3R06B

Crystal structure of anti-mouse cd3epsilon antibody 2c11 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
210
Chain Sequence
EVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWGQGTMVTVSSAKTTAPSVYPLAPATTNTVTLGCLVKGYFPEPVTVIWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTTVDLKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-mouse CD3epsilon antibody 2C11 Fab light chain
publication title T cell receptors are structures capable of initiating signaling in the absence of large conformational rearrangements.
pubmed doi rcsb
source organism Cricetulus migratorius
molecule tags Immune system
total genus 41
structure length 210
sequence length 216
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06B01
1F4HA 2QSCH 2V5SA 1DBJL 5B22A 3VFGH 3OKEB 1JK8B 4HKJA 2VLJA 3FRUA 1NCWL 4KUZH 1C8PA 3SOBH 3QO0B 4JB9H 2Z92A 2DM7A 1TZIB 2C3VA 4IIQA 3FTGA 2AEPL 2HLFC 3RWGA 4RNRA 5L2JA 1CFNA 1CD0A 2DMCA 4U3CA 3SDDB 1E6JL 4JJ5B 1D3CA 4PRPA 4I2XA 3MRNB 4N5ED 1YY8A 4JFED 1AD9B 3L5WA 3X14A 4FFVD 4NWUH 3BGMA 1NFDA 4G8EB 4EEEA 3WDHA 4Y4FB 2BNRD 4KGLA 4EI6A 5T33H 5IM7A 4ONOA 1H3UA 3QIWD 3KXFD 3RX5A 5DK0A 3HZMB 1T1YA 5L9DL 4OZ4B 1U8IA 3FFCD 1IEHA 3L3IB 1MVUA 4BFEA 5F9JB 3PJSB 1EZVX 1EX0A 4AG4H 1YNLH 1FL3A 1F11A 1VPOL 2ARJB 3WFBH 4F3FA 1KULA 4DW2H 5I9QB 1NGYA 4AQ1B 2CDFB 4ZD3H 4LCCC 2OSLA 1NJ9B 5CAYB 5HD8D 2K1MA 4PJXF 4X6CB 1GAFL 1P1ZA 5F9DC 4KRNA 5FO9B 4U1IB 5HHOB 5JNYB 2WIIA 5E6IA 1MRCL 1EO8L 3WLWD 3EKCA 3HMXA 3O6LL 3RGVC 3BIAX 1HQ4A 4UILH 3V5DA 4Y4KC 2X4PB 3IJHA 3QXWA 1MHPH 4HJGA 1A7NH 3DSFH 5T3XD 1JN6A 3BIBX 3QP3A 3B9KB 4OF6A 2EO9A 3ZE1E 3ARZA 3NFNA 4L4TE 2NPLX 3FRPG 2JIXA 4LPWA 4IRSC 1TZGH 5I15L 1RVFH 1RZJH 1C5CH 4P9ML 1XF5B 4K3JL 4UU9A 3WXVL 3RVVD 1DBBH 2Y07H 5JO5B 4NO3B 4QRUA 2F19L 5F1NA 1YPZB 1LO0L 1D6EB 4PJGF 1F2XK 4Y19A 4IS6B 1O5DT 3SDXB 4OM1H 5BZDB 4M6MH 4HMDA 1UH4A 5FM5M 4Z7WF 1C5BL 3T3PF 1X6NA 4Q9QH 1KEGL 3JTTA 2Z93A 4N8VB 1WAAA 1J8HA 2R0KH 2FR4B 1ZHBB 4M02A 3DYOA 4IOIA 4LPYA 3V0AC 4Q0XH 1Y18A 1XMWA 3MBEC 5GRXG 2QQNH 1A4JB 2Q3ZA 4TOYH 1MJUH 1KN2L 3C6LD 3VI3F 4ACPA 4AENB 3N50A 2APWA 3RL1A 2ZUQB 3GHEH 4OZIB 1V7ML 3LSOB 1E4KC 5E9DA 1KIUA 2QR0B 4L3CB 1PX3A 3MRBA 2DF3A 1NDGB 5D2NC 1MUJA 4NDMA 4ZSOE 3JV4B 1ND0A 3CH8A 5DZLA 1CU4H 4KXZI 3MRKB 4ZO8A 2BJML 2ZKHL 1TDQA 4JO3L 4HF5H 5DZOA 3B5TA 5ANMA 2OX5A 2R4RL 5B21A 2FHBA 1RZKL 2W60B 3HUJB 2VXVH 2Q8BL 5SWSA 2N1KA 4I0PC 1A6AB 4PJCB 4GBXD 2VNCA 5JZ7D 2OI9B 3CVHL 4GSDH 4KHTL 5HDQH 4OZHF 4MCYA 1KCKA 3O45B 1JHLL 4NWTH 1IAMA 3CFKB 4U1NB 4J3XA 4PRHD 2HKFH 4K7FA 1G7HA 4UNUA 3VMOA 1P4LB 5BJTA 3INUH 2PXYA 3Q48A 5FO8B 2EIZA 1G1CA 1CT8B 3VFUA 5HXMA 2A1WH 2AI0L 2R0LH 5EIIB 1NCAL 3FB8B 5EZLA 4NCC1 3FFDA 1U36A 1HXMA 3VFRB 2EKSB 4LHUD 3B9EA 5F6IB 4OLZH 1HZHL 2OXHA 5E70A 4JFHD 3UZEA 5BS0E 1IILE 1JGDA 3IS1X 4OB5L 1B0GB 1NDMB 4FABL 2VQUA 1G7MA 5F1IA 1I3GH 3NFPA 4FQJH 3LPWA 4M48H 1A64A 4PJ8D 4U6VL 5D7JD 5F7DA 5CBEB 4V1DA 5GGQL 2WLYA 4X7SL 2DQUH 1JWUA 2O61B 2C5DC 4KUCF 2BY1A 4I3RH 3RTQC 1NGWB 1NGPL 5E1HB 3TO2A 4XWOD 5E94A 5KZCB 1FL6B 2EECA 4JRXE 1JYVA 1SY6H 3NIFF 5FA3B 1UACL 4JPWL 4S1SH 2EEDA 3HMWH 4NGHH 2X1QA 1H0DA 1WBXA 4ELMB 1KIRB 2Y6SC 3WE6A 4F58L 2LFGA 4YDIL 3AGVA 1GIGH 2FECI 1BVLA 2QV2A 3KNBA 3HE6B 2GJ6E 3AC0A 1IGYA 3RUGE 2YZ8A 5D1XD 5DS8A 5JDSA 3KJ4B 4S10A 4ZXBD 4LSRH 3ZKND 2BZDA 4M5YH 4PJDE 1PSKH 4KKBD 2YK1H 1BOYA 2CIKA 3B2UC 4MNGB 5I73B 4U2YA 1W72H 1O7SA 1XIWA 5I19L 4OF8A 5FECA 3CDGA 1YEJH 1VACB 5TE4L 3OG6B 3L5XL 3V6FB 2AJSH 3ARTA 1N6QL 3A67H 1U8MB 3FJTA 3OTTA 1JPSL 1YN6B 4Y2DD 3B8SA 1UYWH 4PGEB 1KC5H 2B2XH 3JZ7A 4OLUL 3GMRB 4JKMA 4GQPH 1UZ8A 4RMTA 4KRMB 2UUDH 3PP3H 3ZDXF 4KDWA 3BVNA 2H1PL 3AU1A 4OT1H 3RVWC 3MMEB 1WSST 3GSNH 3GMOA 1KOAA 1QLRB 3X12B 1Z3GL 2MHAB 1YEHH 3QQ9D 4Y1AB 3GEWB 1DVFD 1SJEB 4JFFB 3PWUB 1JNLL 3TM6A 2JK5A 2X89D 4K7PH 4Z0XB 3Q3GB 3TBSA 2P8LB 4OLVL 4XI5D 1I8LA 2W07A 5DJ2A 1VKXB 1G9MC 3ZE2F 3MLWH 3G5VB 4QEGA 4OD2A 5IW6A 4OQ1A 3V5KB 4GRLA 4YAQB 2VLRB 4NM8H 4C4KO 2ZJSL 4OD1L 3TP4A 4K3DH 3GSQA 5IV2B 5LCVL 2EDHA 2V5YA 4U7MA 2YXMA 1SBSH 1AD0B 3ULVC 3I9GH 1NKOA 4URTB 5DA0B 5IKCA 4WUKL 3N9GL 2DLFH 5A3IC 2I25N 3KPRE 3H9ZA 1L0XA 5ADPL 1CBVH 2W0PA 3DYPA 5C7XL 1SVZA 4Z7NF 1P2CB 1MELA 1P5UA 4ONFH 2NMSA 4U1GB 2FCBA 4BSVB 3TA3C 4P2QA 3IFNL 3FQNA 3ARPA 4KVCL 2OTWA 1DEEA 4U1JA 2BOBA 5F89B 4DN3L 5I6XC 4Q7DA 3MFFA 4L8SB 3LMJL 3BZFB 3PHOA 3GSRB 1JGLL 1CZ8L 3UTZB 5DHVB 1JZ6A 4MNQD 1J88A 4P5TB 4OCWH 3LKPA 3RQ3A 5CJXC 2ICCA 4EBQH 5IF0A 1HHGB 3NFSH 2EDTA 5CSZB 3EUUA 3WHE1 4F8QA 3U46A 3MOBH 4ODVL 2OZ4H 5DO2C 1CFVL 2YBRA 4NO0B 4F7MB 2EDBA 3LRSA 4N0UE 4PJGB 5EZIL 3HI1A 3VXQB 3DROB 4CVWA 4PUBH 4XCFL 1KENH 4LKXB 3L1OH 3V4UH 3PWLA 4Z7WB 1YC8A 2VDKL 4KMQA 5DRZB 3NAAL 5C2UB 1CGXA 4YHYC 2FO4A 3P77A 4PREA 1MAKA 1MFAL 3WSQL 4EDWL 3TIDB 1ZKAA 1FVDA 4X6FB 2Q6WB 2QHLA 1I8MA 3AXLA 4P23D 5TE7H 1CQKA 2J6EH 1OHQA 4C58B 4WV1C 4U6XA 2ADFH 4FXLA 3QXDB 1MLCB 2UWEF 3WNOA 4PY7A 1HYSC 4O2CB 1PQZB 5L2KE 2UZIL 2XWBA 3ARED 1D9KC 4L3EE 3DURA 2XN9A 4JQVC 2Q3AA 4DEPB 1OAYL 2ZCLL 2VL5A 4L29A 4PY8I 1FCCA 3T3MF 2R0WL 4M9OA 1INQB 2Q86B 4HKXA 7CGTA 2Y5EA 