3R06B

Crystal structure of anti-mouse cd3epsilon antibody 2c11 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
210
Chain Sequence
EVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWGQGTMVTVSSAKTTAPSVYPLAPATTNTVTLGCLVKGYFPEPVTVIWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTTVDLKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-mouse CD3epsilon antibody 2C11 Fab light chain
publication title T cell receptors are structures capable of initiating signaling in the absence of large conformational rearrangements.
pubmed doi rcsb
source organism Cricetulus migratorius
total genus 41
structure length 210
sequence length 216
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06B01
4S1QH 4PD4J 4EBQL 4JQVC 5C0ND 4I4WA 3BP4A 4J3TA 4N5ED 5F8RC 1XR9A 2CXKA 3I75B 2BRQA 3IDXH 2XWJA 1QLFB 1NANH 3QQ3A 4R2GD 3ULUL 3AS1A 3MA7B 1NBZA 1VFBB 3G5XA 4NZUH 1H0DA 3ESVF 2JTDA 2D03L 1V3MA 2FNBA 4OKDA 5FO7B 1INEH 3QNYB 4KY1H 4DAGL 5J56B 1Q9LA 4MNGA 2NW3B 1AXSB 1QSZA 3P9LB 4JHAL 4FQCL 4QY8B 1C7SA 3G6JF 1GGIL 3RDTD 1RSFA 5DWUL 2P5WD 4M3KB 2YD4A 5ANME 4RCAA 4C4KO 2GK0B 3AS3A 4WV1C 1G7JB 1RK0B 1GZQA 4POUB 5T5FH 25C8L 4G8GA 2DBLH 5DJ6B 3FCTA 4KHXL 4HPYL 2Q7YB 4PG9B 4C56E 3IFOB 5KSVA 4HK3N 1P2CB 3CSPA 3TO4D 3MROB 5BZWB 5F1IA 4MX7B 3OXSA 5D7IF 2AVGA 3CC5B 4NNYB 1CDBA 4XT1C 4OGAD 1RQ5A 1BX2A 4ODUA 3WFDH 4R4NC 2BHYA 3BH8B 1T04B 4X9GA 5JOPD 4RFEB 4WTZG 2B8OT 5F3HB 3OJDA 4KJYB 4PJXF 2APTA 1GPOH 4YHKH 4FABH 4TUOA 3VH8B 3GMNA 2LFGA 3FRPA 5E5MB 5DMGD 4HWUA 3QHZH 4PJ9D 5EBLB 2UWEF 3SCMC 4HKJB 4DJMA 1JHLH 4P2QE 3S4SG 3WFCH 1RHHB 4K3GA 2D3VA 5DJ8B 4H8WC 1HQ4B 4BFBD 4CDGC 4Y4FD 4OFPA 3V6OA 4R0LA 1QVOB 2B1AL 5GS1C 4JGMA 1H3PH 3B4NA 4JFQA 1J18A 5JTWA 3VFSA 1DUZB 4PTUA 1SJHB 1T80A 4F7TA 1KEGH 1QEWB 1JK8B 2JJSC 1A7PH 3ES6B 3H9SE 2WBJC 4PG2C 4TNVK 3QA3A 3T0EE 1EA9C 1D9KD 5FM8A 4CVXB 1KTDA 3WFEL 4P5KA 3UTOA 4GLRI 2OTWA 1AIFB 5HHPA 2P44B 2OX5A 3VI3E 4X9IA 5DD6A 4G80B 2CR3A 5BXFB 3WMSA 4FP8L 5HGHA 2JJTA 3L3JA 4K8RH 4QNPF 1PYWB 4HIEB 4MJ6B 1U92B 5GSRA 5C6PB 1B4JL 1S7VB 3AREC 3FB6B 3QXAA 2X40A 5DI8A 1RZ8B 2BX5A 2FD6L 5CIPB 2V9QA 2EXWD 2LTQB 1G1CA 4ZFFB 5SWSA 4JRYB 1XGYH 2D7NA 1KJVA 1U3ZA 3DBXA 4ODSL 5DK2B 1AGEA 2Z8VC 3QXUA 1F4YH 3QPXH 3L5XL 1NH6A 4NP4H 4HX1A 4P48A 1FDLH 4OF8A 2EDLA 3NAAL 4MNQD 3RHWF 3C08H 3TFKC 5E8PA 4F15C 2F5BH 2F8OA 3ZE0F 5L7XL 3L5JA 3HR6A 4WI3A 4PJ8B 3N1FC 4P9HH 1HHKA 3SBWC 5D1QB 1UJ3C 3ARTA 4BZ1H 3BH9B 3KR3L 3VMNA 2XXMB 3O4LD 4R2GB 1U8LB 2G5RA 3DLQR 1EAJA 1XF3A 1KTKE 1KV3A 2X10A 2RR3A 3VE0B 2PR4H 1TJIL 3U7WH 3HKFA 4HIJA 4WDIA 3OAZH 5T1KA 1XEDA 5IFAL 1JCKA 4C55A 3LPWA 4X4XA 3CFDA 3QEGL 1SHMA 3MSPA 3RDTB 4Z7UA 8FABA 3MX0A 2BC4A 2P5WB 5GRUH 1RAMA 2R1XB 1CICC 5DFVC 5GGQH 4G6KH 5EOCH 3DV4A 4M48L 3DVGA 5JO5B 5KVEH 3V7AG 4S1RH 5CD3A 2A77H 3FONA 1KJMA 4U1HA 3TO4B 2PO6D 3OKNA 2Y6SC 1ZLSH 3NA9H 4IS6B 1RFDH 3RWJB 5MEOA 4EQ2A 3MRNB 4XPFH 4Y4KD 5FCUH 1XF2A 2PCPA 4LCCB 3PDDA 5L0QB 5IVNA 1OVZA 3ULVC 1MCKA 1MJ8L 3DROB 5DQDL 2X1WL 3EBAA 1YEHH 4Q97A 4O9HH 3OKLB 4XRCB 3A67H 2EO1A 3WE6A 3FB7B 3GMOB 3ZKQD 2Y07L 1BQUA 1CFSB 4PJ9B 2W0LA 3GJEB 3GSWB 5CJQL 1OQXA 2YS4A 2V5RA 5D1ZB 5IHUL 1NJ9A 2DTML 1JPFB 4NHCH 4PGEB 2OJZL 3M45A 1K5NB 1L0YA 4EN3D 3BT2H 1DSFL 3WHXB 5F7EH 4RA0C 5CINL 5CZVH 3I50H 3L3IA 1QQDA 2IBBA 4HFUH 4JFOB 3VXQB 1B88A 5DK0B 2ZJSL 4LVOB 4QT5A 4ZG1A 4RX4D 3BZFB 4XAWH 4K3DH 3NZ8A 2E27H 3SDDD 4D9QE 3TIEA 1I8LA 5AZ2H 3D0LB 5FUZL 1ACYH 1U8NB 2W65A 3G6AA 3SKNA 3U0WH 4YIQB 1NAMH 2AXGA 3B8SA 1EO7A 4KMLB 4LIQL 5C08A 1XGRA 3O8XC 1CCZA 1ZHNA 4UB0H 1GIGL 3V7MA 4G9DA 5T1DH 1RU9H 4CBPA 4WU7B 5FKPA 1KJ3H 5KZCD 5HYSB 3T3ME 1FORL 3PWNB 1M4KA 5CP7A 2VLME 3MYJA 2J8OA 2EIDA 1BIIB 3DWTA 4ZOAA 4QEGA 4KK9D 5CGYC 2NY3C 4F9LC 3WNNA 1UEYA 1X5KA 1LO4L 4WEBL 4MD5B 3QUXC 1QHOA 1AGCB 1EEZA 3VXRB 1VB9A 4HH9B 3X3FL 5FO8A 4L8CA 1A4KA 4XNQA 1U8OA 5T33H 2BHUA 4TNWF 2FWOB 3L1OH 3P4NA 1DJSA 5C8JA 1FZKB 1I9JH 1KCRL 2ESVD 2ID5A 2NX5A 1JHTB 4P4KC 1LO2L 1HHIB 3B2VH 3FOLA 2M26A 3TBSB 1Y18B 4GRLC 4HWZA 5T5NG 4XC3H 4H25A 4XBEL 2Z91B 3GMMA 3O4LB 3KG5A 3D18B 4HKXB 5F1KC 2XZCL 4PJ5D 1H3XA 3NVQA 2HLAB 4WFEE 3H7BB 4HCRL 2V6HA 2F74A 5DRZB 5F9WB 4GS7C 1EEQA 3S97C 5DFWH 4P3DA 3QIBC 1BFVH 1EAPA 4GUPA 5F7DA 1EEYB 4X6CA 1CLYH 1UM6L 3HRZB 4I3RL 1HZHH 3T0EC 5JORB 3BZ4A 1J88A 2FIKB 3WUWG 3O3EA 2CKBH 2SEBB 4XMKH 1MWAA 4JR9H 5HJ3A 2O5XH 4D0CA 3WJLA 5ACMA 3GGWA 1FLRL 5HSFA 1DANT 1ITBB 1LHZA 4TN9A 4M1GH 5I76B 3MJ9H 3BWUC 3PHSA 2DQFB 4YHNA 4MQXD 3AU1A 3WIIH 1QACA 3N06B 4XP1L 1S9VA 1A7OH 2XN9B 4NJ9H 3KYOA 4LPUA 4Z78A 1N5YL 1NUFA 1L9MA 3DX9A 4K55A 4XZUA 2J4WL 4Y4KB 4JN2A 1QSEE 4LSVL 1KN2H 1EVUA 3VD5A 3FB5A 3VXPA 1EUTA 4GKZA 4PY8I 1L0QA 3T0DA 4WNQA 4PY8J 4OD2A 1K2DB 1UXWB 2ADFH 2F5AL 4LQFH 3MGTA 2X4QB 2VE6A 3P0VH 5GS0C 4NUGH 4M43L 5D5ME 2P24A 4IHOA 3QCUL 3C87A 3PF2A 4ZNCD 3NIGE 2VXUL 1WWCA 2WSKA 5IEKA 1W8NA 1QLRA 3FO0H 3O6MH 1C5DA 1VACB 4NWUH 5SWSE 1UZ8A 4EN3B 2R2HB 1PQZA 1INQA 2W07A 3OGCB 3UJJH 2EDRA 1MCBA 3WNLA 1JZ2A 1SJEA 1RZIB 1DANU 5I17A 2ZUSA 3QHFH 5IVXE 4OV5B 4OCLC 3LH2H 2GJZA 4H26B 4YDVA 5HYFA 2NY0B 2P5EE 3SKOA 5K9OA 1BLNA 