1D 4PRPA 3C60C 1X5YA 3QJHA 2YUXA 3O8XA 5GGUA 2OQJB 4OI7A 4KKCC 5HYJE 5CIPB 5SWZE 4N0UA 3BRFA 5IIEA 3OBAA 4PBVC 4YHYC 5GQBA 5LAXA 2BNQB 2BSTB 2OYPA 4PP2A 4OGYL 4N0FB 4S0SD 1F58L 1W72H 4NQVB 4YX2H 4QRTA 1WTGT 4OLEA 3MRLB 5EFIA 4XNXH 3ARFD 1DLFH 1HKLH 1NC2A 4UB0H 2BC4A 2FX9L 1I7RA 1ACZA 4X7TB 4JY4B 3GK8L 5BXFB 2BX5A 1JV5A 3L3GB 3MOBL 5CD5C 1JPTH 1OAKH 2VWEC 3B4NA 1OP3K 1FO0A 4MZ2A 5CJOL 1RD6A 4EXPX 1QRKA 3TH4T 3DX8B 1YPZF 3DX9B 2VXSL 4U0QB 2YSSB 3C6LA 1MCEA 1Y0LB 3O2VL 4YPGA 4KPHL 3VXUB 4EN3D 4LSSL 4V1DB 1CBVH 2COQA 4ETQB 4PREB 2IAND 5IBLD 3ISWA 2GSIB 3F5WA 5SWQB 3SDCA 5I1DA 3EJYC 1P7HL 4P48A 1KIQA 5IBTL 2FIKA 1RIVL 2J88L 3VXQA 1KCVH 3SKMB 3VFPB 4JE4B 3O41A 1YY9C 1YPZA 3V2AR 3V8CA 1JGVL 5GS1C 4DKDC 5FYLE 2XZAL 2RBLA 1IAOA 2XN9A 2E7CA 2VDOH 2D0GA 5E56A 3QDGA 5F9AC 3C5ZC 3GSVA 4HMEA 5C70A 2IAMC 3F58L 4KQ3H 4OLYH 2E27L 3KLAA 3LKQA 1BX2B 2A74A 1AR1C 2XZCL 3RVWD 1J8HB 2ZCHL 4QXTB 1HIMH 2UYLB 5I1CL 3ME0A 4GRWH 4HGMA 2GJ6B 4HQQH 5BS0B 1K8DB 4G6JH 4JRXA 4APQD 3MRIA 5A16B 3LN4B 3B9AA 4OF7A 1D5MA 2G75B 2A77L 3MYJA 4DTGH 4BSWB 2FYYA 4PG2A 2VZOA 5MI0C 4S1SH 1G9NL 1R3HB 3LB6C 5E2TL 3VXSA 3MR9A 1NGXA 3PGFH 1DANU 4YBLC 2X89D 1TPXB 5I66A 5HVHB 1KTDA 3BP7A 1CFTB 1G9MC 3EO9H 5JLZA 3HG1B 5GGVH 3IFOA 4X6DF 1UH4A 4JN1H 4M6MH 1VB9A 3U83A 3OXRB 2OL3A 1OT1A 3DV6A 3PIQA 4EVNA 1HQ4B 3E8UH 3S8WA 3VA2C 1Q94B 3OHXA 1TJIL 4Z0BL 4QTIH 4MD5B 3UTQB 4IRZL 2M26A 4HS8L 2BXYA 4XI5C 2DQIH 4Y1AA 5DVLA 4NQSB 1YDPB 1RUQL 5GJSL 4ZQKA 4EIGB 5D1ZD 3T1FB 2IQAA 5TQ0L 3GO1L 3P4NB 4X6DA 1ZK9A 3S35H 5CZVL 5C8JA 3C8KB 1KPVB 1WAAE 5A3ID 3FN9A 4FS0A 4QHNB 1AQKH 2GSGA 2VLRB 1CL7I 3AROA 2BNRE 1TPXC 3OKNA 3T3ME 4JRYA 5DJYA 3L3IB 3RUGE 3TT3L 5D2NB 2ZOLB 3OAUH 2NY5L 3ARGA 3L1OL 4IJ3B 5IWLA 1EO5A 1G7IA 1UQSA 4N8VG 1IGYB 1TDQA 5ISZD 3A0OA 4XX1G 3X12B 3HE6A 5HYJA 5L8KB 5SWZA 1NGWA 5C0JB 4QWWD 4TOYH 4L3EB 4HK0A 5J12C 2OMBA 4G7YL 2BY1A 5EIVA 3VRJA 3PV7A 4QHMB 2FZ3A 5DJCA 2EYTA 4IOSD 5LJYH 1K6QH 5FGBA 1RV6X 1A3LL 2ADFH 4HV8B 1Z3GL 1L7IL 5JW4M 3VGEA 1TENA 3HMXL 2BJML 3ZDZE 4ZD3L 3V4UH 3BOVA 2X4OA 1KCUL 2X1OA 3VJ6A 2HWZH 3GMOB 3D39B 1OSPH 1T0MB 3BHBB 3BX7C 1D6VH 3LH2L 3VFMA 4PGDA 4QLRA 2VLJE 3OGOE 3PWJA 1U8JB 3I6GB 3PHSA 5DMIH 1KB9K 1LE5B 5D2NC 1CFQA 2ZJSH 5JW4R 1N2RB 4IJ3C 4C4KT 2X4TA 2X1QA 5IB1A 4JFYB 3DX6A 3RNKB 4FP8L 4YHKL 4QF1A 2CDFB 3FN0L 3MLTA 4IM8A 3U9UA 5E5MB 5GPRA 2BVYA 3BYTA 4JR9H 4JKKA 2FJGA 4DN4L 2B8OT 1HINH 2EKJA 5C0DA 2EDEA 1X5JA 4HFUH 4ZUVB 5SX5H 4EQ2A 4Z78A 1P5UA 2XNAB 5FCUL 4PJEB 4OI9A 3BW9A 3QFJE 4GMSL 1ITBB 2FEEI 3GSWB 1NBVL 2A0LD 4L4TD 3QQ9C 3MODH 4R4NC 5D1XC 1JZ6A 2AEPL 2E9WA 2MJWA 2SEBA 2BVEA 1R3JB 2H26A 2YUZA 3GBNH 3HMWL 5TFSL 4X6FB 4P2OA 5CLTA 4DVRL 4DKAA 4OZGE 4RFNB 3O6ML 3U7YH 3P77B 4HXBL 1L9MA 1U3HC 4X9HA 1NGZB 1IEAA 4JFXA 1RVFL 1UYWH 4UILH 4KKLC 3WCYA 4K7PL 3FRPG 1T22A 2W07A 1LEIA 2EC9T 1P7QD 4KHTH 4GW4A 2R15A 4NSKB 3EDFA 5DK2A 4P3DB 4QRRB 3IJYA 1BM3H 1EHAA 4WHTA 3BKMH 3S5LG 3UDWA 1TTUA 3CCHA 3H3KA 4LBEA 4F57L 1J1OH 1XMWA 2BVOB 2JTDA 2R56H 4F7PB 1M7IB 4PS4L 1MCOH 1ZTXL 4LLAA 4B7LA 4OFDA 1T1ZA 3RP1A 4FFZH 4OFIA 5DUPH 5KS9B 2AI0H 4YWGH 4PLKD 1G7LA 1UA6H 3EOBB 4L4VD 3PDDA 1EVTC 1IBGL 3T3MF 1VHPA 5GRVK 3RPIA 2IANE 3KDMB 1NC4A 3RUGF 4EI5B 2Z8SA 3VFUA 1I1FA 1DZBA 1NQBA 5IQ7L 1FFQA 2J4WL 3MNWB 1QLFA 4RSVA 5ESVB 4OGAC 2AJVL 1RY7B 3BUYA 1MLCB 4ELMF 2XWTB 4Y4HB 4WEMB 1FG2A 4UU9B 1FJ1A 1WJ3A 3G6DH 4KDWA 1WAAA 1GGYA 5L2JA 2ADJA 1NL0H 3U0TA 4NUJA 4TSAH 1ROWA 4I13B 3EYUH 4JQVA 4TVSa 5E6ZA 4JRWA 3RUGA 4XPBH 1WFNA 1I75A 4H5SA 1IGIH 3VXNA 3ZDZF 2X4PA 1A1MB 1JHKH 3RWHB 2X4NA 4MS8D 4U05A 1EK3A 4CN1A 3PABB 2X9XA 2FO1A 2ICWA 2ADIB 4ELMA 2F54D 3RVTC 2YPVL 3HZMB 2I9TB 2X70A 3PNWA 1SMAA 5DUMH 5ALBH 3BXNB 2DD8H 4U6TA 4XPAH 3WS6C 5FK9A 5LBSH 1YMHB 4JDVB 2BERA 2LTQB 4YHZL 1VADA 4UQ2B 1NPUA 2NNAA 2IMNA 3BDXA 1DEDA 3TT1H 1JWMA 3CC5B 1WWWX 3TH2T 1BGXH 2X6MA 3HLAB 3BZEB 3IDMA 2YPLD 5I1EH 3RAJL 1T4KB 3OJDB 2VLJA 1QNZH 1L7TH 2GK0B 2F5AH 3OG4B 2OR7A 5GZND 1FFOB 3X3FH 2WBJC 4OLZH 2ZUQB 3F8UB 3V0AC 4UOJA 3HNTL 4YDKH 1XGYH 5LGHH 5I19H 1FL3A 3V79C 1A6WL 1GGCL 