2R2HB

Structure of s25-2 in complex with ko
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
215
Chain Sequence
b'EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
molecule tags Immune system
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
total genus 44
structure length 215
sequence length 222
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r2hB01
5JO5B 4OCRH 1R0AL 4CVWA 2J88L 3BE1L 3LS5H 1B2WL 1MJUL 1RSFA 5CGYD 4BFGA 1ACYL 4NRYB 2YPLD 4AEFA 1KTLB 1RUKH 5D1QA 5D7LB 2Q8BH 3VE0A 3DPBA 4PJ9A 4LF3B 2VDMH 3FT3A 4R0LC 4JFZL 3FTGA 3OGCB 1FAKT 1FFPA 1JPGB 3ZYIA 4FN0A 3TBTA 1UB6B 3QXUA 3MNVA 4H1LA 1DBAH 1T5WA 4RMRA 5C0CB 3WO4C 4M1GH 2FX9L 1P4IL 2CKBA 5JNYB 4P2QE 4TUOB 5TDPA 2M26A 4R9HA 1NDGB 3MUY1 1DQQA 3DVNA 1G7PA 5E08L 2QL1A 4HS6A 1EUUA 3EYUL 5BS0A 4PJGB 2VDNH 3EO1B 1A7NH 3OB0K 1QRND 4KTEL 3H3PL 5FA3A 1I8KB 5B39B 2ICWB 1FFQA 4WTZA 4Y4KD 3JTSA 3ROLA 2J8UF 4ISVB 1ADQL 3FO0H 3C87A 2IANE 1NLDH 4PJFB 2J1KA 1WISA 5L9DL 2JJTA 5IB5B 3ZKMC 4YXLH 1K3IA 1XH3A 3P0VL 2JIXD 3JUZA 4PJ8D 4YHPA 2H1PH 2X9YA 1BF2A 3QI9B 2OSLA 4YPJA 4O51A 3G9AB 1HSBB 3LQAH 3BKJH 3T2QA 3RNQB 3EJYC 1OB1A 5CJQL 4NOBA 1D9KD 3TA3C 4XH2B 4YHNA 1I4FA 3NTCH 1LK3H 1CIUA 1OD9A 3ZE2E 3LN4B 1S7VB 5LBSL 2I9LA 3IDJB 4GBXB 3PWLA 5ITBH 3P2TA 3O6KL 4ZFZA 3LQAC 1FVCB 1XR9B 4PP1D 5A3ID 2APXA 1N3NA 4Z95L 1OW0C 3MLWH 1MSPA 4XC1H 4S1SH 3GSQB 5E9DB 5HDQL 5F96L 4AEIL 1LEGA 3C08L 3FB8A 2P4AB 1FE8H 2FECL 3HCVA 1U8MA 2FD6L 2APFA 4FQIH 3SDCB 3E2HB 3CMOH 5HI3D 1QBLL 3WIIL 3QXDA 1GGTA 4OIBA 1GHFL 1YQVH 12E8L 3T4AB 3PXHA 4TOYL 1D5MA 2FWOA 1LD9B 3LH2L 3MSPA 4JDTH 4WGVB 4GMSH 5CIPA 2R2HA 4JEGB 2EDHA 1NCAH 4JRYE 3CU1A 4Z0BL 1U41A 3MUHL 2JK5A 1KNOA 3L3HA 4YHOH 3FB7B 2EE2A 3VRLF 3TN0D 3E2HC 3CFDA 4PRHB 4DAGH 1TTGA 4Y16B 4L9DA 1INEL 1YC7A 4OQTH 4U1SA 4GKNA 4L4JA 4MJ5A 4OM0H 4DFHA 5HPMB 2DQDL 3KNBA 3X13B 4WHDA 1CE6B 2YR3A 3WKMH 3U7AA 1QBAA 1RUML 2BHZA 2AXHA 5IW6B 3VWKD 3ZDXF 3GUTA 1WICA 4TUJB 4LAJH 2APVA 3BP7B 3OKOB 2G60L 2X10A 3CSYB 3BKYL 2EXWC 2O5ZH 2ATPA 4U1GC 2P45B 3UZVB 2ZUTA 3X17A 3JV0A 1NGXB 2VZVA 4S1DD 5GJSL 3KS0J 3OX8B 2NXYC 3QJFB 3CLEL 5FDWB 2DIAA 3PHOA 2V7NB 1VFOA 3GSNL 4XVTL 4PJ7E 4X83A 5FF6B 3PDDA 4ZFFA 2CIIB 3ESVF 4Z7VA 1VHPA 2CK0L 4X7FC 3F7PC 4P2QA 4LHUD 1AI1H 1OAZL 2NY6D 3NA4A 2YD5A 4TYUA 4HXAH 1KFAH 3VI4F 5KG9A 4JFHE 4ETYA 4AL8L 3QCVH 1C5DB 4X0KA 4JGUA 5ICXA 1SYSB 1H5BC 4XC3L 1JTOA 1T83C 6FABH 2X70A 1KF9B 1H3GA 2UVFA 3CCHB 4G9FD 5LGHH 5I9QC 3FB5B 3B6SA 2XZQH 3TT3H 1BD2A 3VXMA 4ZO8A 4OAWB 5I1AA 4JJ5B 5CSGA 5H37G 1QSED 3NIDF 3MODL 4XP1L 3TBSB 5SWQB 3BN3B 4ONFL 3L3KB 4J6RH 2VLKB 3EOBB 4J4PD 4IMLA 3BZ4B 1VDGA 5I1DA 1FSKB 5ETUB 5JA8B 32C2B 3WFDH 4G7VH 4QHMA 3ESUF 3WFHA 1NAML 3QPXL 4P3CL 1J8KA 4PRBB 1CCZA 1G9NC 1X7QB 1RMFL 3CDCA 2EDJA 5I1KL 3LKPB 5F97E 3Q1SL 1A9EA 3HZMB 1KGCD 1UKTA 5HJ3A 4L8SB 3S35H 4WWKC 2DWEB 5B8CA 1TZHB 1WK0A 4MNQE 4I0PD 3VGHA 4D0CA 5GRUL 3AVEA 5L0QB 1FG9C 5GGTH 1DFBH 4PGCB 1CLOL 3EFDH 4Y1AE 3ULVD 1CFNB 3EYOB 1IKNA 4HBQA 1QSFB 4XPFL 4P9HH 2YA2A 3HE7B 4E5XA 3RDTA 4NZTH 3BP5A 1E27A 2XRAH 1UWGL 5FGCE 1DLFL 2GJ6A 5IWLA 1KB5L 1REIA 5HHME 1G7MA 3V7MA 4DZ8A 4WHCA 1MFEH 3IDIA 1QRNA 4QRRB 3H9SA 3JWOH 3C5SB 2DL9A 5DD5H 2A0LD 3VRLE 3DTXB 3GGWA 3V6OC 4Y2DC 5I15L 1EERB 4M7LH 1RZFL 5E6YA 5FA4A 1IEBB 4HMCA 2J8OA 5LGKA 4RWYH 2H8PB 1FLTX 1AP2B 2JJWA 3LIZH 1A4KB 2CLVB 3RDTC 4XI5D 2HH0L 3OHXB 5IVZA 4H0HB 4DKEL 1HI6A 1IKNC 3GJEA 5EZJB 4M8QB 2ZUYA 4I77L 3NAAL 4I2XE 4PJXB 1N8ZB 3R8BB 4TSBL 4OLVL 3ZLQC 2LE9A 1H8SA 3MLSL 4WWKA 3RUGB 2WK2A 3IYLW 2M1KA 3KAAA 4P9ML 3BUYB 4RCAA 3RX8A 5J12B 3LEYL 2D4FA 2BVOB 3DURB 5DQDH 5E00B 4M6NH 1HQRB 2R0LL 4LVOB 3G5YA 5LGJA 3UTTD 1MF2H 4G5ZH 1VKXB 1I1CA 5DTFA 1QR4A 3CZFB 1HKLL 1H3UA 3PGCA 4L5FL 2E7LA 3VJ6A 5D6CB 5F96H 4AEIH 4UV7L 1YEEH 4XMPH 4JRWA 3OWEA 2V5RA 4Z7VF 4XP4H 5LG1A 5D93C 3KXFE 5I71B 2IMNA 2AI0H 4FQ1L 4XBGB 3BD5A 4GH7B 4KDWA 3VCLA 3QHFH 3O4LE 1VEMA 3QNZB 4Y4FC 1QSVA 5H37H 1MAKA 4Q9RL 1CTOA 2VR4A 4PY7B 1CGYA 4X7TB 5I30H 5JQ6L 3GM0A 5DQ9B 3KPSB 4DTGH 1H5BA 2X4PA 3TIEA 1T20B 3G5XA 3WMSA 5JHLH 4P23B 2UY6A 3T0ED 2Z35A 4OGAD 3QIBD 1J86A 4R2GB 5SWZD 3OKNA 1NGYA 2EH8L 5CWSB 3IJHA 5JHDD 5GGSY 4X6DE 4JY6B 2HKHL 1FO0B 2VB5A 3GK8L 3RIAF 4NQUA 4EIGB 2ICEA 2VXVH 1S7RA 3VFMB 1CXEA 2R56L 4IEFB 3BDYH 5CJOL 3U2SB 2AK4A 3GRWL 5EDXA 4KKBC 3X11A 2YUVA 3OGCA 3B3IA 3QNYB 5DJ2B 1U8NA 2VDRL 5KVMC 3ZMRA 4FZEL 4JVUA 4JRXD 3KWWA 1OD7A 4QWWD 4K2UH 1WBZA 1O5DT 1FV1A 3E6HB 1JZ8A 3BEWA 4XCCL 1NGPH 4Q0XL 4GW5A 3X3GL 3I2CL 4ELME 1DANT 4HGMA 3PDOA 5MERB 3G5ZB 3PV6A 1MH5B 1X5KA 4KHXL 3DARA 4D9QE 2VISA 3JTSB 4XVUC 4TVPD 1IAIM 4FA8A 2BK8A 4NYLA 3EFFB 2OTWB 2QSVA 3PL6D 4JHAH 5BQ7A 1MJJB 2D3VA 1OF2A 4AEEA 4HFWB 1KB9J 3AFLA 3DOSA 5J3HC 2NY5H 3ZL4H 1K4DA 4E41D 1UQSB 4XP9H 2VQUA 3CFCH 1CVSC 4M7KH 1ZMYA 2AK1L 2JCCB 3VXUA 4GRWF 1NGQL 2V9RA 4PJIA 4LHUG 3L9RA 2P5WD 3GSVB 4ZYKB 1IAIH 4NRYA 4XWGH 3ARWA 5ID1B 1V05A 4LF3A 1WCBA 1Z9MA 4NQEE 3GNML 3I02A 3IFLL 3MNWB 1I75A 4PY8I 2I9TB 5IEKB 1AQDB 1I1RA 1N7ML 1IC7L 1CF8L 2XN9A 2GAZA 3RTQD 4HUVB 5FECA 3HFMH 2BNRE 