1MIEL 5AG8A 1MRCL 3F12A 3EHBD 3CSGA 1GGYA 4U6VH 4HUVB 1MCOH 4EDXB 1KJ2H 3R4DA 4WWKA 3VFTB 4QRQA 3TM6A 4HUXB 2HFFA 4ZFGL 3WN5A 5E7BA 4L4TD 5KZCB 2HJFA 1WITA 3CDFA 1VADB 2HKFH 5E6YA 5SX5H 1MRFH 1DBAH 3MV8A 4X98A 2A0LD 5I9QC 2ZUVA 1JP5A 4JANB 4LL9A 1VFAA 4P9MH 5B3NA 5GZNC 1CG9A 3OJMB 4X9BA 3FQRA 1YEIH 5E24E 3N9GL 3U4EA 1JN6B 5DJXB 3I6LD 3CZFA 1P7QB 4J4PA 4JRXD 4HS3B 4PUBL 5I1EL 3P3YA 5T3XH 2R9HC 3LY6A 1VFOA 3HI1A 3OJVC 3RHWK 4TULH 5ADOH 2VDRH 2IALB 3DURB 1OY3B 1F2QA 3BYYA 4BK5A 1JNHA 3SEPA 2JIXA 5DUPL 4AIZA 4JM4L 4FQLH 4PLKC 4PP1C 5IW1A 4GG6B 4JFPA 4OLEA 2R2EB 1ZLUH 3L3DB 5F7MC 1KPVB 5DJDB 3BPLB 2YD5A 1R3HA 3IFNL 3RNKA 4RNRA 5E1AB 3QI9D 3BKYL 3CK0H 3RJQB 4PJ5B 4LHUA 5AZEH 1U8HB 4HGWB 5EG6C 4EI5D 4PIRF 4L3CA 4V2BA 4MDIB 1T5WB 3X3GL 2DI7A 2IQ9H 4NUJA 3I3BA 3MXVL 2VDOL 1HXMA 1ZA6A 2NLJA 4F57H 1LEIA 1DL7H 1FN4B 3GJFH 4ZUUA 4MHHG 5FM5O 1ULVA 2IG2L 3QZWA 3EO1A 3MV9A 3RVVC 4HUUB 3ZT5A 5SWZA 1EERB 4NQDD 4IOIB 5HI5D 4UTBH 1CD1B 4QTIL 1CR9L 3CLFL 1T2XA 2H9GB 4OZFG 4XP5L 1HXYA 5MEPB 1N3NA 5INDB 4NWTH 1CQKA 3ZL4L 2A9ML 3MFFA 1DBML 1F8TH 3B83A 4JFHD 4Q9QH 4U1JA 5CEYA 5C0CB 1NBQA 4PJEA 3HR5B 2EIZB 2EYTB 1HILA 4KKCC 3LB6D 4H20L 2O5ZL 5E8NB 5CBAB 1AJ7L 4RZCB 1EFXD 1MHEB 1IAOA 1CN4A 5F21B 2DLGA 2Z35A 2OMBA 1U3YA 2AK4D 3RIAF 1TZHB 3S5LB 1JFQL 3KJ6H 3TT3L 5JQ6L 4GQ9L 2H26B 2J1KA 5FYKU 1YEJH 5JNYB 5D7LE 2QHLA 5M95B 2FX9H 4EVNB 4NZRH 2DIBA 1EHLH 4WWID 3VXSD 3HMXH 4MS8D 5IHBA 3GK8L 1V3KA 1NFDA 1IT9H 3MLXL 2CQVA 4XPHL 2Q86B 1CXHA 1MCLA 5KVGL 2Q76A 4P5MA 4ZO8A 3GSOA 1KULA 4NO3A 4F37F 1I4FA 1BZ7A 2AJ3A 4HIXL 5MHSD 3DMMD 4I3SL 4NQVA 1NUNB 4XX1G 1NDGA 2NX5E 4XXDA 5EBMA 4DOHB 2X4PB 4UINL 2G2RA 3FMGH 2I60L 4GKOA 3QDHA 4Z95H 4YDLB 4YX2H 2KZWA 2H32B 4IJ3B 1FCCA 4HDIA 1RZGB 3VG0L 2YEZA 3DJ9A 5JHDE 3BSZH 4QHUA 5JR1L 4YHPB 4IRZL 4WUKH 5EU7E 4W4OA 4ZDHA 2CD0A 3K2UH 5C0GA 4L4TB 1ZS8B 5I66A 4LVNC 4MGXA 1IM3B 3NABH 4YHIA 5J7CC 2A74B 4X6CE 3RVWC 4OI8A 1T7YA 1CBVL 5EU6A 1M6OB 1KIUA 4RFOL 5H94B 2JK5A 5DHYA 2PW1B 3QQ4B 2AEPL 4UZGA 4I48A 3MRMA 1PEZA 1A1MB 5HHXH 3QCTL 4RGMB 3JV5A 1DTUA 1JPGA 2V7NB 4ODTH 1YN6A 4ORGB 3UX9B 1MI5A 4XVSH 4TNWK 4JRXB 1XF5B 4YHOH 3CDCA 1QNZH 1PX4A 4UTAH 4L29B 4XVJH 1NAMA 4HT1L 4F8QA 1U8IB 3F5WA 3JWOH 2GEEA 4JKPH 2AQ2A 4B7IA 1J10A 3C6LA 4KRLB 3QI9B 3ZO0A 3BAEL 2W60B 2VN7A 3DUHA 1UWEL 1HHHB 1F4AA 1IEAB 5DD1L 4CUCA 5CEXB 5IV2A 4ERSH 1R5WA 2OR8A 5F70A 1W72A 2GQHA 4DQOH 3RVXD 3FQNA 4XWOC 1ADQL 1DQML 4UAOB 1ZWIB 3IAGC 1ETZA 3D2UA 2CRMA 1J8HD 4JPIA 3GIVA 2E6PA 3ILPA 5DUMH 3MBXL 4XVTL 4PBXA 2A6IB 2F19L 5J6GB 1KBGH 3FFCB 4PJIF 4P2RA 1JPSL 1YYMH 3PJSA 5IOPA 1DQDL 4OV6F 3HNSL 2ARWA 5IKCB 4M1CD 4CADA 2WM0A 4H88H 1Z0MA 5TPWH 3D25B 3O11A 4M5YH 5GRVL 5E2WH 4KKLD 3RZCD 1VSCA 2X4TA 5DD5H 5H35A 4JZJA 3VXNA 4NCDA 4Z0BL 2D2OA 5D7JC 5CCKL 5I8EA 4OQ1A 4LSUH 5C0AA 2Y5TB 2AK4B 1K6QL 1YQVL 2B2XH 2Y4SA 4F3FB 1T7VA 1JVKA 3HI6L 2HRPL 4U0QB 3QDMD 2LU4A 5A16B 1JMZA 3QBTB 4FQXB 3FN0L 4N9OB 4AEIL 4LRNH 3MJ8A 2NY4D 1H5BB 1M1SA 2P7TB 5A2KH 1F2XK 1FL6A 3WJJA 3T1WA 3T3PF 3MJ9A 3AMLA 3C5SB 4JHWH 4GG6F 1BM3H 3DMMB 4GG8A 1NLDL 1RJZA 2BNQD 2FECL 1BWWA 2DDQL 3DHMA 3PP3K 4X5XA 2UV3A 4LEXH 1BP3B 2JB5L 3LQAC 5JPNA 2P49B 4IRSB 2CDEB 1S3KH 2DQEH 2YK1H 1VPOL 4EUPH 3GBMH 3QUZC 5IHZA 3R1GL 4GRWB 3ZYJA 3MRCA 2QR0B 3DPBA 2CLVA 5FIEA 2N7AA 2WINB 4JY5L 1NGPH 2R23A 5HGAA 5IWLC 3HMWH 5DDHB 3SPVA 4JY4A 5JW4R 5EOQH 1RZJC 4XXCA 1AXTH 2CK0H 3T0XA 4NQCA 2VSDA 3JWNC 1T21A 5E8OB 4OT1H 3MRKB 4QHLA 4N5UA 2J7LA 4LLQA 1KTLB 1RI8A 3E2HB 5F89A 1BQSA 1HWGB 3QNXB 3EJZC 4XCFL 3IDJA 3IF1A 1N8ZA 3OKOA 4QXTA 4Z0XA 3V95A 1YEEH 1YMMA 3BHBA 1J05A 3QEUA 1S9YA 2RJMA 5D6CA 2E7BA 3VXUD 1P4LB 1HHJB 4Y5YA 1FZJA 2VLRA 4JM2A 1UADC 4UT7H 2WUCH 2UZIH 5D9SA 3KYKH 5D1XB 1KJ2A 4C4KT 5HGGS 2DQDH 3S98A 3ZTJG 3HLAA 1U95A 4QOKA 1FYTD 4IRJD 4LCIH 3X17A 5CJ8A 4OGYH 5I6XC 2VJXA 3VXTB 4TUJA 4XP4H 3A6CL 1XCTA 1BFOB 2DIJA 4HJ0D 2BVQA 3PNWB 4LPCA 2VLLA 2Y36L 3KPPB 4D3CL 5CGMA 1P4IL 5BQ7A 5IBLD 1EXUB 2K7PA 1NFDE 3BRFA 1WV7T 1RUAL 1J8HB 3NIDE 1LK3L 5CSGA 4OCSH 4U6HB 3MLRH 3DV6B 6FABL 1XIWA 4U1KA 3TV3H 3LDBC 3TH3T 5I1IL 1I85A 3BUYA 5L88L 5TGBB 4YLQT 4KTEL 4KUZL 5ENWA 3VU2A 1KYOK 3UTTA 3DO7B 3O45A 3KPLB 5EC1A 2CKNA 2GSIB 4OB5L 4E5XA 1J1XL 3CCHB 4ZXBD 3GMPB 4WY7L 3EOTL 1W0WB 4WI7A 5I0ZA 4M7KH 5EOTB 3RZCB 2FRGP 1T89C 2LU3A 1DR9A 1PY9A 4MD0A 4OLVH 3BVNA 3O6FC 1FNSL 5IVZB 4P3CH 1AP2A 1KCKA 2EDYA 2FYYB 3CXHK 4X0KA 2VH5H 3RIAK 4A6YH 5C07D 2HJLA 2JELL 2C1PB 5ACLA 4RDQF 4OLXH 1MF2H 5EU6E 5B39A 5IFJB 2R69H 5GRVK 2GW5A 2BNUA 4O4YH 3Q1SH 1FAIH 3T04D 1E4JA 1GGTA 4O00A 5GGRA 1LDPH 1OW0A 4KRPC 1MI5E 3ARYA 5JLZB 4F37K 5IVOA 5BS0E 5ICZA 2VLJD 1KCUL 4XBGA 5JW5B 3FO1A 1F6FB 4PY7B 1E6JL 3V6FB 2DAVA 1RUML 1MAML 5LAXA 3RBSA 2BNQB 3PL6A 5GRYA 4I0CC 1T2QL 1WJ3A 2GFBB 1T2JA 4PJCB 4ZFZB 1MJ7L 3QXDB 2EDBA 1WCQA 3H2WA 3IETB 5H37G 3VJ6B 2J88H 3AB0C 3I2CL 6CGTA 2LAGB 4KXZI 5C92A 1H3UA 2BOCB 3DYPA 4PJDE 1T3FA 5GGUA 5ICXA 5C86A 1ND0B 2YXMA 2YKLL 3RL2B 5MENA 3WS6C 1IEBA 1AO7B 4OQTA 3R0NA 3TCXA 1I8MA 4LP5A 4UILH 2W1NA 1EFQA 3BN9C 4Y16A 1S7RB 1F4WH 4WW2B 2HVKB 4YPJA 3TZVA 5DSCA 3AVEA 3LN4A 1YEDA 