3MLXH

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISGFHWSWIRQPPGKGLEYIGYIYYSGSTSYNPSLKSRVSMSVDTSRNQFSLELSSVTAADTAVYYCARDFGEYHYDGRGFQCEGFDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
total genus 41
structure length 228
sequence length 228
chains with identical sequence I
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxH01
5D7SH 1U8IB 2OTWA 4BH7A 5FO7A 4NWUH 3RBSA 4QRUA 1ZWIB 1HOCA 1JWSA 4MQ7B 1EEUA 1VGEH 2FR4B 2AP2A 1FG9C 3T4YA 3VFGL 3LRSA 2ZP0T 4B0MM 4FQLL 5IEKB 5EIQA 4KI5F 5I1JH 4FXGB 2HH0L 5D72L 1QSEE 1T20B 2J4WL 5BJTB 4KQ3L 4HJ0D 5CBAA 2YEZB 2YN3A 4JN2B 5IR1B 1JZ7A 1DBKH 3BPOB 4L9DA 1MWAB 4HAFA 5LBSH 3RP1A 2EDWA 2HTLC 2Z35B 2ADGA 2YWYA 1V7NL 3D2UD 1A3QA 3MV7B 2XN9E 4F7PA 4NSKA 3WNPA 1RIVH 1T1XA 3BH8B 3TVMB 1QRND 4GG8B 4QLRA 1JNLL 1QHPA 5E1AA 4KDWA 1HHHB 3HI5H 1ZHBA 5EOQH 4OLZL 2RHEA 3EJZD 3OKOA 4PLKD 3VWJB 1J86A 2ZOKB 3NIGF 3MV9D 5C0IB 3SDAB 5F88A 1QFOA 3KXFB 1GGCL 2H8PB 3EDEA 4MSWA 4OKVA 1ZHLB 2PW2B 1IZJA 3ILQC 5E5RB 4XNXH 3BGMA 4A2MA 2BCKA 3L3KA 3MRHB 1R24A 3QXDA 5FOBA 5DT1L 3U7WL 3QJHB 3MUGB 5A2LH 4BQCA 1FBIH 1HH9A 4OGXL 3ZT5A 3N85H 2ESVE 4J12A 2DLFH 1A1NA 3C6LB 4M7KL 1I9EA 5HD8C 5FO8A 2WK2A 2R2HB 4U6YB 4KZDH 4OZGF 2LU3A 3EDKA 4YPGA 4WTXA 2F74A 1CICD 1D9KD 3MROB 3L7EB 4FMKA 4AEIL 2MCPL 3JVGA 3ARDD 4B50A 2P5ED 4WWKD 4XXDB 3RKDD 2EE2A 5JW4R 3H9SE 4I13B 4MMZC 4CJ0A 5T1LB 3PP3H 4QXUH 5H37H 3U7YH 2FLRT 2R69H 2DYPD 4L3CB 4PRID 1UM4H 1IFHH 3VXSB 1T0PB 1BOGB 1QSEA 2NY6C 6CGTA 5EZIL 4LASH 2F53D 4OZFB 1PSKH 3MREB 2HT4D 1C5BH 1KN4L 1MCEA 2IQ9L 3HC4L 1PZ5A 3DHJA 1F2XK 3CD4A 3V52L 3QDGE 4F7EB 1S7UB 2CO7B 4ZUVB 1IE5A 4GQ9H 5EPMB 1DL7H 2IAND 2XN9A 4MA1B 1OAUH 4JN1L 3NCFB 2VDQL 3L5IA 3ZTJG 5ADPH 3ARQA 1IEBB 3NOIA 5BO1L 3PHQB 4YHML 2N7AA 3I3BA 5DI8A 5FYKH 1LE5B 5EU4B 2YOCA 1AGBA 1QLFB 1UM6H 3BSZL 3F58L 2RQ8A 1ZT4A 4WHTB 4QRPE 5K33A 3HC3L 3CFJB 3FQUB 2CDFA 3KYMA 2KQMA 2VLKD 1VKXA 5GJTH 3R1GH 2MNUA 4H26B 3ZT7A 2ARJB 2HVKB 1IEAB 2UY7A 4ZTPH 2HT2D 1ZVSA 2C3VA 1JUFB 1K5NB 2ESVA 2ZKHH 4G9FE 4IBLT 5HSFA 4AJ0A 4R4BA 4JY5H 3ZE0F 3QIUA 3F5WB 3S36X 4EXPX 3RY4A 4MD4A 1K9TA 2ITDA 3PGFH 5GGVL 3QRFM 1XF2B 2LTQB 3LKPB 3FRUB 2XZCH 1B0WA 1H15A 1TJGH 4PJCE 5DTFB 1U8OA 4LCUB 3MOBH 5ACLA 4F33A 3HE6C 3FT4B 1IAII 3H9SA 4ISVB 1H8SA 4P2OB 5GRUH 3VDBA 4EQ2A 3QIWB 3HZKA 3FQRB 1A9BA 3RPKA 3UCRA 4HWBL 3VFVB 2FX8L 3VG9B 5IB4A 1OAXH 3EZ8A 2LVCA 3W11C 1HDMB 1KIRB 5SWZD 3ROLB 2EXWC 5I16B 4H25B 4FOMA 3QDGA 5K93A 1ZE3C 5ITBH 2HJLA 1BWWA 3NPSB 5IOPA 5JOPD 4CDGC 1IT9L 5MHSE 5EZJA 2VMFA 4WHDA 3PWPB 5JORA 4JQVA 4OCRH 1NDMA 5HHPA 4FQ1H 1TJHL 4BQBA 1AY1H 1AXTL 4Q0XL 4HV8B 4QRPA 3T65B 5CIPA 4TUOB 5FK9A 5JW5B 4RGMB 4L4VD 5MEQA 4EUPA 1G6RA 1OARH 3AB0C 3VXPA 3GSVB 1Q9KB 3VXUB 1W8OA 1G0YR 3ARFC 3MRMA 5E2TL 3UYRH 3QUZB 4G9FA 5GGRA 5D6DC 4WO4A 1RZJC 1XGYH 1P69B 3TO2A 1AQKL 3DARA 4OLXL 2XTJD 1RZGB 3X3FH 1MHPH 3B9KB 5GRVK 3INUH 1T2JA 2AI0H 4Q6IC 3WLBA 1NAMH 4ODTL 2AJUL 1E6JL 5HTSA 4Z76B 3N9GL 3K1DA 4PJCA 3D48R 1CU4L 3PJSA 3ARSA 3M1BA 2ATKA 1GAFL 2V5TA 5IQ9A 1C08B 2R1WB 5EU6E 1B88A 3KYNA 3LEXA 1K85A 3S96A 2ZZUT 2X4OA 5HGGS 1L4IA 4EUPG 1EA9C 3H2WA 3V9FA 5E6ID 3E2HC 1C16A 3CFBA 2CLVA 3UJTH 5EC1B 3I9GL 3MNZA 4EKXA 5A1AA 5I1LA 1LK3L 3DGGB 2YK1L 5FM5O 5AD0A 4I3SH 2GJZB 5IMKA 3SGEI 4NN7B 4NQED 1EHLL 4JFDA 4FXKA 4CNIB 5FDWA 4NC0B 4OFIA 5TF1H 4JREB 3TH2T 1N4XH 4W70A 1TCRB 3N50A 4HSQA 1JIBA 3QEUA 3BPLB 2VZUA 3C09C 2NY0C 1N0XH 4BKLB 4U1KA 1AGFB 4PJAE 4NQDB 4P2RE 4CVZA 4HLZH 2J3SA 5AUMB 1KSRA 4PJXE 2XKUA 4ODWB 2HFEB 4K3JH 1NQBA 1MFNA 1EO5A 1B0GA 4QT5B 1YUHA 2R0ZH 4U1HB 1NH6A 3I2CH 2HTLD 1JYXA 1H3WM 1RU9H 4RRPA 3QXVA 3ES6B 3QJFA 5M7QA 3RPIA 1L6XA 3MSPA 1LEKB 2Z8SA 4PREA 4ONOA 2P5WE 4TUKH 4TTDC 5EBGA 5IVZB 1MJJA 3A67L 2ZNXA 4OFYA 2XNAB 4YQXL 2CKBH 4LSDA 5LJYH 4HIJB 4XMKL 5KVDH 1QFWL 4G8EA 4Z7VE 4OCYL 4BM7A 2OTPA 1BFVH 5GRXG 1P5UA 4POUB 4TSCL 4PBWD 1KJ3L 3GBML 4D3CH 3EOTL 5GHWH 4OZIA 5CCKL 2OK0L 3EYUH 3O9WA 5EO1A 4KHXL 4LDLB 1WCQA 1MCSA 1V5JA 4ZFZB 3CX5K 1XIWA 4WW1B 2ARWA 5E94A 5FA4A 5HD8D 3V0WH 3AM8A 4NQTA 4RRPG 4NO0A 5GRWA 2R0LL 2Z0BA 4O2CA 1I9IH 2J1KA 4TVSa 1MCPL 4LQFL 5DD6B 4P99A 1QLRA 5DEFB 1CLOL 4AQOA 4N5ED 3GHBH 3MLRH 3WHXA 5JXEA 5F7NC 1P4IL 2AXGA 3G5XA 1NUNB 1JGVL 4O58H 2V2TA 4P2RA 4GAGH 4OGYL 3OKKB 4NO3A 1KEGH 1QACA 2NY6D 4P23A 4W4OA 4YO0B 3I02A 2HLAA 4U3CA 2OJEB 4MDIA 4MJ2A 5ISZD 1KCSH 1UVQB 3B4NA 4ZFOB 3UDWA 3BEWA 3KPSB 2YD2A 3G04B 1XGRA 4MDJB 5BQ7A 4GKOA 5C2UB 1ZT1A 2QSQA 4ZUWB 2VLLA 3S88L 2EDNA 2X70B 1GIGH 1MCFA 4M5ZH 5D2NB 4HZLA 5EWIH 1IJ9A 1A7NL 2HWZL 4NFBA 1YMHA 2NPLX 1QSFE 2P5WA 1UXWA 1X4XA 4DGVH 1JV5A 4M8VA 1TQBB 1MAMH 3MMEA 1RY7B 1MPAH 1U91A 1ZHKB 1X7QB 3SE3C 3X11A 1JWMA 3BIAX 4PRHB 3MV8B 3F7VB 4Z7VA 1ZS8B 4DKFL 3HUJE 1JMXA 5I1DA 3MNVA 5BS0E 2FH6A 4NT6B 1BQHB 5F3BB 1CFBA 1YYML 3TC9A 1S9WA 4JPWL 1K6QL 1OAKH 2V5YA 4JO4H 3SKOA 3ULVE 5F93C 1Z9MA 2AJSL 3MPCA 3Q0HA 2MPAL 2JIXD 2J12B 3BO8B 4D0BB 1KCRL 4EI5C 1I85C 5JHLL 2BSRB 4Y5XC 1JPFA 4GXUM 3GMLA 3Q6FB 3U9UA 3BP6B 1UH2A 3QDMB 3DYPA 5IMMA 4OLUH 4P59H 3LB6D 5F9OH 3HZYA 4MA7H 4YDIH 1E4XL 