3MLXH

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
b'QVQLQESGPGLVKPSETLSLTCTVSGGSISGFHWSWIRQPPGKGLEYIGYIYYSGSTSYNPSLKSRVSMSVDTSRNQFSLELSSVTAADTAVYYCARDFGEYHYDGRGFQCEGFDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 228
sequence length 228
chains with identical sequence I
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxH01
2VQ1A 3QEQA 4MX7B 1JN6B 5IMOA 1G7PB 4WDIA 4P4KB 4FXKB 5DFTA 1JYNA 1T2XA 2A6KA 5DFVD 4JZNA 2XFXA 1ORSA 4PV9A 4CMMA 4IDJL 2BVEA 1W0VA 1A3RL 1A7RH 5FYKE 4M1CC 4HEME 3DVNA 3PGCB 5C7XL 4WIQA 1YPZF 2W0FA 3ZE2E 5E6ZA 4QCIB 3QIWA 4HIIA 4U1NB 3KDMA 4G8IA 4O5LL 3NCCB 3OTTA 1REIA 4JRYB 5ADOH 4I3GA 1RUPH 4OF8A 2VDML 1L7TH 1U2CA 4L4TA 4KDWA 4R7DB 1KCVH 4TPRH 2R29H 5EU6B 5MENE 1XF4B 4L5FH 3QO0B 4X0KA 3JWDL 2BOCB 4LQ1A 3QPXH 4ZUTA 1OSPL 5IQ7H 3HI6L 5HYSB 4MQ7B 1YMME 1TQCC 1F97A 1BZ9A 1NGPL 5I8CA 4JM2F 5HSFA 4NO2A 3KPRA 2NNAB 4LLWB 1I9JH 2PNDA 2Y36L 3LKPA 4Z18A 4YEFA 1FIGL 1YQVH 1VGKB 4ERSH 4UB0H 2C26A 1IFHH 4Q6IC 1S3KH 4X99B 2J8UA 3BGMA 1BECA 4U1LB 1G6VK 1D7FA 2V2WA 1INEL 1U3HD 5CKAA 3QUMA 2E7MA 1T1ZA 3TO4B 2DWEA 4PB0H 4ETQA 1T4KB 3GSNL 5FF6B 3T65A 5JORA 3U9UA 4MNGA 2EXWC 4XCFH 3INUL 3QIWC 4ONHB 4H26B 4ZTPH 2AJVH 4KROC 3W0WB 3QFDA 1FL5A 5CD3B 3SDXF 2FRGP 1I8MB 4NWTL 3BPCB 3FO0L 3WJJA 2Q86A 5ILTH 3UDWA 3LKNA 1IM3A 1U6AH 5FO9A 1HINH 3TN0B 2E7BA 4FFVD 3QO1B 2OR7A 3PNWA 3D9AH 4KK8C 5I1AB 3U6RB 3V4UL 2OQJB 5DQ9A 1KACB 3HC0A 1W72B 2COQA 4U3XA 3CVHB 2A6DA 1AI1L 2R1YB 3O6FB 5JOPD 5E9DD 4K3DH 2WAHA 1BVLA 4NNPL 2FGZA 1RUQH 2EDWA 4XPHH 4WTXA 2YKLH 3WO3B 2IAMB 2GSGB 3DETD 3U4BH 3BWAB 4XGZB 3IS1X 4D0DB 3IFLL 5F9DC 4K7FA 4OIIL 4DGIL 1P7KA 2WUCH 3FMGL 4XMKL 1WWBX 4LSQH 4FQIL 1N2RA 5F70A 3VXUD 5GGTA 3TF7C 2XPGB 5D93B 2Y72A 4M9OA 5D5ME 3AU1A 3B9KA 2EKSB 2NY0B 2XZQH 5BZWB 3HR6A 2WLYA 3IFOA 1KB9J 5I1DB 3ZE2F 4MA8L 2Z91B 2XNAB 3WJJC 4PGEA 3C60B 3MLRH 5IK3B 2WV3A 1ZEAL 2A83B 1S9VA 4CU6A 1I3GH 5FYJH 4G5ZL 2ZKHL 5LKNA 4M4PA 3MV9B 3WLWD 1UENA 3TYGL 4NQCA 3EYOB 5C0AD 4YHIA 1CYGA 4FTVD 4XZUA 3RAJH 3V6ZA 1I3RA 4QOKE 4YDIH 3TFKC 3ZE0F 4D9RE 2AJSL 1TVHB 4HS8L 4CAGA 5DC0A 1CGUA 4PRPB 2CGRL 3NCBB 1OB1A 1JPTL 1PX4A 3RWCB 4O00A 1NCWH 4G80A 3QEGL 3AAZA 3GHEL 3L3IA 2XA8L 4UU9B 4HPYL 3SKMB 3MBED 2G75B 2DM7A 2OMBA 1VACA 3LAFA 1HIMH 4TUJB 1ACZA 1P4BL 1ZGLP 2DQCL 4X80H 5EBGA 3OKYA 5EIIB 3MLYH 3BE1L 5CMAA 5SX5K 3B9KC 5IV2B 4O2EA 1D9KA 1I7RA 4KGLA 2NX5E 3E3QC 4J3OC 1MWAA 4Y4KD 5F7DA 1ONQA 1P4LB 1LILA 3RWGB 1LP9B 4MHHI 5KS9E 4YC2B 2VXSH 4TUKH 1LWRA 4PRBA 4KU1A 4X5XA 1QOKA 4RMVA 1CD8A 3V5KA 1NMCB 1U8QB 1G0DA 1VFBB 2B0SH 3PIQA 3NZ8B 4MVBC 4JFPB 2EECA 1RJZA 1I7TA 2VZTA 1FNEA 2DLGA 4R4FH 1WFTA 1Q9LB 4PGBA 4TVSa 3HC4L 1UKTA 4TSCL 1T03L 3GHBL 3Q0HA 1E4WH 2ESVA 1BFVH 3MJ8A 3HRZA 2G9HA 3PGDB 1CFBA 2DLFL 3SDAA 3OKDB 2LTQC 4MLIA 2ZUSA 1J0JA 4I2XA 3OXRB 1OQOA 2DQJH 1LD9B 2DRUA 4NOBA 3QFJA 1IGCL 1UH4A 5IFAL 4M5ZL 1D9KC 5FUZH 2R56H 1CIUA 3KNBB 1SJVA 2FX7L 2FD6L 5D5MF 1EFQA 2B20A 2QTEA 4CVUA 1AJ7H 2MOVA 2KZWA 3BN9D 3D3VE 4BUGA 1F45A 4P2RD 4G9FA 4U1HA 1KJ2A 3E6HA 4M5YL 5FYKL 1PLGL 2HJLA 3STZA 4WWKB 4Z78B 1UEYA 5HGHA 1KF9B 5JQHC 5CJ8A 3ALWA 4GRWH 4F7EB 3MFGB 2AQ1A 5DMIH 5LCVL 1S9XB 1OTTD 3FKUS 1NSNH 3H2WA 5CIPA 1NMBL 2CK0H 4G43B 3X11A 5BJTA 1YEHL 1Q1JL 1HYRC 4NM4H 5IMLA 4OLWL 1IEAB 2YRZA 3B6SB 4PJGA 3G5ZA 5IKCA 4ZUUA 3KLAA 5SWSA 3M1BA 3UZVB 1YQ2A 5JR1L 2WBJB 5HI5C 3EFFA 3CFCL 4APQD 1DBKH 2FX8H 2ZCKH 3RTQA 5F88A 1IAOB 3UBXA 5SWZD 1EO7A 5DJ6B 4WEMB 4KUZL 5FA4A 2RFXA 5E5MA 2HRLA 2PTTB 2X4SB 4QXUH 3BQUA 2CR6A 4HFUL 4H8WC 1NEZB 2D9QB 2KL6A 2ED7A 3GM8A 4CRPA 4OD3H 4GT7A 1F5WA 3NFNB 2BERA 2IEPA 3DYMA 3EYUL 4NZUL 4JQIH 4M43L 4P23A 1NL0L 4XI5D 5H35A 3C6LA 1JHLL 1KCLA 2CRYA 3AS1A 3GB7A 3BZDA 5ESAB 5LWYL 4OM0H 5KS9F 5D7LA 1XF1A 5TE7L 3AMLA 1WWAX 4Z0XB 3VXPA 4X6CB 4LDEB 3VXTB 4KHTL 2FYYB 3G9VA 3D2UD 3L7EA 4NQSA 5J6GA 4M8QB 4UOJA 3ZT5A 1MNUL 2F54A 2EDHA 3VGAB 2FEDC 3SGDI 4R9HA 4N8VB 3TZVC 1F2XK 1T89C 3S4SG 1RZGB 4HT1L 4U3HA 3DO7A 1XGRA 4WUUD 3VFUB 1ZGLA 3ARSA 1XIWA 3EJJX 4Y19E 2PYED 5ERWB 4WHTB 4UT9H 2Q7YA 1DUZB 1NBZB 1B88A 2DLIA 3I2CL 4JHAH 3STLA 1DQLH 4HJJH 3HE7A 3QCVL 3CFBA 1P7QD 3ARQA 3MV7A 4XBGB 1UYWL 5GZND 1DQMH 2IH1A 2PYFB 3QH3A 1OM3L 2IJ0C 1RFDH 3S36H 5HD8C 3RUGA 2DB8A 4G8GB 2F5BL 3BQUC 5K9JH 4YXKH 5L88L 4G6FD 3MLSL 3V2AR 1SYVA 1OSZB 3VFMA 1A6VL 3C5SB 1BOGA 2X42A 3WIIL 3CZFB 4GW5B 2VXTH 4XMLL 1K6QH 1A6WL 3C6LC 4ZXBD 4OLYL 4ZG1A 5B8CA 2VDMH 3MACL 4U2ZA 5LAXB 4IHOA 3PWPB 4MS8C 2M2DA 1UQSA 1NCCH 3GSRA 2YPVH 4GG8A 4NQDD 1S9WA 1A6TA 3Q1SH 5DGRA 3ARVA 5GGTH 3D6GA 3SN6N 1KV3A 4YHPB 4JZOB 5TE4H 1Q38A 4KJQD 1IC5L 1WLHA 4BSWA 1JNNL 4LQFL 2VDQL 4HGWA 1VEOA 3BD4A 4HD9A 2Y36H 1XIWC 1MAKA 4LNRB 4XP6L 3WL9A 2FZ3A 1IQWL 5CSZA 4Q0XH 1BMGA 3QEUB 5A43C 5DMGC 3HE7C 1T5XB 2R2EA 1BQHA 1JGLH 1TQCB 4NQED 4PD4J 2DLHA 5K33A 2RCSH 1G84A 1QRND 4DOHE 3MLXL 3QI9D 4ZO9A 3UCRA 4R96A 2N1KA 3LS5H 5EO9A 5I8OL 3OKNA 3VDBA 5J1AA 4ZO6A 2BRRH 2F15A 4WFHD 4XB8A 3Q5TA 2PCPB 4Q6IB 3N06B 3PV6B 4BZ1H 1XCQA 4LGSB 2VQ1B 3QEQB 1XCTA 5IMOB 3T2NH 4J3UA 2BDNL 1OWWA 3FFCD 4GRWB 2A6KB 