5ACZA 4JGJA 1RIUL 4QXTA 4QRRE 3RWFA 1ZT4B 1UENA 3QXAA 4N5EC 4OZHB 3ZE0F 2MQCA 5AD0A 5HGDA 4MDJA 4FFVC 1NBVH 5GSVA 3PNWA 2E7LC 5IVNA 3I84A 2CLZB 4FQHB 4N9GA 2X05A 1GGCH 1IQDA 2VTFA 2XZAH 5KVFH 1CD1A 3QIWC 4HH8A 4UV4H 5GJTL 5ID1A 2Y72A 2W9LA 1VFAB 4ZAKD 1FG2A 5I1KH 2FEDD 1A4KA 4PB0L 3WNLA 1FNGA 4WFEE 4BZ1H 4O5LL 5D6DA 2YRLA 4H26B 4PY8J 1ZGLB 1ZWIB 5GS3A 4NYLB 3W9EB 4F8TA 5C2BL 5KVDH 5K9QG 5IQ9A 5EZJA 3Q6FB 2X42A 5CLWA 2Z91A 4WHTB 3T8XB 4TSCH 4J23A 1XT5A 3HZVA 3MSPA 2QSCL 4KQ3L 2X9YA 3VWKB 5HD8C 1JYWA 4FS0A 3O6FA 3VFGL 1QQDA 4U6HB 2Y5TB 4P9HC 3VA6A 3NZHH 3QULB 2XV6B 4OTXH 4JB9L 5DRXB 3O9WA 1LP9E 4HHAB 1Z0NA 4H0IA 1AGFA 4TSBH 2XTLA 5CSGA 4YBHA 4KI5E 3VFSB 1LEIA 5TF1H 2NY0C 3RJQB 25C8H 3T0VA 3F58L 3D1MC 3P11H 5DYOA 3LEXA 4FZEH 4HIHA 3FQWB 4YDJB 3UJTH 3H3KA 4P3DA 2HLAB 5A2FA 4E41A 3W0WE 3BP6B 4NWUL 1EHXA 4NQDA 3RVVC 5T33L 4MQXD 2HMID 1C16B 5DK3A 2EE6A 3ARFD 4EVNA 1GRWA 5FGBC 1DLFH 2G2RA 1QUNA 1W0WB 3WO4B 4PV9A 3WIFA 1CN4A 4YO0B 3RNQA 4GMTH 3MRFA 4AG4L 3MRPA 1YNLL 3WFHA 4WHYG 2PTUA 2FBOJ 3WFBL 5C08A 4DW2L 1KTDB 3SKUD 4U6TA 4ZD3L 1XGRB 1U3HD 1DANU 4RAVA 3VFOB 3C6LC 4N8CH 5HYJE 1D5BB 5LGKA 3T0EE 1MI5E 4YJZL 4JZJA 3VJ6A 1WWBX 5KSAA 1G7PB 2R29H 4JEGB 2P5EA 4QXWA 4WTXA 3S4SG 2AVGA 4UILL 5HHPB 3BJLA 1INDH 4I9WD 2NY4D 5CD5C 3MGTA 1I7ZB 5C07B 3L95B 1MHPL 3O3AB 1A7NL 3DSFL 1CLCA 1E4XI 3QCVH 1NC2D 5D1ZB 5MI0B 1BWWA 4GBXC 1BHGA 4WI6A 1TZGL 1RVFL 5JZ7C 1J11A 1C5CL 1RZJL 4G5ZH 4YPGA 4KKLD 4LDOB 4U7SA 2Y07L 3BPNB 3ARUA 3PIQB 1P9MA 3PG2A 4HIJB 2AK4D 3TT1H 1ES0B 1I9EA 1FFOB 4OM1L 1NUGA 5TQ2H 4M6ML 4K8RH 1G7QA 4NQCE 2BNQB 4Q9QL 1I3RA 4NN6C 3G6JA 2DWEB 5MEQB 1A7PH 2R0KL 2I9LB 4Q0XL 3GSUA 5L88H 1K85A 4A6YB 2H8PA 2BVEA 2QQNL 3T0AA 4X80H 1N5AA 5T1DH 1MJUL 1MCPH 4NQXB 5EU3A 2MMXA 5K9OB 4OKDA 4XRCB 3GHEL 1JYNA 3B5GA 4F33B 2DKUA 2EE3A 3DXAD 2IAND 3ESUF 3MRDA 4MD0A 4FOMA 2EYSB 4K3HA 1Q9LB 5DJ6A 3VFMB 1CU4L 4UT6H 5FGRA 4OBSA 4MWFB 4OZFG 5T1KD 4XCCH 4HF5L 2HVKA 4ZFZB 4ZUVB 1RZ8B 3C5ZD 2VXVL 4ONGH 4XWOC 4JPKH 1MAMH 1MREH 5JPMA 5J6GA 2AJZB 4QF1B 3BW9A 4GSDL 4GAYB 5HDQL 5DUMH 4PBXA 2DWDA 1C5DB 4XP9H 2XG5A 1WC7B 2NQCA 4H0GA 1QA9B 1FVCA 2HKFL 3D85D 3IAQA 4MDIA 1KJVB 1NAKL 4WW2C 5MERB 1VEOA 3INUL 5C71A 2YSSB 2J1KA 5D1XC 1KB9J 1I9JH 4PYGA 4ZXBC 4NIKB 1NFDF 4ZO6A 4BK5A 1B6UA 4JFDA 2DMBA 3ES6B 3BZDA 1I8KA 2A1WL 3ROOB 5ITBH 2R0LL 3PQYD 4YIQA 1GZQA 5C0CA 4KKBC 4JG1H 3OKMB 3QEHB 2VZ3A 1HCFX 1KCSH 2IQAA 1F6AB 2UWEB 15C8H 2HRLA 3UTSA 5D6CA 5BW7C 1Q94B 2AEQH 5C0BA 5GS2D 2GJZB 4OLZL 3HAEB 1W0VA 1C7TA 5GRJH 2IBBA 1I3GL 2AGJH 4FQJL 1T80A 2FL5B 1XFPA 4M48L 3IDIB 4M7ZC 3TPUA 2D7NA 1MCOH 4POZD 3L3JA 4OZFH 1KYOJ 4HS3B 3IXAB 2VMFA 2DQUL 5HSFA 3QSKB 4I3RL 4Y2DC 4QRSB 4J3SA 5KSUB 4AMKH 4NRXB 2ADIB 3K4DA 1GGIH 3S35X 1N6VA 5CS7A 1FZJA 1SY6L 5ICYB 2BHUA 2ED9A 5EBGA 7FABH 3LKNA 4S1SL 3CFJB 3HMWL 3EO0B 4JJHA 2MCPH 4M61B 1DVFC 2GCYA 2RIKA 3CU1A 1W8OA 1I4FA 1EH9A 3ALWA 5ICXB 2VZOA 4JZOB 2CPCA 3WIHH 5HHNB 4CADA 1GIGL 3MV9A 1UG9A 4KVNH 3S37X 4QOKA 4ZUTB 1DSFH 3EYQD 3MYJB 2X09A 2LTQC 4LSRL 4LQ1A 1PYWA 4IJ3C 4M5YL 1BQHA 3BP5A 2F53B 4XH2B 4B5EA 2YK1L 2CRYA 2VUYA 5EBMA 3ROLB 1JUFA 4C56A 4XNMB 2HYMA 2YPVH 4KMTH 4BQ8A 1FL5B 1W72L 4E0RA 5DD0H 1WBYB 1N59A 4U49A 4YBLB 4KK8D 4J3VA 4R97B 2FYYA 2AJSL 3O4LE 1ZLUK 3BH8B 3GO1H 3WN5C 5C0AE 5TH2B 1E27B 3A67L 3HR6A 4RSVA 5AAWA 4XBPB 2WSKA 1UJ3B 1UYWL 2X6MA 3R1GL 5HVGB 4LMQE 1P84K 1KC5L 2BDNH 3OG4B 3VFWB 1QBAA 2ZZUT 4PP2A 4H25A 4JZNA 5EWIH 3O3EB 2HH0L 4YHOH 4OT1L 4G6KH 1HQRA 3GSNL 3VGBA 1DQTA 1YEHL 2J8UA 1U2HA 2XA3A 3D39E 3VRJA 3DX9A 5CJQH 4K7PL 2CLRB 1GGTA 4LPCA 4Y16D 1EEYB 4UOJA 4LCCA 5I66B 2P1YA 1GC1H 3MLWL 3QUXD 4P57B 4KZDH 3EFDH 3F7PC 4U31A 32C2A 5T3ZL 4NM8L 5IB4A 1KG0A 1T1WA 1EEZB 3ZDYF 2WBJB 4K3DL 3STZA 3RGVA 1SBSL 2B4CL 4BFIB 1C12B 4NKOB 3I9GL 5IHLB 4P23C 2V7HA 3FQTA 4HUVA 5H8DA 1T7VA 2DLFL 3TIEB 5EUOA 5I30H 1MCIA 5EA0H 8FABA 1P7QB 1S9VB 2ESVE 1AO7B 1CBVL 4IRSA 3L3HB 1CICD 2APBA 4FTVA 4X6EA 4KRPB 4AJ0A 3SKOA 3IETB 3K8MA 3AREC 4MJ6B 2ATPB 1TNNA 4X5XA 5CGTA 2IPUG 1S9YA 2YPLA 5DQJB 5T3ZE 3RWDB 4JCMA 5GGSB 3RRQA 1ZT7A 5L6YH 3CSGA 4UT7H 1A6ZB 3RNKB 5EOCL 1IJ9A 1N0XH 4OCWL 1FYTB 5AEAA 1X5LA 1NAMA 1ZANH 1XGPB 1VFOA 1ACYH 3F5WB 3NFSL 4TQEH 5KANG 1FNLA 1TVDA 3CC5A 3MOBL 2OZ4L 3JUYA 4QHLA 3MREA 1RIVH 3EGSA 3H8NA 3SGJC 3LKOA 3OKDB 1KJ2H 3O2DA 1JGEB 2J12B 5A1AA 4D9QE 1E4KA 1KENL 1YEDA 3L1OL 4XHJD 1A2YB 1FNEB 5D71H 3V4UL 3RDTB 5D2NA 4OV5B 3P40A 2GQHA 4ZAKC 3MUGB 3SJVA 2RFXB 1FAIH 1BPVA 3TBTA 1DDHA 3MRRA 4D0DB 1IE5A 4LVHB 5TE7L 2J6EL 1V3LA 2ADFL 4U1KB 5F9OH 4YDLC 4I0PA 5DJZB 2GUOA 4NO2A 4OCLC 1RFDH 4XP6H 1FZOA 3RWJB 4XVJL 5TDPB 5CLTA 4OI9A 4DTGH 1L0QA 1VFUA 3P4OA 4HGWB 5J12B 1F3JA 2DD8H 5IROC 1MWAB 4U2ZA 4L8DB 4BK4A 2VDNH 2EC8A 4JRYE 4ZUUB 4MXWH 3HKFA 3MNVA 1UWEH 4HKJB 1CGUA 2VLJB 3FRUB 3SCMA 5J11B 3BGAA 4JVWA 2Z92B 2BOCA 2VWEE 4JREC 3G5XA 5DVNA 2C3VB 4IIQB 5BO1H 3FTGB 2EKJA 4Z0BH 3RWGB 1NBVL 4LVOB 4N1EA 4RNRB 5L2JB 1CFNB 1N64H 4MQXC 5JMRA 2HMIC 4I2XB 3C8KA 1GGCL 2QQQA 5KVFL 2GIYA 3ARFC 1YY8B 4UV4L 3L5WB 3VI4F 3X14B 1MCHA 3BGMB 1NFDB 5I1KL 3KPSD 3IFLH 4EI6B 5IM7B 4PG2A 5JQ6L 3NVQA 3RTQA 