1WA0X

Crystal structure of w138h mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPHHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X02
2ZWNA 1BXUA 4YL4A 2XYBA 5B1AB 1AG6A 1M56B 2IH8A 2EIKB 1MZYA 3MX0B 4KNUA 2XWZA 3QJUB 4DPBX 1EHKB 2VM3A 3T9WA 5I28A 1W6LA 1PF3A 1ZPUA 2IDFA 1V55B 1J9TA 2PPFA 5I26A 1A8ZA 5IY5B 1AZRA 4DPAX 2W88A 1SF3A 2YXWA 4JKNA 4A2EA 3UACA 4A68A 2AVFA 1PLAA 2YAFA 3ASOB 2HX7A 1AQ8A 1AG0A 4DPCX 1AANA 1GYCA 1KDIA 3OM3B 4GP4B 5TK4A 3NJNA 3QPKA 4HALA 1KV7A 3EH5B 1SFHA 3NT0A 2VSMB 3PAZA 1SJMA 2HRGA 2FT8A 1WA2X 4GY4A 4Q8BA 3TBBA 1PZAA 2IDTA 3PPSA 2RACA 5I6NA 4HCIA 2BZ7A 3X1FA 4A2HA 1JVOA 3WKPA 2HZHA 2BP0B 3T6XA 5AFAA 1ASQA 5FC9A 1SDDA 8PAZA 3TU6A 2CJ3A 2R7EA 1CYXA 1JOIA 2B08A 1NZRA 3FU8A 1OE3A 2WO2B 5D4HA 3NJGA 1OCCB 2YAOA 2PP7A 2J5WA 1BAWA 2YXVA 3AW5A 2P80D 4W1TA 3OMIB 4PCYA 1E30A 2FQDA 1NPJA 3NSCA 4P5RA 5B3SB 3X1EA 2J55A 1NINA 4CSPA 5TK2A 4EF3A 2WSDA 2JFCA 1IBZA 4MFHA 1JXFA 2WO3B 1A3ZA 2EINB 1PAZA 3GDCA 1BQKA 4JHVA 1WS7A 2CCWA 3CVCA 2FQEA 3L45A 3BVDB 1A4BA 2BZCA 3HEIB 4KNTA 2XXFA 2UXGA 1TKWA 5PAZA 4AZUA 1PZBA 1JVLA 2I7OA 3FSAA 5B7MA 1FFTB 2FJSA 3TASA 2XV0A 4K9JA 2DYRB 2IDUA 4HCFA 1R1CA 1GSKA 2DWTA 2IWKA 2QPDB 4M3HA 1X9RA 3MBWB 3NP3A 1AACA 3IN0A 3OMAB 2EIMB 3JT2A 5B7FA 4AKOA 2BP0A 1L9TA 3CVDA 3FPXA 3ASNB 1OCZB 3G5WA 2ZONA 2XXGA 3V9EA 3JTBA 3S3CB 1AIZA 1ZIBA 1CYWA 4AI7A 1KGYE 1PLCA 2IDSA 1CC3A 2EIJB 1MG3C 4RH4A 3IN2A 1IUZA 2OV0A 4YSRA 2PP9A 3FT0A 1RKRA 2YARA 1SHWA 5B1KA 5I5IA 1KYAA 4YSQA 1BYOA 1AS7A 4GP8B 4HAKA 2XVBA 3X2QB 2OCCB 2ZXWB 1YLBB 2DY2A 3FQ1A 1DZ0A 2HX8A 4E9QA 3OMNB 3CVBA 3N55A 3TA4D 4A67A 1BXVA 4YSTA 2JXMA 5A7EA 1KBVA 4YSCA 2XV2A 1JERA 1N70A 3RYMA 2IH9A 4Q89A 4CSZA 3NSFA 1WA0X 3FS9A 2BW5A 4DP0X 7PCYA 1ET5A 1W8EA 1FA4A 2PPCA 5B1JC 4DP9X 1NIBA 1MZZA 1TEFA 1PMYA 1XMEB 3UAAA 1ZIAA 1WA1X 2BWDA 3QJRB 3PCYA 1WS8A 2GC4C 1CUOA 3T71A 1GR7A 3AG2B 4G72B 1A4CA 1F56A 1PLBA 3H4HA 1JZIA 2GBAA 4DP2X 1QHQA 1OOWA 1JXDA 4YSEA 2P80A 3GYRA 1AZBA 1A65A 2H3XC 2IDQA 1J9SA 2IWFA 3FQYA 5I6OA 1J9QA 2PCYA 4HHGA 2IAAC 3ABKB 2FNWA 3D12B 4BDVB 1NIDA 2I85A 2X87A 2FWLB 4UAHA 3U25A 1GS7A 1EZLA 3NSYA 2YAMA 2ZOOA 4YSOA 4E9SA 3X1NA 3IE9A 3PLYA 3NJFA 5B1BB 4G7QB 1DYZA 1WAEA 4DP8X 1KCBA 3QJVB 2UXVA 4DP1X 1BYPA 1OE2A 1IC0A 1ZDQA 1URIA 2HRHA 2HX9A 2Q9OA 2XLLA 2GB2A 2GIMA 3AZUA 4E9TA 2VW4A 1XB6A 3FPYA 3S3DB 5B7EA 4KO7A 4WTQA 5PCYA 2FQGA 4UF7C 1AAJA 1AZUA 3FQ2A 1NDTA 3DTUB 3PXLA 4ENZA 4NAJA 1M57B 1NWPA 1XB3A 4AKQA 1SF5A 4KO9A 3SQRA 4DP6X 1HFUA 1SNRA 3ZX1A 1SFDA 1NIAA 2XUWA 3ABLB 3NJKA 3C75A 4YSUA 3NYKA 5I6LA 2FTAA 1OCRB 2GI0A 3SBRA 5E9NA 1B3IA 3FU7B 4AX3A 3AG1B 3QQXA 1AS6A 2AZAA 2A3TA 1L9PA 1T5KA 1X9UA 1AR1B 2DWSA 2FQFA 1GS8A 2BO0A 2H47C 5D4IA 2LLNA 1L9OA 1E5YA 3X1BA 2PCFA 1PNCA 1ILSA 1KCWA 2UXFA 1NPNA 3PAVA 1GW0A 4X4KA 4BDVA 1PY0A 4HZ1A 3SBPA 3AG4B 3T6WA 1L9QA 5F7AA 1JZFA 1AZNA 1KDJA 1TU2A 2E86A 4L0PB 4QKTA 3WNJA 1MG2C 1PCSA 3HB3B 4KNSA 4WKXA 1FWXA 1J9RA 1KBWA 1CURA 1RCYA 2FT6A 2UX6A 4E9RA 3FYEB 3KW8A 3WG7B 1N68A 3WNIA 2YAHA 1BEXA 2FT7A 2VM4A 4YVUA 3T6VA 2BHFA 2PP8A 4E9WA 4GP5B 1HAWA 1PNDA 1SHXA 1GY1A 1SDDB 3EHBB 4G7RB 4NB7A 4BWUA 1E65A 2QDWA 2GSMB 2OJ1A 3T6ZA 2CALA 4A2FA 3UGEA 3S3BB 2PPEA 3WKQA 5F7BA 1OV8A 2VMJA 3ZBMA 4DP7X 3ABMB 4A2DA 2YAQA 2I7SA 1IBYA 3NSDA 3FU7A 4KOCA 1OCOB 1ADWA 1AOZA 1ZDSA 2H5UA 2Y1AA 2YAPA 3V9CA 2HLEB 3AY2A 1J5CA 2B3IA 2IWEA 3ZIYA 2PPAA 5D4JA 4KOBA 4YSAA 4P5SA 2Q5BA 2UXTA 3NJMA 4E9YA 2YQBA 1ETJA 1NIEA 1OF0A 1AZCA 6PCYA 4UANA 4W9ZA 3TBCA 2XU9A 1XB8A 3EH3B 1NIFA 5AZUA 3N2JA 4HIPA 6PAZA 3FSWA 5LDUA 3IBOA 3H4FA 5ANHA 2BP8B 5I5MA 3ERXA 2PPDA 4GXFA 2X88A 5AKRA 2DYSB 2J56A 2QPEB 4E9VA 2CBPA 3NJIA 2YAEA 1VLXA 1E67A 1ILUA 7PAZA 2UX7A 1QNIA 2GHZA 3QJSB 3FYIB 3X1GA 3OQRA 3CG8A 4A66A 4N4YB 1L9SA 3DIVA 3H56A 3CDZB 4PAZA 4BWWA 3NJLA 1NICA 3FSVA 4YSSA 3AG3B 3S8FB 1JXGA 1PZCA 4YSPA 3OD3A 5I5JA 4BXSV 3QJQB 1ET8A 2NRDA 3FSZA 3WIAA 4F2FA 3FU9A 3S8GB 5I6KA 1NTDA 1RZQA 3PAUA 1MDAA 2VW7A 2AANA 2PLTA 2QDVA 1W6WA 1J5DA 2VN3A 3WI9A 3SBQA 5I6MA 1ZV2A 1ASOA 5I6PA 3KW7A 1GS6X 2CUAA 2XV3A 3UABA 1ID2A 3CZUB 4HCGA 3EF4A 9PCYA 3UAEA 3ZDWA 1V10A 3DKHA 1JZGA 4G7SB 1A4AA 1JZJA 1IKOP 2W8CA 4KO6A 1BXAA 4ZK8A 2JKWA 1HAUA 4G71B 2QT6A 2MRYA 1L9RA 2BWIA 4QLWA 4NERA 1ET7A 4BK5C 4A2GA 4DP5X 3QJTB 1AS8A 4DP4X 3NJHA 4YVNA 2BP8A 2BW4A 2TSAA 4M4RB 1I53A 1M9WA 2N0MA 1JZHA 2AZUA 2CAKA 2VSKB 4F2EA 4KO5A 1GY2A 3GXUB 4BXVA 4F7KA 2AFNA 4YSDA 4G70B 4HHWA 4GYBA 2HXAA 1BQ5A 5EHFA 1ASPA 2TSBA 1JZEA 5B1JA 4FAAB 3CDZA 2VW6A 3UADA 2J57A 2XX1A 3NP4A 2XX0A 3NJJA 1V54B 1TEGA 4N8UA 1NWOA 3BQVA 2DV6A 4E9XA 4FA7B 1QLEB 3EH4B 4AKPA 1RZPA 4BWTA 2EILB 1BQRA 4TXVB 4JHUA 3IEAA 1OE1A 1E5ZA 2R7EB 3ABGA 1UATA 2MTAA 2Y69B 2GC7C
chains in the Genus database with same CATH superfamily