1JNHB 3S8WA 1A5FH 2HJFA 4HUWB 1NL0H 2XZAH 2X4NA 1T7ZA 4AT6A 3ARWA 4ZOAA 1N6VA 4I2XB 5DS8A 2V2XB 2R0WH 3RUGB 2WUBL 3CX2A 2Y5TB 3W11D 3EYQC 4X7SL 1GZQB 2EXWD 5FGBA 2CUMA 3IDMB 3ZKNC 1T0MA 1T6WA 2E5EA 5L8LB 1CT8A 3DV4B 5D7JA 4F7MB 2GT9A 1ZKAA 3T3MF 1T22A 3E0GA 1QA9A 5KSUA 5E6YA 3UTSE 4RX4A 1BGXL 2R2EB 3FQTA 4YHKL 5GGVY 2XFXA 2D0HA 2YBRB 3O2WH 3EDFA 4NQVB 5D93C 5L88H 3HUJA 3Q1SL 3LMJH 3EYSH 3PABA 4NKOB 4I8DA 4XNUL 1KJ2H 4KHTH 3STBA 3TZVD 4Z7UF 2WUCL 4R7NA 1J8HB 1G84A 2XY2A 1KOAA 3ARFD 3IJYA 1A7QL 5C6TH 2YMXL 1ES0B 1MREH 4LFHD 4NNXA 3RDTD 3SDXB 4Y4KA 2ICES 4G9DA 4PIRF 2ZWLT 3KPOB 4XP1H 4NQCB 2X1XR 4LARL 3VU2A 5TFSH 5FKAB 3OR6A 1HQRA 1Q1JH 1U58B 2UWEF 5AG8A 3JBG7 5HGHA 1YN7B 1INQA 3C2AH 4XXCA 1OLZA 3HAEB 1ND0A 3DJ9A 1GRWA 4QHUA 4XT1C 4MJ4A 3P9LA 3U0PB 4QNPE 1RVFH 4NWTH 1KN2H 3NZ8B 1GOGA 4Y5YB 3VFMA 4NRZB 5CEXB 2NY2B 2ORBL 2DAVA 1U8NA 1NC2D 2EIZB 4NN5C 2OI9B 4X4XA 1DEEA 3CIQA 3BHBA 1VFMA 1XCQB 2O61B 4XP9L 3H7BA 1MCKA 4S2SB 4YE4L 5C0JB 3UTSA 5HYJB 3GI8L 1CFSA 3EYFA 5IF0A 1DUYB 1U9KA 4PJ5D 3WJLA 3QO0B 4EI6A 3VXRE 3FO2B 1PX3A 3QUMH 2E9WA 4QHMB 3QUYC 4JM2B 4MB4A 4FZEH 5GS2D 5HVWA 3MLYL 4EOWH 2OZ4L 4JY4A 3VCLA 2UY6A 2JK5B 4WCYH 3B5HA 1KTLA 3MODL 4R4FH 4FTVD 1FZOB 4HGMA 1F3DH 4JZNA 2YD6A 3W5MA 4ORZC 5D7LA 3D3VD 1IAIL 5EC2B 1NCBH 1WUNT 2C1OA 1JTPA 4XVSL 1MNUL 3E3QE 1ETZA 3C8KB 2XT1B 3WSQH 1JNNL 1KTRL 1MUJB 4P4RB 5IBLC 1ZV5A 5F97E 1EEYB 5F7DA 1ED3B 3BKJH 5BRZE 3QEHB 4N0UB 2BRRL 1GJIA 3JWNC 4J3WA 1E4JA 3NAAH 3IDNA 3DXAD 1NCNA 4Y89A 3O4LA 1A7PH 1AHWA 2IPKB 1NLBH 3AM8C 3LQAC 2FO4A 2MQ0A 1K4DA 1LP9B 3HRPA 1G6VK 5EN2B 3BAEL 5DD1H 2QQKH 4MX7A 1YEKH 1G9NC 2H3NB 3G08B 3FT3B 2E7BA 3LKSB 4GOSA 4HJJH 5EA0H 4U1GB 4LLUA 2AK4E 3VXRA 5MI0C 4UB0H 1LEGB 3LN5A 4U49A 3MZTA 1A1OA 3ISWA 3UAJC 1OB1B 2BNQE 1UACL 4M4RA 4CN4A 4P2YA 3W2DL 2B4CC 3F6LA 1Y18A 1WZMA 3Q2CA 4PRPB 2C26A 3OKNA 5F96L 4XMPL 2WBJC 1F8TL 2BJMH 4LP4A 5I18H 3L5WA 2BVOA 4IRSA 3BKCH 2YPVL 1UENA 1S7WA 3O0RL 2FD6H 4D8PA 3U0WL 4OGZA 3O41B 2BNRB 4HDIA 4R96A 3WV0A 5IBTH 4JQIH 3D2UB 4XWOC 1R5IB 5J9PA 5E2VH 4LLQB 4HC1L 4P9HH 1F4YH 1MFAL 2VLJD 4JFOA 4K7FB 1X5JA 4PJEB 5AAWA 3D0LA 3GEWB 4KQ3H 4RGOL 2CH8A 1R3IL 1MFEL 5BRZA 3DI2B 5I1AA 3P77B 1HXMA 1BIIB 1HI6B 3MV9B 4PP1C 4YHZH 3AAZA 3LN4B 4JG1L 5HGAB 3MUY1 3RTQA 3VWKC 4OQTL 3RZCC 4RAUA 5BV7B 4LCWE 1HWHB 2VXTL 3L7FA 3KJ4B 4OF7A 5F1IA 1RK0A 2Y25A 4OCLC 5DRNB 1SEBB 1WGOA 5HHVL 3TNMB 3QG6A 5IB1B 4HMEA 2JLLA 4YK4B 5IT2L 3W9EA 4N8VG 3RNKA 3TM6A 4RMVA 3Q5YA 1LO0L 3FKUS 4Y4HA 3IGAB 2WIIB 1BVKB 3I6KA 2X9YA 3EFFA 4BK5A 4MQXC 4MCZB 1IL1B 4PJHF 4W6XB 1CICB 4JRXE 3GMMA 4MNHB 4P9ML 2AK4A 3KNBA 4WWKB 2A9MH 4NRYB 2B7DT 2BNQA 2DYPB 3ARTA 1TZGH 3AS3A 1IKNC 3P0VL 1PAMA 5I8KH 3LQAL 5J1SC 5HGBB 2F53B 1I1CA 3ZDYF 4H1LB 3EYQD 4WI8A 2D2OA 2YRPA 4IJ3C 1NFKA 1IGTA 1Z3GL 5INCB 1Q9WB 2C5DC 5JMRA 3ZKND 3TO4A 1PD6A 1EXUA 4LEXH 5FB8A 4OF0A 5JDSA 1DE4A 4JFYA 1G9NL 1RJLA 4LSVH 2IANB 1QPPA 5IJKA 3O8XB 4UQ2B 1NCAH 4JZJB 4X4ME 1PEWA 4N0YL 3IFLH 2VUOA 3D9AL 5EZIH 3OAYK 3GSNL 3L6FA 2DN7A 3BYTA 1WCBA 2A6IA 1NEZB 2ZSVA 3MRQA 2B4CL 1CFQA 3V52H 1WT5A 2VLKB 3O3EB 1A2YA 5IQ7H 4LCWA 3RX5A 2BOBB 1JPGB 1E4KA 4DEPB 1W72A 2CRYA 4XCEA 3VMNA 3GSRB 1I75A 5L9DH 1NCDL 4QRSB 5K9QG 3U9PH 2FWOB 2EE6A 4PJ9D 5JA8B 1VSCA 1VACA 5HHQA 5E8DH 3WD5L 1KNOA 4KUZH 3FTGB 4HIHB 1MY7A 3QEQD 4LLWB 3OXSA 5TE7H 4UV4H 3P30H 4JRYE 4WFEE 2WWMC 3VFRB 2GCYB 3GI9H 2KH2B 5JW4Q 4JRXA 5CS7A 5C9JB 4YFLI 4OF5A 2I9TB 3O2VH 2NXZC 1MOEA 4PRAA 2BP3A 4HH9A 4LKCA 1LO3H 4GKSA 3DUUB 4OTXL 1P5VA 1M7DA 2CLZA 2CIIB 1E6OH 5HXMA 2ADFL 1UXSB 5HHNB 4LRNH 3PL6C 1U8QB 3V4VL 4LCYB 3RNQB 1PFCA 2PXYC 1XH3B 3HI6H 1BMGA 1SMOA 4ONHB 4M7LL 4ZO9A 3PHOA 1IGYA 4HXBH 2AEQL 3OQ3B 4WDIA 2IG2L 5DR5L 4C58B 2XG5A 4FFYL 3C5SA 2BERA 1N6QL 4X4MA 1A4JA 3S6CA 2XIDA 1BZ7A 4JKKA 4ERSL 3SKUD 4K71C 4ZDHB 2WP3O 5H94A 5EU7C 3QAZB 3QUYD 4G8IB 4X8JB 4I0PA 4TOYH 1UWEH 2VXUH 3AFLA 4K55A 4U6HA 1UEYA 2BY3A 3T2OA 5F89A 3JV6B 2AS5M 3X3GL 2NZIA 1FFOA 1OGAE 2FYYB 5DD0H 3X13A 1ZSDB 3V6ZB 3ET9F 5BZDB 2O5YH 1KPVB 4OLYH 1KC5L 1FFRA 1TJHH 3HI1A 1II4E 5ACZA 2XTJB 5T1MB 4Q0XH 1FYHB 3N1GC 2EE3A 3AY4C 2PYEE 1JK8B 4G8FA 3WIFA 4JY6A 4JRYA 5SWQA 5C0AE 4YWGH 5IBLD 1W0VA 3BQUD 5IWLC 5E2TH 5DGQA 3ZHKA 25C8L 4Y16A 4YLQT 2X4QB 5FECA 5C1MB 2WP3T 5KBNC 2P8MB 4JFEE 4K9EC 4ALAH 1GVIA 3B3IB 1YC7A 4OLXH 4Z78A 3BZEB 3MRGB 4YNYB 4OD1L 2X4UA 4KK9C 1YEEL 5E6IB 4YEFA 4MZ3A 4ODTH 1AH1A 1T1ZA 3V4UH 1MVFA 3VDCA 2XI9A 4WJ5A 4ZD3H 3BFOA 5HHXH 4GG6B 2PW1A 1NCCL 5K9JL 1OSZA 3IFNH 1EAPA 1UCBH 3CLFH 4HUKB 4P5TD 1KV3A 2EE9A 2VLRE 4NQEB 4M6ML 2K7QA 1X6LA 1KULA 2A83B 1AIFA 3V0VB 1U3HA 4K8RC 2N1KA 2AV1A 4O4YL 5SWSE 3VXMA 2XZQH 1I8KB 4HWNA 4J2XA 4APQA 1U42A 1V3LA 4D9LH 5DMIL 3QUXB 1LK3H 2CK0L 3SPVB 4A6YA 2J6EH 4LF3B 1Q9LB 1FRGL 3QT2A 1OGAA 1OHQA 3HMXH 4NN6B 5F1OB 2WBJD 1NMCC 4O02H 2H26A 1WEJL 1Z2KA 3S37H 1FAIH 2ZCHL 4JO1H 3HTLX 1BD2D 5DYOB 2WZPD 5DMKA 2W0LA 1FCCA 1IAMA 4D0CA 5A43C 1PBYA 2X7LB 3GMQA 2PYEA 2K3TA 2A74A 2EECA 2V2WB 3KPRD 4XWOD 5HDLA 5C0AA 4F8TA 4AL8H 4PD4K 5D6CA 2R2BB 2AJYL 3T0BA 1IGCH 4E0RA 3C5ZD 4GW4B 