3R06B

Crystal structure of anti-mouse cd3epsilon antibody 2c11 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
210
Chain Sequence
EVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWGQGTMVTVSSAKTTAPSVYPLAPATTNTVTLGCLVKGYFPEPVTVIWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTTVDLKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptors are structures capable of initiating signaling in the absence of large conformational rearrangements.
pubmed doi rcsb
source organism Cricetulus migratorius
molecule tags Immune system
molecule keywords anti-mouse CD3epsilon antibody 2C11 Fab light chain
total genus 41
structure length 210
sequence length 216
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06B01
2VDNL 3VI4E 1OT1A 1U8QB 5JNYB 2BRRH 2L4OA 1U8MB 1FO0A 1L6ZA 2EDQA 4F33A 3T4AB 43C9A 4LNRB 2FIRT 1KELL 4MS8C 2CRZA 3TPKA 3PABB 1G7MA 4I2XE 4BKLB 4Z7OE 3S4SB 4J23A 5FM8A 1T5WA 4LLVA 1ITBB 1WFOA 1A7PH 3C5ZB 1P1ZB 4X4ZA 4ORGA 5A1AA 3EFDL 4PJEE 1NCCH 4NO0B 4QRSA 3PWVB 4X5WA 5IB4A 2G5BA 1EFXA 3O3DA 1NH6A 1DUZA 4KJPC 3LN4A 1XCTB 5IW3A 3NVQA 3QEQE 3L6FA 3TNNB 4XI5C 2NY6C 1HI6B 2EYTB 4RA0C 3JUZA 3SE4C 4I0PA 2F8VA 4UNUA 5FK9B 2VJXA 3QULB 8FABB 1YEKL 3T77B 1LDSA 5DUPH 1H0DB 2B1HH 1X5JA 1ZHKB 4B5EA 1OARH 2VDPH 4N0YH 4WWKA 3GUTA 3ULVC 5IMOB 4EQ3A 4ONFH 2YBRB 4BZ1L 4R2GD 3FZUC 3GMQA 3MBED 4PRIB 2CPCA 2I5YH 3H7LA 4MJ5B 3FN0H 4UV7L 4JDTL 1OSPH 5JLZA 3IJSB 5B39G 3Q1SH 4RRPG 3BRDA 5ISZE 4KKLD 1MLBA 4H1LA 3R8QA 5C0FB 1RJCA 2HLAA 1JF5A 4JFFE 1X5HA 4FZ8H 2BZDA 4UV4H 5E08L 2PTVA 3DMMB 1OLZA 5CWSB 2MKLC 5DFVC 4F7PB 4I5BA 4X7SH 3I6LD 4G6AD 1KIUA 2XQBL 3O3UN 5C70A 1EHLL 5DD6A 2LTQC 4P9HH 1ZTXL 3U0WH 1FLRL 3QRGL 1CCZA 2DBLL 1PX4A 1OAYL 2DICA 2GSIB 1KYOK 3GMOB 1UQSB 3ZHKA 3IF1B 5KW9H 4XNYL 1CLZH 5DD3H 3BPCB 4F58H 3X13A 3RWJA 4U49A 3SE8H 2EH8H 4YHPA 2XTLA 2MKWA 4YEFA 4ODXA 3P4NB 5T5NG 3EFFA 4K23H 1T7VA 2JJTA 3HNVH 4G6JH 1P7KB 3O9WD 3FMGH 5IMLA 1XGUA 1EO7A 2BY0A 3ILQD 4PGDB 5C0BB 3TBVB 4ZAKC 1EFQA 5D72L 1U3JA 1Z3GH 4OQTL 5D2LA 3ISWA 2OXHA 5I8CA 4PJ5A 2C4FU 4APQA 3EJZD 1EEUA 5EU7C 3CDGA 5E6YA 5HHOD 1BOGB 1E27A 4NRXA 3W0WE 2CUIA 2FH6A 3K3QA 4NO2A 3C09C 4PJBB 2FSEB 5IEKB 5EU5A 3B2VH 5T1LD 1TJIH 4AG4L 2AKRB 3EAKA 2F74A 4OKDA 2VDOL 3Q6GH 3C6SB 1WISA 2G75B 4O58H 1GL4B 4LARL 1DQQB 1PFCA 2J8OA 3C60A 3LHPH 4JKPL 2RBLA 1X4XA 1DVFB 1UCTA 1FNFA 5DJ2B 3HE6D 3TO4C 2VQUA 5E2WL 4OQTA 3P9WB 4M7ZB 1RJYB 1H3WM 4Y5YB 4IS6B 1RIUH 1AHWA 4OCSH 2EO1A 2VLMD 5H8DA 2YA1A 2PF6A 1C8PA 2ERJB 4JLRA 2R1XB 5EOTB 2ZNWA 4BUGA 3OB8A 4PJ8D 2FGZA 3PWVA 3B9KC 1NLDH 4OCMC 4PJAF 1J1OL 5ERWB 5IMLB 1FZKA 3WO4C 4NBZB 4ZO9A 2Q8BL 4UT9H 2I9TA 4Y5VA 1ODAA 3L5WB 3FB6B 5IR1B 4GG8B 3KPTA 3HNSL 4UT6H 3ARBB 1Y6KR 5IB1B 5DJ0B 1G9MH 2NYYC 1VGKA 5MENB 5J3HD 1PQZA 5L8JB 3BN9C 3MV9E 1R6VA 4LDOB 4MQ7A 1I9RH 1NCCL 3SDYL 3ARUA 2ED7A 4XVSH 1DSFH 4JG1L 5DZNA 2DKSA 4X83A 1F4AA 3L1OH 4NQDA 4XCEA 3CIQA 3K81A 3IDYB 4D0CB 1JF1B 3EO9H 5ANME 1HKLL 4E41B 4JPIB 1A3RL 5H2BB 2GY5A 4GKSA 4AEIH 1JHKH 3D3VB 3PQYE 1E4KC 3AS2A 12E8H 4BQ9A 2EKSB 4M1DL 1JYVA 4WTWA 3SOBL 1DQLH 4OUUB 5I1GL 1FZOB 4I48A 3MLYL 4C58B 2E7LA 5EIVA 4M6MH 2XIDA 2IBZY 2WW8A 5IW1A 4HGWA 1QBLH 4HEPG 3LRSA 4J3WA 1N4XL 2X1QA 3G6JE 2CDFA 2OK0L 4OZ4A 5CGYC 3QIWD 3BIKA 4DEPC 2W0KA 3MCKA 5HI3D 2Y6SD 1KPRB 3T0WA 5CLWA 4EJ1C 5ISZB 4DUWA 3SQOL 3OL2A 3WKML 1IAMA 3WFHA 1QFWM 4YDKH 2XFXB 3MX0A 1J0JA 1QNZH 3CLEL 2R0WH 5C0AB 1I8KB 5DVOA 1NDMB 4XCNB 3L3IA 2EYTA 3MGOB 2EKSA 3LKQA 1J8KA 4XP1L 4IM8A 4QXWA 2HTLD 4HC1H 4MD4A 1X5AA 4JPIA 3PWPB 2CDEA 4RMWA 1DBMH 1FFOA 4WW2A 4B7LA 3AM8C 2JCCB 1PSKL 1F4HA 4NQSB 4LU5H 3SKNA 1DLFL 3T8XB 2A77H 4X4MA 5DLML 5E5RB 4HMCA 4ZS6C 2QLVB 4AEIL 1EAPB 4DN4L 4UUJB 3TWCH 3WSQH 1I1AD 5E8NA 5DJ0A 5C6PB 4KUZL 3I84A 1N6UA 4AEEA 1QHOA 2M1KA 2IADB 4F2MA 5D93C 3SKMA 1RI8A 3U46B 1U3HC 2JKXA 1J1PL 4X99A 1RJZA 1HH6A 2FO1A 4KKBC 1NEZB 2IGFL 4PRHE 3FT4B 25C8H 5EOCH 2IFFH 2BFVH 4KY1L 2C4XA 1MFAL 3BD3A 2FJFA 4P5TD 1A6AB 4XZUA 4JM4L 3DO7A 1D5XA 2LTQB 3WXVH 5AAWA 2OP4L 1EGJH 1RIUL 3P77A 1AP2B 2V2WA 4JPKH 3REWA 2EC9T 2Y7QA 3ECBB 1OAXH 5I8KH 3REVA 5IHUL 1MAMH 1LE5B 5CD3A 5BZDA 4L4TB 2EDXA 3OJMB 5DJ2A 4PJ9A 4UI2A 4PPTA 1RZFL 1A7OH 1N8ZB 2ERJC 2JB6A 2MCPH 4R96A 4I0CC 5IHUH 5CKAA 5LXGL 4JZJA 1BLNA 1MAKA 2V6HA 4HWBH 2FRGP 3MA9L 2X7LA 4R8WL 1OAXL 1ZT1B 5I8KL 5TDOB 2IQ9H 3RTQB 3O6FC 3L3JB 3O4OC 4XH2A 3UTQA 1P5UA 2VITB 3KXFD 2CKBA 1FVEA 2OP4H 5DYOB 3L95A 4FFYH 2NY5C 2B1AH 3EO0A 5F7FA 1EXUB 4NGHH 4KKAD 4I2XB 4M8VA 5CSGA 1MRFL 3CDGB 3MBEC 1JV5B 2ESVD 2XWBB 4JGMA 1VADA 4PJ7E 4X6CB 4PJGE 5MP6L 1RZKH 3ME0A 5TQ0H 1FO0H 2CXGA 1XF4B 4R4BB 2DIJA 1E28B 1NLBL 4GXVH 2XOTA 2E6PA 2F58L 4CJ1A 5MEQA 1ZSDB 4P23B 1ORQA 3MLSL 5DJ8A 2QSTA 1RUQH 3RUGB 1AQKH 5KVFH 1T22B 1L0XA 3HI1B 4QXUL 4OCRH 3UDWC 3BKML 3X13B 2P48B 3IDNA 4OQTH 3MMEA 1GPOH 2FBJL 4LHQB 1D5BA 3IF1A 2NY6D 5D2NA 5BS0D 4JO4L 3ARFD 1AI1H 3TYGL 4TVPL 3QZWA 4LSUH 3RX5A 4L8BA 3PP3K 5IKCB 5IVXE 5CBAA 4V1DD 1D6VH 1Z5LA 2YK1L 2JIXA 5INCB 5DJZA 4XCFH 3ARFC 3HLAA 2FX9L 3VFWB 3VMOA 4TNWF 2JLLA 2BRRL 3NABH 4NRYA 3V5DB 3PV6B 4E42A 2NNAA 3BO8A 4ZFZA 4PLOB 