1FNSH 1QSEA 4W6XB 3V79C 4H0GA 4NDMB 2M2DA 4AYGA 3O2VH 3ZR6A 2JSFA 1MQKL 3Q5TA 2K4AA 4ODSL 1QI5A 5SWSA 4NKMA 3ROOA 1NUDA 2Y6SD 3MCKB 4X5QA 5IBTL 3X17A 2YPLA 4QRBA 1PLGH 3GSWB 1MRCL 1IFHL 2Z35B 3DPBB 3DURA 3EYVB 1DR9A 3BX7C 3KPMA 4HSQA 3OAYK 5CMAA 1EA9C 1W0VA 4HS3A 4BYHA 4XCEA 1QABA 2CO2A 4H20L 4LLAA 4ZUVB 4B60A 1I8MA 3MJ7B 1M6OB 1M05A 2X4TB 2W88A 3NEEA 3BHBB 1NC2A 2YPKA 4R5VA 5AVTB 3QCUL 4FZ8H 3GHPA 2A1WH 4HA1A 3QDJE 3WENA 4BFBD 1U3HC 3KLHD 1A4KA 4MB1A 4DGYH 1TPXB 2WUCH 3A6CL 4Z78A 4FQQB 1QSFB 3QQDA 4KC3B 4M1DH 3KM2A 3BEWA 4AYEC 1ZT7B 3O9WB 5AALA 3CDCA 1QRND 4M6OH 2FT8A 2DYPA 3WIHL 4E2OA 2IVFC 3KBPA 3UP6A 4PTTB 2CE6A 2Y06L 1JDAA 5HHOE 5TE7L 5CEZH 3R4DA 4Y2LA 1FL5A 1I1AB 1K9TA 3OB0K 1K8DB 4N0FA 3MRJA 1P84J 1O9ZA 4WWKB 3F7VA 5F9AC 4I48A 1GGCL 5IVZB 3CDFA 3OKMB 2YBRB 1O6TA 2ARJA 3JV5A 3IU3A 2OK0L 5HXMA 4YXLH 4FNQA 3TBSB 3L5WB 4QRRD 4RFEA 3DTDA 1CFVL 4UCFA 2V5YA 2EUWA 1FPTL 4G9DA 1RJYB 2FQDA 1CGXA 1MF2L 3BPNC 2OZNA 4PY8J 4NJAL 2XWTB 4L29A 1BJMA 2H0EA 1A7RL 1K5NA 4PLJD 3RFZA 3K6NA 3DUHA 4JG5A 3RWCB 3RILA 4K5LA 2X3CA 5FHBL 3QWNA 1R3HA 1MHPL 4MZ2A 4EMZA 3TNNB 3RKDD 1UKTA 3WNOA 2DPKA 3IE4A 1J8HD 2BVYA 1JNHB 1BF8A 2R69A 2OPCA 2UXGA 1TKWA 3JWOL 3K4AA 3OR7B 4KJQD 1E3XA 4OFYD 4X5PA 4KK8C 1PZBA 3DO7A 2IIJA 5C08A 2CDEB 1TO4A 1A47A 2DWYA 1BVKA 4X5XB 1Z9SB 3LKRA 2CXKA 4PB9H 2NY6C 4PJ7A 5F97E 1KBGL 2IDUA 2DWTA 4XH2A 2IWKA 1U92A 2QLVB 3MBWB 1L7IH 1LO0H 2PXYC 5BZWA 1TXKA 3B7TA 3OMAB 2Z92B 3PV7A 1I7UB 5DHYB 5E8EA 3FPXA 4HJGB 1H19A 4RGMC 5IMMB 3KPNB 1IC7L 4V2CB 3WIFB 5K9OA 4G9FA 2UY6B 2Y07L 4YC2C 1KB9K 3JTBA 2B9AA 1AIZA 2IAMD 4HUXA 1AYOA 4Y2DA 3A6BH 2ETWA 1INDL 1Q9WB 4YBQD 4X99B 2FH8A 3ESMA 4G6FB 4RGNB 3QG6B 4H8QA 1IUZA 4PSRA 4RAVB 1HZHL 2Z31A 4ORGB 1WRFA 3U36A 3LVTA 2OBGA 5B1KA 2FGWH 5T33H 4NUGH 3LQAC 4EZJA 3EDEA 1BYOA 4Z5RB 2G30A 3FRPG 5F9OL 1JPSL 1ZLWH 2A9AA 3APFA 1KYDA 1E9QA 3MO1A 5I2IB 5A2FA 4PEEA 1OQXA 2VZ1A 3HC2A 4DF9A 1JGVL 3QXAB 5E8DH 4F8NA 4YSTA 4IDJL 3S36X 4XNBA 1EDHA 3O8XD 4PJBF 2IH9A 3LQMA 4BQ6A 4ERSH 4HWZA 4L8DB 5MEQB 1PDKA 5D2LF 5KVDH 1EUUA 1A6UL 3QEQD 2P4AB 1M4KA 2Y2YA 1F4XL 3GXPA 1DLFL 3BIKB 3BP6A 2VNCA 1EFXB 2HJLB 2XG5B 4PS7A 2VDRH 3PS6A 4OZ4A 4ZFFB 5J6GB 2B3RA 1X5IA 2E5EA 4AXWA 2CM6A 2W94A 1Z2KA 1R3LB 3PCYA 2MJWA 2VDKH 4G72B 4GSUA 3N41B 1TZAA 3L2NA 4GRLD 2CK0L 4N2EA 1RZKC 3CVIH 4DNLA 1JNLL 4RISL 5FW6A 1C5DB 4EIZC 1YEKL 1CQKA 2ADGA 2VLJE 3PP3H 3REWB 2A6JB 2G5RA 2IDQA 3SE8L 1J9SA 5I9QC 1HKLH 2WVTA 5D7EA 1KGCD 2JELH 2VR8A 5GGRB 2WCGA 1VGEH 1Y1DA 3CXDH 3N1QC 3GMQB 2V7HB 4C83A 5JUEL 4UIKL 5FWRA 1INEL 1IL1B 1T2QL 4ORZC 5C8JA 2H0JA 3WCYA 4EJ1C 3PLYA 4KXZI 2IQ9H 4KXBA 3CXHJ 4KRPD 4MXWH 3ESVF 1S8DB 5EBWA 2VXVL 5FO9A 3IJYB 5CN2A 3UDWC 4XBEH 5ECJE 1KN2L 1MFMA 1V7NH 1I7ZB 2VDNL 1S7SA 1E4WL 4PRIA 1ZDQA 2E7CA 4W9EC 5GIRB 1HEZB 3S3DB 2HT3D 5GSRB 2JKSA 2XVGA 2NCEA 1EDYA 4G6JL 1MUJA 3KJ6L 1A6ZB 1IZKA 3GZQA 4Z7VE 2DBLL 4JFUA 1SMAA 4Z95H 5GS0L 5EDSA 1XB3A 5HI4C 3UZQA 4ONFH 3O2WL 4DP6X 1KCUH 2ZCHH 2HG5B 1PIGA 1ZAGA 4NQDD 3CUPB 3K6FA 5JTWA 5I1CL 1NIAA 2DLEA 2ZUUA 4HXBL 4OZGF 2P8MA 3SBRA 4UYQA 5J9PB 3RX8A 4PJBA 4AJVA 5CEYB 4QO1B 4OD3H 5JLZA 2AJUH 4LCWA 1ONQB 5D2LA 1JCVA 1GS8A 2BO0A 5AZEL 3WY4A 3ZQWA 5CNHA 3ULUC 1SGKA 4WWNA 5IVXE 5BZDA 1Z5LB 2UXFA 4MNGE 5DJ8A 4R4NC 2J25A 3C08L 5FV1L 3VGDA 1VEPA 4HZ1A 4Y4KA 3VXUB 2ZYIA 5FW7A 4P3DB 1LO5B 1VGKA 2GT9B 4NKIL 3VG0H 2Z9TA 1N6QL 1Q8MA 4C56B 5DHEA 1P9MA 1UT2A 2CO6B 1QZ1A 5LQBL 3HC0B 3LS4L 3TTYA 1GC1C 2K3TA 2AQSA 3P1VA 2JI1A 2JJUA 2QADC 2FH6A 2XN9D 1J9RA 3QUMH 4L1DA 2WZPA 4Z7OF 2O93L 3QQ4A 4QF1A 4WWID 2CO1A 2AJVL 3HNVH 4GKSB 2WP3O 1ZHKA 2YAHA 4KV5F 4OCXH 3QQ3A 4IMLB 3FUKA 1S7VA 2FSEB 4XC3L 4M62L 2LTQC 1Q94B 4GP5B 1F42A 1UB6A 3V4PH 4PJGF 1S7XB 1FH5H 4JJ5B 5I1LB 2XZAL 3D85D 3K2UH 1SLUA 4HIXH 5AB2A 1T7WA 3TZVB 2B9BA 2C9SA 4KDTA 5LNEA 1UZGA 4DP7X 2VDPH 4TNGA 3O6FA 1WV7T 3DX9A 4Y5VC 2O30A 2WSPA 4WFEE 3CH1B 3PGCB 2H5UA 1PKQB 4H1LG 4DCQB 4B95C 3AMLA 3WU1A 2CGZA 1FN4B 4X6BB 3ES6B 3TO4A 3B2VL 5KW9H 4Q9QH 3VI3E 1UWEL 1UH2A 4QD2E 1F97A 3ULUE 2NMSA 2A0LC 3PGDA 4YGAB 1IE4A 4PP1D 3P3SA 4L1TA 4XE0A 3VD3A 3VG9B 3LEXB 1OB1A 4IU3A 3VSQA 4OZGA 1G1YA 4GRMB 3KS0H 3L3JB 3VXSE 1CFTA 12E8H 2AJYL 1HHIB 3L3DA 2X88A 4TUUA 3TBTB 3VGAB 4ALAH 2G3ZA 3BOVA 3VO0A 2ZWYA 2MH4A 2X2IA 2VLKB 2YAEA 3CGTA 1F4WL 2EC9U 3OBAA 4GG8B 4NUJA 5CCKL 5IB3B 3MLRL 4OTXL 4LLWB 2JJTC 3U79A 2X6CA 4X7FC 1H15B 4WUUD 4N0YL 4B50A 4PAZA 4ONHA 2FRGP 1AHWC 5B1CA 4ZXBB 4JO3H 2WKGA 1XBDA 5I5JA 3UTQB 3ULVE 2BOCA 3RU8H 4NN7B 3GBNH 4BFRA 3S4SA 5BO0D 3K6SB 1L9MA 4JRFA 1XTMA 1GGYA 5AAWA 1IVTA 2C3WA 1OW0C 1DJSA 1Q9OA 4LU5H 3V5DA 4DUXA 3RZCD 4XMWA 3NZHL 3Q1SH 4NOBA 1VFMA 4JDEB 4RFOL 4WFGD 5EG6C 3ALXA 3KW7A 3K72B 2KERA 4HOMA 1IO4C 4LKXB 4H0IA 