3HUJF 2VUYA 2D0HA 1HWGB 3MRIB 1OGAD 1QEWB 2B0SL 1U8QA 5HHOB 5C07D 4PJCE 5IK3A 4OZHE 5MENB 4HS8L 1I1AB 1XF3A 4GLRH 4JQIL 3BKML 5EUOB 2N1KA 1NFIA 2FYYB 4NN5B 3FFCD 4PJ5D 2C7UB 5BZWA 3P9LA 4X6CE 3L5IA 5CIPB 5FV1L 1QLFB 3BHBB 1JYVA 3RDTD 4ODTL 1Y0LB 4YHLH 1U3YA 1P2CA 3RJQB 1Q72L 4LSUH 2Z4QA 2JJSA 1RHHA 1D3CA 3RUGE 1V7ML 1IKFH 4LKCA 1X4YA 4PJHA 4Z7VE 3O6FA 4WUUD 5D2NA 1L7TL 4I4WB 4Q6YA 1U6AL 5C8JA 5LKNA 3ARFD 1RJLB 5D7IF 3WFCH 3X13A 4RFEB 4R96A 3MV7B 1E4XI 3TVMA 3B9KD 4Z8FH 5C0FB 1HIMH 3S4SB 4MMZC 4HH9A 3VRJB 5DS8A 1BBDH 4QRQB 2R8SH 1G7LB 4XNUH 1JPGA 4GQ9L 3VFTB 4ETQB 3ROOB 1AH1A 1T1XB 4M7ZB 1B2WH 4XP5L 4DVRH 1NGXA 1MCQA 4RA3A 1FH5L 5C71A 3WIHH 4H26A 1FCCA 4QXUH 5SWZE 3RPKA 5EUOF 5HHNB 3L3DA 1DL7L 4FFZL 3S37X 1LP9A 3ARSA 4YJZL 3EDJA 2Z8SA 1Z2KA 3QAZC 4KGLA 3KPTA 3PWUA 4NNYA 4X4ZA 1AFVL 5DR5H 2H2PC 4J3WA 4F7TA 3TJHD 5MI0B 4EJ1C 2J6EH 3KYAA 4P23C 4XWOD 1T89C 4H20L 5ADOL 5FOJA 1FDLL 4LSQL 5MP6L 1JPSH 1NCUA 4RFNC 1BBJB 1IAKA 3MRJA 1UKQA 1P1ZB 5IJVB 4DUVA 3AXLB 1CFSB 4I18A 4M1CD 2E9JA 1BJ8A 3UTTE 2CR3A 3KPQA 4P5MB 2EYTA 2E3VA 3DVFA 5I1KH 4ZAKB 1S7TB 5FGSA 5I30L 2C3WA 2NY4D 3Q1SH 3SJVE 1DE4B 2DI7A 1J87A 2UV3A 4YXKL 5J89A 4O4YL 3GI9H 3U48A 2DLFL 1MELA 4WI7A 1RZ8B 4FTVA 2NY6C 3QIWB 2GSGA 4NP4H 2ORBL 4AJ0A 1R3LB 2HFFA 5CBEA 4JQVA 1QHOA 2N4IA 3VXPB 2ITCB 1U0QA 2X6MA 4S1RL 5HYSG 1C1EL 2WP3O 3G9VA 5CEZD 1F4WH 3PHOB 3HE7C 1OAQL 4AG4L 4L8BB 2DM7A 5FIEA 1BFOB 2X4TA 3ARYA 1Y6KR 5K9QI 2NY5C 4PREB 1HZHL 1S5HA 5F21B 3K1KC 1MFCL 1TQCB 3QEQD 3S7GA 4OT1H 5HGAA 1A5FL 3RGVB 3TT1L 2X4QA 5DDHA 1T1WB 3ZHLA 1X6NA 1F11B 3HE6D 3VFSB 1TCMA 4MJIB 3HRZB 1VFAA 3BQUA 4XPAL 3G5VA 1J0HA 2X5PA 4GRLA 5D2NE 1FJ1B 4OB5L 4GRWB 4LIQE 4Q0XH 1KULA 4PRIA 2F54E 3IB4A 2HVKB 2GI7A 1JNLL 4KK6D 2ADGA 2OI9B 5EU3B 3DVIA 2QSCH 1AO7D 3O3DB 4FFVD 3MREB 3M45A 2Y4SA 2VE6B 1LHZA 4C4KT 1EZVY 4ONOA 4U6VL 2ICWJ 1KACB 4LPUA 4M6OL 4QHLA 3KLHC 1FIGH 1N5AA 3GBNL 4R4ND 5EO1B 3RWFB 4IRJC 1IQWL 1HI6B 3C8KB 2DL2A 4Y4HD 3MUZ1 1U2HA 3V95A 1H0DA 1LO5B 1G6RH 5DSCB 4NSKB 4X9GA 3DX8A 1NLBL 1SHMA 4U6TA 2G9HA 1YJDH 5KSBF 4ODUA 2QQNL 4YHYC 3TCXA 4OF5A 2D31A 4XMPL 2D0FA 4G3YH 1VA9A 4JFFA 2A6IA 5DJ8B 2DS4A 3MV9D 1B4JL 2IC2A 4PJEB 1SBSH 4L3EB 3VXRD 4IRZH 2WWMD 3WNLA 4U1NA 4UQ3A 4YPGB 1BX2A 4O9HL 1ADQH 4YDKL 5JOEA 4G9FE 4DKDC 2KZ1B 4I3RL 1YEKH 3ARDB 1UC6A 3MLXH 1ITBB 3CFIC 3JUYA 3T0EC 5FB8A 4K07A 4MNHA 5IB1A 3ULSA 2LAAA 4GJTB 4MCYB 4OSUH 5CUSL 2CKBH 4AL8H 5HGDB 4LSPH 3VXMB 2YZ1A 4CNIA 1ZT1B 2R23B 4C58B 4LNRA 3W0WB 2PTTA 5IFJB 5T3XH 3L3KA 4LLWB 5IMLB 1N0LA 2H8PA 5F88B 3HUJB 1KOAA 1ZT7B 2BP3A 3BD4A 1XCQB 1J0YA 1W8OA 1DDHB 3L95B 4LLAA 5HI4D 2FHCA 2HT4D 4PRPE 1G1CA 4ELMA 4PRBA 4FP8H 3VXTB 1EAPB 1RUPL 1ZVYA 5EFIB 4ZSOE 5EZIL 3LKPA 2BCKA 1W72H 5DJCA 1INQA 4HWBL 2VO5A 4PRAA 1KELH 2BVUA 4AQ1B 2ZPKL 4J2XA 4XNQB 1GZQA 4TNWF 3QPXH 1DTUA 5IR1A 4TTDC 2BNUB 3X14A 1EK3A 2WM0A 5E8PB 3B2VH 5HHVH 1CFNA 4G8GB 3LDBB 2JIXB 4PJ8B 1WSST 2EECA 1YEFL 2FNBA 4GMSL 4HCRA 1S7UB 4BUHA 1A4JB 4HUXB 3T8XB 4Y5XA 1NJ9A 2GJ6B 5IFHH 3QUXA 4UT7H 1DFBL 4MAYB 2PYEE 5DEGA 1GVIA 1WTGT 2IQAB 1O7VA 1GPOL 2EIDA 2FCBA 4IDLA 2F19L 2BDNL 3C5SA 2P24B 1J9CT 3N50A 4K7PL 4YNYA 3BVNB 4BK5A 5C6PB 3GGWB 1H3PH 5DQJA 1Y18B 4UBDC 3RBGA 1A7OH 3OMZA 2AKRB 2BSRB 3DO3A 3QFDB 3DHJA 3OF6A 2GSIA 3GRWA 5DJXA 1RK0B 3BKYH 1G9MC 2D7QA 2R2EA 4UZGA 3PUCA 3RPIB 4XWGL 2NXYD 4RGOH 1XR8A 1M05A 4J8RB 2GITB 2V7HA 3CJJA 4M3KB 3FHAA 4UILH 5MP6H 1BQHB 4GW1B 3UMTA 2D7NA 1FORL 1BOYA 4FG6D 1IGCL 4HKBA 2MCG1 1EEQA 1JMZA 1RUAL 2AK4B 3QRFM 2K3TA 3VWJD 3VWKB 4RBPH 4P2OD 4Y89A 2CDGA 3QWOB 1BFVL 1HHIA 1IGFL 1N4XH 4NZRH 2AJXL 5TDNA 1PKQE 4HS8H 1MHPL 4EUPG 1H3TA 3RWHA 1K5NB 4NN6C 3M17B 4I2XA 2GJZA 4L8CA 1EXUA 3MRIA 2R29L 1I7TA 4XVSH 1ETZB 4J3SA 4HS3B 1JCKA 4CVXB 3RIFF 3G5ZA 5E99L 3D39E 3PHQA 1FAIL 4GT7A 2NY7H 2XFXB 3OR6B 4QLRA 4GRLC 4LPWA 2Y72A 5TPWH 2Z8RA 3OKMA 3P0YH 3BI9X 1WFOA 3ARVA 1LO2H 5HYFA 4GAJL 1QRNE 2O5XL 1WZ1H 2MWCA 1A1OA 1EPFA 5FO7B 3TIEB 3QIUA 2C3VA 4PRID 2ZG1A 4MSWA 3U9UA 4L4VA 3KYMA 3WS6C 5I75C 1RMFH 1UQSA 2G2RA 1MLBA 4JO4H 1I8MB 5CAYB 3CVIL 4N0CD 1MRCH 2AQ2A 5D2NB 2B1HL 4U1HB 1KCSH 5HDBE 2GJJA 1DLHB 2HLFC 3CVHA 3Q6GH 5DGRA 4WTZG 4XP5H 3RY4A 1OHQA 3WHXB 5D9SB 2YUZA 4ZYKA 3NIFF 5J8OA 4ZNEA 3MFFA 2EDYA 2PXYC 5JLZA 5IQ7L 2YBRA 3I02B 1KYOJ 1RZJH 4HV8B 1DZBA 3BH9A 3MGOA 4JZNA 4D8PB 5BO1L 4XX1E 2KZWA 2WBJB 2FSEA 1AIFA 1EFXA 3ET9F 3JWOL 2YXFA 4MQSB 3VA6A 3NN8B 1N0XL 4NCC2 3UAJD 3KPPB 5HHNA 2XRAL 1DLFH 5MERA 5EU6B 4PG2C 3GI8H 3RP1A 4QXGH 4MNGB 2HFGH 4Y1AA 5FUOL 3CSPA 4NQCD 1NANH 2V17L 4F9LC 4ZTPL 1U3JA 4POUB 1YN6A 1BD2E 4JR9H 1J1XL 1D5XB 1DBKH 5LAXB 5GGTA 3T0DA 3QFJA 2PTUA 4GXVH 1NCDL 4O58H 4Z7WB 2QHRH 3ZKXC 4MA3A 3MRRB 1JZ7A 3VXRA 4KK8D 1NUDA 3V0VA 4U0QB 1SBBA 1J10A 2XTJE 3MLSH 4P9HC 4GKOA 1OQOA 2QQLL 3LD8B 5ITFA 1NBVH 4YBLB 5FM5M 3MLRH 4RMUA 4Z0XB 5DRWB 5AG8A 3MCKA 3IF1B 4N0CC 1I7RB 1PG7W 3CX5J 4FTVE 1VERA 1NANI 1DANU 1JNHA 4JFED 5EU5A 2EYTB 1MUJA 5KSUB 2ZOKA 3J8F7 1H3XA 5FUZH 1S9KC 4ZUWB 2JF1A 4M43L 2IADB 2VDOH 5HY9B 2B8OT 2OZ4H 5DZOA 2O61B 1XIWB 1DEDA 4LQ1A 2HP4A 3L3JA 