4JLRB 4Q9QH 2BVEA 2ICWB 1C7TA 2DKMA 3VFWA 1X5KA 2ZOLA 4PP1D 4JFEA 5MENE 4FZ8L 2VABA 4HKBB 5ERWB 2BSSB 3VWKD 4G6KH 1QYGH 1AP2A 1N2RB 3VD7A 3QB7C 5A2KH 1EFXA 1LEIB 4N0FA 4YHPB 4M6OL 4IHOB 4WIQA 1A6ZB 5D7IB 3WFEL 1UEMA 4KJYA 2IQAA 1FVEA 1G0DA 3QI9C 4RDQG 4XMKH 3H3BC 2EC8A 4OCYH 1MCDA 2VLRA 2FSEB 4KFZC 1T2QL 2E6JA 3DWTA 3K7UA 4RZCB 3IKCB 2NW3B 4MQXD 4QGYA 5GXBB 1PG7H 4QTIH 5CCKH 2COQA 1IGIL 2KZ1B 1UM5L 2XICA 3CVHA 5E0QA 5E8EA 3WUWB 2A77L 2EIEA 1A4KA 5SWSA 2W0FB 3VDAA 1RZJH 4U3XA 1CS6A 4PJ7E 3A6OA 5LAXB 1I7ZA 2FECI 4R0LB 4OLWH 1DEDA 2NY6B 3DIFA 1SJXA 2R0LH 4YEEA 1U41A 5C2BH 2FATH 4JJ5A 4PRNA 2Y5EA 4JHWL 4ONFL 5BVJB 4LQFH 5ISZB 4P5MB 2KUTA 1CLOH 1Q9OA 3UO1L 2EIDA 1P4IH 4XZUB 5EZOH 3B5GA 2VOTA 4H20H 3K3QA 3TF7C 1A3LH 5CBEB 5FYLH 2F58L 4YHIB 4GKNB 3SGJA 4CADA 2AV7A 4K8RL 2Q6WA 3STZB 1NGQL 4PTUB 3I75A 1CBVH 1AFVL 5FHAH 5DWUL 2A6DA 3W9DA 4MVBC 4C59B 4HWEH 3BIKB 4GSDL 4WW2C 1CL7H 1TJIH 5MENA 5FEBA 1BQUA 5BW7A 3PQYB 5E8OB 1T7YA 3MRLB 4Z7WB 5KVEL 3VI3F 3OB8A 3QZWA 4MA3B 2IAMC 4KK8D 5HY9B 1S5IH 2A6KB 2AJXL 3BE1L 4U1MB 1TPXC 3GGWA 2ZCKH 2VC2L 5D5MF 4N8CL 3LQZA 1BJMA 2JIXB 2R8SL 1TENA 2ZPKL 5C7XL 4OD3L 4K3EH 3L3IB 3JSSA 3L3JB 3OXRA 2ZG1A 4U1NA 5K9KA 1I3RB 4CAGA 4EZMA 1UZ6F 2WWMD 4ZUSB 3EYOA 1YPZF 3ORJA 3RVUC 2Y06H 2Z8RA 4JPWH 3T2NL 1KJMA 2NXZD 5H2BA 1Q38A 1RURL 3ARRA 2VZOA 5EU3B 2XKNB 1TDQA 4OZHB 4CW1B 5DUML 3ROOB 4NZJA 1OTSC 1DLHB 3O3AB 3TBTB 4NHCH 3PL6D 2VL5B 3DTXA 3QZWG 3QHFH 3WN5C 2PXYD 3MRNA 3DX8A 2G5RA 2EYTB 4S1QL 4I3RL 3UJJH 5JO5B 2E6PA 1KCVL 2DMCA 4KTDH 4YC2B 1R3HA 1ZHNB 5EIIB 2Z92B 3CLEH 5F7EH 4KQ4H 1N6UA 3O45A 2Y36L 3QDJB 2DD8H 2FDBP 2DM2A 1WBYA 2CR6A 2Q76A 4TNWF 5HYIA 3NCMA 4YAQB 4LMQE 2YKLH 4LCCA 1NSNL 4S1SH 3ZTJH 1QR1A 3FOMA 1VENA 1RULH 4TPRH 3ULSB 5I15H 1QPXA 1QBLH 3TZVB 3V0AC 1FO0A 3P0YL 3HS0A 1D5BA 1T5WB 2VWEE 3ARFB 4NQXA 1G7QB 3CFCH 2ZNWA 3PV6A 3CDFA 3J7HA 4E42B 3RDTB 1DN0A 3QPXH 3BUTA 4X4ZA 4TSAL 1N8ZB 3AXLB 3IVKA 2VXSH 4FA8A 2X41A 1HSBA 2I60L 1T21B 3TH3T 4Q6IB 4KI5E 2H6PA 4K3DL 2W65B 4TULH 2KPNA 3FJTA 4U05A 2NYYD 4XPFL 1S7QB 1YECH 2BC4B 2VKXA 5EBLB 5L2KB 2OR9H 5CZVL 5DQJB 2JF1A 5D8JH 2C1PB 1QNZH 4GLRH 1KB5A 3VI4E 3ZKMC 1IAOB 2X4PA 4KK9D 5HYFA 4CMMA 1PG7W 3E2HB 2FX7H 4YDKL 5DJYB 4JPKL 3BRFA 1V7ML 3MLPA 3MFFB 1OAZL 3QDAA 1NC2B 3QP3A 3MNWA 3IDXL 3CJJA 3NA4A 3NIGE 4YFDB 3ZO0A 5BMFL 5FO9B 3MRPA 2PETA 1J0YA 4EN3C 4H5SB 2GJ6E 1KLUB 2FB4H 4RMWA 4RMSA 4WFFE 4K8RD 1JF1B 2BHZA 2IBBA 5T33H 5ID1B 4BUGA 3TN0C 1OSPL 5B22A 1NKRA 4HQQL 2P49B 4X5WB 1NUFA 5DHYA 4GFTB 3R0NA 5CMAB 5IM7A 2QHRL 5F71A 5D1XA 2GFBA 1UJ3A 5AYQA 1U92B 3GSXA 1EO7A 1EJOL 1OPGH 2Q3AA 4UOJA 4FTVB 4P3CH 1J1OL 3WNMA 1ORQB 3NCJL 3LOWA 5FFLA 4HCRL 3D3VB 5KSBF 4N1CA 1HH6B 4CVWA 1CGSH 3CXHK 4GMSL 3A0OA 2W1NA 5IVXF 1N59B 3KJ6H 2B8OT 4HJGB 3G5VB 4RMTA 4X7TB 2ZUYA 2NLJB 3NCYS 3BWAB 2VE6A 4YXLH 4PJ8D 3P4MA 4DFHA 1KTDB 2XXMB 5IIEB 5J12C 5LGKA 4G6AD 3RVXD 1DTUA 3IETA 2X44D 1MNUH 4BFEA 4MLIA 5E8NA 2IGFH 1W0YT 3DXAB 2CUIA 4Y5VB 3V6OC 1OP5K 2HG5A 5CIPH 3C08L 2BSTB 3H3KA 2UUDK 2ERJC 4EUPH 3QI9D 2FGZA 1G6RH 3D18B 5EULV 4F3FB 4OF8A 3WFDH 1NGWA 2OYPA 1CGTA 2C7UB 3MJ8A 4IOSD 4NM8L 5FM4A 1R3KB 4PJBE 1MJ7H 3GZKA 2GJ6A 4F7TA 5DRZA 3QCTH 3S36L 3S34H 5F9DC 3VXOB 1S7XA 4RGNE 2DQDL 2EIBA 3ECBA 4FQXC 4KKBC 2W59A 3TEUA 1FG2B 2ADJB 3V6FA 3ZT6A 1T0NB 5ESAA 4GKZA 1P84J 4OZGA 1J8KA 4DVBA 2VNCA 3NZHH 1ZA3B 4MHHI 4HFWB 4PUBL 3MJ6A 1U3JA 3NGBC 1K8IA 4P2QA 1RJCA 1D5ZA 1FVCA 1JGEA 4I9WD 4P5KB 5KG9B 4U1LB 4YBLC 1MH5A 1BM3L 3ZE2F 3OG6B 1M71A 1YNTB 4BSJA 1KIQA 3CSYB 3BXNA 3O81A 1KCUL 2GSGB 3WS3A 3NIDE 2VLJB 2XKSA 1WJ3A 1PDKA 4CRPA 4PJDB 5K9OA 3QBTB 3I50L 4R3SA 3OL2A 4MVBD 1F8TH 4MXVE 4FQQB 1YMMA 4GRLC 3SDYL 2EYRA 3QWQB 5KSVB 3O3BA 5AZ2L 2I5YH 1CE1L 1MCJA 3C60D 4CN6A 3MLZH 3WNNA 5JQHC 1I1FB 3KPLA 1LO5A 4X99A 1WISA 4NC1C 5EUOB 3RA7H 5MEOA 1I8MA 1MFAH 1YEHL 9CGTA 5IJVB 1RZ8B 2EKSB 1KELH 1F02I 4U1JA 3FO1A 4PJBA 4Y5XB 2P7TB 3OGCB 1UB5B 4JG1H 4U6VL 3GJEB 3SGEH 2DQHH 1FVDB 1DQQB 3P4OA 1I7UB 4XBGB 5LCVH 2X1WL 2VXTH 4L8DA 4MJ5A 5JMOC 3OSKA 2GSIB 3GSWB 3CVIH 4IOIA 5DK0B 5JTWA 1OTSD 3X12A 5F9WB 4DOHB 2JB6A 1JTOA 2I9LB 4FFZL 2CQVA 4DGIL 4MCYB 1RZKC 4D0DA 3UYPA 2OL3L 3QHZL 5I8OL 3PGDB 5LKNA 5DQ9A 1BQLL 4EIZC 5GZOD 3PUCA 1U8HB 3MV7E 3PDDA 2X4TA 5L2JA 1KPRA 5C70A 2C4FT 1F4XH 5C09D 2DL2A 3RWIA 2Q1EA 4U31A 2H32A 5ICXB 5ICYB 3BZFB 2R4SH 2P8PA 5D93B 3TT3H 1S7VA 4NZUH 1U2CA 5GSVB 1H3TA 4QTHB 4XHQA 5KSAA 3QXAA 3CUPA 4Z7NF 3WL9B 4ZTOL 5GGUA 8FABB 3UTTD 3D85A 3CC5A 1F6AB 3BP7A 2B1HL 1RUKL 4XVJL 3IDGB 3NCBB 3FT2B 2I07B 1W0WA 3EOBA 2E6QA 4I18C 4LK4A 1N64H 2EDFA 2WQ8A 4PJ9B 1HHGA 4N9GA 5EO0A 4XNQB 1KLFA 1S3KH 4E41D 3KPPA 4NKMB 3QEQB 2FECL 2B4CH 5F21B 1JZ2A 1EEZA 1OCWH 2UZIL 4CKVX 1SY6H 1KT2B 4MQ7A 1NBVH 2FR4A 5KN5A 3QQNA 3FFCE 4P46C 2NX5B 2ZUTA 5D71L 2C4XA 2OJZH 5B3JF 3VXSE 3OB0K 3ZKMD 3MTRA 1PGRB 4DW2L 3A6CL 5CSZB 3SJVE 5C3TA 3VGBA 2ENSA 2EDXA 1BX2A 4JO2L 3V79C 3SQOL 3NIFE 1VGKA 2YEZA 3L5HA 5C07B 4JN2A 4QKXB 3DVGB 3IFOB 5HHOD 3HKFA 4HUVA 3M07A 1CGUA 1YEJH 2EDEA 4WNQB 4JPVL 3F65A 1Q72L 3MV7A 2DIBA 2YPKA 4MAUL 