3AT9A 3CMOL 5ICUA 3VWKD 1KCKA 4PV9B 4GFTB 4QXTB 5DUML 4PJGA 2KLRA 1FL3B 1SQ2N 2WQXA 3UC0L 1OP5H 3TGXA 3VE0A 4G71B 4MS8D 4OCRH 5AL8A 3L3KA 1CIUA 3LEYH 3L7EB 3BWAA 5HYIA 3CDYA 2DMCA 3EYSL 1IIKA 1SEBA 2WXKA 1ORQB 2VDLH 1G1CA 1BJ1H 1FV1A 2N0MA 2IH3B 4YL9A 4LSQH 2C3VB 3CZJA 1S9YB 4BZ1H 1X5LA 3ESNA 5EU4A 3SPJA 1PGRB 5E94A 4S1DD 3CDGB 2TSBA 3IJEA 5I23A 5KZCD 1I75A 2BDNL 4FAAB 2ITCA 4Y19B 3QC5X 4F7EA 1ZA6B 4ELMB 4G80A 2VDNB 1U93A 5K93A 3TLRA 4N87A 4Y1SA 1H0DB 1LEIB 1CE1H 3KVDD 3L5HA 4K8RH 4LKCA 1DBBL 2BNRE 5T3ZD 4FYTA 4NP4H 3NCMA 2DBJA 4OZIE 1BQRA 1JRHI 2NUTA 4Z7NE 4E36A 1RUAL 2QGBA 3QRGL 2H6PB 3M17B 1K2DA 4KUCD 3V7AG 4PJIB 1TZHB 4G8FA 1HL5A 3OXSA 3VJ6B 4GAFB 4Y7MA 5ACZB 4PJ6A 2CIIB 4MX7A 5GGSY 3RHWK 5EZJA 4PGBA 1QKZH 1FNEB 3LRSB 2BVPA 4PVBA 4KNUA 5DS2A 1Q0YH 5DJXA 4MCYB 3F7KA 5JW4R 1AQKL 4M43H 2Y3NA 5INDB 2XNAB 3K81A 2X12A 4AGQA 5D72L 2P5WE 3NSJA 5IG7B 3UOAB 1A8ZA 3W5MA 3F7QA 2WMPA 3JZ7A 5GRUL 4JKNA 5DRWA 3VRIB 1I82A 4NKOB 4B97A 1IJNA 3CK0H 2B4CL 2DQTH 2IH1B 4NNXB 5E51A 4KVCH 4X4MA 3DI3B 1CF1A 4JHWH 4FQXC 4MD4B 3QJHB 2VWEE 4P05A 4A63A 1MELA 1U8NA 5CXPA 5I82A 4YPGA 1KCVH 5IQ7H 1DBAH 3FO9A 4FFTA 3VDCA 4ESKA 2HRGA 5F88A 3L3IA 5AOKA 4L3FA 3ARFC 3N42F 2V3FA 2CBOA 3HRPA 4GAJH 5DA4A 5B8CA 4A2HA 3EFFA 1OP5K 2A74C 5C0AD 5FV2A 3KZ8A 2PXYA 5J3HD 3HLKA 1T89A 1BJ8A 4GUPB 1OK8A 4PJ9C 4UDTB 2WLLA 3CVHH 2WNGA 3QSKB 5SWZB 5C0IA 4ZO8A 3EG9A 1A4JB 3Q6GL 2PO6B 4HHAA 4D0CA 4H25A 4PG2C 4P46B 2QQKH 1MFEH 1GKEA 3QWOA 3AW5A 1FVCB 3QUXB 4W1TA 1NKOA 4TVUA 1KTLB 4XXDB 32C2B 5GS2H 2EUVA 2J20A 5F7DB 4PJDB 3Q0HA 2X41A 3AB0C 4MJHA 4MMXB 1N5AA 3CZLA 1II4E 1F58L 4H1LH 25C8L 3NTCH 2F74B 4XXCC 4XMVA 3MJ6A 4TQHA 2VLLB 3ZHLA 2XC8A 2DQ6A 1HJBC 4ZMPA 3RDJA 3RGVD 3MRFA 4B3VA 3MJ8A 3MRLA 1VHPA 2W92A 2NXYD 3DVNA 5D1ZI 2EEFA 2QELA 3CSTA 1SM3L 3VFGH 2EDFA 1QATA 3N50A 3BZ4A 4HUVA 5F7EL 3BZ5A 3OKNB 2MCPH 2VOTA 2VZUA 3FUIA 3QRLA 3FSAA 1CU4L 2GJJA 3IF1A 3RVTD 4I1RA 2ZOLA 4OZIB 2MFNA 3DX6B 2BSRB 4EKJA 4UV4L 3F5WA 5E7BA 3HG4A 4K9JA 3IMWA 4HPOL 5ESAA 2ZXAA 4XPTH 5B38G 5LKNA 2VDQH 2EACA 3DGGA 2EZ0C 3IDGB 5B39G 4M3HA 2AHIA 2P24B 3ESPA 1VKXA 3SDDB 5C9JB 2Q6WB 3ZDXE 2XOTA 1ZMYA 4Y89A 1FGNH 3JT2A 3RTQD 5IQ9B 4RDQG 2OS7A 1GAFL 3DXAE 4YGVA 1A7NL 4IMKC 4XMUA 3UTOA 2NTSP 1PS3A 1Z6JT 1CG9A 5GGTA 2JCCF 3KR3H 3MV8A 1X5ZA 3FOLB 1KBKA 4QGYA 5C0DB 3LB6C 3HNSL 1CBVL 4U1IA 4F57H 3DRQB 2IDSA 1IC1A 1OVZA 5IBLC 1F90L 1CICD 5E7FA 1SDYA 5L8LB 3SKNA 1REIA 1KBBA 5IHLB 1F11B 4LCVA 1YMME 2OV0A 2OSYA 1B6UA 2BRQA 2D7NA 4FG2A 3MNZB 3MBEC 4GAYB 3IDYC 4GRWH 2P48B 2DTSA 3EW3B 4ES8A 4POUB 3WD5L 1JMXA 4PJCE 3LPGA 1O5DT 5J12C 1T0MB 4HKJB 3KGSA 4HIJA 3ZE1F 2HTKC 3V0FA 2X6BA 1T2JA 1FNLA 4IBLT 4FQCH 3X3FH 2KZKA 4KI5D 3V4VH 3FB6B 3H9HA 2CCLA 3E1ZA 4WW1B 2OTUB 1G7QA 3GS7A 5C6TH 1FBIL 1J10A 1QA9A 4AEHH 1ZTXH 1U8HA 2DN7A 2NW3B 2X38A 3FC8A 5FECB 2M83A 4XPHH 4N6RA 3EOAA 2XY1A 1WA0X 4EXKA 1DUZB 5TQ0L 1QUNB 4YHYC 1TNNA 1JZ3A 2XCMC 3K1DA 3D30A 4WHYG 1D5XA 4QRAA 4IK6A 1H3GA 5FWQA 1MZZA 5KSUA 2R8SL 3NDYE 3OC5A 3UAAA 3RLSA 2P5EB 1WA1X 3KXFB 2XG4B 1ZXQA 3VXPB 2BSSB 3TIDB 3EBAA 3GO1L 2AV1B 5IIEA 3S34L 2AK4B 3EJZD 4ZD3L 1S5HA 4UT6H 2OMZA 3EDJA 1JGLL 2WWNA 3I50L 1AGBB 2A38A 2Q20A 4YSEA 1I1CA 1TDQA 4OQTL 2A6DA 1SJEB 4OIFA 5DZLA 2OQJB 1AZBA 2X40A 3ARBD 4GG6E 1FNGB 3VGHA 4IGBC 1J1OH 2VN5A 2ZAIA 5C0BB 3PFUA 1U42A 3MLTA 5D70L 2QQLL 1XEDA 2JLPA 2JJSA 5AKSA 2Q7YB 1X5HA 2FL5B 2I85A 4QRPD 2JKNA 2K6ZA 1ZGLA 3BD5A 5KSBF 1UGNA 5EPMB 4ZO9A 2ZOOA 5IKCB 1N8OE 3ARED 3DWTA 2H32H 3NJFA 2JCCA 5JPMB 2R1YA 3MX0A 3MV7E 4MJ6B 1FVDB 3RKPA 1FH2A 4JQVC 5FS5A 5KOVC 3T3ME 5C07B 1I8KB 4GW5B 4WDIB 1DVQA 1RLWA 2NYYD 3OTTA 4JM2D 1TVHB 3IDMA 5AZ2L 2DI9A 1XL6A 1T5WB 1X7TA 1BYPA 3Q6FA 1E28B 1HNFA 1Q0XH 4WRLA 3ILPA 4PW4A 3WTTA 3RGHA 3DROB 4RSYA 4EVNB 3X13B 2NR6A 1GHFH 3QP3A 3GTTA 4H2CA 1KPUA 4TSAH 3LKPA 1OD9A 4P2AA 3LXAA 1B0GB 4WTXA 4A6YL 1WTGT 3WFBH 4JG0H 5AB1A 3VXNB 3STLA 3L2LA 1FDLH 5IZ7A 4CU6A 1TTFA 3RWEA 2Z1PA 3GXFA 3O3DB 5EZLA 2DQIH 2GKIA 2WXQA 4PJHF 4YHNB 1B3IA 3JV6A 1B6DA 4PBWD 4AX3A 1AQDA 1USQA 1U21A 2AERT 3G6JB 4FNSA 3L48A 2I24N 5CEZD 1LJMA 3D3VA 3K2KA 4WI6A 1JGUH 1AO7A 5D96C 3WNLA 1CD0A 1FORH 4ZMVA 4DKFH 3OHXA 3QFDA 4B7LA 1CF8H 5AOLA 2F6AA 5HGHA 5CFHA 1PEZA 4XMKL 4O2FB 4OFVA 5TJWK 1RFDL 3WJLA 1ZLUH 2EIEA 3KPSB 4B7IA 3G08B 3IFPB 3ILQC 4EOWH 1KDJA 1UZ6E 4U7KA 2V9UA 3SQOL 4YE4H 4N5UA 3SEPA 2LV4A 2QGEA 3T2NL 1CLVA 4MAYB 5LHDA 4KDVA 2J1KA 4HJTA 4O4YH 3ZN6A 1IGFL 5JHLH 5E9DB 4KROB 1X4ZA 4Z7WB 1KWKA 2HB0A 2IANB 1I3UA 1UG9A 2X4PA 3EYFA 1F6AB 1JD7A 4E42A 5FO2A 4FFZA 3CQPA 3BXNB 3KBEA 3ZW3A 3CHSA 1SJVA 3T6VA 2VO5A 4EQ3A 5IJVA 3EIFA 1JFHA 3JYCA 1TITA 3H9SA 4HF5L 3EHBB 3NIFF 4QYOA 5KSBA 2YSSA 4L5FL 1HDMA 4X6DE 4A2FA 4P49A 5I1DA 4GEIA 3JQOB 4J2XA 2PPEA 