1MCSA 1AR2A 5D2NC 3O6FC 5T1MA 5C92A 2AI0L 5ICYA 3VI4E 4HS6B 3PWPA 4ZFOL 4QRPD 4YDJA 4L5FH 5FA3B 3LHPL 2ED8A 3OPZH 3DSFH 4WEBH 2R0WH 4W4NA 4QRPE 4ZO6A 4R4FH 2V5YA 4N5UA 4ZS7H 1KB5B 2PXYB 4PREA 4ZQKB 3V0WH 5BZDA 2HT4C 4KQ4L 5D2LB 1LDSA 2YD4A 3ULUC 1QA9B 1FFNA 2ZPKH 4RIRB 4Y8AA 3UJJL 1J5OH 2H32H 5JOPE 3BP4A 4F15C 2RCSL 2XNAB 4B7IA 2FIRT 3ECBB 4NQSA 4C57C 3PXJA 3VU2A 5FCSH 2EDEA 5JO5A 3BW9B 1I7ZB 4I3GA 3ZT6A 1TXKA 1C8PA 1H9VA 4LKCB 3R0MA 2NXZB 3G04B 5AZEL 1W0WA 4ZFZB 3RL2A 1I8LC 2WAHA 5E4IA 4Z95H 1UZ6E 1SJXA 5CINH 1FG2B 5FO9A 4YE4H 5HDQH 2Q7NA 3ARTA 1ZKAA 1K6QH 3ULUF 1FBIL 3GRWH 3MO1B 4HH8A 3RRQA 1AGEB 3U9PL 3BYYA 1GGUA 4PS4L 4LRNL 2RJMA 2Y25A 5JNYA 5GGQL 1SBSL 4HG4K 4NSKA 1OTUD 4Q58C 3UZEA 4E41E 5DMKA 4YX2L 4KHXH 4JRYB 4UT6H 3LH2H 4ODBD 4PLNC 5SV3A 2NW2A 3WSQH 5F1SA 1TZGH 5D6DA 1GCFA 4QCIB 3HS0A 4BFIB 1Z9SA 2VUOA 5EUKB 1LP9B 1FNEB 3PWPE 2W1NA 3RVWD 3AU1A 4QHNA 4JPKH 1MCJA 4GXUM 1N4XL 1IC4L 4NHUA 2HTKC 4KJWD 1F8TL 3C09C 4EOWH 3AB0C 2H41A 1RIHH 4M7KL 1M1SA 3C5ZA 1ZSDB 4PJBA 4NNPH 2XTJC 4U2YA 5F6IC 1CQYA 4P46C 4KKLD 2AK4D 2DRUA 2IANA 4P2OB 1M71B 1LEKA 2VSDA 3FFDA 5DJDB 2W0LA 4LNRB 3PIQA 3H9SD 4HIEA 4WW2C 5HVHB 4Z78A 1CGTA 4XXCC 4KJYB 1LO4L 5DHVH 5D2LE 1XCTA 1ED3A 5B3JE 3RZCC 4GKSB 3L5HA 4Y19A 1S7TA 1D6VL 5E2WH 4CJ0A 3FB8B 1CGXA 1KIUA 4FQLH 4YFEA 3L3OA 3OX8A 1F3JA 4R97C 3L7EB 3O11B 4ELMB 3E1F1 3WIFB 2A6JB 4RFOH 1RZJC 1B0GA 5KVFL 3FQXA 3HC3H 4XNXH 3WLBA 4LGSB 3WNOA 2OR9L 1OSZA 5I16A 4H25B 2HTLC 4OF8A 3PL6A 3ULUE 2DKUA 1HHKA 1FYTA 3OG4B 4MAUL 3T1WA 2XWBA 4JDZA 4DFIA 2X4SA 3PF2A 4E42B 3W2DH 2ZUQB 4WU7A 4OM1L 1BX2B 2W0FB 2AJSL 5GZOD 3ILQD 4EDWL 4ODTH 4Z7NF 3I50H 5FOBA 2HWZL 3BSZL 3VG9B 4OZHA 1JZ5A 4KVNH 2B5IB 4JKMA 4M1CC 5E2VL 4LLQA 1FVEB 2R2BB 4PJ5B 3NZHH 2YRLA 1A3LH 3ZTNL 2Q7YA 5EU3A 2DICA 2W59A 5EBWA 2FH6A 2VR9A 4Q6IB 2BNQA 3A6CL 1C7SA 1W2KT 3KHQA 1NMAL 2DOCA 4OZFG 4N8CL 1RIVL 3H3KA 2WNGA 3WFHB 1CL7L 3PGDA 1UXWB 4QHUA 4NJ9L 1BWMA 4OZ4A 1ES0A 2X05A 2VAJA 3SDDA 1A9EB 1X6LA 3MXWL 2DJ4A 3FN3A 1U58A 1OGAB 3ARFB 4L8SA 1J1OL 1JWUA 5KN5B 4M7JH 3W11C 1RULH 1LO5A 4UU9B 2ADFL 4KKCD 5B8CB 3ZTJG 4FQJH 5HYIA 1D9KC 1EHXA 1MJ7H 3RNKB 2B4CL 3DIFA 4MYWB 2DQTH 5DR5L 2FX7H 4Q9CA 5F7DB 3QUMH 2E9IA 4N0FB 3MGTA 2V2TA 2YA0A 5KZCD 3QSKB 3LPGA 3GO1L 5JQHC 1KJMA 4IMKC 2VDOL 1NC4A 4OCYL 3O9WC 5HHMD 1EH9A 1KEMH 4K3GA 1I1FB 3KGRA 2D03L 2FB4H 3DTXA 3VH8A 4ZNEE 4GG6A 4L4TB 2R0ZH 2AEWA 3ULVE 1NCWH 3DSFL 4M48H 2IAMB 1CXHA 5IB3A 4IS6A 1NBYB 4ALAL 1ZVHA 2AABH 2FO4B 4PG9B 1CDJA 4O4YH 4MWFB 4OCRL 1R0AH 3BZ4A 2X2YA 2W65A 3BE1H 3I6LD 5F89A 4DUWA 5FO7A 3Q6GL 3S5LG 2DLGA 3HA0A 4JFPA 4GAFB 4HXBL 3VGBA 5C09E 2XXCB 1ZOXA 5B38A 2Q86B 3GMOB 1XR8B 4GFTB 4X5LA 1VB9A 3MGAA 1T66C 1X7QA 1F6AB 1S9VB 5CP7A 4GLRI 3IDMB 4ZO9A 1AR1C 2WLYA 3RGHA 8CGTA 3UP1A 2LU7A 1R5WB 3ARBB 2W9LA 3BKCH 5I6XC 1J1PH 3TBWB 1QFOA 3MYJB 1IARB 2DDQL 1MRFH 3EYVB 4FS0A 1N26A 3D87B 4N0UE 5DO2C 2VDNL 4NCC1 3HPJB 2J7LA 4XP4L 1PKQB 5FKPB 4L8DA 1KENL 3NPZB 4OGXH 1CXLA 3GSXB 1IAII 1ORSB 1S78C 3FQWA 1YMHB 1DQDH 2IBZX 1SJEA 3TZVB 3L3IB 1HHJB 2CO6B 2OCFD 3HLAA 3CAFA 4X7TA 3T4YA 1JYXA 2WIIB 1YUHB 1AXTH 1J05A 2L4OA 1RZIA 3U0TB 3NABH 5I18H 4TULH 2OL3L 4UNVA 1NBVL 4KKNA 3OAUL 1MRDH 1KUMA 5EOCH 3ZSTA 3BGMB 1A9BA 4UT7L 3V2AR 2BHYA 4Z7WA 4F7EB 5ITBL 4P4KB 3QIWD 3KDMB 4JFFE 5IOPA 5CP3A 2H45A 3CZJA 4UIMA 2RHEA 1W72A 3ZHDA 1QLEL 2R56H 1CR9L 1E4XH 4P46B 2R69H 4LLMB 1DBBL 4S11A 1XAUA 3MCKB 2CRMA 2OJEA 1IGTA 1N2RA 3BPNC 2LAGB 2GJ6E 3QEQA 5DVNA 2UYLA 1KG0B 2XQBH 2VERN 3S6CA 2VLJA 3MFFB 3QEUA 4F58H 1PFCA 1L4IA 3INUL 4H5SB 4UQ2B 2CDGB 1HHIB 2AEQL 2A9NL 3LVEA 5A16A 4P59L 4ZS7L 1IEAB 4YDIL 4C56A 3AAZA 1MHEB 1BJ1H 1OOAA 3W82A 3DUUA 4PTUB 1N5YL 2XG5A 3NGBB 4KKBD 2BOCB 5IBTH 3MRHB 1IGFH 2FZ3B 4YC2B 3LRSA 5KW9H 3LKRA 3TLRA 1HHHA 3ARGC 2CJUH 3UDWA 2XZCL 4RGMC 4YDLB 4Z0BH 2ZSVB 1AGDB 4RX4A 5FYJH 5AZ2H 3ORJA 4NYLB 1MHPH 1ZVSA 2AXFB 4Y16C 4FFYL 4MXVF 4WDIB 2OP4L 2OK0H 2IPUK 4MNGA 3HZKA 4JFDB 1ZLSH 3UJTH 1FFNB 4GO6B 2AV7A 3EKCA 3PNWB 3Q48A 2DM2A 3THMH 2CRYA 3FQRB 4XP9L 5F71A 5B4MD 4FQPA 4PRNA 2NXZC 4G6ML 1ZV5A 1YNLL 5HHPB 2EIBA 5MEPB 2G5BB 3KYMB 3H2WA 4RSVA 3U0WL 5B39A 3VXME 4FQ2L 4LK4A 3VXMD 2ADJB 2G60H 3RVVC 5FYLD 1BECA 4LPXA 4XMLL 4HWEH 4TQEH 2AW2A 4KC3B 2UZXB 3HC0A 2CMRL 1V7NL 3RX5A 1S9XA 1OW0A 5I8KL 5H35A 5LGJB 4QY8A 2Y07H 1YYLL 1CK0L 4G43A 4PJDE 1DJSA 5IBUG 5KVGL 5HY9A 2LFGA 3IDGB 4FQCL 1BQUA 3MRPA 4D8PA 4ZODA 4Y8DC 5DD1H 4KVCL 4JREC 4PJ7A 2SEBB 4ZTOH 1GXEA 5IK3B 4KU1A 4JQIH 3LMJL 1GJIA 1PZ5B 4Z76A 1P7HL 2A2QT 3CLFH 5IW6A 1MI5D 5CEYB 4HK3J 4KUCD 4EOWL 2W91A 3V7AG 1JUFB 3WJLC 1VGKA 3JV5A 5DRNB 1J18A 3VFPB 2NY3C 1P5VA 4PLKC 3FO2B 1FRGL 2XT1B 3AS2A 4YXHL 3FB6A 1LEIB 4ZOCA 3ARZA 4GQPH 3ZKND 3KLAA 4OF0A 5FM5O 2BOBA 1MIEL 1X5GA 1X5IA 2GJ6D 4S1QL 3SJVA 4PJHB 2IFGA 1UWXK 4N8VA 1QFWH 2O5YH 3IGAA 3AREA 3KYOA 3JV6B 2WW8A 4ONGL 1D5IH 2Y6SD 3BN9D 4WUUE 1AHWB 1VFBB 2R4RH 4Z7NE 3WFDL 2H3NA 2H2PD 2VQTA 4K23H 2UUDH 3ES6A 4LNVA 3TYGH 4MVBC 2Q76B 5I1GH 1OPGL 4M9PA 3IDXH 4PJXF 2GK0B 2R39A 5HHMB 2VDKH 3RTQA 3NA9H 1MCWW 3IU3A 1A3RH 4NQTA 