2VJXA 2Z4QA 4EN3D 3MBEB 3ULUC 3TVMA 3KPMB 2QJDA 1O7SA 3EGSB 1K2DA 3TN0D 4M1CC 2DICA 3LKQB 3VWJA 3KVQA 2ZOKA 3SDAA 5C0RH 5EB9A 4JVWA 1CXEA 5HBBA 3QUYB 3ARED 1ONQB 3B9VA 4TNVK 2HT3C 1IMHC 3RU8H 1CIUA 4R90H 1S7RA 1RMFH 4QCIA 1OAYH 4DN4H 5LQBL 1I9RH 5SX4H 4MD0B 3IJSB 4BYHA 1JFQH 2L0DA 3S35X 4JB9L 4NZRL 3WIIH 3QA3B 1DQDH 5I30L 1O0VA 1QFPA 2R2HA 1IILE 3CFDA 2JJUA 4WFHD 3GIZL 5DDHB 2GHWB 4MGXA 2N56A 3KS0H 3MROA 2BVTA 5DZNA 3W39B 1A47A 3TA3B 4KJWC 2RCSL 2V9RA 3BQUB 3FFCA 4OFPA 5T1LA 5B8CB 4KJPC 1ZEAL 3VXSA 1BOGA 3QIBC 4GO6B 2DQJL 3G6AA 4YXHL 3SJVA 2OSLB 4NOFA 3Q5TA 1NGPL 2ENYA 5GGSB 3LN9A 3O3DA 3MREA 5D96C 3RHWF 35C8L 4RQQB 4JM4H 4LPXA 3GMRB 1FNEB 2IC2A 2Y4SA 1INEH 4HAGA 4F7EA 1HKLH 3LH2H 5IFJB 5EPMA 2ZCLH 4P5TB 5CILL 1T6VN 1TZHB 5KVFL 1FCGA 3WXWH 4RAHA 3PHQA 2YN5A 3WFCL 2N7BA 2NTSP 4IRZH 5A2IH 1J1PL 5EU4A 1LE5A 4NBXB 1QLFA 4PY7B 4M6NH 5MI0B 4FQXD 4PRDB 4KKBD 4CUCA 3E1F1 4BZYA 4U1IB 4AG4L 1G7PA 2X89D 3GSNB 2Z31C 4KK5C 4QGTA 3CXDL 3JWDC 1NCCH 2DTML 4H26A 2ARJA 4JG0L 2HVKA 1IEAA 3VFOB 3MOAH 1Q0YH 4UTAH 1EAJA 4OI9A 3EFDL 1BAFL 1H3PH 4YGAB 1PLGH 1P9MC 4O4YH 4QRQB 5F9JA 3LEYL 2V7NA 4LSTL 3O6FA 2FJGB 2E27L 2DQUH 1CDJA 3LKPA 3TYFB 5IW6B 2XWBB 5DTFA 4HUNB 4NJAL 2X42A 2AW2A 4LCUA 2XPGA 2B2XH 3C5ZB 5EBWB 1WC7B 4ISVA 1XZ0A 2VDMH 1KGCD 1QZ1A 3GO1L 1YJDC 2ZCHH 1XCTB 4NO2A 1P4LA 3QIWA 3QNZB 5IGXH 3B9AA 3HPLB 3VWKB 4JKMA 1FDLH 4ZXBC 1U8KA 3GIVB 1RD6A 2A9NH 4JDZB 1GHFL 1HDMA 3BVNB 1MJUL 1KIRA 5FYKE 4GAFB 5JHDD 4H25A 3TPUA 4ENEC 5A16A 1RIUL 3LIZL 4UOW1 4O9HL 4DZBB 3QUKB 1F45A 3KLAB 1GPOH 4RGNC 4K23L 4YHOL 4MWFB 4TQEL 1M05A 1YZZA 1LDPL 3QCVH 4FP8H 4Z7UE 5GJSH 2B5IB 3RWFB 3VRIA 3VD9A 2HJKA 4YHNB 4M8QB 1OP3H 4IRJC 4C56D 4UBDD 3T65A 3WFEH 4TUOA 4PJCF 5DRWB 4UT9L 2VDKH 5T1KA 5KZCD 4YGVA 3GSVA 1Q9KA 2HP4A 2AJ3B 2VXVH 2PYFB 4JFFB 3M45A 3LZFH 3WIHA 1DBBL 3MGTB 1IM9A 4CBPA 1Q94A 3H0TB 4HIEA 4ETQA 1BPVA 2A77H 1A6TA 4JO3H 4OIIL 5I8EB 3B9KA 1BFOA 4RBPK 3EIFA 2YR3A 2Q8AL 4K9EH 2D7PA 4GXVH 3CFEB 2JELL 3W82A 5I75C 3VXNB 4XPGL 4Z76A 1BZ9A 3ESVF 3W0WD 1C08A 2R1WA 2BVQA 1QQDB 4BSWB 2H9GB 3T04D 2EICA 2PN5A 3GK8L 5I0ZA 1UWXH 2D3VA 3HMWL 4KTEL 3SOBL 1YEFL 2DQCL 2AK1L 3DSNA 4PV8A 1HCFX 3REVA 2OMBA 5JIIA 2YSSB 3D39D 2XN9D 3MACL 1R3JB 5EC1A 4XCCL 2EEBA 4N1HB 3DGGA 1ZXQA 4X7FC 4PV9A 1WLHA 1XF3B 5B38B 2P46B 4Z7UA 1U95B 1TCRA 3QNXB 1T5XB 1YJDL 2E8YA 1ZLVK 3MGOA 5INDA 1JGUH 5JPNB 4P46D 3BPNC 2VC2H 4X5LA 4N8CH 2EZ0D 1MVUB 3M17A 4J3SA 4OJFL 5J6HB 3EO1B 4X6FB 4D9RE 2HFEA 2UWEA 4V2BA 3GRWA 3QRGH 1T04A 3KPSE 2PXYB 5FF6B 5GS1B 4L3AA 4DK6A 5D2NE 3ES6A 5DZLA 4V1DD 1UYWH 1LEKA 5CINL 2NMSA 3B2VL 3ULUD 4LSRH 1WBXA 3QEGL 5JXAH 5DHVB 2FO1A 5IVZA 2SEBB 3PDGA 4ODHL 1L7IH 1R5VB 4K71B 4PRHE 5E99L 3VRLF 2R1YB 1LK2B 1T03H 4PR5A 1FAKT 1DUZB 3MRIB 4N68A 1MLCB 1MQKH 3OBAA 1X4YA 3HRZA 1UKTA 2ZUQC 2HT3D 4WTWA 3C6LC 4PJAF 5DJZA 5F72S 3A6BL 5EH1A 2IMNA 2HTKC 4LVNB 5HGDB 3IRZA 4WW1A 5D9SB 4PJXF 1B9ZA 1MFBL 3MGAA 4LDEB 5IUSA 5FHBH 1FYTE 4G43A 3RVTC 5E5MA 1K3IA 1EFQA 3K2UL 1IZKA 4GMTL 4TVPE 5T3XL 4LSSH 4PB9H 5DD6A 4NKDB 1QKZL 1ACYL 1I8IA 4JHAH 2VB5A 2C3WA 1I1AA 3QDME 4KJWD 3SE9H 4PGDB 4XI5C 4Z0XB 3QH3B 2BY0A 1T89A 2NXYB 2VSDA 4JAMB 3C5JB 2XWTA 1XGQB 3QIBD 2F5AL 4YO0A 1JTTA 5C0GB 1NAMA 3ZKSD 4FQCH 4M62L 4I2XE 4Z7VF 1UVQA 1IQWL 3RUGE 5FUOL 3KPSA 1LO2L 3G04A 2F19L 2VR5A 3MRCB 3FN3A 1FN4A 5HI5D 1IC7L 3G5ZB 3ZSTA 4MA1C 4KMLB 4M43H 2X70A 3MRBA 1VFBA 3BD3A 5D2NA 4YHYC 3N0PB 5FYJL 4X9GA 1NBYB 2E3VA 4O51A 3T08A 4ZYKA 5TDOA 3RRQA 3KGRA 1SM3L 1YN6A 1ZHKA 1X7QA 4MQSB 3I6LD 3ARVA 3WJJC 1IC5H 4Y2DA 4PRHA 3DV6A 1D5XB 3R4DA 1HHKA 2MJWA 3SCMB 1ZS8A 1RJZB 2Z31D 4KK5D 2R0KL 2DWDB 4AMKH 1CD1B 4GRWH 1BQHA 2OX5A 4CL7A 3AROA 5T5FL 1I9JH 1J8HE 4AEHH 4BZ1H 2DQGL 1WIOA 3PWNA 4JFDD 3MRKA 5C08E 1ZMYA 5JZ7D 1D6VL 1FYTA 2X1QA 3SDXE 3IXAB 2LTQC 4LHUD 1OSPH 4NJ9L 4ONGL 3BO8A 4NQCE 4M7JH 4D0BA 3TJEH 4BELD 4M9PA 5CJOL 3UJIL 4XPTH 1MFDL 1J0IA 4L5FH 4F9PC 3TT1L 1I8LC 3D69B 4P2OC 3QDMA 4XPHL 3FFDA 4HKJB 4XCFH 4UNUA 3LV3B 3ZDYE 4M5YL 3S3PA 2QL1A 4PJ8B 2VKWA 1JNHA 3VXQA 1FNAA 2VH5H 1BQHG 3U6RB 3DMMB 3VXTA 2UYLA 4GMSH 4JKPH 5L8KB 3HUJF 3T4AA 4POZC 2H1PL 1GZQA 2ZUXA 3QCUH 3QI9B 1BBDL 1Z6JT 4ENED 4ZPVB 2FIRT 4OFYD 5C71A 4LLDA 4JHBA 5F1KC 1FLRH 1FE8H 4ZAKA 1IKFL 2FL5A 4QXTA 2WINB 2VSCA 1DVFB 3P11H 4YDVB 5HYJE 4RGMC 1ULVA 4X80H 1SBBA 3O9WD 1JPTL 2I26N 3ULVL 2YBRA 3TESA 3KYOB 1R0AL 5JW3L 2M26A 3RFZC 1XIWD 2EEAA 2XACC 3BZ4B 2X5PA 3QUZC 5EORL 4F57H 1J8HA 4P4KB 1ES0A 3FMGL 5C08A 4IS6A 1AJ7L 2DQEL 3SDXA 3MLTB 4AQ1B 1MCOL 3T09A 4NQCA 3TBVB 3NVQA 3TIDB 5FKAA 2Q8BL 4NUJB 4XAKE 3R8BB 5T3XD 5MP6H 2EDBA 3ZYJA 1S7TA 1YN7A 1UKQA 1NFDF 3GB7B 4P23D 3HAEA 3UYOD 5JW4N 5IB5B 5KANG 2CSPA 3DETC 4WW2B 4N0UE 1KUMA 3FQWB 3BEVA 3F12B 3U0PA 4CVXB 3FB8B 2BVPB 4YH6A 5AZEL 3C60B 3NZ8A 3P4NB 4GBXA 4OT1L 4XC1L 4Y5YA 2VERN 1U6AL 5GGRY 4S1RH 1ADQL 5CEXA 3NN8B 2W9LA 4X8XA 4PGCB 5CAYB 2BY1A 4FNLH 4PJFF 1TPXB 2EIZA 3UZQA 1HN1A 2P8LA 1A9EB 4NN7C 3FB6B 4HT1L 1VPOH 1TQCB 3S3SA 2R1XA 3MYJA 1CVSC 2QQNL 2O61A 5FYJD 1REIA 3IFPB 4LQ1A 5HYJA 3HA0A 4GXUN 3NBNA 5DUPL 