4XC3L 4ERSH 4M5ZH 1DLHA 2Q86B 3VXMD 1KCRH 2WINB 2XT1B 3DROB 1Q9OA 2YD8A 1XIWC 3QIBC 4X7SL 2Z8WC 4N8VA 3U48A 5SWZA 4JZNA 2CLRA 2H2SC 4L5FH 2CLVA 3N50A 4I0PC 3V6ZB 3SQOH 3VD4A 3CC5B 4G8GE 2XNAA 2HN7A 4JKKA 5HXMA 1FSKC 2QEJA 4WCYL 1ZLUK 1JPFB 1NCAL 2FEEL 1FNAA 4MA1C 1A02N 2VOTA 4G3YH 5D7LD 1LNUB 3T0EA 5T3ZE 4JN2A 4LMQI 2D0FA 2GITB 2Q7YA 5DHVH 1JFQH 3PDOB 1S3KH 1YDPA 2C1PA 5DUML 3AFLA 1NCWL 4P46A 4K9EC 5F8RC 3HR5B 5AUMA 3IDJB 1CICC 3QIUD 4PJ8B 2GEEA 2HLFC 4U3HA 4QOKB 4TULH 3W0WD 5IG7A 3B43A 3IKCB 3EO9L 1KN4H 4OGYH 5E2TH 1EMTL 3NPSB 4CU6A 2G9HB 5C3TA 1LO0L 3TJEL 2X89D 1CF8H 3D25B 3QCUL 4LLMA 4DKDC 1BIHA 4OGYL 3JSSA 3HR6A 2H1PH 5JUEH 1G0DA 2PYEB 3SKMB 5HYQB 5KSBB 5I30H 3HG1B 4WFGD 3U9PL 2J3SA 5DA0B 2X1PA 4Q6IC 5F93C 1WTGT 4BH7B 1MEXL 3GM8A 2FR4B 1VFAA 4H5SA 3KYNA 2AV7A 3I6GA 2H3NB 4JPWH 1FG2A 5GRJH 4UBDC 1JGUH 1ZANH 4I3GA 1KF9B 1U8JA 3F7VA 4PRPD 5FUZH 2CUMA 2F54E 1IEAA 4LAQH 1HHJA 1MELA 2UVFA 2PO6C 2NY2B 3AU1A 1OQXA 2HT2D 3QDJD 2IH3A 3MJ7B 1LEIA 1LDPH 3DXAA 3EHBC 2GCYA 3R06B 2H26B 3BP4B 3CH1B 1WWBX 3T3PE 2FEDD 4ZUVA 3IKCA 1OTTC 5IG7B 2ZKHL 1JTPA 3F12A 5EC1A 2NW3A 2A74A 4JDZB 2AJXL 3BP6A 1GGCL 2EDWA 3R1GL 3BH9A 1RUAH 3VH8G 5FCSH 5L2JA 1PG7L 2QSCH 4I77H 5D2NE 5SV4A 4ACPA 4GAJH 4OZFA 4F58L 5JMOC 1RK0B 4HF5L 4ZQKA 4XT1C 1H3UA 1CG9A 4OD2B 2Z91B 3ZTJG 5ADOL 4OLYL 3ETBF 2YPLB 4HUXB 3I50L 5FGCE 1OAKL 1KJVA 2DLFH 2NYYD 4PJHE 5JW3H 2VO5A 5DUBA 5BO1L 1OM3L 3S8WA 3V52L 3T2QA 5D96B 2E27L 3BQUD 5E7FA 1PG7H 1TLKA 2CUHA 4MCYB 1AI1L 3KPNA 5FIEA 3OKMA 3OG6B 5BOZG 1FQ9C 3BHBA 3MROB 4JFDB 4F9LC 4X7EC 3S37H 4M62H 3P4OB 1A1OA 5IF0B 5ACLA 4Z76B 5HGGS 5GGVL 5B3JF 1DVFC 5E94A 3EYVB 4C56A 2XYCA 1MRFH 3EOBB 2A6JA 2CMRL 3SO3B 1V7NH 1QUNA 4ZOEA 4DAGL 5IQ9A 5I71C 4R4FL 5F7LB 5IVZB 3C87A 2O5YH 3VFGH 2MHAA 3QQ3B 4YX2L 4UQ3A 2BNUB 3NIFF 5HI3C 4PRDB 1TITA 4PB9H 4TOYL 5JQHC 1N64L 1ORQB 5HY9A 4MA1B 4M02A 2VN4A 4LSDA 1RZFH 4KKNA 2F9BT 3TYFA 4XBPB 3L3HB 2YPKA 4JN1H 2WMPA 1Z9OA 5MERB 4YHNA 4OCWL 1F58H 4WENB 2DQUH 3IFNL 1DLFH 5I1CH 5KVDH 1VFMA 3U7WH 4F3FA 1G9NC 4NQXA 1AXSB 4HS8L 3OAYK 1RZ7H 1ZLSL 1S7QA 1S5IL 5TDOA 5GIRA 4P2OC 1RHFA 2GJ6A 5J6GA 1OL0A 5KSBF 1BLNB 4XP1H 5J11C 1Y18B 4NQVB 5DUMH 2CGRL 4XPTH 3OZ9L 1KLFA 3CDFA 2P5WD 4LSPL 5IQ7H 4NWUH 1B9ZA 4LCUB 4XBEL 2PO6A 3U9PH 4LCIL 2XPGB 3VU2A 3C60D 3VFTA 3MLZH 5EH1A 2JIXD 4JQVC 5GS0C 1DUYA 5IV2A 3MV9A 4AEFA 2NY5H 4GG6B 1E4WL 1RJLA 2WIMA 3G6JB 4WI7A 5F1IA 4K3EL 2F54D 3EYQC 3U7YL 3EDJA 1FV1A 1RFDH 3S37X 3C9NB 2VDQH 3X17A 1FRGH 1I9IH 4P2QA 2KZWA 3EYQD 4KAQH 1DBML 4CU7A 2Z92B 2FJHA 2IF7A 1VSCA 1GXEA 5IFHH 2AXHA 5T1DL 1SEQL 2P44B 1QNZL 2PO6D 4UUJA 1EAPA 2CIIA 1SM3H 3EDEA 3T2NL 1OPGL 3OAUH 4EVNB 2SEBB 5EUKA 1GOGA 4IOIB 5LAXB 4DN3H 1EGJA 5BXFA 3W5NA 3FFCA 4Z76A 1ZSDA 4P23A 1U8NB 4KK5C 1FNSL 4RBPK 3RTQC 5F3BA 3MR9A 4Q6IB 2A0LC 1LQSR 5IJKA 3IDGA 1VADB 3LIZH 2MPAH 1L4IA 4CBPA 3SDXA 1A7RH 3LQAC 2VDOH 3MRFA 1S7SB 1Z0MA 2FHFA 1G7PB 2W0PA 3GSWB 3P30L 1JK8A 1YMHA 2Q6WB 2X4NB 3MUZ1 4TNVF 1F4WH 3FRUA 4WDIA 3T3ME 2CKBH 3JWOC 5E9DE 4YZFF 3VRJA 1TTUA 3QDGE 5C0AD 1QFWI 2EYSA 3TIEB 4MA8L 1M7XA 4LSUL 3CVHL 3P3YA 4X7DC 4JZJB 3U1SL 3LRGA 3LKOB 4Q2ZB 4PJGB 4XVSL 5B3NA 2VSDA 2VZOA 3L7FB 5JHDA 1A0QH 1P7QA 5D5MA 4ZNEE 3VXSA 2DQGL 2QHRH 5CINL 3SDDB 3BGFC 4KMLB 3UAJD 3UTTD 4DUXA 3BP6B 2Y36L 1AH1A 3KPRD 3UTOA 3BJLA 2VL5B 4MAYC 5EC1B 1NEZG 2R4RL 3BMWA 2R0ZH 4NZTH 4JFEE 1MHHA 2DI7A 3LN4B 3I85A 4ESKA 2ZUVA 2XWJB 4ZPVB 5A2LH 1CGSH 3Q6GL 3FO2B 4S1QL 1CDBA 4OQ1A 4QRTA 5DJAA 5C2UB 2VE6B 5BRZE 5J1TC 4IDLA 4N8PA 1Q0YH 4PY7B 2VLRB 1HZHH 1OB1A 1FC2D 5LKNA 1QFWH 5EU7E 1VFAB 3GRWL 4NOFA 4GRWH 5E2WH 4L9LC 2EYRA 1IVLA 2VUYA 3MNWB 2G2RB 4M1CD 1KACB 3MRPA 1R0AL 4GJTB 4XHJD 5I6XC 4OCSL 4QHUA 1UXWB 4YDIH 2JCCA 1Z9SA 4EKXA 5LWYL 4WUUB 2EICA 3OX8B 5C0ND 5J6HA 4YUEH 4I4WA 4O4YL 1HZHL 3LQZB 4OV6F 4R97C 1P4LA 2A9MH 3FO9B 4OCLC 4EN3D 5TQ2L 2W60A 3U30C 2VL5A 1U8HB 1KIQB 3VXPA 4AT6B 6CGTA 4WJ5B 4HJJL 2FATH 2DN7A 5GGRB 2OTWB 3DGGB 3IYLW 4C56E 1A7BA 4XNXL 4YC2B 5ID1A 3FOLB 4M62L 5JPNB 3IFOA 4DVBB 3K4ZA 3QIBD 2Y23A 2EIBA 3ARFB 5FUCE 3ARPA 2IWGA 4A2LA 4YAQB 4MB4A 3RAJL 3UC0H 5GGUA 3TIEA 3W81A 3TBTA 4N0UB 5GS0D 4HIJB 5IROA 3D39A 4CNIB 4FQHA 2W0FB 3SGEI 4FQ1H 4BFGA 2CH8A 2FL5A 3PHOA 3QHTC 1F3JB 4L29A 1NGPL 5JW5B 5EU4A 1LD9A 4APQB 3RQ3A 4XVUC 4K7PL 5I8CB 5D7JA 1NC2D 4Y4FC 5ACMA 2APFA 5D2LB 1UM5H 1CD1B 3O3AA 5C8JB 2H9GA 1T4KA 1QLFB 3U0WL 1F4YH 3OXSA 1MNUH 4HZLA 3RBSA 5DJZB 4Z7UB 3ULVH 3KPSA 5L8KB 5IK3A 5C0BD 2DQFA 2XICA 3MUGB 4JDTH 1PQZB 4WWKD 1HHIB 4OZHE 3MYJA 2GSIA 3GMOA 3LEYH 3JVGC 1JMZA 3IDNB 5C09D 1CZ8H 1CDYA 2DQFB 5FB8B 1UKSA 5CJ5A 5IJKC 4BSJA 1AHWC 3QQ4B 1OTSC 3QEQA 4LSVL 1KN4L 3V5KB 2FCBA 2FX7H 2J8HA 4ODTL 4DZ8B 2DYPA 4HWZB 4JM2B 4DFHA 4ODVH 3WFBH 5CJ8A 4HIIB 2ICCA 4R4NC 5CZKA 3B5HA 4OFDA 4TNWK 3VWKD 1UEMA 2V7HB 4I2XA 2J8UE 5T3ZD 4WHCA 3QNXB 5E03A 3RDTC 2NLJB 5ICXA 3S5LG 1G7JA 6FABH 1PKQE 4F15C 1U3HB 3BMVA 1B0GA 5HYSB 1EA9C 1MRCL 3RJDA 2A83B 2DQCL 4LSQH 3S36H 4X7CC 2NZIA 1Q9WB 4HH9A 5ANMB 5IJVA 5TE6H 4IMKC 1JJUA 4J3OC 1LO4H 3C6LD 4LCCB 2DWEB 3VXUE 5BZDB 1OP3K 3D48R 3ZHDA 1NGYB 1I1RA 1MI5E 4M03A 2B2XH 