4G8GD 2IADA 3TWCH 2FJHA 4YR6B 4F2MA 5FYLL 4AT6B 4YBQC 4L4TD 1I3RB 5A1AA 1IFHH 3KNBB 5FUZL 3TJEH 2AEIT 4OM1H 4WVRA 4NZTL 4UTAH 5I8OH 3P0YL 5DMGC 4XCYA 1UKSA 5DA4A 3U6RA 2EC8A 3T0WA 4KI5D 3JBG7 4NKMA 2A38A 4R26H 4FZ8L 4IOIA 5F8QC 1CQKA 4HZAA 2BSTA 1G7HA 3V4UL 5F7UA 4YHML 4XGZB 3SCMB 4EZMA 5CILH 5DVLA 5TQ2H 3CVIH 4NDMA 1WZ1L 4PJDF 4AMKL 3LIZL 5IB2B 4P0DA 3OSKA 3B9AA 2CKNA 1CGUA 3SDAD 1P6FA 3UJJH 2NX5B 1WZKA 4ZXBA 1NCNA 4NJ9H 3BW9A 2MJWA 4PJDA 4U31A 2W60B 1F4YH 2F15A 1A7RH 3MTRA 1AXTL 1WLHA 2X1XR 4Z78B 4XB7A 1AXSB 3FQUA 5JOFA 1W0YT 3NABL 3VFOA 3TYFB 1MJUH 5EO9B 3K8MA 5ACZA 3LKSA 1MPAL 2P7TA 1KT2A 1MJ7L 2OYPA 1KBGL 4I8DA 3PGDB 1T1XA 2HG5B 1WZMA 1CGSL 3ILPB 4U1JA 1HHGB 4A6YA 2XZZA 1R5VB 4DN4L 1YEHH 5FDYA 4R6UA 2Y7QA 2XKNB 4JG0H 1BZ7A 4YHKH 3HI5L 1OAXH 1K6QL 1IM3B 4KH2A 3O41A 5IW1A 2A73A 5C0BD 3IU4L 1QFHA 4S1DC 4DGVH 4FXKB 2E7BA 4Q9QL 4KJPC 3VXSE 1UM6H 4M6AA 4UOW0 3EGSB 4PRDA 4PJXA 3AU1B 1ZAGA 1FJ1A 2XWTB 3GHBH 5HBBA 5BMFL 2IEPA 1RAMA 4PRIB 1SYVB 5L9DH 4POZD 3Q6FB 2R4SH 4HLZG 1SY6L 2G5RA 4LVNC 3KPMB 5IVXA 5E8DH 5KS9A 5D1QD 4OCXH 4HXBH 3LPFA 4N8PA 5T33H 5HHQB 1HNFA 1T04A 1A1MA 4KKCC 2MNUA 4D0CB 3EDFA 5JTWA 5FYJL 5AZ2L 4M6OH 2HJLA 4S10A 3R06A 5F1NB 5KSVA 1NKOA 3K2MC 3GJFA 3MNZB 4NNPL 3S4SA 1S3KL 1YMME 5IEHB 5ISZB 1JVKA 4HF5H 4BSJA 3F7VA 3BXNB 2AJZA 1AQKH 3LHPH 3O6LH 4J3UA 5GS2D 3ULUL 5DK2A 2YD3A 3VFVB 3BIKA 3PABB 4U1MA 5K59E 4PJIE 4BQ6A 1X5FA 4GBXC 1KPUB 4JGMA 1WC7A 4JFYB 1G84A 5E1HB 1GAFH 1CL7I 3Q5TA 3QQ9C 5DVOA 5T1KA 3VMPA 3OHXA 5IVZB 2CXKA 3F5WB 4X7SH 4BKLB 3MRLB 3GJEB 3G08B 5FGBA 1UA6L 4F7TB 1B0RA 5J6GB 2DLHA 3QPQC 4O5LL 5T3XD 5C0IA 3AC0A 5D7IE 43C9B 5L6YH 3EBAA 5IVOA 2OL3H 1INDL 2GTWA 4HT1H 3T3PE 2YD2A 5F1IB 4MCYA 5IW3A 2B7DT 4KVCH 4Q97A 3VFUB 2QTEA 4LASH 1JF6A 4X80H 4V1DE 4HX1A 5E00A 8FABA 2P8LA 3ARRA 3MBXH 3DMMD 3LN5A 4KUZL 4Y5YA 4PLJC 1FVDB 2VIRA 4Y0GA 4NBZB 2R9HC 1NBYA 4JHBA 5C0CD 2DI8A 3W39B 3X3FH 5ERWB 1TITA 5AG9A 1FRGH 3P4NA 3LDBC 4PJ8C 5KVEL 1U95A 3WUWA 1DDHA 5E2VH 4YE4L 1F2XK 2BXZA 2DQFB 2PKDA 3C8HA 3ULVL 4V1DB 4GAYA 5B38B 2Q86A 3WJJA 3EUUA 4NRZB 5I66B 5IHZA 3CGTA 2NXZD 2RIKA 3CFEB 5B3NA 4ODXB 1IL1B 3EOAA 4X98A 3VRIB 1YN7B 4NQXB 1R5WA 3J7HA 3BZDA 1N64L 4IJ3B 4L8BA 2PXYD 2R1WA 3VI3E 4U3CA 4PY8J 4I0KA 3QYCA 4UQ2A 3IFOA 2F53A 3B2VL 2QEJA 5I1CL 5CSZB 3DIFB 3LKOA 4WUKL 1OLZA 3LS4L 5IM7B 1UH3A 5DDHB 1NGYB 4J3OC 3IDXL 2LU3A 5KTEL 5ALBH 5GIRB 3VXUB 4L9LA 3SDXB 2P5EE 5K9JH 5H8DA 3O45B 1KJMB 1Q0YH 4HIHA 3H8NA 5KSBA 4GBXD 5CZXD 5GGSA 3L3IA 4HPYL 3M8OL 4YGVB 5JW5A 5CGYC 4R8WL 2YEZA 5HGDA 1T3FA 5HD8D 3BT2H 1T1YA 3SKJL 4OIIL 3MLYL 4PJGF 4L4TA 4UDTA 1T7XA 1DUZB 3MZGB 1PAMA 5IFJA 5D7SL 3MREA 3D5OF 3UPRB 4FQ2H 1ODAA 1L9NA 4XP1H 2X4OB 2LABA 5C2BL 1PX4A 4OD3H 2CGRH 5DLML 1XCQA 3EJZC 5J9PB 3PV6B 5MEPA 2A9ML 1CBVL 3WUZA 5HGBB 3WDHA 5FUCE 4ZXBD 3CXDH 4WW1B 5E5MA 4JKPH 4D9RE 1UJ3A 3M1BA 4GMTH 4S0TD 3D1MC 3WKNA 4GQ9H 4IIQB 4LCUB 2C3HA 3I3EA 1PG7H 1MCPH 3S36L 1S7SA 3ZDYF 5IQ9B 3LOWA 4POZC 5DFVC 4N0YH 2VWEE 3MBEA 5TDNB 2VLJB 4LGRB 1GGBL 4XMKH 1IZKA 3VXSD 2P46B 3OKLA 4PP2A 5IMMB 2R29H 1MHHB 2VABB 4IOFC 4P3DB 1UWGH 2W0KA 3SE8H 2Z91A 1I7UB 4RAUA 1T4KA 4OZIF 5TE6L 1SEQL 1Z3GL 2QKIA 2NX5D 4R96B 3QQ3B 5ILTL 4JKKA 1UVQA 3GHEH 5EC1B 3NZHL 2P42B 3EYQC 5JXED 3Q0HA 3B9KA 1SJEB 2OR8A 4CMMB 5DO2D 5EOQL 2KL6A 1KIPA 3HMXA 1ZVSB 2AXFA 2FEEL 1AE6H 4YO0A 4JB9H 1KPRB 4LSDA 3GJFK 4LCYA 4ONGH 4YLQT 7FABH 3KPLB 3T77B 5FK9A 1C7TA 5DRXA 1J0KA 4IHOA 1WFUA 4EN3A 4G8IB 2G2RB 4K23L 3BUTA 2AJVH 1YNTB 2DD8H 4N0UA 5CZXC 5E95B 1JK8A 1QYGH 4QT5B 1SY6H 3MOBL 4WFFD 5C9KA 3RWJB 1IGJA 3FZUD 3T1FA 1DSFL 3NCMA 4A2MA 2VXUL 2YN3A 3SO3C 4JPWH 4IDJH 3NCFB 3TPUA 4P4RB 1MF2L 4J3VA 1KCVH 2F5AL 1UACL 1UJ3C 4UNUA 5IT2L 4OCNC 3WV0A 1F4WL 5KJRL 4ZFOA 4DVBA 5E6IB 1ND0A 1TQCC 4UDUA 2HJFA 3ZT5A 1J88A 1S7XA 1BOGA 4X9FA 3GMMB 4QNPF 3LEVH 3O3BB 4M1DL 3REVB 1FNGA 4XCEB 1Q8MA 4ZFGH 3RY6C 1S7UA 3EYUH 5D1QB 5DMGD 5C08B 3AMKA 2Z31B 3FT3B 4F58L 5J57B 3PHQB 3MRHA 1CG9B 1QG3A 3N9GH 4XPAH 2PW2A 3SCMC 2VLKE 4WHYH 4AMKH 2H26B 1IC5H 4NPYA 1OGTA 2YD7A 5D8JH 1YNKH 5IVXE 3DSNA 3QFJB 3TGXA 1Q1JL 3O6MH 3QH3A 4M48L 4OD2B 2QQQA 3VXPA 5INCA 4LL9A 3FQRA 3TN0A 5BS0B 3T3PF 3MLTA 1O0VA 4WFED 1CN4A 4PTTA 3BD3A 2MQ3A 5L6YL 1PD6A 1U8KA 3HG1D 4U1HA 4JE4B 1FIGL 1IGML 4PJHF 2IAMD 4Z5RA 3O6KH 5DUBA 2PCPA 1P7KA 4XPHL 1PKOA 1JWMA 1E28A 2NY0C 4G6AC 3VWKA 4S1SL 1NEZB 2HFTA 4ZUWA 5F9WB 1D6EB 1PEWA 3FTGB 1OAXL 2P7TB 3S34L 1S9XB 1KXQE 2IF7A 1A6VH 4U6XB 1LGVA 2FLRT 3IU3B 3DXAB 1LDPL 1JWSB 3LN4A 3PWPB 5D7IB 4CDHA 3SKMA 5D71L 1M6OA 1BZ7B 1JPTH 5BRZE 4MXWL 4QOKE 4TPRL 3JVGC 3NIGF 2AV1A 4CVXA 4HJJL 1YYLH 3DMMB 4JDTL 2CR6A 3I2CH 3GSQA 1QOKA 2DQHL 5JZ7C 2EDNA 4P57A 4P2QD 2ICWA 5E8EB 4PJBE 1N5AB 3TBTB 5EZOL 4FQXB 1S7WB 3JWDC 4PR5A 5SWZA 4MD5B 2GSGB 4JFQA 3D25B 3TP4A 5T33L 4IRSD 2DMBA 4MXVE 1MVUB 4V1DD 5TDPB 5I18L 4YK4B 5J1AA 3FOLB 3EJYD 4HIIB 4QXWA 4Y2OA 3VMOA 4N1EA 3VXNB 4JPVL 1DBBH 4HDIA 5C0AD 3KPMA 3IT8D 35C8H 3OKDB 1NSNH 4R3SA 2NCMA 4NT6B 2OL3B 2WP3T 5GS1C 1IAIL 2BC4B 2NY3B 5EU5B 3V8CA 2ZKHL 4MD4B 4GBXA 4U1NB 4UQ3B 