5HY9A 5JTWA 2XFXB 1ORSB 4PV9B 4CMMB 5B8CC 3P40A 3QEHA 1ITBB 3MJ7A 3S3SA 2DQHH 4DUWA 4NWTH 4I1NB 3W39B 4AEIL 1M1SA 1IRAY 2E7CA 2XA3A 3DVNB 2VN4A 2F58H 2W0FB 3QIWB 3CK0L 4WTWA 1JIBA 1QQDA 4HIIB 5ITBL 4G8IB 5E0QA 4KROB 2WWMC 4RAUA 3MLWL 1GXEA 1NDMA 2HLAB 3D39D 4L4TB 3QZWA 1JFQH 3FN0L 2GYSA 4X0KB 4ODTL 4KMQA 3V52H 3PV7A 1CR9H 3FTGA 4ZUTB 1KCKA 4Y1AE 4M6AA 3I6LE 1DFBL 3BESR 2CKBL 2LFGA 2HFEA 3V7AG 3UTZA 1BZ9B 5FYKD 1VFOA 1IC4H 4WW2F 5E8PB 1YECH 3BZEA 1P69B 3VD9A 4GW1A 4HS3A 4FQIH 5HVHC 5GS2D 2J8UB 3BGMB 5TDNA 2H2PD 5GGRA 2V2WB 3PWNA 4JFFD 4KQ3H 5CEXB 4TSBL 1T1ZB 1MEXH 2DWEB 5HGAA 4ETQB 3KGRA 3T65B 2VZ3A 4MHHG 1MCSA 2B1AH 1FYTA 3FQWA 4Z9KB 2BY2A 4QTIL 1PSKL 3A6OA 4MNGB 4ONFL 4NQXB 4XPFH 2BY3A 1G9NC 1RZ7L 3CDGB 1I1FA 2B8OT 3QFDB 3T8XA 3UJJL 3TYGH 4KGJA 4D0CA 4HF5L 4XRCA 1BFOA 2Q86B 1N6QL 1MSPA 3KXFE 3ARBD 4HC1L 4Z7VA 2XI9A 1IM3B 1BGXH 2Z92A 4HS8H 5FO9B 4PLJC 3HMXH 2AAVA 3ARXA 1JYWA 1JGVL 2AXHA 2CGRH 2BJML 3PNWB 3X3GH 1JPTH 4LARL 2BY1A 3KLSA 1ZTXL 2XN9D 4I5BA 5DQ9B 1IEHA 3BKCL 4YDKH 3HC0B 3GHEH 1YJDL 4NO5A 5T3ZE 1PZ5A 1DQQA 2NY5L 2A6DB 4ZSOE 4C4KO 4NJ9L 5LQBL 1BVLB 3ULSA 2NY3C 4R4ND 1ZLWK 2EDKA 1J11A 1CG9A 3IDJA 2UYLA 3K7UA 4KWUA 3DV4B 3T2OA 3BE1H 3OKMA 1QNZL 3GMLB 3E6FA 4K7FB 4YHOL 1P53A 1MCWW 4IRSA 4WEBH 5M7QA 3V0AC 3VXMD 4ACPA 3LY6A 3Q5OA 1N2RB 3TBTA 3VMNA 5C92A 4QXGL 1KB5A 5DJAB 1AC0A 3AU1B 4J6RH 3B9KB 1E28A 4LDLB 4K3GA 3ARDD 3IFOB 1IGMH 2JCCE 4MNHA 1FE8L 4LEXH 3RJDA 3TJHC 3VE0A 1Q0YL 3GRWH 4PGEB 5HVFB 1J0YA 3CC5A 3PHOA 1S9VB 1ZXQA 3O6LL 2QHLA 4NP4L 4ODBD 4PG9B 2DTSA 4NO0A 2YD1A 1B2WH 1WICA 2IADA 3QG7L 1G9EA 3U4EA 4YHIB 4LAQL 4XZUB 3V6ZB 5BW7A 3GJFK 5SWQA 2OYPA 1I3RB 4IOIA 4GXUN 3GHBH 2RR3A 4KK6C 2CXKA 4FFYL 4JDTL 1A7BA 4KDTC 1HSAA 1TPXC 3MOAH 5D96C 1OB1B 1ZANL 4WEUD 3RY5A 2EZ0D 5IT2H 4G80B 3AAZB 4CN1A 1IGCH 4P59H 1G7IB 2R0ZH 4M5ZH 4QF1B 1FPTH 1VACB 2KPNA 3UYOD 1KYOK 2LTQB 3RWEA 5CHNA 4NN7C 4Y5XC 5EO0A 2G5BA 5L8KB 2Q8AL 4UNTA 5CMAB 4M5YH 2BOBB 2DYPB 2QQQA 2J6EH 3R0NA 4O2EB 4OCXL 1D9KB 3RU8L 2NR6C 1I7RB 3CFIC 2Y1VA 2IFGA 4U7KA 5CINH 5DRZA 1WGOA 2A77H 3QUZA 2DQEL 3GZKA 5F7DB 3DJ9A 1ONQB 5GS2H 2ICES 4J1UA 3MJ9H 1DBJL 1NMBH 1JGEA 4PRBB 4X5XB 3PXJA 4WVRA 3V5KB 4UILL 3PIQB 4NOFA 1Z5LA 1RJZB 3M8OL 1I7TB 3P9MA 4I0CC 4OCLC 4JRXD 5FM8A 2OZ4A 5E8NA 3MROA 1NBQA 4PGBB 3CFCH 1DANT 5I66A 4FQPA 4YXLL 2P5WD 5IVOA 4H88H 4N8CL 4CGTA 4BH7A 2ESVB 4UBDD 1S7SA 1NUNB 1A7NL 4RFEA 3HRZB 2G9HB 4JFEA 4N0YL 4PJXF 4N5UA 1NKRA 1FC2D 4RMRA 3LQAC 4FFZH 4I2XB 5CP7B 5EU4A 4M6OH 1CICA 1J18A 1UZ8A 4MA3A 3UXFA 1MVUA 4WJ5A 3QFJB 2Z8VC 3D85A 3NIGF 4JKLA 1EZVY 3I02A 1N8ZA 3V79C 1JHLH 4IBLT 4LAJH 5LWYH 3QUZC 5TF1L 4YIQB 3BUTA 1Y18A 3U46A 2GUOA 4IRJA 4LSUL 5CBAA 4G9FB 2UWEF 2W92A 3LHPL 4N1CA 2YN3A 3LQZA 3E6HB 3ORJA 2HJLB 4XCCH 3DI3B 1ZLSH 5M95B 1MNUH 3O6KL 5DVNA 2NW2A 3PP4L 4ODSH 3IFNH 3HZVA 4QWWD 4OUUA 1YMHA 3DSFH 4BFEA 3L6FA 1QBLL 5CIPB 3C8KB 3X11B 1G9NH 3I2CH 1DQJA 2V2XA 1WEJL 3P73A 4JRYE 2PTUA 3TZVB 3NFSL 4KRMB 1UYWH 2Q3AA 2VZSA 4XVSL 5I6XC 3G5ZB 5IKCB 5KW9L 2VKWA 1E4XH 5EU6E 4ZUUB 3KLAB 3BPLC 5AYUL 2DI7A 3OAYK 3M1BB 4Y16C 2H6PA 1FZOA 1EUTA 4WI2A 4BA8A 2AJUH 4ONGL 1CICC 4F57H 4KI5C 1K4CA 3MLSH 5F88B 3QIBC 4OI9A 3V8OA 1B6UA 3CSYB 3WIIH 4JHZA 1WC7A 2F9BT 2O61A 2GKIA 4XMLH 2YD2A 5FA4B 2DQUL 2RFXB 1A6WH 3M17A 5E5MB 4OLYH 5JOFA 3BQUB 2QV2A 4XH2A 1IAII 1KPUA 4QRRA 3B9EA 3MUY1 4PJEA 4B53A 4IRJC 3OHXB 1QSFA 2YD7A 3BP5A 4P2QD 4OD1L 3C6LB 5H35B 4FHBD 3HMWL 3ZKMD 5DZOA 5D7LB 1IC5H 5KSVB 2YMXH 5BVPL 3L7EB 4F15C 5J6GB 2ZCLL 2YPLA 2EDRA 2F54B 2XRAH 3W0WE 4ZNEE 2MPAL 1YEDB 4YHLL 3B2UC 4QHNA 3D48R 5F7HA 2FJGA 4LOUC 3DO7B 1QFUH 2E8ZA 2ZG2A 4OZHE 5AG8A 1ZGLB 1XIWB 1OLZA 2DMKA 4FG6D 2Q7YB 3KG5A 2FO1A 3WXWH 3STLB 4XNQA 3HE7B 3CFBB 3MV7B 4F58L 1Z9SA 3QH3B 5L8LB 2EH7H 3MQIA 1NC4A 3SGKC 3QDGE 3CMOL 3FO9A 3IJYA 1CK0H 2DBLH 1FGVH 4HAGA 3T77B 3DV6A 3RKDC 4KKLD 1SYVB 3AB0C 1JF1A 4POZD 1BOGB 1QLEL 3Q2CA 4OZGF 1WIUA 4M4RA 4AENA 1QD0A 5CZXD 5B8CB 1BBJA 4Y19D 1VERA 4C56E 1RUAL 2Y07L 2YN5A 3BZFA 1UQSB 3FN0H 5CD5C 3GSRB 1WWCA 4OB5H 1PKQE 4GG8B 4K9EL 4OV5A 1S9WB 1A6TB 4XC3L 1RJCA 1OQXA 1OHQA 3K2UH 2DQIL 3DUSB 1F4XL 1QFHA 2QEJA 1F3JA 2VR9A 1LO2L 3NOIA 1SM3L 2JK5A 2CKBH 3U36B 3ARZA 3VFSA 5C0BE 4BSWB 1KIQA 4R4BA 1MCJA 1JCKA 4HGWB 2ZCHH 4ODUA 3S5LG 3MUZ1 3O4OC 1IAKA 1CD1A 1GGUA 4ZD3L 5C0FA 2FZ3B 3C8DA 4MXWH 2DJUA 2XACC 4AL8L 3EJYC 2R2EB 4G6JH 4HXBL 3PQYD 5DHYA 5FGCE 4S2SB 3DROA 4R96B 3EJZC 5EO9B 3OKNB 3HG1E 1N5AB 4LSPH 4FZEH 5HVHB 4XNUH 4QTIH 1S7RA 1XCQB 2RBLA 3P0YH 5D1ZD 5EB9A 5DVMA 1RZ7H 3SBWC 3TWCL 3L7FA 1XF3A 4J4PD 1ADQA 5FIEA 5HY9B 5MI0C 4JRWA 3QEHB 3ZKNC 4OGYL 3MJ7B 5I16B 2HFTA 3WDHA 4LSSL 3TP4A 1RUKL 1MUJA 5E2TL 4XHJD 4A2LA 3OF6D 1JGVH 4HDIA 4RAUB 3DWTA 3KJ6L 2QHRL 1N6VA 3ME0A 4JFDA 1ZT4B 2QQNL 1LDPH 4XVTL 1NDMB 3BKCH 3QZWB 1D5MA 4A6YL 3U9PL 1B4JL 3FTGB 2EH8L 3ECBB 5BVJA 3VXOA 2AK4D 2VLRA 1UVQA 1MHHA 5B38A 4OZHF 4AYFA 2L4OA 2GSIA 1FCCA 3UTZB 4GAYA 3WIHL 5HVWA 1J05A 1KN4H 3BZEB 3P30L 3SCMA 4YX2H 1F58H 4GW1B 4UTBH 2NY3B 4HS3B 4KZDH 4LIQL 1LK2A 5C09E 4FS0A 1H5BC 1NGWA 1UFUA 2HN7B 