4HWBA 4AG4H 1J86A 4MWFB 3U6RB 3WKNA 2O5XH 1K85A 4HKJB 3F5WA 1YEIH 2IG2L 2LFGA 4KJWC 1OCWL 1A1NB 4JM2A 3P9MB 5EDXA 4PGDA 1M4KA 1ZAGA 4Z0BH 1TXKA 5K93A 4J1UA 1QSFB 3VXTB 4WI6A 4BKLA 1ORSB 1ITCA 4UQ3B 1A6ZB 3DVIA 1EUUA 1NCBH 4R97B 5FYLE 4M5ZL 4Z5RB 1M7DB 2F8XC 3H9SB 4WFFD 2VIRA 4J6RH 1W72H 4YWGH 4IRSB 5TQ0L 3V6FB 2O5YL 3VFGL 4MXQD 2ICWI 4IRZL 3ZLQC 5KSAC 1QRNA 3ZYOA 4HJJH 5FYJH 1UACH 3BKYL 3UJTH 4F7EA 1XFPA 2C3XA 5GGQL 4QHMB 5IVNA 3WXWH 1Z2KA 1NKOA 3QR2A 1FRGL 1NGPH 2GQHA 2GK2A 2CQVA 4KI5F 3WHXA 2DMCA 2ADJA 1C1EH 4L8CA 4ODWB 4A6YA 1H5BA 3MO1B 1IAII 5JDSA 4NP4L 1XIWD 3BQUB 2ZJSL 2CDGA 4OUOA 5BZWA 3LKPA 1KTKE 2BSED 5KVEL 3F7PC 4NPYA 3LPFA 5E5MB 1FJ1A 1MH5B 1YMMD 2Y9RT 4PJGA 1IGML 5IHZB 4U1NB 1WLHA 4J3XA 2HWZH 1FJ1B 1MH5A 5JA8B 3ULUE 1IZKA 1XF3A 1LO2H 4KK9C 4RGNC 1IGTA 4WV1B 4HXBH 3MXWH 5FK9A 4O5LH 5D1ZD 1MHCB 4LAJH 1G6RL 4AQ1B 3OAYH 5JHLL 3DWTA 4HF5H 3VFOA 2DQIH 2YRZA 2MFNA 1B6DA 5LWYH 3OKYA 4Z8FL 4M1GL 4GO6B 4XWOC 2GTWB 3BQUC 3F58H 2YWYA 2V5YA 5C7XH 1EZVY 3JWDL 3X3FL 1MIEH 1MJ8L 3MR9B 4Q6IA 5D7KE 3V7AG 1HHJB 1CDUA 1RURL 3BAEL 3SJVD 4NSKB 1EBPA 3HUJF 1N59A 4KZDH 4NC2B 3DBXA 1VDGA 4ODBD 4HXAH 5HYEA 4F57L 1R3LB 1A9EB 3DUSB 4PJFF 3CZFB 3QFDB 4UU9B 5KOMC 4QTIL 1QA9B 25C8L 1IKFL 1A6ZA 1CFBA 1OGAA 3FONA 4UQ2B 1ORSA 3WXVL 5L9DL 3QUMB 5EC2A 1UVQA 1J05A 3TZVA 4JG0L 4PP1D 5T5FL 3BN9D 3QP3A 1A64A 1QYGH 5HGDB 3ROOB 1E6OH 3OKNB 5I15H 1OAQL 2WQ8A 1A14L 1D7FA 4WW1A 4PS4H 2GKIA 5CHNA 4POYA 3EGSB 4RX4D 4JR9H 1JNLL 1FLTX 4GRLB 1XR8B 4NNXB 4DW2L 1AGEA 2QKIA 1JGVH 1BBDH 4HMEA 2DRUA 1MCPL 2X89A 5DJCA 2O61B 1SY6H 3TCLA 1UWXH 4LRIC 5JIIA 2EDFA 2K1MA 2HFEB 4LPVA 3QI9D 1LEGB 4LFHD 5J12B 4F9LA 3PDOA 1AIFA 2JCCF 3D0VB 3VXQB 3UTSD 4OD3L 5ICZA 4LCYA 2GJ6B 4M4PA 1SJEA 1QG3A 5EU6E 1ZK9A 5DRZA 3ZZ1A 3Q6FB 2AABL 1FHGA 2BOCB 4MA7H 4HK3J 4ZFFB 1QLEH 3QEQD 5DEZA 5DT1L 1A7RL 3MLTB 2OYPA 5E9DB 3EYOA 4S1SH 5IBLC 3X3GH 5HI5D 4U1LA 2F5BL 2DS4A 3MV9D 5T3XL 3GHEL 4X9HA 1NAKH 1HOCA 5IVXA 2Q1EA 3MV11 3M1BA 5GS0L 4FQ2L 2YUVA 5GSRA 2ZZUT 1TCMA 4PJFE 4G80A 4Z7WB 1M7IB 2IANE 5DFVD 1Q0XH 3OZ9H 4M1DH 3JV0A 3LD8B 3M45A 5LCVH 3FFDA 2IAND 4PTTA 5CD5C 1HSAB 1R3KB 4PJAE 3HZKB 3B4NA 4D0DA 1MCOH 5E5UB 5F7DB 3DETC 2HH0L 4OZGF 4FRWA 2WK2A 2I24N 3E6FB 2BX5A 4OZGB 4NZDA 5E6ID 4RFOL 3IFPA 1F6AA 2GT9A 4QRUA 4U1JB 4E0RA 2HT3D 2W0LA 3SKJH 2ZG1A 5MI0B 5FYJD 4CVZB 5FOBB 5ILTH 1F6LL 1CD1A 4JHZA 5DRWA 1CE6B 3QCVL 3FZUD 5HHMB 4U1LB 5D7JB 4X5LA 4HIHB 2QQLH 3QCTH 1YYML 3LHPL 4JKPH 4RMQA 4RNRB 1R3HB 4X9IA 4XMLH 4JY5L 1HINH 4WV1C 3MOBL 4K3HA 2VH5H 4MNHB 1WIPA 3L95B 3MODL 2B4CC 5ACZA 2DQIL 2FATL 3V0WL 4XVUD 2ATPA 4O5LL 3KS0J 3FT3A 4HUXA 5KSVA 3TN0C 3NN8A 1A1MA 1NSNH 1HN1A 3G6AB 5CJXC 2NXYD 3EDFA 2ZSWB 2GJJA 2AXJA 5HDBE 5FOJA 3MLUH 1EH9A 3L3OB 5GJSH 1UM4H 4YLQT 2GJZA 4PJXB 1F8TL 5I76A 2O61A 5I18H 1RULL 4RWHA 4LVEA 2B7DT 2JJWA 4OCWH 1RZ8A 4OLZL 1QR1A 1ZA3A 4K3DH 3WJJA 4DGVL 4J7RA 5IEHB 1GCFA 3HNVL 1U58B 4MXWH 1OOAA 4HUUA 1RZIA 2QR0A 3TBYB 1FNGB 1XZ0A 4NHCL 3S35X 1KENH 4NO0A 4X99B 5FFLA 4YJZL 4PJ8C 2P5ED 1Q38A 3BXNA 3QUMA 2Y25A 5IFAH 1QSEB 5EOCL 1KT2A 1A9BA 3FJTA 3IAQA 4L4VA 2B5IC 3VE0B 3SDAA 4CN4A 4TQEL 1OB1B 5DC4B 5KSBA 3OR6A 3UYRH 4Y8AA 3TO2B 4QLRA 5CFHA 1FFOB 1J12A 3PL6C 4NSKA 3RWCA 1G7IA 1KB9J 3GKZA 2CDEB 3PWPA 4Y16B 5I1EH 2EDLA 3K2MC 1YQVH 5DEGA 4NNPH 4KKCC 3MRGA 4HUWB 3RGVC 5L2KB 3LKQB 2W1NA 3KPQB 1RK1B 3WNMA 1ZOXA 5IEHA 1BQHB 3HE6B 1YNTB 1X5ZA 4F7TB 3DHJA 1V3LA 2IPKB 3V52H 3P9LB 4JFEB 3CMOL 5BVJB 3CFJB 4Q9RL 4JPWL 3CFIC 1GGTA 2X40A 2CR6A 2VKWA 3ZYZA 1FL5A 1CG9B 1QSFE 4FXLA 3T09A 1ZT7A 1DQMH 1EHAA 5I74B 3L5HA 1OVZA 3LEXA 3N1QC 4HUNB 4LSQL 2QSCL 1WBYB 3P4MB 1GGBL 2J8UB 1CLOH 4HWBL 1C12B 4GRLD 4X7TB 3HTLX 2CLRB 2FX8L 3RY4A 3TJHC 3NIGF 5K59E 3OF6D 2DQDL 2X9YA 4HQQL 5C0AE 4PRAA 3RUGF 2YPVH 1MQ8A 4N0YL 3MV8D 4NFBA 1AFVH 1F11A 1BFVH 5T3XE 2BNRA 4GKSB 4Y16A 1KCSL 1YEDA 1J11A 1HYSD 4U1JA 4QRUB 12E8L 1BIIB 1KB9K 4HX1B 4W4NA 2FD6H 2Q76A 1KJ2L 2W9DH 3QA3B 2R1YA 4HG4K 1H5BC 2CIIB 3RU8L 3O2VH 3KLHC 3H9HA 1NMBH 4RMSA 1GC1H 1CXHA 1ZLUH 3MODH 4N1CA 4I9WE 5F88B 1NGXA 3OB0H 1HINL 4U1SA 1MJ7H 4XXCA 4FQJH 1SMOA 1A9BB 2A6DA 1WGOA 4LIQE 2PUQT 2RQ8A 3L3GA 3P11H 4L5FL 1HOCB 3QCVH 4NBXB 2C3VA 3LOWA 3HC4H 1X9QA 4QYOA 1TTGA 2A38A 5TDPB 3CXDH 3PWJA 3WDHA 1KEML 2WSKA 4OB5L 4XB7A 2DKMA 3MV9B 5J1AA 5BW7A 1S5IH 3G5ZB 4KK6D 3AUVA 4WWKC 3DX9A 4KHXL 3STLA 1RJYA 3MA7A 1NGYA 2P8MB 3AY4A 2AJ3A 2GJZB 1NCWH 4EN3C 4RA3A 2HG5A 4ETYA 1KV3A 4I3RH 1I85C 1JFQL 2NY6B 1C7SA 2HJFA 4G5ZH 1ND0A 2UUDK 1U93B 2OLDA 4X9FA 4JO3H 3EYUL 5EO0B 1FVDA 3HUJE 3AB0C 1RHHA 5HYFA 4LPCA 2NLJA 5ICXB 4D9QD 4HHAA 5GSVB 1JUFA 2AJVH 3QNXA 3F62A 4GKZA 1H8SA 3O2DH 3DHMA 1ZLWH 4ZDHB 32C2A 4ZFOL 2VXTH 5D9SB 1MCCA 1H3VA 1Y6MR 3W9EA 2VRAA 1A3LL 3QUYB 4JQXC 3VG0L 1I7TA 4YK4B 5KS9B 3GSRA 3TYGH 4M8QA 2YOCA 4X4YB 4EQ2A 4GMTL 4Q0XL 1IGJB 1QBMH 3GK8L 2FDBP 4WIQA 4XC1H 3L9RB 5FO7A 4ODXB 5HSFA 5C08D 1T1XB 2D7MA 3ZT7A 1A7QH 1Z3GL 3T2NH 2WAHA 5F7DA 3ARGD 1DBAH 5IBUB 3BFOA 5D1XD 4NQCA 3QXAB 4Y4FA 2P5WA 5GRUH 4ZMAT 2BP3A 4KV5E 1CBVH 3ARTA 1TTFA 3CFKB 3GK8H 3ZDXE 3C6LA 4Q97A 5E4EC 2AEPH 4U1KB 1CLZL 4HX1A 4DK6A 