5GZND 1R24B 4OIIH 1MCFA 1HYRC 1AGEA 4XCNB 4WV1A 2YBRB 4HWBA 4O2FB 3HI6L 5C0RL 3LKSB 2BNQD 4OFVA 1I8IB 4G8EA 3D3VD 5IHUH 1XIWA 3V4PH 5AWNH 2IBZY 4P46D 3TPKA 2CLRB 1GGCH 3R8QA 2AEQH 4QRPA 1TETL 4JRYA 5CD5C 3D0VB 3P30H 1CLZH 4WNQB 3TZVD 2WMPA 3L1OL 5DZNA 3T4AA 1LO0L 4ZPVA 5CBAB 4K8RC 2X4RA 5C6WH 4WJ5B 3GM8A 2YRZA 3QDGD 5SV4A 3MLPA 4NQDE 4K71C 4FNLH 4WW2F 2I60L 4NHUB 1VPOL 1AC6A 1HILB 2MSPA 3C5JB 1ZGLP 5CKGA 4PGZA 4P99A 2J12B 1XGUA 4P4KD 4ZFFB 1IKFL 5CMAA 4HG4J 5E03A 1J0IA 1U8HA 1JGDB 3S96B 3OAYH 3PIQB 3WFCL 3OXSA 4BJLA 1YNLH 1ZLUK 5DRWA 3LV3B 4MA8L 4AIOA 3EYQD 2A6IB 5DJ8A 1ZLWH 1ED3B 1NUGA 1T6WA 2AVGA 2X44D 5C0NC 3QFJE 2OQJB 1L7TH 2DQIL 4JN1H 1TCRB 2BVQA 3P4NB 4D0BA 3FRPG 5IVXF 3CCHA 3QIBB 2DAVA 5ESAB 4OZGE 5GPRA 5EO9A 1BD2B 3DETD 2D4DA 3D2UA 1LMKA 5JHDB 4ZO7A 4NRZA 3C8DA 5MI0C 3O2VH 1QPXA 5KANG 4MNGE 4LLDB 1IL1A 3EOAB 3OKEA 5DMKB 5ICYB 3CDYA 1R3KB 1QQDB 2MHAB 1ZHKB 3OKYA 5F1KC 3CFKA 4BZ2L 3KS0H 1C5BH 3O41B 5IW1B 2CIIA 4DK3A 3OF6D 1KN4H 1JRHI 5CKAA 1QLRB 5IV2A 1RU9L 2XWBB 4JDZB 1G0YR 3KHOA 5JW4N 3F12A 3WL9B 2ZUXA 3DBXB 1VENA 4KAQH 3D39A 4PRDB 5ICXB 1FZKA 3QJFA 2VLME 3B83A 1T0PB 3BP4B 1SYSA 1OAUL 2EC9T 2M8XA 5TGBA 5D1ZB 2VLMD 3DRTB 4P4KC 4LLQB 1BIIA 5L8LB 4P2OA 2E7HA 1F13A 3G6DL 4PRAB 2C26A 3RUGF 4HX1B 8FABB 2I07B 5HYQA 5J11C 3GHBL 4U6HB 1FO0L 1NMBH 3QUYA 4JM2F 5E6ID 4DKAA 1EMTL 4GKSA 5F9AC 3PQYB 1RZKL 1I7TB 5DUPH 5E8DL 2Y23A 2EDWA 5ETUA 2VN4A 4R4NC 5CJ5A 1RUKL 2Q8BL 4OKVB 1NCBL 3T65B 5I1GL 1JHTB 4NZJA 4ZUUA 3F7VB 2Q6WA 5SWQA 2A83B 1B0GB 5T5NF 1G6RB 4KDTA 3BIAX 3PE9A 5E4EB 2D9CA 5HYJD 4BSVA 2CLVA 3QIBC 1AC0A 1KLGA 1MI5B 3ZE1E 4Y4KB 2J4WH 5D1XB 3QWQB 3UTSA 4MA1C 4W4OA 1T6VN 4RISL 3TFKC 4DKFL 5LCVH 1AQKL 3BZEB 1WBXB 4QHMB 4JM2C 5KSAC 3BPCA 1M05B 4J8RA 1JHLH 3UAJC 3N1QC 3V52H 2NQCA 3HG1B 3P3YA 3C09B 4O2CA 1D9KB 3PDGA 2MKWA 1J1XH 1NCTA 5CEZE 5DI8B 1N59A 5I1IL 4XAWH 2EO9A 4HJ0D 5D72H 5B4MC 1QO3B 4KHTL 4R7NB 4XNYL 3WFZA 4LCYB 3RWHB 3MLRL 1G7QB 1P6AB 3QPQD 3GSNA 5J11B 2V2WA 4NN6B 3O4LA 3R0NA 5AUMB 3RWDB 3TA3B 5FYJE 3U0PB 3I6GB 1J8HE 4OZ4B 1ES0B 3WNKA 2VXVL 4N5EC 4KTDL 5J9PA 3BDYL 5DHXB 5IT2H 1HDMA 5KJRH 2ID5A 4M03A 3O11A 1YYMH 2ZCLL 4JCLA 3C6LC 1A6AB 1UJ3B 3M1BB 3I84A 1IEBA 4N9OB 4ERSH 4JG0L 4LU5H 4JFDE 5BW7A 3OKNB 4FQIL 4MHHG 1JF5A 4JQXC 3MBEB 3ILQC 3MRRA 1TMCB 2X4UA 2E7MA 2QJDA 2HJFB 2NYYD 4ELKB 1VKXA 1UFUA 2H6PB 5C0RH 2YZ8A 3KXFA 2VABA 2W92A 4QEGA 5C0AE 2DQGL 4QO1A 1N64H 1NBZA 3D9AL 3SGKC 2DQJH 2XZAH 1PX3A 25C8H 2CKBL 3RVTD 3ZDZF 2EO1A 1RJCA 3DYPA 4HC1A 2YD8A 4YEFA 4JHWL 2ARJA 2O61A 3CZFA 4BFBD 2L0DA 4MWFA 3KPSA 2YS4A 1JN6B 4I0PC 1CXIA 3C2AH 4WWKD 2FHFA 4ZS6C 1K3ZA 4LPCA 2FSEB 4XHJD 3U1SL 3CFCL 1S7QA 2GCYB 2GFBA 3QHZH 3TC9A 2C9AA 1R5IA 3GMRA 5CZKA 3UCRA 4RGND 1YY9D 1NFDE 5AYQA 2Q8AL 1KCLA 5DJ0A 5C86A 4AZ8A 4CADA 1RK1B 3MJ7A 4LARH 3P73A 3C60C 4G7YL 1S7RB 3ARFA 3FAXA 5DEZA 2OTWA 1GIGH 3QEQB 4LCIH 1XT5A 3C2SA 1GAFL 4WU5A 3TBWA 1HINL 4I9WE 1YPZA 1MAML 5KVDH 1EHLH 1WVZA 1L0XA 3PJSA 3X11B 5GRVL 3N0PB 1JHKH 1UA6H 5IROA 2Q3ZA 4CU7A 1XGRA 2JCCA 4V2BA 4PTUA 3OJMB 5IMKA 3IDNB 1UB5A 5KW9L 4M4RA 3L3GB 1MFDL 3HC4H 4NC0B 1VADB 1FNGB 4XCEA 3GJFH 4CVZB 3IF1A 2GUOB 5FYLE 5C70A 4OI8A 1U8NB 1PLGH 1J05B 1RY7B 5JPNA 4HD9A 3U0TA 4Z7UF 2XN9B 2NY0B 4KY1L 3T04D 4IS6B 5LGHL 1GPOH 4OLWL 3SKNB 3FO1A 4UMGA 4PYGA 3MRFB 3SGEH 3GIVB 3MRBA 4NO5A 3ZYOA 1X5YA 1KIQB 3GHEL 4UV4L 3MODH 3SOBH 4KZEH 3MYZA 1VESA 4JQXA 1RJZA 4J1UA 1AE6L 1BAFL 2ZOLB 5GRXG 2ERJC 2C7UA 5BZWB 4YHZH 1HYSD 2FATL 4LIQH 2AXGA 4RGOL 4B7LA 3EFFA 1YEDB 4NFBA 4XPTL 4RGNC 5AAMA 3G6JF 3QB7C 3CXHK 3MCG1 3ARBA 1UADC 1FL6A 3NFNA 1KEGL 2YK1L 4YBQD 4FQXC 5IGXH 1T21B 5DD6B 4OUUB 1X5ZA 5DC0A 4NKQB 4WCYH 1IEAA 5KTEH 3ECBA 4NFCA 4NQSB 3SQBA 1JMXA 3MJ9A 1F90L 3MR9A 1KJ2A 1A6ZB 3O3BA 4R8WH 1ACZA 5CHNA 3W0WD 3VDAA 1M7IA 3DMMA 3HLAB 3KYKH 4YUEL 5H94A 4ACPA 3O2WH 3VRJA 5GJTH 3U36B 1YUHA 4Y19B 5EIQA 3FCTB 5E99H 4YBHA 4LVNB 3PNWA 3BT2L 3EZJB 3NFPA 4NNXA 3D48R 1E6OL 3NACL 1EX0A 4HK0B 5EA0H 2RAMA 1IEHA 3GSRA 4K94L 5I8EA 4QWWC 3N9GL 5JDSA 5F44A 5I15H 1CBVH 3FQXB 3A6CH 3L5XH 1GOHA 1DUYA 1G7IB 1X44A 1BZ9B 1K4CA 1SJHB 3EOYG 1JGDA 1KCSL 4ZMAT 5C2BH 2LVCA 2HH0H 1PG7L 4HWUA 3QCUH 4Z5RB 1C16B 5E6ZA 1B88A 5BOZG 1SM3L 1A22B 3VFNB 4OLUH 5CLWA 3TVMB 3FL7A 5BVPH 2IPKA 3TV3L 1JGUL 4RNRB 2GK0A 4HUUB 5IMOB 3I85A 4DUXA 4YIQB 2X89D 3SDDC 1NKRA 3VFTA 3ROOA 2ERJB 4YWGH 1ZSDA 4U7MA 4YHIA 2CDFB 4G6KL 1Z3GH 4GW4A 1EZVX 4HCRH 3WEXA 1V8HA 3O4LD 5TDOA 2Q7YB 2WINB 4G5ZL 5IP4A 2P49B 1ZEAL 1P7QB 4Q6IA 4P2OC 3NVQA 2GIYA 4M1GL 3KPOB 3NCYS 1BQHG 2ZSWB 3CFBB 1JGVH 4NWTH 3K0WA 3S37L 3IKCA 2DQUL 2NXYB 5E8EA 1CICB 4JFXB 4YAQA 2FB4L 3V4UH 4LPVA 5IESH 1LNUA 5CILL 3S9DB 3I6KB 4OZGB 5SWZB 2X1WL 3RA7L 4PLOB 4EXPX 1JI2A 1HCVA 1BFOA 3VXOB 3L3DB 3V79C 3FONB 1ZS8B 4P2CG 4O58L 3QUZB 4C4KO 3BDBA 1AO7E 3OL2A 4C83A 4ORZC 5HYQB 3OXSB 1C5CH 3P11L 2XQYK 5D7LA 4PJ9B 2IH1B 3VFSA 5LWYL 1CICC 2DWDB 2IJ0C 1BGXH 1G9ML 3UPCA 2HRPL 3MV8B 4YDVB 4XTRC 1F97A 1L7IL 4ORGA 4E41A 4HZLA 2J4WL 3PWVA 5HI3C 5C0CA 3DI2B 3GBLA 2FJHB 1R3LA 3O4OB 1I8IA 4G8EB 4LGPB 3SDAC 4NQDB 