1ADQA 2IAMC 4BZ1L 3OGOE 5DK0B 3IKKA 1T1YB 1T20A 4TNWF 5J13C 4APQD 5GGSY 3DX8B 4FQXC 5KVDL 1MVUB 2P48B 3JV5A 1U3HC 5D8JH 5DJ0A 1FL3B 1F11B 3OSKA 1INEH 3VD7A 5SWQB 4MQ7A 3D69A 1K6QH 4F3FB 5B38A 4X7DC 4PJFA 3A6OA 3NZHL 5GGTA 4UOW1 4XT1C 1H3VA 4OTXL 4K07A 3OKLA 4P59H 4HC1A 2OSLB 3G9VA 2NY4C 1P1ZB 2VC2H 5TF1L 1T89C 2NY6B 2WIIB 25C8L 5E6IB 3P11L 1IBGH 4FZEL 1X5XA 4P5KA 4Y4FC 1AR1D 1PD6A 1PEZA 1HQ4B 3V5DB 4X9GA 4I18A 1MCWM 3IJHB 3PWPA 4HJGB 4KKLC 2AK1H 2VXQH 4NP4H 1JN6B 4NQVA 2ZOKA 4X6CE 4NNPH 3OJMB 5DURB 3QG7H 3NFNB 2JIXB 1R3KA 4FQPA 5E8EA 3PV6A 1DLFL 3NH7H 2WUCH 4UU9B 4RX4D 4PJDA 3GM0A 1ZT1A 1Z6JT 4OD3H 1BVZA 4H1LA 3QZWA 4GMTL 4OZGA 3ULUL 4Y19B 3T2QA 3MNWA 4A6YH 2A73A 3HG1A 1NL0H 1XGUA 3JTTB 2MCG1 5D7LD 2XKNA 1J8HB 4N8CL 3FB6A 4KK9D 4S2SA 3E0GA 4G7VH 1YPZE 3WD5H 5E2VH 3WL9B 3V7AG 3AMLA 3BD5A 2B8OT 5J56B 3SDXE 2R29L 4JO1H 4HWNA 4U1SA 1WTGT 3I75A 3RL1B 3MRLA 1DUYA 3HNSH 1INDL 5T1LD 2BY2A 5E9DB 3ULUE 3MRBB 4BQCA 4WENB 4NC2B 3C5ZC 1MUJB 4NDMB 4RA0C 5JHDD 3V0WL 1ND0B 4IDJH 4A2MA 1V3JA 3MLVH 2RHEA 2ZUWA 3HRPA 3GMQB 1XCTA 5DFTA 3KPQB 1QVOA 1DBKH 5DVMA 1IGJA 5ANMB 2MKLC 4OCXH 5JIKA 5SWSB 3ZTNH 4PFEA 3OAZH 1A7QH 3D48R 1M4KA 3ZT5A 3TT1L 4AM0A 3QWRA 5DDHA 5TQ2L 1A7RH 2W65A 4K8RL 5EC2A 5CSBA 4MCYB 5EH1A 3IVKA 3TA3A 3C60D 3MA7A 4L8BA 5F6HI 2DQHH 1M71A 3TYGH 1A7PL 2Q87A 1G7HB 3HUJE 5BJTB 2X4RA 4KDTC 2PXYB 4PJCE 2AJ3A 2EIZB 1CQYA 2ZUQC 2Y9RT 4X4MA 4X80L 5T1DL 1T3FA 5K33A 4M7LH 5FKAA 1MCPL 4I3SH 5CJXA 5GGRA 2G5BA 1FH5H 5EZLB 4LCYA 4AIZA 3FFDB 1HXMB 5F7EH 5FA4A 2L7JA 4G6JH 1V8HA 3E8UH 5E2WH 4LKCA 3RVXD 2R2EB 4JM4H 1HWHB 3LAFA 4NBYB 4UT6L 2X4UA 1JGDB 5J6HA 4XCCL 5F1IB 1G7MB 3NFPB 1EVTC 3S5LA 2VZVA 5F7DB 3EZJB 5B39A 4ONGL 4V1DB 4JPKL 1MAML 1MREL 4JY5H 5F6HJ 1JWUB 3ZT6A 4YLQT 4OF5A 3LRGA 4WV1A 5DC0A 1TCMA 3MRCA 3TO2B 2YA0A 5DUML 5E94B 1ZOXA 2H3NA 4XP9L 5FV2A 2NLJA 1WTLA 3QDGA 4TN9A 1EEUA 4M7KH 5EUKA 1G9NH 2WUBH 1D9KA 2BSSA 1H0DB 1WBXB 3EYQC 4OQTA 1I9JL 4JQVA 3WE6B 5ITBL 4RDQG 5EBLA 1BVLB 1XF2A 3KNBB 4JG1L 1IGYB 3DO7A 5DS8B 5JDSB 1RZGA 5L7XH 4PGDA 15C8L 2AEQL 2GTZA 2CIKB 4HUXA 5HDBE 4ELME 1BF8A 1S7WA 3LN4B 1CFBA 4KK8C 5GRJL 3TYFB 2R4SH 1J12A 3BE1H 3CFEA 4JFEA 2AGJL 1JL8A 3IS0X 1BP3B 1MCOL 2BNRA 1T2XA 3RZCD 1XIWB 4HWEH 5TF0A 1GSMA 2NXYB 2P5WD 3CDGB 4UMGA 5FECB 1CWVA 4MXVE 3QIWA 4AMKL 2OP4H 3KXFA 3QDMD 3HLAB 1TLKA 3T0ED 1MI5D 4YHLL 4XP5L 4O9HH 4MNGE 1RSFA 4NQED 2EE9A 3V52H 3X3GH 7FABL 4DZBB 1Q0XH 3BEWA 1L7IH 1UZ8B 3GJFK 1UFUA 2MCPL 2GSGA 4NJAH 5CKGA 3REVA 3AU1B 4Y8AA 1D7FA 4U6YA 2VAAA 2LU3A 1ZEAH 4KVNL 1NANI 3Q1SH 1PKQA 3X3FH 1DSFL 4DGYH 1OB1A 4ZFGH 3BPLC 2JK5B 4MA1C 4UI2A 5I74B 3TBSB 2Z4QA 3SKNA 1G6RA 1T2QH 5DJ2B 3NCEB 3FOLB 4M7JH 1WWAX 2BVOB 2YPVL 4OD2B 5IW6B 3CK0H 4GRLB 4KMTL 4Y1AE 1HE7A 4YQXL 3G6JF 4JFFE 2EIBA 5DD0L 3GSQB 4LVEA 1UM5H 4FRWA 4AEEA 3MNZA 3GO1L 5IKCB 3SDAC 1J7VR 2A2QT 4OI8A 3BUYA 3QWOB 4F37F 1LP9A 1OY3B 3ARBD 4N90D 3KAAA 5FGBA 2VLRE 1T1ZA 2BDNL 3PDGA 1X3DA 4YGVA 4YXKL 5EWIL 4HX1A 4YHOL 5F97E 4G6KL 1OQXA 4P2QB 2J5LC 5L8LB 3TBYA 2OTWB 1DEEB 4U1JB 2BOBB 3V4PH 3MFFB 1JRHI 3PHOB 5CJQL 4PRIA 1D5MA 5CP3A 3QYCA 1BD2B 3U30C 4QHMA 3C6LA 4YC2C 4HKZA 3LKPB 1NCNA 3TN0D 1GC1L 4C59B 4CN6A 5IF0B 4KZDL 3EFDL 2ITDA 2CXKA 3Q5TA 2YBRB 4UTAH 2QKIA 3LRSB 4P5MA 1LILA 1JJUA 5DVOA 3GMPA 4YX2H 5D5MA 3DRQA 1JZ4A 2GY5A 1WLHA 3PWLB 4WWID 5I30L 3GSOA 5CJ8A 2FO4B 1OSPH 3P77B 5EA0L 2GK2A 4GBXA 4U1GC 3UAJD 1FVDB 4TVSa 3AXLB 1FZMA 1J8KA 5FEBA 3DIFA 3O2WH 4PJGE 4U6XB 1OSZA 2BVUA 2QSQA 1JZ7A 1RZIA 2NY7H 2H26A 4KPHH 1L6ZA 4DZ8A 4PY7B 5FYJU 2DJUA 5CJOH 1JHTA 1I8IA 2XWBB 4PRHA 4Z7WE 3T3PE 1I1CA 5KN5A 5F9WB 4P5TC 1FNSH 3IGAA 4W68A 3DURB 2EYRA 5IMMA 2XN9B 5L6YL 3G08A 4UT7L 5E08H 3PGCA 2HWZH 5JW5A 4NKDA 1N0XL 2VL5B 2E7BA 4L29B 5EFIA 3UBXI 3UTTD 1A14L 3EDJA 3BSZH 2XY2A 3UBXA 1ZANL 4ODTH 4X8JB 1ACYL 4RWYH 4WU5A 4LHUA 3VI3E 1WIUA 4G8GD 1RIVL 3KLHD 4HKXB 3WUWA 3U4EA 5ACZB 3DMMD 1OAZH 4Y8DC 4QXTB 4PV8A 3V8OA 5I18H 2HP4A 4ZQKA 5F7MC 5ECJE 3RWFB 3QXAB 5AD0B 5HGDB 4MDJB 4PJ8A 2EDEA 5GSVB 3PNWB 1FAIL 5B39G 4N9GB 4XVTH 4DOHB 1IQDB 1CD1B 5K59F 5F9OL 1FG2B 3KS0H 1A4KB 4APQC 1RFDL 1KIPA 4XP6L 5I1JH 4OZHE 3VGGA 1ZVHA 5I2IA 4DTGL 2K9UA 1T6VN 3PXHA 3JWOH 4V2BA 2DD8L 3TNMB 2WINA 4XCEB 2VZSA 4YHPA 5IQ9B 5FHBH 5EZJB 3N0PB 4AZ8A 3SE4C 1I1AD 2VDNL 4WW2A 2EDKA 2Z91B 4MXWL 3RIAK 5D1XA 3TT3H 3MXWH 3HZVB 3UYOD 4ZXBA 4LGPB 3O6FB 3DSNA 1QQDB 5EPMA 2LQRA 4WRLA 5A43C 3BKJH 3HMXH 4HIIA 2V7NA 3CFCH 3NIDF 3O9WB 5GZOC 2R39A 4NZJA 1AR1C 3B5HA 5BO1L 4Z0BL 2DQJH 1LEIB 5BW7A 2DIBA 3EZ8A 3P0GB 1N64L 5DYOB 3ZO0A 3LEXB 4HIHB 1RJCA 1GGBH 4P3DB 4IHOA 3FOMA 4JM2D 1T7YA 3VDCA 5CKAA 4E41B 4K55A 3WBDA 3ZYIA 2BX5A 4GKSA 4NQDB 3M1BA 4DN4H 5JUEH 3IFLL 4L4VD 3QEUB 3MUJA 4Y2DA 3GRWA 1F3DJ 4LIQH 2HA1A 1KCUH 2G2RB 3NIFE 4PV9B 4YHKH 5MEND 5E8OA 3WIFB 3KG5A 2QQLH 1OLLA 3RNQB 3MRFB 5H37H 4ZS6D 5IUSA 5D8JL 4M6OH 3WFHB 3OAYK 4KK9C 3NCJH 5I1CL 1DVFA 2PO6D 4Y88A 1INEL 2MTPA 2VQ1A 5KAQF 2X89A 1K6QL 1YJDC 1AQKH 3ALXA 3CVIH 4WTWA 5EUOF 4M62H 2ESVD 2KL6A 4RAVB 4CMHB 4P59L 2PETA 4XVSL 4FQQA 4LSQH 5DUPL 3VDBA 5J1SC 1FFNA 2VC2L 1R5WA 4JZJB 3AS1A 3VJ6B 5KSAB 2IPUK 