1KF9B 1DBMH 3HAEG 1EMTH 1XF5A 1C5DB 3FO2A 5DD3H 3ARYA 1F6LL 3DX7B 1TETL 1U3YA 4JM2A 4OFVA 1D5IL 2DM7A 4QHLA 3VFSB 1O7VA 1VB9A 3L3DB 4BQ6A 4PJIB 4Y2OA 2NNAA 4NGHH 2RAMA 1FZOA 5I19H 1BJ1H 4QNPF 1C5CL 1RZ7H 4Y7MA 4ODSL 4GS7C 3MLWH 5CJXC 4O2FB 1OQXA 4BSVB 4ZUTA 2XQBL 5DJDB 4DAGL 3QQ4B 2BOCB 2AJZA 3S98A 5D1QC 5E8PA 1ZLSL 4OM0L 12E8L 4KPHH 1OP5H 2VDPH 1GGUA 5C09B 2X6MA 3GMPB 1CLZH 1QRNE 3KXFD 5TE4L 4X6BB 1H3VA 1P7QB 4G42B 3QEHA 2HRPL 1KIPB 3MV9E 4HFUH 3OF6A 3CVHH 1JF5A 1QLEL 5SV4A 3V5DA 5I9QC 4LLYB 1LQSR 3UTTB 4I48A 2IPKA 2HTKD 2HVJB 2CDEB 4GW5B 4KAQH 5D7JD 4POYA 5I1HL 3RGVA 4ZSOB 3T77B 5J89A 3KYAA 3RVTD 3L1OL 4RX4D 1BF8A 1H3UA 2HFTA 2G9HB 5I1KH 4NO5B 3FHQA 3KPNB 3K81A 2DQFB 5HPOA 3DNKA 1MCRA 4E41B 1KJ2A 4R6UA 5EOCL 5EBMB 3LKNB 5DEGA 4WV1B 3TIEA 2H3NA 3FT3A 3RL2B 2A1WH 4PTTA 5LXGL 3CU7A 1BP3B 2P5EE 4UV7L 1EUTA 5ALBH 1OB1A 1DQMH 3ULVD 2Z91A 5SV3A 4X6CB 4PRIE 1JF6A 1TLKA 2J2ZA 2X4RB 5T5NG 2JJSA 1TVHB 2ITCA 1FL6B 2F53E 1ZTXL 1RI8A 2VAAB 4AIZB 1N5AB 2UZIH 1OP9A 5IFAH 2V6HA 2ZSWB 3KDMB 3FHAA 5E2UH 3DRTB 3EO0B 4B7IA 1EX0A 1JWUB 2RFXB 2Y1VA 4HUXB 3D2UA 1EZVY 4HBQA 4OV5A 2IANE 1R5IA 1AGEB 3ARPA 4LLQA 4DQOH 1NKOA 4K7FA 1QRNA 2QQQA 2NY5C 4PG9B 1FZJA 4HXAH 3TN0B 1FZMB 3MA7A 3SQOH 4BK4A 1EVUA 1BIIA 1HI6A 3MV9A 5CUSL 5DK3A 3OKMB 1MFCL 4LGRB 1IGML 3LN4A 3RI5K 3AREB 4MJ6B 4H0IA 2VLKE 3L3GB 1FJ1B 2M8XA 3QWOB 1Q72H 2YD4A 4G7YL 2BRQA 4DCQA 5DD5H 1YDPB 3WNLA 3MCG1 5I66B 5IB1A 2AJVH 1QO3B 1T3FB 1W2KT 4MNGE 4LIQE 2BK8A 1X5GA 4M3KB 4TRPH 3QUMA 4QF1A 2I24N 3CMOH 1BVKA 4NNYA 2FJFB 3TYGL 3IDIB 2EDDA 4MCZA 3FZUD 1H5BB 4P2OD 1IL1A 5L7XL 5TE6L 1CICA 1D9KA 1RZKH 3CZJA 4UT6L 4MNHA 4Z95H 3ARDA 3WEXA 2P5EA 3LS4H 4WWKA 1G1CA 3GHEL 1F90L 2V5MA 4XVUC 5I0DA 4PG2C 1QBML 4GUPA 5DJ6B 4LCIL 3O6MH 5J12B 1NJ9A 4PRIA 5D7LD 1WFUA 4U1SA 1GGIL 4C57C 4LBEB 2LAAA 4JANB 4HBCL 2F53A 3RJQB 2CRMA 1PYWB 4IEFB 1UQSB 4JFPA 4POZD 4QRTB 3KLHC 1UA6L 5FCUL 4NP4H 5DSCA 5SWZE 3IU4H 3PWPD 1WICA 2OL3B 1FO0H 1JRHI 5DLMH 3DX6A 4L8SB 2VIRB 3FL7A 5JOPE 2FGWH 4UQ2A 3UROR 5DXWA 1J0ZA 4YXHH 3VI3E 5I76B 3F7YB 4HK0B 1DQJB 1W72L 4OM1L 1A14L 3O4LD 2AABL 1PKQB 4RIRA 4FQXB 4U6TA 4HS3B 3VXUD 3ARXA 2XA8H 3BI9X 4QRRD 4L4VE 2VLKA 3CZFB 3O6LL 3O3EA 3CPLB 3QUZD 4GRWF 4OCWL 2YD3A 5ID0A 2DWEB 5C0CD 4XCYB 2QSCL 5C0NC 1JZ6A 4KKNA 3ARBC 3FCTB 3GSRA 5C6PB 5HYQB 4F80A 3N1MC 2EH7H 5F8QC 1KB5H 2D0FA 3OR7B 4L4TB 4MNGA 4QEGA 1NCWH 2FWOA 4BH7B 1SVCP 4QRUB 3AGVA 2XTJE 3BWUC 1X5AA 2WNGA 3OB0H 4LLWA 3TWCL 3VGDA 5L6YH 4F9LA 2IH3B 2NY5L 4YBHA 3T4YB 2DTMH 3K4AA 2QQLH 2GCYA 4J4PC 3Q3GA 1DDHA 2I9TA 5GRJL 4FQJH 3DETD 3LEVL 5CBAB 1IM3B 3DUUA 4LU5H 4ZOCA 1EO8L 2NY2C 4IRSD 2J8OA 2NR6C 3OHXB 2EKJA 3VMPA 1DZBA 1UXSA 5HHNA 3ULUH 2OI9C 4AENA 1F4WL 2ADGB 3RNQA 4NKIH 1JZ8A 3LSOA 5SWZA 4F7PB 1WFTA 5JHDB 5I1GL 2EDOA 5I8CA 1X5ZA 4JGJA 5E1AB 4G3YL 4MXQC 5E7FA 1HYSD 4FN0A 4NQEE 3SO5A 3K2MC 5F88B 4NQDD 3T3PF 4LSQL 1CFTA 1AE6L 2D7MA 4MSWB 4OKVB 3S5LA 3BGMB 2WSKA 4ZDHA 4C56B 5D5MA 1GHFH 5TQ2H 2I25N 3BJ91 3QXDB 1KFAH 5FOBB 1MJUH 2HKFH 2WLYA 4G8IA 1CGXA 4L4VA 4WHYG 5IHUL 5KZCB 3VE0A 2W9DL 4TQEH 2FYYA 5IROC 1YPZA 1LDPH 1ZSDA 3QYCA 5BZDA 1RZFL 5IMOA 1S78C 3TGXA 2NY7H 1OGTA 4YPGB 2F74B 2YUZA 1WF5A 5T1MA 4PB0L 3UBXA 1VFAB 3D0VA 5D1QD 1UB6B 3B5TA 1JK8A 4EBQH 3RBGA 1E4WL 2BNQD 3UTQA 1SHMA 4Y4FC 5TF0A 5EFIB 4OD2B 4IMLB 1QSEB 3W0WB 2VUYA 4Q6YA 1AKJD 1MIEH 1OW0C 5IHZA 4XP5L 4PY8J 3BZEA 4B41A 3UPRA 3MRGA 4YNYA 1PZ5B 3SE8H 5IKCB 1CZ8H 4KK6C 1HIML 2XN9B 3D39B 5D7IE 5CGMA 2AGJH 3WHE1 3UBXG 5DI8B 3JWDH 4FQHA 2DBJA 3GK8H 1AGBB 4ODVL 1J5OH 1ZT4B 1WZ1L 5I1IH 2O5XH 3V0VA 4A6YL 3MCKA 2CDFB 3KYMB 3TNNA 1VKXB 2AXFA 4PRBA 1L0XA 1TZIB 1UKSA 1I8KA 2BNUB 5GGTL 1MIMH 1CIDA 1ZVSB 2C3VB 4LF3A 5IVXE 4R4BB 3H42L 3HNTH 5JQ6L 5ISZE 4MD4B 2XV6B 2CMRL 5FDYA 3WXVL 1G7HB 2YC1A 1H15B 5TQ0H 5C8JA 4F33B 3ARGC 3EBAA 2W9EL 1CF8L 3H9SB 2V2WA 3MV8D 2JJTC 3MLUH 4GAJH 4UI2A 3EJZC 4G6JL 3OPZL 1FSKC 3HZKB 4JLRA 4OKDA 1A9BB 1MEXH 1DCLA 2ICWA 4OCXL 1CWVA 4PLOB 2BSSA 3HPJA 3QULB 3KJ4C 1GGBH 1I3GH 3MXVH 4B7LA 2HMIC 4YK4C 5IESL 1N2RA 1DLFH 2ZJSL 1V3KA 3QDGB 4Z7WE 1U8PA 2HJLB 4IHOA 1WAAE 1FIGL 5FAAA 3T0XA 3MLXL 5D7IA 4HWBA 5EZJB 2XRAH 3MJ7A 2FNBA 4P2CG 4D9QD 2EH8L 5HHPB 1CICC 5E56A 5ICZA 3TBWA 1D5MA 2NW3A 3TV3H 3RKDC 3IS1X 1FNFA 2LV4A 4I0PD 4IDJH 5EO9B 5FK9B 5J57B 3WUWA 3MRFA 3U48A 5DUBA 5HHMD 3A6BH 2W0FA 3VXPB 4GW1A 4XVUD 1XR8A 2GTWB 3S4SA 1F3JB 1Y6MR 5KSBA 4RBPH 2PTVA 5LAXA 1KEML 1CLYL 2BMKB 4G9FB 5GGRB 1IVLA 4XMLL 4WO4B 5IVXA 1G7IA 4K2UH 5BVJA 4P5MA 3PGCA 3BGFC 5D96B 5DMYA 1Q0XH 3PJSB 3O8XC 4KVNH 4JZJC 3MJGX 1A6UL 3MO1B 3STZA 1A02N 3S96B 3WUWG 4AIXA 4NUGL 4F2MB 4GT7A 4Z0BL 2LU4A 3NACH 1RSFA 3RWJA 3S4SG 5KTEL 1C16B 1JPSL 3CFBB 2CLVB 3FO0L 2HT2C 2Z31B 4K7PH 5JUEL 3H7LA 4WGWB 1FZKB 3MNZB 6FABL 4WEBL 5E8OA 3MRLA 5I1LB 5IVNA 4PJ7F 5C0ND 1BEYH 1Z9OA 4MA3A 1WAAA 3ARBD 4H8WL 5AD0B 5IMKB 3PHSA 4KRMB 4JFDB 4FXKB 5FDWB 1ZLVH 1N5YL 4XBEH 4NQUA 1U3HD 1VA9A 1YNLL 2JIXA 2VDRH 4LHUB 3OJVC 5TGBB 4XX1G 3I84A 4LEOA 4XPAH 3RJDA 3L3IA 3VXMD 2VN7A 3L3JA 3RAJH 2YD1A 1FGNH 4U1KB 2ATPB 4HD9A 3OAUL 1KPUA 