4KDVA 2PW2A 4PS4H 2AEQH 3PWVB 4I0PD 2E9BA 1OGAD 3HE6C 3VRLF 3AS2A 2PYFB 3V79C 2G5BA 3JVGC 3NZHL 4R4ND 3OKEA 1R3LB 4JDZB 4OGZA 1FNGA 1MNUL 5HYEA 4Z7OF 4K7PL 1CXLA 1LO0H 3CVHL 3G9VA 1SBSH 4X7TA 1GC1H 4GT7A 1OTTC 4Q74A 2FB4H 3BIAX 1WCBB 5BVJA 5TDPB 3F7YB 1FYTB 2YPLA 3MLYH 3VWKA 1XCQA 1S5HB 1DN0B 4Z7VE 4NN7C 5BJTB 5KN5A 2C7UA 5TE7H 3LS4L 4P57A 1WAAE 3GUTB 1PSKH 4Z7UF 3O9WD 3U6RB 4HK0A 4P49A 1PG7X 4JFDD 2JJVA 1M71B 4G6MH 1U9KA 5GHWH 3VXMB 2GK2A 2EYRA 3M1BB 2XXCB 2MFNA 5F7LB 5I2IA 4X98B 3HE7B 1KIPB 3MOQA 2DQJL 1KEMH 4R7DA 2CRZA 2WBJD 3RY6C 2VKXA 4G8EB 4WEUD 4FOMA 4OF6A 5KW9L 5E5UB 3QEQA 2LU7A 3D3VB 4K8RC 4UI2A 3U46A 5CEZH 1VEOA 4GRWF 5A40E 1IGTB 1ONQA 4RBPK 1AD0B 4ZXBB 3L7EB 5F72S 2XKNA 3QCVL 3DX6A 5C6WH 3DXAD 3EYSL 3P4LA 1EO8H 4UDUA 1I1AC 4KHTH 4IEFB 3KWWB 5EO0B 1SJXA 3T09A 4LHUB 3GZKA 2X1XR 4R26L 2XA8H 3JSSA 3T65B 5C07B 2RFXA 3TBVA 5KTEH 1QFWI 2CRYA 3QDGD 3SDCC 3BGFB 1OP5K 2X6MA 3PQYA 3RU8H 2E8YA 4JFEB 5FB8A 3NGBB 1RIHH 2XFXB 4S2SA 1IKFL 3KAAA 3VGBA 1FRGL 2HTKC 3MV9B 5IG7A 4P9HC 3LKRB 5ACZA 3BGAA 3BRDA 2FLRT 2ARJB 1IM9D 1HYRC 3NFSL 2BHZA 1J1OH 1J1PL 1D6EA 3B6SB 2VLJB 4YAQB 4HWBL 3TFKD 3WEXA 3O3BB 3TH2T 3REVB 5I15L 1YMME 4YQXH 3U0TB 4P2OC 5D2LA 2IAMD 1LDSA 3U82B 1ZLVK 4JPKL 4JHBA 4L3EA 5DC4B 2VLRE 4KU1A 3LVEA 4FFZH 3OPZH 1A6WH 2BVEA 5FYLD 2DI8A 4AENB 4L1DA 1KLGB 1XGPA 4Z7QF 1CGWA 1I9EA 2OMNA 4OCRL 4LBEB 4QOKE 4MJIA 4FZEH 2AEIT 3OR7B 2C26A 4XBPA 4X7EC 4KROC 3V6ZA 4PGZA 5HYJD 1A7BA 5JHLH 4MDJB 2RIKA 5FUOH 2AW2A 3NTCH 1IC4L 4WFFD 4MXWH 2BMKB 2OCFD 1IGFL 4NRZB 3MNWA 4LU5H 3QFJB 4WV1B 4Y2DC 5DFVD 4YUEH 1FNFA 1MCDA 3TA3A 4YZFE 3QUKA 4ODBD 4XNYH 5SWQB 4M1DH 5TFSL 2I07A 3WXWL 5T3XE 4YHMH 5HGDA 4HKBA 1U8KA 1OGAB 4HXBH 1CFQA 1BJMA 4PR5B 1FVCB 2WQ8A 2Z4QA 2B4CH 5H2BA 2Y6SD 2ZOLA 2ZSVB 1NDGB 2W0PA 4M7JL 3H9ZA 1ZA3A 4LLWB 1TQBC 2FL5B 1FV1B 5C9JA 2C9AA 4XPAH 3ULVD 1KPUB 4EUPA 1JUFB 5TE4H 3HCVA 5C6TL 1BQHG 1ERNA 2CMRL 2E9JA 3RWDA 1KIQA 4WI2A 1NCAL 2VKWA 3CFIC 2X44D 3IFLL 4MCZA 4Q7DA 2FDBP 5IT2L 2PTUA 3RUGA 1XGUA 1FFNB 3VMOA 4MMXC 1NC4D 2DYPD 3SCMB 4BA8A 5CKAA 1EO5A 4XPGL 5C2UB 4K9EH 2HJKA 2YD2A 4ODXB 1MAJA 4YHIB 2R8SL 2P48B 4AIXA 1WWAX 1JF5A 2ATKB 5GS1B 2XTJB 5J9PA 1T22B 5CP3H 2IC2A 5EWIH 3TT1L 1UYWH 4FQHB 4N0CC 4D0BB 3TJEL 5LWYL 3PV7A 2B1HL 3UYRL 5J11C 1D6VH 2WBJB 1P5VA 4ZYKA 1KGCE 4OZIA 3MZTA 2OS7A 1UFUA 5KSAA 4QRSB 3ARGC 3FJTA 32C2B 1NLBL 3FRPG 4X7FC 3X11B 1JYVA 4OLZH 3IB4A 3RVUD 3PWJB 1UEMA 1A3QA 1S7UA 2YWYA 3O8XD 1CE6B 2P42B 3DXAB 4GRMA 3MRHA 5ISZA 5EA0L 3U9UB 5ALBL 4H0GA 2FEDC 2NNAA 3EFDH 4HV8B 2FGWH 5I30L 3TWCH 3AREB 3KPNA 3QDGB 4WW2F 4C56D 2A6KB 2X4SB 3REWB 2Y72A 4H1LH 1IGJB 4JFZH 5E6IC 1T6VN 5HXMA 2Q7NA 3QUXD 4R96B 1UB5A 3R8BB 3VD4A 1FVDB 3WIFA 4NOBA 3TLRA 2IH3B 1MLBA 2BY0A 4XP9H 3GIVB 1C5BH 5DD0L 3MUHL 4LFHG 5K9QG 3NCFB 1SBBA 1B0RA 4F15B 4P5TA 5KOMC 5DD3L 2BOBA 5C09A 3RL1A 4GRLD 1UJ3B 3MCG1 1KNOA 4JVUA 3T8XB 4P2QD 2OZ4L 3VG9C 1BGXH 4GW1B 5FM5M 4TPRL 1I9IL 1HH9A 3SGJC 1FGVL 2H3NA 4X9HA 2GT9A 5IMKB 4A6YA 1B90A 1MFEH 1WC7B 3IDIB 1QR1B 4Z7WE 3CUPA 5IEHA 4JY6B 2PETA 4L8DA 5DHXB 3CX5J 1CGSH 1E4WL 1NCWH 1PVHA 1B2WL 3H9SD 4I18C 5DMJB 2VDLL 3T0ED 3FT2B 1CE1L 2VXSH 1YDPA 4RFNC 5D2NA 2JKXA 3BEVB 4DGVL 1CICB 2H45A 3CDGB 4HGKC 2VDPH 3WS3A 4M6OH 1HI6A 4ODVH 4M9PA 3T2NH 1XGTB 5E99H 4KMTH 5HPMB 1WEJL 1K8IB 4HBCL 3QEQE 4F7MA 3LQZB 1ZXQA 1AD9A 3KYMB 3MJ7B 5GGVH 1JGDA 5D4QA 2FX7H 3V52H 5GRJH 3DUSB 3NN8B 1CDUA 2VAAB 3TF7C 3LAFA 1OP9A 5DHVH 2XIDA 4Y4HC 4DW2L 4J1UB 3MRFA 3OR6B 5GGSA 1YA5A 2NY7H 4OGXH 5DMIH 5GRXG 2HT2C 1FJ1B 1FFQA 5GS0D 2NY6C 4PJFA 4LSRH 5FA3A 4AM0B 2ICEA 5F96L 2DYPB 2ENSA 1I9RL 2CLVB 3MZGB 1JGUL 4JAMB 4YDJA 3DRQB 3L7FB 1DEEA 1QO3B 5EFIB 2V7HB 3PWPE 2ZWLT 3FAWA 2VOTA 2X70A 3ZHDA 4KI5C 1TZGL 2DQTL 1FO0H 2XTLA 5J8OA 1CFTA 1AFVL 4Y5YC 2ED7A 1QLEH 2APXA 3G5ZA 3WIHL 3L3KA 1EUUA 5D2LE 4OZGB 4N8CL 4PJEF 5SX4I 1G7MB 3OTTA 3S36X 4G6FB 3TNMA 2PYED 1OAZL 3B3IB 1SEQL 3LKQA 1IAKA 1QBLL 1KYOJ 4F2MB 4XMLH 3O8XB 2QQNH 1A2YA 4MVBC 3UTQB 2VLKE 4PRIE 1I7TB 5ID0B 4TSBL 3EJJX 2E7LA 5ANMB 1F90L 5HI3D 1AHWA 4Y19A 4X80L 2GJ6E 4J23A 4ZTOH 5DVMA 4WHTA 4PGBA 5DS8B 2D03H 4C56B 1KB5B 3CXHJ 4LNVA 4UNUA 1UWXK 2NY3B 1LO3L 3V0WL 2D7TH 3L6FA 4IMKC 4NJAL 3JWDH 4JHAH 3QUXB 4FQCH 5GZND 1CFVL 4BFEA 2DL9A 1Z3GL 4Y8DC 5DWUH 2FCBA 2GY7B 3B8YA 2V2XB 1QZ1A 4DUVA 1GGBH 5JMOC 4GAYA 3W11C 1WFUA 3P11H 1TENA 3HPJB 1MCWM 4P4KB 4JZNB 1ZANH 3BWAB 4PLKD 4PP1D 4FQJH 2FATL 4P46C 1KT2B 1I8IB 1DDHB 3MQIA 4OI9A 4GRLB 5CUSL 5L2KA 3MLSL 3IGAA 1QOKA 3HS0B 4P2QB 1ZT1B 5I1CH 4TVPH 5E00A 3DX7B 1SMOA 3LKPA 4GS7B 3IJSB 1NGYA 2NXYC 1X5GA 4ZFOA 1L7TL 2OL3A 5KS9A 5FOBA 3QIBB 1NSNH 5I71C 2EIBA 3H3KA 3RVVD 1FPTL 2IBZX 1R3JA 3PV6A 4FG6C 3IJHB 4POZC 4XNMA 3U7YL 3T0EB 3WXVL 4JREC 1KG0B 4D9QD 1TITA 4M02A 3UPRA 5IB2A 3ZKMD 2JCCA 4OAWA 3SDAA 1BZ9B 2YD1A 4PB0H 4NCC1 4XC1H 4GAJL 2XWTA 3T2QA 4OSUL 2B1AH 4BQBA 4OKVA 1ED3A 1EX0A 4OZIE 3HNVH 3CLEH 4PJGB 2XWBB 2M8XA 1I3RA 3PGCA 2GSGB 4O02L 4NN6C 1JNJA 4KKCD 3BD3A 3U2SA 5HY9A 1NCCL 3V6BR 2VLMD 1YY9D 2D31B 4IDJH 2VSCA 3MFGB 3CJJA 3WFEH 2H8PA 2FHFA 4NO2B 1PX3A 4Q9RH 5ISZE 1JRHI 3Q3GB 1HSBA 1MFDL 