5TDNB 1VB9A 5GGRB 5FCSH 3PWNB 4ZS6C 4HKXA 2YWYA 4KXZI 5HGAB 3AXLA 4E41E 2ZOLA 1F90L 2D7TL 2JJWA 3B2VL 4Y1AD 1FYTB 2F8VA 3FQWB 5DURB 5C0GA 2J5LC 3WFBH 5E9DA 4NP4H 3P4LA 2F5AL 1I1FB 3VGBA 4NZJA 5HHME 3T8XB 4OF5A 3T04D 1K85A 1OW0A 1OLLA 5IBTH 5T5FH 3R06A 1BFOB 3FB5A 3DX7A 2Z92B 4FFYH 1AXTL 4JDTH 4PP1C 5IEKA 5F1NA 4AK1A 3IF1B 1YEGL 5ICXA 3QRFM 3S8WA 4I5BB 4NUGH 3BVNA 4OFIA 4NO5B 4NBYB 1ZK9A 2OX5A 1I7UA 5DSCA 1OAUL 1TPXB 3SCMC 4ISVB 5D96B 3CSPA 4OLXL 5H2BA 2DS4A 1AQDA 3LB6C 1TNNA 3CH8A 4NHCL 4WI9A 1CG9B 4PBVC 3NAAL 2DLEA 1KN2H 2UYLB 2AABL 1R3LA 3KLDA 4MJ2A 3R1GL 2I24N 2OM5A 4OCYH 1JWMA 4KTYA 5F1KC 3RU8H 1R3HA 5DTFB 4RGOL 5L9DH 4L9LA 1CCZA 4G8EB 1TTUA 5IM7A 1N59A 2CLRA 5DJDA 4KAQL 4LRNL 3TBTB 3X13A 4NN7B 2LVCA 1DVFC 3MRQA 5ACZA 1KB5B 4Q9BA 1E28B 43C9A 2VDLL 1EV2E 5GRVL 4MNHB 3VE0B 3I85A 1VPOL 1KFAH 3GSXB 1BD2D 3AUVA 3DETC 3IJSA 4RGNE 3S34H 5TH2A 5I2IA 1QFWI 3VFPA 2KUTA 2UY6A 5IROA 3PHOB 4DZ8A 5DXWA 1HE7A 1U8JA 4WUKL 2P8MB 1KSRA 1G0XA 5DK0A 3I3BA 1K5NA 1GC1L 3IXTA 4HJ0C 1L4IA 3DGCR 2IADB 3SKUD 3WV0A 1CLYH 3U4EB 3KLHC 2QQLH 3RVVD 1MIML 1LP9F 4N8CH 5E6ID 4IOIB 1OARL 2HTLC 2IQ9H 4HS6B 2X9WA 3L5XL 5E1HB 1HSAB 4HBCH 4LVOC 2EDQA 4BFBD 4YEEA 4JKPL 1D5BB 4Y4KA 3MRDA 4Y4FD 5IGXL 4NBZB 3IU4L 4GMSH 1UM4L 5CILH 3IVKB 1Q9WA 2NYYD 4ZNCD 1U8OB 1P1ZA 3ZL4H 3DRQA 4TUOA 4U49A 1JPST 5GRWA 3RA7L 1D6EA 1BPVA 5D71L 2X4RA 3RWEB 2VYRE 5TF1H 5CHNB 5F21B 2I9TA 3RY6A 5FM4A 5AYQA 5EO0B 2G5BB 2BNRA 1CFNA 2IBGA 4AEEA 1ZHKA 3ELAT 4Z7QE 3X12B 3MREA 3OGOE 3TT3H 3QJHA 4PB9L 1J1XL 5DRZB 4W70A 3PP4H 3QUZB 3THMH 4DGVL 3JTSA 3QDJE 1FAIL 1M71A 5L6YL 4J1UB 3BD3A 4FQ2L 3RIFK 1HI6A 2EXYD 5T1DL 3RVXD 4U7SA 3WLBA 1CN4A 3N1PC 3RIFF 2AP2A 5FHBH 1VEPA 1U3YA 4GAJL 4FQLH 1WEJH 4R90H 2NCMA 4XVSH 3OKKA 5DHXB 4YBHA 1Z5LB 3K2MC 4U6TA 4XP9H 4UV7L 3CJJA 3P9MB 3PWPE 4W6XB 1GGIH 1OPGL 3NFPA 5AYUH 3B43A 1RZFH 5GJTL 1ZE3C 5E8NB 3MROB 3JWNC 1T0PB 2IMNA 1AGFA 5D2NE 2IH3A 3TNNA 1U2HA 5E99H 4ONGH 2R0LL 5I66B 5JHDB 4P2RA 1U8PA 3HR5A 4GQPH 4BH7B 4N90D 3T0EC 2YXFA 1S7SB 4XCNA 15C8L 4RFEB 3BPLB 4JFEB 4MNQE 2DQUH 1KGCE 3RZCC 2O5YH 3LIZL 5EU4B 5IB2A 1CICB 1UZ8B 2NZ9D 4MA3B 4PJDE 5DQJA 1JI1A 4PY8I 3RY6C 1B6DA 3W9EA 4OFKA 3QIBB 4WJ5B 5C2BL 5DLML 4PRAA 2AJYL 3D85B 1CZ8H 3GSNA 3I02B 1CTNA 1T21B 3O81A 5ALBL 2GK0A 5IB3B 1Z0NA 4BZ2H 5TE6L 3QUKA 2IG2H 5A40E 2ARWA 2DQGL 3IDMA 3A6BL 3U46B 2ADJA 4IRJB 3EUUA 3HZKA 5CBAB 5JUEH 3PHSA 4YPJA 4XP1H 3LQZB 1PJ9A 4WW1A 4H1LG 5C0EA 2BP3A 4APQA 4MQSB 1PDKA 2AV1A 2NW2B 2YUWA 3RVWD 4OUUB 5EUOB 2ZNWA 1TETL 3WHXA 4XTRC 5I30L 3UJTL 5MEOA 3L6FB 3V95A 1IKFL 2I07B 1RSFA 3BIBX 5T3XH 1OP3H 2VLJA 4HPOH 1C16B 2AERT 2EYTA 1DQJB 1MREH 4PLKD 3BN9C 5CEYA 3C87A 2V2XB 5C0CA 3N50A 4PUBH 3ULUC 1DSFL 5E4IA 1CGTA 3HI1A 5GGSB 2R23A 4NRZA 5J89A 2ORBL 3CMOH 5FK9A 4EI6B 3V6OA 5GGQL 2W9EH 5FB8A 3MGAA 2H6PB 2HT4D 3GKWH 1DZBA 1K4CB 3TV3L 1OTTC 4KKAC 3DMMC 5CJXA 4WWID 4E0RA 3D2UA 5MEQA 2O61B 4O02L 1LO0H 1MQKL 2C1PB 5JOFB 2VLKB 4ZFZA 3KPRE 4XH2B 3BEWA 4QRRB 4OJFL 2B7DT 4Z7QF 4PJEB 1RY7B 1FLTX 3AB0B 4LPCA 5K93A 4WUUA 2FATL 2PYEA 3SGJA 2J8UE 1QSFB 3GBMH 1F4XH 1HH9B 2A1WH 5KJRH 4Z95L 1LO2H 3BN3B 3KPQA 4XVUD 1P7QA 1YPZA 3RI5K 1SM3H 2L7UA 3OX8A 3HC3L 4LCWD 1KBGL 4YBQC 3RI5F 1E27A 4DAGH 3KPMA 1YZZA 3VI4E 5HHNA 4XB7A 1V3KA 1FL6A 4L8DA 4QHNB 1IJ9A 4RISL 1DEEA 2FJGB 3O4OB 1TZGH 2FO4A 2BSRA 4FQCL 1Y6NR 3GNMH 2EDDA 1MRFL 1CT8A 2O5ZL 4NQDA 5DRXB 4LMQE 2IAND 3ULVE 4ZFGL 3REVA 4TYUA 1U58A 4PJDF 1E6JL 4QO1A 3CPLA 2YK1L 3DV6B 5FOBA 4ZAKD 1RUKH 4YQXH 3GUTA 1JF1B 3QXUA 3JWOC 4NCC2 1CQYA 3SGJC 3IDYB 1JJUA 5MI0B 3C08H 1HZHH 4AENB 2QHRH 4NKQB 2HAZA 4NQEA 4JN1L 1S7TA 4BQBA 4UUJA 3BZFB 1BQLL 4JLRA 3VJ6A 4OV5B 2J7LA 3LS4L 5DUML 4NSKB 1F3JB 1EO8L 2BNQD 5CUSL 4FQXD 5GS0C 2VIRA 2DKSA 3QWRD 3VFSB 1QACA 4LHUD 1UCTA 1JPSL 2JIXB 1KIQB 1SJHA 3E3QE 4R4BB 5E24E 4N9OB 3ETBF 3P30H 1IAKB 2O5XL 1CD1B 1JK8A 1IGTB 3L5IA 3PABA 5C0FB 2A9NH 1AIFA 1FV1A 3QDHA 1I8LA 4JM2C 4LIQH 1EA9C 4ZUWB 1MCLA 3C5ZD 3EOYG 5GGVH 4TTDC 4NQCE 4KMTL 3EO9L 3DROB 1EK3A 4DN4L 3JV5A 4D94A 1YN7A 3KPTA 1X5LA 3HA0A 3D5OF 1H5BB 2XQYK 3L7FB 3KYMA 4HZLA 2YD4A 3UP1A 1XF3B 2Y06L 2F5AH 4H20H 2W9LA 2AK1H 2BSSA 4WI6A 2ITDA 3MNVA 3T0WA 1ZA3A 3JV4B 4DKFL 2J8UF 3DURA 1H8NA 1KT2A 2J5LB 4PR5A 5CEZE 1MUJB 4JKWA 4PJFA 1AXTH 1NPUA 4RWYH 4HDIB 3E8UL 4Q9QL 1YYLL 4EXPX 3PJSB 1MCWM 5D8JL 4JFDB 5GRJL 5MEPA 5FEBA 4JN2A 3VI4F 3MOBH 5MENA 4RX4A 2OP4L 3LRSB 1OAUH 4JVPA 2NXZD 4ZS7L 4RFOH 1JZ2A 1XFPA 1YC7A 5BVJB 1CU4L 2VLRB 4JCLA 4QNPE 1UVQB 3IAPA 4HFWA 5B38B 5BXFB 2Z35A 4OFDA 2GSIB 1YMMA 3VG0H 4GAYB 4MJ5A 4RGOH 3SCMB 4LASL 2QSVA 4M02A 5JW4M 1AO7B 3C6SA 1RULH 3SEPA 2KDGA 1LK2B 2LVEA 5ACMA 1FORH 1SBSH 1NGWB 1IT9H 5ISZD 1J0IA 3K3QA 5JLZB 1C5CL 4HKXB 3HZMB 4LF3A 2ESVE 3AXLB 3ES6A 1RJLA 2XN9A 1VPOH 1WTLA 1PVHA 3RGVD 3KPLA 1MJ8L 1DVFB 3QG6A 3JUZA 3KPOB 5C0GB 2XYCA 1UWEL 2NY2D 4WUKH 1MLCB 2WUBH 4O2FA 3QFJE 1CTOA 4ONOA 3PWJA 5KBNC 4JJ5A 3VI3E 3F12A 3ARPA 4JFOB 3R06B 4XNYH 2QQKH 3FB5B 3DX7B 1D5XA 1AD0A 4YPGA 1D5IH 4NC2B 3EOTL 5IEKB 4U31A 2FB4H 1AGBB 2UY7A 4G9FE 3VXMA 3MRKA 4JG1L 