3LKNA 5HBBA 1BJMA 1OP9A 3BGMB 1MWAH 5DD0H 4M4RA 5K9JH 1SHMA 3BW9B 2IJ0C 1I3VA 4LSTL 4P9HL 3OJDB 3T0EC 1ZWIB 3DMMD 5L88L 2E9JA 3RI5F 1I3GL 2AJUL 3DV4B 2VDMH 4UAOB 4WO4C 2J8UA 2B1AL 3HAEH 4HC1A 2V5RA 4OCYH 4X6BB 2YUWA 4N0UA 4OF3A 3BDYL 1SVZA 4YFLF 5GGRY 4NQED 1C5BL 1AIFB 1U3YA 4OCXH 5F1NA 2XZCH 1XGTA 2DQEH 1N8ZA 4R26L 1U9KA 4LVOB 5CJOL 1IQDB 3BPNB 1IAIL 1YMMB 4PJ9B 3LRSB 3D2UB 2F53A 4OBRA 2X70B 3SKOA 4ELMB 2XN9B 1NEUA 3WIIH 5CEXA 3GSVA 4JO2H 3P9LA 2IPKA 3VGGA 1U95A 2DQEL 4YBQD 5T3ZL 4I48B 2NY4D 4M43L 2AI0L 5EZLB 3ALWA 1XCTA 1F4XH 3LQZA 3G04B 1TJIL 1DUZB 4WW1B 5CHNB 4DAGH 2HVJA 2BC4A 4DFIA 3HI5H 3ROOA 3S6CA 5C1MB 2PR4L 3CLEH 5SWZD 1Q1JL 4LLDB 4C83A 2ATKA 1HH9B 2PTTA 3GHBH 2D9QB 4Y5XA 4YHZH 3SJVA 4M3JA 5LBSH 4AEHH 4YX2H 3O81A 3MNWA 3IFLL 4OZIF 4PRNB 1X4ZA 1GHFL 1UB5A 2OL3B 4JDVB 1KCUL 5K9QI 1LO2L 3IETA 5C6TL 1R3LA 4OFKA 3OKLB 3RVVD 4P4KA 5C0RL 1K4DA 4R0LC 5DS8A 5DHXB 1CGVA 3VFNA 5ALBH 2DM2A 4XB8A 4N5ED 2JJTC 3PHSA 1NC2B 1BAFL 3DURB 3NA9L 1YPZB 1RZIB 4OJFL 2BY2A 4HH8A 2VISB 3AREC 5ADOH 2R2HA 1JHKL 1SY6A 4BFIB 4X9BA 3GB7A 5D1QD 2QV2A 1DEEA 4PJAB 3VRIA 3PWPE 4S2SA 5CCKL 1BGXH 2R0WL 3GSQB 1RIVL 2LVCA 2FGWH 5IJVB 2FEEI 4X6DE 3MJ8B 4MNQB 2XN9D 1Q9WA 4JO3L 3ET9F 1K6QL 2VR5A 5JIKA 3Q1SL 2YD4A 3D18A 5GJTL 4CDHA 3OKEB 3DARA 4UV7H 2P5WE 3ZKND 3K8LA 4CN6A 1GZPB 5CEZD 4I3RL 4WI8A 1NBZB 2IPUK 9CGTA 4IRJB 4RMUA 3H42L 2DMKA 5CIPA 5I1DA 4GKNB 5KS9E 4JFFA 1DE4B 4OM1L 3WHXB 1S7SA 2EEBA 2NXYC 2Z4QA 4LP5A 2X6MA 1IFHH 1VEMA 2ZG2A 1XGRA 1ETZB 1MCBA 1X3DA 1K8IA 3QUMH 3L3KB 1MREL 3DRQA 1G9NL 5LJYH 4NN6C 4PYHA 2DAVA 2Z8VC 3VWKB 5D7IE 3CXDL 1WVZA 5C09E 2Y5TA 2FWOB 3F6IA 3BW9A 1QFUL 5D1XC 4OLXH 3HLAB 4Y19D 1CS6A 3BGMA 4LQFL 3E6HB 3LKRB 4JFOA 3NPSC 4M9OA 1Z5LB 4U1KA 4FOMA 1I3GH 2BCKA 2P1YA 1OD9A 2I26N 5D6CA 5BV7H 1WK0A 3ARRA 3ILPA 4YBLC 5C0GB 2AK4B 3QJFA 2JCCE 3SGJA 2YMXH 4L8DB 2W65B 2KZ1B 3ARBA 4NFCA 5JXAH 4G80B 5IK3B 4PY8I 1EAJA 4EXKA 2DLTA 5GSRB 1ZGLM 3ARGB 1KNOB 2BVPA 1JZ8A 4NZUL 1FV1B 2PYED 3IU3B 4G8FA 5HYSG 4KK8D 3EOAB 4WW2F 4Q9QL 1RULH 3CFBB 3WEXB 3QB7C 1K8IB 2MOVA 3L3KA 4DKFL 5D72H 5EU4B 4NHUB 3UDWA 4IS6A 4PGEA 4QT5A 1FAKT 3TPUA 1JGDA 4G8GB 1MRDH 4XNMB 3W11C 3M8OH 1AJ7L 1FVEB 2H8PA 1LK2B 5F71A 1FFPB 2Y06L 2ICEB 3ARSA 2PO6B 3OXRB 4OFPA 5CILL 5C0DB 3MJ9L 2IPTL 1GAFH 1TJGL 1UJ3A 4KDWA 4XCCH 2J2ZA 3MUHL 5BMFL 4Z95L 3TVMC 4HJGB 3BISA 1FDLL 4JANB 4U7MA 5JW3L 1L7TL 2EXWC 3C2AH 2IFFL 3F6LA 3NCCB 1IM3B 1U3HA 3NH7L 3MJ8A 4PJFA 5I8OL 4OTXL 3MACL 2FHBA 4OZFH 3CFEA 1X5KA 4MDJA 5D8JH 1D9KC 2YD7A 1PZUB 3GSUB 5JR1H 3MXVL 3DX9B 2J88H 2WWKO 3TN0A 1HI6A 5J1AB 1NGQL 3LS4L 3KPSE 1A6AA 1GGCH 1KIPB 3IAGC 1KJ2B 1JRHL 3U7AA 5T5NF 3D1MC 4NIKB 4RFEA 1INDL 1S8DB 2BVPB 4FZEL 1P7KA 1P1ZA 4XP4H 5KOVC 4U6VH 3B9EA 1MUJB 4WU7A 2V2XB 1BEYH 4GRWB 5E2JA 2D0HA 3B83A 1RUML 2H2PC 4HBQA 5C6TH 1WZKA 1C16B 3RZCA 4FZEH 5D5MF 1FO0L 3T2OA 4LNRA 4UU9A 1CYGA 4RAUB 5C2BH 4U1MA 5F7UA 4JRYE 5DUPL 4BK4A 3FAXA 1JRHH 3KYOA 1KN2H 5TQ2H 4OCRL 4OAWB 4J4PC 2ATKB 1DN2A 2F54B 1RUPL 1VEOA 3PV7A 1EEZB 1KTLA 3C5SB 4QNPE 4FP8H 1CICA 4M6AA 3FAWA 4Q58C 5LBSL 1FH5L 1QHPA 1FL6B 1BBJB 1MHHB 2NTFA 3WDJA 4YQXL 1LO3H 1NJ9A 5GQBA 2EC9U 1X5IA 3QUZD 1KSRA 4J3VA 5CJXA 1AKJB 4G9FD 4X6EB 1HXMA 1B2WL 2MQ3A 1CN4A 3QIWA 4NKDB 4R7NA 1URLA 5CEYA 3ARDC 2IFGA 1FN4A 1CU4H 3N1GC 3TBTB 4KK9D 4BZ2H 1S7UB 1LWRA 1FIGL 1KGCE 3WNNA 5IMMB 3CAFA 2OX5A 3LAFA 4XP5L 5TF1L 4GQ9L 4IEFB 4PJ7B 4X6CE 1VACA 4KGJA 5TFSH 2WBJB 3WD5L 3G9VA 4U4BA 5DC9B 4S2SB 1KLUA 3KYMA 1KIQA 4RDQF 4TSBL 5KJRL 1X6LA 1VKXB 1CIUA 2W91A 3RRQA 3L7EB 4KUZH 1MHEA 4FMKA 1I1YB 5B38G 2FB4H 4HGKC 1P5VA 3O3DB 3HE7D 4NDMA 1CICB 2YEZB 1G7IB 3QDMD 3UO1H 3DSNA 2Y1VA 1KPUA 3WN5C 4NM4H 3W39B 4FQXB 1ZVHA 5HDOA 2GK0B 3O3EB 3GSOA 3RPIB 4OCXL 4LQFH 5ICYA 4PV9B 4G43A 2X05A 1NDGA 4M5YH 4V1DA 2C9AA 4FXGA 2DQGH 3TA3A 1N7MH 1S7TA 4WI5A 2ITDB 1FO0B 3WFDH 2V2XA 1HCFX 3NCYS 2R2CA 4XPAL 3FB6A 2UZIH 4Q9BA 2BVOB 4PJHB 3SJVE 5I73B 3I3DA 2Z35B 4TUJA 5KVGH 3QUKB 4WNQA 3TBWB 4GT7A 3BKMH 4Y2DC 4EIGB 5C0EA 4GW5A 2YZ8A 2ZCLL 2HVJB 5EZOL 4HUUB 3RHWF 4JCLA 5EZLA 4O2EB 3W9EB 3EO1B 3SN6N 1CLCA 4Y7MA 2BMKA 2UYLA 5GS2H 3I75A 3GRWA 5JIHA 1NUDA 1LO5A 4XCCL 5KN5B 1VPOH 3QNZB 1DVFA 1J5OL 3U2SA 1DQQA 3C60B 4K07A 1SEBA 2RB8A 4RCAA 3HUJB 4OT1H 3G5YA 2Q7YB 2HRPH 1CQKA 4K71B 1LNUA 4QHKI 3T0EB 4XX1E 1NBQA 2DJSA 1P53A 3AGVA 3PWNA 2HG5B 3NPZB 2A2QT 5GZOC 5LXGH 1D9KA 3O6KL 1XGYH 4OCNC 4JFZH 1JGDB 3VFUA 3TFKC 1DQJA 1UWEH 3VXME 4WU5B 1NCTA 1U8OB 4N0CC 1QLRB 3NFSH 5EA0L 1KUMA 1UACL 3BKYH 3FN9A 3NZ8B 4OSUH 5E8OB 2WM0A 2NNAB 3BO8B 3IDXL 3FQXB 5DRWB 4G7YL 1DN0B 3D39E 1T89A 1FYHB 1FE8L 4NKIL 2OL3L 5CSZB 4PTUA 3SDDC 3BPNC 3IGAA 4C54A 2HTLC 2BDNH 2GFBB 4E41D 1ES0B 1VHPA 1Q94B 1ZT4B 4JRXE 5JORB 5FB8A 3GO1H 1KFAH 3I9GL 2ORBL 3HG1D 2OR7A 1D5MB 4LCIH 3SDCB 2E5EA 3MMEB 4KUCD 3S96B 1FYTA 3IFNH 2KQNA 2OS7A 1D5IL 1T1XA 3DVGB 3U9UB 5EZIL 1A6UL 1G7QA 4LOUC 4PG2C 5FXCH 5TGBA 5I2IA 5IF0A 4QRRB 7FABL 4PJCB 1WSST 2R9HD 4JFDA 3BHBB 3MROA 2Y5TB 1KB5B 5IMKA 1X5YA 2W9DL 5E8OA 3T65B 4H25A 3BUTA 3EYOB 4S1RH 4WHTA 4PB9L 4H1LB 3FQWB 4TOYH 4RGND 2QJDA 1CL7I 3T3PF 4AJ0A 4ZDHA 1SJXA 