1U41A 2BZDA 4MSWA 2MWCA 4P3WA 1KCVL 3RWFA 5FO9A 3BP5A 1QFUL 3FOMB 2HFGH 1VEMA 3MRGA 4BK4A 1T3FB 5B4MC 3CSYB 2DICA 3EO9H 2EYSA 5BRZB 5I16B 5HYQB 1B4JH 4HIHB 1G7QA 3RWCB 3TO2A 3SJVA 4ZSOE 4LLMA 4Y16B 4M61B 2VR5A 2Z92B 4PLJD 4NKIL 1WICA 4B41A 4Z8FL 1FNLA 4HAGA 3VCLB 4OZHA 3UCRA 3QWQB 1HYSC 1F5WA 5CILL 4WFED 3X13B 3VWKC 3MOAH 3H42L 1FZMA 5C09E 1ZEAH 3K4ZA 1WFTA 4JGUA 3RTQA 2PYEB 5F9JA 2WBWB 5JZ7D 3LZFL 1F6AB 1OAUL 1IARB 1DBBL 1C12A 4OM1L 1MCSA 3CAFA 3GSUB 5IMMB 4OCWL 1DLHA 2MOVA 1BBDL 3WL9B 1U3JA 4YC2C 1TVHA 1KELH 1X3DA 2YPLB 1X44A 3VWJA 3H6JA 4BFIB 2ERJC 5KN5B 1MCIA 2GCYB 2DL2A 1O7SA 2VQ1A 1CVRA 2R0KH 1F3DJ 1X5ZA 5I9QB 4TUKL 2W9EL 5CP3A 4NGHH 5A2IH 2F54A 2DQUL 3TYFB 4BH7A 1RIVL 5DEFB 3JWOC 4BUGA 1XF4A 1N2RA 4D8PA 1QSED 3QEHA 4H8WL 5F3BA 4QGTA 4X6EA 3QH3B 1DQLH 5MEQB 2HFEB 2G75A 4L4VB 1U3HA 4F7EA 5KVFL 2VDKH 3MLTB 3G04A 2YHGA 1A6VH 2CIIB 1CGTA 5D72L 4HW6A 2A6DB 2AGJL 2BSSB 4HBQA 1URLA 1N0LA 5SWSD 2FR4A 4KV5E 3GRWH 1II4E 3PGFH 4I77L 2MCPH 3T2PA 1VFMA 3V0VA 3E3QE 4PP2B 3GHEL 1LP9E 4P23C 1MVFA 1MCQA 1QUNA 1X5IA 2PXYA 3I6GA 3VGHA 4XWOD 5BV7B 1WGOA 2VMFA 3RWIB 1N7ML 3OAUL 2IEPA 4PJBE 5IG7B 2P5ED 1RURL 3JV4B 4OZGF 3EFFB 2BVOA 3HZMA 2Y7QA 4KXZH 1YNTA 2OR9L 1NMBH 2ZSWA 4ODHL 2OP4H 3GSXB 5FYJU 1IQDA 3SGKA 4BSJA 2YOCA 5ILTH 1PLGH 3GFUA 1ZT7B 1HQRB 2X4RA 4XCNB 2QLVB 3UO1L 2LVCA 4CNIB 4ZAKA 1JI1A 1S8DB 4JM2F 5GJSH 1BQHB 4OJFL 1JHKL 3INUL 5DGRA 1JWMA 3C09C 5DJYB 5EIIA 1Q9KA 5ITFA 3BKML 1MCPL 2IADA 3H9HB 3WFHB 3I02A 4LIQH 4JFFB 4Y19E 1E4XL 2ZUWA 35C8H 5AAWA 4OF5A 1U2HA 2Q8BL 3C5JB 3GIZH 5JIPA 4O2CA 5FYLL 3F58H 2UVEA 1FORH 5GS2H 4MQTB 2X9WA 1I7RA 5IW6A 4K7PY 1K85A 1XAUA 5DQJB 5TF1H 3H8NA 3ARFA 3OXRA 4MWFA 1INDH 2EZ0C 3GMRB 3MMEB 3GMLB 7FABH 3GO1L 1F11A 4FXKB 5HTSA 3JTSB 1T0NB 3MACH 2FO4B 2X4OB 1WBXA 4OFYD 5DR5L 3LHPH 5I8KL 4PJ7A 3MLWH 3CDYA 5CEZE 2R4SL 1LK2B 1U8KB 5IB5B 4JCLA 4APQA 1IGML 4ZODA 3MNZB 3TNNA 3VFNA 3LRSB 5IMOB 4PRNA 5TE6L 3T0BA 1N4XL 1OAQH 3O41A 1CTOA 5HVGB 1RJCA 5KVDH 1VKXB 4M7LH 5F1SA 3BXNA 5DLMH 5C2BH 5KS9E 1SM3L 4ZS7L 5IQ7H 4MCZB 4LVNB 2F58L 2J8HA 1T4KA 5T1MB 3QULA 3MO1B 1JNLL 4RIRA 4HCRH 4UNVA 4O58H 5L6YL 3ULVL 5I74C 1OAYH 3UJTL 3D69A 4MLIA 3L3OB 4FNLL 1AKJD 4OZFH 3UEZA 2JCCE 4L4JA 1FO0A 4FTVD 2WV3A 3G5VA 5DZOA 4N0UB 4PJGF 3ZT6A 3RJDA 4URTB 5EO9B 2E6QA 3EJZD 1QSEB 4JJ5A 2RQ8A 4I2XA 5JXEA 2Z0BA 1A6AB 3BPNC 4MB4A 4ELMA 2G9HA 5FGCE 2ATPB 4NPYB 3RWHA 3F7VB 1A4JB 4E41A 5D5MB 2FJFB 3P4MA 4OFKA 4NOFA 1BVLB 2HN7B 3L95A 3CU1A 5EH1A 1C5CL 3H3PH 3MREB 5D7LD 3VRJB 5K9QI 3MUJA 5DEGA 1AQDB 5L9DH 5E5RB 1J5OL 4YHLH 4K94H 5KG9B 5C0RH 1JGVH 1X6NA 1PG7H 5FKAB 4HS6B 5TDOA 4Q6IA 5JPMA 2FEEL 4YH6A 3PWLB 4HEPG 5L2JA 4UDTA 5AG9A 1KCSH 1VGKB 4M43H 3QCUH 3GBNL 2NX5D 5IVXB 2X7LA 4CMMA 2XY1A 3SJVE 1KFAH 3FAXA 4N5EC 1IJ9A 1V7ML 3W0WA 1D5BB 2BSED 2I26N 2P5EB 3AY4A 4OZHE 4OBSA 5E2VL 4YEEA 4NQEE 5JHDD 1HHGB 3QIUC 1KB5L 1JWUA 5EO1B 4ZUTB 4BKLA 3HPLB 3TIDA 1DE4B 1AGFA 3U36B 4WI8A 4LKCB 3MLVL 5IJVA 3AS0A 1OTSC 1XH3A 4GXVH 5D7JB 1A1NA 2UZXB 3QIWC 5IQ9B 4M6ML 4G42B 1NGQL 3V4UL 4DK6A 3GNML 5E9DA 3S9DB 2JB6B 1YYLH 1OM3H 4JG1H 4L8SC 4OGAC 2F54E 4WW1B 1FGNH 4WJ5A 3O6LL 1J0YA 3DI2B 1YDPB 5DRNB 4KRPD 2DLHA 2YBRB 5FOJA 1OL0A 5E4EC 5K9JH 2FO1A 3WS3B 1U58A 1BD2A 2JF1A 1M7XA 5E8DL 4B50A 3D6GA 3MXWL 4AG4L 4PUBH 1VCAA 3E3QC 3KYNA 5F1NA 5ITBL 3V0AC 3QUZB 3QJFB 4Y4FC 4NDMA 4UMGA 3FQUA 3UZVB 4K2UH 4ONGH 1P9MC 4PRPE 3IFNH 5DRWB 1F00I 3VFVA 1I1FA 3T4YA 4M62H 3MRBB 1IGCL 1WZ1L 4GOSA 4S1DC 4NHUA 3AXLA 4ONFL 1HDMA 4LF3B 3UBXA 2VDQH 2OI9C 3MXVH 4EXPX 2DM4A 3BN9D 3L3HA 1D9KC 4DN4H 4D0DB 1AKJB 3HAEA 3T77A 2AJZB 5GS0L 4FTVB 1UENA 5EZIL 1A7QL 4YWGL 2W9DL 5DT1H 2X1PA 1GC1C 1GJIA 2GTZB 4QTIH 3HE6D 5DTFB 2DMBA 2VWEC 3CLFH 4WWKD 3QWOB 3Q5YA 3CD4A 4XP5H 4PRAA 1FG2A 3HFML 4Q2ZB 4JG0L 2G60L 3JTTB 3IVKB 4XP6H 4V1DB 4XCCL 4TTGA 3VGEA 4O51A 3ZDYF 3UC0L 5J1TC 3BJLA 3ZE1E 3G6JA 4HQQL 4DGYL 3MBEC 5D7LB 1P84K 1IAKB 4DVRL 5AYQA 3B9KC 2K9UA 5I1LB 2AI0L 2XQBH 5CWSB 1A1OA 1R24A 5I6XB 2ZUUA 2CJUH 4AEEA 1G9EA 3PDGA 1P7KA 1S7QB 4U1MB 5I1DA 1LE5A 4J4PD 1R5VB 4KDWA 1CL7I 2DLFH 1YEGH 1NC2B 1YNKH 1G6RB 5D7IA 5JQ6H 1JBJA 2JIXD 1DBJH 3PP3H 3OG4B 4LLUA 5FHBL 3PDOA 5DA0B 1MAKA 3LDBB 3QRGL 4FQ2L 1D5MA 2VDNH 3WCYA 5KSUA 3IAQA 1CDJA 5JHDB 2X89A 2IGFH 5H8DA 3O2DH 4XPHH 2VR9A 3EYVB 4PJ7E 5KVGH 1A7NH 4WI5A 4R4BB 3CFEB 4K8RD 3TBTA 4Z77B 1JL8A 3STLA 5I18H 1IC7L 2BNRE 3IU4L 4BH8B 2DF3A 1WIUA 4JKLA 1KIRA 1QRNA 4TSAH 4UUJA 4KUCF 1I1AD 2GJJA 3O6FB 5ECJE 1UWGL 1S7TB 3GRWA 3RUGF 3VG0H 4U1NA 3NFPB 3BIBX 3SDAC 4IRZH 43CAA 3N1MC 2IANA 2Y23A 5B8CC 4ORZC 2R0WL 1X5AA 2ZPKL 5DXWA 4R4FL 1QSFB 2PO6C 1NFIA 3FHQA 3DNKA 3GBLA 5AYUH 1UA6H 3R06A 1FE8H 4JB9L 1NEZB 2VABA 1UQSB 4KRPB 5JQHC 1TPXC 4HJGA 5FCSH 4LEOB 4I2XE 4WUUB 3HC3L 3SDXB 4YPGB 5F44A 3CFKA 4G9FA 1MY7A 1V8HA 4YGVA 4P2OD 5FV2A 3O6KL 2P8MA 1MCJA 3FN3A 4WO4C 3QDAA 1JV5B 2YC1A 3GSQB 2CDFB 4PJHA 3F7RA 2XQYG 4QRTA 5T1LA 3ZTJH 3HG1E 1IL1B 3ECBA 5E8EA 3AB0B 5KAQG 1K4DB 4CU6A 2XQYK 3DECA 4GBXC 4R8WL 4FMFA 1NBVL 3H3BC 3I9GL 4KROD 5CZXD 3BOVA 3WNMA 5GGTL 1RULH 3BAEH 3K81A 2WLYA 4OTXL 3EYFA 5TH2B 5CHNB 1I75A 