1EJ8A 4F58H 2F5AL 1G84A 4HJIA 3H3BC 2QEJA 1OV8A 5KAQG 2YGPA 5F7NC 2B0SH 2WBKA 2H2PD 5KYUA 4AE1A 4EZLA 3RP1A 4HKBA 4KZEH 3MYJA 4P2QD 1HNGA 1NM9A 1OW0A 4JY5L 4XPAL 3U2SB 1ZVYA 4AV0A 1AHMA 4APQD 3SJVE 2F53B 3CLEL 1LQSR 4BFFA 2GIXA 4H88L 1L6ZA 2GFBA 3L5XH 1WJ3A 4IRZH 4P5SA 1HIML 2UXTA 4WTZA 5L2KB 4E9YA 4K94C 5BOPA 2ENQA 4GI8A 3S35L 1JRHH 2OA9A 1QBML 3I6GA 4UNIA 4YX2H 3OGCB 5CSZA 4HIPA 4NUQA 4UU9B 6PAZA 2BFGA 2X4QB 4HJUA 4NN6B 3UJJL 2EYSA 2NY4D 3WUWB 4PJHA 5EFIB 3N9GH 3OG4B 2NYKA 4AEIH 5HYJD 1U3ZA 3FU3A 2J6EH 3QCVH 3QUYC 2CBPA 5BXFB 4GW4A 1NQBA 3FFCE 3ZGIA 3PWPB 1DVZA 3FZUD 2GHZA 4HUCA 4LLVA 3E38A 1UZ8A 4Z7UF 2ZX6A 1TJIH 2R2EB 4WLCA 5D93C 3EO9H 1MJ8H 3RVUD 4BA8A 5F1IA 5IV2A 4AENB 2KDGA 5DC4B 3HMXL 3KLQA 2P7TA 4XBPA 2WXMA 4XBGA 5FUOH 4XNUL 1DDTA 3ARQA 4GAGH 5BRZA 1BCIA 2YUXA 3P02A 5KUMA 3TA3B 3WFDL 2RFXB 4FNLL 4PIBA 2HVJB 4KZ0A 2MQ0A 2HAZA 3HE7D 4U1GC 5ICXA 3P30H 3D51A 1UT9A 4CADA 1X9LA 5LN8A 1OEZW 4LCUA 4DN4H 4FYQA 5FLVA 4WHYH 2DJUA 2XV3A 3VTAA 4YLCA 1N0XL 2ILLA 1I8IA 2J8UE 3NAAL 4RGOL 2OTPA 5MENE 1KT2B 3DJSA 1OSPL 4YDMA 3U1QA 4DGVH 4S1SH 3WBDA 1MNUL 5HYQB 1HAUA 4YO0B 2A9CA 3W0WB 3P0VL 3GJEA 3T8MA 3TWCH 5AW2B 3OKEA 1SXAA 2AITA 5CKGA 4AIZB 1Q0EA 3TJHD 3NJHA 1JFQL 4AVHA 1LNUB 3QHTC 5E6UB 4JN1H 1S3KL 4K23H 2F1EA 1O5PA 5I8KH 4TSBH 2AZUA 4H13C 2BFVL 3MA9H 5C1MB 4KO5A 1G7HA 3FTUA 3BESR 1BG1A 1J1PH 4XCFH 3ZVVA 3AFLA 4FQXA 4YJZL 2VZSA 2FECI 4C8XA 1FGVL 4P8QA 3CE1A 3NABH 4RWHA 2H9GB 3G5XA 2DQEH 3QJFB 3F00A 5I76B 3QYNA 3PV6A 3GXNA 4Y16A 4NM8H 3LKQB 2IO5A 4NT6A 2F58L 5HI3C 3H1ZA 1U8IA 1CYGA 3TV3L 2GEQA 3IAQA 3ECQA 4HH9B 1Q72L 5D71H 4LNVA 4A6YB 4I0PC 2OR7A 5LUMA 2R7EB 3HR5A 1C5CH 3O41B 4K5NA 1J7VR 1AC0A 1BSIA 3TL5A 4J8QA 4CNIA 4PJ9A 3VXRE 4ABUA 1DTUA 2WAQA 3ALPA 3H9YA 5IOPA 4I13B 5ACLA 5E1AB 4J7RA 5ILTL 3ECBA 3A4AA 5B1AB 4FQ2L 5ICZB 3M7FB 3RAJL 1MZYA 4GEJA 5CP7A 4OJYA 4ZUWA 5CF3A 2DQJL 3WKML 3T9WA 2DMGA 3B7YA 1ULVA 3QEUA 1GGUA 3OKOA 1XIWC 3DX7A 1CGTA 2ZSVB 1T66D 4PJXE 3VXQB 4DPAX 1NC4A 2PYEB 2X4NB 3BCFA 4AQ1B 3QZWA 4XXCA 3KVQA 1M9SA 1IEAA 2XWBB 3D0VA 4F20A 3PGFL 4WWPA 1OPGL 4JFOA 1ZT1B 3DVGA 1KB5L 2WV3A 4PRBA 4CMHC 1KDIA 1JUFB 2BNQD 3CPUA 2NY0B 2VMCA 3L3OA 5IMKA 1WITA 1SFHA 3O6LL 4KXAA 4UBDC 5CIPH 1TNMA 4I3RL 1A7QH 1RUQL 4D7BA 1QQDA 3BYTA 4LMQE 4DKDC 4QRUB 1P4LA 5ALBH 3D4YA 1Y0LB 1Q9LA 3BWUC 1EV2E 3EDKA 3QCTH 4W4NA 4FQJL 1IBHA 3MUY1 1P4IL 1MI5A 3C6SB 2B1OA 3IGAA 4BUGA 4BRJA 1GGBH 5ENWA 1OTTD 3VWJD 2XFXA 3NMEA 4YK4B 4M61A 3MRIB 3NA4A 1CZ8H 5T5FA 3VFSB 2LOEA 4QXUH 1FLTX 5FYJU 3UX9B 4IU2B 4AGMA 4IMKA 4J3OC 1S7RA 2WO2B 5I8CB 5FO8B 1NCGA 1KLFB 1NBYA 2W0FB 2E8ZA 3ATAA 5DHVB 2VLRB 4JO8A 5L88H 3GZKA 4IRSC 1O7SA 4RSVA 4EDXA 2VISA 4DGWC 5E03A 4YN3A 1P2CB 1T0NB 1AR1C 4FP8H 4NZTH 3SN6N 4N8VB 4LO9A 1WLHA 4GO9A 4LSPL 3SO5A 2X6AA 3PWUB 3MBEA 3D06A 4UNUA 3VI4B 5I6XC 5JIQA 2VL5A 1T4KB 5J0BA 3GTNA 1GYUA 1KLGB 2PN5A 4F7TB 1JXFA 1A3ZA 4U1NB 3GDCA 1QPXA 3J27A 5CD3A 4WU5A 3E2HC 4TNWK 1MW3A 1YYLL 1Q4NX 3BKMH 3C8DA 5FHAH 1DO5A 1QRNB 3QQ9D 3PY9A 1RP9A 2VH5L 4L4VB 1XGPA 1N5YH 1E42A 4LSUL 3HZ3A 3L4CA 1YRKA 5GZOD 1Y7VA 2XV0A 4IRJA 2VLJD 3LXBA 1UB5A 4U6YA 4IJTA 2NSXA 3TBYB 1Y18A 2LE9A 4U49A 5C6WH 4YZFE 3RNKB 4XHJD 1OT4A 3EF7A 1NCIA 3CH8A 4MA8L 4NO0D 1A9BA 2H1PL 1DUYB 3CVDA 2UVEA 1E4JA 1TCMA 3ASNB 4WV1C 4D94A 3O3EA 2YJLA 4X83A 5MEPA 1INQA 5H37A 5FGCE 2XXGA 1RJLA 2EECA 1JD9A 1MHHA 3KPLA 1XCQB 1W72A 3OKKA 5F3BA 4XX1E 3CFCL 5D9SA 3CAFA 5FGBA 1MCPL 2FNBA 3ATEA 4QCIA 2ENJA 4NP9A 1E27A 3JWDH 5AEAA 5TH2A 2AEPL 5E5MA 4N2CA 1O6SB 3ETBJ 2E7LA 3GIVA 4PBVC 3SCMD 1K8IA 3V6BR 1AS7A 1OD7A 4TMPA 2Y5TB 3TYFA 4OJAA 1FFQA 2Z8RA 3WEAA 5ID1B 5FUCC 1HTYA 1SN0A 2GBVA 1J8HB 2QVFB 3QIUC 5JMRA 3L4XA 2DY2A 1EWHA 1QBLH 2AV7A 4WO4D 2BS9A 3VXTA 5HHME 5I19L 5T1LA 4G42A 4AIEA 1T5XA 1NJ9A 3KNBA 1BOGB 2ICWJ 2ED9A 2WPGA 3IXAB 4N86A 2ADFH 2UWEF 5F0LB 5BV7L 5AW1B 3PE9A 5JW5B 1S7QB 5CUSH 2O6CA 2V33A 2BOBA 5A3IC 3IMBA 3AS0A 2XA8L 5F1OB 4UINH 4HUWB 1RAMA 2DLTA 4N2HA 1C9SA 3VFTB 3KPRD 2LVEA 5C0RH 4ZOBA 1PMYA 2QFPA 4M1GH 3WO4C 4TRPL 3GMLA 3TJPA 5IF0A 2IAMB 3H4HA 5GISL 3GSXA 4MQXD 2LLLA 2WVVA 4W9JC 3GSNL 5C0EB 2JH2A 2RAMA 1R47A 3PQYD 1A66A 1S4IA 1MLCB 4NSKA 4K8RD 1WICA 1AXTH 3I3DA 1G7IB 3DX3A 5FM5M 4GOSA 2DTML 1DZBA 1YAZA 4QRFA 4MWFA 1BF5A 1IIIA 3PUUA 3I75B 3ZUNC 5F21B 1A6WL 3ZQXA 2FLRT 2V6HA 4HMCA 5G5DB 4QMEA 3U25A 2Z7YA 1ORSB 3C5SA 5EIQA 1RUMH 3US1A 4NIYE 4N0CC 3M1CA 4X9GA 4U1MB 4OCWL 4B9FA 2R69H 2JJWA 3TF4A 2OMWB 3N40P 1U8OB 5FUCE 3UPAA 1N4XH 1WAEA 4BFGA 5J7CC 3O8XB 1R5WA 1T20B 2J21A 1NGZA 2X4RA 1FZMA 4FQHA 4NX0A 4WGKA 4ZFGL 1OL0A 1ECYA 1UVQB 3QEQB 2VDOL 4G82A 3QR1A 4K5PA 1MHEB 4KO7A 1SEQL 4WTQA 2BSED 1KB5B 4IEFA 3FCTA 3DSFL 1WAAF 2H1XA 1C12B 4S1RL 4M6NH 1TF4A 3SQRA 1M2VB 4WSJA 3ZDYE 4DEPB 