1F3RB 3WNMA 4I18B 1GHFH 1SJVA 2OZ4L 4LLDA 4PJ7B 2PN5A 1ULVA 1QQDA 3FJTA 5ECJE 3V0WL 5D5MA 1EVUA 5GGRA 4ZPTB 1S5IL 3X3GH 3BGAA 5FUCC 4NHCH 1S5HB 3U30B 4ODWB 2H9GB 2YMXL 3D85D 4U1LB 3KG5A 4HBCH 1Q0XH 1TIUA 1H0DB 2AJYH 2BERA 2XWTA 3QUKB 2IQ9L 3DBXA 1E4WH 4I5BB 5CJ8A 3CDGA 2YD9A 4R4BB 5KBNC 3HRZA 3G5VB 4GRLB 1QD0A 3TIDA 5KN5A 5HVGB 3DRQB 3OAUH 4BQBA 2KPNA 5T1DH 5T3XE 4XNZC 4BZYA 5MEOB 1BIIB 2MOVA 3KYOB 5CMAB 5AZEH 1WIPA 3HZYB 3HAEA 4RX4D 5C0JA 3M07A 3TCLB 5D7KE 1FZJA 1U3HB 4C55A 1PY4A 5D6DC 3SY0A 1PLGL 4HJGA 5BRZA 1YJDC 5JW3L 2OX5A 3BQUB 5IEHA 1OT1A 5DXWA 4L8DB 5BS0D 5AUMA 4BELD 3DO7A 3C6LB 4KUCF 4PGBB 5CD3A 1BVKA 3LKQA 2AJZB 3ILPA 3OAZK 2XQBL 1YZZA 3VXUE 2R0KL 4OKVA 1DR9A 3SDCA 5GJSH 4YX2H 4U1MB 3DROB 4U1IA 5HHOE 4DCQB 1DBML 1MCBA 1RZIB 1W72L 2A9NH 1AKJB 1H15A 1LDPH 4YHZL 1URLA 3SBWC 5FYKD 4ODUB 1U3HC 3HE6A 3V5KA 4N0RA 4U2ZA 4JAMA 1H8OA 4Y4KA 1LD9A 1AI1L 1OAZH 1YECL 4F7EA 2WUBL 4NKIH 3X12B 3PV7A 4KTYA 3DXAD 5IGXL 2DF3A 1CS6A 2HVJA 1KNOB 4EI6B 5JXAH 4NO3B 4PFEA 1G7HB 1KTDB 2P8MB 2NZ9C 5K9QG 1IC4H 1G0XA 1O7SA 3MV01 3BESR 1RU9H 4LDOB 5BXFB 5K33A 3WNPA 4Y5YB 4XC1L 2NX5A 3BJ91 1I9JH 2VDQH 1UH2A 3X3FL 5JPMB 3R06B 2NTSP 5F1NA 1RHFA 1HQ4B 1YQ2A 3QJHA 2YSSB 5EB9A 3UJIL 1IGYA 1D7FA 4Z7WF 3QIUD 5ACZB 1HH6A 3MA9L 1GGCL 2NTFB 4RAVB 1PZUB 4PJFE 3PQYA 4C54A 5ENWB 4I48B 5C0AB 3LKNB 3G6AA 2EXYC 4JVPA 5ANMB 1CLZL 3CDFA 1JYNA 1R5VA 2Y07L 3H7BA 4X98B 3O0RH 3VRIA 5IHUL 3QQ4B 1HDMB 2R9HD 5KAQF 2OR9H 1HNGA 1EMTH 3P4OA 5KVGH 1LO0H 2Q6WB 5CJBA 4DGIH 1XGTA 4FQCH 1FNAA 2Y5TA 3QDJB 4MVBD 5K9OA 4FQQA 3I9GL 4P2QB 4PJAE 5MHSD 3K2UL 4ZUSA 3KJ4B 4O2EA 4NRXA 3BGMA 4MCZA 3GSUA 4OLUL 3HC3L 1H3VA 2YWYA 4QXUL 5CEXA 3GIZL 4R2GC 3L95A 5JDJA 5C3TA 4RDQF 1UM5L 3OV6A 4XBPA 1LVEA 2X4NA 2BFVH 4K9EC 4MD0A 2OJEB 5JW5B 3QDMA 2ZWLT 4M4PA 3UPAA 2YEZB 1YMMB 1RUMH 3SKJH 4BH8B 5L2KE 1F6FB 3ARDC 2AXJA 3SOBL 3O3EA 4HKXA 4LKXB 3V0AC 1A6WH 3ZTNH 4Z7WE 4R0LB 1MFBL 4RMTA 1T04B 1LO2L 4H5SA 2NY3D 3UPRA 4PG2A 4LHQB 4L8CB 1II4E 1RZGA 1S8DA 3OAYK 1EEYA 5DQJB 2VLRB 4R7NA 3O2DA 2EZ0C 3MRPB 3MRBB 4NO5B 5FYKH 1U8PB 3D3VA 2MQ0A 4HS3A 1IT9L 3RWEA 3L6FB 4RRPG 1TJIH 4L4TE 1R5IB 3GMRB 1UYWH 3O4LB 3RA7H 2IQAA 5JW4Q 1R3JB 3A6BH 2J88H 5A3IC 4DW2H 3MUGA 1VGKB 3UTSE 1LE5A 4NZDA 5F9WC 4EBQL 4NN5C 3P73B 2RFXB 1HXMB 1B9ZA 1QTYT 1Y6NR 3FB6B 3QXAB 1FYTD 4KK9D 1MLCA 1RK0A 2RGSA 2F53B 3SGJA 1VGEH 4KXZI 3EYSL 2ADFH 2X40A 4G9FA 3LCYA 4UB0L 5T1KB 3HR6A 2P5EA 5GGVH 2EXYD 3IGAB 1UCBH 2Z91B 5DQDL 5HHPA 1T5XA 3WS6A 4QRRE 1B0RB 5J6GA 2HMIC 3LEXA 3ZKMD 4GW1A 1HCFX 1HZHH 1TJGH 3MR9B 2MQCA 1TVHB 4FQHB 4MA7H 2ZUWA 3OR7B 1FL3A 1FVCA 1XR9A 2B20A 3H9SB 1DQLH 1KIPB 3B9KC 3CH8A 3JV4B 1Z9OA 7FABL 2EH7L 3UTZB 2Q76A 4U49A 3NGBC 2V5TA 5J13B 2VNCA 5HSFA 3AROA 1TVBA 1U8MB 4BYHA 4MNQB 2HT3C 2CSPA 1AIFB 1JNLH 1KYOK 1NCWL 2ARJB 2YC1A 3ZT7A 4Z7UE 4BH7A 4PJAA 4Y16D 2F74A 1JN6A 1JRHL 5D70L 1FFRA 2OMNA 4LAQL 2CRZA 4KROD 4QT5A 1PYWA 1AR1D 5ESQB 3EO1A 4Z76B 3NTCL 5L2KB 1OTSD 1FLRH 1FGVL 4OJFL 1F58L 5L8KB 2AQ3A 2FLBT 2VXUH 3OKMB 4PJFA 1UACH 3WHXA 3QAZB 4KROC 2QADD 3VXRB 4MA1B 2FH8A 1FQ9C 4XGZA 1MFAH 4OZFH 2D7PA 2Q87A 2XY1A 5IMMA 3MA7A 4XVJH 2VDLL 3CH1A 1MLBB 2DDQH 3JTTB 4KJQD 3UX9B 2HA1A 1NGPL 3WDJA 1HK6A 5JMOC 1A7QL 2P44B 4ZD3L 4DOHE 1BVLB 3QQ3A 3MJ9H 4IRZL 1MUJB 2D7MA 4LHUB 4ZUTA 1BJ1J 5EOTB 5TE4L 5D72L 5FEBA 5DVKA 1T7VA 3GSWB 4HUWA 3VGGA 2ZCHL 3N1FC 4TULL 4NCDA 3D18A 4F3FB 3MGOB 4JZNB 4X7DC 4X4XA 5TFSL 4JHAL 5EBMB 5DRXB 4ZSOB 4GRWH 2YKLL 4NNXB 4Y5XC 5FYJU 3MV7E 4F8TA 1TQBB 5C6TL 2PYED 1YDPA 3EDEA 2BVPA 1CR9H 3VDCA 1KIQA 3LEYH 5FF6A 4OQTL 1JK8B 1LWRA 2JB6A 3UTTA 2V9TA 3CX2A 1KLFA 2MPAL 2UZYB 3QUZA 2FHBA 3JWDL 1Q9KA 1QFWI 1DN0B 3O3AA 3S97C 1LE9A 2AEPL 3DHMA 2GTZA 1A14H 3T3ME 3ZTJH 1WWWX 3WJJC 1X3DA 3BFOA 3GMNB 4K9EL 1I1AC 4U6XA 3FB7A 4PV8B 1KJ2H 4HUUA 3KWWB 4LDEB 4ERSL 1ZK9A 3PWJA 3JWNC 4AENA 2FATH 4LU5L 1T21A 2Z92A 1GZPA 4K3HA 4XPTH 5EN2A 3HFML 4B5EA 3GNMH 5KS9B 3CLEH 3IKKA 4PJCB 3OJVC 3H0TA 3K74B 4X7SL 1LP9E 1CF8H 3QO1B 5IBLD 4RMWA 5KSVB 5I1DB 4ZPTA 1KXTB 4PJEE 2ZSWA 4YFLI 5DURB 1ZLVK 2H2SD 1I3GH 3THML 3QEHA 2HT3D 5IFHL 4OGZA 4LASL 3V4VL 2P1YA 4JO1L 4U1JB 1MCCA 1WV7T 3VXNA 5D5ME 4JO3H 1TENA 2CKBB 4G8IA 1F3DJ 5I8EB 4AQOA 3WHE0 1YEIH 3TEUA 4QF1A 1A7OL 4TNVF 5L7XL 3CC5B 3V5HA 3BISA 1BZ9A 4PBVC 1TQBC 4PRHE 4PGCA 4NQCE 1T22B 3U4BL 2K7QA 1N6UA 1V5JA 2Q20A 1R24A 5B38G 3HNSL 1JHKL 4D0DA 1C16A 3BZFB 4M8VA 3IJYB 1M7DA 4DZ8B 43C9A 1U93B 1XF2B 1SYVA 3FN0H 3KVQA 5D7JB 5I2IB 2IANB 4WW2B 3VFUA 3SDDD 3SO5A 4KKLC 4XAKD 1BBDL 3PHSA 3RL2B 1AKJA 4MJIE 4XNUL 4KKAD 4LQFL 1B0WA 1T03H 3O8XC 2R2CA 4WFHE 2C4FU 5IG7A 2Z31C 2F5BL 1MFDH 4PD4K 2HLFD 1RFDH 4JPIB 4ODHL 4CW1A 2I5YL 5SX5K 4Y2DB 5DK0A 4JZJA 5EZJA 3GJFB 3MNZA 1MY5A 3X12A 1FNEA 3QO0B 3W2DL 3KPNA 4ZOBA 3FOMA 3M8OH 5E6IC 4HULB 1F3JB 3EYSH 4PV9A 1XGUB 1MVUA 3QUKA 4LLUA 1XZ0A 2PYFA 3W9DA 4KVNL 4EKXA 3L7FA 1ZLVH 1YA5A 1JPSL 1CLCA 4YXHH 4K71B 2ZUVA 3U4AA 3BIKB 1AGCB 1P5UA 4G6AD 5I1EL 4MA7L 3VXOA 5I75B 5F3BB 3V6OE 4M7LL 5DUMH 1R3IL 3IAGC 2XN9D 3UO1L 2PCPB 1MAJA 1JGLH 3FFDB 4OF7A 1ZA3A 2APTA 