5SX4H 5ADPH 5IESH 2B4CC 3L5WA 4Y2DD 3WV0A 3V7AE 4X8JA 3LS5H 1MHPH 2ICCA 4JPVL 5D71L 4F58H 1ADQH 1DQMH 2A1WH 4LCUB 4N0FB 4WRLA 5C0IA 4QRRA 1UVQA 2XACC 2YXFA 3DSNA 5EU3A 5EDXA 2BJMH 1JGLH 5IIEA 3HE6B 1BWMA 3H0TA 5B22A 4OBRA 1LEGA 4YR6B 2VUYA 3C60A 3U0PB 3WSQL 3MLUH 1OF2B 3IDNB 4WFGE 4ISVB 1DQJA 1JPSH 4GAGH 3UZQA 4K9EC 3O3AA 5FUCE 5JA8B 1QA9A 4TVPE 5EU6D 5ESVA 3EZ8A 1R3IH 3S37L 1MREH 1S9XB 3C2SA 1SEBB 3B5TA 2O61B 4NN7B 3TC9A 4Q0XL 3EGSB 3C5ZC 4PV9B 4X7SH 4HCRA 4HEME 2CUHA 1NFKA 5E9DE 1MI5D 3JBG7 4NKDA 5BS0D 1ZGLA 1YQVH 4ZPTB 3IXAB 4U0RC 4U3CA 1YNLH 2A73B 3ZKND 2XPGB 4PRBA 4N0CD 4CRPA 4NSKB 3MGOB 4MA7H 3SQOH 3S36H 5DJAA 3BQUA 2R0ZL 4R90L 2EH7H 2UYLB 3C6LD 4XPBH 1P4BL 3BP6A 3W39B 3SKJH 2YR3A 3S96A 3NACL 5ICYA 2BDNL 5FGBA 1F3JB 5AWNH 5FF6A 1U3HB 4YXHL 1T0PB 2GITA 5HGBA 1MFAL 2Q8AH 3GSNH 2VXTL 2J8UE 1S9KC 1ZTXH 2JB5H 3X12A 2VXQL 1I1AB 4PYHA 4RWYH 4K3EL 3D2UD 4PJFF 2FEDD 2FJHB 1A6ZA 4NRYB 1EBPA 1ZT4A 5E70A 1D3CA 2Z31A 3D85A 4KVCL 3P30L 2I9LA 3SDCB 2VXVL 1IGYB 5E6ID 4JY5H 1FP5A 3I75A 5INCB 4MQXC 2CGRL 3MA7A 1WWBX 1VFBA 4MA8L 5GJTL 2PN5A 1T5XB 1GZPB 1EGJH 4UIKL 1JRHH 3QWRD 5FO7A 3QNYA 2ORBL 1F42A 4FQQB 4FFYH 3V5KB 1Q1JL 4OD3L 2NW3A 1K4CB 4XNUL 4P2OB 3TPUB 1LE9B 2AABH 3P9LA 1AQKH 4QY8A 1HINL 4XPTH 1BFSA 5IM7B 1NUGA 2QSCL 3LIZL 3MODL 2GK0A 3G6JE 4C59B 1G7JA 5I0DA 3BW9A 1RK0A 5D6DA 4N90E 3C8KB 3WNPA 5TQ0H 4E42B 2LE9A 5DJ6A 4MZ3A 2AJVL 3UPCA 4ZQKB 4NO0B 2A83B 2Q7YA 4QTHB 4PG9A 2AV1B 3IFOA 3ALXA 1P2CA 4KROB 5ERWB 3MROA 4C54A 5BZWA 4MX7A 2XZQH 4LDEB 4X6FB 1OAXL 3CC5A 4NNYA 3OB8A 4NM4L 4PPTA 3VFGH 2D4DA 3EO0B 3BH8A 1T04A 3P73B 1IAIL 4XHQA 5KJRH 3PWUB 5D7IE 4NQSB 4Y2DB 4RFEA 4DTGH 2R1WB 5F3HA 4RSVA 4PYGA 4KJYA 1ZSDB 4KKAD 3DARA 1JZ7A 2M1KA 3VH8A 4N9GB 5I1HL 4RBPH 4PJXE 2BY1A 1I8KB 5D96C 3KHOA 5E5MA 1LK3H 1RMFH 1UACL 5EBLA 4HKJA 1RHHA 1TFHA 5DJ8A 1HQ4A 5BVPH 2BERA 2VL5B 4NKQB 2UWEE 1TQBB 3N85H 1F3DH 2NW2B 4Y5VC 3WDHA 4Z18A 1QVOA 3HA0A 4Y4HD 4ZD3L 1OP5H 5EULV 3KXFB 1GAFL 1UM4L 5EN2B 4PRNB 2A0LC 1DUZA 5CBEB 4WY7H 1SJHA 4WTWA 3BE1L 4XI5C 1QEWA 1WBYB 1EHAA 1JK8A 3ES6A 2ZCLH 2IPTL 1X5YA 1RUQH 5BW7A 2IANE 5SV3A 3LQAL 3BKCL 3PXHA 5D70L 1LWRA 4WGWB 4CVXA 4LSSL 3CH1B 5BS0B 2W59A 4WEMB 3S3JA 4YE4H 1YMMD 3RRQA 4AEFA 2AJSH 2HFTA 3SDXF 4G80A 1SY6L 2F8VA 3IAPA 5J12C 3FTGB 1ZLVH 1A6TB 2AK1L 2EC9T 5BXFA 2VLRD 1TCRB 1WT5A 3MC0A 4UOW0 4YXKH 5J11B 1RZJL 4QHKI 1V3LA 4E0RB 1PYWA 4HIEA 4QHKJ 4MJ6A 4EUPG 1U92A 2B5IC 4QOKD 5J13C 1S7VA 3FB6A 4ZS6D 4QNPE 1RZ8A 3ARGB 5CIPA 1Q9OB 4NFCA 5F6HI 4PJDB 4ELMB 4Y5XC 1FSKC 5F6HJ 3AM8C 1E6JH 2XRAH 3RWHB 4ZFFA 4JRYA 1RUMH 1MAMH 2YSSB 4MVBD 4QWWC 5DK2A 3MUY1 3U4BL 4DKAA 1KENH 4LIQE 4KK5D 5HI5C 1AC0A 4YJZL 1Q38A 3JWDC 4OCNC 1MJ7H 3OG6B 4J3SA 3QUMH 4PRHE 3SY0B 3FO9B 4PREB 4EEEA 5IFHL 2E3VA 2OJEB 3SE3A 1NL0H 1WZLA 5T3XD 3KPSE 4PJ8A 2BFVL 3FN9A 5L2JB 2IWGA 5E6IB 3ZE0E 1Y0LB 3BH9A 4JPWH 5IMLB 1BEYL 4JRWA 4QF1A 3ILQC 1U8LA 5CJOL 4HXAL 3QISA 2EC9U 3VE0A 3K4DA 3QUYC 1JPTH 1UCBL 5FUCC 1N0XH 2E6JA 4ODWB 5IR1B 1T03H 1DFBL 3TVMC 1G6RL 4NT6B 5C7XL 2W0KA 1JWSB 4HZLB 4Z7VB 4YDIL 3RDTA 3EUUA 3HZKB 5HHME 2P5WA 2W38A 3VG9B 3IYLW 4OCYL 2IFFH 2R1XA 4EZMA 2RAMA 1MNUH 3O0RL 2CKBB 3L5HA 5F97E 3BKJL 2R0LL 5JO5A 4ZUVB 1MH5B 3Q2CA 3Q6FB 3TO4A 2P45B 4MAUH 4FG6D 2ZCKH 4WCYL 4P59H 4DUXA 4I18B 4IS6A 1JF6A 1UCTA 3RWJA 3W82A 3TYGH 2AJUH 1KGCD 3MRNA 2N4IA 4RFNB 2H32H 4LCCA 3WD5L 3PL6D 3NPSC 1T83A 4DKFL 4YHZL 3DROA 4X8XA 5HHQB 2BY2A 3OKLA 4XRCA 3UZEA 1FHGA 3LEVL 2HH0H 1W0VB 3FB7A 3UROR 4J3UA 4N8VB 1IKNC 1J11A 2GTWA 4S1QL 1CFSA 4PJ9A 4QLRA 3GJEA 3GSWA 3MA9H 1I3UA 5D1ZA 1TCMA 3VRIB 1JPFA 3IDXL 4PGEA 1HIML 1K5NA 2ICES 2LAAA 4PV8A 5KW9H 3WHXA 4NZUL 4Y4HB 2EC8A 1HCVA 3ZDXF 3VXQA 4JFOA 3S35X 5DK0A 2NY6B 1INEL 4KY1L 3BZFA 3CVIH 2EDWA 1RHFA 3MNVB 3D0LA 3LMJH 1U8NA 3VFVB 3L9RB 1HKLH 4YIQA 4P4RB 1AR1D 2WP3O 2DI9A 1DQQB 5T5FL 1Z0NA 3UMTA 2DBLL 3IDGB 3CX2A 1ADQA 4WU7A 2QV2A 1MFCH 5HYSA 2ZKHH 3PWNA 2EKSB 5TF0A 2Q6WB 3VWKD 3WFDL 5K9KB 1BIIA 4MZ2A 1HSAB 5HHNB 4HFWB 1E27B 1KPRB 5FYJL 5DJ2B 2RBLA 4HUWB 4YNYB 4YHKL 2R15A 3RVXC 3OF6D 4PTTB 4MD5A 4JPKH 3TCLB 1AGCA 1ZHBB 1NCBH 2AV7B 4WHYH 2DJUA 3KPQB 3VXRA 4HH9A 3IDYC 4B0MM 3QHZL 2Z93B 1JMXA 3MCLH 5DO2C 4OCRH 1X5LA 1JHLL 1FZKA 3WFCL 5E2UH 1JHTA 1Q72H 4GKSB 1HHIA 3BZEB 3TBSA 3KPRE 5IBUG 1Y18A 4QHMB 4GSDL 3SGEI 3OAYK 3QEQD 1ZE3C 1H3PL 2Z91A 3O4LA 1IC4H 3D18A 4HKXA 4M1CC 1NAKL 2IPKB 1MLCA 2NPLX 2HLAA 1IGFH 2H2SC 2A6JB 3H7BA 1KEGL 1TJGH 1B3JA 4TRPH 5DRZA 2E7MA 3D0VB 4LASH 3ISWA 4N1EA 1EEYA 2X1QA 4P46B 3ARSA 1ZMYA 3GJFB 3HRZA 1TVBB 3MRIB 5JORA 2FIKA 4LPWA 5KSBE 3C2AH 2SEBA 3K3QA 4KMQA 4A2MA 3PWPD 2HMIC 4LCYB 2NXYB 3IRZA 4K8RL 4QXUH 5C6TH 1CD8A 3TP4A 4P23D 5I71B 4LRIA 4JLRB 2DQFA 4CGTA 3D39E 4MNHB 1XR8B 4Y2OA 1Q94B 4HAFA 1IILE 3KS0J 4JREB 1DP0A 4MAYC 4BZ2L 4Y4KA 1XGYL 5F7YC 3LOWA 4N1HB 1TNMA 3WO4C 1GOFA 4L9LB 4HJJL 1EGJA 1F4YL 2CUMA 3B9DA 4GRWH 4HKZB 2OBGA 4NP4L 3OMZA 1K2DA 1UXWA 4HF5H 1MPAH 2V17L 1FDLL 1SYSB 4WENB 2X4QA 3TT1H 3VFUB 2VLKD 2QSVA 3C08L 4PRID 4UT6L 3RGHA 4DN3H 4ELMF 2F5BL 3F7QA 3BP7B 5IGXH 4POYA 4P9HL 4HPOL 1X7QB 3MOBL 4NN6B 5DRXB 3EYOB 3UYRH 1VACA 