1AGEA 2X1PA 5ICXB 2Z31D 5DA0B 1PD6A 1UM4H 3BVNB 3SDDA 2BSED 3QPQD 4X7CC 5I17A 5I76A 1YEKH 2G2RA 1I7UB 3ARDA 5DSCB 3U7YL 4LVOB 4OCSL 1K3IA 4GS7C 3UZQA 5H2BB 3GI8H 2OL3L 3LH2L 1JRHI 2BY0A 4TQEL 1X3DA 2R9HD 1AXIB 1R3LB 5MERA 4LLYB 1WITA 5ICYB 1JWMB 1WZ1L 5A2FA 3OXSA 3ISWA 4PJGE 4L9LB 3VFWA 4XAWH 3CDFA 1DQTA 1F6LL 3DTXB 5IM7B 3ZDXF 1N59B 5CP3A 2CLRB 5DJDB 1L9NA 5SWSE 4DGVH 35C8L 1FVCA 3F65A 5D7KD 4L4VB 1FAIH 5ACZB 4JO3L 3NCEB 3I75A 5T1DH 5A1AA 3OAUH 5C2UB 4IDLA 43C9B 1UB5B 1W8NA 1H3UA 3NTCL 4GAJH 2OXHA 1BAFL 2G5RA 4KY1H 1KENH 3QIUA 1IGFL 2ICEA 5TH2B 5I2IB 3WE6A 3VFPB 3MUGA 3S3PA 3MBXL 5BS0D 1FFOA 5DK0B 4YWGH 4LLDB 1K5NB 2VXVL 4U6VL 2AEPH 1WUNT 1HXYA 3RWDA 3O2DH 3QHTC 3JWOH 1DBMH 1CXKA 3BUYB 4FQHA 4LLUA 1IGJA 4PJ5B 2HJKA 5HHPA 3SDDC 3P0GB 5JXAL 4XPTH 4AEFA 4KPHL 4QNPF 5JQ6H 2GFBA 2H1PH 5HYSG 2PO6C 3X17A 3MRDB 1OL0A 2CPCA 4N5ED 4B50A 4DVBA 3CUPA 4OFYA 1I85A 5E5UB 1Q9WB 2F54E 3S36X 4A2MA 4HWEL 1P1ZB 2Y5EA 4D9LH 1OVZA 5GS0H 3PE9A 3DRQB 4TUOB 3SE3A 3UPAA 1X44A 1KNOA 5DEZA 3ULVL 3SGDH 2H9GA 2X4RB 4OCRH 2E9WA 1J10A 4P99A 2BNRB 2IGFL 2V9RA 1CFNB 1EZVX 4JRXA 3MCKA 3MREB 3MV7E 1UCBL 2UZIL 2V17H 2X2YA 2ZUQC 3QQ4A 4NNXA 3QJHB 5E8DL 3T09A 2ZZUT 4H5SA 3SJVD 4DTGH 5K9QI 3RUGE 3LCYA 5DD1L 1WF5A 1GOFA 2P5WA 3QIUC 1LDSA 1TETH 1M71B 3ARYA 5K9KA 1ES0A 4HIHA 3D0LA 1IKFH 2AXFA 1C5BL 5IHLB 1K2DA 1CLOH 4LPXA 3WLBB 1N0XL 3K46A 2QKIB 2W65A 4LRIC 4RDQF 3W2DH 4PREB 4HIJA 1DSFH 3L1OL 3ZKXB 3OKKB 1AFVL 1GGCL 3H7LA 4GMTL 3MCLL 1O7SA 4M7LH 1J0ZA 3EDKA 3NFPB 4PJ9D 1FH5H 3K4AA 2NY7L 3GSQA 4JHWH 3HS0A 1OGAD 2IH3B 5DMKA 3TNNB 5KG9A 3ZSSA 5FKPA 2MFNA 3HR5B 3HPLB 4LCCA 3BHBA 1FFRA 3VGEA 3VMPA 4AY0A 4XCNB 3CSGA 4O02H 4F8TA 1XR8A 1BP3B 3SE3C 2LE9A 1FNSH 4YJZL 2GIYA 3MRJA 5B4MD 5IB2B 4XAKE 1BIIA 4RRPG 1BVZA 4PJGF 3W9EB 1MY5A 4HUXA 3DMMB 4PRAB 1XGYL 4RMTA 4M1DL 1ZWIA 1YY8A 1R0AL 2Z8SA 4Z95H 3HFML 2CIIA 5GSRA 1WBYA 3MRBA 3IDMB 5HHXL 1CGYA 1RZJC 3HZKB 1MF2H 4WW1B 5C0EB 3MCG1 4JPVH 5IFJA 4JGUA 4APQB 4CADB 2Z9TA 4TOYL 4KMLB 4OQTA 5J8OA 2AV1B 3FB6B 3WFCL 5AZEL 3PGFH 1I1YA 4G6AC 2XWTA 2QSQA 4PLOB 3U1SL 3WHXB 5IUSA 3DUHA 5ACLA 5EU3A 2VLJB 2EYTB 5DRNA 4MD0A 5IFHH 3GJEB 2Y5TA 2O5ZH 5C0CB 4Y5YA 4JO2H 4LCCC 4OT1L 4NZDA 1C7SA 4E42A 1CDBA 5FK9B 5A2LH 1MFCL 3O45A 5FB8B 2FBJL 3L5HA 4Z0BH 2YK1H 1NDGB 4G8FA 4GRLD 3ILQC 4QWWC 4RAVA 3BIKB 5JDSA 2BMKB 4ORGA 5LGHL 2YUXA 4E0RB 2IMMA 2W9DL 2A74A 2BX5A 2WMPA 3CXDH 4Y2DA 5BRZE 5MEQB 2P24A 1P6FA 4WO4D 1JMXA 3K80A 5AD0A 3JV6B 1UEMA 1RIHL 4ZFZB 4F9PA 5GJSH 3E0GA 1MHCB 2B1HL 2J12B 3IRZA 2XQBH 5JXEC 5HHVL 4QRTA 4IOFD 2EE2A 3RUGF 1MJ7H 3TJEL 5CBEB 2NXYD 4DQOH 1NBYB 2Q76A 3KPQB 1I1RA 5CUSH 1P7QB 1YPZB 2PR4L 3OX8B 1OAKH 1JPSH 1BF2A 3ZE1E 1F3DH 4NUJA 4U1IA 5F71A 1MI5D 4YO0A 5SX5H 4ZUVA 5K9OA 4G6FB 3UROR 2NLJA 4L8DB 2NY5C 5HJ3A 3TH3T 2YBRA 4TVPE 5EU5A 4IS6A 5C07D 4GH7B 5I18H 4DN4H 1JZ4A 4Z7VE 5HI3C 3U0WH 2FO4B 2C1OA 4IEFB 3VWJD 4Y19A 5LXGL 3ZKMC 1YNLL 3MX0A 4KTDL 4HXAH 4PRIB 1CT8B 4D0BA 4NQDB 4XT1C 3IB4A 1JYVA 4Y2DC 3REVB 3CFEB 1U58B 3I9GH 32C2A 5EOCL 1KB9K 1UADC 1K3ZA 1U8IA 5I1EH 5FOBB 4OCWH 3QHFL 1MH5B 1WFUA 4I0PD 3GUTB 1MRCL 1JHKH 2JKXA 1CF8L 2EIBA 4FG6C 2CO7B 4OF7A 1FO0H 4HX1B 5D8JH 4XMPL 3PQYA 1S7TB 1EEYB 4UUJB 1AR1D 4JLRB 3VJ6B 5C3LD 3NCJH 1KEGL 3EKCA 2LU7A 4JQVA 3ULVD 1G0YR 2V6HA 3G5VB 4WFGD 2I25N 2CR3A 3DVGA 1EXUB 2GW5A 2VIRB 4AT6A 1SJHB 4J4PA 4I4WA 1G7JA 2B5IB 2VDOL 1NAML 1JK8B 3PABB 1GIGL 3FT3A 4X83A 1S5HA 1AIFB 4WW2C 1FV1B 3GI9L 1OAQL 5LGJA 3O9WD 3LKQA 1A6UL 3OF6A 1U8KA 1JYXA 3EDEA 5FYJU 1QG3A 2DTMH 1DR9A 4TRPH 1YN7B 5F1IB 3MUJA 2YD5A 1MJ8H 4KKCD 5F7KC 3KYMB 4HZLB 3VFGH 4NZRL 5E5RB 4M6ML 2BSSB 1NEZG 2BVTA 5EH1A 2ITDB 3MNVB 4RSVA 5DEFA 2EEBA 1ZA3B 5JIIA 3PP3H 5IQ9B 1KT2B 1LVEA 4M61A 4XWOC 1JUFB 2JJUA 4S1SH 1MIEL 2CO6B 4HJGA 4JQVC 1X4ZA 2NTFB 1S78D 5LBSL 3ZE1F 3CVIH 5MEPB 4JN2B 5MENB 3C5JB 4KJPC 3IDUA 2APBA 1DE4B 3U7YH 1U9KA 3UTTE 3LEVL 1RZJH 4ZTOH 1KPRA 1S5IL 4Y1AA 2GJ6D 4N8VG 4HFWB 5GHWL 3C9NA 4L1HA 1JMZA 4Z7VF 4X5WA 4D9QD 1HHJA 4J3TA 1YMMB 2C7UA 1AHWC 2R1WB 3QWQB 4QRPD 5KSBE 4MJ5B 3NCYS 4JFHE 3AFLA 4GS7B 4IRZL 4XBEH 3AROA 2H2SC 3C6SB 35C8H 1AY1L 5DJXB 1XGUA 4S11A 5K9QG 1U93A 5AWNL 2VDNL 1T66D 4ZDHB 4AIXA 3BEVA 3O3EB 4QRSA 3MRGA 12E8L 2FNBA 2CIKA 1RJLB 2XN9B 3FFDA 3ES6B 4KRLB 1CGSL 4JFEE 1FAKT 3KPLB 2BCKA 3QG6B 4YHML 4M3JA 4HMEA 1T7XA 1KLUB 4OD2A 3AS3A 4KI5E 5I1HH 4TN9A 2FIKA 2QR0A 4O2FB 2KZ1B 2VXVH 4K8RL 3UYRH 3PWJB 4JJ5B 1CE1L 3F12B 3U79A 3AVEA 2BVPB 5JXAH 5E2VH 3GO1H 1D5XB 1AD0B 3W82A 4KPHH 1NFKA 4E9LA 5BV7C 3TA3D 3VXMB 3MRKB 2DJSA 1AGEB 3PWVB 3I6GA 1FNGB 4AMKL 2CSPA 3SDDB 1XGTB 3L5WA 5IB1B 5EA0H 2ZNXA 4PJCA 2YZ1A 1WQVT 4HWEH 2DQDH 5I17B 5GPRA 4OQTH 2G2RB 4OI7A 3KWWA 1VFAA 3UTQA 2PO6B 4N0CC 3RVTD 3K81A 3IGAA 2VO5A 4UZGA 3L3GA 1FO0B 2CDFA 2NY1D 5MERB 1JV5A 1JWSA 1U8HA 3QNZB 3VFWB 2XZZA 2XV6B 4HUUA 4PRHE 4RFNC 1I9RH 5E6IA 1FVCB 5ALCL 4NHUB 4LGPB 3I75B 1RIUL 1C5BH 2QSTA 5E2WH 3UBXI 5ICZB 2ZUQB 5D1QD 2WWKT 3T2QA 3H42H 3FQNA 2LAAA 4Y4FA 2JCCA 3QIUB 2ICEB 2ZJSL 1HN1A 2EEDA 2UZXB 3WE6B 3H6JA 4JO4H 3NGBC 1E4KA 4BFIB 4EOWH 