2NY2D 5E5RB 4PJ5E 4HFWA 1IBGL 5E2TH 3DLQR 4KXZH 3FQXA 1FNFA 2YD1A 1IMHC 3VGAC 1A6WH 1TQCB 3MGTB 2NY3D 1JP5A 5FV1L 2F15A 2AK1L 2VXQL 1WT5C 2A6DA 3QG7L 4HV8B 1XAUA 3NH7L 3WN5A 2BHYA 4MMZC 4YPGB 2WUCL 5GZND 5GXBB 4OD3L 4K9EL 2DS4A 3M17A 3C60C 4MLIA 1PAMA 2EDRA 2PW2A 3ZDXE 5C07E 4IDLA 5I76A 1RV6X 4A6YL 1G7QB 1HHKA 4HD9A 1NL0L 2G75A 2DJSA 1I3RB 2B0SH 3G6JB 4MNQA 5BV7B 3ZYOA 2CMRH 3QUZD 3O4LA 4G6AD 4X5LA 1MLBA 2GW5A 3GSUB 4AY0A 2AAVA 4G7VL 4LLDA 1GCFA 2H8PB 3B4NA 5E2VL 4V2CB 1UM6H 1N5AB 1J0YA 3CAFA 3H2WA 3U0PA 4JO1L 4ORZC 4BFBD 1KYOK 4YK4B 3GNMH 5EU3B 1CL7I 3QXUA 5HGBA 2BNQE 3HNSL 5IFHH 3BN9D 3GJEA 4G43A 1BWMA 4EXKA 1X44A 3KYNA 3MRDB 4MD0B 3QEQD 4LU5H 3MLVL 5DJ6B 4BSJA 1JMXA 3BPNC 2WV3A 1IRAY 1DBKL 4P23A 3RVUD 3MLYH 3QXVA 4G6FD 1XCQA 4DKFL 5J6GB 3ZTNL 5JPMB 4QLRA 1PY9A 5CEXA 2E5EA 3JWDH 1A7QL 4LLQA 4UTBH 3HFMH 1G7JA 3BW9B 5EU4A 4UV7H 3AREA 1MJ8H 1A7RL 5B3JE 4RGNB 2HFGL 2DWDB 3BRGC 2DQHL 3RWHA 3MXVH 4ZNEE 1AXTH 3BT2H 4MDIB 2G5RA 1NGZA 4GXVH 2D7PA 4NT6B 1IZKA 4MLSA 2PUQT 3Q0HA 3DJ9A 4WI3A 2DI9A 5E99H 1I8KB 4LHUG 4M7LL 4I3SL 4WNQA 1GZQB 4YIQB 5C0CB 2XG4A 1FH5L 3HE7D 3QEGH 5F7EL 4OFPA 2IQAB 4G6JL 1CR9H 1JV5A 1WCQA 3E8UL 5FYJE 3SGJA 4XBGB 5D6CB 5EZOH 4JM4L 3RZCC 5C0BB 3UDWC 3K1DA 4XPHH 1CLOH 2DTSA 4XVUC 1EUTA 3CJJA 4JN2A 1BQLH 1ZAGA 5CGMA 3GGWA 2OCFD 4ZAKA 3I02B 3ZT7A 4PJBA 5GGVY 3TPUB 1P53A 3H9YA 4JY5L 3SBWC 3L3JB 4PJFF 3E1F1 5EU6D 4X5WA 1BEYH 2UWEE 3U7YH 4MSWA 5FF6A 5D7SH 5I1AA 4L9LC 3F12A 5HDLA 2I07A 1FZJB 3NACH 5F7HA 1AH1A 2FH6A 4L5FH 4X4YA 1YNTA 2PCPA 3SDYH 3LKNB 4M7KL 4X7EC 1G9NL 2WUBL 3IFPB 4Y5VC 1BQUA 1UB5A 5T1MA 5IROA 4F7TA 2GCYB 5FCUH 4M3KB 1P4IH 1I4FB 3FO9A 4Z6AT 1HXYB 1FHGA 5EDXA 3MV9B 1F00I 3T3ME 4LCWA 3ZHDA 3OAZK 3FO0H 5E8PA 2X1PA 3I6KA 5L7XL 5BQ7A 4DFHA 1FBIH 4PJDF 1PYWB 4Z7QE 3GM8A 4YHMH 8CGTA 2W0LA 3E6FA 1BQHB 3BP5B 5GS0C 3NCMA 4X6BA 1BJ1H 3ZE0E 5EBMB 4OZGF 1JUFB 3BXNA 1A02N 3A6CH 4C56B 3BESR 4OLEA 3MV7D 5HTSA 2R4SL 4D3CH 3G04A 5LGJA 1U6AH 3BPOC 5L0QC 1AIFB 1MPAH 1BGXL 4LSSH 4E0RB 3KYKH 4FFWD 1VERA 4JDVA 1N59B 2DQIL 1MHCB 5MEPA 1JWSA 3TJHD 2OP4L 3ARFA 4KC3B 3RL2A 2PYFB 1T5WA 2FYYB 3CMGA 2F53E 4O9HL 1KPRA 1KB5A 2ED8A 4XCNA 1WCBA 1TCRA 2V6HA 4GKOA 2IAMA 3V52L 2V2WA 5IB5A 3X3GL 3S9DB 1S78D 4HULB 4L1DA 4XXDA 1Q0XL 3RHWF 4PP2B 4H25B 4JZNB 4HEPG 1L7IL 3QDHA 4NJAL 4FQXA 9CGTA 4EUPG 1HQRB 3EJZD 5F1SA 1U3HA 4PRAA 3CMOH 3OGCA 1ZEAL 3S88H 2J8UB 3Q1SL 3VRJB 5I16A 3SPVA 3ULVF 4YR6A 3X3FL 3B6SA 1S7TB 4ZFGL 3CD4A 4LOUD 4XBEH 1F13A 3OL2A 1ZXQA 2F58L 1K5NA 4XX1G 1T2QL 4LCCB 1RUMH 2MQ0A 1U95A 1ZHNA 4K94H 1W2KT 2YKLH 1M05A 2KQNA 5JR1H 1ZS8A 4M7JL 32C2B 3CK0L 3FMGH 1T89A 5IB4B 1KG0B 1T1WB 4QWWD 3BX7C 2F9BT 5D1QD 4G8EA 5DR5H 3LQAH 1NC2A 4Y4FA 5A2LH 3UAJC 1RK1A 2V7HB 3FQTB 4HUVB 4HCRH 3HZMA 1L6XA 4BH7A 5GGUB 5EUOB 1FQ9C 5CZVH 8FABB 3BD3A 1IFHH 4GXUM 4IRSB 2AK4A 4FTVB 4X6EB 1PLGH 3SKOB 1BBDH 4JN1H 4UIMA 5D9SA 2MOVA 2Y06H 3MC0A 1CD8A 4XMKH 2HG5A 5IG7A 4K8RD 3UEZA 4LLVB 4X5XB 3O6KH 2YPLB 4WHDA 2ARWA 5EULV 1P4BH 4EUPH 1YDPA 2VE6A 3V4PL 4XPBH 1ZT7B 3HC0A 4XNQA 1AO7E 1F8TH 3L5HA 5H2BA 4EDXA 3KLHC 4Q6YA 5HHOA 2AV7A 1NAMB 4MD5A 4PTTA 3DMMC 1AP2B 2WBJC 5I1EH 3CC5B 1HHIA 2IANA 4QHLB 3MREB 1SBBA 3EGSB 3S3PA 4UTAL 3LKOB 2OLDA 2DLEA 5EO1A 1DEDA 5BRZB 3VG9C 1DLHA 1OARH 1KELH 4WY7H 4YX2L 5T1KA 1YEDB 3KPOA 5D2NB 1FYTE 4DVBA 3C5ZA 1U8OA 3ET9F 3D18A 4MJIE 5IBUB 2Y25A 3SJVB 3D9AH 4QRTB 2UY6A 1OSPL 4MAYD 4HBCL 3TBTB 2E9JA 5KG9A 1DBMH 1DDHB 3MRRB 1M7XA 1Q1JH 3WS6C 2YC1B 2NY7L 4I0PB 4KPHL 3DECA 2GUOB 1QG3A 1Y0LA 4NO2B 5CJOL 3UROR 4Z5RA 1TTFA 1ITCA 1FZOB 4OGYL 3D85A 3NABH 4N8VA 1FNSL 1TXKA 3P4OB 3HE6D 4PD4K 1F3JB 1IC4H 2Z8RA 5E8DL 5E08L 2HWZL 5FXCH 3PQYA 4I0CC 1G0XA 3BSZL 4RMWA 4ODTL 3O2VH 3AM8C 4KDTA 4OFVA 4DKDC 1T66D 4TUKH 4PB9H 4WFHE 2E6JA 4OZIA 3MNVB 2A83A 1EHLH 4TVPE 5BZWA 3EOAA 3VRLE 3RDTC 2NYYD 1I75A 3SCMB 4XTRC 5KW9L 1OAZL 5I1GH 2OR8A 1CD9B 1DQQA 2BOCB 3BRDA 5I18L 3G5XB 1MCBA 3MRKA 4JM2C 1BJMA 3NPSC 4FFYH 2Y4SA 2AJYH 4LVHC 1RIHH 2HAZA 2IMNA 3EDKA 5GRVL 5T5NG 4XVTL 3C8KB 3KWWA 4R0LC 2UYLA 2B20A 2VLJE 3ZHLA 1DJSA 2YMXL 3AY4A 4FHBD 2Y7QA 2OK0H 1AGCA 5J12C 5I1JL 3RTQB 3VFNA 1A9BA 1UKSA 4CUCA 3P3YA 2VXTL 4WFGE 1IM9D 3JWOL 2PO6C 3GMMA 4I2XE 2BMKA 2A74A 5IWLC 3IJYA 3NZ8A 5FHBL 5I71B 2DKMA 3OXSA 2HVJB 1NFDE 5DJ0B 2A38A 4G9DA 4PJAA 3TT3L 1MVFA 3MLZH 4MQ7B 3ARGD 3D69B 4NBZB 5B38B 4PJFB 4MVBC 3CH1A 1X6LA 3BKJL 4IEFB 1LP9F 3MRGA 3HMXL 3CFCL 3OKLB 4LVOC 3UPAA 4CU7A 3IDUA 3QG6A 2DQJL 4RMVA 4LNVA 5DJCA 1E4XH 5JW3H 2YWZA 4P5KB 1Q72H 5D4QA 4I18B 3PWPB 4DN4L 3EOTH 5JUEL 2ZSWA 2F54D 3IXTB 4NQVB 3QUKB 4LIQL 5E8EB 3PV6B 4JFZH 3FQUB 1KCUL 2AABH 1MRFH 3O81A 2E6PA 1ZT1B 1QBLH 4YHKL 3FHQA 1GJIA 1BAFH 2MWCA 4H1LB 2QQLL 3QZWB 1KIQA 4OZGB 4YFDB 1MIMH 4HT1H 4M6OL 3QUZC 4G6AC 3NCJL 2X4NA 1RUKH 5D5MF 5EU7E 3MNWB 2A73B 3HG1B 3O8XB 1AQKL 4UAOC 1U0QA 3CVIL 1F4YH 2XKNB 3FB6B 3CZFB 4KU1A 2EICA 2H41A 4S2SB 5EG6C 1VENA 4LSQL 3F7YA 3BN9C 4LIQE 4Y19E 4EI5D 5JHLH 5E2TL 2P44B 5CHNA 4U1SB 3I75B 2IBGA 1A6WL 5HHXH 4M8VA 1WAAE 1J8HE 3RVUC 4PG9A 2IFGA 2C9AA 4LQFH 5HYIA 3OB0K 3KYAA 2CKBB 1CICA 1XCTB 2X4QA 2VITA 1FZKA 3MTRA 