4BZ1L 2GJ6D 2ITDA 4N8PA 4X99B 3GMQB 4JRYE 1JF1B 4RMRA 4EN3A 4QRPB 2R2HA 5J6HB 5C0BE 5GISH 3OGCA 1CXEA 4XNXH 1UWXH 4M7ZC 3ULUF 3IDUA 2PR4L 2VZ3A 3U7WL 3VXOB 1RZIA 1EDQA 1FIGH 1KC5H 1S7WB 3UDWC 4U1LB 4OV5A 1RUPH 1K8DB 1L4IA 1TQCC 4JZOB 4H26A 4O2EB 4ZUWB 4LLVB 5GRUL 5I30H 3NH7H 3C60C 1L7IH 3ELAT 4HUVA 1D5XB 1G9NH 2EZ0D 4JCMA 5GGQL 4G6KL 1E28B 5EOCL 3TBYB 4EDXA 3VFTA 4HUXA 4DCQB 5KVEL 2BVPB 4HMCA 4S1RL 2A77L 2D7OA 4Z7VF 3RGVC 3NCBB 2L0DA 4IRJC 2R4RH 1VADA 3NA9L 4MQ7B 1WAAF 1RFDL 3H0TB 4XPFL 4Z7WB 1CL7H 5FCUL 5I8OH 2QQLH 4K3JL 5CJXC 3Q48A 5CZKA 3HB3C 4JANA 2EXYC 4MYWB 4QYOB 2UUDK 1YEHL 5LXGH 4O9HL 5IBLC 1JN6A 3A67L 5DJXA 1OCWL 4GW5B 1X5XA 1NGWB 1P7QA 4GW4B 4YC2B 4HS3A 1PZ5B 1R5IB 3FO2B 4RWHA 4LLDB 1FGVH 5IJKA 2ERJB 2IALA 2ESVA 3ARZA 3DURA 4HLZG 4NHCL 5I73C 2XZAH 4GG6A 3Q5OA 2R2EA 3L3DA 5IP4A 3BT2L 2NY5H 3KHQA 5KSAD 1KPVA 4DVBB 5DJDA 4UQ2B 4HHAB 5E1AA 3I50L 4HFUL 4PJ5A 1U8HA 4HGWA 4GMSH 2ZCHH 4IIQC 4L5FH 4XAWL 4K3DL 1T5WA 3MUGB 4MDIA 3QDJE 2E27L 2OXGA 2HT3D 4BSVB 1RIUL 2X1OA 3CFJB 5ISZD 1FN4A 5AZ2L 3LPGA 4BUHA 1ACYL 3HC4H 3TGXA 2VTFA 1PKOA 4HUUA 4Z5RB 3UTSB 4HBCH 1FFOB 5EC2B 1CD1A 3MV7E 5T1DL 2H9GA 4KPHL 1RU9L 2DTSA 1BREA 5MEPA 2V2WB 1ZK9A 1KJ3L 3OKMA 5TDNB 5INDA 4NNPL 1RVFH 3NA4A 2DQGL 4DW2H 4NFBA 4P23B 5JDSA 2KPNA 1TDQA 4KI5F 5C0CA 1EJOH 2BCKB 3HR5A 1OAKH 2EIZA 2EYTA 4D2NA 1C7TA 2R56H 5E8NA 4UV4H 1JGUH 5CBAA 4C83B 5C09D 4RZCA 1MHEA 2NCMA 1D5ZB 5ESAB 4DGIH 2AS5M 2GUOB 3QIUD 1XFPA 3L1OL 3NIFF 3AFLA 2HT4C 1TZHA 2DQTH 4LCWB 3S5LA 2VLKB 4PRIB 1I9JL 5HHOB 1AFVH 3HZYB 1DCLA 3BDYL 1OP3K 3B2VL 2H26A 3PIQB 5JNYA 4EVNA 2EDFA 4HIIB 4XC3L 1VA9A 1Z2KA 4LSQH 3CPLB 4W4NA 1OTSD 4X6BB 3SO3C 2Q86A 3VXRE 2H41A 3BW9B 3QIWD 4H1LG 3QJHB 1OWRM 3MRDB 2NTSP 3J8F7 2EE2A 4NYLB 1MQKH 4GAFB 4I0PC 3N1QC 2QQKL 2XICA 1G9MH 2X4PA 1CLYL 4ZNEA 3BX7C 1G7HB 2VUOA 2H32A 4F33B 2CKBL 3O2WL 4XMKL 4OUOA 1RZGA 2B0SL 2O5XL 2YPVH 5DVKA 4OCXH 1SJVA 4YHPA 2XI9A 4AEHH 4E9LA 4NBXB 5LGKA 4FFVC 4M1GL 4L4TA 1ZS8A 5KANG 5FYKH 1IM3A 4Z7NF 5D8JH 3B9EA 1JYXA 2A74A 1A7OL 2EDEA 4NJ9L 4Y89A 4YBHA 4MB3A 3PGDB 1M6OA 1D7FA 5H94A 2QHRH 1CXFA 4XNZC 2PW1A 3ROLB 3QQ4A 3BYTA 3O9WC 1DUYB 5IK3B 1A1MA 2BSRB 1KN4H 2V7NA 4PLOB 2ADFL 4ORGA 2DQIH 1IQWH 3MLSH 1FL5B 3HC0B 3PP4H 2E8ZA 4NUGL 5EPMB 4JRXA 5IROA 4X4ZA 4FQIL 2CUIA 4S1DD 1XF5A 3FO0L 2IJ0C 2XN9E 3ARBB 5I74B 3S3PA 2E7CA 4NWUL 1L7TH 4L29A 1A0QL 3Q6GH 2APFA 1U8IA 2YZ8A 4M9OA 2F53B 3UJJL 4CN1A 1BVZA 1HEZB 1RZFL 3QI9A 5J06A 3U7YH 4EI5A 2W60A 5DJZB 1HHHA 3QHFL 1A7RH 1IEAA 3FB8B 3BPNB 5CEXA 3JXAA 4Y1AB 1E6OH 1EMTL 3ARDC 4L9DA 3OL2A 1CFNB 4PJHF 4EXKA 3WHE0 2D9QB 1ZWIA 4U6VL 4U6XB 2J5LC 2Z8SA 3MBED 4PJ8C 1KJ2L 3B9KD 2MNUA 5D1QC 1NCCH 3B2UC 4ZO9A 3CFBB 3ALPA 1KXVC 3U9PL 2A6IA 4ZSOB 4UT9H 5J6GA 3FFCA 4KVNH 2HKFL 3IKCB 4LSDA 5IB4B 4G43B 1MFDH 1T20B 5ELIA 4MD4B 4PJIE 5IKCA 1DBAL 1YPZB 3D25A 2RCSH 2IAMC 5CEZD 3B5HA 3A6OA 4P9ML 3FQTB 3KLHC 3W9EB 1YEKH 4QF1B 4U1SB 4D9RE 2HYMA 1AY1H 3QIUB 2Y5TA 2AK4A 4AMKL 3DTXB 4TULL 4F3FA 2ZUYA 3STBA 5ADOL 1P5UA 2VDRL 2DB8A 5EU5B 3RPIB 1CK0H 3P4OB 4XMPH 5A16A 3A6BH 4M5ZH 4FQXA 5AZEL 3RA7H 1H5BA 2P7TA 3VMPA 3N0PB 4MCYB 3QIWB 2IQ9L 3SDAD 1MQ8A 4RISH 3BFOA 4F57L 3C5SA 1DL7L 2CLZB 4J7RA 3DMMA 4OM1H 1MVUB 3T3PE 1BBDH 3VFMB 4ETYA 4UTBL 4L8SB 4TQEL 4IRSA 2CDEA 4RGNE 2BRRH 3SDYH 2QR0A 2KH2B 4TUKH 5E4EB 4NWTL 2W9EH 3KLAB 1F8TL 5F93C 1ES0B 2WINA 1RIVH 3GHBH 5DDHA 4WO4D 5IBTL 1NBYB 4H8WH 5CJ5A 2GTWB 5FHAH 4OLUL 2ED8A 4OF3A 4NQUA 1JTOA 4U6TA 1LP9B 5E8OA 3HUJB 3T0VA 1ZHKB 4Y4FB 3MRKA 2NY2C 3TBWB 4PV8B 1KTLA 4GBXD 1QBBA 3SJVD 3QNXA 3KJ6L 2IQAB 4PJBB 3K8LA 1TLKA 5C0CE 5ETUB 1YEJL 4NQED 3V9FA 2OI9B 4NZRL 4M8VA 1D9KB 1EHLL 3GB7B 3GHEH 1P4LA 1HHJA 3HMXL 1NMAH 1N6QL 1IT9L 1IBGL 5D1XA 3LD8C 2OTUB 1E0OB 4OIAA 3RVUC 3TN0C 2XOTA 3OAUH 1OPGH 4OD1H 2QEJA 1AI1H 1AC6A 3VXTA 3CU7A 5F88B 1ZVHA 4MNGE 3FMGL 3PHOB 4Z95L 1BFOA 4YX2L 2FX8H 3PNWA 3KPPA 3ULSB 1GGCH 1U6AH 3UJIH 4TOYH 4J12A 1EXUA 1YUHB 3UO1H 1W72H 1J8HA 2QADD 4M8QB 3MBEB 5DURD 5AD0B 1JZ4A 4WUKL 4U6HA 3B9KB 2KKQA 3DV6A 5EORL 3K2UL 3W5MA 3G5YB 3UBXG 2OZ4A 2F54D 4G8GE 5F9OH 5TGBA 1U8MB 3NABL 3C5ZD 3WFZA 5HD8C 3HAEG 1GXEA 3FZUC 1M05B 2YMXH 4ZNEE 4XGZB 5MERB 1T1YB 3DO7A 3KPLA 4MNQB 4YK4C 5A2JH 2GSIA 3EIFA 1V5JA 3BGMB 3CCHA 3GMPA 5DUBB 3QXVA 2FJGB 1W0WA 4LAQH 5GIRB 1KF9B 5EOTA 3RZCA 1WBZB 5HHXL 1OHQA 4ODTL 1WSST 4JHZA 4LDLB 1VEPA 4F9PC 5IVZA 4PGCB 4XVSL 5E03A 1MLCB 5LGJB 2FYYA 1DBKH 2MKLC 2C1PA 2YN3A 4YHOL 1T0MB 1QNZL 4UTAL 1J87A 4PRPD 4XVJL 2DS4A 1Q9WB 2PXYD 1CZ8H 3JWOL 3RQ3A 4JKPL 5IFJA 4XCEB 4KDTC 1MRDH 1ZHLB 3QG6B 4NNXB 5LBSH 3V6OE 1ORQB 2Y9RT 1R6VA 5TE6H 5JLZA 2DD8H 4QRUB 1CD0A 5ALCH 3A0OA 5JW5A 4PY7A 3V6FA 5F6IC 5B8CB 2BNQA 2KUTA 4DQOL 2PTTB 4JDVB 2EH8H 2PO6B 2GFBA 4LSTL 4PJCA 1H3VA 4ZFZA 1JNLH 3QXDA 2ZNXA 3IETA 3VJ6A 5J0BA 4LHQB 1WK0A 1TPXB 5DUML 2Y06H 4LMQI 3D5OF 3RIFF 1KBGL 2BOCA 2ZUTA 1ND0A 2VZVA 3RL2A 3V4PL 4WO4B 3ZYIA 1AO7A 4H88L 3WIHA 5TPWL 1S5IL 4M5YL 1TJHH 5E2WL 2X05A 1S7RA 4WW2A 2HVKA 2ITDB 5DD5L 2DKMA 4GBXB 2JJUA 1QFOA 3PWVA 4LSUL 2Z8RA 3ARFD 2B2XL 3FFCE 3U79A 3PABB 1YPZF 2YZ1A 2PYFA 3RAJH 5C0EB 3WKNA 4PRDB 