2EDBA 3SGEH 5I1LB 3GM0A 5GGSY 3VWKC 1F97A 3WUWA 3FRPG 3O8XC 5EBMB 1JYNA 4LCUA 4S0SD 1FVDB 3RWGA 1EEYB 1MVFA 4Z0XB 1J8HE 2R2BA 3ZE2E 1YPZE 4AIOA 4YXLL 3RNQB 1XIWB 1F2QA 4PGBA 5FYKE 2LV4A 1PX3A 1DDHA 2AEQL 1YEEL 3T77A 4AMKH 2PCPB 5CLTA 1R3JB 3NGBC 4QHNA 4X6DA 4U6HB 3HC3L 2BJMH 2ILLA 3L5XH 1BFTA 4D0BA 1JIBA 3QQNA 5T1LB 4DKEL 4FXKB 5DVKA 4H0GA 3QPQD 3QIUA 3ULUF 4GMSH 3BP4A 4NUGH 3MRGB 2JE8A 4MXVF 4P2OD 4Y19A 5C2BL 3DXAB 4KH2A 4PRHA 2ESVA 4QXGL 3EOTL 4WNQB 4GG6E 4Z7NE 1CLOL 3RVUD 1FAIH 1YNLH 3OHXA 2PXYA 1ZHBB 4U3CA 2BNUA 1RZJL 1OGAB 3HG1E 2ZUSA 4NKMA 4ONGH 2CRMA 3HPJA 2IMMA 5GISH 1DEDA 2AW2A 4U1IB 1QSEA 3C08L 2BSTB 2PW1A 5JXED 1A3LH 1KPUB 5FHAL 1YC8A 5EUOE 1KENL 4AH2A 3CMOH 3BKJL 5I1HH 1MVUB 3IJHB 1U92A 5E08H 3BZFA 1N3NA 3N06B 1EJ6A 2F19H 1K3ZA 4Y19B 3X12B 2GTWA 1BQUA 1HE7A 2JJSC 4UDTA 4G6FB 2AK1H 3C6LC 4R26H 5DJYA 2ITCB 5IM7B 4KVCH 1R5WA 1OP5K 1JHLL 4X6DB 3IDJA 3FCTB 2X70A 3QDMA 3SKOB 4ELMA 1TZIA 4NQEB 2VDRL 4U6YB 1KG0A 3SDDA 4PJ7A 3BAEH 1IQDA 3MOAH 3PGFH 4A6YH 1U3HD 4M7LH 5FUOH 5IGXL 3RWEA 4JREB 5F9WB 3PF2A 4KJQC 3V7MA 4BH8B 5L7XL 4O02L 2HN7B 1NBVL 4XNZC 1G7PA 3LH2L 3JTTB 4NKQB 4FFVC 1MCEA 3SDXB 2D03H 4M7JH 4V1DE 2NTFB 5E2UL 1EIBA 3KLAA 2HA1A 5I1IL 1JNNH 4OKVB 3D3VA 5D1QB 4HV8B 1U92B 3RIFK 4D0CA 2EDKA 4P9HC 1I9JL 5ESAA 3BDBA 1J87A 1IC5L 4BQ8A 1PYWA 3WS3B 2R0KL 2R56H 3QZWB 5H94B 4DVRH 3RX8A 2P5WB 5C08B 3IB4A 3AS0A 5GS3A 1I3UA 2VTFA 3CX5K 3IKKA 1Q0XL 2Z92A 1ZHBA 4TSCH 2EE2A 2PXYB 4R6UA 4WU7B 1BVKB 3HZYB 3L5WA 1AE6L 1HHHA 3LSOA 5AD0A 2I60H 3HFML 3ZTNL 5GS0H 2UV3A 2EIZA 4XRCA 3CLFL 4JO1L 5CSZA 3GBML 5ESQB 5KTEL 1XF4A 1WC7A 2A6IA 4WCYH 2WLYA 3U83A 5LGHL 3A0OA 5FHBH 2VXSL 1QKZH 5IVXF 3UTPE 1NCDH 4CMHB 2D31A 3GMRB 2A9NL 1RJLB 4MWFA 4GG6A 3DSFH 3O2DA 5F7WC 5HDQH 3MFGB 1PY4A 4JJ5B 2KL6A 3T2PA 2X9XA 2NY1D 4WW2C 4RGMC 5E8PB 1DL7H 5CCKH 5E8DL 3W11D 4E5XB 3PG2A 1JPTL 1KPVB 3TGXA 1IC1A 2F5AH 5I1JL 3PGDA 3VG9B 2GITA 4QNPF 3V5HA 1XMWA 2HMIC 3DVFA 4Y4KD 5LG1A 1MF2H 3PGDB 2EH7H 2VWEC 5D96C 5LCVL 4IOFD 5IROC 2ICWB 4E5XA 2AP2A 1D5ZB 1K3IA 4GAFB 2JK5B 5D2LF 1R5VB 4HSQA 4PR5B 5DF0A 4KQ4H 3IXTA 3BH8B 2DBJA 1CQYA 3VXNB 4DEPB 1E27B 3IDIA 5GZOD 1JRHI 3QHZH 4ZAKD 5FYKU 3WDIA 1DLHB 2X2YA 1CGTA 2XY1A 4URTB 3EGSA 1AD9B 4E42B 3NAAH 1JZ2A 3FT4A 4AIZA 1X5GA 1OGAE 4XP9H 1SM3L 2EDNA 3L3GB 4WHDA 5FYJE 3CVIH 4N0FB 1BD2B 1B90A 2Q3AA 3WNPA 2CXKA 1IBGH 1N0XL 4XHQA 1F6FB 1T2XA 3I02B 3RPIA 2W38A 3H3KA 3O3EA 5CEZL 5KSAD 4PRBA 5F3HA 2PTUA 2H45A 1XGQA 3ZSTA 3THMH 3T8XA 5J8OA 4JRXA 1CR9H 3DVNB 5H37H 5E94B 2FO4B 3QI9B 3E6HA 3KLDA 4MD5A 4BFEA 4AMKL 1YEDB 4QXTB 4ODUA 1UWGL 3O3AB 4P3DB 2DLHA 3E2HC 2EEAA 1NL0H 4X6CA 1XT5A 1ZVYA 3GSNH 5E9DA 5F7EH 1G1CA 4K2UL 1JV5A 5CP3H 2D7TH 2AGJH 2AXGA 1K2DB 4TRPL 3EYFA 1TDQA 3I3EA 2AS5M 1FG9C 5BOPA 4XAKE 3K8MA 1NKRA 2EXYD 1WCQA 1JPGA 3UJJH 2QHRL 1CIDA 1EZVX 2WANA 1IGYB 3MYZA 3B9KA 1JWMB 4X4ME 1T1WA 4PJIB 2N56A 4R9HA 2CRIA 5GGUB 1NFDE 1P84J 4GRLC 3D0VA 2YUZA 4GBXC 2YD1A 3BE1L 3E2HB 3GI9L 1KYOJ 5E2VL 5JA9A 1L9MA 5BZWB 5CEYB 4OF0A 7FABH 5HHOB 4X0KB 5JDSB 3N9GH 4X80H 4QRPB 3QIWB 2EE9A 1MJUH 4L4TA 4NKDA 4D2NA 5D71L 4K55A 5L2KD 4IMLA 2GHWB 2RHEA 5EPMA 3O11A 2E7CA 3N1PC 3UC0L 2VISA 2ADGB 1LEIB 1UB6B 1N64H 5IB4B 3D5OF 1YEHL 2F54A 4XNZB 1UVQB 1ACYL 2YA2A 3O4LB 2H32H 1UH4A 3BX7C 4YWGL 3MRJB 5C09A 4KUCF 5IESL 1YECL 3IETB 3AMLA 4N9GA 2RFXB 2AV1A 1YNKH 2AJZA 2GK0A 3HFMH 4ALAH 4GW4B 2UZYB 1J8HB 4UIKH 3SO3C 4FQXA 3AREA 5D7LB 4PJGF 2YC1B 2HTKD 4J6RL 3D87B 4LBEB 2NX5A 2VLME 3EDKA 4GBXD 3O6FA 4LPTA 3RUGE 1IQWL 5INDA 3MRIB 2R56L 3UBXG 3HHRB 3KJ4B 5JW4Q 4BFBD 1F8TH 4JGJA 3VFPA 3VW3L 5EOTA 3TV3L 2GY7B 3VFRA 2KQMA 5GGQH 2ZG3A 4MLSA 1RZ8B 3ROLA 4HWUA 5SX5H 4P2CG 5KTEH 3SO5A 1KLUB 2YD3A 2X4UB 1T7XA 3NCMA 4M7ZC 3DXAE 1RZJC 4V2CB 1L6XA 2OL3H 2BY3A 4UNTA 3GBNH 5ANMA 4JQVA 5ISZA 4POUB 1A21A 3IDMA 4YHIA 3WNKA 4PJCE 5F8QC 4JANA 4CMHC 2ZPKL 3G08B 1ZXQA 5FO8A 5LVEA 2R2BB 2Z8RA 1M1SA 3B3IA 2NY0B 3M17A 4Z7NF 2ATPB 1YYMH 1LMKA 5EBMA 4D9QE 3UTSA 1JPFA 4YFEA 2NY3D 3QNYA 4UB0L 4OF5A 1DANT 2XNAB 5F7KC 1A14H 1HYRC 1I9JH 4GQ9H 5IWLA 4X6EA 5C92A 4KTDH 5A16A 2X9WA 3RGHA 4PLJD 5FUZL 1BVLB 4NO0D 1CGUA 5LGKA 4HIIA 3AB0B 2HJKA 5FOBA 1LK3L 4JFYA 4ODUB 3HRZB 2CLZA 3GSXA 4HKXB 4P5TB 3VFWA 5C9KA 1Y6NR 4MD5B 2GSGB 4LHJB 4ZO6A 5HVHB 3MSPA 5INCA 1FIGH 4BQCA 2X41A 1SJHA 1U8LA 1CR9L 3DVNA 3HCVA 3OSKA 3KYOB 3C6LB 4APQC 4JE4B 5JZ7C 1VGEH 1PBYA 1X7QA 4LHUD 1XCQA 1OTUD 2IAMC 4PREA 4TNVK 4XCYA 3T04D 3BKCL 2J12B 3KG5A 3O0RH 4RAUA 3T0EE 4Z18A 4QEGA 3DTXB 5LGJB 1CGXA 5D6CB 3O9WA 3RWFA 3JWDH 3QJHB 1CF8L 4PJEF 4CRPA 3LQAL 5A2FA 1JHTB 1E4XL 1UG9A 3IGAB 1A2YA 3KPRA 4F7PA 3UCRA 1MNUL 4X5XA 2UZIL 1T0NB 5MEQB 3HMXA 3DO3A 4IMKA 2P7TA 2Q7NA 3PUCA 4L9DA 2YD9A 1N7ML 3CCHA 3R0NA 1BVLA 5IB2B 1MJUL 2IBBA 4YHYB 1TZHA 4G6JL 1OY3B 1RVFH 4JLRB 3GNMH 4HT1H 5FKPA 4PJBE 2F19L 2EEDA 1AHWB 3UBXA 3H9YA 5A16B 2Z93A 3NA4A 4YEEA 5CGYD 1CLYL 1S5HB 3ZMRA 4NQTA 2DM7A 4MQXC 1ZLVH 5ITBH 5CIPB 5DYOA 5FM4A 4RMVA 3RTQA 1FL3A 5EBLA 4G6KL 1N5YH 1ULVA 3RGVB 3UTTE 4YHIB 1B0GB 5HYSA 1P9MA 4LLYA 1CDIA 1CGWA 2AGJL 4G8GD 5B4MD 1T6WA 1G7JB 4OD1H 5GZND 4WTZG 5F89B 4DVBA 