5JPMB 4OM1H 5C0AB 4YHNB 4ODTH 2R2HB 4OZGF 4JPVH 2KKQA 1H15A 3N1QC 1A6AB 1S7UB 1SM3L 5D93C 4KZDH 1P4IH 4G3YH 1KJ3L 2NTFA 1WFOA 4PJFB 2XFXA 5T1DH 3SE9L 3K8KA 1HXYA 3E2HC 1UJ3B 1OP3H 1INEL 4DZ8B 4F33B 1MNUL 3QFJA 3AU1B 5KZCB 4OCNC 1EUTA 4WU5A 1G9MH 5A2KH 3GKWH 4JO3H 4GSDL 2VIRA 7CGTA 4MJ2A 5ILTH 4XZUA 4RMQA 3QG6A 4OZGA 3JTSA 4Q6IC 3SBWA 5BW7A 2AEWA 1W72L 1W8NA 4YX2L 1W0VB 3CFDB 1ZHKB 4YEEA 4LPWA 3HC0A 4XNXL 4LL9A 3REVA 1HKLL 4UB0L 3WUWB 1HZHL 1RZJC 4RMUA 3H9SB 4PTTA 2XI9A 3PP4L 1JPTL 5EU5B 3ARFA 43CAA 1OAKL 2R1WA 4ZUUA 3NAAH 1DSFH 1E4WH 2VDNL 1HYRC 1JN6A 5IB4A 1OW0C 2WQRA 1M4KA 2NY3B 4RAVA 3HMXA 4K7PX 2BY3A 5TGBA 2HMID 3F6LA 1EXUB 1MPAL 3KYNB 1XF1A 2V9RA 3DMMC 3AMKA 4K7PY 1CBVL 4HUXB 2WNGA 1FIGH 5BO1H 5FECA 1XR9A 3NZ8B 2CRIA 2RB8A 4EN3A 2ITCA 4LLDA 3RWFB 1JZ7A 3QPQD 2IANA 1P2CB 1A6ZA 4ZAKD 2QQLH 3T4AB 1Z0MA 3FQRA 1G0XA 3GSQB 3UYRH 3PWNA 3NVQA 5KAQG 4P4KD 3T0EE 3X14B 2Z9TA 2OZ4A 3STLB 4FQXC 4OGZA 2KPNA 5EBLA 1VGKB 2F74A 2J8HA 4Y5VA 4Y16B 4G8FA 3O6KL 3VFNA 4BQBA 3QHZH 3GHEH 2VDOL 5IVOA 3O45B 4L4TE 4MCZA 1GL4B 4J3VA 3MOAH 2A1WH 3JBG7 1SYVB 3O9WB 4OLYL 3TH3T 5F7EL 1J86A 2NY3C 1JZ3A 1H3GA 3RA7L 4YHIA 1HIML 4YFLF 2DM3A 1M05B 3FQTA 4HQQL 4JCMA 4G6JL 5B38A 5INCA 4J3OC 3DSFH 4I48A 4Z95H 1CDBA 4DTGL 1LE9A 2AJYH 5F7MC 4GT7A 5E1AB 1J0ZA 2XV6B 4S1SL 4APQA 4DZBA 3D9AH 3PGFL 4WU7B 3PDGA 4X6EB 2NX5B 5GGVL 1OGTB 4YDVA 1QFHA 2X89A 3BH9A 4PJIB 4DQOH 1YNKH 4M6ML 2X4SB 1TNNA 3O3UN 3VWKD 3D0LA 1NJ9B 5FKAA 3E8UL 4QCIB 4RGNB 2YD9A 3FO2A 4U7MA 3VFSB 1OF2B 4QTIL 1MY5A 4R4BA 2NR6C 3C60D 4L4VE 2VOTA 3BPOB 1D5BA 2APXA 1XIWB 2DQIL 1TQCB 5AZEH 1NSNH 4KKCD 3IDGA 3IVKA 3E6FA 3VD3A 4BQ8A 1T66C 3H9HA 4P2QD 3FT4A 1G6VK 3S35L 3CH1A 3M1BA 3PQYD 5D1ZA 1ETZB 3MLRH 3V6FB 5JOFB 1T7VA 1AQKL 1NEZG 1WITA 3UMTA 4N9GB 2UWEE 4G5ZL 3VGDA 3BKYH 4PJCE 1YEIH 3C2AH 3SE4A 1FZKB 1GHFH 1T5XA 4HWZB 4MA3A 1AQDA 3MLUH 3SKOB 4YHLL 1OPGH 3OAUL 4KJYA 1GOGA 3FQXB 4PY8J 4X6BA 3WHXB 2C9AA 1KPUB 1A14H 1I3RA 1B0GA 3WFBL 5K9OB 4RGNC 1PEWA 4TOYL 5ISZA 1ACYL 3CDGB 4F9LC 5E6IB 3BPOC 3D3VD 1FN4A 4GRWE 3VXPA 1TQCC 1L0XA 4J4PD 2PYFB 1K6QL 2Z35B 2EC8A 2ADFL 3QDJB 2R0ZH 5AYUH 3QWRD 1OWRM 4WI7A 2R1XB 3SDAC 3EJYD 3N85H 4G8EA 5MENB 3ALPA 2QR0A 4OV6F 2HWZL 5FUOH 1OSPL 1D6VL 1BQHB 1HYSC 1CICC 1IL1A 4WY7H 2R4RL 3DYOA 4U2YA 4LRIA 4XNZB 1CXFA 3ESVF 2EO9A 4PRHB 2ZJSL 2YPLE 4HIJB 1H8OA 1QPPA 2CLRA 5HGAA 4XNYH 4KFZC 1SJEA 1XAUA 2O5YL 5F96H 1BFOA 3C5JA 2IAMD 4XCCL 4IHOB 4JR9L 3TZVB 1AR1D 1BHGA 2KDGA 2VC2H 4F9PA 1N8ZA 5E6IC 1YUHB 3R1GL 4WDIB 2YXFA 1ZVSA 1PGRB 3ZTJG 4KKAD 1N0XH 1PW3A 3OG6B 4DFIA 1XGRA 4HFUL 4YC2B 4GXUN 1QLEH 5JO5B 5D4QA 4CU6A 4DUVA 3K4DA 3MRJA 4QGYA 4ZPTA 3MODL 1F4XH 3RI5K 5JQ6H 5IMKB 4ISVB 1T0PB 2CUHA 4HUWB 3SOBH 4L4TA 3GBNL 5DC4B 1ZANH 4PV9B 1MCFA 3U7YL 3U82B 5I2IA 1CLYH 1UYWL 3P0GB 1Y6NR 2NLJB 4UILL 3WO4C 1MF2L 2DIJA 1CR9H 1HHIB 4XNQB 1A4JB 4JFZL 1C5DB 1J5OH 3EYFA 5CGYC 1DQLH 5FYKH 1MY7A 3VW3H 2FECI 3MBEB 4OB5H 3CVIH 3GMQA 1P7QA 3L3OA 3DROB 2EECA 3QZWB 4X4ZA 1W72A 1PKQE 1BFVH 4Q74A 3V6OE 1S7VB 1OAZH 1FVCB 1TJHH 4H26B 4YC2C 4NWUH 3X17A 2I24N 1RPQA 4POUB 1MCWW 1MCOL 3LEXA 5DRZB 4KV5E 1M7DB 5DDHA 5BMFL 4FFZL 3SGKA 5DUPL 4PY7B 2AI0L 2R1YB 2HFTA 4YWGL 1H5BA 3CSPA 3QQ3A 1AGFA 1UA6L 3KPTA 3JSSA 4PJCF 2WIIA 4TTDC 5DFTA 5F71A 4PJXE 3QSKB 2QHRH 4L4VA 4XCEB 2FNBA 1G0DA 5F7FA 4DJMA 3U2SB 2XTJB 2VKXA 3WLWD 2XXMB 1I8LC 3THMH 4BH7B 4A2MA 1HILA 2B0SH 3KS0H 5J6GA 4UBDD 4NDMA 5IKCB 1MVUB 5FO8B 1ZEAH 3G6DL 3KG5A 4NRYB 1R24A 4OIIH 3QDAA 4D8PA 5E9DB 1NL0L 4H25B 2X40A 4GRWF 4GW1A 1RZJH 3KYKL 2P5EB 4PJCA 3Q6GH 3EYUL 2AV7B 1MCPH 5DGRA 3IU3A 1F90L 4XPBL 1IGIL 5B3NA 1XEDA 1JHKL 3S35X 5I1JL 4DGYH 5B8CB 2P8MB 1DANT 2YD5A 3J8F7 4LDOB 4S1RH 2A73A 4W6WB 1AC0A 1CE6B 5JOPD 3DXAB 2V6HA 1RK0A 4ENEC 3V5HB 4W6YB 1BWMA 2W38A 1DN2A 5EOCL 2XTJC 5D7JC 3DGGB 5ALBL 2FR4A 2F54A 2I26N 4XP5H 3HI6H 4XPAL 3U4BH 1LO0H 3D69A 1RUPL 1U8HB 2V5YA 1A21A 5GS2D 1V3KA 3ARBB 1JPFA 1MHEB 4Q0XH 4LNVA 5GHWH 1HKFA 2ZPKH 5DJ0A 3TT1L 4PYGA 5ID0A 2BMKB 4POZD 1BGXL 1NUNB 3O81A 1SBSH 2Y4SA 2VDRL 3KPMA 1NBYB 3TPKA 5M7QA 