1IGJB 4OAWA 3SDAA 4MS8C 2P42B 4Y0GA 3AAZA 2VDQH 4YEEA 5F70A 5E9DE 1QLRA 4AM0B 2Z31D 5DDHB 5C0FB 2W65B 5EC2B 3RU8H 3MUY1 3IVKB 5H94A 1B4RA 5DJ8A 3BPCA 3MA7B 1T04A 3PWVA 4L8BB 4RGOH 1M71B 5ANME 2CMRL 4PJHA 5SWSE 3FO1A 2X4RB 2IG2H 4UDTA 4JHBA 1M7DA 2AJ3B 2VLME 2XFXB 1FNAA 3TF7C 4J8RA 1T3FB 4MB3A 5C1MB 3ORJA 3BISA 5FKAB 3QUYB 5GGRB 2ZG3A 5LQBH 4GRWF 2G5BB 4LCYB 4AIZB 5IFHL 3ZDYE 3KR3H 4WI8A 1LO5A 5FA4B 3O41A 3SE8H 1JTTA 4ISVB 4MQSB 1KCLA 5C0JA 5C86A 1YEIL 4LU5L 4G3YH 1G1YA 3H9SD 2X4UB 4WW2F 3H6JA 2NY5C 5J6HB 1RZFH 1JPTH 3NCCB 3FZUD 4MX7A 2W9DL 1P2CA 3FL7A 2X4OA 3MLYL 3S5LB 5B39B 4YHYB 2VDRH 2FD6H 1A3LH 1L4IA 1JPGB 2A6IA 2YPKB 5LAXA 3JWDL 4KTEH 4X4ZA 5F8QC 4UTBL 3HFML 4WV1B 1HOCA 1S7QA 3MRCB 4UV7L 5HPOA 1MJ8L 4XGZA 3IDJA 5IK3A 2H3NB 3PP4H 1MFDH 5IJKC 5F3BB 1ZHKA 2NLJB 3QDGB 1AXTL 2FECL 1XF4A 4V1DE 5EUKB 1D9KB 1ZLWH 4WDIA 3UJJH 4KUCD 3S36H 5CSZA 1QEWA 3TLRA 5E99L 4CAGA 1YYMH 3ELAT 5EBLB 1XF2B 1JNNH 1PG7X 3VD5A 1S7RB 5J3HD 3QEGL 3DO7B 1A7BA 1RZGB 3WFZA 1CR9L 5E4EC 4PGDB 5HVFB 4ZO9A 5EZOL 2GTZB 4HUXB 4J12A 1S7WB 4XPHL 1CLOL 5D2LA 2VDLH 5KVMC 3CFEB 3BD4A 4JFEB 1P6AB 4Z18A 3IDXL 1GH7A 4YBQC 4Q58C 1AXSA 3KPSA 5E2UH 3HHRB 2UVFA 1JNHA 2BNRB 4OM0H 2L7UA 3TZVD 1F4AA 1A47A 4RFNC 2DN7A 3QIWB 1BEYL 3KXFB 2YD5A 1S78C 3U7YL 1WWCA 2QLVB 2XWJA 1GZPA 2AQ3A 4APQA 4PJ5D 3FFCB 2I9TA 1N8ZB 3NACL 2DKSA 4BQBA 4KTDL 4L5FL 3SDYL 1GYAA 3BEWB 2D7MA 2DLGA 5CGYD 1KGCD 2GSGB 5FCUL 5SX5K 1P4IL 3REVB 4YHNA 1H3XA 5IP4A 2FDBP 1G0YR 3E3QC 1S3KL 1NCWH 4QXGH 3FO0L 1PKQB 3V7MA 1OB1B 1FBIL 5EC1A 4AEIH 1IEBA 1OTUD 1ZT4A 2Z4QB 3SKNB 5BMFL 4X6DA 1FDLH 1G6RB 4QWWC 3CX2A 5D72H 5E5UB 3ISWA 4XMLH 2ENYA 4FP8L 4LEOA 2NY0B 5CEZH 5D7KD 5ADOL 1MPAL 4LSSL 5JMOC 3VI4E 3KYKL 1FPTH 2FWOA 3QA3B 3WXWH 3DOSA 4QYOA 4XNXH 1PG7W 3MNZB 4RX4A 2DLIA 4S1RH 3WUZA 4XMPL 3BUYB 4LSUH 2EC9U 1T1ZB 2XZZA 3TBWB 2QADD 4YGVB 3U9UA 1D5XB 2C1PA 4HX1B 4LHJB 5F96H 1T5XB 1RK0A 3CMOL 5D7LA 3TBYB 4BH8A 5CBAA 4CNIA 3S88L 3K8LA 3N1QC 3DUUA 2YWYA 4HHAA 2JJVA 3C2SA 4MQTB 4XBEL 1D5MB 5D93C 3T4AA 4QHMB 3C6LB 4KI1A 3DX6A 2YUZA 1RUML 1OWRM 4GRLC 2DLHA 4HKZB 4K94L 3P2TA 4WO4D 2Y36H 2YKLL 2ATKB 5JR1L 4KV5F 5CFHA 4P2QE 3VXUD 2ITDB 2HLAA 3FMGL 3BP6A 4PJ7A 1FIEA 2FX9H 2QKIB 1NUNB 3I3DA 5JHDA 5DR5L 4P5MB 4HZLB 3LQAL 4GAFB 4Y2OA 3GMPB 5D5MB 3DRQB 1BD2E 1DQMH 2HT2C 3L7EA 4HCRL 2XZCH 1X5GA 3GSOB 1WT5A 3BFOA 3V8CA 5CZVL 5ACLA 3FQRA 3QUMH 1CG9A 4GBXB 5DHYA 2YN5A 5DVKA 4F15B 1FZMB 1WIPA 1PLGL 4ODSH 1HEZB 3DIFB 1BBDL 5HGHA 1OSZB 5E2JA 1RZIB 2H26B 2Y06L 4DZ8B 3P0YH 4P46D 3C60A 3PL6D 4XMKL 1JHTB 3MGAA 1I8IB 4WJ5A 3O6KL 4PRHB 3T2NH 5KN5B 5E95B 1P4BL 3IGAB 5MHSE 4CVZA 4XPBL 1XZ0A 1T66C 2EYRB 5IMMB 1F8TL 3G08B 4YHIB 4PJBF 4NN6B 2BSTA 3PGCB 5JW5B 4NKDB 4IOSD 1ZA6A 1BFSA 5EFIB 1U3ZA 2NYYC 4I0KA 3UBXB 4PS4H 3QFJD 5CUSH 3EW3B 3ARDD 1N6UA 1HYRC 3C09C 4JFXA 5I1EL 4LHUB 1KF9B 4JFYA 4N0YH 2UV3A 1I7ZA 1BX2B 4M1DH 4GAJL 1NUFA 4IMKA 3U4EB 3WUWB 2AEIT 4NZDA 4XPAH 2XN9E 1OARL 4WY7L 1KELL 4PV8B 4ZQKB 2XWTB 4PJ8B 5D7JB 1H3GA 3D9AL 4HLZG 1XEDA 2JF1A 2X44D 1UXWA 3N1MC 2ID5A 1DBML 5AZ2H 1A5FH 4O2EA 5A2KH 2OMNA 1Q1JL 4TTDC 1JZ2A 4AH2A 4BQ9A 4MHHI 2FIKB 3D3VA 1KIPB 4GRWB 1H3PH 3NABL 3K8KA 5I2IB 2JLLA 1T7ZA 2KKQA 5ETUB 4X9BA 1IC4L 2WINB 4DOHE 1N3NA 1MSPA 3ARGC 2BP3A 4YHPB 3TH4T 2N7AA 2AI0H 4WW2B 2CDEA 3O2VL 2DLTA 5D1XB 3OAUH 1XH3A 4TUKL 1LK3H 4ZXBB 4PB9L 5GJSH 1KACB 1I9IH 5EPMB 1NH6A 5CJBA 3R8BB 4Z76A 2RBLA 1EHLL 2IH1A 2WAHA 2EE2A 5TFSH 4HIIB 5I1GL 2V7NB 4R90H 3VXSD 3OXRA 3WIIL 1Q9LA 5I17A 2C4FU 2EDOA 5GRWA 3RPKA 5D70H 4FFYL 43CAA 1QR4A 2AJYL 1RIHL 4W6YB 5J7CC 1RZ8A 5DUBA 3UDWA 3RZCA 2I60L 2P5WA 4XCYB 4IHOB 3QDMA 3FOMB 5B4MD 3CNKA 4ZOCA 4HLZH 4KROD 4M7ZB 3EYOA 4QF1A 5DJAA 3UTPD 4LFHD 4GKSB 1DFBL 3M1BB 3SBWA 3CFDA 2OK0L 1LDSA 4HGMA 5EO0A 4NQEA 4Y2DB 1A3QA 3CPLB 1U8PA 3C6SA 4L9LA 1GOHA 1X5YA 4X7TA 1X7QA 4BKLB 5E8OB 3TO4D 3KPMA 4E41E 3QFDA 3ROOA 4HAFA 5AZEH 4NQDE 2VAJA 4Y5VA 3VXMD 3U4AA 1DVFB 3MLZL 2VQ1B 2LE9A 1MH5B 1YEEH 2KQMA 4P2CG 4D2NA 4EI5C 3V5HA 2D0GA 4FQQB 2LTQB 2VH5H 2HFEA 1FFNB 4IJ3B 4AYFA 1R5WB 3B43A 1CGYA 1K8DA 2FL5A 1QKZH 2DL2A 1E4XL 5JW3L 2XTJD 3O3UN 1HK6A 3FQXB 5I19H 2H32H 3U83A 1Q72L 4HK3J 1P7QD 4QRSA 3KLSA 2IALA 1D5IH 3EOTL 3QB7C 1N6QH 3QQ3A 5A16A 5DMYA 2A6DB 5HDOA 4JFZL 3KPNA 5FK9A 2AABL 2Z31C 1MRFL 2WNGA 3WN5B 2A0LD 4KHXH 1QBLL 2P5EE 3PDDA 4M61A 1BAFL 3M17B 1B6DA 2QL1A 1EXUA 2PW2B 4L9DA 1MIML 5HHNA 2VIRA 4HT1L 4FN0A 5I76B 1FYTD 1UZ6F 4MJID 5C0GA 3MYJA 1HHKB 2G75B 3U36B 3O4OC 4MNQB 1BJ8A 4OLVH 5DD6A 4JY4B 3TN0A 1MLBB 2FJGA 4FQLH 1IKFH 4LLDB 5CIPA 3G6DH 1FG9C 3ME0A 3U0PB 3W9DB 1I3UA 1Z9SA 5JHLL 1YMMD 2COQA 1JZ3A 1S5IH 1IGTA 3ZKQD 5HGBB 43C9A 3HS0A 5HHXL 3G6JE 3MRMA 1EAPA 1PFCA 2EXYD 3FZUC 3GJEB 4OCSH 1XGYH 3KYNB 4WUKH 4LQFL 4XC3L 4OUUA 1IVLA 1UVQA 2EDQA 4KJYA 3MRIA 3FRPA 4Q9RH 5ALBH 4Y7MA 1KLFA 4P23B 3ARRA 4WFHD 2X4SB 2FHCA 4OZIF 1XCQB 4ODXA 2VDQL 2FRGP 5CEXB 3FN0H 3F6LA 5FKPA 4LLQB 5K93A 3MV8D 1G7JB 5BV7C 2HJLA 5EU4B 4CL7A 4HK3N 3AREB 4OQTH 3NCBB 3AROA 1IZJA 3BKYH 4CN4A 3RU8L 1ZMYA 3HC4L 3OJDA 1CZ8H 3RWHB 5GSRA 3K7UA 3ZZ1A 4Y5XC 4F57H 3UTTA 2NX5D 5J3HC 1NGZB 1U8QA 3VA2C 