4GRLB 4Z76B 3CMGA 1ACCA 1F4YH 1NCTA 2PTTB 1R3JA 5I15L 1ZGLP 2Z4QB 3C60D 3BAJA 1HH6B 4YSUA 5ETUB 3S9DB 3QJOA 2GI0A 5KWYC 4YR6A 3P9LB 4HG4J 5IQNA 3T8XA 1S3RA 4M4PA 1F8TH 2G60L 1RIVL 2NPLX 4NWTL 3F58H 1OCWH 4JY6A 5IVNA 2VDMH 1L9PA 3MBXH 4IYKA 3NZ8B 2D7TL 4FNTA 3KWUA 1IEBA 5HGDA 2F54D 2Z3FA 3S36L 3B8YA 5C0FB 2AXGA 1MCDA 2OMTB 4R26L 2EDXA 5DEGA 2Y5QA 2H2SC 3OJ2C 1UJ3B 1NPNA 3RX5A 5CZVL 2FDBP 3PWJB 4FLHA 2O72A 5E2WL 3IVKB 1L9QA 3BAKA 3OWRA 4R5XA 2L7UA 3S4SG 4MDRA 1MG2C 2ZOKB 4L8BB 1NSNH 3LTVA 5GS2D 4NUPA 4BV1A 4UQ2B 4WKXA 3TN0A 4XVUD 1E5UI 2OJEA 1MJJB 3ARDA 3EJUA 3Q3GA 3AACA 5FUZL 4E9RA 4CSTA 1BYNA 1RZJL 5I8EB 3QUYA 5F44A 4P5MA 1ZHLB 2NZ1A 3BPCB 3LQZA 3RWGB 4BQ8A 5T3ZL 2OL3A 1BEXA 2FT7A 1BFOB 2X4UA 5JIHA 3IYLW 3I84A 3TYGH 1Z0NA 1TPXC 8FABA 1J12A 3W9DB 2XWCA 3FOMA 3SKOB 1OF2B 4NQDB 2APWA 1EANA 2OJ1A 4XO4A 3O9WC 5JOEA 3CC5A 3WEOA 1QSZA 4J23A 1QNZL 5IMOB 1XF3B 3O3AB 5EF3A 1LLAA 2I7SA 1I1AC 3IDJB 4HEME 2V2TB 4MJ2A 4TPRL 1AOZA 1AMYA 4MA3B 4WWKC 5DUBB 2CRYA 3UYRH 3LSOA 4K9EH 4IK7A 2IWEA 4NQXB 4ODWB 4M7KH 2HVKA 2C9PA 5EEVA 5HDQH 1WAAA 1ZA3A 2LW3A 4G8AC 3HG1A 2Q87A 1S5IL 3ZMEA 1YPZF 3IAGC 3LRMA 3KPOB 3TBCA 4OF6A 2BERA 3QHZH 2VGLM 1S9VB 5EWIL 2XN9B 1IGYA 2D0GA 2BP8B 3INUL 4RMVA 1CI3M 3ZDZF 4ATTA 4G7VH 4GBXD 2OI9C 4YDZA 2H3NB 1E8ZA 3QPQC 4PGZA 1ITCA 2R27A 2EO9A 3JTSB 1JHKH 4J6RL 2N3JA 1KXVC 3N44F 3C6LD 3FU0A 3GJFB 3X1GA 5EUKA 1MWAL 3KYNB 5F0PB 4B9ZA 4L4TD 3OKYA 3T0AA 1HHJB 3QG7L 5LG1A 2HKAA 1LK2A 1XSJA 1FJ1A 3H42L 1LYQA 1CDIA 1Y6KR 5LGHH 1ET8A 1QSFE 4LF3B 4M00A 3IGKA 5ESVB 4DTGL 2R1XB 3BH4A 4OJFH 4PRHB 1NGXB 3MTRA 3U0TB 5CBAB 3FONA 5GGSB 3EJCA 1RZQA 1QLEL 4FMKA 1ZSDA 2WN3A 1MDAA 4HYTB 4LIQH 1RL1A 3CHOA 5DLML 4EIBA 4ZPVA 4KJWC 1E6OH 1YMHB 1IB5A 3C9NA 4AGNA 1NANH 3KJ4B 1WGOA 3BAIA 4I0PA 2ZUSA 1JNNL 5FYKH 1J0HA 4EBQL 2R4RH 4LL4A 1L6PA 2AXJA 3ZDWA 3G3LA 1I1RA 2Q7AA 4NQVA 3T3PF 2LU5A 4ZODA 5F6IB 1UXSB 5D1QE 3UTPD 1AGDB 2C3HA 4F7CA 4RGNC 1QEWB 3HZKA 3LYRA 1KIUB 1HQ4B 3FO0H 3LIUA 4TL5A 3KL5A 3Q2WA 1PX3A 3B2PA 4GKZB 4EN2A 3IAPA 1KJ2H 1SVZA 2LU4A 1XIWA 5HJGA 1DBKL 4Q6KA 1I53A 5C70A 5DC9B 2CKBL 4PJFB 4B9PA 3HPJA 4XAKD 2VSKB 4ODHH 1KYOK 5D1ZB 4OF0A 2PCPB 3GK8L 3IFNL 4XPGL 4XT1C 4N2AA 4DT2A 3MUGB 4HGWA 1MFNA 3W56A 1AIFB 3HZMB 4N1HB 5C0NC 4AL8H 5EIIA 2GSIB 4JRXD 4TUKL 2XX0A 2VDOB 5AWNH 5FDWB 4WNQA 2VR5A 4XO8A 4KTDL 1KTCA 3QIBD 4M7LL 3EOBB 3RZCB 4KKNA 1OM9A 3QISA 4X8CA 2BP5M 5EUOF 3BQUA 4P5KA 5DHMC 5TE6H 2R9HD 2YR3A 4P4KD 1VSCA 4ZUSA 2OYKA 3NA9H 4KY2A 1E8WA 4I77H 1YYCA 3NFNB 1CDCA 3MRMA 2X4OB 3VWKB 4QOKA 2ZJSL 4XZUB 2Q8AL 2GC7C 4NQSA 3HUJF 2YGNA 3CU1A 4JY4A 4YL4A 3KLDA 3BDBA 2OXHA 3M1BA 3FDWA 3MXWH 3GMOB 3V0HA 4YAQA 1YEDA 4GSRA 1MVUB 4NRYB 3HE6D 2CDFB 2MOVA 5D7LD 2Z34A 2CMRL 2XQYA 5KSVB 1ACZA 1ETZB 1VIWA 4RGNE 5I0XA 5EBMA 5BMFH 3FN0L 3NPSB 5E2UH 3L7FB 2FD6L 1KCRL 5E6SB 4O5LH 4UQ3A 4FKEA 4U1JB 1TTUA 3BAWA 2ZCLL 2J1ZA 3KGRA 4IJ3C 5FCUH 5DO2C 1OT1A 5KZCB 3MOAH 2EXTA 4GP4B 5GRVL 43CAA 1PKOA 3DXAD 1X5AA 5C09D 3VFVA 5KYYA 3DOSA 4GSXA 5C7XH 3GI8H 2UY7B 3DYPA 3REVB 2WLIA 3FTGA 2XBZA 3MJGX 3F84A 4YXHL 3WKNA 1RK0A 2JKTM 3T77B 1PZ3A 3ABZA 4FNPA 3WIIL 3WAJA 3CFIC 2Q10A 3ETBF 3BZDA 1QFWL 1ND0A 2FJGA 2ID5A 2NZ9C 3D9AL 2HRLA 3H2WA 2UZPA 1KPVB 4AM0Q 2AMUA 2EEDA 3IJHB 3SGKC 4U33A 3TU6A 3ZRCC 4PV8B 1J8KA 1OE3A 3UJIH 3B2MA 3NJGA 2FHBA 3MYZA 3LJ3A 2PP7A 4XP9L 1T7YA 4W9FC 1FNSL 3BVVA 5EMYA 3RDTA 1WFIA 3O2VL 3TF7C 4AYFA 4N0UA 2CJUH 4WHTA 5DUPH 1E4HA 5TGBA 5FOBB 4X9IA 5F96H 4D8PA 4ZQKB 2WZ0A 5C3LD 3HS0B 2HUHA 1PLGL 1FL6A 2VCOA 3FO2A 1D5BB 5B3SB 1YC7A 4WAFA 2XWJB 3WKYA 3JTTB 5MHSE 1XF2B 5EUOA 3NCFB 2P1YA 5EIVA 1MW0A 3PP4H 1YY9D 3UEZA 2ZE0A 4NQCA 4FZ8L 5F9DC 2A1WL 1JF5A 4FMVA 4JPQA 4CILA 1VA9A 4Q0XL 1DFBH 1JPEA 3FQNA 2VUYA 3HUJA 3P9MA 4DGYL 2WUCL 1U3YA 2GUOB 4M1DL 4YXKL 3NIDB 2JNZA 1HN1A 4MSWB 3QA3A 2BVTA 1FFTB 3JWNG 2EABA 3DX2A 2D3JA 2EXWC 4WI0B 5C0AB 1YEEH 4A7SA 2VJXA 1MWAB 1X9RA 1KV3A 5CEZL 3U9PH 3PHOB 4MZIA 1MQ8A 1P4BH 3JWOC 1H3PH 3VFNB 4HWNA 4WK2B 5GHWL 3U7YH 3G04A 1YNTF 4JFEA 1OCZB 4ONGH 3HG2A 3ISWA 3ZKMD 1QLRA 3I6SA 3TZVC 1G9NL 1NCWH 1OP4A 2BIPA 4EI6A 4MXQC 4YXLL 3DX4A 3MV7D 5D7JD 5CJXC 2K45A 1P7QD 1QI4A 4F92B 3MGAA 4RH4A 3BRGC 1VCBC 3QDMA 3ZT6A 3QHFH 5DK0B 1LILA 4ETQB 3RA7H 5IJDC 2MTPA 3LNIA 3GC3A 1XL4A 1KXQE 3T2OA 2ATKA 4V1DE 3TPUB 4EUPA 4GQQA 5I1AA 2YD9A 4F7MA 3UTTA 1FYTD 2XY2A 3AXIA 4AGLA 3V8CA 1W8OA 4HFWA 4NPJA 3VG9C 2ED8A 3OMNB 1BXVA 3NACH 2V17H 2XPYA 3AC0A 5KYNA 1L3WA 1AP2A 2EDNA 1ZVSB 4RZCB 4X4XA 5FX3A 4C56E 5KTEH 3VGAC 1OLZA 2CKBB 4GW1A 3H0TB 2GJZB 4RNRA 2Z1KA 4QRTA 3RY6C 1A1NA 4PB9L 3ZKNC 2EVIA 5CP3H 2XETA 4H0HB 1U58B 3RTQB 1VB9A 1JK9B 1L7IL 1LO0L 2X9XA 4CC0A 5AYUL 5AW5B 2L3BA 4ZXBC 2XKUA 4OZHB 1MCCA 3MV9A 1DANU 1PLBA 5D2NB 2NY3D 4NN7C 2EP6A 