1MWAH 4NCC2 1XGPA 3CDYA 4J4PD 5KOVC 4K94L 3SY0B 4CVZB 3HMXA 4QYOB 3HE6A 4HX1A 3CK0L 3GDBA 5ITFA 2DQTH 4HIIA 4MD5B 1YUHB 4G7VL 1KG0A 2NY2D 3GSQB 2NR6D 2E7MA 2BDNH 3ROOA 1YEGL 4LNRA 3Q6GL 1DLHA 2DRUA 2P42B 3TBTA 1QFWI 1CDHA 1HNFA 1FGVL 5AAMA 5F7UA 3G6JF 3RPIB 4EDWH 4UQ3B 5J1TC 3ZL4H 3RVVC 5JO5A 1WBZA 4XP4H 5TPWH 4WTZA 4MXQD 3LKOA 3L5JA 2Q7NA 4G8EB 4LLAA 1VESA 1C1EL 3BKYH 3EHBD 4OZIB 3DYOA 4R2GC 2IPTH 2IWGA 1YEDA 4YAQA 3O9WB 4PJ5E 4WU5A 5EO1B 1EFXD 3GBNL 5IFHH 4PP2A 4OB5L 4HWZA 1J0JA 1NBZA 5J1AB 1XIWB 3THML 3ULSA 3HNVL 3BH9A 5DFWH 5FA4B 1O5DT 1ZLWH 1JI2A 4LLMA 3GJFB 2IEPA 4FTVE 3ARFA 4O2CB 1FORL 5LGJA 3QFJD 2XTJC 2F5BL 1QLRB 4GRMA 2R56L 5D6DA 5D70L 5F3HA 1GOFA 3D3VE 3WHXB 4M7ZB 5E7BA 4J8RA 4CMHB 1N8ZA 3AXLA 4JDTH 4WTZG 1JHTB 3JUYA 2AXGB 5B39A 3G5XB 5GIRB 4OZFH 2AKRB 5JW3H 4Q6IA 5B3JE 5GS0H 3SGKC 3CH1A 4HF5L 4P2RB 4XWGH 4NBYB 3KR3L 1A6WH 4Y4FD 4M61B 4NO3B 4P23B 1S7QA 1GXEA 4EVNB 3LQMA 4MDIB 2ICEA 1JPST 3BEWB 5E6IC 2VZVA 1XGRB 1OM3L 1JRHL 5BQ7B 5IMLA 3VG0L 1IAOA 1ZT1B 3ULUF 1LO4L 2VLLB 3DXAE 15C8L 5DJYA 4Z8FL 4HZLB 4XPBH 5ADOH 1SEQH 4KK6D 1NC2A 1JGLH 4LFHG 4XNYL 5CZKA 1UXWB 1WWWX 2CDGA 2C4FU 3MMEB 4DVRH 1U91B 4R4NC 4FABL 3CXHJ 3OKDA 5B39G 3X11B 2DMBA 3BOVA 4TNVF 5HYEA 3ZKXC 1IGFL 4HPOL 4H5SA 5ANME 4ZG1A 1HZHH 3S35L 4KY1L 2EDLA 1X5HA 1JF1A 4XC1H 4IMKC 4MA8L 1YQ2A 3MNVB 2GY7B 4MYWB 1INDH 4RFOH 3MA9H 5ID1A 5JOFA 2F54D 3QUXC 4PJ5A 1S9WB 4X5WA 3BPNB 4M1GH 4PRPD 5DJAA 5CMAA 4PJGF 1OF2B 4NN6C 3SKOB 2VDLL 4NQSA 1U92A 4G8GD 1M7IB 1E4XI 3R06B 4FTVA 3MLSL 5D2LB 2BNRD 3ZYIA 5DJXB 1ORQA 3VI4F 2V17H 3GMLB 5KOMC 4UILL 4YHLL 3M8OH 1MRDH 4HH8A 3U30B 5MEPA 5CKGA 4JQXC 3ARGD 1B4JL 1TETH 4M02A 4WFGD 3HFMH 1N59A 4M1DH 5EG6C 3PWJA 4HJGA 4W68A 4MJID 3RIAK 2VLJE 4ZFGH 2X4NB 2VAJA 4AT6B 1U8LB 4PJDE 1A0QH 5C0DB 1C5CH 1MJ8L 5HDOA 5TDNB 4BFGA 1RUQL 1CFNA 2HMID 1XF4B 4URTB 4WUKH 2ZUQB 3DXAA 4Y5VA 4M9OA 5E1HB 1T0MB 3U36B 1YY8A 3RQ3A 12E8H 1H9VA 1CT8B 2CGRH 2J5LB 5D7JB 5EU5A 2GT9B 4PBXA 1T22B 5ALCH 3D18A 3PP4L 1JL8A 1UG9A 4GH7B 5KSUB 4N5EC 3FQTB 2DLTA 3WIHH 2XFXB 5ANMA 3UC0L 5DC4B 1CDUA 2GQHA 5GRYA 3VXOA 2EC9T 2VR9A 5B4MC 1MCWW 4KKLC 4R0LC 3SBWC 1A6AB 5I1HH 3UPCA 4XBPA 3MJ9H 3OKEA 3IKKA 1FG2A 5E4EC 4GAYA 1WQVT 4BZ2H 2XYCA 4Y4KB 3EKCA 4G9DB 4DOHE 2QTEA 1CFVL 2Y72A 3WNKA 4CU6A 5CJQL 1MF2H 3L95A 3ALPA 3O6KL 3OR6B 4P48A 2GAZA 5HDQH 4X7DC 2R4RL 4P5KA 5HGHB 3O8XD 1XF1A 1IQDA 1WFOA 1NC4A 4YHYB 2F9BT 1R3LB 1ND0B 1QUNA 4UIMA 1Y0LA 2GSGA 3P9LB 1QVOA 2VLJA 3SE3A 4PGZA 4PJBF 4QXGL 1QRKA 1QFUL 4P57B 1G7MA 4WY7H 3BDYL 1RPQA 2EYSA 2MSPA 5KW9L 1KIUA 2FJHB 5KJRL 3BHBB 4X7EC 3SDCC 1RV6X 4NPYA 1QR4A 3SO3B 1DBAL 1SBSL 1NMAL 5DRXA 4YUEL 4XGZB 4QHNA 5CEZL 1VADB 1RZ8A 2C3XA 1RUAL 2EKSA 4I77L 4S10A 1FFNA 3KLDA 1CFSB 5KVGL 3EYFB 3FO9B 5E2JA 2HAZA 4EI5A 1I85A 4J6RL 3GRWH 4JPIA 4Y5XA 4EI6B 3J8F7 3QEQE 3BPCA 5F7LB 3WDJA 3LB6C 1FVDA 1DQQA 2DI7A 1K4CB 1I7UA 4XBGA 3NFPB 1FC1A 4G7YH 5LGHH 4JY4B 1J1XH 3VCLB 1HHJA 1P53A 4AM0B 3GSWA 3E8UH 2R23B 2DJSA 3NIDF 4UU9A 5DK0A 3OJ2C 4UTBL 5D7LB 5DQDL 2D7QA 4MXVF 3HG1D 2I9LA 4TN9A 2OZ4A 1IARB 3MLVL 3S37X 2DDQH 5JIHA 5HJ3B 5DJ2B 4YC2C 4JRWA 4R7DA 3GSUB 4OFDA 3PGDA 3KYKH 1PQZA 1ZANL 4LSPH 3RVVD 1FFPB 5TH2A 1F6FB 4G6FB 2RIKA 1CK0H 2FHBA 4LCIH 5F7DB 2XWJB 1HSAA 4OGAD 5CD3A 5IP4A 2ILLA 2FHFA 4NM4L 2B1AH 4R2GD 4RISH 2HKHL 3LAFA 1T7VA 3IDNB 4Q2ZB 5ICXA 2OP4H 1JP5A 2G60L 3O4LB 3NH7L 2WWKO 1FPTL 3TZVC 1AHWB 4EDXB 2NY4C 4OSUL 2L7UA 2FO4B 4QTHA 2D31A 4QRRB 1K4DB 4J3TA 4ODXA 3SKJL 1AXSB 8FABA 1CXLA 3RDTC 1IBGH 1UZ8B 2MHAA 4M93B 5C0CB 1DBJL 1KYOK 1N3NA 3U1SH 3DOSA 1T83C 4MX7B 5AWNH 2EO1A 4KKAC 3BT2L 1GGYA 5HI3C 1L7TH 4Y19D 2CUHA 1JHLH 4KVCL 4LLUB 4NKMA 3ZTNH 3VXRB 1PG7X 3QEQA 3U0TB 2FZ3B 5A2JH 1A1OB 2M2DA 4BH8B 4YR6A 3DBXA 1KT2A 2YS4A 5FXCH 1HINL 1CYGA 1YNKL 1AI1L 4FRWA 4OIAA 1Y18B 4FQIL 4DN3L 4Q9RL 4OLVH 1D6EB 1RUPL 2J8UB 1P4BL 2R29L 1YYLL 3LHPH 4UDTB 1G9ML 2BVOB 4IRSB 4P2QD 3UPAA 1S7WB 4G5ZL 3TWCH 4HZAA 4HDIB 4S11A 4RMUA 3I85A 3DVGA 3IFOA 1NAKL 3VRLE 4JFOB 4R4ND 5J6GA 4FFWC 1MCWM 3D0LB 4WNQA 1MCNA 1Y6NR 2Q3ZA 3OZ9H 2GK0B 5BRZB 1YMMD 2H41A 43C9A 1HXMB 2XTLA 2O5ZL 4TVPH 1RIHH 3OJMB 1FL3A 5JPMA 4YX2H 4UIKH 3QUXD 4HC1A 1S9XB 3CFKB 3LKQA 1TVBA 5DO2D 3T1FA 1B3JA 3QUYA 1X9QA 5F1IB 3QG6B 4ZNCD 4UINL 3W9EB 2F8OA 3FN0H 2MQ3A 4OQTA 4MD0A 3I6KB 3EFFB 1NGZA 4GS7B 2APXA 3JWOC 1MRCL 5E9DD 1BD2E 3QA3A 3QG7L 5CEZD 5E2WH 1EHNA 1AGDA 2RJMA 3NIFF 5DDHA 3VRJB 1DSFH 5D1QB 5DFVC 5EU6A 3NFNA 5HVGB 2DQIL 3KPRE 2BNQB 1IC4L 1JZ3A 3W39A 3F7RA 4KMTH 4PPTA 1YEIL 1AKJB 4LHQB 1B0RB 1M6OA 1DQLH 3BMWA 4Y5VC 3PXHA 1U8JA 2NY1B 5FOJA 2PUQT 1IGTB 4LP5A 1KENH 2APTA 5I9QB 1EXUB 2NCMA 4ZOBA 5FB8B 1JHKH 4JR9H 5GGSA 1DE4B 4JFYB 1RJLB 4RQQA 1SVZA 3GMRA 4K07A 4DTGL 4HS8L 4U2YA 4N9OB 2AQ2A 3B6SA 2HN7A 4RFEB 2NY3B 5IFJA 4XC3L 4XP5H 3L6FB 4UAOC 2A6IB 4PJAA 2VDOL 5IHBA 1CFQB 2V5SA 5D7SL 5B4MD 1NGXA 4KKLD 1WWAX 4NWUL 4PJXA 1LNUA 4O2EB 4LCWB 4PRDA 3T0EC 1VGEL 1W72B 1BHGA 4JZOA 3HAEH 2IBZX 3LY6A 5I1JL 1FNSH 1VACB 3F7PC 1KNOB 1WZ1H 2WBJA 3D87B 4C83B 5GGQL 1SY6A 3ZHDA 1BD2A 4QRQA 3RVWD 2B0SL 