2V2TA 3ROOB 3BEWA 1QNZL 1L7TL 1A7PH 5IEKA 3X3FL 2YPLA 5DMKB 3MFFA 5D1XD 5DJ2A 2AW2A 2J5LB 3IT8D 2G2RB 4YDKL 5AD0B 5LGHL 3VWJC 5HDQH 1QFPA 2W9LA 2VZVA 5I19L 4GG6E 4ZMAT 1EAPB 4OM1L 4PRBB 1AFVH 1E4XI 1RIUH 2DLGA 2C3WA 4ODTL 2Z92B 4JPVL 1S5IH 1YQVH 1U3HD 3O6FB 2WBWB 4P2QE 1MRDH 3WIFA 1M6OA 4KZDL 4G3YL 4NN5B 3PQYE 4F7CB 5CKGA 5JIHA 5T1DL 3GMMA 1IEBA 1I8IB 1ZHNB 2EEBA 3M8OH 5IK3B 3ARBC 5HHVH 5LGJB 1G9ML 3B83A 4PLJD 3GKWL 3SDDB 3L5XH 4XP4H 3BDBA 1R5WA 1JGEA 1KBGL 5T1LD 2Q76A 2VWEE 4OUUA 3MRGB 4IOFC 4U6XA 4KV5F 5JDJA 5HI5D 5I8KL 2J5LC 5TDNA 4YR6A 8FABA 2JK5B 1XCQA 2VSDA 5CEYA 5HI3D 3D3VE 5DD6B 43C9B 1K4DA 1SEBA 4CMHB 1UZ6E 3EJZC 2BHZA 2Q3AA 5T3XH 4PJXF 3D2UD 2B2XH 4KAQH 1E4WL 2XWJB 1E4XH 3RWJB 1PKQA 4MSWB 3TBYA 5ANMB 3DRTA 1U58B 3NGBB 2HJLB 2NQCA 1B3JA 4LLMA 1MUJB 1BMGA 4GRMA 1N6VA 1QYGH 5CHNB 4PGJA 3P4MA 4ZUSB 1AGEB 4L4JA 5IBUB 1FYHB 4QRSB 3DVNB 3SDDC 2GITB 1Q1JH 1IAIM 1FIGL 2AJXH 5BO1L 1CLOH 1S9XB 3EDJA 4FQ1H 4JFPA 3B3IB 3N1GC 4AEHH 2OTPA 3V4VH 3RJDA 1L0YA 4MWFB 4JLRB 5I1AB 4U1IA 3ELAT 4PJXA 4ZYKB 2QQLL 4LEXH 3UBXB 4MLSA 4K8RD 3UYRL 1AGCA 3GM0A 5CJXA 3IDYB 2EDRA 1BVLA 3MRDA 1U8IA 3WNOA 1NFKA 2FD6L 4ZAKA 3WFDH 4CMHC 4I77H 4P4KA 3G6JE 4Z7UF 3RVTD 5KVFH 5ICYB 3DYMA 3GHEL 4CL7A 5JHLL 5EUKA 3I84A 1N3NA 4NNPH 3BGMB 3NGBC 4OSUH 2VE6B 3MXWH 2DM7A 3OXSA 1TIUA 2ILLA 3NZHL 3R06A 2ZSWB 1S8DB 4L8BA 4EDXB 4U0RB 4XPGH 3Q48A 4Z9KB 4LVOB 5J6HB 2ZCKH 3DSFL 1FAIL 3KPQA 5DQJB 1F4WH 1P84J 3QDHA 3RIAK 4HUUA 4Z7UA 3ARVA 1PYWB 1IAII 2CRYA 2WBJD 1IMHC 4HX1B 2X5PA 3TO4B 4OZ4A 1I7UB 4FQLH 1KLGB 3ZL4H 2V5RA 1O7SA 4R9HA 1OARH 4F7TA 1YNKL 4N8VA 2ICEA 2P8LA 3M17A 3RIFF 3SY0A 3UPAA 4M61A 5I0DA 3VWKA 5JIIA 3FT3A 2DQUL 1IJ9A 4WW1B 2R0LL 5JA9A 5B4MC 1MCCA 1S9VB 2ADGA 4DKEH 1JRHI 2CKBB 4LCIH 4LMQI 3TWCL 5J1AB 3O2DA 5F7LB 3DLQR 5AZEL 4XMPH 1J0IA 1NSNL 4IRJC 3K74B 3C60A 3BP4A 4FTVD 3GBLA 4U1LA 2GAZB 5IHLB 4GG6A 5J11B 2HTKD 4Q2ZA 5D9SB 1HN1A 2FATL 3QIBC 2PW1B 4P2QA 1AH1A 3VI3E 1C12B 3MX0A 1YEIL 2YUVA 3CFBA 1EJ6A 3PQYA 1GHFL 3LN5A 4YO0B 3HPLA 2FB4H 3BP6A 3MLUL 1OPGL 1BIIB 3T3PE 4ZUTA 3MJ8B 4G6FD 1UZ6F 3GSRA 4LVHC 1MEXL 2ARWA 1GZQA 5E2WH 2WWKT 4MHHG 5EU4A 4FFWC 1KELH 3WFHB 4AQ1B 2BNUB 1DEEA 4U1NB 1LQSR 3DMMD 1TQBB 1WCQA 4ZUWB 5JOPE 1JRHH 4X0KB 2C4FU 4ODUB 4Z0XA 2R0ZL 4LLVA 5C0FB 3D3VA 2YWYA 1Q9OA 2D31A 3IAGC 3N85L 4DVBB 4J4PA 5J11C 3W9EA 5EO9B 3NA4A 1NDGA 2CIIA 3DBXA 5GRYA 3TO2B 5DYOB 5FUOL 3QWRA 5L0QB 2EIEA 3M45A 4O2FA 2Y07H 5SV4A 4WY7L 1KNOA 2C7UB 4XBGB 5FGSA 3VMOA 1PSKL 1AXSB 1NH6A 3OR7A 4P5TD 5EZLA 3GUTA 3IGAA 2EXWD 4LPUA 3G6JF 1KT2B 4XNYL 3FRPA 5I1LA 4X4YA 3ILQC 2JJWA 1U91A 5T1KD 5F96L 2C1PB 3RWIB 1U8OA 2NY0C 1YMMB 4KI5C 4Y4KD 3ILPA 1D9KB 4RWYH 2FWOA 1I4FB 3UP1A 2L7JA 3S5LA 4QXUL 3U48A 2VC2L 3HNSL 2VZTA 4FABH 4PJBE 3OKYA 4Y19B 1CGYA 2IAMA 1QRNB 4YXLH 3I02B 1E6OH 3BIKA 5JZ7D 1LO5B 5ERWB 3ZKSD 1QLEL 2MKWA 2HT2C 1F4XL 1I1AC 3G6JA 3TVMB 5JQ6L 1A7BA 3QQNA 5L0QC 2V2XA 4NO3B 2YPKB 4YHOH 4YBHA 2OTWB 2EE3A 3CPLB 1I8MB 1Y18A 3QG7L 3GSXA 2DIBA 4KRPB 2VDPH 4R96B 2NY4C 4WRLA 3BYYA 3FFDA 4EUPB 2DL2A 1CR9L 2D7OA 4W70A 4I18A 3FB5B 4TUJB 5DEFB 1X5IA 4Y4FD 2VH5L 4TTGA 1EBPA 2OJEA 4OCYH 3VW3L 1D9KC 3B6SB 3CVIL 2JCCE 3K81A 5JW5B 4HAFA 5F7DB 3OKMB 3KPSD 2DQFB 1WBZB 1D5XB 5D70H 1BFVL 2BVQB 4XHJC 1X4XA 1OAZL 4LCUB 1TJHL 1T66D 2QQKL 4XPFL 3K3QA 5JNYA 5F1IA 4NWUL 1XF5B 2KH2B 1IM3A 5IVNA 2B1HH 4YHPB 3TVMC 4CVXA 1SHMA 2J8UB 1VFMA 1YNTB 3GMPB 4MD0A 5DR5L 4U7SA 4PD4K 1V7NL 5JHDD 3LEVL 4UI2A 4KRPC 4PPTA 3RKPA 2H9GB 3T3PF 2RCSH 4OBRA 3Q5OA 1CG9A 1JL8A 4U6HB 5IJKC 5ENWB 1DDHA 3DNKA 3THML 2ZP0T 4W4OC 5FO9A 1U3JA 2B0SL 4AIZA 1VPOH 1QR1A 3LOWA 3L3HA 1ZEAL 4P3WA 5FA3A 4N0CD 2VABA 3MV9B 4OIIL 2VISA 4JGJA 1YNLH 4NKDB 2AJSH 2J1KA 3KYOA 1RZJL 2OTUB 1CU4L 4ZDHB 1RJZA 4HJ0C 2P7TB 3Q6GL 2B7DT 4KTDH 1AKJD 1BJMA 1MCPL 4R0LA 1ZT4B 2DLIA 1TCRB 3LVEA 5E94B 1A4KB 4HEME 2V7NA 3PXHA 2EICA 4YBQC 3RVVC 5DRNA 1HYSD 1CICD 2AP2A 4OF8A 1K8IA 2EKSB 1X5AA 4G9FD 4S1RL 5IVZA 1Q9KA 2LABA 3HI1A 1MVFA 1QBLH 4L8SA 5GSRB 4W68A 3EZJB 2R8SH 2VLKD 4LPYA 3WE6B 3UBXI 5IROC 1MREH 2CKNA 4XP5L 3HI6L 