1LK2A 5KSAA 1DQML 3TT3H 4YZFE 1N5YL 5ADPL 5LGHH 4NO2B 2PKDA 1WBZB 3QFJA 2UYLB 4ERSL 1UM6H 1DBJL 1YJDL 2W60B 4XXCC 3RNKB 1L7TH 1JGEA 3K7UA 1S7WA 2EDOA 2C1OA 1WIOA 5E99H 3QUZB 1JI1A 4G8FB 4GAJL 1C5DB 3MNVB 5EB9A 4XPBH 5CGMA 5FGCB 4PRHD 4TUOA 2A9ML 3QIBA 3EFFB 4RIRA 4JO4H 2ZOKA 4YHML 1VCAA 1T7YA 1A4KA 5DS8B 3ULUC 4XNQA 3PABA 2EZ0C 3MRPB 2I25N 2ITDA 4Z0BL 1QA9A 3VDAA 4RFNC 4F33B 3H9SE 4Y1AE 4PP1C 4NN5B 4YDIL 2BVQA 4N8CL 4U2YA 3TIDA 5EUOB 1IAOA 2I07A 4HLZG 2YN3A 4XVJL 3VG9C 4CDGC 2H1PL 4WFHD 2OZ4H 3H6JA 3NFNB 3GO1L 4GXUN 3DX6A 4O51A 3NCJH 4FN0A 2BC4B 1J9CT 1CXLA 1LEKB 3AAZB 1LO0H 1HQ4B 4O2CA 1AQDA 1S7VB 4Z7VA 2HLFD 2BSSA 4KQ4L 3BWAB 1GJIA 2VH5L 1CTNA 1MHEB 2HVKB 2P5EE 1OP3H 2XTJE 3GFUA 4P3WA 3BVNA 3WUZA 3V2AR 4NFDA 2VZTA 4HBCL 3JTTA 4HMDA 5T1KA 2E7MA 4LRNL 3ZKNC 3DI3B 4LCWE 5HHOA 1JNJA 3HA0A 2QADD 1NBZA 4O9HL 2HYMA 2VABB 3MRDB 3HAEA 2R4RH 3VD7A 1J8HD 4TPRH 4MNQD 4TSAL 2QQNH 1ZHKA 5J06A 1DCLA 2AK1L 2GJ6D 1FN4B 3MRDA 5D70L 4N1HB 2VQ1A 2CDGB 1MCHA 1IL1A 2FH8A 5L0QB 1WFTA 2ZPKH 3QUML 3GIZH 4Y4KC 4CAGA 4WJ5A 2A74B 2HKFL 2J4WL 3Q5OA 1YNTA 3ROLB 1WWWX 3JV5A 1HHGB 2XACC 1AD0A 2HVKA 3E0GA 2NZ9C 1KULA 4L8SA 2IALA 3KAAA 1HQ4A 5DJDA 4ORZC 4CVWA 4F37K 5J4MA 4LKCB 4XAKD 1FNSH 4L3CA 4FG6D 1G7HA 3VI3F 1EEZA 1KTLB 2NXZC 3C5SA 4K8RC 4NQDB 3TA3C 4U0QB 1QRNB 5LAXA 1U42A 1FFRA 3LDBB 4DN3L 3QO1A 3QDJB 4WFGE 3ARZA 1MFBL 4YDVB 3H9SD 2L7JA 4XI5D 5BS0B 3V7AE 4MQ7B 3GIVA 3MBXH 5AZEL 5B39B 4FNLH 3V8OA 4G42A 3DV6A 4N9GB 1G9NH 4JRXD 2Z9TA 4PRNA 5DR5L 4QXGH 4RAVB 1J0HA 1S9KC 4YFLI 2EDDA 3CXHK 4P2QE 1WT5A 1U8QA 1QBBA 4XNQB 4ZXBA 1T20B 5JNYA 1FZJA 4HUKB 5DD1H 4LEXL 1J5OH 4V2BA 3PJSA 5GHWL 3WNOA 5ERWA 2YXMA 3ULSB 3NIDF 5IP4A 3B9DA 1UB6A 2ESVB 1YEGL 2ADGA 4OLUH 2AQ3A 4JFDE 1OW0A 5T3XD 2NY5L 2VDKL 1T04B 4EOWL 1N5AA 2QL1A 1MCLA 1FP5A 5EZOH 1W2KT 1JNHB 3GI8L 4NGHL 1JNLH 5FUOL 3HI6H 2VZVA 4QOKD 5J57B 4Y1AA 1FGNL 4HH9B 3K1DA 3N1FC 1IM3A 4K8RD 3K80A 3HE6C 4DW2H 3MJGX 4WHYG 3CH8A 4GSDL 3RNQA 3TNMB 3L5JA 3OKKB 4K3JH 1AGBB 3W82A 1A7OL 2EE3A 5CUSH 4JO2L 1V3MA 3FRUB 2L0DA 4UAOC 1QSED 1YMHB 3WLWC 3PNWB 4XNMA 3MA7B 3D9AL 5ID0B 2OQJB 3UTSE 4ENEC 5D6DA 4G7VL 3H2WA 3P0YH 3JV6A 5I9QB 3MLVL 1OP5H 3CXHJ 1D5IH 2DQDH 3WS6A 1R0AH 5KVDL 1SBSH 5I1CL 3OGCA 1DSFL 1WBXB 4JG1H 4U31A 4K9EL 1CZ8L 5JO5B 5KZCD 2DI8A 4X4XB 1EX0A 2JIXB 1LO3L 3INUL 1WZLA 1HHHB 3LSOB 2X42A 3RVWD 4M6NH 4B50A 1OAQH 3IS1X 2MHAB 3QQ3A 4P4KD 5DVNA 2AK4A 3QJFB 4NWUL 1NGXB 5C0GA 5DA4A 4PRPE 1UEYA 1P7QD 2BRQA 3QT2A 4LSSH 3S35L 2NCMA 4UIMB 5DSCB 3BPOC 1D9KD 1M7IA 4Z7WA 2D7OA 4N0FA 1MPAL 1Q94A 1BAFH 4ZUTA 4NQUA 2UWEE 3L9RA 4NZTL 4OFYD 4EUPB 3PE9A 5FEBA 1IGJA 3ZKSD 4HKXA 1TJHH 2DQUL 5D1QA 1KC5L 4J8RA 4P4RA 3WL9A 3VWKA 3HPLB 3A6BH 3KPNB 3N85L 1U8OA 1C1EL 1GPOL 1YEEH 2FBJH 4XP9L 1G84A 1V7ML 1LD9B 5IOPB 3VDBA 4Y2OA 5K9OA 2VAAB 3OGOE 2CD0A 2ZJSH 2BOCA 1QACA 5ISZD 2NY4B 4MX7A 4ZPTB 3DGCR 35C8L 3I3BA 3HB3D 4Z8FH 2J88L 2WBWB 4QHKJ 3LEXB 3N0PB 4WGVB 1I1AA 4OGZA 3U30B 3DSFL 3VG0H 3KXFB 3QEGH 1ZVSB 2X4PB 2XXCB 4MAYB 2O5ZL 3TCXA 3IDMB 5AZ2H 2VXSH 2IANB 4YAQA 2OR9H 1FNHA 4JRWA 3QNZA 5IT2L 4WI3A 5EN2B 4JJ5A 2UUDH 1KB5L 3ZKMC 4DCQA 1WICA 2F5AL 2VWEE 3P77B 3EOYG 4LSRH 3P73B 3D3VD 1QO3A 4YNYA 3VFPB 1E6JH 2E6QA 3FMGL 4HAFA 3ZKMD 1KBGH 3ALPA 1KLGB 4K94L 3EYUH 1IEAB 1NC2A 3QBTB 4LHUG 1SEQH 4LLVB 4K7FA 1OAYH 2G5RA 3HZYA 4MQXD 1XF1A 4X6FA 5CMAB 1E4JA 5J13B 4LVNB 4JM4H 5E8NB 5F88A 5D7SH 1KJ3L 2Q8AL 3V8CA 5IQ9B 2J5LB 3S88H 4Y2DD 2ARJA 3D39D 5C09B 2UWEF 1KJMA 3EOBA 3QA3A 4HBCH 3QDGB 4ETQB 1OD7A 2B2XL 2PYEA 1FZMA 1HH9A 2YMXL 3QDJA 3WUWG 3CX2A 3SDAD 4LCWA 1AJ7H 1BFOB 4C4KT 2E8ZA 1MY7A 1TIUA 1ZGLA 3ARED 3FO2A 2FNBA 3O41B 4N8VG 4XBGA 1INEL 2V9QA 1GC1L 1XGYL 5F9JA 4TSAH 2IQAA 3ARGC 5GS1A 3MLPA 3LMJH 4YNYB 3MGOA 5L2KE 4M7LL 1A0QL 1ED3B 3L3IB 3GSNB 1A7QL 1JPSL 3PGFL 3MLUL 4U6HA 1IGIL 3KDMA 1W0WB 3ZKXB 4LAQL 3SBWA 3BSZH 3KS0H 1ACZA 3PXJA 4APQD 1R3JA 3RIAF 1YMMA 5IUSA 1JGUL 2D03L 4M7JL 4HIEB 5EFIB 3K4AA 2HT4C 4JHWH 2C1PB 4N0CD 3DIFB 4YH6A 5HHVL 1HQRA 1NAML 4XVTH 5JXAL 1YNKL 4MVBD 4K3JL 1HNFA 5IMMA 3MCKB 5DD5L 3WJJC 4U1NA 5IHZA 1OWRM 5I0ZA 3TFKD 2RCSL 3ULVE 5C0CA 2FX8H 1HQRB 3BP5B 5D1ZC 2OBGA 3UYOD 2WUCH 1EK3A 3SE3C 1W72B 1JTTA 1RZKC 4BSWB 1Z9MA 5DQ9A 5JOPE 2NW3B 2XXMB 3MGTB 3C8HA 4CJ0A 4N8VB 3SPVB 2FYYA 1J1XH 2JJVA 4L3AA 4Y16D 4C59B 4MJID 2A1WH 4DTGL 3F7RA 2PYFB 3O2VL 4RFOH 1R24B 4HFWA 1N4XH 4GS7B 2AABH 3JWDC 1BVZA 1H15A 5D1ZB 3QH3B 4XPBL 4XC3H 1KCSH 1P69B 3KYNB 3MLYH 4L8BB 4RAHA 4K94C 3TIDB 4J12A 1I4FA 5GGVH 3B9KD 2VDNH 3AY4C 4MJ4A 4JFQA 2HFFA 4CKVX 1VEPA 3S37L 3J8F7 4LLWA 1OLLA 2APVA 1UM6L 4G3YL 5BVPL 1GHFH 4WEMB 3VXTA 3MFFA 3DLQR 2DLGA 2Z0BA 2I9TB 1MFDL 1AQKL 1RIVH 5KVFL 1FFQA 3DMMC 4OF6A 5JO5A 2NQCA 1E28A 2QR0B 3GHBL 4ZYKB 2C3GA 2D7QA 5F21B 2G9HA 4PGZA 1G9ML 2H41A 4P2RA 3G6JA 5D7KD 3Q5TA 1TCRB 2XZQH 5D7IB 5ELIA 3I6KB 1EHLH 5D7IF 4KKCD 3GSUA 5D7JC 3ULUD 4TVPD 4FFYL 2DWEA 1CK0H 2MWCA 4P46B 4KRLB 3VJ6A 4XGZB 1U36A 1NCNA 1YEJH 5KBNC 3HZMB 3HC3H 2ZOLA 1BZ9B 5ICZB 3F7YA 4K3DL 3O6LL 4G9FE 1FL3B 1KPVA 5DDHA 2V7NA 1LK3H 2ICEA 4KROB 3JWOH 3K1KC 1J0ZA 1EO5A 1YPZF 4G8GA 1ZEAH 2Y6SC 4NRXB 