1L7IL 4PJEE 1FFOB 5KZCD 3EZJB 4I48B 1X5KA 4MAUL 2VITA 1IAIH 2NY7H 4YE4H 4UV4H 1HXYB 3RWDB 4HCRA 3O2WH 4L3ED 3SKOA 1QSFE 4FQHB 1FVDA 4LLUB 1IGJB 3AC0A 2HJKB 5HHPB 3G5YB 1HYSD 4J3SA 3IKCA 4V1DD 2WIIB 1T1WA 2GFBB 3O2VH 1EAPB 5IMKB 1I9IL 1A14L 5F6IB 3CUPB 2YPLE 2GQHA 4M1DH 1X5IA 4HIEA 1HQ4A 3DECA 3QCTL 1NGQL 2XQYG 1OGTA 4P46D 1NH6A 3EYSH 5E7FA 1LE9A 1EHLL 3V9FA 2H9GB 3RVVC 1ITCA 5E6IC 2W60A 5HHXH 4PRDB 3OG4B 3HN3A 1E4JA 1VHPA 1KC5L 4JRXB 3MCKB 3QQ4B 1G9MC 3WN5A 4H5SB 4TOYH 2NX5B 4RIRA 1MCOL 4G7VL 3BGFC 2P5WB 4KI5F 1SY6L 4DKAA 1GHFL 1HKLH 2NYYC 4AH2A 1URLA 2ED9A 2PETA 5K9KB 1BVKA 1E4KC 2C5DC 5TQ2L 1ES0B 4MAYA 4YDJA 2AXFB 1K2DB 1NC2D 5D7SH 5ETUA 2W65B 1AGCB 4A6YA 2YWZA 4JY6A 4HIJB 3ZYOA 4Z76A 1RU9H 4I77H 4PD4K 4CKVX 3SOBL 1Q0XL 4WCYH 1KELH 3GSQB 3A67H 3QUXA 5HHOD 5I1IL 4S1RH 3GK8H 5KG9B 3WIHA 4U1JB 5F8QC 4LCCB 3BHBB 3RVXC 2QSCL 5E1AA 5F96H 3QXDA 1XR8B 3C2AH 1YUHA 3ZMRA 1RIHH 1TJIL 2MHAA 3ARFA 1UJTA 3MRJB 1SVZA 2APVA 1BIIB 5F7YC 5HHVH 4V2CB 4HUXB 5D70L 4AZ8A 4KVNL 2AEQH 1ZWIB 1YY8B 2DL9A 3RVUC 1EGJL 3W11D 4O4YL 4GUPB 4D8PA 5I1CL 2CIIB 1MCBA 3MLTA 4QT5A 5GSRB 1T1YA 1SBBA 1WBYB 3MRBB 3O3AA 1XF2A 1ZHNA 1U8LA 5CLWA 4LFHG 1TCRA 1YEFL 1ULVA 4KKBD 1DN0A 1I8KA 2ARJQ 4MAYC 2V5YA 3KVQA 1HH6B 3KS0J 5C08D 4JR9L 4MDIA 1CXHA 5C0RH 5IFJB 2J4WL 2N4IA 2GCYB 4Y4HC 4JY5L 4PJEF 1UC6A 4YHKL 1I1YB 4XC1L 2XWTB 2FX9L 4P9MH 1W72L 2EDOA 3CVHL 5I19L 3BKYL 4I3SH 5EU3B 4DN3L 5GQBA 3QXWA 4MSWA 3QUXC 3JUYA 3BPNC 4NGHL 3D0VB 1TVDA 5DRNB 3TESA 4MD0B 3H9SD 5EIVA 4Y5YB 4PP2A 3MXWL 3P9LA 4E42B 4XCEB 5KVDL 4K8RD 2VB5A 5J3HD 5GISH 1WIPA 3O45B 1M7IA 3FHAA 3FO2A 1Q72L 4G8FB 3ARFC 4RAVB 3EHBD 1A7PL 3WKMH 5MHSD 5BV7H 1QHOA 4RZCA 4ORGB 5DD3L 4JB9H 2A74B 3IU3A 4Y2DB 2P24B 2CMRH 1EVTC 1YA5A 5E56A 4LSTH 5J6HB 2LU3A 3BJLA 4OQ1A 5AD0B 1ZVYA 1F4YL 2DMCA 4JREB 4QRTB 3MRFA 2WWKO 5E03A 3RRQA 1AQKH 4J3XA 5D9SA 4X9GA 4AM0A 1KEGH 1BLNA 4F7MB 5C70A 5A3IC 2HT4C 3RP1A 5E08L 2HWZH 2Q76B 1R5VA 3FOLA 2FJFA 4GW4A 1ED3A 3Q3GA 4WU7B 3ZLQC 4EUPA 2R69L 1HQRA 2PN5A 3DHJA 4J12A 3ARED 4KXZH 1XAUA 4ELKA 5L2KD 4NUJB 4U1IB 2VDOH 1EIBA 1NAMH 5JOPE 3TEUA 5E9DE 4WI8A 4F33A 2VXUH 4YO0B 3QAZC 5K9OB 2NLJB 4EIZC 5HJ3B 2YBRB 3FZUC 4IS6B 2WINA 1X5JA 4FQ1L 1A7RL 5DJZA 2ADIA 1MRDH 4GJTB 3LPGA 4OZHA 4X6DA 4Y19B 2ADFL 4KVCL 1QHPA 5IIEA 1FC1A 3V5HA 4FFWD 1CVSC 3VXUE 1NUFA 5HTSA 1RUPL 5MP6H 1L7TL 4NZRH 4M6MH 4R2GC 3QDGA 1KUMA 4BSVA 1KCVL 32C2B 4TPRL 2BNQA 5JO5B 1L0YA 4FQXA 4L5FL 5T3ZH 2HMID 1VSCA 4LHUA 1UH3A 3TIEB 2GY5A 2WW8A 4TVPD 2YSSA 3ARWA 2X5PA 3TNMA 2HFGL 4ENED 4RDQG 1RZKC 4JVWA 1PG7H 4UDUA 4O2CB 3C5ZA 1W0YT 4U3CA 4C56A 2WSKA 3TO4C 4P5KA 3BMWA 5C0AE 4FTVE 1YQVL 2R2HA 2VLMD 2GHWB 1QBAA 1PKQA 2EYRA 4P4KD 4ERSL 1VENA 4OCNC 3KAAA 1S3KL 1UWXH 4GKZA 4I0KA 5DRWA 5EPMA 3ZTNL 1MFEH 3K8LA 2V7HA 5F7NC 2OTWA 5GHWH 1DP0A 3N1MC 1RHHA 2YPKA 5IHUH 1NCAH 4PY7A 2H8PA 4PB0L 4DFHA 1G9MH 1G7JB 1WFOA 1ZKAA 4YZFE 2I9LA 4O58H 2VTFA 4I18A 4J7RA 2AV7B 3FT3B 2M8XA 2DL2A 1S5HB 3MRNB 1QFWH 4MLSA 4XCFL 3SDCD 5DC4B 1XH3A 3FAXA 4JPWH 4X6BA 3S96A 2AJVL 4MXQC 1B0RB 1V8HA 3LKQB 3O6MH 3WUZA 1AHWB 1N4XH 1IGYA 1U8KB 2XKNB 3OZ9H 1SMOA 3V0WH 4DOHB 1V7NL 5ILTL 2JELH 5FYLH 3AM8A 2R2BA 4FQXC 1U6AL 4H0HB 4DUVA 1HINL 3TBWB 3UBXG 3G5XA 4TSAH 5FFLA 1GJIA 3ESUF 2GAZA 4K8RH 3RL1A 4PJIA 4MB3A 4DK6A 4NPYA 5DEFB 3C5ZC 4K3DL 3OAYH 4KFZC 1RUQL 3V8CA 3VXQA 4M61B 3CXHJ 4UTAH 2YKLL 3EFDH 4P5TC 1QBML 1ZSDB 3U4BL 4YFDB 1IQDB 4YUEL 2N7BA 4ZOEA 5DEGA 1FGNL 4HWBA 4P3WA 2YRLA 1LK3H 5ISZA 4P2YA 3H9HA 3NN8A 4K23H 2GT9A 4UT7H 3HE6D 4KK5D 4QKXB 4Y5VC 5F72S 1U95A 4Y1AB 3RGVA 4PRNA 4M7KH 2XZQL 5I73C 3QDMD 2D7OA 2C7UB 1QZ1A 3U82B 3TN0D 1C12A 4G9DA 2Z8RA 4ZOBA 1M7XA 3W5NA 1FLRL 1IL1A 5FYJL 1K4DA 2VZUA 3S35H 1CLZH 1XGUB 1YYMH 3FONA 5C09A 1RIUH 3O6FD 4QY8B 4P2RE 3BDBA 3HKFA 3BEVB 4YNYA 3RAJL 4YDIL 2CIKB 3FFDB 2Z31A 2R2CA 1ZOXA 4EDXA 4RFNB 3MLUH 3CSBA 2BCKB 3RPIA 1A4JB 4YGVA 1MPAL 4OD2B 1WCBB 4HIXL 2FIKB 2HYMA 2QR0B 4GBXA 3HHRB 1T0MA 4MAUH 2X4NA 2XWBA 4GG6E 2R4RH 3IDGA 1GH7A 3PDDA 3EOBA 1DBAH 3KXFB 2NY0D 3R4DA 4LHQB 4X80L 4L3CA 4RNRB 3IFPA 4PTUA 3RDTA 2C3VA 3I6GB 3QQ9C 1QKZL 4GSDH 3C60D 4X9FA 4YZFF 3L5WB 4XBPA 1L9MA 4UINH 2DN7A 3F58H 4X6EA 1NGQH 4OM1L 3BYTA 5SWZE 3KWWB 3FB7A 1VFAB 3MRIA 1EHLH 2DKUA 3CX2A 2Q8BH 1JPGB 3BP4A 3IGAB 4TUKL 3L3GB 2CDFB 1JV5B 3D69A 4I8DA 5DWUH 2OK0L 1FBIL 1I3VA 1JWSB 4PRPD 4CU8A 1BZQK 3MA9H 2B0SL 3FRUB 3QDAA 2Z31C 1AH1A 5HI4D 4HUUB 3V6OE 5E6IB 1GHFH 4R4FL 1NCDH 2BNUA 5TQ2H 3LEXA 2B39A 4LP5A 3BO8A 4GBXC 3GBLA 5DD5L 5HXMA 1NUDA 3EDDA 3FQNB 1MFAH 3MXVH 4Y4FB 3WDJA 3OJDB 2JCCB 3BGFB 1BFVL 2NMSA 2OXGA 2X40A 5DJ0A 3F8UB 5DYOB 3SOBH 2MMXA 4LVNB 3KPPB 2DQJL 1FN4B 1VESA 4OGAC 3NZHH 4WUUE 3QZWG 2PYEE 1MAJA 2K3TA 4KJYA 3RDTC 3SKOB 5E94A 4J3VA 1FVDB 5E2JA 2DKMA 4HLJA 5FUZL 2R56L 4WWKC 4B7LA 4K55A 4PRHD 3BP6A 1RZKH 4POYA 1H3PL 2QSCH 4FZ8H 4FOMA 3IKCB 3MODH 1AJ7L 5T1MA 1T1WB 3SJVA 4M3KB 1YY9D 1UJ3C 1TJIH 4BQCA 4DKEH 2E7HA 3UJIL 1NMAL 4R7NA 3K0WA 5D70H 2JLLA 4KVNH 3MV11 1HQ4B 3AS0A 5J1TC 1EGJH 4O4YH 5FV2A 3BOVA 1OGTB 1OAZL 5I1KL 4PJAE 5DMIL 1LE9B 1TZHA 