1G9MH 1OAZH 2GBTA 3T0EE 2AEOA 2IFGA 4JMNA 4LVHB 1CGWA 1CICB 3QEGL 1NMCB 3X12B 3T1FA 2APFA 5TQ2H 4MVBC 3U1PA 4NZFA 1RZFH 3A6BL 4JRYE 1CT8A 4G5AA 3CSFA 1XTLA 2VL4A 4J3BA 4PWEA 1KSRA 3QFJA 4E41A 3ML9A 1MKFA 4OUOA 2FSDA 4W9LC 5FO7A 5HPOA 2V2WB 4P2RA 5KVFH 1LEKA 1PKQE 3K4ZA 5T33L 5E6YA 3ZE1E 4NUGL 4OCLC 1TQBB 3G5YB 1KB9J 2F1AA 1XCTA 3L3HB 1HL9A 1F3JB 1PIFA 3BP4B 1YNTA 3P11H 4YSOA 1OTUD 2F8XC 4QEGA 1N6UA 1QVOB 2HLAB 1M1SA 3TO2A 1KCBA 1H8SA 1C5BH 5FA4A 2PF6A 1EEZB 4WK0B 5E8DL 3NEOA 3F04A 1CD1A 4KKBC 2PETA 1WD8A 3TBVB 5EO0B 5DMGD 5E8OB 4ZUVA 4ERSL 2HRHA 3MJ7A 3QNZB 2GIMA 1F45A 2X4TA 5KVDL 2MEJB 3BHBA 2QV4A 2ODIA 1V27A 3THMH 1ODUA 5A40E 4YHIB 5EN3A 3WXWL 2D7OA 2DQUH 2MHAA 4JKWA 4WTZG 3SYQA 4CC4C 2LU3A 4XB3A 2ZXEB 4RMTA 3GMNA 2VDRL 3OPZH 1ZT7A 2BC4A 1CDUA 4LLDA 3O9WA 4Z8FL 1SNRA 1NKRA 1RZKH 2OMVB 2XN0A 2FX9H 1ZLSL 1AY1L 2VDKL 5HVFB 1TCRB 4LPTA 5JPNA 1WFTA 3F6IA 3KHOA 1U4FA 4AQEA 4XPBH 3CVIL 1JV5A 4G8IB 2ZG1A 2IPKB 4PTTA 3BUTA 4KQ3H 1WCQA 1ACYH 5GS0C 1EMTL 1KMGA 4ZFOL 1J0IA 5TDPB 2ESVE 1K8DA 3RWIB 3V4LA 3FMGH 2EE9A 1QMUA 2W60A 3GRWA 1HKLL 4UDUB 5C0CE 4BGDA 2PCFA 1ZLDA 4QRPB 5TFSH 4ABVA 5CCGE 2JELL 3D34A 1VGEL 3CXDL 4N2OA 4L3CA 5JO5B 3PAVA 4JNXA 3AREB 5CU9A 1PY0A 3EGXA 3LIZA 1S6NA 5DJYB 1KFAH 4UZSA 4EN3A 4XNZB 5CGBA 5DT1H 3QIWD 3M6DA 3B9KA 1NEZB 2IQ9L 5E9AA 5DJ6B 2IGLA 3QWQB 3BUYA 1CL7H 2CM5A 4KI1A 3CLFH 4L1BA 4XBEL 5EEZA 2XWTA 1V7NL 5I71B 1BMGA 1FO0A 1IBGH 5BS0E 5DXWA 1AI1H 4IHOA 3RWCA 4ZO7A 3FFDB 3U0PB 1G6RL 4CVZA 1JI1A 1YNLH 2NW2A 3BZFB 4YVUA 4J3UA 1M7DA 2R0WL 4K3DH 1M7UA 3GXTA 4Z95L 3S3SA 1EK3A 4ONFL 1D6VH 1LGVA 4B0MB 1KCUL 2ZCHL 2Y7NA 1GZPB 1MRDL 3L8QA 5E23A 5MEND 4Y19E 5TDOB 4J4PA 5DEFA 1Z9SA 4ELME 4FA8A 2QFRA 4XNQB 3I74A 4GAAA 4AE0A 1TZOA 4A7VA 3JWNH 3ARGC 3V4UH 2A6IA 3AXLB 4L48A 2OSXA 3PWNA 4HEPA 3MBWA 2NX5D 1R6VA 2R2BB 1OARH 4OD3L 3UH8A 2AJUL 3V9CA 4R0LB 1I7UA 4FFWD 1J87A 1MFBH 2KC0A 3KPNA 4PJIE 1QSED 1QR1B 2PO6C 5IW6A 4KHXH 3BO8B 3R7RA 4P46C 5H8DA 3MCLH 5SWSD 3QUXC 2X6UA 3TCXA 5CHNB 3D39A 5IHHA 1O7VA 1PZ5B 5CCHE 1LE9A 2YPLD 1PU0A 4FTVE 1Q9WA 1XGRB 4X99A 3GHEH 2V0AA 3AS1A 2K6WA 3QG6A 3WSQH 4GQRA 1XEUA 3B2XA 3BZEA 3GBEA 3W5NA 4RAVA 4MMXC 4FFVC 4ORGA 4KGJA 4U1KA 5AKRA 3QUML 3DJ9A 1JV2B 3TCLB 3QULA 5I75B 4D9QD 1SHSA 4FI7A 4Z5RA 4Y0GA 3QJSB 3B7UX 2V5RA 5I2IA 4HIHB 4JVPA 1AJ7L 5F72S 5I66B 1XGUB 3K8LA 1O75A 3MRDB 4DOHE 2VSCA 3O2DA 3V4PL 3WJMB 1OSEA 1CDBA 4BXSV 2FB4L 1BG9A 1FH5L 3VXRD 4OD2B 1HQRB 4HV8B 3FBKA 2GIYA 3EYQC 4IS6A 5AVWB 4F2FA 5K9OB 3S8GB 2VR7A 4HIXL 2YUWA 3S98A 3WE6B 4LSVH 5DFVD 4P2QB 3CLWA 4K15A 4YQXH 5T1KA 4WFFE 2VDPL 4JVWA 2PLTA 1ES0B 5DS8A 1EFXA 3QZWG 2VLMD 1ASOA 3CIAA 2E7HA 4HKZB 2NUPA 3F64A 4IDLA 4LB8A 4ISVB 4ZFFA 5IGXH 3CZUB 5J6GA 1X5MA 1U36A 2X0UA 1R3LA 2XBTA 1JZGA 1UEMA 4I18B 3RBGA 1MCRA 2JTDA 4BFIB 5KW9L 2WXGA 4UZUA 4BQCA 3K2IA 1A0QH 1IAMA 1AKJA 2NY4B 3L08A 5FF6B 5BZXA 2A6JA 5HYJB 2W07B 4OY9A 1RZGA 2R15A 4M4RB 3FHQA 1JJUA 12E8L 3PREA 4PJDE 4XO5A 5GGRA 4WF7A 4R7LA 4Z7UE 4FFZH 1XAUA 3GMQA 1KNOB 2CRIA 4TLSA 1IL1A 4X0KA 5SX4H 4YSDA 4HHWA 5KG9A 4ZDHB 1NOAA 1KGJA 4OIAA 3IKCB 5ISZB 3KMDA 2H41A 2W81C 2I9TB 3IJYA 3GDBA 4JO3L 3BE1L 3SE3C 1L5GB 2ZKHH 2QPSA 2EEAA 3LVEA 3NCXA 1I7ZA 3RU8L 3GBNL 1FFNB 1NCBH 1SYSA 2D03H 4S2SA 5LCVH 4TNVK 3HE7B 5GIRA 4BFOA 1HEZA 2DEWX 3ATBA 3EH4B 5GSRA 5C2UB 3ASWA 2AQ1A 4BWTA 3WYRA 2W9EH 4LU5L 1IGIH 1A6ZA 3VTMA 4MNQA 5EEUA 2VDRB 1B2YA 2LU7A 3Q1SL 4AW4A 3AWFA 1E7UA 5DJAA 3JVGA 1SY6L 4CVXB 4MJ4A 3QDJB 2YN5A 4KKCC 3SGKA 1ZLVH 4N1EA 2VDKB 2HG5A 3Q9PA 4JM4H 2WGNB 5HJBA 4G8EB 1AG6A 1U8QB 4W9HC 4L8CB 5I1JH 4Y2DD 1HI6B 4JZNB 4ZFOB 3RBSA 1G43A 4OCRL 3S3JA 5CEYA 2V9QA 4QO1A 1E3FA 2VERN 3SKMA 4BEIA 1I3GH 5I28A 4H44C 3D25B 5EC2B 2Z31D 1EJOH 2PUQT 3LEYL 4JW3A 3UG3A 5HHOB 1XVSA 2XPGB 1HZKA 1KGWA 2QKSA 2VDLL 4AC2A 1JGEA 4Y9FA 2WXOA 4OSUH 4LSQL 4MMZB 1AANA 5DURB 5H37G 3VXUA 5JPMC 4OM1H 4X80H 4DK6A 1LO5A 1DBMH 2WLHA 2G75B 3C5JB 5CILL 3EH5B 4IOFC 1XFPA 5C0JB 3NT0A 1ZKAA 4J2QA 2CO6A 4PY7B 1UA6H 1TJXA 4Q2ZA 5IW1A 3TFBA 3L1FA 3PXHA 4JO5A 3LRLA 5IM7B 3O6KH 1TJHH 1G6RB 3NCJH 3NIGF 1BPVA 4MDIA 3RWDB 2B4CC 1JVOA 4K8RL 2ZG3A 4NNYA 1EO7A 4GKSA 2JWYA 4IMLA 1TQWA 2BP0B 3K91A 4KQ4H 1Q94A 3KGTA 4HZAA 3QNFA 4XCNA 3BKYH 1LDPH 4QTHB 1S7XA 4NQEE 5K1NA 5LXVA 1W15A 3B3IA 3GTVA 2OMXB 4KK6C 2EEXA 1PCXA 2IXQB 3KXFE 1MHCB 1I4FB 1QKZL 1BAWA 3TZVA 3SKJH 2AK4E 5HHMD 3II3A 3O3BA 1Q0YL 4EKXA 5CJXA 4LRNH 3N1MC 3C8KB 5LBSL 4KK9D 5LVEA 4M43L 1EEQA 3ARXA 3CH1A 3PGCA 5GRWA 3TV8A 4DCQA 4FL4B 1PSKH 4Z6AT 3MRPA 3V6FA 5C0BE 4FXGA 1ZCRA 3LKOB 4M8RA 5CD5D 3B37A 1IV8A 1FN4A 3C6EA 4OJCA 3PHSA 3AU0A 1E40A 4CGTA 3U4EB 2EKSB 2BHZA 1D7CA 2CCWA 3OJDA 3CK0L 3WEBA 2DQTL 4KVCL 2V3EA 3QXUA 2VXQA 4JHAL 4J1UB 1BWMA 2FE0A 1PQZA 1CXHA 2A83B 4R6UA 