3WDIA 3P9WB 4G8GA 4FFZH 1U3JA 4D9RE 3T09A 4WNQB 3GSVA 3DMMA 1A6PA 3BDYH 4RGNE 1NKRA 2WBJA 2XXMB 4LASH 5FUCE 2OYPA 3LKSA 4PRPD 4BFIA 3WLBA 4NKOA 5M94B 1JV5B 1JI2A 3SE8L 1URLA 3WV0A 4ENED 4G3YL 1LWRA 2WP3T 2GY7B 5JIHA 3TZVC 3S8WA 3RWIA 5JTWA 4JN2B 1JPTL 4DUVA 5IB1A 3GGWB 5C0CE 3HRZA 4ZAKB 4PJBB 3BP4A 3GSXA 2VDRL 2FD6L 1A3LL 2WBWB 4HS8H 4KTEL 3IJSA 2ATPA 2MFNA 4HUWB 3VGEA 3PGDA 4X5WB 1SY6A 2Z35A 4NJ9H 3BWAA 4MSWB 5FF6B 5I1AB 3WS6A 2J7LA 3L3GB 5C0BE 3F12B 3RWDA 5F88A 5GGSA 3OF6D 2I07B 3H7BA 3PP4L 5EN2B 4M03A 1I1AA 3WJJC 1KN4L 4X4YB 1B0WA 1OAYH 1NANH 1OGAD 3ILPA 3P30H 1EPFA 3PHQA 3UJJL 3VMPA 3S36L 1UB5B 5T1MB 4P9HH 4ONHA 3FO9B 1YYML 1G6RH 5EIVA 4NM4H 3TC9A 4LCWB 1JNNL 3AM8A 1KJMA 5E8PB 1JGEA 3I6KB 5BQ7B 4L3AA 3VE0A 3RDTA 1QSED 4X6BB 3CLEL 4M8QA 2RFXA 1W72A 4PRNB 3BXNB 4JM2A 5SWZD 3G04B 3MV9E 2X40A 4MGXA 4D0DA 5LGJB 4GO6B 3MBXH 4QGTA 3PE9A 4L4VA 4OM0L 4RBPH 3W11D 5K59E 4Q6IC 5LBSH 4JDVB 5DJZA 5MEPB 1OP5H 1GGUA 1JWSB 4R0LA 3ARFB 3RL2B 5F7KC 1T5WB 4JHAH 2QADC 4O5LH 5DJDA 3RWCA 4HEME 4JFQA 1KPRB 5I1DA 1KB5B 4C56E 4XCNB 1WCBB 2FH8A 5MENA 1SHMA 1OOAA 3SGEH 5DTFA 2IAMB 2V2WB 5IB5B 1F4WH 1Q9OA 4R6UA 3GSNA 4XXDB 4U1MA 3WYRA 2PO6A 4GH7B 3MRJA 1JRHH 2RCSH 4EZMA 1R6VA 5IWLA 4PGZA 3EHBD 4KQ3H 3DETD 1TETH 2CIIA 4PGJA 1UXSA 1U3HB 4PRAB 4YDVA 3OGCB 1HIMH 4QXGL 5I16B 3SPVB 4WO4C 4YR6B 5ICZA 3B6SB 4WFFE 4ODUA 4AEIL 4D0CA 3NIDE 3ARXA 1K4CA 1FDLL 1K5NB 5IOPA 2CO7B 1U95B 1ZHNB 5D72L 3F58H 1M05B 4XMLL 1ZS8B 1X4ZA 2ZUUA 2NY4B 5D96C 2IPKB 1G84A 2J8UE 5CEZL 3LY6A 3VXRD 1FPTL 1NC2B 4PJ9D 4KMLB 2DQFA 3OJ2C 3WXWL 4PJHF 4XNXL 1RK1B 1CXEA 2AERT 3DHJA 3DVIA 1CE1H 2BVYA 4S1RL 2BY0A 4BH7B 2V5RA 4HJJL 4LSUL 3PL6C 2APTA 3TVMD 3DARA 3DX8A 1S5HA 2BVPA 3DO3A 3FB7A 3GKWH 4LP4A 2AK4B 2R9HC 1H8SA 4NKIH 3GHBH 1QSFA 2DI7A 3ETBF 4UIMB 5D9SB 5TJWK 3D0VA 1NLDH 2HG5B 5SWQA 1C08A 4GXUN 5F96L 1OT1A 5IG7B 3MCG1 1NAML 3QUZA 5CILH 5ISZD 1U3YA 4HPYH 5CEZE 1YDPB 2VE6B 5EUOE 1U8HA 4KZEH 3ARDC 4XNQB 3HC0B 2CO6B 4FTVE 5H2BB 4EDXB 2NY1D 2AV7B 4MD5B 4PTTB 2OZ4A 2Y36L 4OCMC 5GIRB 2LAGB 3P0VH 4WI2A 3VGHA 3V0VA 4XPGH 1HHIB 3DXAB 2YPLE 2IANB 3GB7A 2ZUVA 4YZFF 3QDJD 3QNXA 2FX9L 5DD3H 1MCFA 4H0HB 1JCKA 3QEQA 5EO1B 2GSIA 1HSAB 2QJDA 5AG9A 4QO1A 1DLHB 2BY3A 5T1KB 1DQML 3LH2H 3KPOB 4DVBB 3C5ZB 4LEXH 1U8OB 3D18B 2XZCL 4RQQA 3QUML 1U92A 3NN8B 5KG9B 1G7LA 3SKMA 2AW2A 3U0WH 2R56L 1R5IB 4ODSL 2D4FA 4HIXH 5HHMD 5BRZE 3L3DA 3BRFA 1A21A 5E1AA 3P0YL 1Y0LB 1G9NC 2YZ1A 2AS5M 4Z5RB 3AB0C 4YUEH 5D2NE 3D85B 1JPST 1QD0A 4NRYA 5EORL 5D2LF 3T2NL 3SJVE 4FMFA 4QHKI 1VFMA 1QSVA 2EZ0C 3VRIA 5KSBA 4A2LA 3WL9A 3PQYB 1EIBA 1HSBA 1KLUA 4B53A 3HE7A 4J1UA 4PS4L 5CUSL 1X5FA 1ORQA 4ZFFB 4W4OC 3RVTD 4N0YL 4ODWA 1S7XA 2A83B 4M1DL 4PRDA 3N1FC 3EOAB 5BZWB 1DQDH 4XPAL 1AFVH 2YD2A 1TQBC 1DQQB 3B9DA 1XIWD 3GMQA 4YWGH 2NXYD 3KPQA 4KROC 2CKNA 2EDYA 4O02H 1F90H 4KQ4H 4NNXB 1CS6A 1E28A 1K8IA 1AQDA 2NR6C 5EU6A 1MHEA 3MJ8A 3KWWB 5JOPD 2JJTA 5AZ2L 1A5FL 1EO5A 4QHKJ 2C3XA 1P5VA 2UYLB 2XOTA 2WWMD 3D6GA 2C1OA 2Y7QB 4X6DF 5BCAA 1AGCB 1NBZA 3OR6A 3VFNB 2R1XA 1A9BB 1H3PL 1HN1A 4KRLB 2V2TA 4HAGA 4FMKA 4K71B 2EO1A 4KY1L 2XI9A 1NAKH 3GMMB 3ZKXC 4U1HA 5IJKA 2BMKB 2A74B 1QTYT 3IJYB 3NZ8B 2OL3A 5BVJA 1RULH 2OQJA 3OXSB 4WI9A 3QQ4A 3UZQA 2V9TA 4G9DB 1CDHA 3OAUL 4PJAB 4R3SA 4R96B 4QKXB 3SCMC 4Y4HC 1LK3L 1JTPA 5GJSL 2PNDA 1I9IL 3RI5K 4EN3D 1CK0L 3RP1A 3CH1B 5TFSL 4F80A 3MRGB 2R2EA 4R90L 5FYLE 1EA9C 2XTJC 4NQSA 4M93B 3MV7A 4R2GD 5D70L 3RY5A 5GS1C 3QG6B 1KTLA 4RZCA 4NZUH 4ZMAT 5DJCB 2Q7YA 1CF8H 2X9XA 1PKOA 4IRJD 5JLZA 1WBZA 4PG2C 4PJFE 4CVUA 1BIHA 2A0LC 1G9EA 5ITFB 2DM3A 2ZSWB 4WWKD 2DICA 3GMNA 5HYFA 3SDCD 3SHSA 2VKWA 1CDUA 4P2QD 5I71C 5FB8A 1ZE3C 1YZZA 1X9QA 2R2HA 1CE6A 5K9QI 1WISA 4X99A 4PJ7F 2W0FA 1KIQB 5AZEL 5IMLA 3PWPE 4JR9L 4YPJA 2X4NB 3BMWA 1ZLVK 1H15A 3B83A 2PTTA 5BVPH 4HWBH 1MCEA 1YEEL 4OLXH 3DTXA 1Q0YH 3QUXB 1CL7H 3BPLB 4MA1B 2VH5L 3LN4A 3E6HA 2IBZX 3F7YB 4OZGE 3TYFA 5BOPA 2CDGB 4I18C 2LAAA 1QKZL 4WU7A 1KLGA 3QIBC 2YUVA 3UJIH 5CHNB 3AMKA 3U6RB 4HMEA 3SO5A 3ULVL 3HG1E 5MHSD 3LD8C 3GUTA 3HLAA 5DQ9A 4PG9B 3UYPA 1D5IL 1ZA3B 4BQ6A 2CUHA 3OBAA 1U8JA 5HVHC 1CICB 2X4QB 2I26N 2VITB 3R1GH 1FZKB 1MCNA 4NKMB 1EJOH 4DZBA 4OAWB 3SDAB 4KHXL 3F7VA 4OFYD 3AAZB 1ZVSA 2ZP0T 2W38A 3P4LA 2HH0H 3UPRB 3GKZA 3IFOB 1FO0H 3O8XC 2JB5H 1F5WA 2R23A 3QHFH 5IB2A 3PGFH 1XGQA 1OAKL 3UX9B 1YECL 2L0DA 5H94B 1QZ1A 2J5LB 5DJ8B 3EOYG 2H2PD 3BPCB 1T04B 3PWVB 3ULVE 2F74A 1T0MA 3ILQD 3MRQA 4ELKA 4PJHB 3KYOA 4MMXC 3VD4A 3FO1B 4UDTB 3FOLA 1M7DB 4FQLL 1IKFL 5C6PB 3G6DL 2BVOA 3U30B 4J8RB 5IVXA 5T3ZH 4YC2B 3VU2A 4ENEC 1J1XH 1S5IL 3S4SA 1J0JA 1OL0A 2X2YA 4P3WA 2B4CH 1LO5B 2D7TH 2DM2A 3O41B 4OCSL 3GJFA 4WI4A 1XGYL 1KFAL 4WW1B 3T1WA 1RUPH 5C0JB 5F7WC 2DQTH 1EMTH 4Q9RL 3QWOA 5ALBL 1DL7H 5I8EA 4X4ME 4ZUWA 3BEVA 4QNPF 4P2OD 4MX7B 2X4OB 3W82A 3ALPA 3CLFL 3EYFA 4HGKC 2A6IB 3FN0L 5LAXB 1NC4D 4AEHH 3D25A 2OJZH 2BXZA 2ICWI 2WWKT 5B3JF 2FBJH 1HOCB 1S7QB 2ICWA 4GKZA 1VHPA 1MJ7H 4OQTL 4XGZB 3IDJB 3BKYL 4KKNA 1AC0A 5IK3B 5HYEA 3BGFB 2LU7A 4PBVC 3UO1H 1ZHKB 1DQJA 3LOWA 5EOCH 4F57L 1BD2A 1GVIA 5IT2H 1XF4B 4KJQD 4WDIB 3QUYC 1U8KA 