1LO0L 4P5KB 5EU6B 4GOSA 1BJ1H 3BEVB 2KBGA 5DHXB 4CRPA 1HSAB 4Q0XL 2ZUVA 3RTQD 5GHWL 5TE6H 1CFNA 4JY6A 4PJBF 3VXRB 3GSOB 1GGTA 1SBSL 4MX7A 1UM5L 2R2EB 1J0HA 3PWUA 1G1CA 2AV1B 5CMAA 1A7PL 4U1HA 3P9MB 4U1JA 1AO7B 4YDJA 5C0IB 2EDHA 5FYJH 4KVNH 4G8IA 5IVXB 5D72H 2BOCB 1RJLB 4MA8H 2NW3B 3DUUA 2Z91A 3HAEG 5HDQL 3CX5J 2AJ3B 5D1XA 1AP2B 3T09A 2PTUA 5K59F 1AFVL 5EO0B 3ZTNL 1RIUL 3MCLH 4FTVE 1YQVL 3B5HA 2BCKA 5KAQF 1MRDL 4P46B 4PJBA 3ZE0F 3BZFA 2XTLA 3RVUD 3K1KC 3C5SB 5F1SA 1RURH 1U3HA 4X98A 1ZS8B 3G04B 4NQUA 3UTTD 5CGYD 3M8OL 1QVOB 3F7VA 3CK0H 3QQ4A 2ED9A 5HHVL 3OR6A 1AXTH 3L5XL 3WJJA 4XP4L 5C0BB 5C9JA 4HIIA 4NT6B 4S1DC 5DJDA 3U46A 1J11A 2J3SA 5F1NB 2JJTC 2NCMA 1N5YH 5T1LA 1OAYH 3B8SA 2KQNA 3MCKA 5EBGA 2E5EA 1G6RA 1CCZA 3MUGA 2JB5H 4Y5XC 1DQJA 4U33A 5T3XL 1Z6JT 3SCMB 2CMRH 4OAWB 2B2XL 1OAQH 3QI9C 1YY8B 2BVUA 1E4XL 4X8JB 2DKSA 3TNMA 5CEZH 2LAAA 6FABL 3P73A 2IEPA 5DJZB 4U3XA 5GXBB 3D2UA 4NPYB 1FZMB 4DGIH 1QYGL 1R0AH 4P5MB 4HIHB 5F72S 4NZJA 2BRQA 2YUWA 4HKBB 1MIEH 1HH6A 1Q1JL 2AJXL 4FQ1L 4AEHL 5DGQA 4XCNA 3V4VL 2DL9A 3FQNB 4LEXL 2HFFA 5ITFA 5KVDH 3AREB 3KXFE 4AQOA 5MEQA 2HJKB 4QTHB 3GSNH 3UC0L 1IEHA 3MV7D 5KSBB 4HAGA 3WFDL 4M00A 4KK6D 4YUEH 1MWAL 5A2IH 3L7EA 3HRZB 4PB9H 3SCMC 3FB7B 3KLSA 3OKLB 1QBMH 4X5WB 5KVFL 3G5XB 3HAEH 1A6TA 2B4CC 1ZVYA 4JAMA 4OSUL 5FXCH 4XBPA 5IR1B 3IJHB 3MXWL 2ZG3A 4UZGA 4WUUD 2AK4D 5C0ND 3WS6A 3FFCB 4P4RA 2A9MH 4XPGL 4P9MH 3CFJB 3NCEB 2ZCKL 4WO4B 1SJHB 1F4WL 1A6PA 4QRUB 1FVEB 1NEZA 5HHNA 5DC9B 2VERN 5D1QC 3VRLE 2EYSB 2P8PB 3Q3GB 1ZSDB 3AREC 4FQLL 5KBNC 1IT9H 1IC5H 5ID1B 4XAWH 3ZL4L 3STZB 1AD0A 5HYQB 5EIIB 3VWJD 2WBJA 3KPSE 5E8OA 1OARL 4NJ9H 4MQ7A 2OXHA 4K23L 1FL5B 4BJLA 5C0EB 5FV2A 2FX8H 1ADQH 2VL5A 4AIXA 3UJIH 3VE0B 1ODAA 2Z31D 4GAGH 2X4QB 2BFVH 4Y2DB 5CBAA 4ZO9A 4LCIL 3UYOD 3ZE2E 1KIRB 2WBKA 3IF1B 5GGSB 5BV7B 4NWTL 3ZMRA 5DSCB 5JHDE 1S78C 4XMPL 4NCDA 3ZYJA 2H41A 1F6AA 3IXAA 1NAKH 1BD2D 1CDHA 3QXDA 4AY0A 4YDLC 5IW1A 1KV3A 1F2QA 3U79A 1HCVA 4FTVA 4IOFD 2ZCLL 4PJ8B 1QP1A 3OL2A 1C7SA 5DVOA 2XA3A 1TVBB 2PO6B 1MI5D 5FFLA 3QFDB 4MA1C 1FCGA 4NKOA 2R4SH 4NRZA 4YNYA 2FBOJ 1JUFB 4HPYH 1KC5H 3PL6D 1FL6B 3IFLH 4JANB 5E2WL 1CDCA 4U6YA 3BISA 4X99B 2DIAA 1CK0H 4NN7C 3MREA 4J12A 4ORGA 3RNQA 5DVMA 1KELL 2GY5A 1JWUB 4TSCH 3QA3A 5HXMA 3VFVA 4BH8B 1WQVT 4G9FE 1HOCA 3QBTB 3Q6FA 2DKUA 4RQQB 2XA8L 4GKSA 2GK2A 5E08H 1TLKA 2VLKE 2YZ1A 3WFCH 4XVSH 4HKZB 3DMMA 3LKSA 1XR8A 5I18H 3HZKA 3PF2A 4EUPH 4JZJC 1FNSH 3NOIA 5IMMB 2G5BB 2Y07L 5KSAB 2EDQA 5IFJB 2PO6C 3QWOB 3IRZA 4K3DH 5FHAH 4JFDD 3DI3B 3SDXF 2Y7QA 4BKLB 4OF5A 4NC1C 1K2DA 1RQ5A 2ZUWA 3UROR 2YC1B 1ONQA 3G08B 4R97C 4AM0B 4ZXBD 1ZA6B 4P5TA 1KTLB 1WGOA 4MB3A 1C7TA 4YAQB 1OM3H 2F53B 4F3FA 3HNVL 1R5IB 4E41B 2CDGA 4RWYL 3S3PA 2NZIA 5T1KA 3B43A 4NGHH 4IOIA 1UADC 3AMLA 4JGUA 4FABL 4YGVA 4KROB 4IIQC 5IQ9A 1GIGH 1FORH 4Y4KA 1HH9B 2GT9A 4YXLL 1DQMH 1E6OL 3W0WB 1ZT7B 5HYEA 4J8RA 4FMFA 2EXYD 2EYRA 4W81A 3NIFE 2XQYG 2I60L 3BZ4A 2K1MA 2J6EH 3GMLB 3K8MA 4WJ5A 3VRLF 5DHVB 1WTLA 3TA3C 1W0WB 1E27B 5E2VH 1FYTB 1EEYB 2VDPL 4Q97A 4P2RD 1LNUA 3QUYC 1UKTA 4RFEB 3RY5A 4ELKA 1S9KC 1Z5LA 3PGDA 4BELD 3QJHB 4OCYL 3O8XB 5FA4A 3S7GA 4JHAH 3T0DA 5GGUB 4M6NH 1I9EA 4HFWA 3VG9C 3ZE2F 4Y4FA 1DL7H 4LGSB 5D70L 5KVMC 4N0UB 5IIEB 4IRJD 3O3AA 1NCUA 4NC0B 4O02H 1EA9C 4UT6H 3KPSA 4JO2H 2DJUA 3HC4L 4PP2B 3V5KA 1GOFA 2B1HL 4H88H 3NPSC 3QIBD 1T0NA 2WK2A 4QRTB 2RFXB 3UTSD 5EFIB 1NC2B 2BC4B 1I7RB 3BO8B 5FO7A 1JV5B 1MAJA 2DI8A 4TN9A 5E5RB 3TLRA 4MYWB 1BZ7B 3B9DA 3OQ3B 5DI8A 1S7WA 1FO0B 2VR9A 5JHDA 2HVKA 1F3RB 3X11A 3LKRB 4NCC2 3MLPA 1RU9H 4V2BA 4YPGB 3QJFA 1WZLA 2Y72A 5CUSH 3WXWH 4LKCA 4TUKH 3QT2A 5I1DB 4OF3A 4F9LA 4KTDL 1KSRA 1FNLA 1PEZA 1KIQB 2OP4L 4G42A 1MWAA 3VXQB 5IEHA 5DK3A 4KUZL 1AKJA 1IKFH 3O41B 2AABL 4WUUE 5TPWH 1HXMA 1YPZB 3B9KD 1ZLSH 2QLVB 4S11A 1TCMA 3WYRA 5J13C 1DQDH 1LWRA 4LHQB 1CICA 3U4EA 1IAOB 3MLVH 4G9FA 1ZGLA 3TYGH 1QBAA 1HDMA 3QDGB 3GSVB 1J7VR 3KLAB 2VLKA 4OQ1A 4PLOB 4NKMA 1G7JA 3C6LC 2Q7NA 2IPUK 3K4ZA 3NTCH 4WGWB 5TE6L 4TRPH 4O2EA 5JXAL 3KPOA 3HZYA 1DVFB 4HKJA 4KGJA 3RTQA 