1T2QL 2NZIA 3ULUF 1NSNL 1ZVHA 1JNLL 1Z6JT 3CH1B 4PJ9A 5DD0H 5ITFA 5ID0A 1RZ8A 5DF0A 4NQDE 4K7PH 2J4WH 1OGAA 3WN5B 4PGDA 1QSEE 3EYFA 3QBTB 5GSVA 4RIRB 4JG0H 4N5EC 3P0VH 4XC1H 4RGNC 2FX9H 3QDJA 1ZHBA 5FUOL 2DQFA 4X6FA 4DUXA 4MAYB 1DBKL 4X4MA 3HPJB 5DI8A 4DN3H 2ZCKL 1HHKA 4RQQA 4NGHH 5GRUH 2VQUA 3QP3A 2O26U 4Y4HB 4H0IA 3CGTA 4JY6B 1KXTB 4KJWC 3MXWH 4QXUL 3WD5L 4NQEE 1OY3B 2D31A 4R6UA 1QRNE 3QUXB 4PS4H 3Q6FB 1JTOA 4JPIB 3BPNB 1FYHB 3MNZA 5HVGB 4WFHE 3SE8H 4JQIL 4FA8A 5JW4N 4NKIH 4J23A 5DD3H 3WS6C 4G7YH 4OLVL 5E1AB 2XXMB 4OM0L 2YA2A 3QXDB 5EZJA 1EFXA 3HCVB 4HK0B 4MNQA 1CBVH 3FFCE 1YUHB 4QHMA 4U1MB 5DK3A 2MHAB 3ARFB 5T33H 1QYGL 1QLRA 2A0LD 5F89A 4PJ9C 1TZIA 5IVXE 4D8PB 3MLTB 4GKOA 1T1YB 1XF2B 3O3AB 2FCBA 1ZHNB 1U8LB 3TT1H 3D39E 4UT9L 1DN0B 1I8KB 5J4MA 4JHAL 2VR5A 1DQLL 4HJJL 1F13A 4JFZH 5HGGS 4MDIB 3WFEL 5IF0A 4GRLA 1DQML 5FYJD 5B4MC 1MCKA 1RFDL 3S36L 5DD6A 5EOCJ 4HUVA 5GS1A 4JVUA 3QQ3A 4Z5RA 4FQ1H 4JFYA 4WO4A 5K9JL 4CJ1A 4YXKL 2H45A 3LZFH 3WFHB 4PJFE 4MSWB 2ADFH 4KVCH 3QAZB 3FCTA 5D2NC 4WRLA 2LABA 3KJ4C 2VXTL 5D7IE 1K6QL 1J87A 4PP2B 3IJHA 4Q9RL 4QYOB 4PYHA 4ZQKA 5FO7B 3P9LB 3WO4C 5JZ7D 4XNXH 4FXGA 1NCCL 1M7IB 3FL7A 4JFFE 1A6ZA 2YPVL 3FO2B 5IBLC 4EN3D 4XVJH 3Q1SL 1HDMA 4M7ZC 5GGTL 5TQ0L 4RZCB 2WANA 5T1LB 5CJOH 4NC0B 4PJAF 3TPUA 4PGCA 3IU3B 1MI5A 4R2GB 2HFGH 5TE4L 4WU5A 1OP9A 4KK9D 2MSPA 2EYSA 1JL8A 5C07A 4LSVH 3MRFB 4Q0XL 4WHCA 4AM0B 3VWJA 3ZTNH 1BLNB 2FR4B 4G8GD 1JGLL 1UB6A 1JGUH 3FOLB 2FJFB 2RCSL 4GW4B 4HW6A 1ED3B 1T2JA 3LS5L 2XN9E 4ODVH 4EUPB 4HMCA 4FQJH 2BRRL 4XPGL 5EZLB 4WO4C 4BZ1L 1T20A 1HWGB 2HTKC 4F33B 4M7JH 3T2NL 4JAMA 1CFVH 4M1CD 1NCTA 5BOPA 3S88L 4I0PA 1F02I 1KXQE 4IOFC 2WINB 2FGWH 1A3LH 2DQHL 3HNTH 2O93L 1V7NH 5DJZB 4P4RB 4X6DB 4OZHB 3OKLA 3HAEA 5KSUA 3KR3H 4BQ6A 2F58L 4OZFH 4UIMA 2EDXA 1KCRH 3BAEH 4ZOAA 5IIEB 1A4KA 3MRLA 3VXME 4AEHL 3V5HB 5JMRA 5IWLA 1UXWA 4GXVH 4X8JA 5JOEA 4QXWA 5F9AC 3UPRA 5F6HJ 2XXCB 1YNKH 4JPKH 3SPVA 3FRPA 3QDGB 4BSVB 1JFQL 3ZT7A 4MJ4A 4FQXB 2AW2A 3V52L 1KTKE 1F4WH 2R0WH 3GIVA 1CR9L 3TBYB 3VA6A 2Y9RT 4B5EA 1JVKA 4PJHA 4LLQB 1QBMH 3TNMB 1JRHH 4WHDA 2H26A 2X89D 4YUEH 1IC4L 5JMOC 4LCYA 3LMJL 2EDEA 4UDUB 1FGNH 1YECL 3C5ZB 2YS4A 3O9WA 4C56B 3QEQD 3W9DA 4P5KB 4ZOCA 4HG4J 3K4ZA 4U1SA 1PKQB 1U8MA 2EYRB 2JB6A 4LPWA 4P5TB 4GKZB 5DRWB 5EG6C 1J1OL 5TGBB 2OTWB 4KQ3L 4QTHA 3RJQB 1RHHB 2YPKB 1MEXL 4PJFF 2EXWD 2H8PB 4NC1E 5C0BB 4ZUSA 3GMQA 3QIWD 4CUCA 1HNGA 3DX9A 2B1AL 1DL7H 3UDWC 5LVEA 2I9LB 2J88H 4KROD 3SQBA 4XPFL 2DD8H 4Y5VB 1FLRH 5BCAA 4Y8AA 1MFBH 4X6BB 3S96B 1FZMA 3F6LA 5I73B 4RA3A 1IGYB 4LNVA 4KRPC 5FGCB 3ULVC 1OAYH 4KK8D 4Y7MA 5CSGA 4NT6A 2R2BB 4YDVA 1BGXL 5EZIL 3HG1B 1LO3H 3O0RH 3VWKA 3HMXL 3G5XB 3RX5A 3X3GL 1RUMH 1MPAH 4X7EC 4HIXH 1X5XA 5CGYC 2X4PA 2GAZB 3ZHKA 3RL1B 4YDKL 4PJIB 3L3KB 4NPYB 1OAXH 3VW3H 5I9QC 3EO0A 4QRPA 3TLRA 4BQ8A 2OTUA 1OTSC 4EI5A 3VXQB 4MCYA 3BH8A 3KYKH 4Z7UE 5C6TL 3JTTA 4JRXE 1QKZH 5CZKA 1GGYA 4WEBL 3WYRA 5ISZB 1G7MA 2VZ1A 1I75A 4JFXA 2P5WE 3NN8B 4KDVA 4MYWB 3NIFE 3LQMA 4OM1H 5GIRA 1QSVA 1A02N 5B21A 3T4AA 1N3NA 4U1KA 4J6RL 5DJ2B 4JFQA 1M6OA 4PRNB 5IOPA 3QXAA 5HPMA 3MFFA 1FL3A 1IGML 4LEXL 2OK0H 3VFNB 1FBIH 3E2HC 3DLQR 3GRWL 3H3PH 5HYFA 1A64A 4HWZA 4G9DB 1WBZB 4M8VA 3DBXA 2NQCA 4Z7WA 1ORQA 1PKOA 1IL1B 4D2NA 3VWKC 3WXVH 5KOMC 1H8SA 4EVNA 2X4QA 5CZVL 5C09B 1B2WL 2X05A 4Z77A 4HHAA 4LCUB 1LEKA 3TA3A 3RFZC 3UTPD 4G6MH 5DD5H 1ZLVK 4YNYB 1KJMA 4K7PY 5EUKA 2HVJB 2Z31B 4E41B 5DUPL 4EDXB 3OKEA 5GZOD 4GFTB 4XCYA 2E27H 5FV1L 4U6HA 4CDHA 1X6LA 3MOAL 4MMZC 3RPIB 5HDBE 4YGVB 4EI5C 4GBXB 4CVXA 1T0MB 3GBNL 5IT2L 2AKRA 2PXYD 2XWBB 3IDGB 4P59L 5HHMB 5KVFL 5KTEH 2VLLA 2R0ZL 3EOBB 1FPTL 5D6CA 1J1PL 1H3PH 4OZFB 3B9KD 2X9XA 4ZYKA 4L3CB 1SQ2N 1L6ZA 2UUDK 5DUBA 1YN6A 3RDTB 2C3VB 1Q9OA 2J6EL 1U91A 2VABA 3GIZH 3WCYA 1P2CA 3DGGA 1NMAH 4OF3A 3UJIH 4XBPB 4KI1A 5CINL 2A77L 1XF5B 4LPUA 5BZDA 3P4MA 1OAZH 5AEAA 3FB7B 3MRIB 1A6AA 5I1KH 1UJ3B 1T2QH 3MJ9L 3BP4B 1NQBA 3VU2A 4LLVA 1R6VA 4MVBD 1JNLH 3IXAA 4RWHA 3D69B 4QGYA 1FG2A 3TA3C 4WFFD 2R8SL 3EYVA 1SEBA 4L3EA 3BW9A 4P2QE 3PP3K 3PDOA 3EAKA 2BNUB 5FUOH 3SDAC 3GJFA 3LEXB 4LDOB 4WTZG 2J8HA 4H88L 1UM6H 5J11C 4PJ7E 4D3CH 2ZWLT 3EGSB 3H7BB 4RGNB 1J8HD 2G60H 3WD5H 4JDZB 1CIDA 1UT9A 2DYPD 1KOAA 4X4ZA 1O7VA 4FFZL 2CLVA 4OF0A 1JZ8A 4P46A 1D9KD 4M6OL 4UNUA 1FRGH 2W0PA 4KJYB 5E94B 1U92A 3BKJL 3S97C 3BP6B 5C8JA 1I1AA 1MLBA 4OLVH 3QUMH 4F37K 3SJVB 3L3JA 5B38G 4RMUA 2V5SA 4F37F 2GK2A 4XCCL 4NWUH 1QYGH 1C1EL 4FNLL 4R7NB 3DPBA 1ZLSL 1MCNA 4ODSL 1NC2A 3HTLX 1FNLA 3IFNL 4NCC1 5IHBA 5JW3L 5TDPB 1GZQA 1TZHB 4I13B 1MHPL 2KBGA 3DSFL 2CDEA 3L3DA 3O8XA 2QADC 1C08A 1HYSC 5A16A 4C4KT 4RBPH 3EIFA 1G9NL 2VC2H 4PJ9B 5ITFB 1RZ8B 5HHOA 3RTQC 5IESL 3WFEH 2HKHH 1OGAB 4PGDB 5HDBF 5GSVB 1E4XL 3GSOA 5T1KB 3L3HB 3QDJB 1ZHBB 3I50H 4C83B 1JPFA 2AJUL 2F74A 5DI8B 3TYFB 4F57L 4L8CB 4QHLA 3QCUH 1HHKB 4RQQB 5BQ7A 2HH0H 2MKLC 4YBLC 4OFPA 2Y7QB 1U3JA 4P23C 4Q9RH 3VH8A 1P5UA 1I1AC 5KAQF 2HT2D 5JPNA 3PQYE 3MO1B 1DANU 1QEWA 2D31B 2VDRH 4KTEL 1F11A 1T83A 3BISA 1MJJA 4UDTB 5D2NB 1JZ6A 3MNZB 3BYYA 