3LEXA 4MAYC 1P5VA 4Z0XB 3P0YH 3F01A 2OMYA 5CS7A 2PCXA 3QUMB 4GRMA 3L3JA 3BPOB 5C07E 1SBSH 4FADA 4KROC 4PRID 5F1KC 3AITA 3TBTA 3ZKQD 3AS2A 2OCJA 2YMOA 4BBWA 1RZ8B 1MEXH 1UKSA 2VLKA 2ZZUT 4LCIH 4UT7L 5EOCH 3RY6A 2IG2H 4GAJL 3VWJB 5INCB 1HSBA 4OF7A 1H15A 4C4UA 2XWRA 4IKLA 3V0AC 4X6CB 1KIRA 1OSYA 1PG7H 3EHBC 1E9OA 1C7SA 1A6VH 4AV4A 4ABWA 3AY4C 3CVHL 3MLSH 4RMWA 4F1ZA 4N2DA 1N0LA 5FM8A 5LN4A 4R90H 4YHZH 2J72A 2F5BH 1SMDA 1VZGA 1WBYB 2ITFA 4I4WA 5AKTA 5DZPA 2VDPB 3K6SA 1QTPA 3CV5A 1MCWW 3RVVC 4LCWD 1K4DB 4LMQI 4MCZB 1HCVA 3ULVL 1T21B 5HI5C 4GLRH 1SHWA 1RIUH 4OGAC 3K72A 4KGLA 2F8OA 4GP8B 2FUQA 3CFUA 5FYKD 3NTCL 4ZQTA 4WCYL 4RRPM 5EB9A 1E50A 3TM6A 1H6UA 4TYUA 5C3IA 4PJEB 1FL3A 3WTVA 1RPKA 1WDAA 4P23A 1IQWH 4XXWA 1DL7H 4HQQH 2WWMC 4AYMC 1GOFA 1UXWB 2VO8A 1NGQH 3VDBA 4WW2B 3NQKA 1OK0A 1N70A 3L7EA 3OZ9L 1JYWA 2VLJB 4PREA 1BVLB 1G1OA 1Z3RA 3H2PA 4LRIC 2C3VA 3Q1EA 5E9DE 4DP0X 1S9YA 2ZYHA 3MJWA 4NEHB 4XPTL 4Z7WE 1FA4A 1S9WB 4NO0B 4OLXL 4UIMB 4YUEL 2HT2D 1EEYB 1FGNL 1UQSA 3CDGA 3JT0A 3OJVC 3N43F 4N2IA 3S3PA 1GR7A 1DEDA 1ZA6A 3S48A 3UGUA 3W11D 4LHUA 5HPMB 3T65B 3KR3L 4L3EE 2DWDA 4AH2A 4UTBA 3TA3C 2OSLB 3GYRA 3O6FD 1JGIA 4L8SA 4F57L 3EO1B 3G6AB 3MLPA 2X0WA 5IFJA 2NZIA 4FYSA 2H6PA 3M17A 2C9VA 2SODB 3SCMB 2X0VA 1KY6A 4GB9A 1UWGH 1BD2A 4HFUL 3VJ6A 2Z6FA 1HC1A 3QRBA 3FTYA 2CIIA 5IROC 1Z1WA 1NUGA 4WO4B 1FNEA 5ICYB 3LRSA 5IHZA 1E2WA 4JG1L 1U2HA 3J8F7 1HXYB 4LLMB 1FIGL 5E24E 5B1BB 4DP8X 2UWEE 4FQCL 4DKEH 4J39A 2B59A 5E2TH 3V4VL 1CO1A 2XNAA 1QLFB 3W1ZA 2XDHA 3Q44A 1DLHB 3N04A 4YZWA 4BUHA 1IC0A 2VDLB 4R4BB 4AEHL 5C6TL 3G5ZA 5DTFA 2C9UA 3A22A 5BOZG 1LP9B 4XPHL 4I2XE 3VRIA 4NKOA 1QG3A 5BCAA 4XI5C 3KPRB 3UBXG 2IH1A 2R4SL 4AY0A 4JCMA 3GT6A 3HB3C 3QJHA 5H37H 1SF5A 4AUJA 3VVWA 2JIXD 2B39A 1QYGH 5E2VH 4PB0L 1W72H 4MJ5A 1NCNA 3NJKA 3PQYB 5IK3B 3VSTA 5JW3H 2WY3B 1RK1B 3OL2A 3LZOA 3U83A 4H8WH 1WWCA 1GGIH 1JP5A 4ANUA 2EYTA 4U6HB 3N1PC 4BZ2A 1J1OL 4TVPE 3QUZB 2VUOA 3BAYA 1J5OL 3VQLA 3F85A 3PDDA 4GUPA 2YD1A 4UDTA 4TTDD 4H0LC 2WSKA 5SWZA 4DUWA 2DDQH 1GW0A 1WK0A 4PLKD 3KYKH 5DC0A 5A43C 1UWXH 3VFWA 1JPTH 4Q97A 3DHPA 1ETB1 2Q8BL 4F9LC 1KGUA 1FZKB 4QHNB 1A21A 1FVCA 3ZE2E 1F3DJ 5E6ID 3QUGA 4QTFA 4Y1AE 3CFKA 4OIIH 2WWOA 2HG0A 3OZKA 3W0WE 2RCSH 4V11A 1OGPA 1CURA 4MMXA 1VAHA 4QY8B 2COQA 4AQ1C 2JB6A 1D3CA 4GMTL 2VLLA 5DRZA 1Q0XL 5D4QA 5IT2H 1S9KC 2Z93A 5FB8B 4QT5A 2HTLC 1G9EA 4LCYA 2EDMA 1GHFL 2NY0C 4BHUA 4TSAL 1A02N 1E65A 4NCC2 2Q2LA 2ITDB 2FEEL 5HBBA 3UGEA 3WFBL 4JG0L 4BUQA 1VADB 4Z1PA 5IJBC 5DD3H 1AGEB 5E5UB 1RSYA 1FDLL 1X4YA 5JHDE 1R0AH 5F7BA 5D1QD 2DQIL 3ABMB 1MW1A 3IDGA 3VXSB 1OCOB 2RQEA 3SDDA 4BQ9A 4YK4C 2ZUVA 4C59B 4KMQA 1JNJA 2B3IA 1JGUL 1M1XA 1O9WA 2PPAA 5C92A 3CVHB 1FORL 4DKFL 1JPFA 5HVGB 5F1SA 1CF8L 1CFNB 3RWHA 1I1YB 2B7DT 3FOLA 4UANA 2Y6SC 5EIIG 5KS9B 3QRFM 1X5KA 1Z7JA 1UD5A 3VXOB 4M9PA 4LSSH 3IBOA 3JV4A 5I0YA 4EOWL 3LCYA 4D0DB 3VACA 2YZ1A 5GGQH 1F11A 4N90D 1ERNA 3B1TA 4NPKA 4Y5YB 4YE4L 3DSNB 3TIEB 4H1LB 3MNZA 1ID5I 4O4YL 3IDIB 5DVLA 3N6YA 5DEJA 1DCLA 5JHLL 3MLXH 5GRXG 3KLHC 2G9HB 1F6LL 2OTWB 3QZBA 2HN7B 1EAPB 2C4FU 2PYEE 3NCYP 1T0MA 1MFVA 2A6KB 3O4OB 3P73B 4Y5VB 3CDZB 2ZIDA 1DE4B 5E0FA 5SV3A 3UP1A 4TV3A 2DQCH 3FSVA 1UYWH 4I87A 1U2CA 3ORJA 3FB6A 1JXGA 1PZCA 4HPHA 2H6OA 4KK8D 4AW7A 4ZYKA 2R1WB 3G6JF 3FSZA 2NW3A 3LPOA 4PWJA 1B2WH 5FECA 2XQYG 3BN9D 3PL6A 3MNMA 4BM7A 1BVOA 5C86A 3SPIA 4WY7H 5BJTB 5DSCB 4TLTA 2V7NA 1QUNA 2VW7A 2B0SL 1MCFA 4I8DA 4KZEL 5I6MA 3DVIA 4JFWA 1E6JH 4C58B 3CPLB 2OFQA 2AQNA 1YPZE 1WG3A 2P5EA 2XG4A 4JANB 4F9PA 2BSSA 4L5FE 3TIDA 5EOTB 3L5XL 4IRZL 4JFDE 4AYSA 4YFDB 3FF7A 1QO3B 2XWEA 3V6ZB 4A39A 3ARSA 4YX2L 1H9VA 3ZDZE 2EDLA 2NNAA 1FNGA 4PLJC 3SDAA 4GBXB 4A2GA 5EF1A 1T7ZA 2FWOB 5HVHB 3TOPA 5GRYA 3O11A 4AEIL 2OL3H 2YD2A 2BNRB 3SE9H 2J6EL 3QCVL 3C6LB 4AMKH 1JZ5A 4Y1TA 2FL5A 4RIRA 3RKDC 4AQ8C 5ID0B 5E1GA 1SXCA 4Z7NB 1MFAH 1W80A 2BVOB 4M93B 4KJQC 1FF5A 1TJIL 5JPMA 3K1KC 3EJQA 4MJ6A 3V4VB 1A7OH 2B15A 1MJ8L 3EO9L 3BDYH 4LEEA 1I8KA 3NOIA 2ZP0T 4GW5A 4HCRA 4WDIA 2NY2D 5A1AA 1TVHA 1TEGA 3EOTL 1NWOA 3DDGA 1TMCB 1T22B 5FUOL 4X0NA 1RH8A 5HHPB 3GIZH 5AAMA 4GAGL 2W0LA 2EILB 1L0YA 5A16B 2P5WB 4M1CD 3P30L 4DN4L 3BEVA 3FHAA 4KWUA 1Z9MA 4P57B 3T3PE 1U6AH 1A7BA 2IAMC 5JIPA 3VXNA 4JB9H 4QXWA 4AQAA 4NXKA 1T1ZA 4BK8A 4DGVL 5SX5H 4S1SL 1HT6A 4QRRE 3D69B 1N59A 1NFDE 1W2KT 1XR9B 2I60H 4OI8A 2VXUH 4OD1L 2AK1H 1CDGA 3G6JA 4N2MA 1Q1PA 2F8IA 4JL1A 3TWCL 4PD4K 4PWHA 1LWRA 4HWEH 1TTCA 2G4EA 4JKKA 3ILDA 4MASA 2PPFA 1ZVHA 1U8CB 5CJBA 1L0QA 4MD0B 3NJVA 4JQIA 1SF3A 4S0SD 3DUUB 4JN1L 4BKSC 4K23L 1RJZB 5DMJB 5I8KL 4TSBL 4HIEB 5F0JB 2PW2B 5EU6E 3RB7A 4O2FA 2OYPA 3IWVA 3KPSA 5D6CB 5TK4A 3G08A 1K3ZA 4JRXB 1J1PL 3FRUB 3IFPA 1J8HE 3NRFA 3O8XC 4R8WH 2DMBA 2P44B 3OF6D 