3SDCC 3QXVA 1TVHA 1OQXA 3LS5H 5EC1B 3MYJB 5I1KH 4XTRC 4ZOCA 2FYYB 4NQXA 3F6IA 4JZOA 1NMCB 5FB8A 2W1NA 2B4CH 3MR9B 3VU2A 1C5CH 5EO1B 3GRWL 1I1AD 1NGXB 4PGCA 3NIFF 5I66B 1RAMA 2PN5A 4KVNL 5D72L 1KTDB 5JLZB 4PBWD 5ACMA 3IFOB 5HHPA 3S96A 4KHXL 4CUCA 3MCLL 2OL3B 3DV6B 1BD2E 1KB5A 3BWUC 2DWDA 4JFEE 4Y5YA 1ORQA 1RURL 1CXHA 1UB5A 3U6RA 3O4LD 3CK0L 4JFQA 1MI5E 3C08H 1YJDC 5T1MA 4Y1AB 3UTTA 3VRIA 4ZQKB 1AXTL 2IQAB 3BVNA 1UG9A 4XHJD 1U93B 3MGTA 3MZGB 4J2XA 1F02I 2C4FT 2IBGA 4UV4H 5C8JB 4PG2C 5IMOA 5I8CA 1ED3A 1T2XA 3CH8A 1FVDA 1Z9MA 1NMCC 5GS3A 1N5YL 3H3PH 1JI1A 1SYSA 3FCTA 2FL5A 2WAHA 3OKNB 4MXQD 5TE7H 5DJYB 1FNEA 3LD8C 4LGPB 2JB5L 5CGTA 3ARGB 1CIUA 2VLMD 1G7IB 2CMRL 2EDBA 2A2QT 4X9GA 1I8KA 1OAQL 3VDCA 3HE6B 5HYJB 4KDTA 4L1DA 4Y0GA 2GJ6D 2OI9B 4KK9D 5BS0D 4X6CE 3T0AA 4HK0B 3RU8H 4DGIL 1R0AL 1NLBH 4HIXH 5CBEA 3VRJB 1N0LA 2HVJA 5ELIA 2FZ3B 2V5MA 4JFDE 1MIEL 5GRUH 4NHUB 4WI2A 3UPRA 4QRQA 4S1QL 5DC0A 1YEFH 3MUHL 1WBYB 1U8LB 2HYMA 1C16B 1NDMA 1A0QH 1IAKA 3HR5A 5KVDL 2P43B 3GSNL 3RVVD 3PWJB 5A2LH 1S9YA 35C8H 3ARGC 4YUEL 5IWLC 1E4KA 4PB9L 4NFDA 5IB1B 3MV7A 1QBML 4R3SB 4OZHE 3MLTB 4LVNB 3U9UB 5D7SL 3ULSA 4HEPG 3PUCA 1UEMA 2OI9C 2FJGB 4PRID 4JM2C 1TZIB 4NKIH 3CVHA 2V5TA 4PV8A 2MWCA 1GC1L 5C0DB 1PDKA 1N26A 5FGBC 4Z78B 4LPVA 1ZLUK 2ZSVB 2A9ML 4D0CA 4WUUA 1B4JH 1E28B 1VSCA 2AK4A 2CSPA 2DQCH 2VLRD 4P9ML 4HUKB 3F7YA 3BW9B 1Q9WA 4ALAL 1CFSA 3FB6A 1X5KA 2SEBB 1F5WA 3AVEA 2VTFA 3TPUA 1IT9L 1IC5L 4XAWL 5DA4A 4NOBA 5DJXB 4P2OB 1CFBA 5C3TA 4HJJH 1IKNC 3LQMA 4ZPVA 1IEAB 4JFXB 1OQOA 1I1CA 1T89C 4C83A 5KG9B 4K3JH 3VWJA 5E5UB 1T22B 1LEIB 2NW2A 3FONA 1JWSA 3NN8A 1IM9B 1LVEA 4LVNC 4Q9BA 3UJIL 4UINH 5GRJH 5DK2B 2BFVL 5H35A 3UTSE 3CFEB 4U3HA 3PJSB 1KXQE 2Z31A 4O51A 4LBEB 2JE8A 3RWEA 3N50A 2Y5TA 4WFFE 2YMXL 3D39D 3CAFA 5KVGL 1X3DA 2R0KH 1NAKL 4MAUL 3AAZA 5LKNA 5IJVA 4GKZB 4MNGE 2JJVA 3IDUA 5EA0H 4OCRH 1BD2A 1G7LB 1BBDH 2LU3A 3BWAA 3OAZK 3RPIB 4Z5RA 2AQ3A 4QRPE 2R4SL 1OL0A 3VFUB 4LLWA 4HPYL 4YLQT 4AENA 1KC5L 2EEAA 1MI5A 1I1FB 4JFFD 1CK0L 2AXGA 1NFDE 1JPGB 5HGDB 3BUYB 2EIZA 3BDYH 1QFUL 3PL6A 3WUZA 4TSCL 2BXZA 4I4WA 4O2CA 4X6CF 1D5ZA 1FJ1B 4PGBA 2ZUUA 2ADJB 1LK3H 2ZUTA 4CADA 2FH8A 2QSCH 5E08L 2FGWH 2BNRB 2VZSA 3H7BA 3WFCL 4OZIE 3RUGB 5I18L 2VAJA 4H5SB 5F97E 2X4PB 3QEUA 1PFCA 3V95A 1FNSL 4KI5E 1QFWH 2X4NB 1JPST 2V7HA 5I73B 1FV1A 3VFOB 3Q2CA 2BOBA 2HFGH 3VG0H 4LKXA 3O11A 2B20A 2ICWB 4ERSH 4K3DL 1CFVH 3MRMA 5FHAL 4X6CA 3GMRA 2X70B 4HS3A 1VACA 4XXCA 4TNWF 1NFIB 3K8LA 4L5FH 3RHWK 1KN4L 4DEPC 5D6DA 1BREA 5EOTB 4JFDA 5HGHA 3CFCL 1N7MH 1D6EA 1OM3L 4OZHF 5JUEH 5AG9A 2LU4A 1NAMH 3X13A 1X5FA 4QO1A 4ZXBA 4NGHL 3LV3B 2V9TA 1JWMB 3GRWA 3O3EA 1AI1H 1DQML 3O0RL 1WFUA 5KANG 3AS3A 4JQVC 2HAZA 3ZO0A 1QOKA 1I3UA 3VI4E 2LQRA 2J6EL 5D1QD 5DFVC 3O4LE 5I73C 5JDSA 5I16A 1FL3B 4OZHA 1QEWA 4ACPA 1UGNA 2DTSA 3RDTB 5E2VL 3IAQA 4XCFH 4F80A 4M3KB 1H15B 3KR3H 4BFIA 2DLEA 5LXGH 3OGCA 2NTFB 3DO7B 4NQDD 4OT1H 4CMMB 3S34H 2XFXB 3KPRD 5E00B 2BVTA 3MRKA 3PDOB 4P2RA 4L9LA 5E99H 4GO6B 2CO7B 3QFJB 4K3EH 4NN6B 4JHAL 3W9DA 4JFOA 4M6NL 4WU5B 1BOYA 3QZWG 5CZXD 2D9CA 3RY4A 1DL7L 2DQTL 3WMSA 2VLME 2FGZA 1KCLA 4LSPH 1B6DA 2VN7A 4UDTA 4HUMB 4O02L 4XZUB 5DEGA 3QG6B 4LCCC 2FEDC 4OZGB 4W6XB 3JTSB 4JO2L 1EDQA 5T33H 4NYLA 1A64A 4IRJA 1SBBA 4H88L 3NPZB 3U7AA 1P7KA 5BS0E 2VKWA 1MELA 4MB4A 2Z93A 3CFKA 1QO3A 2O5ZH 5SX4H 3FZUC 4KJPC 3REVB 1UXSA 4JG0H 1QPXA 3MGAA 3QIBA 1YJDH 1AD9A 1T20A 3NFPA 3EFFA 4R7NA 4PTTB 1H3WM 2KQMA 4GXVH 3UTSA 3ARFB 43CAB 2NZ9D 4YHMH 5EU3B 4ZUUB 2I25N 1JN6B 4HK3N 5IB4B 4GAJH 3MNVA 1V7MH 1NFDF 3HB3C 1RU9L 2E6PA 4MNGA 4NN6C 2MFNA 1YEGH 4MVBD 5CUSL 1T1WA 3WXWL 4PP1C 4TUKL 2XZQL 5FECB 4QXGH 1XR9B 3RPKA 2NXZC 4KY1H 4RA0C 1CLZH 2ITCB 4GRLB 2OL3H 4LLDB 4EN3B 2G5RA 2Y9RT 4OV5A 4I3GA 2IANB 4OZIF 1A6ZB 2IPKA 5JORA 3SBWC 4AMKL 3J7HA 2FLRT 4PRIE 4GLRH 1FGNH 1N4XH 1IKFL 5TPWL 2WANA 3HAEA 5TDPA 1ZLSL 4UAOB 1NFDA 5EBLB 5B21A 1JZ2A 4Y5VB 5IB5A 3QO0A 4G8FB 3VFNB 2HFEA 3B9KA 3NMEA 3MLVL 1QSFB 3R0NA 5DQDH 3TYGL 4MCZB 1D7FA 3OKDA 1Z2KA 4U6VL 1FQ9C 2HN7A 3MJ9H 3T2NH 4OZIA 1FE8H 3NTCL 