1QSED 3KJ4B 1NKOA 5TQ0H 4WFED 3WO4B 1EFXB 3N1GC 3ZSTA 4MNQB 2YMXL 4UQ3A 4ZPTA 5DJCA 4M7ZB 3O8XC 2FEDD 2FH8A 4PV8B 3TZVD 1QLRB 4O51B 4PJDB 5KVEL 3CX5J 5F89B 1FJ1A 1VFMA 4XX1G 2EIEA 4JDVA 2XRAL 2VXQH 2IPKA 3H9SA 3P4NA 2VAJA 1QFUL 1A8JH 1CL7I 4OGXL 5J9PA 4XPGH 5HD8D 3CFDA 1QLFA 3WXWL 5BO1H 3BIAX 1QSZA 2N7AA 3GMMA 2CJUH 4WDIB 4F2MA 2EH7L 5DD6B 4HUVB 3S88H 5GS1B 4KZEH 1CK0L 4M6NH 3MRHA 1DQDH 4MB4A 2AK4E 4JZNB 2DBLL 3OBAA 3QQ3B 1FGVL 1U36A 1W8OA 4Z5RB 1R3KA 1W0VB 3VD4A 1G6RA 4JFYB 4WO4B 2ICCA 5KVGH 5C0DA 1T83C 1EEUA 3C6LD 2B2XH 3FCTB 5D7LD 2P8LA 4MS8D 5CJBA 4AEHH 3KDMB 3D18A 1CDJA 2W1NA 1RQ5A 3IJHB 4ZQKB 4OZIE 1CDCA 1NEUA 5D1XA 4N68A 4OB5L 4BH8A 1RURL 1MWAH 1S9YA 1HDMB 2AJXH 2VJXA 3K2UL 5L2KA 5I0ZA 2UVEA 3TPUB 1BFSA 4PGCB 3RWIA 1MI5B 5BRZA 4ELMA 2A9ML 5I8CB 2BVOA 3Q5YA 3LMJH 2ZCHL 3HE7D 4NO2B 3KPRB 2EYSB 3JVGA 3LKPB 5K59E 5EOTA 2DIBA 4S0SD 1KJ3H 4MXWL 5FKAA 3LN4A 3VWJB 2P5EE 1NJ9A 4G6JL 1UB6B 1BX2A 5D7JA 1J1OH 5FHAL 2KQNA 4WNQA 3QUMB 2ZUVA 1RAMA 4OLZL 4WHYH 4LSPL 4FZEL 4U6XA 5JORB 4XNUL 3TM6A 3U9UB 3P0YL 4M1GH 2CUIA 1BOYA 1T20B 1X5ZA 1SJEA 2EICA 2W38A 4JAMB 4I0PB 5L8JB 1FL5B 1LO5A 5D1XC 1Z3GH 1B0GA 1ZS8A 3D25A 3OKLB 3HAEB 3LKNB 1OOAA 5EZIH 4H8WH 2YD6A 1JN6A 1YNTA 2X4UA 4JEGB 1A4KB 3MRLB 4OGZA 3CFKA 4CVWA 5J13C 1MAMH 3RBGA 4P4KA 4FXKA 2V2TA 1KJ2H 3QNYA 4X8JB 4K3JH 4KRPB 1LDPL 3UPRB 4U4BA 3SPVB 3CD4A 4PJCE 3SE9H 2VDPH 3GIVB 4YHNA 5E95B 1JF6A 3PGCA 2C3XA 1BD2E 1XGQA 4HH8A 4OF6A 5C6TH 5CIPH 1RHFA 5D7JC 1SY6A 3SDCA 5DO2D 3V4PH 1J5OH 1EAJA 1KN4L 5DS8A 1OTUD 3O9WB 5I9QB 3QO0A 4YX2L 3W9DB 1P7KB 1F58L 2BOCA 3FAWA 4UTBL 4X5LA 2C3HA 3BDYH 4KZDL 1EHNA 1X5GA 1U8MB 3I3DA 2JB6B 3QSKB 4U1SB 5AG9A 3VXRE 2ZUWA 3T0AA 1TTFA 2OZ4L 1WAAA 5I8KL 4MQXC 4QTHB 4ZUSB 3GMQB 1AD9A 3DX9B 1ETZA 5I8EA 4ENEC 3LDBC 2Q87A 3WFBL 4X7TA 5I15L 4S0TD 4ZFFA 1IE5A 1IAMA 1FZMB 2ENSA 5CZVH 1EEZA 3GDBA 4PLJD 3E2HB 4NQCB 2DM3A 5IBTL 4ORZC 5T5FL 3J8F7 3OAZH 4NT6B 1UA6H 5DUPH 3ABZA 3EO1A 2ARJA 5EDXA 3VWKB 4MA1C 2B4CC 3H3KA 4LVEA 4ONHA 3QJFA 3HE6A 1QPPA 2X4PB 4O9HH 1TLKA 3GBNH 4NUGL 5CD3A 3L3IB 5K59F 5CKGA 2NY3D 3SDCC 4K94C 5KVFH 2QBWA 3UC0H 3QDMA 1PQZA 2VDKH 4IRSC 1J1PH 1FCGA 1QFOA 2OTUB 4EI5B 4MCYB 1ODAA 4PYGA 2IQAA 1KN2L 2YC1A 3JTTB 4PJ8A 4OCYL 1RMFH 1W72A 2HA1A 2XTJD 5DURD 5L9DL 3O6FA 1G7MB 4JFXB 5GIRB 1MWAB 3SY0A 4N0UE 4K3EH 4N90E 4HKBA 4KV5E 4CNIA 3UTTA 4ZODA 3TJHD 1N3NB 2H32A 4U1KB 2PF6A 1M6OB 1S8DA 5DMJB 5F9OH 5IOPB 4XGZA 4CJ0A 3QXAB 5HPMB 3MFFB 3M07A 1FL3B 4NJAL 2V5TA 3S37H 1MQ8A 4MDJA 1KFAL 2R8SH 3S34L 4HWZB 5BW7C 5KSBA 1A9BA 2YR3A 3DBXB 4Z7WB 1ORQB 2VL4A 2XPGA 1HEZA 1FNEB 3PUCA 1Q94A 3TH4T 4PJCF 4EVNB 2X4QB 4U1GB 1CDHA 4QGTA 1LEKB 4HHAB 1CLYL 3HE6C 3TA3B 4KK5C 1F6AA 2QQLL 2VZOA 1LEGA 3BP7A 3WNMA 1KJMB 5DHVA 5EUKB 4B41A 2XNAA 1A7OH 4CBPA 2IQ9L 3OKEB 3C60A 4XCYB 5IK3A 3MJ8B 4HBCL 4LIQE 2L7JA 3SDAB 1MCIA 2E6PA 1QBBA 1W2KT 4CVXB 1UWXK 1VGEH 3KYOA 4GMSL 2AKRB 4P2OD 5CILL 2IALA 5J11B 4M48H 1V3MA 4PJ8C 1INDH 2VLLB 5DJ8A 1HCFX 3WFDH 3ZL4L 3BKJH 1CD0A 1TVHA 1J9CT 5D6CB 4U2YA 3G6JE 4Z7OE 1ZAGA 1YEEH 2NR6D 4U1HB 1QR4A 1KJ2B 5DUBB 1A7QH 2JCCF 3P2TA 4WGWB 5DA4A 3WJLA 1Q9OB 4G42A 1U91B 2VABB 1P2CB 3DGGB 3STZB 3TT3L 1C1EH 4FNLH 3SKMA 5HGHB 4LSRL 3THML 5BZDB 1NFDE 4TUJA 3V7AE 5JW3H 5D72H 2X41A 1MHPH 4ZO8A 2GJZA 1G6RH 4LLVB 1KG0A 5F7EH 5FHBL 5BJTB 3IXAB 5KZCB 3ARGA 4FQLL 4KQ4H 5IESH 3EYVB 4LGRB 3SKJH 4R90L 4RCAA 5IMLB 4L3EB 4PJGB 2V9QA 3BW9B 4XP9L 1NBVH 1GGIL 2QADB 4FP8H 4PRHA 5SWSB 2NPLX 1RZFL 3L9RA 3EFFB 4LCWE 5E99L 3RTQB 1MCPH 3UBXB 4MB5A 1PEZA 1JGDA 4XHQA 3CCHA 2YUZA 3PL6A 1IILE 2O5YL 2X1XR 2CLVB 4KTEH 5TJWK 4RMQA 4M9PA 3QUZD 4YBLB 1CZ8L 3CIQA 1U92B 3V0VA 4P23B 3FQRA 4KV5F 2JJTA 4UT6H 2X1QA 4BZ2L 1I1AB 5C8JB 3ZDYE 3GB7B 1K8IA 2IG2L 2IANE 3VXPB 5JUEL 4K3HA 3L3JB 4XP1L 4XNZC 1RIVH 2D03H 3IDIA 1J12A 4NQSB 5KVEH 2D0GA 3ARGC 5FDYA 1ZA6A 3T3PE 5INCA 1WWWX 1GZQB 4W6WB 2DQTH 2AJZA 3G9AB 1XGRB 5JHDD 4X6DE 2CDEB 3L3DB 3O8XB 2AVGA 5TFSH 4OGXH 5A16B 3NPSC 5T3XL 4HPOL 3D87B 5C0JA 3MRPA 1BQUA 1MREL 4EBQH 5I0DA 4PUBL 4Y16D 2IH1B 2FECI 3RUGB 1CICD 1C8PA 2BNQE 1BQSA 2W9EL 1S9XA 3QIBD 3PL6C 3D85D 5C0ND 5ABDE 1JPFB 4X9BA 2F74B 3GKWL 4G43A 4I9WD 3RX8A 4QHLB 1X9QA 4CU7A 3WUWA 3VFMB 3S3JA 4Z7OF 1CFTA 1XGPA 2MQ3A 3B6SA 1LO0L 4IRJD 1RI8A 2JJTC 3F7PC 5JPNB 3DIFA 4IHOB 1N5YL 1QEWB 1BBDL 2P49B 4W6YB 3QXVA 1F11B 2X6MA 3BD5A 2W07A 4HAFA 1MJJB 1RURH 1EHXA 4I3RL 3GBML 1A5FH 1NFDF 2A1WL 5KJRL 5DJ6A 1KB5H 3K1DA 3K74B 3MA7A 2OJZL 4S10A 3RL2A 4EQ2A 4N1HB 2X4SA 3VRLE 1EJ6A 1IM9D 2A9MH 2VWEE 1ZHLA 1VDGA 2X44D 4ZPTB 2CH8A 5DJCB 1IZJA 3SO5A 3BRGC 4DAGL 1X5FA 3NFNA 5F44A 5E8OA 3WL9B 3B4NA 3QUYD 1GYAA 5CSZB 1FJ1B 3T0DA 1PBYA 4LOUD 5E2UH 3WNLA 4HQQH 1BQHB 2CDGA 5BMFH 4J8RA 5FHAH 3N1QC 5H37G 4XPAL 4Z0XA 2APXA 5F3BA 4DW2H 1NGYA 3TCXA 1TZGL 4X6CA 5J1AB 4Q97A 3QHZH 4OLZH 5J9PB 1EJOL 1FDLH 3GNML 3KPSD 3CFDB 1I1CA 1QLFB 4EN3A 1XCTB 3GMMB 2VLKD 3F7VA 4F2MB 4QRRD 3DOSA 3RKDD 4NRYA 3IDYC 3MRHB 4FQQA 4LU5H 4PJIE 1O5DT 1AP2A 2RIKA 1FSKB 1G6RB 2HG5A 3P11H 5C0DB 3F7RA 4YQXL 1G7LA 3LQAH 1QQDB 2P8LB 3CLEH 4BZYA 