4JR9L 1A6UH 5TDNA 4NHUA 1T04A 4P23D 3UPRA 1RPQA 1JMXA 1T1YA 1ZANL 4HK0B 4P2RB 3UJIH 5DURB 4L9LB 5T5FH 1B0RA 4QF1A 4JVUA 5DJXA 1MAML 1B3JA 5I1AB 5IBTH 5HI4C 2DQHL 1A6WL 1G6RB 5HGDA 3NIDE 3WE6A 4S1RL 4DQOH 4IIQC 2Z31D 3MLXH 4ZUTB 1ZHLB 5CD5D 1T21A 3D2UD 4MB3A 1E0OB 2W65A 4UIMA 1YY9D 1MWAL 3O9WB 5DD0L 5DSCA 3SDCA 1BX2B 4PTTB 4PBVC 3FFDB 1I4FB 1YJDC 2VKXA 4XWOD 3TJEH 4F80A 4XWGL 4KTDL 2MCPL 4XMLL 3QEHB 3EYSH 3HI1A 5D1ZA 4OCYL 1YUHA 2UWEB 1AGFB 2GSGA 1CBVL 3RL1A 4HKZB 4OLXL 2CLZB 2Y07L 3GSXB 4FQCL 3UTTA 1T4KB 3U0PA 2GIYA 3OGCB 1G0XA 1AR2A 1RU9L 2VXVL 2V2TA 1YN6B 2GAZB 2IAMB 4ENED 1AGDA 4ZFGH 1PSKH 3O9WC 4LKXA 1J0YA 5C0FA 4N0UE 4UIKL 1OAZL 1ZTXH 4LSTH 3MGTA 4NJ9L 1J7VR 3KPLA 2WWMC 5C0AA 5EA0H 4KXZH 2VAJA 4BUHA 3WFHB 3UTSB 4Y2DB 2VLKB 2X4RB 4K7PY 4EI6A 2FLBT 2FZ3A 4W6XB 1NMAL 2HTKC 3TNMA 3VW3H 5FA4B 5D2LE 3TWCL 3FO1B 5MENE 1BQHG 4MNQA 2ZCLH 1QLEL 3IFOB 3FQUA 4LHUB 2OSLB 3LS5L 3PQYA 1P4IH 4ODWA 3IRZA 2R39A 3M07A 4XC1L 3UPCA 2J6EH 2Y7QB 3ECBA 2ENYA 4LCWD 4QCIB 4F7TA 1F13A 3ALXA 1BQSA 2ITCA 5IM7A 1U0QA 4OUUA 2KUTA 2P49B 1QPPA 1GGIH 5L2KA 3FHAA 5JTWA 5C3LD 1FBIL 4W70A 4G9DB 5HHPA 4LVOC 4P0DA 1QRNE 1EFXB 4OLWL 4LPYA 3HAEG 5J6HB 5CJBA 1IEBA 1YPZA 1KCUH 2CO6B 3TBWA 3EKCA 2APTA 3IFLH 3Q3GB 1J05B 3F65A 3TZVB 5TE6L 1S7XA 1OTTD 1YQ2A 4ETQA 1T5WB 1IGIH 3WIHL 2ZWLT 5B21A 2R8SH 4Z7QF 1B4JH 3C5ZD 4NO3B 1NFKA 1OTSD 2XKSA 3HI5L 1XAUA 3MRJA 3BUYB 2YUXA 1T2QL 5DT1H 4U1GC 3SJVB 1KT2B 1BM3L 5BS0A 3O4LA 4EDXA 3QISA 4JQXA 4WO4B 1NMBL 1OCWH 5F7NC 2XKUA 1QBLL 5CZXC 1UZ8B 4TULL 4JFXB 5SWQB 1NLDL 4B41A 3VGHA 4F15B 3GJFH 8CGTA 1AKJD 5ETUB 4WI2A 3VWJA 4KZEH 2M8XA 3MC0A 4I8DA 4BSVB 3O4OB 3QIUB 1ZA3B 3I6LE 1QR1B 5HHMD 4D0BB 1IT9L 1U95B 1O7VA 2WBKA 1X5FA 5I19H 4LSVH 2XN9A 5I76B 5FYLL 1E4WH 3VFSA 1P7QB 5D1XA 1I9RL 1QBAA 5JPMA 2XZAH 3C8KA 2DF3A 3P2TA 3RIFF 4HPOL 1IEHA 3B9KB 3GBNL 1V8HA 4Y2DA 5J13C 4IIQB 3MV01 1A3QA 3HS0A 3B2VL 4DJMA 3F58L 5BV7C 1IAKA 3KPLB 5KZCB 1HXMB 3DV4A 3VXMB 5J1SC 5IBLD 1UM5L 3S5LB 3KYKH 4PJDF 1GOFA 4TTGA 5C07A 1TZHB 3WFEL 4QHMA 1CFTB 1F2XK 1I8MA 4J8RB 4P4RB 1XH3B 4MJIB 1G7LA 1GSMA 5C0RH 2N7AA 4HXAL 3S9DB 2KPNA 5C0BA 3DYMA 4A2MA 4NNYA 5E00B 2OTUA 3IFPB 3QEQB 5E1AA 4X8JA 5DQJB 4Y1AD 1DR9A 1RURH 2NW2B 4KFZC 1IAOB 1EHNA 4MZ2A 3SDDD 2B4CL 1PG7X 2BNRE 4IHOB 4YO0B 1GH7A 5GRXG 3I2CH 5HD8D 1YN7A 2FIKB 3D0LB 4ZFOB 2Y4SA 2ZUTA 4M1GH 3O2WH 3PP4H 1XCQB 5JORA 5DD6B 3STZB 2UZXB 4I3SL 5B8CC 1VA9A 3M1BB 4PTUB 3WE6B 2P24A 2WV3A 3ORJA 1QLFA 1P2CA 3C5JA 1O0VA 3MV8E 2Q3ZA 4KV5F 1AD9A 4YBLB 43CAA 2BNQE 1S7WB 3ZT5A 1CE1L 5CJOH 3TT1L 2FECL 2IQ9L 4ZXBC 3QAZC 5IV2B 1UT9A 3S5LA 1RZGA 3V4VH 3CSYB 5HI5C 2Z4QB 4MXWL 2OQJA 1CT8B 1AR1D 4MJ5A 3HMXL 2WIIA 1NAMA 3MRHB 2ZCKL 3BDYH 3VXUA 4K23L 2K9UA 3O3BA 2V9RA 4HIJA 2DJUA 2YBRA 5IB3B 5DMGC 5D8JL 4M61B 1OM3H 3SGDH 3HNTL 3RWDB 3UEZA 2F74B 3GBMH 2FBOJ 1MFCL 3TM6A 3A67H 3DETD 4IOFC 2AK4E 2P46B 3VDCA 4X6CF 1JNHA 2W9EL 4I0PB 2V7HA 3RPKA 4TSCL 1U8HA 3VXPB 2R0LL 4AT6A 4EEEA 1D5XB 4FQIH 3L6FB 3TNNA 3U0TA 1MWAA 5L6YH 3HRPA 4JM2D 1B6UA 5JW4N 3DJ9A 4PRIE 2B5IB 3L3HA 2QADC 1NUGA 4ZAKB 2P8LB 3CNKA 4OIIL 4HEME 4X5XB 2ZKHH 3ARGA 5GS1C 4CMMB 3LB6C 2BNRD 5DK2B 3VH8B 1FZJB 4JPVL 4OFVA 3OKLA 4LLWB 3PP3H 4KWUA 3IXAA 4NT6B 2EYRB 4V1DB 3C09B 4PIRF 4YHOL 1Q0YL 3QFDA 4MAYD 1HCVA 1WTLA 4NKOB 3RU8H 3ZE2F 1U8MA 4NJAH 3RZCD 2B1HL 3PDGA 1TPXC 5I66A 4RWYL 3MLRL 2OMBA 3P30H 3V9FA 3QRFM 4FABH 1A7NL 4XPHH 4MNGE 2DTSA 4NQCE 3QQ9D 3OF6A 3QPXH 4QY8A 3DMMA 1J0KA 3S3PA 5C8JA 1K9TA 5JXEC 1JN6B 4ZPVA 2FWOA 2J6EL 4CL7A 3TO4B 5JW4R 1T66D 4JKMA 4LLAA 2OJZH 2DYPD 1HSBA 3BP7B 2X1OA 3WKMH 3R8BB 1HHGA 1YEFL 2GJ6E 4LARH 4GW1B 3VFOB 1MCWW 4ZS7L 3SEPA 2YD5A 1IAKB 4J3SA 1WZMA 1IGTB 3FQUB 4ZUSB 1TZGL 4P5KA 5T1KD 3FO1A 2R0LH 3PHQB 2EH7L 4DKAA 1MCFA 4P2RE 3WIFA 3RIAK 1UFUA 3PWLA 2MQ0A 1U8KB 4AK1A 1A6TB 3HAEB 5GGVY 5DHYA 3VRLF 3GMPB 1FPTL 4HGWB 1YQVL 2M2DA 3ZHLA 1KCVL 1RU9H 3KDMB 4TTDD 1MCQA 2QQQA 1P6AB 4YIQB 3K4DA 4LIQH 3RAJH 3VMNA 3BT2L 3TO4A 4TPRL 1H3GA 5KS9F 2G5BB 2BOBB 5KW9L 3T1FB 3DX6B 4O51B 5HD8C 2IBZX 3FFCB 3JTSB 4MA7L 3MRCB 3V6OA 1J8HA 4PJ9D 3V4UL 1KJMB 4JVWA 2FR4A 2AJZB 2YR3A 2VLLA 4KAQL 4BH7A 5E0QA 4WEBL 5MP6H 4D9LL 3IXAB 4NT6A 1WCBB 3CK0L 4MQTB 5IBTL 5JW4M 1LHZA 5EG6C 4ODTH 5IFAL 4IDJL 3WHE0 3UTZA 1IKFH 2XRAH 4QTHA 4O00A 3EJYC 3H3PL 1SY6L 1BJ1H 1T5XB 4ZOCA 1V05A 4OGAC 4O9HH 1A1NA 3FN0L 4K8RH 2BY1A 3C8DA 3MA9H 3PXHA 4R8WH 1CI5A 5EORH 3PGCB 5A40E 1QYGL 1F90L 1NBVH 4MDJB 1ADQL 4BK5A 4TN9A 4PRPB 3RKDD 1A6WH 1U8PA 2VDML 1CFVL 4RZCA 3KYKL 4WEUD 5JHDE 5E99L 1F90H 5CGTA 4XPGL 2G75A 2VUOA 4K7PH 5EU6B 3NN8B 1F42A 1W0VB 2I27N 3C6SA 4X6BA 4QWWC 5EORL 4XP4L 2WIIB 1JZ6A 1YYLL 5JOFA 1HDMB 4KZDL 1CDGA 3GSNL 1JHLH 2R0ZL 4POZD 2A0LD 5CZXD 5FDWB 4YHNB 1I7ZA 3MRLA 1N6QL 4XMPH 5FKPB 5DTFB 3SCMC 2CIKB 4H25B 1S9XA 4NC1C 15C8H 3HPLA 3VXOA 4P2OB 5DGQA 2DL9A 4PJCA 2HKHL 5HVGB 1GIGH 4KJQD 1I9EA 1R3IH 3U1SH 5BO1H 1T83C 2MJWA 5AD0B 2SEBA 3STZA 3T08A 5FKAB 2EKJA 5FYJL 1HXYA 5LGJA 4QHLA 2I60L 5GRVL 1AO7D 1GAFL 1TJGH 5C0NC 5IESH 4G6ML 3Q2CA 3VCLB 1A47A 1ZT4A 5FA3B 2H32A 2YD2A 4NC0B 2BVTA 3KPMA 2A1WL 4YR6B 2V17L 5FGBC 4MLIA 