3OKLA 1DBKL 3QWRD 1UWGH 5LBSL 4ELKA 4M4PA 4W6YB 2FJGA 2KQNA 4L8CA 2J88H 4PRAB 3RHWK 3TYFA 4LKCB 3KPRA 5IW6A 2XWBA 3EJYC 5I1CH 5LG1A 1M7DB 2CLZB 5JQ6H 2ED9A 1WC7A 1KJVB 1J05B 3NCYP 2CMRH 3HI5L 1LILA 5EOQL 2MFNA 3PQYD 3DO7B 1MCIA 3JV4B 4QOKD 1RUMH 5D4QA 3HPLA 3VWKA 4H88H 3RZCA 4F58H 2D4DA 1Z0MA 3PG2A 4WU7A 3SDCD 3PHOB 4XNXL 4JDZA 1GZPB 3BKMH 3JWOL 1H8NA 3DVIA 3MRJA 1DQTA 4TSBH 4FXLA 4PYGA 3N85L 1A4JB 4R97C 2DLFL 3QUKA 5FUZH 3KLAA 4MWFA 5FV2A 5H94B 3FQNA 5BZWA 4WI6A 4KZDL 4I0PB 3T8XA 5E95B 1L0YA 4U6HB 5E08H 2AEWA 3PNWB 5F89B 5HHMB 3MLXH 3SDDD 5F9WC 2Z9TA 3KWWA 1BFSA 3HLAB 4QXUL 5DRWA 3U7YL 2OBGA 2R69L 1IKNA 3HI1B 1GC1H 1IFHL 5ACZB 3I6GB 2HLFC 3DUSB 3KHOA 1ITCA 1NFDE 4LASL 3H0TA 3WIFB 5AYUH 1QSFA 1PSKL 2CJUH 2JB5H 2J8UF 4LRIC 1C5BL 2CXGA 3CNKA 4Z5RA 3QISA 3QDJD 4X5XB 1W0VB 1XGTB 4IIQC 1EGJH 5BCAA 4WUUD 3CDGA 4GQ9L 5D7KD 1DL7L 2E9JA 3LD8B 4LAQH 1U3ZA 4P49A 1OL0A 5HDBE 5ADPL 2APFA 3VD5A 4PJFE 5BS0A 4U0QB 1QQDA 4BSWA 5FYKL 1YY9C 3ARZA 4PLJC 5EU7E 2NY4D 4MAYC 4WJ5B 5ELIA 5ESQA 3V4PH 2IADB 3ZKQD 3L5XH 1RJYA 3PDOB 3VFUA 4KDVA 5GJTL 2PW1B 1NEUA 3R1GL 5J7CC 1EAPB 3VGHA 2X2YA 4PJ9C 2YSSA 3ARBB 4ZTPL 5JNYA 2ID5A 4KKAD 1R3JA 5HI3D 4U7SA 1AIFB 4PLNC 1U3HB 4Z0BH 2ZKHL 1WWCA 4TTGA 2AV1B 4JY5L 1XF3A 2X4SB 3VXMB 5L2KD 4MQTB 4APQB 3V95A 1FH5H 1U95A 1NANI 1AO7D 2XZCL 1TJGL 4L9LC 4M48H 2FCBA 4A6YB 2FBJL 3MOBL 1RHHA 1MVUA 1V3MA 1UC6A 4XP6H 1FLTX 5GRUL 4JFZH 5J6HA 4NZTH 3EO1A 5DMKB 1X5IA 4NZDA 4RWYH 3PL6A 2OXGA 2IBGA 4D0CB 5C0BD 1P2CA 5F7MC 5FYJU 1NFDA 3EO9H 3O6FD 3GMQB 3TJHC 2PXYA 1H0DB 1IGJA 1OAXL 2A74B 3L3OA 4QY8A 1AR1C 1ITBB 2VZ1A 2AEIT 3MBEC 1CR9H 3HE7C 5CP3H 5BV7H 4TUJB 2A6JB 4FFWD 2CIKA 4MNQD 1TTUA 1M7XA 4FQ2H 3UTPD 1HKFA 3VFWB 2ZOLB 2CLRB 1A21A 2SEBA 2VABB 3NFSL 1SMAA 1QP1A 2PR4L 4PJFA 4OCRL 1R5VA 4FQ1L 1BIHA 3HZMA 1EFXB 3QXWA 3MRIA 3IJHA 1AY1L 5J13B 4KJYB 2IQAB 2IH1B 3GMOA 3DUHA 1R5WB 4PS4L 3IF1A 1BECA 3D25B 1OARL 5DJ8A 5ENWA 3QFJB 4OLEA 5D9SA 3RWDA 3UYRL 3SGDH 2X40A 2BFVH 3SKMB 1XGYL 5E8EB 2W60A 1A4KB 1GL4B 4H1LH 2DM3A 3TA3C 1GYAA 3AY4A 4NKDA 5DFVD 3X3FL 3E6FA 1MHPL 3BQUC 3INUL 5B8CC 2J7LA 1NAML 3JV0A 4HKZA 4Y4FB 3U4BL 1I7ZB 5T1KD 4PGDA 5JR1H 5IWLA 4JJ5B 4PRNB 3QH3A 1PY4A 32C2B 5ESVA 5CJ5A 1A7RH 1Q9OB 1IM9D 1NCTA 2YWZA 1XGQA 4QHKI 5MERA 2X10A 5KS9B 5C0GA 3WE6B 7FABH 4Q97A 1VEPA 4LL9A 2D9CA 4CADB 2Q6WB 4P5TC 3G5ZA 3S3JA 3HNSH 3FOLB 4J1UB 4ZO6A 3UJTL 1T1YA 3I75B 4WVRA 3RI5F 1NBYA 3WFBL 1F58L 2A6DB 3W9DB 2WIMA 4I3SL 4LIQH 1PW3A 4JVPA 1T1WB 2EDTA 3O2DH 3NA9L 3H3PH 5TF1L 1N4XL 2F54B 4U2ZA 3U46A 3T0ED 1A6VH 1EZVX 1N0XL 3QZWB 2DWDA 1CD1A 1MLBA 5CD5D 4G8GB 2P24A 4N8VA 4K3JL 5ILTL 4B53A 4KDTC 5CLTA 5K9KB 3VFGH 4WHYH 3IXAA 2R0ZL 4KXZH 4OZ4A 4FQLH 4F15B 5DURB 4I9WE 3RUGF 5JLZA 2HH0H 5D72H 2J4WH 3I2CL 3ARGB 2IJ0C 1RU9L 3C5ZC 1UCTA 3EJYD 1H3GA 2D0GA 4MJIB 3MV01 4TUKL 3PIQA 4HKJA 3U2SB 1FSKB 1EH9A 5DC0A 3GKWL 1CVRA 2XQYG 3MRDB 2CKBL 3IS0X 1PZUB 1V7NH 5KVDL 1BFVL 3HZVB 5L0QB 3UTZA 4D3CL 1JNLH 4Y8DC 5GHWL 1NUGA 4OCNC 3WKNA 4OLZH 3EYUL 3QI9A 5F6IC 2QV2A 3O45B 1GGCH 2B5IC 2Q76B 3V0WL 2BVYA 1F00I 3AVEA 4X4YB 4OUOA 5EIVA 4LCCB 4GRWE 5DT1H 3U7WH 1I9IL 3SDXF 4OGXH 1QR1B 3FOMB 3GHBL 1WV7T 3MLRL 4M7KH 2F8XC 4ELMB 2OTUA 3KYOA 2BHUA 4WENB 3HS0B 4NQXB 3PV6B 4GAGL 4PJIE 1DN0B 1OT1A 1JZ5A 1KEGL 3D1MC 3LPFA 4YZFF 4AEIH 2MCPH 2HLFD 3S9DB 3BGFB 1HSBB 4OUUB 1KCSL 2H6PB 1EHXA 1HHIA 3MLTA 5J8OA 4DZ8B 3O4OC 2JCCB 1I1AD 4X6DB 5IK3A 1NLDL 3TBVA 3TIDA 2ARJQ 1GIGL 4M5ZL 3RWCA 5EWIL 1KXTB 1S9VB 5C09E 1KN4H 4DGVL 4KRPD 1CFVH 2IQ9H 3BD4A 3HC4H 1CN4A 1MAML 4I4WA 1MPAL 2E7CA 2X4PB 3O6KH 4CMMB 4WW2A 1Z5LB 3FQWA 2PTUA 1SJHA 3F12A 1YY9D 3FB8A 4PLJD 2BVPA 2E7HA 4LVEA 2EXYC 4I1NB 4MAYD 4JN1H 4KK8C 2VDQH 5BOPA 1P7KB 2C3GA 3MNWB 5BO1H 4YHMH 2VO5A 3NN8A 3UTTE 3T3PE 2IAMA 4JM2F 3BSZH 3F58H 4MZ2A 4NCDA 3FB6A 3HC3H 4ZSOE 4JO4L 1MAKA 2Y7QA 4X9FA 4H0GA 1GGTA 2Y23A 4E41E 4JGMA 2VQUA 2KBGA 1RFDL 1KLGA 1LVEA 1A7OL 4N5UA 5DHYB 2NX5D 1F4HA 5D1XB 3ILPB 4JKLA 3GSXB 4OLUL 3DX7A 1XGUA 1QTYT 4HIXL 4MA7L 3ME0A 4YDIL 5GGVH 3VD3A 3T0AA 1L9NA 3L3DA 4X6CE 1A5FL 5C07D 5GS1C 1NL0L 2XZAL 3RIFK 1AC6A 3HG1B 1E27B 4RWHA 3TJHD 3NABL 3WN5A 2R0WL 1AR1D 4BSVA 4O2FA 1WZKA 5I2IB 3MBED 3HE7D 5T5NF 1SYSB 5HHOE 1NGYA 4FFVC 1DANU 2VE6B 3QQ4A 2BOCA 4HHAA 4HWBH 2FX8H 3P4MB 3IDUA 1LP9F 5C09A 3ESUF 3GMNA 1F5WA 4G42A 4R2GB 4Q9BA 4LPVA 5E8NB 4JJHA 1P6FA 4KGJA 3IU3A 3ALWA 1LE9A 1IT9H 3O2WL 5IW1A 4LVNC 5L88L 3LMJL 1OTTC 4PGBA 3EYSL 1OP3K 3UTTA 1KJ2L 4KHTL 3JUZA 3KPTA 2HVJA 4ZAKD 5J4MA 1AXTH 3GM8A 5CGYC 4LPCA 4ZSOA 4F7TB 2VRAA 1Z9LA 3P9MA 3L3HB 3EOAA 5DRZB 5C6TL 1MREL 2DIAA 3GSOA 1S7XB 4Y19B 2G9HA 2NYYC 2DQFA 4XP1L 4S0SD 3TA3D 4WFHE 5EBMA 2GUOA 5TFSL 3G5YB 4ZFFA 1JN6A 2NXYC 1Q1JL 4XNZC 3RL2A 4KU1A 5IVOA 4GKZB 1AQKH 4OZGB 3C2AL 1OY3B 4DVBB 1A8JH 1BQSA 3U7AA 4JCMA 43CAA 1J0HA 1H3XA 1S9YA 4PJEF 4X6CA 1K8IB 1E6JH 2AJUH 3N9GH 4P2QB 1CU4H 1RVFL 1FVCB 1JGEB 4NWTL 3BP4A 1GAFH 1TVHA 1KN2L 3V6OE 2G75B 4G80B 1M71B 3FONA 1UWXK 1KIQB 2VAAA 3BXNB 5CJ8A 1JMZA 5HI4C 4OBSA 4UZGA 5HHOA 2ZSWA 4QWWC 3BDXA 4Q9RH 1CG9B 2PO6C 5C0EA 