2N7BA 4YHIB 1BLNA 1RZFL 5CLWA 3ECBA 4TRPL 2N4IA 3CXHK 3FQTB 5CIPA 3MRPB 5B38B 2Q6WA 3RZCD 3RZWA 3I3BA 4I48B 4U1KA 5MEPB 3LS5L 5I1KL 1N64H 1ZWIA 1LE9B 4L8DB 3S36X 1KIUA 4OFKA 1TVDA 3KJ4B 2B4CL 4M1CC 4DZBB 1C5CL 1ZHLA 3Q5TA 4DK3A 3VI4F 3WDIA 1QSZA 3FAWA 3QCUH 4RMVA 4U49A 2RQ8A 3TA3D 4Z7WE 1JHTB 2APBA 2VXTH 4YDVB 1I1AA 5BXFA 1WBXB 3BH9B 3KJ6H 3L3GA 4Y5VC 4BSVB 5F3BA 2OK0L 3PWVA 3D39E 3D0LB 1KYOJ 2VAAA 3QUYD 5FKAB 3PHQA 4RFOH 1DE4A 3EGSB 3OV6A 3DX9A 1RZGA 3FO2B 1RZ8A 3U1SL 32C2A 1Y0LA 4ETQA 3JV6B 4PREA 3IDGB 1ZVHA 4UT9H 2WM0A 3E6FB 5JQHC 5CSBA 2FJHB 3O4LA 1CI5A 4FQHA 1FH5H 4UV4L 2BSSA 4JFFE 4NUGH 3CH1B 3M1BB 4LF3B 4NZRH 4APQC 2I9LA 1J1PH 3SKMA 2LAGB 4Y16D 1Q9LB 5TE7L 1MHHA 1T5XB 4MA3B 5FUZH 1AQDB 5CJQH 4X6BB 4HD9A 4I3SH 1BBJB 5D2LB 3D6GA 3LQAC 2F15A 3MRNB 3BRDA 3ARSA 3QULB 4KQ4H 1BWWA 3C09C 2DJSA 1O5DT 5C07D 5T5NG 5J9PA 3BQUC 4HIXL 3Q1SH 4QXTA 4ODHH 2UYLA 3MSPA 4B41A 2GJ6A 5BS0A 1K8DA 4NRXA 4PTUB 4IRSD 4LU5L 5GRUL 3LN4A 4OLVL 5A16A 1U8QA 4FG6D 5GZOD 1VFOA 3W5NA 1WISA 3V5DA 5KSVA 4G8EB 1YEFL 1R3HA 1H3PH 5D1ZC 1BFSA 2DLFL 2NX5D 2QR0B 4Z7QE 2QKIA 2R69L 4XVTL 1IL1B 1MFBH 3B5TA 3I75B 4XWOD 4MGXA 1SVZA 3ALWA 4D9LH 5A3IC 1QG3A 1F58H 35C8L 2CLRB 3DV4A 5HGAB 1ULVA 1SJEB 5DK0B 1BFOB 3LY6A 3MOBH 1OAUH 2HP4A 4WTWA 1X4YA 3H7LA 3LSOA 5CD3A 2ICWI 2ATPA 1ORSB 4PD4J 1CDIA 1BVKA 5CKAA 3L3KA 3CUPA 1ZVSB 2J6EA 3L3DB 1XGRB 1J88A 4PRIA 4I0PC 4XVUD 3T0EB 1PVHA 1B4JL 4FQQA 2DQCL 3P4NA 4NQDE 3JVGC 4LSSH 3MRJB 4ZPTB 3KPRE 2OS7A 4QHNA 4LP4A 2VLRA 2GKIA 3CSBA 4UIMA 4JG1H 4L4TB 1EERB 1RIVH 4HJJL 4LRIC 2ZOLA 4Z7WF 2J88H 4XMKH 4LGRB 4UV7H 4AJ0A 3T0BA 5JXED 3FOLA 2HJFA 1T3FA 2EIBA 4P0DA 3OAZH 4K3JL 1QHOA 4Z18A 5HSFA 4B50A 1WIPA 3L3JA 4WFGD 3EYFB 4L3EA 1MJUL 2W9EH 2YD4A 2FHBA 1JI2A 5GRJL 3UYPA 4EZMA 3EYQD 3S4SG 4M9OA 4K2UL 3GMQB 1P7QB 4F9PC 2H3NA 1W72B 1GOHA 3G5YA 1RIHH 5DD0H 4ZFOL 2APTA 1OLZA 4ODSL 4M03A 5MEND 4LHUG 3E6HA 1LO3H 2HH0L 2R0KL 5IHZA 4Z7WA 2ZCHH 3LEXB 1REIA 4R26L 5I1CH 2UVEA 3H9ZA 4PFEA 5M95B 3D39A 4OUOA 1MIMH 4OCRL 1H5BB 3EKCA 3QQ3B 2A77H 1NCWL 1QTYT 1BBDL 4U4BA 3TC9A 2A0LC 3I6GA 3PGCA 3TYFA 1BPVA 3ZHDA 3O2WH 4GS7B 1MCRA 3T77A 3DVIA 4L4VB 4JFYA 3ZSSA 3RNKA 3IDXH 2Y5EA 3A67L 2CDFA 1B9ZA 2R39A 1J0KA 2JIXD 4HPOH 4Y5XA 5E5MA 1EFXD 5FKPA 3BDYL 4I0CC 4CVZB 5J6GB 4P3CH 4X7SL 3MA9L 4JFFA 4ZO8A 4RRPG 1R24B 4D8PB 3VXTA 1LK3L 4JY5H 1TJIH 4Z0BH 2FLBT 2UWEB 2XNAA 4PJCB 1T7ZA 4NQCD 3ZYZA 4D94A 2IGFH 3HCVA 3IU3B 3GSWA 1TMCB 1EHLH 4MXWL 2CPCA 3CMGA 2P5WD 1QFWL 1R3JA 2PTTB 4D9QD 5CZVH 1ES0B 4Z7QF 5B39A 2BHYA 4MNQD 3AS1A 2HFGL 2A73B 4G6MH 1HSBB 4GS7C 3P77A 4R7DA 4ERSL 1GGBH 4N1CA 4PLKC 1RK0B 1N59B 3MBED 4L5FL 4U3CA 4GRWB 4CW1A 4H0HB 1ND0B 2JJSA 2FR4B 4FZ8H 1M71A 3D69B 3L1OH 5AWNH 4LIQH 1IVLA 1CD1A 5JUEL 1NAML 1JPFB 4HG4K 4OCLC 1CDYA 4JM2D 5DJ0B 5I30H 1A5FH 3HC3H 4OD1L 4AEIH 4ZSOE 5IB3A 5A43C 2BVOA 1JFQH 2ENSA 3HUJE 3KPMB 4F7PA 2V2TB 4P57A 4G7YH 1GXEA 5IEKB 5H8DA 2YPLB 5ACLA 3MFFB 2CDEA 2Z8WC 3D0VA 2DMKA 2BJMH 4OFYD 4ZD3H 1B90A 4WI5A 5FM4A 2RIKA 4XCFL 5D1QA 3LH2H 3QEGL 4DUWA 1G7PA 1FNAA 4XMLH 3GSUA 1U42A 4NNYA 3WIFB 1M6OB 1WT5A 3KR3L 4XAKD 5LXGL 1DUYA 3EOAA 1T80A 1FNFA 3SE3A 4OT1L 4NBXB 3B2VH 4NHCL 5E99L 5KJRH 5EN2A 2P5ED 2XWTA 4UU9A 1FNHA 2P1YA 4NQDA 4FP8H 4WTZG 4YHKH 4MDIA 2OZ4H 4UDUA 3KPRA 3LRGA 4YFLI 2FDBP 4EJ1C 1R5WB 1JGEB 4LSPL 5EZIH 2Q76B 5EBWA 1RZKH 5TF1H 4BK4A 2E8ZA 5SWSE 2E7MA 5T33L 4OUUB 4U6XB 2QSQA 5C07E 4PJ9D 5TDNB 4PRPE 4YR6B 3K1DA 5CEYB 1V3LA 2YD6A 1AGDA 4OKVA 1JYWA 3WN5C 4J3TA 4K71C 1SEBB 3QIWC 5C6TH 5BOPA 5D6CB 4GXVL 2I9TA 2CIKA 1BAFH 4KC3B 3DIFA 2OBGA 5DUBA 2D3VA 2NX5E 3TBYB 3V7MA 1KPRA 1YMHA 4M7ZB 1V7ML 4LLMB 4GRMB 4JKLA 3P4MB 3FB8A 4K7PH 3VFTB 5SV3A 1L0QA 3QUXB 3KWWA 1RUMH 4QXGL 2DQEH 2ZZUT 4JFPB 1A47A 3OJDA 4KY1L 4I2XE 1CLZL 3EIFA 3LQAH 3HFMH 1JNLH 1A8JH 3SO3B 2E3VA 1JPSL 2W91A 2NXYD 3H0TB 4F57H 1VKXA 5HHMD 5F70A 4Q9RH 2V2WB 3QNZA 3MUZ1 1FGNL 1N4XL 1FIEA 3O6FD 1BVLB 3MRDB 1ZTXH 4OF0A 5ESQB 5JPMA 4YGAB 4KMTH 1L6XA 1MCSA 2CLVA 4FQ2H 3KLHC 2D4FA 3FHAA 3WIHL 5DJ8A 4Y89A 5DQDL 2VLLA 3QWQB 4GUPA 2C3XA 1N3NB 