3VWJD 2R0KH 1FYTD 3RDTB 1XH3A 4R4BA 3GSRB 3FQNB 3WLBA 4LPWA 1T3FB 3KPOB 1PD6A 4OGXH 2JTDA 3VXOB 3QXDB 1KCVH 5DTFA 5GJSL 1QBML 5C9JB 1ETZA 3HB3C 1XGRB 5A2KH 5ESVB 3RDTD 5KSBE 1TPXB 2F8OA 4U1GB 4L3EB 4ZFFA 3BH8A 5ABDE 1UA6H 4GKNA 3AS3A 3Q6FA 1S78D 3R0MA 4S1QH 3L3JA 4XH2B 3UTQB 1RHHB 3MZGB 4J2XA 2X7LB 4LMQE 5C0CB 1AO7A 1DL7L 4NQVA 1C7TA 1Z0NA 3C8KB 3LV3B 4EIZC 2VLJB 4L3ED 4RGMB 3HC4L 4OFYA 1NC4D 2GUOB 3CUPB 4CADB 5DXWA 5ID1B 3BKCH 3DGGA 1I7UA 1I8LA 4I18A 1VGEL 5IFJB 3G5ZA 3UTPD 3U4AA 2OK0H 3EO1A 1PW3A 2CGRH 4XPTL 3DO7B 2WBJC 3QPXL 5DWUH 2YPKB 2FJFB 5F9JB 3SDCC 4XBPA 4ZTPL 2IH3B 3G5XA 1YY8B 2BNQD 3MRIA 5C86A 4Q7DA 5A43C 4JY6B 1F4WL 4WI4A 4QTHB 1UZ8A 4TUJB 1QQDA 5GRVK 4HKBB 5L9DH 2X4SA 4QHUB 2YWZA 4PG9A 2ZUYA 4ZXBB 4NUJB 3T4YA 2YPLE 1CFNB 1A3RH 2AJYH 4KQ3H 4PJXF 2QTEA 2H6PB 4PJIE 1INEH 4U33A 1N0XH 5GGTL 3MCG1 3KYAA 1PYWB 5FYKL 3L3DB 4R4ND 2Q76B 4NO5A 5HYQA 3CVIL 3BXNB 1NUFA 3EYVA 1CFQA 1K8DB 3V4PH 1DBBH 3DUUA 3OAUL 3BZ4A 3B8SA 2XA8H 5ALCL 1G7HB 3UAJC 4J4PD 4HXBL 3S88L 5DJDB 4JFPA 3KLAB 1MCWM 1WFUA 4BZ2L 1F00I 4H88H 3QI9C 4CVXA 3VXUD 3ZE1F 2E9IA 4DCQB 1DQDL 3CVHA 4I18B 4AL8L 3IAPA 2XI9A 4YHYC 2YHGA 3G6DL 4PBXA 4X0KA 5KSUA 1ZLVK 4WTXA 3MRNA 1MHPL 4H8WC 1N2RB 1T89C 3FTGA 4N8CH 4M6OL 3PWLB 4KPHL 5TE7L 3LKOA 4JN1L 4Y4HB 1S7UA 4N5UA 1JL8A 4OF8A 5E5MA 2LAGB 1MIMH 3LKPB 4X7FC 1UKTA 4KPHH 5TE7H 5C6WH 4OGAD 2MSPA 3KHOA 4KKBD 3IT8D 5IW1B 5BVJA 4K71C 2DMBA 4J4PA 3LS4H 3FKUS 4RNRA 1YEJL 2AXGB 4OLYH 1Q9OB 4G6MH 5AAMA 3GJEB 1BBJA 3OJDA 4BM7A 1AQDB 1S7VA 3KJ6L 4Z7VB 1MPAH 5F3BB 1W72L 2JF1A 3TVMD 4F7EB 3WIIL 4U6VL 5A2IH 3FRPA 3CLFH 4JO1H 1K8DA 1EVUA 4YPJA 5ADPH 2WWKT 3RWIB 4GRMA 4UDUB 3DVGA 1X5LA 3I6GB 4PJIF 5F3HB 1HKFA 4OD1L 3S96A 3O45A 1HSAA 1R3KA 1KIRB 3WFZA 1MFDH 4QKXB 5D2NB 1KC5H 3QQ9C 3NBNA 5C08E 3QUXA 5FO9B 4NUJA 3T4YB 1CL7H 1MQKH 4K7FB 4D8PA 4HKBA 4P2QB 3B2UD 1KXQE 4XNXH 1K4CB 2AQ2A 4HCRH 4W81A 3TZVC 4GKOA 3UP1A 4OTXH 1HK6A 5J3HC 1FLRH 1FNGA 1XZ0B 4R90L 5SWSE 4R7DA 1WZ1H 4KDVA 4N0RA 1P4BL 4IJ3B 1UH3A 3QUYA 5I75B 5GXBB 4CGTA 5F9WC 4TSBH 5KJRH 1T83A 2R2EA 5IFJA 1BHGA 2ZCHL 5DK0B 1UKQA 3OKOA 2XN9E 2PXYD 4WUUD 4ZS7H 3FL7A 4MJIE 4JY5H 1DDHB 5C0IB 3OQ3B 3G6AA 1A7PL 4JN2B 4PJDE 3H7BB 3V0VB 1SEBB 3HZMA 5DLMH 1IGFL 3VJ6B 1AXSA 2NY4C 2AJ3B 2DLEA 3U4EA 4P57B 1BWMA 3O4LD 5CD3B 3O6LH 1S5HA 4PP2A 5E56A 1C5CH 4F8QA 5BJTA 4L4JA 3DYPA 1MFAH 5K9OB 3TO4D 4MMXC 5ESVA 1TMCB 5MERA 3FQWA 2DQTL 3TH3T 4F9PA 3SQBA 4PJ5B 1PJ9A 3FN3A 3T65A 1CE6A 5I1JH 1QP1A 5HYJD 3V5DA 4WFED 4PYGA 5FF6A 3EJJX 4X98B 3KPRB 1G6VK 2FX7L 5I0DA 3U46A 4PUBH 2QBWA 5EC2B 4JVPA 2H32B 4Y4FD 1FC1A 4PRDA 4EOWH 4TVSa 3OPZH 4I9WD 3D85D 3MRMB 3RWFB 1WCBA 3DTXA 4XPAH 3BT2H 1D5BB 2ZUQB 2N1KA 3ULUL 4OLWH 4X8XA 1NGZA 4MB5A 4I18C 3KVQA 3DBXB 1BZ7B 1P9MC 3W39A 2AJSL 3RWIA 5FYJU 5JDJA 2MMXA 1CDHA 1KJ3H 2OTUB 2Q8AH 4WW2B 1QVOA 2FEDC 3KLSA 3WO3B 4HCRA 4NM8H 1QLRA 3DRQB 4L29B 4QXUH 3C5ZC 1V5JA 2DLIA 4U05A 2NY2D 3NACL 4YXKH 4WV1A 4L3EE 2FHCA 5IW6A 1WAAF 1NGWB 2KKQA 1MJJA 4UILH 1NLBH 1J0IA 1GRWA 2EDYA 1W0VA 1RSFA 2D4DA 5CS7A 1ZT7B 2WP3T 5EU6A 4OD2A 1S78C 3BIKB 3D18B 3MNZA 3LB6D 3U2SB 4Y1AB 1NAMH 4XVTL 2F58H 1H0DA 1LEGA 2FX9H 4KVNL 1MOEA 2VZUA 3QULA 4NQDD 4HG4J 2R69H 4DQOL 1I3RA 3ELAT 5F6HJ 1F4XL 3REVB 5T1KB 3CVHB 1YMME 1AP2A 2V2WB 4FQXC 2QKIB 4UDTB 4KDTA 3TLRA 3TC9A 2XV6B 4KRMB 1IC4H 3KPQA 2HAZA 4CW1B 4BSVA 2DB8A 3K74B 3R06A 1N26A 1MQKL 3OG4B 5INDB 1FNEB 3QIWC 2ARJQ 5BRZB 3N85H 1RMFL 3BJ91 4FQIL 4NO5B 4KJWD 3N9GL 5C0BE 3P0GB 1P84K 1G7MB 1TJHL 4LVHC 1JGLL 4YHMH 2ARJB 5EOQH 3SY0B 4BJLA 3VGBA 1KFAL 3I9GH 2D0GA 4JRYD 3HG1A 1QFWL 1AXTH 5FDYA 2UVEA 2VN7A 3CU1A 3QDME 1CVRA 4LSSL 3S35H 4F9PC 3JTSA 4CMMA 2AEWA 2BHZA 3RVVC 3LPWA 4MD4B 4M6NL 3G5XB 3SDAC 2XWJA 4QRPE 5ITFB 3NIFE 1I1FB 2O93L 1KIPA 2HP4A 5MHSE 1CXIA 1PKQB 4BYHA 5T1LA 4LSRL 1MIML 3CFDA 2CK0H 2QSQA 4PJ8A 5LQBH 3GSVB 2X10A 2R29H 2XRAL 5D2NC 1KBGL 2ADFL 4LP4A 3WSQL 3HZVB 4O2FA 3T0DA 3MREB 4XP6L 2E27H 3H8NA 1RY7B 4LLYB 4C56D 5T33H 1L0QA 4HFUH 3QG7H 1OGTB 1KPRA 5DK3A 4FG6C 3GMNA 4Q2ZA 4IJ3C 5I75C 4LF3A 4P3CL 3C08H 3DECA 3GJFA 3QO0B 3RWGB 3WLWD 1B2WH 1WAAA 2X4RA 5CP7B 4I0KA 3GEWB 1IGYA 2FGWL 1R5IA 1NGWA 3QUZC 5ACZB 2WLZA 5F70A 1YY9C 4ZG1A 4M1CC 3MRFB 5SWZB 3MBEA 3HKFA 1AKJA 1Q8MA 1UZ6E 4Z9KB 3DROA 3U79A 2ZSVB 3PP4L 43CAB 4YXLH 4OIAA 1FL6A 4O2CB 3NCEB 3I2CL 4YDKL 3R1GH 5H2BA 1CD8A 4HDIB 4QRRA 1ZA6B 4HKZA 1QVOB 2P45B 4MNGA 3V5KA 3QI9A 4M48L 1I1CA 5I2IB 3RY5A 1YUHB 3P4NA 5TPWH 4M6OH 5I66B 2CJUH 4U7SA 3DRTB 4UOW1 4PRBB 5CIPH 3SE4A 1XGPA 3ARBD 1C08B 1C08A 2AJSH 2WUBL 4IHOA 4HJ0D 4JHWL 4YO0A 5HHVH 3DRTA 2MNUA 5E95B 3V4PL 5H35B 1TETL 2EIEA 3K2UL 4Y5VB 1NMCC 5DWUL 1I9IL 4PG2A 1UCBH 1J1XL 5FF6B 4B0MM 2VERN 3LZFH 5C07D 1QTYT 1T7WA 3FQXA 1DBBL 3O6FD 5CJQH 5C07B 4S10A 4C4KO 4LSPH 5IQ7L 5D9SA 1PGRB 1EMTH 3VXMA 2R4SH 5IHLB 1S9VA 4HUMB 3PNWA 3CFEB 2ED9A 4IRJA 1IAIH 3GMQB 5DD5H 1T1ZA 3D39B 4OM1H 1IC4L 4CNIA 1OAZH 5HJ3A 4G7VH 4OIBA 4FFZH 1UXSA 1ND0B 4KC3B 3NFSL 2I9LB 3V5HB 2DTML 2D7NA 4BQ6A 5EZIH 1OGTA 2R69L 1MRDL 5GIRB 5D1XB 5HJ3B 5C0DA 1S9WA 2MTPA 3SE9L 2P47B 1SQ2N 4NQXB 2H8PB 2DQCH 1FSKB 4OZGE 4KK5D