5HI5D 1NEUA 2H6PA 1QEWB 1MY7A 4FFZL 4P2RD 4HUUA 3BDYL 4LASL 5I8OL 3QDGE 5IESH 1BECA 3W11C 4U3HA 4CW1A 5DRNA 4JG0L 3VFVA 4IRZH 2ICWJ 5D2LB 4OZFA 1AXSB 3KPSB 5SV3A 4P48A 1JNHB 4HS8L 4DAGH 1GOFA 1EJ6A 4NJ9L 3L9RA 4JDTL 4NC1C 4XVJH 4JY6A 1IM9A 2XWJB 1T4KA 1GZPB 4RMRA 4APQB 3EHBC 2I9TB 4JFEE 3DETC 3MRHA 4LCIH 5C08D 4JPVH 3WIHA 3P30L 1MAJA 2BNRE 4WTZG 1EFXD 5IQ7H 4X8JA 4NN5C 4P9HL 1OPGH 3ARGA 2MSPA 3KXFE 4YHNB 2VL4A 1G6RL 4NM4L 1MRDH 5DGQA 2VLKD 4Z7QF 2BRQA 2P5ED 5EC1B 2CRMA 1IEBB 4FQCH 4X6DB 5C0EA 3ARQA 1FV1A 1HH6A 3V6OC 4PJ9C 35C8H 3GI8H 4LEOB 3VFTA 5I1HH 3MBXL 4PJXA 1PKQE 2F54A 5E7BA 5LBSL 2FWOB 3TVMC 5JQ6H 3UTOA 2PYED 4QYOB 2GT9A 4JVPA 4BZ2H 4JHAL 2D9QB 5ERWA 4K3GA 1F6FB 4P4RA 3WS3A 4R4ND 1N2RA 3TNMA 1OW0C 4XCEA 1CGWA 1F4WL 1FAKT 2P24A 5IBLD 2OTPA 3VCLA 5T3XE 2R8SL 1TNMA 2VZ1A 1JRHL 2RCSL 3U9UB 2J88H 2C1PB 1TETL 2N7BA 3UMTA 1RK0B 3BMVA 5D7LB 2NY1C 1YQVH 2HT4D 2VDOH 4M6AA 4BH8B 4CNIB 2VDMH 5CBAB 1HIML 3BI9X 4KAQH 1R5VA 1YYLH 3WLWC 3DUUB 2F5AH 1QLEH 2ZPKH 3M45A 1PX4A 3T4AB 2YD4A 3DX6B 4EI5A 1EZVY 3S3JA 1EVUA 2HFFB 1VADB 3MZTA 4GFTB 4CDGC 4QRPD 1WVZA 3T0XA 2WMPA 4YFLI 4OF3A 3LDBC 1BOGA 4PJ7B 5JHDB 5E03A 3QEUA 4H5SA 4PRIE 3VGAB 1RU9L 4LLYB 1I7UA 2N4IA 4WI7A 1IGMH 5EU5A 2DAVA 3C5JA 5IHUH 3L7EB 1CE1L 4BZYA 2LABA 2D2OA 3EO1A 4PP1D 4JO2H 3RIFK 2PF6A 3FQRB 1CG9B 5DHYB 3EOBA 3GKWL 2D7QA 2Z31A 4NKIL 3ULUH 3GHBL 4JQIH 2G60H 5HGHB 3BOVA 5JW4Q 1NLDL 3KLDA 3C60B 5D5ME 4K2UH 1QPXA 3BAEH 4WJ5B 4JFDD 5CILL 3IDYC 3SQOH 4HPYL 5C0CD 4KZEL 4CVZB 4G9FD 1VGEH 1XZ0B 3KPPA 1F97A 2ITCA 2BSTB 2AKRB 4F9PC 1ZA6B 2WP3O 1U41A 2EH7H 3UTSD 1BZ9A 4I5BA 3P0VL 1KJ2A 4X83A 5M7QA 1KBGL 4OGXH 4JFXB 1Y6KR 4H8WC 4XPGL 4JFYB 2IWGA 4PRHE 3M07A 4GQ9H 5DD3L 2DYPD 4ZS7L 2Q76A 3H9SA 2MNUA 2AEWA 3V0WH 2XQYG 2EDXA 4ZO7A 3LH2L 4HV8A 1Z5LA 4F15C 4PPTA 4K7PX 4LEXL 4X9HA 4LF3A 5C09D 4ZOAA 1OTSD 4WUUD 1UXWB 5I8CA 3U0WL 3TNNA 4O2EB 3K2UL 4HIXL 4AH2B 1Q38A 1CXLA 3STLA 3IDGA 4XNZC 4JFHE 1QRND 4JFPA 3SN6N 4ZTOH 2CXGA 3D3VB 2EDJA 2HN7A 4YUEL 5AWNH 4JGUA 4U7KA 2NXZD 3EJYD 2OS7A 5DA4A 1F45A 3JV6A 4QOKD 4Z7VA 1N3NB 4TUOA 3QJFB 5JA8B 4EN3C 4Y5XA 2CDEB 3MX0A 5KANI 4IBLT 4KK6D 1XH3B 3T77A 4GRWE 1J0ZA 2WQ8A 1DANT 3VRLF 1CDGA 5F93C 2O93L 4Z76B 1DQDL 2AXFA 1NCCH 2HLFD 2IH1B 4BUGA 4PJ8C 5D7JC 1AFVL 5I17B 3OXRB 3C8DA 1LE5A 2DBLH 2ZNXA 4F7PA 4IRJC 1U93A 4WEBH 4YWGL 5IMOA 4BSWA 43CAB 2HRPH 4O02L 1F90L 4KQ4L 4YH6A 2BVQA 1LQSR 5DUBB 3RZCB 4WWKC 3TZVA 2P5WB 4HDIA 4W6WB 3QDMB 4WFFD 3I50H 2BC4A 3EYOB 5DJAB 5LWYH 3OQ3B 3PWNA 3ZSTA 3CFDB 3P73A 3L3OA 5EO0B 4NQEB 3B2VL 3KHOA 4M4RA 2Z8VC 1U8PB 3C6SB 1H5BA 3GIVA 4L9LB 1Q9WA 2QSTA 2NZ9D 4X7TB 4QTIH 5IJVA 1X7QB 4NT6A 3FO2A 3KPMB 3V6ZA 3WJJA 1RULL 2PW1A 2YRPA 3S3SA 3ZKSD 3QFDB 3ZKNC 4Y5VB 1T0NA 4ZYKA 1LO3H 1RJLA 1B9ZA 3OKOB 2IMMA 3IYLW 1NEZG 5CWSA 2KPNA 4XBGA 4LGSB 3MO1A 3V5HB 3FONB 1CIUA 1ETZA 3RGVD 4NZUL 3LQAC 2HFEB 1NMBH 1K8DB 4Y4KD 3I02A 1CF8L 1VEMA 3FN3A 5CEZD 1UWGH 3SEPA 5HI3D 2IALB 3BPOB 5L0QB 2EEBA 4POUB 4YHLH 4XP5H 4Q6IA 3QQ3B 3U9PH 1ITBB 4ERSH 5A16B 4N5UA 5B8CC 3KPNB 5FK9B 1JNJA 3LS4H 1KXTB 1U42A 4RIRA 3IFPA 3QQ9C 3HCVA 1HXYA 1EXUB 5FOJA 1AE6H 4XI5C 2VIRB 3ILQC 4L4TD 4QTHB 3WKNA 4MJ4A 3EYSH 2AV1A 4P49A 5C0GB 1CGTA 3MBED 5BVPL 3U7WH 4HWBL 3VGDA 4OLXL 3EJJX 3HI5H 1Q0YL 5DD6B 3TN0B 4WO4A 5FHAL 1UB6A 3GIZL 2FJGB 1CL7L 4FZ8H 5I75B 3VXUA 5CIPB 2W59A 5HYQB 3TJEH 1AIFA 3UJIL 3PABA 4YQXH 1IGTB 3ZTJH 2AXGA 1T6WA 4RFEB 3HS0B 1MHCA 43C9B 1WAAF 3MGOA 1FC1A 3MRMB 1EAPB 4MNQE 4AL8H 2D4DA 1EK3A 1B90A 2QEJA 2PYFA 4P2OC 4PGBA 5KSBF 2X5PA 4OUUB 3N06B 1UVQB 4KJYB 3MRIB 4I0PD 3CDYA 3QBTB 3QR2A 1QFPA 1RQ5A 1WJ3A 3ULSA 3KLAA 1EJOL 2BRRH 4F7CA 2Q8AH 4YXKH 1XR9A 4ODXB 3PL6A 4CMMA 5DHVH 2NNAA 5FKPB 5KTEH 1ACZA 1FO0L 2NTFA 2JB5L 1N0LA 3QHFL 2HJLB 2EH8H 2B39A 3PGFL 3JXAA 4KJQC 2P8PB 2ADJA 2HJKA 1LEGA 3QJHA 2RGSA 4MAUH 1S7TA 3QDAA 3OJDB 1A6TA 1S9XB 3FAXA 2RR3A 5GSRB 2WBKA 4HXBL 3UTTB 5DI8A 3ARDA 1VA9A 1U8QB 4G8GB 4XP1H 4KV5E 1KCVH 1IAKA 1S7UA 3GSWA 1A1OA 3GSVB 1J1XL 3DMMB 5EIQA 2FGWH 5C3TA 4GS7B 3LKSB 4GW1A 2D7TL 3WLBB 2RQ8A 4HQQH 4OGAD 6FABH 1BFOA 1RUPL 4W4NA 3VG9B 2DQTL 3DPBA 5GGUA 1EMTL 3RWIB 1DL7L 1KSRA 5IB1B 5JXED 4JFOA 1V7NH 3HRZB 3BP4B 3GSXB 3MLTA 4ZFOA 4JANA 3IJSB 3MUZ1 4AEHL 3A6BH 1AHWC 2OJZL 3PGDB 3UTQA 2Z35B 5BS0D 4LLVA 3BWAB 5BXFA 2FBJL 1MJ7L 3CU7A 5IW3A 2ICES 5F88B 2ZCHH 3H7BB 3B3IA 1JF1A 2FNBA 2VYRE 3UO1L 1I1AB 3PUCA 5IT2L 4PJBE 3ILPB 1TJGH 5ILTH 3IB4A 3PHQB 2FHFA 4UDUA 1A14H 2WM0A 2XPGA 1AP2A 2O5YH 4ONHB 1KPVB 2XYCA 4JRXD 1A1MA 2UUDK 3PP3K 3V6BR 3VXSA 4XPFL 1KJMB 4YXHH 5BRZA 4W4OA 1SEQH 3FB5A 4LLAA 1BBJB 1IAIM 4XC1H 4W6XB 1KV3A 5FOBA 3RBGA 5FIEA 3VE0B 5IESL 3MJ6A 4M8QB 2FEDC 3PWPD 1PZ5A 1W72B 4QRTA 4IRZL 2VJXA 2GJ6D 3DVGA 4JM2B 4RRPG 3NPSB 1QYGL 1MCWW 1T2JA 5BOZG 1TZHA 4LCWE 3J8F7 2MQ3A 4L4VB 4DAGL 2YC1A 1CGSH 5JOEA 4ZPVA 4R4NC 1JWMA 4R0LB 1RUAL 2P7TA 5IBLC 5DJDB 3RWCB 4JFQB 5I1DB 1E0OB 4PJIB 5MENB 4JHWH 4DKAA 5DTFB 1T22B 1FE8H 4LCIL 4OUOA 1Q9OB 2HT4C 2KZWA 4JPVL 3GSNB 1YEGL 1MCCA 3VXMA 4U1MB 1W8NA 2PO6B 1YJDH 3MRJB 3RPIA 5IQ7L 1OPGL 2A9MH 5HYSG 3SO3C 3CFBA 2CIIB 4PLJD 1UXSB 3O3DA 4YDVB 