4NQEB 1R3LA 3DETD 3VRLE 4JDZA 3SDDB 3WYRA 3K8KA 4LKXB 2OR7A 4HWEH 2AJYH 4OUUB 1H8NA 2PUQT 2BNRD 4Z7OE 3OKKB 1JNNH 1WCBA 5BZDB 5TDPA 3F7YA 4D9LH 1FYTA 4S11A 2IH1B 3V8OA 1S5HA 1DN0A 1M7IB 4JHWL 5BJTA 1BM3L 1E4KA 5B38B 5EBGA 1X9QA 5E2VH 4LEXL 5HI3C 3GUTA 3U6RA 1AE6H 1KB5H 3S35H 2FBJH 1M71A 3W2DL 3VXMA 1S3KL 2DQEL 3GBML 4Z7UE 4LVHB 3M1BA 3SGEH 4NO5B 3HE7A 1KIPA 3ZTNH 1F58H 1ITCA 4UV7L 4XI5D 4G6AC 1JGEB 1DVFC 1CF8H 1KXQE 1NGPL 3MRJB 4RGNC 3HMWL 1ZAGA 3C5ZB 4G8EA 2V2TB 5IB3B 2ZOKB 5JXED 3D3VA 1AXTL 1IGTA 2ESVB 5A43C 1AD0A 4ZXBA 3L7EA 2IMNA 3W9DB 4ETQB 3QXTA 4OT1L 3BUTA 3OV6A 4GRWE 1U8PB 1UM5H 3IU3B 4G8FB 1G7IB 3X14B 3HG1D 3KWWA 4IDLA 5EO0A 3ZHKA 3KYAA 1QFWM 3RI5F 4KTYA 3T65A 5C07A 1AGDB 4HS8H 1LP9F 1TTUA 1JZ3A 2WIIB 3HUJF 3LEYH 3FT3B 1BF8A 4M7LT 4PRPB 3KS0H 2P46B 4JFEA 2XFXA 4OM0H 4XWGH 1Q0XH 2MQCA 3CXDH 4UT7L 2WUCL 2UZIL 2VRAA 4PJAB 5F7NC 3KYKL 1V3JA 2WP3T 3SE4A 4QWWD 3LKRA 4H1LB 2WANA 4PJBF 4R9HA 5ITBH 3IRPX 3S34H 2ARJA 4BQ9A 3ZKMC 4OGYL 4NKOB 5C0FB 2UZYB 3B6SA 4LNRB 2VLJA 4YAQA 1SVZA 1G6VK 3O3BA 3REVA 3QG7H 3OKMB 4XP4L 5FV1L 3U0TA 4JQVA 3LN5B 1JTTA 2NYYD 4G7VH 1BECA 5JDSB 1X5HA 1WZ1H 3RKPA 1C08B 3ILQD 1QKZH 1BAFH 1HH6B 3NCEB 4AENA 1KLGA 3MLRL 3TV3L 1V7NH 4WFGD 4LBEA 5C08E 1YY9C 2P8LB 3QUYD 3OR7A 5C71A 1GYAA 4Z7QE 4TVPD 4G6JL 2J2ZA 4JO1H 5EZIH 3TVMD 1T1XB 4JN1H 4YFLF 3S4SB 4MDJA 1PKQB 2BMKA 2BK8A 2HRLA 3EDFA 4HZAA 1I7ZB 3LKOB 4J6RH 3ZE2F 4NRZA 3THMH 4PGDB 4M7KL 3QFJA 5E9DD 4WV1A 4OQTH 3J7HA 1MJJB 2MKWA 5KANI 1H8OA 3QNZB 5SWQA 4P3CL 3UC0H 5EZJB 2VH5L 4U3HA 1OGAA 2W9LA 3CVHB 4PLJC 4DK3A 4PR5A 1FVCA 2WUBH 3P9MB 4OLXL 4NKMB 1MF2L 1REIA 4JQIL 2ZSVA 1VGEH 1NUDA 2R69L 4LLWA 2FL5A 1FV1A 4U1GC 1I1YB 4O4YL 1KPUA 2VZ1A 1JUFA 3Q1SL 1FAIL 1IAMA 2BNRB 1KLUB 3Q0HA 1LDPL 4J3XA 3S7GA 3VGDA 3EDJA 3BMVA 4AH2B 5DHVB 1Q0YH 5D96B 4U33A 5JZ7C 5I1KL 3V6OC 4R0LC 2FGZA 4K7FB 3T0WA 1FFNA 1T1ZB 3SCMA 3QRGH 3F65A 1MSPA 4ONHB 2H2PC 4ODXA 1MFNA 5F71A 4Y5VB 4M6AA 3W5NA 3VGAC 2ATKA 5GS1A 1TTGA 2YUVA 1T22A 2A2QT 2J88L 4FQHA 1MHHB 4D0BA 1HOCB 2JJSA 2KDGA 2WBJA 1U8QB 1WIPA 4PG2A 4GKNB 4G5ZL 4AT6B 3DRTB 4YO0B 1GRWA 5JXAH 3VH8G 2NQCA 4CW1A 4QRSA 5DEZA 4UILL 32C2A 3X11A 4N1CA 1F4WL 4I8DA 2JJTC 3PWJA 5J12B 2R0WH 1CE6A 1W8OA 4PS4L 2AEQL 3DXAA 4EI6B 3VDBA 1Z9OA 3U9UA 3HG1B 4Y7MA 4CVWA 3B5GA 4N90D 4HV8A 4JB9H 4EI5B 2B5IB 5J13B 3AREA 3QDGA 1AO7E 1UZ6E 2A6KA 2X4SA 3REWA 1RJLB 4Y5XB 1BVKB 1FSKB 2RB8A 5BV7H 1LO0L 4HUNB 1IGJA 1N5AB 4DKEL 5MI0C 1GC1L 3O6KH 3IDMB 4R96A 3C6SB 1YN7B 4NQDB 1FVDA 5T3ZH 4MJ5B 1I3GH 3MLYL 2IH3A 4H0HB 1VDGA 4F7PB 5EUKB 5DO2D 1OD9A 1U93B 4Y88A 4JFXB 4TTDC 1VHPA 4BM7A 4G8IB 1CGYA 1PSKL 4R8WH 5D7SH 2X89D 4FQPA 7CGTA 2X4UB 5EU4A 3SBWA 1VENA 1UJ3A 2DBJA 1D5IH 3T8XA 1P1ZB 4EIGB 4GW1A 4OTXH 3H7LA 3FRUB 2FZ3B 4WHCA 2H2SD 1KEML 4OLYH 5CKGA 2WIMA 3VFPB 5IB1B 3QUYB 1CS6A 4RQQB 5FYKE 5IMKA 4YXLH 1WC7A 2Y25A 3IDIA 3RIFK 1EFXB 1F4XH 1QR1A 1PGRB 4JY6A 3TVMB 1LEKB 2VO5A 3DVFA 5CEZL 4KK6C 3VXME 2IAND 3FT2A 3BEVA 4OIIH 3MV8E 3WO3B 3RWEB 3M8OL 1CICA 3WSQH 5JOEA 1YJDC 1EO8L 1N64L 1LD9A 3CDGA 4L8BB 3VXSB 2HMID 4X5WB 3VW3H 3SOBL 4RMTA 2XA8L 3VA2C 3OSKA 1YY8B 1XGTA 1JYNA 5KTEL 4UU9B 4MJ4A 5HPMA 1H3TA 1K8IA 1RUKH 3D3VE 3LQZA 3KYMA 3MJ7A 2VIRB 1RIHL 4H5SB 4MAYD 2O26U 3IFPB 4AY0A 3DGGB 3NPSB 3DUSA 3NN8A 2VAAA 3K46A 5I1GH 1AXIB 4J1UA 3OR6A 4HG4K 2VERN 1J1OL 1FJ1A 2J8UB 4AM0A 5HHVH 2EEAA 2W91A 4X6DB 3QAZC 2I27N 1BQLH 4FN0A 3E2HC 4YQXL 2DYPA 1BBJB 3MRPB 4PJAF 4JAMA 3ZDZF 4M4PA 3DRQA 3L7FA 4PRHD 4JFEE 5HDBF 1QO3A 1A9EB 5EFIA 2V7HA 3OKDB 4G3YH 3MV9E 4FFZL 3OPZL 1A6WL 1P4BH 1YMHB 1MCWW 5SWZE 3KPSD 5GS2D 3CMOH 2BDNH 2MJWA 3K4AA 1FFPB 1I8LC 4FZEL 5E94B 4LLYB 4YXHH 2NXZD 4LPTA 2WWKO 3BIKB 3T1FB 1TZIB 4OZGA 5JHLL 1GCFA 5FUOL 3NTCL 4MXWL 1G7MA 2W92A 5EIVA 2B20A 3P30H 3B3IA 4CVZB 4PJEE 3UBXI 3C60D 4F2MA 1H8SA 3O8XA 3UTQA 4N0YH 5JUEH 1I7TA 4XNYL 5ID0A 4M1DL 5DJ0B 4XH2B 4YHML 5HHMD 5ANMA 5I1JH 1A47A 3SHSA 3OHXB 2AQ1A 1NDMB 3RI5K 4HXBL 3RGVD 2OK0H 3LKSB 2B4CL 4HUKB 3QPQC 5DS8A 4UIKH 4NRXA 1HE7A 3BEWB 4C56A 4K23H 1A6UH 1KB5A 3I6KB 1QBMH 4F9LA 4OD3H 3QFJE 3HB3D 5CMAB 3WUWB 1WZMA 2CXGA 1I3VA 2EXYD 5TE4L 3V5HB 3QUXA 8CGTA 4JE4B 3QYCA 2NY5C 1F02I 5IUSA 4UQ3B 3IDYB 3MODH 5IF0B 2V2XA 3LRHA 4PFEA 4JO3H 1FQ9C 3GKWH 3ZKXC 3QHTC 5KVMC 4U3XA 1CLZH 3HPJA 4P4KA 4K9EL 4JZNA 3GSRB 3QO0B 3BWAA 3TJHD 4DZBB 1KT2A 5EU7C 3U1SH 1I8IA 1DDHA 2YA1A 5K59F 4GRLA 4GXUM 4EJ1C 5HYSG 1OAXH 3HS0A 4P2QA 4U7MA 1ZT1A 4NM4H 1A14H 2HKHH 2EDKA 2C3VB 3MPCA 2UWEB 2P8PB 1B9ZA 3DX7A 3VA6A 3FFDB 1D6VL 3IJSA 3QIBA 4NN5C 4G7YH 3I85A 5I1HH 3DGCR 5C3LD 5I19L 4S1SL 3WJLC 2R29H 2Z31D 3IJHA 3D85D 4OLZL 3T0EA 3NCJH 2XTJE 1KG0A 3QDMB 4KI1A 1O5DT 2YD9A 3RZWA 1G7LB 3VFOB 4XVUC 1BZ9A 4BQCA 5GGRY 4NQTA 3EFDL 5BOPA 4ZD3H 2NY4B 4OZ4B 3TWCL 1GAFH 3MRRB 1IC5H 4PJGA 2XWBA 2ADJB 4KK8D 4RMSA 4KTDH 2GSGA 4JKWA 12E8H 2IPTH 2CDGB 4MAYB 3BKCH 1OD7A 2ITCB 5ID1B 2D31A 4ZTPH 1NCNA 4LPVA 4NO2A 5EZLB 3RNQB 3Q3GA 4Z76B 5I1AB 4XP9L 4JO4H 1C5BL 1JZ6A 2HT4D 1SY6H 3E8UL 1S7XB 3FOMA 2W0FB 3CSYA 5ESQB 4KJWD 2GY5A 1VFUA 2GAZB 4LGSB 3RPKA 4RRPA 5BRZA 5I16A 5HYQA 4HIHA 1BGXL 1AGBA 5F7KC 