3SE9H 2VC2H 5DD0H 5E56A 5E2UH 1UXSA 4D0BB 3HE7A 3O0RL 4QRUB 4E5XB 3WUWG 1WQVT 2HKFH 1CFQA 3MOQA 1OP5H 1NL0H 5LXGH 5DS8B 3O45A 4IIQC 2BNRA 3BWAB 2F58L 2VZ1A 3VG9C 1EVTC 3QCVL 4H1LH 2DLIA 4EVNA 1FVEA 2R2BA 4PJ5A 3RWIB 1IQDB 3BKMH 4MLIA 4UOJA 3DECA 1RJYB 6FABL 4JJ5A 5T1LA 4YH6A 4UDTB 3PWNA 2A6JA 3TWCL 1H5BB 2X4PB 5EU6D 3F58L 2ESVD 2JELL 1UM5H 2R0LH 5DJYA 5EG6C 2ZUUA 3QUML 2WBJC 5L88H 3NBNA 4U3HA 4I18C 5DZLA 1ZTXL 4EI5D 3HPLA 1I1YB 3K4AA 5EZLA 1GL4B 4X8JA 4GAYB 2ZZUT 2NY1B 4OCMC 4UU9A 1WWBX 5FM4A 2Y06L 1I9IH 4NIKB 5EORL 4TSAH 3QUMB 2J2ZA 3NACH 1FSKC 4P5KB 4NQEA 1QACA 2CDEB 4HDIB 1CT8B 1DBKL 5BXFA 1JPST 3AXLA 4Y19D 3PL6B 1KJVA 5FYKE 3OAZH 1OAYL 4OB5H 4X6BB 3V6ZB 3TESA 5ACMA 4LSTL 1WEJL 3BEWB 1EEYB 4X5WB 2Z0BA 4WGWB 2YSSA 4WO4A 1B6DA 2DLEA 3QZWA 2Z93A 4O2FA 2W9DL 4K8RD 3RI5F 2P5WB 4DN4H 1UGNA 1QRNB 4JG1L 2HN7A 3OXRA 5GGSB 4XXDB 5CJOH 3KYNB 2GEEA 5JW3H 5ESVB 4OAWA 3K80A 1IM9B 3KPLA 3T77A 2R1YB 5DT1L 5FA4B 3TVMC 3AREC 3LEVL 3RNKA 3S37H 1G6RL 1OCWL 1Z9LA 3DJ9A 4YHKL 1DQMH 4OFYD 1NLBH 2E27H 2X4OA 4WTXA 1OSPL 3GMQA 4NRXB 4WJ5A 5CEXB 3QT2A 2F8XC 1T1WA 3V52L 1WFTA 1GOGA 1T5XB 4Z9KB 3O9WD 1S9YA 15C8H 2JJSC 5I17B 3IJSB 1IC5L 2A1WH 5EIVA 2LU4A 1VACB 4MD0B 2DYPB 4BZ1L 2HVKA 3EYVA 1WCBB 5C0BE 3JV4A 4TSBH 1KIRB 2WUBH 4NKIL 4KHTH 3MNWA 1S7SB 5EULV 2YPLA 4KK9C 4ZG1A 4S0SD 4CL7A 3HPJA 4PJIF 4MQ7B 5T3XL 4HUVA 2BJMH 3UBXG 5DTFB 3TBYA 3ZL4L 4P3DA 1K8DB 4DN3L 4DK6A 4N9GB 5C9JA 2W38A 1I7UA 4RAUB 5BVJB 1JE6A 1E27B 4LVOC 4ENED 5MENE 4LFHG 1A7BA 3NIGE 2ITDA 1QSEE 3N1PC 2EDQA 3IFNH 4I48A 4Z18A 1AD0A 3E8UL 4OLYL 3UJIH 3IS0X 2B2XH 3VFRB 4FXGA 6CGTA 3RQ3A 1SMOA 2BY3A 2WWKT 2D31B 5SWSD 4UOW1 4L4VE 4NGHL 3IFLH 1RZ7H 5GQBA 1E6JL 5FO8B 3DWTA 4MXWH 4P5TA 3ZDXE 4WI3A 5I1LB 4FP8L 3TN0B 5EZIH 2LVEA 5E9DD 1QLRA 4WI6A 4CAGA 5AD0B 5IV2B 4X4ME 1BLNB 1Q94B 3OJ2C 5JHLL 5BJTA 1UT9A 3GSOB 5IKCB 2YMXH 4HHAA 2ICCA 3GMLA 3VGDA 3F62A 3HG1A 3SDAB 5FKPA 4RFEA 1BVLA 4ENEC 3VFMA 1FNLA 2DIJA 1KG0A 2NW3B 3RWJA 3ZE0F 2ATKB 5H2BB 4NM4L 4L29B 2OK0L 3QUZD 2X09A 5AYUL 2KQMA 1EO8H 4HH9B 4AIXA 3UJTL 5DMIL 5I1HL 3VGFA 4HGKC 1RIHL 5F93C 1IQWH 1HQRA 5D4QA 5L2JB 1RFDL 2QQKL 1MHEA 5T3ZE 1D5BA 4X80L 1QR1B 2DM3A 1J11A 4X99B 2KUTA 4Z7QF 5LJYH 4FMFA 2CRIA 3UBXA 3B4NA 5TQ0H 4X6DB 3SCMD 2HRLA 3CSBA 1LO3L 1RK1A 4AEHH 1U8JB 5I76A 5C0BB 1W8NA 4NQDD 3V6BR 2PO6B 1S7WA 5HYSB 4KDVA 3IVKA 2DN7A 1IBGL 1IGTB 1A2YA 1KLGB 1U8IB 3DUSA 5CS7A 3PGFH 4O9HH 4XNQA 3QXAA 2EKJA 1GGIL 2BNRD 4UTBH 4P49A 2AJXH 2BXYA 4EDXB 3FOLA 5JR1H 3KDMA 1K4DB 1PJ9A 4XNXL 4G9FB 4WY7H 5JXAL 5LXGL 3KXFB 3OJDB 2BNQE 3CNKA 3IJHB 3SGDI 2NY5L 3LD8C 5J1SC 3BOVA 4QRTB 2HFEA 4MB4A 4DJMA 4PJIB 2BOCA 3TNMB 4KMTL 4OZGF 4HAGA 4W6YB 3RGVD 4TUKL 1N6QH 1YY8B 4KY1H 5BV7B 3RIFK 5TPWL 4CKVX 3CFJA 3U7WL 1T1ZA 4Y4FA 2ZG2A 3UTZA 2ZJSL 1A6PA 4C56B 1T2QH 2NY7L 4PJFF 5CCKL 3E6HA 4S1QH 2FEDC 1RJZB 2O5YL 2VXSL 1F02I 1IC7H 1Q38A 2BVYA 1QHPA 1U9KA 1XF4B 1BFSA 1Z0NA 4XZUB 3KLDA 3O3UN 4U3XA 1ZT4A 5F6HI 1UENA 5ELIA 5HXMA 1HSAB 4OZIE 3VFPA 1QFUL 1AKJD 1K8IA 1NFIB 2FYYA 3HNVH 4HKBB 4WENB 4YHPB 1GSMA 4WO4D 4D0DB 5HHVL 1JGEA 3FO9A 4P3WA 4JFQB 5DD3H 4BSWA 3QUYD 1CDYA 2X4UB 4J12A 3PP4H 1QSZA 4FG6C 3IDNA 4F7PB 4KPHH 5F9OL 2FBJH 5FGCB 3O3DA 5GGVY 5CHNB 3CX5K 3S88H 2I24N 1OAQH 5HTSA 1MEXH 4G9DA 1N3NB 3O2WL 2G75B 5BO1H 3MV9B 5EOQH 3U36A 2FRGP 1AY1L 3EJZD 3GSVA 5F7EH 4Y2DA 5C0CE 4WHTB 3GZKA 3DGGB 3V6OA 3O9WA 5JHDE 1GC1L 4XPGH 1G7JB 3MRFA 3GIVA 1VCAA 3DVNB 2R0ZL 4U0RB 5IWLC 1TDQA 1DUYB 4LCCB 5HD8C 1UZ6F 3EO9H 2I27N 4OLXH 2L7UA 4HC1H 3MCLL 3G6JE 3HAEG 2AJUH 4GXVL 4AK1A 2Q1EA 1BFVH 4NZUH 3DV6B 3BIBX 2JB6B 3UTTB 3ARBD 3VFNA 4RZCA 4L8SC 2JK5B 3F7YB 4IOIB 2IPKB 2D7TH 5I8CA 2QQLH 1F11A 1U36A 2EDBA 3ES6B 3AY4C 1KBGH 5DD6A 1CZ8L 2X9WA 2BJML 3NOIA 4K3DL 3O8XD 4U1SB 1A0QL 1JNNL 1KV3A 5IFAH 2RB8A 2I9LB 3IDJA 2X9XA 3W0WA 2OI9C 1UCBL 1F4AA 1MQ8A 1CFSA 2ZNXA 2FBOJ 3O6FB 1CI5A 4NQED 1MWAB 3A0OA 2FO1A 3T0EB 1RUQH 1WBYB 4TRPL 1HXYB 4L4VD 3U4EA 5E9DA 5T1KD 3U7YL 1EJOL 4K55A 4B0MM 1YQVL 3IXTB 3U6RB 4E0RA 2E9WA 4FOMA 3I6KA 3IFPB 1J0ZA 3D6GA 5SWSA 3D2UB 1SEBA 3GB7A 2HT2C 4PLJD 1TTFA 1BZQK 4PJHE 4XRCB 4MAYD 3T0AA 1T83A 4QTHA 3MV11 4TN9A 3MLXL 1G6RA 2ZG3A 3PL6C 4D3CL 2EE6A 4H26B 3O6ML 4NQVB 4A6YH 4PJGA 1TJHH 3EYFB 4Z7OE 2ZOLA 3ETBF 1MRDL 1P9MA 1XMWA 3MACL 5IR1B 5LWYH 3ZDYE 4KFZC 1MHCA 3X14B 4NKMB 4X6BA 3HMXH 2VAAB 3VD3A 2CLZA 4G8GA 1FGVH 4OJFH 5GSVA 5HPOA 1DBAL 1L7IH 2NR6D 4QRUA 3QNXB 3CFDB 4PRHA 3RL1A 4OT1L 3BZFA 3I6LE 3MUJA 5F6HJ 3AS0A 1N0XH 1UG9A 2IG2L 4MNHB 1A02N 1FP5A 4JGJA 4PIRF 3ZYZA 2YPVH 2IH3B 1I4FB 4PLKD 1IQDA 1GYAA 4WW2A 4KRPC 3VWJB 1WAAE 4HK3N 1A6VL 4ZXBB 4XP6L 1TPXB 3N1MC 4HMEA 4X6FA 3QEGH 2AKRA 3RU8H 1RZKC 2EKSB 1M7IB 2A73B 5D71H 3HI1B 3C5ZC 3HUJA 5TE4H 3IKCB 4MB5A 4JRXB 3U0PA 4LVHB 2DMKA 3UYRL 3DYMA 4MZ2A 3BH8B 3CVHL 4Y5VA 1HHGA 1S9YB 1ZE3C 3NFPB 4U6VH 2WLZA 1MQKL 5CJQH 3DRQA 4JPVH 5DSCA 4LP4A 2XI9A 1VACA 2VRAA 3MJ6A 3TF7C 3L7FB 4M6MH 1KIRA 1A21A 1K4CB 1SJHA 3T3MF 2YPLB 4NKDB 4MB3A 3G04A 4PD4J 2Y36L 5E7BA 2OXHA 4FXKA 4UIKL 1CDHA 5FXCH 4UINH 4KI5E 5KSAD 3P0GB 3TBYB 