4Z77A 3MRQA 1UJ3A 3MJ9L 3T2NL 1RMFH 3OXSB 4CDGC 3OJMB 3LRSA 5DQ9A 2IBBA 3R06B 4LDLB 4ZFZA 3C9NA 4L8BB 4UMGA 2HMIC 3D5OF 1CVSC 1DP0A 1HHHA 2CR3A 3RX7A 4NQTA 1MJJA 3KPQB 2XN9E 3HUJF 1OGAD 3LPGA 4HUUB 3SO3C 3RZCA 4N1EA 2PXYB 1UACH 1W0VA 3K2MC 4OZ4B 3JWOC 5KW9H 2YR3A 3QCUL 5CJXC 5IFAL 4ZAKC 2VXTL 4F7TB 3UTZA 3KJ6L 2L4OA 4P4KC 4JRXE 3TIEA 5EU5A 4HJGB 2ENYA 3TA3A 2P8LB 3M17B 4G7VH 4M61B 1H0DB 4HF5H 3RIFK 1LK2A 2ZKHH 2XPGA 3BPLB 4PJGE 4RFOL 4ZSOA 2EDFA 3FT3B 5MEOB 1H3VA 2YPVH 1WIOA 4AH2A 3HUJA 3QUYA 1N5AA 1EXUA 1OTTD 3G5ZB 3CDFA 3KYNA 5F6IB 2UZIH 5E4EB 3MMEB 2EDKA 3QAZB 4YDIH 2RR3A 2LFGA 1MCJA 3PE9A 1NEUA 4UT9L 3C60B 2IADB 12E8H 4U1LB 1FH5L 3RWFA 5L8LB 4WW2C 4GG6B 2FEDD 4Q2ZB 5F9JA 3TIDA 4NZRL 3T4AA 4KKNA 4P2QB 1J1PL 4YHYB 1OOAA 3I6KA 4ZG1A 3STLA 3CFBB 3LN5B 3QIUD 4IDLA 4KJPD 3HPLB 1VGKA 4I0KA 1BQLH 4Y16A 4ZUTB 1IGCH 4I3SL 4NQCE 4F2MA 1LEGB 3TP4A 3GSRB 1AGBA 1CTOA 2EDWA 4K7FA 4X6DE 3QPXL 1JTOA 5EU4B 4CN6A 4KQ4L 3VWKC 2P5WE 1KCRH 4HLZH 4D9QE 2WUCH 3HB3D 4OD2A 4MNQE 1KJ3H 5F6IC 2I27N 4JRYE 3Q1SL 2ARJA 4ODHL 3QAZC 1V8HA 2DYPD 5C07A 1T21A 4Z0XB 1MNUH 1XCTA 4Y8AA 1BVZA 4LLVB 2BRRH 2NXZD 3D3VB 5C7XH 1Q9OB 2D31B 2P24A 5E1AA 5HY9A 3W9EB 1H3PL 1NDGB 4G6KH 4IRSA 3SGEI 3DBXB 3KHQA 4GSDH 5DJAB 1UWEH 3IETB 4WU7A 3TF7C 1TTFA 1MFBL 1KNOB 2YN5A 2NX5A 4PUBL 4D9LL 3MGOB 3D48R 1NAMA 3OR7B 5EZLB 5EIQA 2OXGA 3GUTB 3IGAB 4WEUD 1IC7L 1NJ9A 1U91B 1JGDB 4ZFGL 1HZHH 1JIBA 2F5BH 5GS1B 1OAUL 2NYYD 3PP4H 1DR9A 3DVGA 3ILPB 1A6UH 4LHUD 4I2XA 3RVXC 3T1WA 3S5LB 3PWPD 2VDNH 3C5ZB 3AUVA 2IAMB 2QADD 3MACL 4JPWL 1DJSA 4P2CG 4PJ5D 1ZGLP 2W0KA 4W4NA 1MPAH 3TBWA 4XAKE 1GYAA 4H20H 4MJ6A 4NZTH 4U1MA 2IWGA 3ORJA 1T83C 4J4PC 1KN2H 4NNXA 3V6FA 3G6JB 2IF7A 4KK5D 4M1CD 2V2XB 1VEOA 1FZKA 4JG1L 3BMVA 5MI0B 3SGEH 1Y18B 3ZKXC 1JNNH 1QR4A 4ONHB 3SKOA 3ULVD 1MQKH 1KJ2L 3GSXB 3U36B 4XMKL 4UV7L 3WHXA 4YBLB 1KPUA 3RL1A 1CD0A 2XT1B 5DRWA 3FFDB 1N6QL 1PJ9A 2XKNB 4I18B 4AYFA 4M8QB 2APFA 2P46B 4FQIH 5JXEA 3QRFM 5K9OA 4PJGF 3O6KH 2BDNH 3BAEH 1NCCH 2W9EL 2OJEB 3AS0A 5EBMB 3W2DH 3BRGC 4ONGH 5BVJA 4F37F 1A7OL 2M2DA 1D3CA 5KOMC 5F7EH 5GIRB 1A9BB 1MAMH 1RIHL 5DD0L 3A6BH 1U36A 3F62A 3QDMD 1MOEA 2RJMA 5JNYB 1LO3L 3HE7C 2YA1A 5F1IB 3RA7H 1MHCA 4QOKB 2JB6A 2R1XA 1IM3B 3PXJA 4KKAC 5MENA 4LCYA 4MJ5B 3ES6B 1MLBA 3GFUA 4CVXB 1A6VH 1EGJL 1MIML 3B2UD 5FDWA 5IW6A 2GCYA 5TDOB 4PJGA 1U2HA 3O2WL 4MD0B 4CJ0A 4FA8A 2GY7B 2DLTA 1YMMD 4N68A 1OLLA 4U31A 1CG9B 1KJMA 3IXTA 1YN7A 4GW5B 1CXKA 3IDXL 4JZNA 3LKPB 1CTNA 4I18C 4Y19D 5HHME 5L6YH 4HPOL 1QRND 1WWAX 4IHOA 4M7KL 5FO9B 4DN3H 3CU1A 3TBVB 2WWMD 3MOQA 1QR1B 1SVCP 3NFSH 4JJHA 4LARH 4P3CL 4PRDA 2UZYB 3BQUD 2JIXA 1EFXA 2VABB 4WDIA 2VISB 2VNCA 4JY5L 3SE8H 4XCYA 1RJZB 3JUZA 4DFHA 5J12B 4L8CA 3DX7A 4M7LT 5DURD 2IGFL 2Y06H 4WHYG 4R0LB 1I85C 2X1PA 1EHLL 3FO1B 5HGGS 2K3TA 4NQCA 2HLAA 3WIHA 1T7XA 2V7NB 4HUWA 5DRNB 4JM2F 5MP6H 4G6ML 3MJ9A 4PV9A 2IG2L 3FQWB 5IVZB 1Q9KB 2P5WA 4YZFE 4YXHL 3PWLA 1GGBL 1F3DH 5I6XC 4G5ZH 2EDXA 4MJID 4MNQA 1R3KA 1OGAE 4U1GB 3L5IA 4OJFH 5HGBB 4YHLH 4BUGA 2UVFA 4FZ8L 5AWNL 2EH7H 2AKRB 4LIQL 4EIZC 3MBEA 1F97A 4X83A 4M7JH 4X7FC 4OBSA 3WLWC 1MFCL 1LDSA 5AAWA 4JVWA 3AC0A 3DROA 3QZWA 1A5FL 5I30L 3HC3L 1CFNB 3WFBH 4JY6B 4AEIL 4RBPH 4WV1A 4ELME 5JOEA 4UBDC 1JFQL 4MX7B 1ACYH 1U8KA 4I0PD 4JM2A 5FIEA 3PWUB 2FSEA 3PV6A 1LGVA 3BD4A 5DRZA 4R0LC 5CMAB 2ORBH 4IEFB 3WNNA 1WC7A 4U1HB 4U1JB 4YDJB 1BQUA 1GCFA 2QQQA 4WIQA 4G8IB 1F4YH 4KTEH 2Z91B 3ETBF 5D1XB 4KRNA 4OGXH 1UH3A 4L8SC 4G80A 3QNXA 3OKKA 4XMLL 4OFYA 1YA5A 4KH2A 2R4RH 4G9DA 4PJBB 4U1GC 1TXKA 2VO5A 1IKNA 4QGTA 3VDBA 1U3HB 3MV9D 3MRHB 3B2VL 4X98B 2YXMA 2LV4A 1FNGA 1H3TA 1T89A 2D0HA 5KJRL 5IKCA 3F7VB 4TVPD 4M8VA 2MMXA 3JWOH 5CFHA 3QQ4B 4QY8A 2O5YH 2OZ4L 3MUY1 3OR6B 4XCCH 3ULVL 1WIUA 3IKCA 2P5EA 5C9JB 5K9QI 4F15C 5EZIL 3KPLB 3MLSH 3U46B 1HHKB 1X7QB 1RZKL 1JF6A 5TF1L 1A2YB 3R1GH 4POZC 5I74B 4PB0H 4PJDE 4UQ3A 5T1LB 4KDVA 4N5ED 3MNZA 3FOMB 3MCKB 5B8CA 4BFBD 2WP3T 5AUMA 5TJWK 4XB7A 1CDGA 4LQ1A 4WI8A 3MUGB 4PJ9A 5C09D 5C6TL 1DQJB 1XF3A 2PYED 4N1HB 1BAFL 2JCCB 1WZKA 1F3JA 5KVEL 