3RWCA 3KPSB 3KLSA 3UTZB 1FAKT 4M7ZB 4M61A 2Z92A 3KPRD 1IE5A 1U8JB 3MR9B 1MFEL 3OAYH 2VITB 3VCLA 4WIQA 5DJCB 1RJYB 1A3RL 4TSCH 1NGXB 4FMKA 1I7UB 2H1PH 2MSPA 3X13A 1NCWL 1OGTB 5GSVB 1O7VA 4P2RE 1TQCB 3O4OC 4WWKC 1RK1B 2VXSL 1IGIH 4RGOH 1CU4H 2PYEA 3WN5C 4NQXB 4B53A 3CIQA 3VXUB 1F6AA 1ORSB 2VDPL 1C16A 3GSUA 5IMMA 4FFVD 4M6OL 5HHMB 1NEUA 4ODVL 3T2NL 1EH9A 4JVPA 3WL9A 4KMTL 3RGVB 3IKKA 5C0AE 4HXAH 4IRJB 5MP6H 4BFIA 1BPVA 5GGVL 2GCYA 2DQCL 2WWMD 2FX7L 4R97C 3V52L 4YHYC 5GRJL 1A5FH 3D39D 4J4PC 2VN4A 3TYFA 4OZFB 2NY7L 5DMIL 1QFPA 4OGXL 5DEFA 1NCDL 4UNTA 3KNBB 1ZVSB 2X2YA 2L7UA 2HG5B 3TPKA 4R7NB 3QH3A 1IMHC 3M17B 5MEQA 4KZEL 1NPUA 3O0RH 2HFEA 3IJYB 4L4VA 2YRPA 3MLTA 15C8H 5I73B 1A22B 4KQ4H 2CIIA 2HWZH 43C9B 1FO0L 2A6DA 3V4VH 2BSSA 2J8UF 4MXVF 1P6FA 4X6DF 1QLEL 4IIQB 5BO1H 1A3LL 2ADGB 1Y6KR 4JRYD 3WD5H 4YFDB 1J8KA 1A9BA 4HWNA 3S88H 3NOIA 5C0BD 4DKFH 4PP2A 5DQ9B 4B5EA 3ARDD 4IMLB 1UH3A 4KRMB 4HUMB 5LGHH 2OL3H 2D4FA 3WKMH 3RWIA 2QKIB 2ARJQ 1UB6B 2YWZA 3DSFL 5C0JB 3SE9H 4XMLL 3CFCL 4PJ8D 1ZLWK 2QQNL 4FQ1H 4NQCE 5KBNC 5D1QD 2AXFB 3B2UD 1HIMH 2DKUA 2VC2L 3IS1X 3JV4A 5J1SC 3EFFA 4FXGB 1CVSC 4ZTOL 3VFWB 3GSXA 4OZGE 3QFDB 5T5NF 1ZT7A 1HQRA 1LNUB 3P77B 4XCNA 5I75C 4CNIA 1S8DA 5GGTA 2HLFC 4KAQL 1BQHA 3MLZH 3MRQB 2D7TL 4B7LA 4XHJD 3JWDL 3TH4T 1MEXL 5DJYA 2AJXH 1YECH 1Z6JT 3KLHD 3EOBB 3H9HA 3WFHA 1QRKA 4JFFA 5EBWB 5E2TH 3VGFA 1GGBL 1KB9K 1BOGB 2UUDH 3P11L 2J6EL 3C5JA 4HSQA 2V5YA 4EDWH 1ZANL 3FL7A 4FQJL 5CZXC 1T7ZA 5CS7A 5DQJA 1HKFA 3DIFA 3EJYC 3SO3B 3N1GC 5I1CL 1JZ5A 4TVPL 3FQWB 3GMRA 3GMLA 3MMEA 4YEFA 3KPRB 1OLLA 1PDKA 5FYJH 4FXKA 4QCIB 3JTSA 1NSNL 1T0NA 1FNEB 2DIAA 2FO4A 5E08H 2X4OA 4HLZH 5F9DC 5I8CB 4I0PB 4EOWL 1CT8B 5FK9B 1LK2A 5B21A 5IB5A 5LQBH 4Z6AT 3QDJD 4W4OC 3UTTE 1F6LL 2EDJA 3MNZA 1XGQB 5F1OB 1G84A 1Z9MA 2NTFB 3LRSA 1R0AL 2VL4A 2Q3ZA 5IMOA 3S5LG 5D1ZD 1GVIA 1MJUH 4PB0L 4XC1L 4BSWB 2MHAB 2I5YH 1MFBH 2XTJC 4GSDH 1VKXA 2BVUA 5KSBB 5JW4M 3MV7D 3HNVL 3CLEL 1NAKH 2WQRA 4QGYA 5T1MA 3MO1A 1FZOA 2DLTA 3OJ2C 4OLWH 4U6YB 3CMGA 4LSPH 2CIKB 2ZG2A 3L3OA 1BFTA 4XNZB 4IDJL 3D39B 1G1YA 3O9WB 3T2OA 1OARH 4O5LH 2NY2D 4Q9RL 2AAVA 4JFDB 1KLFA 3IXTB 5CLWA 4N0UA 4FZ8H 5EO9A 3ZKNC 2IPUG 5BCAA 1QSEA 4PJGE 2HFGL 1A6AA 4ELKB 5DZNA 2XNAB 1J7VR 2ATPA 3C6LC 4NPYA 3WLBB 2IPUK 3F7VA 3EO9L 4PJCF 1A4JA 4P99A 2D7MA 3N1PC 2FJFA 5D5MA 3HI5H 1BVLA 2HN7A 4CW1B 5BMFH 3ZT7A 1OP3H 1OTUC 3MREA 4CMHC 4DZ8B 4GXUN 3VRJA 3TN0D 1AQDA 1N6UA 4BZ2H 1DLFH 5KG9A 3GKZA 4CVUA 1T1WB 5FKAA 2HP4A 4HS6A 3KPOB 5C0BB 4RDQG 4HJJH 3VXRD 2ICWB 3ARDB 3PWLA 3AROA 4U1IB 3MOAL 4N0RA 4Q58C 2V17H 3UTPE 1ZEAL 2FIRT 2WAHA 5MENE 1VGKA 4JQXA 4UT6H 5BRZE 1M7DB 5JW3H 3HRPA 1R3KB 2LABA 5IVXA 4XCYB 2O5YH 2J5LB 4JKKA 4NBYB 4HPOH 2A38A 4RAUB 3MOBH 1D5BA 1EIBA 1MIMH 1IC1A 4EIZC 5TQ2L 2P5EA 1L9NA 2EDOA 1HHGA 3LCYA 5HD8D 1KELL 3F62A 5EO1A 4ZUTA 1OB1A 3HPLA 1IM9B 1RZKH 3FZUD 4HC1L 2FBOJ 1JE6A 2DWDB 1DE4A 4JZJC 5EUOB 2R0KL 3U36A 4LKCA 1HNFA 2PYEE 5FA4B 4ZO7A 3VFRB 1F13A 2IAMB 2E9WA 2KQNA 1OQOA 2EE9A 2FH8A 3LKNB 4NGHL 2H6PA 4I5BB 5EU4B 5CAYB 1Z5LB 3HHRB 2ZNWA 4QHNB 5D7JA 2MPAH 3O2VH 3RKDD 5IQ9A 1DQLL 1PAMA 2YPLE 4G42A 4AQ1B 3DVNB 4LAJH 4YBQC 4HG4J 3GI8H 2VDKL 4WHYG 4RMVA 4JDTH 2JB6A 2VB5A 5D7KE 3WJJC 1IAIM 1A6VL 5HYJB 1HNGA 4WW1A 2XN9D 1KUMA 3R8QA 5B3JF 2APVA 2YD3A 1P69B 5DRNA 2YBRA 2YUZA 3GRWL 4K3JH 3PGFL 2D7QA 4KKAC 2MCPL 1SVCP 3BPCB 1LD9B 5D93C 1OSPH 5DGQA 3P0YH 4NIKB 4L4VE 1N6VA 5HDQH 3SKMB 4OFYA 3AGVA 2X9YA 1F45A 1OCWH 3CSBA 2QBWA 3QDJB 5HI4C 4JO2H 2VDMH 1OSZB 3QUZA 1G7PB 3ROOB 3QJFA 3MRLB 3ARXA 5GGSY 1SY6A 4XXCC 1NMBL 3O3DB 2OP4L 3MV7B 1PJ9A 5DRWA 1UT9A 1SYVB 1FH5H 2EDXA 4ZPVB 5ILTL 1PLGL 5IWLA 3OX8B 3MRBA 3AUVA 3AAZB 1F4HA 2N7BA 5JOFB 2I9TB 4LF3A 2ENYA 1NC4B 5GJSL 5JDJA 4GJTB 1NGZB 1LO5B 1RIUH 1PZUB 2A9NL 3PQYE 3SE8L 4D0DA 4KQ3H 1AKJA 4HK3J 5GZOD 2AJZA 5T3ZE 2NY2B 4FTVA 2NY0D 1U91B 1CDCA 2P1YA 4GMTH 2GHWB 2MCG1 2GTZA 2VQUA 2OSLB 3STZB 35C8L 4M6NH 5DTFA 4CKVX 1WF5A 4JM2C 1J0ZA 3QWOA 4KPHH 3GIZL 2VZTA 4AL8H 4Q2ZA 1T6WA 5FDWB 1H15B 1FBIH 3JTTA 5DYOB 4D9RD 3F58L 3LEXB 4NNPH 3IVKA 2DQGH 4V1DA 5JA9A 1ZVYA 4L3EE 4ZS6C 1CFBA 5TF1L 1INDL 2BXZA 3LD8B 1GHFH 3C9NB 5D7LA 3TN0B 3OKYA 3ZDYE 7FABL 4UIMB 5I1LA 4EBQH 4JFFE 3T0AA 5CWSA 3MACL 4MJIE 4KK5C 3LHPL 3KGRA 3MLWL 3ULUH 1S7QA 4U1MA 1P7QD 2Y1VA 1R5VA 1S9WB 1FL3B 3E6FB 1XIWC 2RHEA 1IVLA 2V5TA 1I85C 1NC2A 4NRXB 4YFLI 1G6RA 3BDYH 2HVJB 5AUMB 4DAGH 3BO8B 1OAQL 5KVDL 4I9WE 1T7XA 4M7LL 4G6AD 5C2BL 5DLML 3G6DL 5IQ7L 1DVFD 1GGIH 4RGND 5JHDA 2NR6D 1OT1A 4RA3A 3IS0X 3EYVA 4O58L 4R4BA 3CFEA 4C57C 4Z77A 1OAYL 25C8H 4YK4B 3G08B 4KHXH 4HPYH 4BH8A 1QD0A 1ZOXA 3V5DB 5KSBF 2QQKH 3PHQB 1T89A 4K71C 5J1AB 3O6FA 3GSNB 1S7TA 3O2WH 2DWEB 2B0SH 3NFPA 3RUGE 1QFWL 2V9RA 1OW0C 3QO1B 1QSFA 3LSOB 3DX8B 5C0CD 3GSVB 3H9SB 3H3PL 4QO1A 1MHCB 1NEZA 2R1YB 2FECI 4MA3B 4N0UE 1UQSA 5L9DL 4YHLL 4K94L 3PL6C 5C0RL 1JGVL 1PG7L 1S7SB 4LEOA 4WUUA 3SDXA 4YPGA 5C0DB 4KZDL 5F6IB 3GI9L 1N59B 3S3SA 1JV5A 2QSTA 4H0IA 1KCSL 3GSQA 2CDFA 1Y6MR 4FQIH 3VI4F 2CO6B 3Q5TA 4NC2B 1KFAL 1IL1A 4ZOBA 3NFNB 4OI7A 2BSTB 1QP1A 5FECB 2OQJB 1K4DA 1A0QH 3MYZA 2D7PA