2JCCE 2XZQL 5IB5A 2X4QB 1GGYA 5SX4H 1F42A 3KXFD 1ROWA 3MJ8A 2B2XL 1HYSC 2PYEB 1A4JA 4O02H 3QZWB 2OSLB 1KC5L 2COQA 4K9EH 4D94A 1DBMH 4WEBL 2XFXA 3OR6A 4UILL 3UO1H 5IVXB 3RY5A 2NNAA 4R4FL 1WF5A 2VXSH 3BXNA 3HI6H 3IDYB 2F8OA 4DOHB 4LSRH 1CK0H 3H42H 3V6FB 2HKFL 1S7VA 3V4PL 3EHBD 2A6KB 1QO3A 3EOBA 2IALB 3PWLB 1NCAL 3B2UC 2F58H 1KPUA 2V2XA 1KCRH 3MXVH 4M5YL 2DQFA 2E6PA 3RPIA 3GSNB 4QHNB 5I0ZA 3RWDA 3I3BA 3TA3A 2E9BA 5C7XH 3W81A 4JO3L 3CDGB 4R4BA 3EJJX 3STLA 4HGWB 3HZMA 5JORA 2YD6A 4X8JB 5SX4I 1YN7A 4LSSH 3V4VH 2V7NA 5E8OA 3IJSA 5EC2B 4MAUH 3B2UD 5F9OH 1I1AD 1WC7B 4JFYA 1INQB 1D5MB 2DI9A 3PJSB 4X4MA 5D1XC 1PBYA 1JPFA 4OI9A 2VH5H 1NAMA 5KS9F 1DP0A 5JMRA 3I50L 5IM7A 3TJHC 4GSDL 1M4KA 4JFFB 4F7MA 2GHWB 1IGYB 4V2CB 4JM2B 4KJYA 5A40E 5E8PA 4X7EC 1CDUA 3RX7A 1G7MB 5C09B 3L3HB 4N8CH 4X6DA 3ZKQD 5BVJA 4ORGB 5HYEA 4XBEH 2K1MA 4M61B 4XNMA 3SKOB 1XGYH 2ITDB 4XAKE 4ZDHB 3TYGL 2EDXA 3DX6A 3DX7A 2AJUL 3HG1E 5E8NB 4PJ9C 2WANA 4MCZB 4WO4C 2WSKA 2DQTL 4JY5H 2R1WB 5ALCH 1QRKA 3NPSB 2Y1VA 2UWEA 3OKOA 1A8JH 1MWAL 4FQJL 2H9GA 4GAGL 5DJAA 4WI8A 2EE9A 4WHYG 4POYA 5GRWA 1CZ8H 5E5MB 2UZIL 5BJTB 4K3EH 1OAUH 4F9LA 3PWPD 5ILTH 2VITB 4LLVB 2PW1A 2Y6SC 1CDCA 5IQ9A 2FL5B 1P84J 2NW3A 5MEOA 4QXGL 4EQ3A 4JB9L 4URTB 2BCKB 2YOCA 3K46A 5DJCB 5JIHA 4JM4H 5CSZA 3MRKB 1PEZA 2ZUSA 2XTLA 5T5FL 5A2LH 4HPOH 4F57H 1NAKH 1K2DB 3D3VB 4HUKB 1T4KB 2H1PL 1J8HA 2CUHA 4ODVL 2WBJA 5IIEB 3UTQA 5TH2B 4IRSB 4N90E 3VGAC 2NTFA 4RAVA 3QR2A 5ADPH 1A6ZA 5KSBB 1H8NA 4PGBA 5D7JD 4OFIA 5HDLA 4N9GA 5C9JB 5JOPD 1KTLA 1KB5A 2AP2A 2PXYA 2X1PA 2DLTA 3NZ8B 3T0VA 4BK4A 3SDDB 3T8XA 4AH2A 2BY1A 2A6DB 5I1JL 3QUXB 3QP3A 1KPRA 1FFPB 1MPAH 3P4OB 3LB6D 3TBSA 3VDBA 1S9WB 4DN3H 3BP6A 5E1AA 3BKCL 4IIQA 3RZCB 3LAFA 4L1DA 3MNVB 4H1LB 5K9OB 4XHQA 4NN7B 1YNTA 4MA3B 1FE8L 2C3VB 1ZLWK 2R2EB 4ZNCD 1I9IL 1ZWIB 3WIIH 4QXTA 1OWWA 3ROLB 2DB8A 1GRWA 1YMMA 1DLHA 2EH7H 3BEVB 2QKIB 1NUFA 4XX1G 3QNYA 1IILE 4U0RC 4GG6B 1U8OB 1JI1A 5EC1A 1XH3B 1FL6B 3NFNB 3NMEA 5E6IA 2VLKD 1FC2D 3FHQA 3MLZH 4U05A 4MLSA 3RNQA 1YEJL 3OZ9L 1QBML 2XTJD 4XAWL 3BAEL 5HHOA 2E8ZA 3PDOB 5JUEL 5D93B 5I71C 3M17A 1AGFA 2RCSH 2Z31A 3F65A 3O8XA 4JG1H 3H9ZA 1EXUB 4P2RA 4NM8L 4X7CC 2Z8VC 4QCIA 5DVMA 3KPOA 1BGXL 5D7JC 3GKWH 3DUHA 1QFPA 1YYML 2ZCLH 3B8YA 3L5WA 1OQXA 2BMKA 1X5HA 3DV6A 4U1KA 3VXSA 1F6LL 2P8PB 3U79A 2DKSA 4HIJB 2J5LC 3NCCB 1CD1A 2ZNWA 5JW4R 4QYOB 4OZGA 2JTDA 4EUPA 3MROA 2JB5L 3GKZA 3JTTA 3AM8A 2O5ZL 5E08H 3MRMB 5JDSB 4G8GE 2OBGA 4YDIH 4PUBH 4P2YA 1FPTH 1LEKB 4M7LT 4PJ7F 4QKXB 3U2SA 1YPZF 2YUWA 3TZVA 2VDPL 1B90A 2XZCH 4LCWE 4WEMB 2G75A 4RDQG 1T2JA 3TPUB 2EYRA 2BVOA 1UCTA 3DURA 3TNMA 1CG9A 1EAJA 5B3JF 2BSED 1LK3L 1C12B 5D2LF 2EDRA 1V3JA 4BZ1H 4KZDH 4MAYC 5EBMA 5LBSH 1ZLSL 25C8L 1INDH 4OFPA 5T1DL 3DGCR 3O9WB 1T1ZB 4Y4FB 3SKMB 3RIAK 3E0GA 3VA2C 2BZDA 3GMMA 5E2TH 1MCOL 2F74B 5F8RC 4MZ3A 4XC3H 3WIFA 5GISH 1RI8A 4Y4HA 5HHXH 3HUJE 3IDUA 5DFVD 3QG7H 4FABL 5KAQG 1AJ7L 1L0YA 4OLYH 4KMLB 2D0GA 3C2AL 4H25A 5D1ZD 5D5MB 5M7QA 1DN0A 1A14L 1MRFL 1X5JA 2VMFA 1QLFA 2F54A 2EIEA 1Q72H 9CGTA 3UYPA 3SN6N 4JRXE 4RZCB 1EHLL 5DUBB 1LO4H 2VJXA 4X6CB 4K2UL 5I74C 2CMRH 2DBJA 2FD6H 2D2OA 4PV8A 1MCKA 3U0WH 3G5XB 1P4LB 2J8HA 4PRIE 3HR5A 2APWA 2BSSA 3TIDB 4LMQI 4TQEL 1MAMH 3OKDA 5ICZA 4PJBB 3HNVL 1ZS8A 1JWSA 4PBXA 1YECH 3HAEB 5C0JB 4PB0L 4F7PA 1M6OB 3DX9B 3RVXC 3CVHH 1FZJB 5JIPA 3AMLA 1WAAF 4WFEE 4MGXA 5KG9B 5DMIH 5I1HH 3LRHA 2NPLX 4WV1B 4X0KB 1RZ8A 3E3QC 1FYTE 4GOSA 1XCTB 4XI5C 3T0EA 2EEBA 3KPSD 5ISZE 1VPOH 2PF6A 4BQ8A 4LSVL 3MO1A 5CINL 2ITCA 3A6OA 4P9HL 3TZVC 4B41A 5I19L 3T09A 3FQTA 3WN5A 5D96C 4OM0L 1MIEH 2BVPB 1FZOA 3VFWB 1H15B 5EU7C 5DRZB 4UNTA 3AM8C 4LRNH 4OD1L 4APQD 1OSZB 1XF3B 4F15B 1A6TB 1HEZA 4IMLB 5I16B 3RI5K 5J4MA 3I75A 4HEPG 2VZTA 4PJAF 4H8WC 3INUH 5J12C 2GTZB 4H88H 4X9HA 4P59H 5D2LA 3NCEB 1UWXH 5DMJB 1TZGL 3IJYA 4D9RD 1ZHBB 4OLXL 2KH2B 3FN0L 2HJKA 3MCLH 4RIRA 2R4RL 3KR3H 5D7JA 1RHHB 4WCYL 4AENB 5E7FA 3H9YA 1IAKB 3O2VL 4OLVH 3OG6B 1TZHA 2MMXA 2YWZA 4M7JL 3WYRA 4M62H 5IG7B 1MIMH 2Y9RT 2W65B 5HI5D 3U7WH 3SE8L 1EA9C 4YHLL 3HI1A 5K93A 3LQZA 4CMHB 3KPNB 3FOMB 4KMTH 1G7LA 4F3FA 3BQUC 1CTNA 3EZ8A 4OFYA 3TT3L 5JORB 3Q3GB 1ERNA 2DBLH 1SMAA 3TBVA 3C9NB 2BHUA 2D03H 4WNQA 1QEWA 3SJVB 1YDPB 4ONFH 3U30C 1JZ6A 3BGFC 4NQCA 1U92A 3QDJA 4ZPVB 1QFUH 3CC5A 4IJ3C 4K94H 4QHKJ 4LFHD 3SE9L 1Z5LA 2C1OA 2KBGA 4XBEL 4U7KA 5KVFH 4TNWK 4XPBH 3EO0A 3KLHD 1MHCB 4JQVC 5MEQA 3NFSL 1RZKH 5DUPL 3S3PA 3RWCA 3SGJC 4H1LG 3WXVH 2KQNA 1MCRA 3WHE1 4MJ4A 2CIKA 5TGBB 4WWKB 3RUGA 4NJAH 1WIUA 5GSRA 4OLZL 2Z4QB 3RTQB 4XNMB 3RHWK 5BVPL 5TE7L 3S96A 1DL7H 5JHDA 5GS0C 2BRRL 5HHOD 1LP9F 4M93C 2VL5B 2OMBA 5FCUL 5C8JB 1CGSH 1TLKA 3U46B 1JV5A 2VLRA 3S35X 4QHLB 2OQJA 3E3QE 3C6SB 2RBLA 2VDRH 3CUPB 2DQUH 1DVFB 5IOPB 1IE5A 1JHLL 5F7EL 5A43C 1DEEB 1T89A 3IU4H 4C56D 4X4YB 5CBEB 1XF5A 4JRXA 4XP6H 4Q74A 4QRSA 4LLMA 4DQOH 1K9TA 3RHWF 3R1GL 4HGWA 2E5EA 4U1GB 2CDEA 2R4SL 4MQXC 3QQ4A 2PW1B 4MQTB 5IESL 3L7EA 3SDXF 2MCPH 4JFEB 3QCTH 1LK2A 4HUMB 1RD6A 4WUUB 2DJUA 3NAAH 3S98A 3B5GA 2R15A 5F3BA 3QQNA 5ADPL 5IBUB 3FT2A