1MRDL 2W9EH 3U82B 2K7QA 4ZG1A 4Y4HA 5ICZB 4GLRI 1SVCP 5FFLA 4ODUB 3O11A 4D0CB 1K4CB 4FQCL 1AI1H 2NY2B 1MF2H 1QHOA 5IOPB 4YHZH 2EEAA 3PV7A 1VDGA 3BO8B 5GS1A 35C8L 3KPTA 1UCTA 2XKUA 3FHAA 3GI8L 1YEFH 5HHVH 5I1HL 4ALAH 1IC5H 4H20H 5A3ID 3ZHKA 5ESAA 4LSVL 2YUWA 2DQFB 3U1SL 2PTVA 4BZ2L 3T2PA 1HKFA 4WCYH 3C08L 3QWRD 4GG6B 4FA8A 2GAZA 2PN5A 1J86A 5IVXF 4D9LH 1S5HB 1KUMA 2BVPB 3FB7B 3G5YA 3S7GA 3TA3D 4ODBD 2HVJA 1QSFB 5FDWB 5I1CH 2J88L 1WICA 3D0VB 4XB8A 3T0DA 4Z78A 1C08B 5K9KA 4C83A 2X4TA 2ZG1A 3KPRD 4K3EH 1YQVL 2VDOL 2VDML 3K3QA 3QUZB 1R24A 4KAQL 1U8HB 1YYLL 4X4XB 4XVSH 4NPYA 3ZYZA 2F5AL 2IGFH 4PD4J 4UAOB 1QLEL 5DUPH 2XA8L 2ZPKL 2AK4E 1TPXC 5DO2D 1YMMA 1J0KA 3TBVA 5LVEA 1SMAA 5EOTA 4NOFA 4XZUB 1NCTA 1JGUH 3C8HA 3V0VB 4NC0B 3GB7B 3QIBA 3QNXB 3QEQB 1OTSC 2GSIB 3QHTC 4HFUL 5GISH 3IXTA 2L4OA 1MHHB 4N0FA 3WFCH 2WWKO 3EDFA 1IGML 3QUKA 2MKWA 3FQUA 5HHOE 3UXFA 5IHUL 3MUHL 4G6FB 4RQQB 4JO2L 1A3RH 1B3JA 4HUNB 3I3BA 1U92B 3OKNA 4K9EH 1GXEA 1FLTX 1G7LB 3DXAE 3SKMB 1JGVH 3MV8A 3EJYC 2IANE 4JQIL 4EIGB 2G60L 3L3DB 3WFDH 4I13B 4XHQA 4NN7C 5E1AB 4K2UL 2UY7A 3O8XA 1UZ6E 3BAEL 3VDAA 3OX8A 4NRYB 3SQOL 2NX5A 5F1KC 4K7PY 3CZFA 4O51A 1UT9A 3DUHA 1VGEL 1YY9D 4KK6C 1D6VH 4IM8A 4O58H 3VRIB 5KSBB 3HAEG 1HSBB 1X5KA 1KLUB 1TJHH 5L2KD 4HMCA 2EH7L 3HE7B 4J1UB 5DEZA 1ORQB 1FFQA 4OGXL 4UUJA 4L3ED 3DX7A 1OGTA 4ODWB 1S7XB 4Z77A 4KKAD 4PRDB 4GQ9L 5F7LB 4NHCH 1JBJA 1QFUH 1EHNA 4AT6A 5HJ3A 4HW6A 1IC1A 1BIIA 1IAOA 2CKBA 4LCUA 1VGKA 3PQYE 3O3BA 2MJWA 5GPRA 3LPGA 2IFFH 1E28B 1K8IB 2IH3A 4JQXA 1AQDB 4DKFH 5EU6B 1MHEB 3MJ8B 4OZIE 1UQSA 2CGRH 1EBAA 3T08A 5FYJH 4QRRD 4XNYH 5JQHC 2Z8WC 5GQBA 1GPOL 4M6NH 2C1OB 1HKLH 2NZ9C 1IEAA 3OF6A 5C0FA 1WFUA 2HFGH 4ZTOL 1ORSA 1NBZB 4Q74A 2APVA 3OR6B 2R1XB 5AWNL 3WNPA 2D0FA 5TE6H 3DWTA 2V2TB 1OGAA 5ENWA 3MJGX 4U1HB 4KJPD 2XFXA 2OL3B 5BVJB 5F7NC 2OQJB 2VERN 5IIEA 2P8MA 3QQ4B 3DI3B 4WFED 3CFIC 3QUYA 4HH9B 5AYUH 2BVTA 3HAEH 4R3SB 4ZTPH 4M1GH 1BF2A 3EAKA 5GS0H 2VB5A 1NCCL 1QSEA 3KS0J 2NY0D 4ISVA 4POZC 3I6GA 1NMCC 4TNVK 4NQSB 1I1YA 2DBLL 3CGTA 2DDQH 3MV7B 4WEBL 5SWZA 1KTLB 4RZCB 5E4EB 3ARYA 4G8IA 1WF5A 1JE6A 5HI3C 2HRPL 1CGVA 4G6MH 4J3WA 5CP7A 2Q7YB 1G6VK 4PJAE 4HK0A 4LFHG 1JPGA 5JW4R 3AY4C 2YPKA 5JLZB 1WBZB 1S8DA 1I7TA 3I50L 1Q9KA 1OT2A 1UEMA 5LWYL 4RGMC 4KI5D 4K71C 1CIDA 3GMNB 4RFNB 4XB7A 5F3BA 3P4MA 5FB8B 1HILA 2VZUA 4K23H 4DK6A 2R2HB 1K4DA 3W0WD 1CE6B 4YFLF 4QTIL 2ZUSA 4X99B 2EDLA 2W0FB 1JTOA 4PRID 3TH3T 5IMLB 5C92A 2LVCA 1LO3L 1S7RA 4JO4H 1H15B 5CIPH 3RIAF 4M93C 2PTTB 3R0NA 3FT3B 3W5MA 3DTXB 2XQBL 1ONQA 5C8JB 3P9MA 4TSAH 3MCKA 4ZOEA 3E6HB 1LE9A 5CD5D 4LGRB 1NMBL 5D1QB 4WU7B 1KLGB 3VXRA 3V6OA 4PJ9A 3PDOB 1BGXH 1GHFH 1UWGL 2DQIH 3IU3A 3L5IA 3GUTB 1OF2A 5HYJD 1SJXA 2JCCA 5DQ9B 1KXVC 4OFKA 3U9PL 4ERSL 4O2FA 1QSZA 3TVMA 3FFCA 1U8JB 1N8ZA 1GL4B 4S11A 3LS4L 5FAAA 1DR9A 4QHUA 3F7VB 4KDVA 2V17H 1ZVSB 1OW0A 3HN3A 2VQTA 2XQYK 5IHBA 1XF3A 1AE6L 3HZYA 4Y16C 5ISZA 3VWJD 1ZTXH 1R3JA 2JTDA 2R23B 5IB2B 1MQKH 1J05A 3EYSL 1QFWI 1XGQB 3VW3H 3QUXC 4HPOH 1ZLUH 2ILLA 4XAWH 3U7WL 4Y5YC 2F74B 1T0MB 1ZHLB 3HI5L 2C26A 5IB3B 2F58H 4HS6A 3MRQB 4B7IA 4ELKB 1D5ZA 3KYOB 5TDOA 4W70A 4FQIL 4JLRB 4FZ8L 1XR8A 4N0CD 1MEXH 1WITA 5D93B 3TCXA 4S0SD 5D7IA 1YMHA 3TJEL 4NQCD 3QDJA 4YNYA 5IVXB 4OGAC 5INDA 3HTLX 3S4SB 1H3WM 3QA3A 1RZKC 4I48B 1CICC 4AL8L 5JXEC 2QSVA 4Z7VF 3GJFB 4PJHE 4UB0H 5C9JA 4MAYB 2VUOA 1VFBB 5I8EB 4G80A 1R3LA 3ARVA 4ZUWB 2BRRL 3BEVB 3TBWA 2Q8AL 5HPMA 3EYFB 1D5XA 1N7MH 4RFOH 5F9AC 5E7FA 5KTEL 3MOAH 1N26A 4UT9H 3D25B 2YD7A 4OCRL 1T5XA 2SEBA 2ICWB 2EH8L 4GKZB 4NFCA 3IU4L 1LDPH 1ZLSH 1MOEA 4MAUL 4DWHA 3UC0L 5E56A 1DQJB 3L7FA 3D2UD 1U8KB 2ATKA 3C5SA 4PJEA 2H6PB 5IHZA 3PWJA 2Z0BA 4XP1L 1O7VA 1KCVL 4XHJC 4F9PA 3BIKA 2E27H 4HUUB 1CVRA 2BERA 3CXHK 3L3KA 2KBGA 2FGWL 3BZEA 4HZLA 3C09B 4YZFE 3E2HC 1T7WA 3QNZA 1FRGL 4JPIA 1CCZA 5L8KB 4HQQL 5KS9A 6FABL 4DUWA 3F65A 5AAMA 4CW1B 5DRNB 5J8OA 4NCDA 3VFVB 1FN4B 4OZFB 3R4DA 5F3HA 4HBCH 3UCRA 1P7HL 1AKJD 4TVPH 1PEWA 3P4NA 1V7NL 1HEZA 3VD9A 2RB8A 4DJMA 3ZDZF 1MWAH 3BGFC 3OKKA 1QFOA 3A6BL 4ZNCD 4OGYH 3L9RB 4JY6B 1IM9B 1T4KB 4G8FA 1ZV5A 5C0ND 2ZCHL 1X5IA 5D2LE 1I1RA 2FEEI 4YHIA 3MRHB 4NUJA 4PLJC 4XWGL 3KDMA 2P4AB 5E8DH 2D31A 2ZSVA 3KPSE 1TJGL 5ILTL 2D0HA 5JPNA 5CZXD 1NGXA 2GHWB 1EERB 2O5YL 2DQDH 3ARGB 4FNLL 1U2CA 4EN3A 4HUKB 1J1OH 1PW3A 1BX2A 2W91A 4YXHL 5KW9H 3MLPA 3GK8H 1B0RA 1SEQL 4XC1L 1NEZB 4M4PA 2XWTA 5C0EB 2ZUTA 2VDPH 5D7JA 2VOTA 1FV1B 1HH6B 4YE4L 4PLOB 4TULH 4IRJA 5IEHA 1E4WH 5J0BA 4HBQA 1BZQK 1YA5A 2X70A 4LL9A 3VFTB 4PJXB 4WWKA 2F54B 1CGSL 1LD9B 2DQCH 2YMXH 3C2AH 3SDCA 4CU8A 2FIKA 4GUPA 1CXHA 1YNKH 2GT9B 4X6DE 2P45B 3QI9D 3NIGF 5ERWB 2VXTH 4P4RB 5ETUA 4JHWL 3WS3B 5H37G 1N2RB 1BLNA 1FE8L 4F9LC 2P24B 1BJ1J 3DVNA 4LPUA 3VCLB 1YJDL 1RMFH 3O4LD 2A9ML 5C0AD 1T1XA 3OHXA 5DMKB 1J0IA 2W9EL 4U0RC 2VN4A 3IDMA 1U8LA 3LEYH 2O26U 1R5VB 1G7IB 1SEBA 3WNKA 1U8NA 3FCTB 4JAMB 3BUTA 1AI1L 1MF2L 4EI5B 4YHZL 1QBBA 3D39D 4M7LT 3EFFA 3HA0A 2D7OA 4XCYA 2J8UF 5D7LE 1YEFL 5HHVL 3CUPA 1BOGB 4ALAL 1IC5L 4H20L 1SYVA 4HCRA 1UC6A 2CJUL 4H5SB 1I7UB 2OBGA 3U4BH 5EU5B 1QLFA 3CPLA 4WCYL <