3BD3A 1RHFA 3TNMB 3QXUA 4LIQE 4RAUA 1U8HA 3E1F1 3P73B 5F21B 3D2UB 4LRNH 3RY6A 2AGJH 3FKUS 3OAYK 1MF2H 4YPJA 4JFZH 2VUYA 4ZFFB 2BMKA 1FG9C 4IMKA 1UKQA 3HKFA 1RUML 3WJJC 4Z76A 1S7XA 2DQEL 3ROOA 4XCNB 3LQAL 1X5XA 3HFML 4PLJC 1JNLL 5I74C 4OTXH 4LHJB 4E5XA 3VFWA 1PQZB 2HFFB 4Q9RL 1B4RA 1Q0XH 2YBRA 5F89A 3HTLX 3PWPE 5F88A 5FGCE 4PYHA 1S7QA 2V17L 4P46D 3O2DH 4AEEA 4MDJA 2KZWA 2MCG1 4KMTL 5BMFH 4PRBA 4OLWH 4PJ5E 5HI5C 1XGUA 4FQ2L 4ZTPL 5ACZA 3AGVA 1EZVX 3O6FA 4YZFF 5HI3C 3FO9B 3BN9D 4KMLB 4F7CA 1HI6A 1PY4A 1U8PA 4XBPB 1RMFL 2EDNA 2X1WL 4Z7NF 1W2KT 1J0JA 2R2BA 3QCVH 1OTUD 3FRUA 3ULVE 4LPCA 4KXZH 4IDJL 1A1NB 1SY6H 4HMCA 1EUUA 3IDJA 5FF6B 4DOHE 1CGVA 5T5NF 3WLBB 1CGSH 1KJ2A 4QT5A 2ICWJ 4D0DA 3MRGA 1NEZB 4K94C 5HHNB 3KYKH 5I76A 1UACL 1OGAA 5KW9L 5DD6A 1AD0B 1F90H 2WBJB 5E8OB 1SJVA 4RCAA 4HBQA 4MQ7B 4K8RC 4NFCA 5I1JH 3QDME 2DOCA 5DZLA 5EOQH 1XGTA 4G7VL 4HF5L 3RWJA 2ZKHL 5DWUH 3UJJH 2HJLA 3OJ2C 3WFZA 2XYCA 2F8XC 4I3RL 5CBAB 3RHWF 4E0RA 5D93B 4ZUSA 1AGEA 5EOCH 4Y88A 2UZIL 3DVNA 2ERJC 4YDIL 1RUPH 1EGJA 3E2HB 5DD1L 4LSVL 1F6AB 1S9XA 1JNHA 3DECA 5IV2B 1KG0A 3B3IA 4MAYC 4HWBA 12E8L 3IXAB 4ORZC 2KZ1B 4QHUA 5GRWA 3NBNA 4HLJA 4XB8A 5IM7A 4MWFA 4JLRA 1CVRA 2FO4B 4DW2H 3WKNA 4ZOAA 2QEJA 3ROLA 4PJDF 1I9IH 2VDRH 4X9BA 2CK2A 4OF6A 4LCCA 4LSRH 4H0IA 4Q6IB 5DLMH 5DA0B 4NKOB 4HMDA 1BQLL 3QIWD 4YNYB 1IGCL 4YIQA 4HGWB 3QIUA 3U9PH 1QKZH 4Y8DC 1NCDH 3MREB 3DUHA 3BGMA 4G6FB 1T5WA 2GJZA 5HYFA 2VE6A 1M1SA 3FFCD 4RNRA 1KCRL 3QA3B 2WUCL 2HLFC 3SKUD 3P4OB 3TGXA 4PJDA 2ZSWA 3OX8A 4ETYA 1EPFA 4K07A 4MJIE 1BF2A 4MB5A 5IESL 2BRRL 3SKJH 2W9DH 4LEOA 5C7XL 3DMMB 3LKSB 1XR8B 2DYPA 5C08D 3HZKB 1B6UA 1WEJH 4G6KL 1KBGH 1NCNA 4HX1A 2I07A 1UWEL 5ISZE 4L9DA 1HEZB 1KLGA 3WHE0 5A2JH 2HTKC 2Q86A 3GM8A 4U1SA 4PJ7E 3JXAA 4S2SB 1ZV5A 3DTXB 2AJUH 4AT6B 5I8KH 1HQRA 1P53A 3KLHD 4FQXB 3UAJD 4Y2DD 2NPLX 1ONQB 3ZSTA 3ARDD 1H3UA 1ITCA 4C58B 2F5BL 3HI5L 2XZZA 1FFPA 5L2KD 3S4SA 2P45B 3ALXA 1A6UL 4E9LA 3HS0A 5T1KB 1W0YT 4IOIB 4EXKA 3BESR 1F11A 2EDLA 5IQ9B 4Y4KB 2EDOA 2GT9B 4JKMA 4FQJH 4LHUA 3ULVF 3KXFB 3PWPA 1BZ9A 1H8SA 4H20L 3AY4C 4NZTL 2GYSA 3VCLA 2EYRB 4NM8H 4BFGA 1BQSA 4PJ5A 3N1MC 1KN2L 5IG7B 2PW1A 1AIFA 3BZ4B 3OTTA 1YC8A 3LAFA 4WJ5B 2E7LC 1JE6A 4H1LG 4YO0A 3NCJH 2A83A 1JNNL 3ARUA 1MQKL 5E0QA 1MFAL 1NGYA 3NCYS 3ZHLA 1LNUB 2RGSA 1GRWA 1UM4H 4C59B 2FD6H 3GZKA 4ELKB 5IF0A 2HT3C 3L5JA 4P5TC 1Z5LB 4FQIL 2EXWC 4JQXA 4YE4H 3TJHD 2DDQH 2BDNL 3BAEL 1NCCL 3AFLA 2B1AH 3W2DL 1WCBA 4LLYB 1R5VA 4ONGL 5FA4B 5I8EA 4RRPA 1FLTX 4Z8FL 5JHLH 4HFWB 3VXMD 2BK8A 5CSGA 4Y4KC 5C09E 4X0KA 1MAML 4P9HL 1IGFH 3A6BL 2PYEE 3O3AB 2ZNXA 3I3EA 3NZHH 3KPSB 1JYXA 3DPBA 5EO9A 3V5KB 3GMNA 2QBWA 3R8QA 3QDMA 3TO2A 5JZ7C 5DYOA 1T0NB 1A6VL 2G9HA 4M5YH 1FAIH 2ICES 3HRPA 5F3HA 3MROA 4M3JA 2VXQH 1X6LA 1AXSA 5FO7B 2EH8H 5GS2H 2F53D 1AJ7L 5ADOL 25C8H 1KT2A 4E41D 5DI8B 1S7WB 2R0WH 5ETUA 5JHDB 3CJJA 2HVKB 4NFBA 5K33A 5K93A 4KROD 3RWIA 1BZQK 2IFFH 4NQED 1YMMA 5L6YL 3MJ6A 4DN3L 3NFSL 4LARL 3W0WD 1VFBA 3QJFB 1A3RH 4Y19A 2DQUH 1QRNA 2DF3A 4LKCB 4Y4FC 2R0LH 3SE8L 1JGLH 1LO5A 4JGMA 3TWCH 3O3DA 3BQUA 3HR6A 3TNNA 2Y06L 3UO1H 4G42B 5GRZA 1MWAB 2ESVD 2FHCA 2QJDA 1CGTA 4N0YH 5C71A 3NIGE 5IEHB 4JO4H 3VFGL 2VQ1A 4NO3A 2YPKA 3ARZA 3SDAB 1P6FA 1JF1B 2PNDA 3CPLA 5GS0C 1I8MA 5K9JL 3WV0A 5MP6L 2FATH 3SGDI 2FX7H 4PJ7F 1CICB 3QUZD 3U4EB 4MA7H 4G9FB 4BQCA 1ZGLB 3AB0C 4H1LH 5EC2A 2VMFA 1GVIA 4OJFL 3FB5A 4GBXC 4MJIA 1FSKC 2EH7L 2KL6A 2VLKB 4NKMB 4WTZA 1G7JB 1MEXH 5FCSH 3B9EA 2A9NH 4M7JL 3RVXD 1CGWA 1AY1H 4N9OB 1G6RH 3W81A 3P2TA 3CLEL 3OKMA 1IGML 1PY9A 2BVQA 4GKNA 3KPOB 3HZYB 3N06B 3RTQB 5K9KA 1TVHB 3EW3B 2H6PB 2CGRH 4N0CC 1H9VA 1N6UA 4EEEA 4PJ7A 5D96C 1A3QA 2ORBL 2F54E 4JZOB 5FB8B 2NY1D 4I0PA 4YHPA 3S88H 4PGCB 5GGQL 4GAYB 3WNKA 3K4AA 3MQIA 1F4YL 3OKOB 4KTEL 3JVGA 2WLYA 3FMGL 2BZDA 5ADPL 1JYNA 4LNRB 4OGXL 3I9GH 4EI6B 1DBJH 1EO7A 1S5HB 1X9QA 1PG7X 5ENWA 2DWDB 3SGDH 1PSKH 5KSBE 1I9RH 1ORQB 3QHTC 1LILA 4K94H 1PKOA 2P44B 1KIPA 1UB5B 5IB2B 3DSNA 1C08A 3JWDL 1U92A 3WO4B 3JWOL 4JFQB 5M94B 2VDQH 1TETH 5T1MB 3MV9A 4POYA 3VRIB 4NKDA