5K9OB 4HUXA 5DJCB 3ZKXB 4EN3A 5I6XC 1YMMB 2EYRB 3SCMC 2XQYK 4AEEA 3I9GH 3TN0A 3KPLB 2YK1H 3RL1A 5FV1L 1P84K 3RWEA 3X14A 4X99B 4P9HC 3U79A 4X6EA 3ETBF 4JFXA 1EHLH 4NKQB 1S7SA 3AREA 1I8MB 5EUKB 3L3GA 5BXFB 4FZEL 4L8BB 4EOWL 3BP5A 4U1JB 3BN3B 4WCYL 4M7LT 3FO1B 4R4FL 5I66A 1M4KA 1C12B 1QO3A 1T3FA 3VH8B 3NCEB 5HVFB 5E9DB 4JVUA 4U3HA 5A3IC 1NCBL 4MJ5B 3DX9B 2FJFA 1ORSB 4OIBA 3IDIA 4HGWB 5FCSH 4PJ8C 4IOIB 3WSQL 4G6AC 3RVXC 3DMMC 2JCCF 5ETUA 5DJ6A 4UDUB 1KGCE 3BKJL 4YJZL 1P7HL 1I1YA 1DFBL 3A67H 3V6OA 3NAAL 3F8UB 4NC1E 4YQXH 2ADIA 1BVLB 1A7PL 1QFWH 1NLBL 1NCUA 4KZEL 4TSCH 5JHDE 4MB3A 1KJ3H 3GBMH 2OL3A 3EOTH 1DVFC 2H32B 4M00A 5CEYA 1OWRM 4ORGB 1ZA6A 2OK0H 5DD1L 3KPQB 4KHXH 3B2UC 2UV3A 1S7VB 3ZYOA 1WIUA 3F7YA 5KSAB 4EEEA 1YEKL 3CUPB 2FLBT 1DQJA 5FGCB 2Y6SD 5GGUB 4C56E 3O11A 4HJJL 1SJEB 5EA0L 4FQXA 5J3HC 3RGHA 3WS6C 5DEZA 2VXQL 4P4KC 1MCPH 4UB0L 5E4EB 4JFFD 2IALB 3MYZA 1W0WB 3CZFA 4E5XA 4XH2A 4DFIA 4U6XB 1HHGB 4N9GB 5EO0B 3V7MA 2FX9L 1JGVH 5A2FA 1UH3A 2DLEA 1EEZB 2BJML 3K1KC 4KGLA 5I18L 4OGYH 1UGNA 3BKCL 1OVZA 2FD6L 1EVTC 5KN5B 4LVHB 2EDKA 2IH3A 5HYSA 1FL5B 3RY6C 1X3DA 5IBTL 4JQIL 2DB8A 1XEDA 5E2VL 2X9WA 1CDIA 3G6JE 4P9HL 1F4YL 3W0WE 3S88H 3C60C 1G7LB 5GGQH 3FB5A 1A7NH 4O5LL 2HWZH 1I7TB 1IM3A 4GRLA 1BX2B 3RWGA 2PNDA 1LMKA 5LWYL 1VGKB 2EXYD 1K8DB 3MCLL 2B0SH 4JE4B 4QOKB 3OHXA 4YHZL 2QR0A 5D1ZC 1TTFA 2GI7A 4HUVB 3SDCB 4Y8AA 1TQCC 2W0PA 4RFNB 2N4IA 5IV2B 4Z18A 2YPKB 3D39E 2Z4QB 5GS2H 4L3ED 4DKFH 5JHDA 4NOBA 2FEDD 1YYMH 1K2DB 2AXHA 3IDJA 5HYSG 1K6QH 4XAWL 4YXKL 3H9YA 1CE6A 4PJ7A 2JE8A 2HFFA 2AJSH 2EO9A 2MPAH 4RA3A 1TCMA 3GFUA 4C56A 3JWOH 2MQCA 1S7RB 1MCQA 4QCIB 1KCRH 3BIBX 3SDDB 2EEDA 2V9TA 4I0KA 5JHLH 1OOAA 1T4KA 5CSGA 2A9ML 1ZGLB 1TZGL 4ZUUA 2R2CA 1J88A 5GZOC 3CFDB 5I8KL 1I4FB 3BUYB 1E4XH 5DJ0A 3B83A 3HR6A 3VJ6B 4ZS6C 4OCMC 4FFVD 2ZUWA 4HMDA 1VFAA 3WLWC 4WRLA 4LEXL 1UB6A 5EZLA 4V1DE 3MFGB 3FFCB 1E28A 2WUBH 4GLRI 1CI5A 1TITA 4ACPA 2ZUUA 3ULUE 4WUUB 4GG6F 4LSVL 4X7SH 3G6JA 5EFIA 4OD2A 3SE4C 4IMLA 1NCAL 4HULB 3W0WA 2VDNL 3G6AB 2WQRA 1HILB 3IFLL 3SJVB 1EIBA 4EJ1C 3O3DB 5IEHA 2NY4B 3STLA 1OTTD 4HS6A 1MHCB 4Z7OE 1BGXH 5J11C 5IKCA 4MS8C 4YHKH 5IQ7L 1JGDA 3MXWL 5CGYD 3D39A 5E4IA 4I18A 1U8MA 1RZIB 3Q1SH 5L9DL 4WV1C 4XNUH 3U9PL 4PJGE 2WUCH 3HCVA 3LKRB 5E8DL 2APWA 4KUZL 2GITA 1A7QH 2YMXH 1G7PB 2VISA 2NXYD 5CP7B 5TE7L 4UV4L 4UUJA 3P30L 1AO7B 1TZIA 3GI9L 2DMKA 2BNUA 4P46A 4DKEL 3O2VL 5F7YC 4LARH 1BOYA 4DJMA 3DO3A 1YA5A 1LO3L 3DECA 5C6WH 1NBQA 1E6OL 2JKXA 5F9JB 1NDGB 3C2SA 3EDDA 3JV5A 3WDHA 3RIAF 5C0BB 2V7NB 4LRNL 2OLDA 3O6FB 5GSRB 1G7HA 5HI4D 4QWWD 2FBJH 3HI6L 1F3DJ 5KAQF 2XPGB 1MHEB 2PO6D 4V1DA 4U0RC 5D7IF 4HXBL 4MNQB 3UX9B 1XZ0B 5I17A 2ORBH 3SCMD 4NO2B 3C87A 1P4LB 3I6LE 4AH2B 1FV1A 4BUHA 3AREC 2LABA 1HXYA 1U8KB 4X83A 4XP9H 5T1DL 2YUWA 3QULA 4YE4H 1S8DA 4TOYL 1AQDA 1UWEL 2FIKB 2VXUL 3TPUB 3T1WA 5A16B 3GI8H 5FM5M 1KCKA 3VGGA 2Q20A 3G6DL 1M05B 5DD0L 4JFDE 3NFSH 2EDJA 3VRIB 2PR4H 1PY9A 2O5YL 2HJKB 4OLYL 1CGYA 3MLYH 1H5BC 2OZ4H 4GQPH 5A3ID 1WSST 3VFPA 4PJGA 3MODH 1BWMA 1BLNA 1TFHA 3WDIA 5EO9A 5I74C 1QFHA 2CKNA 1MHHA 4PS4H 1IAIH 2CD0A 5T1KB 4N90E 4YGVB 4YWGL 2G2RA 1XR9A 2GTWA 3DMMD 4XVSH 3T2PA 1F3JA 2AAVA 2KZWA 1IM9B 2BMKA 1Q94B 4HIEB 3QIBA 4ETQB 1JNNH 1A6TB 4ALAL 1BFOB 3VGAB 2Z8VC 3W81A 1BBJA 4L8SC 2BRRH 3U4BH 4Q58C 3V4UL 1BZ9B 1JYWA 4XB7A 4Z7WF 1HEZB 1DVFD 1MI5D 2CRIA 4ZD3L 3U4AA 1WAAF 4CGTA 5HHXL 1NFIA 2BVQB 3AMLA 3DVFA 1V05A 3IFNL 2GW5A 3MO1A 3B2UD 1UCBL 4UAOB 3CLFL 2X1OA 4I5BA 3VFNA 4QHKJ 3TBYA 1AD0A 3OG4B 4F2MA 4OZIE 5L8JB 3BAEH 3REWA 3V5KB 3JTSA 5J3HD 3TCLB 3T0EB 4PV8B 3REVB 1AD9A 4P4KD 2XZQL 2Z31A 5CKAA 4D9LL 1FZKA 4XRCB 4ODBD 1S5HA 1CXIA 3WFBH 1F58H 1FIEA 2J6EL 4PV9B 4OZHF 3TBSA 2FH8A 3MV11 4KMQA 3HMXL 3NA9H 4Z7UB 2AQ3A 4O02L 3S37L 1P9MA 1UACH 4LHUA 1FAIL 4JO1L 5TGBA 2EC9U 3W2DH 3G9AB 3MGOB 5INDB 2ATPA 5F96H 3TCXA 3VGFA 5T3XE 3EW3B 3R8QA 4XMPH 3M17B 3SY0A 1ZGLM 1URLA 1MCCA 4QYOA 4AL8L 2YPVH 3O0RH 4Y1AD 3U0WH 2UWEB 5ILTH 1JNJA 1IGCL 4MD5A 1FQ9C 4Q9QL 1T04B 1MCHA 3GSQA 4OAWA 5DK2A 5TJWK 4HC1H 5DVLA 3MX0A 1PVHA 5D1ZD 4ZXBA 1BREA 1MAJA 4RGOH 4G6KL 5JDJA 1QYGL 1R3IH 1MFEH 4P3DA 4OI7A 1A1MA 3V5HB 4O00A 4F37F 2DF3A 4UQ3A 5DVNA 1WBXB 4LHUG 3GKWH 5ABDE 5EOTB 5FUCE 4R97B 1QFWM 2UZXB 4OQTH 3AS0A 5DVMA 3DSFL 4NRXA 5FYJE 4PR5B 5HHVH 4UBDC 1TMCB 1HCVA 5IT2H 2G5BA 3ILQD 3MUZ1 4NHUB 1PG7L 3HRZB 4QTIL 3VFTA 4IRJA 4MHHG 4X98B 3OKYA 1LO0H 5DJZB 3D5OF 1RZJL 5J1AA 5H8DA 2E8ZA 5DC9B 5T3ZL 4YBQC 4G43B 5E5MB 5GRVL 3HR5A 4OBRA 4ZNEE 2D7TL 3GJFA 4P9MH 4OLWL 1CXHA 5C2BL 2FATL 5D2LE 3JVGC 1I8IB 4LVOC 3OJDB 4ZS6D 1JHTA 1I1AB 3P0VH 5EZOL 5GIRA 3WLWD 2AKRA 1F3RB 4H20L 4IIQB 1A3LL 1P7QD 3LQAH 4LKXB 5FYLL 3RWHB 5K59E 2MMXA 4ZODA 4M61A 2XWTB 2DIJA 1Z3GH 4KRPB 3KXFE 3SN6N 4EVNA 1N0LA 1NAMB 4MMXC 3QXUA 5TDPB 5FHAL 1CBVL 4HUMB 3CH8A 1G9NH 4HWEL 1FN4B 1CL7L 1TJIL 4MAYB 4OV6F 3ZDZE 1NLDH 3N1QC 4N0YH 3D9AH 3MRBB 1VFBB 4MS8D 4ODUA 3GSNH 3TH4T 1AGCA 1G1YA 4ZYKB 4O51B 4XCNB 4J3OC 1S5IL 4CJ1A 5TDOB 4D94A 2ZCKL 1YN6B 5JW4M 1U8IA 3CSPA 5IBUB 4Y2DB 5CJBA 1ZWIA 2ICWJ 3DV6B