1BFTA 2PYFA 3C08L 5CD5D 1HZHL 3RIAK 2APWA 4HUMB 5HGBA 5D1XB 4G8GA 8FABA 5ISZE 3MLPA 4JGJA 3RIAF 1H3WM 4XWGL 1U3HA 4BH8B 4F7TA 1MJUH 3MRCA 5DFVC 1S9YB 2E9JA 3T3PF 5CGMA 3C5SA 4M62H 2R4SH 5J13B 3CZFA 5L2KB 4LPYA 4EDWH 1OP5K 5DZLA 2EO1A 5BRZB 4X6DF 2HFEB 5LAXA 5JA9A 2BVOB 4NKMA 3EJYD 5EOTB 3B5HA 1IAIM 1HSBA 2A9NL 4R97C 4YXHH 3EJZD 3LN4B 5D2LE 4ETYA 1NJ9B 4EN3C 2NTSP 5GGVL 5D7JB 2OZ4H 4JZOA 4NKDA 3VGDA 5I8KH 4WNQB 1A0QH 3B5TA 1ZLUH 1F8TL 5EBMA 4OIAA 4M7LT 2WQ8A 2D7MA 1QFPA 4UQ2A 2ZUYA 4P9HC 2FHCA 3ZKND 1SJEB 2X7LA 2XKSA 5I15H 3HNSH 4H20L 4C55A 2AK1L 3NH7H 4D0CB 2WIMA 3U0PA 3H9YA 1LO5B 2VAAA 4XRCB 1B0GB 4G3YH 1ZS8B 2X89A 4U0RB 3D25B 3LDBB 4JGMA 4Z7VB 1U3HC 3WHE0 2P5ED 4RWYL 1YNTB 2X4UB 3MLZH 3A6CH 3CFKB 5CS7A 2MWCA 1U41A 3VRLF 2JIXD 5D7KE 3VGGA 3VXUA 2V2TB 3IKKA 3QNYB 2GEEA 3DUUA 4MJ6A 3UTSD 7CGTA 5FOJA 3MOBL 1PZ5B 3B83A 1DQQB 5JHLH 3W39A 5H8DA 4YHNB 4MA1B 4RFOL 3ULSB 2MCG1 4NNYA 2DMBA 4JJHA 5DT1H 4PG2A 1XGQB 4M03A 3HI5L 4GQ9H 3IDJB 5GRXG 5BS0E 2EE3A 3SDCB 2HLAA 4X4YA 3VG0L 3OKMB 4FFVC 5KN5A 3E6FB 5DS8B 3W81A 4IRSB 5KAQG 5DFWH 5C0AA 1GAFH 3DYPA 4FTVA 4RGMC 5HHQA 1RULL 4ZS6D 2JB5H 3ZE0E 5LG1A 3WEXA 1FORL 4PJIF 1SBSL 1IT9L 3NACL 1XR9A 3LN9A 1T6WA 1WT5A 5T3XD 1YEJH 2D0HA 5E8PA 4NJAH 3ULUL 1OW0C 4JHBA 1AD9B 1ETZB 2OSLA 5I8EB 4B0MM 3CC5B 3MBEA 4DKDC 4JFDD 4X7TB 2AJ3A 4ZFFB 4KUCF 2WUBL 3UAJD 4NO0B 1X7QA 1EEZB 5CEXA 4PP1D 1NLBL 1FNFA 4XNYL 4S1QL 5SWQB 1MVFA 2QQKL 1AR2A 3P9WB 3VXRD 1D5IL 1MFNA 2VLRD 2ARJB 3EO1B 3SJVE 4HMDA 4NQXA 5C6PB 2FB4L 2HP4A 1KULA 3AY4A 3CDGA 4PG2C 3QJFB 3HE6B 5EOQH 4K7PX 3SCMD 5CAYB 3FT4A 1KTDA 1AO7D 5M94B 2IFFH 3LB6D 3ESVF 1YEKL 5D2LF 3QDMB 1PQZB 4L9LC 3WLWC 2AXGA 1FVEA 3GI8L 2ZPKH 3LPFA 2IQAB 3FQUA 4WY7L 1YDPA 2YC1B 1DJSA 5IW3A 5ADPH 4PJ8B 5EBWA 3NA9H 5EU7E 4DWHA 1DVFD 5EORH 1OGAE 1WT5C 2I60H 4LSRH 4XAWL 4R3SA 3SDYH 2R0KH 2K7QA 3DHMA 5GGRY 2KKQA 3SY0B 2RJMA 4HKBB 4CNIB 3UTTB 5IROC 3MBEC 2K1MA 2H32B 3UYPA 4ALAH 4X4ME 1S8DB 3EOAA 3DV4A 3OAUL 2RB8A 2X70A 1JGEB 4W68A 1H3GA 3GMLA 4MDJB 4KY1L 1KENL 2PXYA 5KSBB 1A9BB 4HJ0D 5E6YA 4CW1A 5AZ2H 3IT8D 4HH9A 9CGTA 3KLHD 5DJAA 1HEZB 1UG9A 4ODWA 4PBWD 1Q94B 4YWGL 2AEPL 1INQA 4OSUH 2HTLD 3O2DL 3AY4C 4Y4KC 1DBML 3JWOL 1F6AB 3FQTA 1LEGB 3BP7B 1CFQA 5DHVB 3WNNA 4XPTL 1MOEA 3TPKA 3VD5A 1G1CA 5JQ6L 1DBBH 2H1PL 4NN5C 3MLVL 4PG9A 3T0XA 3C2SA 1CGWA 3KYOB 1P4IH 1MVUB 4GG6A 3LRHA 2IALB 5DJ8B 4D9LL 1N8ZB 5GS0L 4L4VD 1T80A 4OCRL 5EC2A 2EEAA 1IBGL 1Y18B 2GUOB 5KSAD 5ESVA 1EPFA 5GZOC 3F62A 3MPCA 5F1SA 2VRAA 4G42B 1QO3A 2V17L 2CK2A 1G7IA 1OCWH 2X1OA 4PJBA 4U6YA 3V5DA 4DTGL 1J8KA 4QF1A 2C4FT 2PXYC 2IPUK 1ADQH 3HZVB 1T22A 3JWDC 5SWZA 3ZKXC 3H3BC 2ERJC 1YMHB 4ODHH 4XNZB 2F19H 4Z8FH 2GJZB 1J8HA 3HNVL 4PJ5D 4QHKI 1KG0B 1CLOL 4GKNA 2BOBA 2DYPA 3V4VL 2ITCA 4LCIH 4WGVB 4P9HH 3OL2A 3BKMH 3ARGB 2ICWJ 3W2DL 3P73B 2J8OA 1HOCA 1N26A 2KQMA 1MCFA 4M7LL 3G6DH 3RY4A 4PRHB 1FH5L 4JHWL 3NPSB 4MJID 3U48A 3L9RB 1FZOB 1I3UA 3T0ED 1YEIH 3WKNA 1J86A 1M4KA 4TULL 2AGJL 2IC2A 3RZCD 1X5AA 1WC7B 1MI5E 1JGDB 1VKXA 5JIPA 3CCHB 1F3RB 3M17B 2BNRD 3PL6B 4HLZG 2V5MA 4DVRL 1FNSL 1KPUB 4R0LA 1N5YH 1QFWM 1BBDH 5C07E 3FJTA 4YR6A 4XP4H 5J57B 1L0QA 4YHZH 1T3FA 1JNHA 4I3RH 4LKCA 3DO3A 3V0VB 5I74C 3BP5B 3FQRB 4AG4H 5FM5O 1B3JA 2OJZH 4APQC 1K8IB 1N7MH 4X9IA 1MF2L 1TIUA 5CP7A 1EMTH 4HUNB 3TO2A 1CL7L 2YOCA 3N85L 3IDIB 3QRGL 4JPVL 2X1WL 4XTRD 3DXAD 2MCPH 2FHBA 2YPLB 3K8MA 4X7SH 5ENWA 1ZA6B 2P47B 5INCB 3PGFL 4F7CA 3HMXA 4DFIA 4PJAA 2AJZB 3QWOA 4XPAH 4YIQA 3EBAA 5F9JA 4XI5C 3V6OC 4ZXBA 1ZV5A 5FGBA 5C86A 3ULUD 1EJOH 2C4XA 3MRPB 5C0JB 4XNQB 5IFHL 1N64H 4JO2L 2IBBA 4CL7A 5CJXC 1NC4B 1QSEA 1DLFH 2ATKA 4UIKH 4WFGE 1DEDA 3VDAA 3FO9B 3IJYB 6CGTA 5CJQH 5FUCE 4KKAD 3DMMD 1FFNA 4Z0BL 4WI5A 2I5YH 2GI7A 4R0LC 4BK5A 4U0QB 3BSZH 3H8NA 3RNQA 5I1LA 3C8KA 3TCLA 1NANI 1H3XA 2HRPH 1T5WA 3WUWB 2AEIT 4MD4A 2XICA 4PJHE 1M05A 2X4OA 3CXDL 1CFTB 1XGPB 4PTTA 3TZVA 1T89A 1BBJB 1IGIL 3DIFB 5GJSL 1MELA 2Z0BA 3VGFA 5GZNC 2ADGA 1QRNA 4XWGH 5JIHA 2XQBL 2XZAH 2FBOJ 3QI9A 5KANI 2HKFL 3VCLA 1MJ7L 4DQOL 3CSYA 4P2CG 3GRWA 3RX7A 4YBQD 3MA7B 4GKSA 1FFPA 5B39A 3RL2B 2DI8A 2JK5B 5EULV 1L0XA 1V7MH 1OAKL 1CLCA 2VLJD 5E4EC 1ZHLB 3FFCA 4FABH 5GGUA 4ODUB 2F53E 5HGDA 2DBJA 2P43B 5C0CD 4ZXBC 3OHXA 5E8OB 5FGBC 2HT2C 3CXHK 1KCUH 2CDGB 2NY4D 4J8RB 5DHYB 1GSMA 5IVXA 1UM5H 4YGAB 3CLFL 5EZOL 5I18L 1X6NA 5KSVA 1FHGA 3DNKA 5F3BB 1NGYB 1SEQL 3U0WL 2D7QA 1F8TH 3D39A 5J1SC 4R97B 5GGSY 4HXAL 4KJQC 1S7RB 2XZCL 3MGTA 3CNKA 3CAFA 3QYCA 4EN3B 3VXSD 1JHTA 3GMNA 2VH5H 4RAHA 3F7VB 1YEDA 4NRYB 4MGXA 2VE6A 3I9GL 2GJ6E 4FQQB 3T0VA 1AP2B 1IZKA 4D9QE 5I1EL 2HG5B 4OCWL 4QRPE 2J6EA 3JSSA 3PWUA 4S1DD 4M00A 1EO5A 3WNPA 1X4YA 1G7LB 3MV8D 3QI9C 1CXEA 4WENB 3EDJA 4L29A 1JHKL 5AUMA 3VMOA 3O4LE 2LAGB 4CN6A 1FO0L 5D7IA 5HGBB 2Z93A 5F3HA 1T7ZA 8FABB 4IDJH 4HV8A 1A3RH 1D5MB 3MJ9A 3T77A 5HYJD 4HSQA 1U3HB 4JFFA 5INDA 4F7TB 5GS0D 3MRCB 2B5IC 5C7XH 3NCJL 4RBPK 3VXOB 4O5LH 3HI5H 1GOHA 1I8LC 1LNUA 1MHHB 3DI2B 1P5VA 1MCEA 3SGEI 3T3ME 4JM2D 4NKMB 4PRID 1J05B 4Z7WE 5J0BA 3JWDH 4TTDD 1T7WA 3P77A 4CMHC 1HSBB 3RBSA