4GXVL 5EOQH 4JZJB 1I31A 4OZFA 3V0IA 1SJMA 2APVA 4MA7H 4WJKB 3NABL 3U46B 3OKDB 2DQEL 1H5BB 1MNNA 4R96B 5ESQA 3RL1A 2IANA 2XXMB 2IF7A 4NM8L 1F6AA 4P4KB 3STZB 1UURA 5CGYD 3DV6B 1ASQA 4EUPG 3Q8CA 2BK8A 5FC9A 2NLJA 1QZNA 1HXMB 2CJ3A 3HCVB 1C5CL 1KELL 4GRLC 4HLJA 4DEPC 1YAIA 3VD9A 2EDWA 3JSSA 3JYBA 4XWGH 4FG6D 4HZLB 3HJ0A 5DS1A 3B4NA 3RX9A 1YUKB 5I24A 3HE6B 4MNHA 4PG9A 3RPIA 5CBEB 3D87B 3DUSB 5AVZB 1PG7X 3V5HB 3ENEA 1N3NA 2Y2TA 1IAII 3U0WH 3MRHA 3BT2H 3F7LA 3AU1A 2F53A 2J55A 5E00A 1IEHA 1DJYA 4FG0A 4NZJA 5IR1A 1A25A 1EIBA 4GT7A 1UJ3C 4LLQB 3L4UA 5L2KA 4UOZA 3WFHA 4UQBA 5K59E 2A74B 3DXAB 5C09B 4BCXA 3BDXA 2J7LA 2ZKWA 3P4NA 2J2ZA 3BVDB 1NDMB 3EGSA 3OGCA 2Y7QB 3AADB 4UU9A 3QAQA 1UACH 2X4QA 3AVEA 3QXDB 4PRDB 1LL1A 1RSFA 4IOSD 1JN6B 3WUWA 2P8LA 1A7QL 3C5ZD 4FEIA 5EFIA 4WO0A 2HT3C 3T0ED 3WDIA 4K2UH 5ALBL 2AGJH 4BELD 4F2MA 5BXFA 4KUZL 3BP7B 3QCTL 2TAAA 3P3UA 3D33A 3PWPA 2NR6D 2ZKXA 4FQIH 5F8QC 1A1MB 1GGBL 2C34A 2R2EA 2OULB 3IDNB 1L7TH 3L1OL 3LPPA 3GB7A 1CZ8L 1DP0A 4PJCB 4YDVB 3X14B 4AENA 4QXUL 5CLZA 2K7PA 5LAXA 3TWYA 2V9TA 2YQ3A 4JO4H 1KENH 2CO7A 1TTRA 2YD4A 3V9EA 4LL9A 2I26N 1QRKA 4NFBA 5L88L 3BGAA 4RLDA 4XGZB 3TA3A 3DOIA 3KCPA 3ZHKA 5B38B 2BMKB 2WKLA 5HGAA 5B39B 3I9PA 2APXA 1HSAB 4CU8A 5DQ9B 3GSVA 5H94B 1AO7D 4NZTL 1KYAA 1J18A 4NO3A 2X9YA 3LZPA 1S9XB 5DZOA 3ZPDA 1KGCE 4Q14A 4WI7A 2EXYD 4ZS6D 2NYZA 2WXNA 4WHDA 4U6TA 5DVPA 2OCCB 2IFFH 4KFMA 5HYQA 3IFOB 5F1NA 2KKQA 4NRZB 5AD0A 2C26A 4TN9A 1JPGB 3BKML 2G3MA 4U0RB 3QFJE 1BF2A 4MAUL 5DQJB 3TEWA 1CFQA 1CTOA 3EKCA 4XVSH 4W6YB 3H7BB 2DWEB 2B20A 1N5YL 3NSFA 5FIEA 1BMZA 1SRDA 3NESA 3EADA 4A55A 4GQPH 4XOAA 2Y72A 2WK2A 5B1JC 2ESVD 5BW7A 4U1LB 5EA0H 3H9SD 1LD9A 2GW5A 2ICEA 3FCUB 5C0CD 3GSOA 1JK8B 3I85A 1CE6B 3M7OA 4ACPA 3GI9H 1F56A 3D0LB 4KTYA 3QJFA 3T4YB 2ZYRA 3VMPA 3MV7B 5D7JB 5I76A 1P7QB 3D6GA 3LKQA 5E4EB 2AABH 5K39B 4UM8B 1IAIM 3IMUA 2M26A 1XZ0B 1GJIA 3CHPA 3VI4F 3KJ4C 1WC7A 4A6YA 1J88A 2IALA 2C5DC 1N7MH 3JWDL 5DD0H 35C8H 4NAQA 5BS0D 2CJTA 2O5YH 5HYEA 2FWLB 3O4LA 4PP1C 1FFRA 1GMIA 5F6IC 4N9GB 4X6EB 2CCVA 3IE9A 3IPEA 4BKLB 1MFCH 2A4CA 5HDLA 2BVQB 1PX4A 1QBLL 3VRLE 1AE6L 1CGSH 1A7PH 3EYUH 4LXFA 3PNWB 3MROA 5DMIH 4HEPG 2YWYA 2DKUA 3BGMA 1XQ4A 2GB2A 3VXQA 1DSFH 1CR9H 2X4NA 4AQ1A 2P47B 1BLNB 2X5PA 5B7EA 3IRPX 2XWBA 3BPLB 5PCYA 1EUTA 2XQYK 5JQ6L 1MLBA 3X11A 4UINL 4WI8A 4IIQB 3WN5B 1JUFA 5AW6B 3FT4A 4KO9A 4DZ8B 5C0RL 2NY3B 4M1GL 2XTLA 2UUDK 3VMOA 5JXAH 1EXUA 1HVXA 5CLYA 2YD3A 4LCCB 1TQVA 3MA7A 4L1HA 5I6LA 2FTAA 3FU7B 3RZCC 2Q76B 5L2JB 2P46B 4FTVD 2A3TA 1KC5H 2F0CA 1AXTL 5KBKA 5IB5B 5CJOH 4XC1H 2FO1A 2ARWA 3IK2A 1QPKA 1T04A 3HVDA 4FKHA 3D5OF 1NCDL 4NHUA 5BUPA 3MFGB 1G7LB 4WENB 3VWKC 2W65B 4EUPH 4MQSB 2YRPA 1VACB 3VFMB 3IXTB 3VDAA 2QR0A 5I8CA 1G94A 3QZLA 2D9QB 2YHGA 4MS8C 2X7LB 4BFJA 2VLRA 2AC0A 4P07A 4FJ6A 1T83C 3RL2A 4X6DB 1N4XL 4KNSA 1P2CA 1C8PA 3UYPB 3ME0A 3OWEA 2UX6A 3CD4A 5DRXA 2ZAGA 2YXFA 3FQRB 4ODUA 1OHQA 3NG5A 1YEGH 1BQLH 2K78A 3VI4A 3BYYA 3HN8A 2PTUA 4D3CH 4S1DC 1KLGA 5IESH 3W9EB 4OLZH 3UZEC 1VFOA 3FH7A 4WUUE 1B0WA 5B22A 1IC4H 2MKLC 1KCSH 4M6NL 1QRNA 1B0RB 1SHMA 2YSTA 4R4FH 1RZJC 3V6OA 4L4VA 4PGJA 3LPWA 5DR5H 3WKQA 4U7MA 3NK4A 4Y16D 3BRFA 2DQHL 1TT6A 3BIBX 5JIDA 3Q5OA 5FKAB 2HH0L 1F8TL 4LNRA 1TTAA 1OCWL 2VDML 1ZDSA 3D48R 5T8IA 2QGCA 3MBXL 3MHZA 2QVKA 3LV3A 2DEYX 1ZY9A 5IHUH 1FG9C 1HH9A 3RUGB 3FU6A 2P52A 1JZDC 1GTNA 4W4OC 4PJ8A 4DO6A 4RX4D 2F8VA 1OF0A 4F33B 6PCYA 5J06A 4HJSA 3QIWB 5LWYH 1XCQA 2L8AA 3MN8A 2BCKA 3UTZB 3CZEA 2ZYSA 2CU9A 3WO3B 2OMUB 3VU1A 1NFIB 2OX5B 1IGMH 5DJDB 2WTRB 2JMRA 4ZT1A 1IGCH 1DQMH 3O45B 1NSNL 4Q6IB 2AJZA 2BIQA 1JTTA 4FX5A 2C1OB 1RHFA 4LSTH 1KJVA 3MZGB 3CG8A 4CBZA 3DIVA 4MMYA 3FT9A 4I3SH 3WDJA 1C16B 4OFKA 1P53A 4LFHG 2J8UB 1YUHB 4H4NA 1WO2A 5T5NF 4BFEA 4F3FB 1BOGA 5MENB 3QYMA 2C9XA 2AXWA 1AD0B 5IFHH 4PGCB 1SLWA 5LBGA 5KN5B 5HD8C 3SDXF 2O5ZL 5J3HC 1MI5D 4FXTA 4NZUL 1UGKA 2EZ0D 5CEXB 5T3ZE 5EORH 4AGPA 4HUWA 3E6FB 1OP3K 4RAUA 2XIDA 3DETD 3DMMA 1QSEB 4K9EL 3EF4A 2DJMA 3LIZH 4M7KL 4WEBH 2I07B 5HDQL 2IAMA 5SWSB 1NLDH 2X4SB 2SEBB 3ROOB 1BZ9B 4EZKA 5C0EA 2YPLB 2Y4SA 3KPMB 5CMAB 3NCWA 4QLWA 4OIBA 3UIZA 4XCEB 1G7IA 3BUQA 1FO0H 4DP4X 2WO4A 2QSCH 4F27A 2BW4A 5M7QA 3I75A 4APXB 3MBED 3RGVC 1SLXA 2VKXA 2XZQL 2NXYC 3A47A 1A4KB 1ORSA 4PUBH 1XSOA 1JHKL 2Z7WA 4JEGB 3QQDB 4U1MA 1K4CB 2HTKD 3JBG7 3BEWB 2OMWA 3FUMA 3OLGA 3VXRB 1UM5L 2CLZB 4NBYB 3MXVH 1GIGL 4NQED 3UADA 1T20A 4BSVB 2XX1A 2EDOA 2B1AH 4AJWA 4J5VA 1UVQA 2F19H 4BE5A 5KBNC 4N8UA 3DK0A 3QEQA 4GKOA 3KH4A 4IRJD 3FQTB 3NIDE 4D7PA 4XR8C 4OJFL 2FZ3B 3VD0A 4U6XA 4N0FB 3MRJB 3F7VB 1MHEA 3RTQC 4DWHA 2X6MA 3PWLA 4I48B 3WTYA 5DRNB 1U41A 1C12A 3ABGA 1NBCA 4FGMA 4NO5A 4XNAA 2ARJB 5FYKL 4NXSA 4DN3L 1IBFA 1KGIA 5D2NC 2R4RL 4GRLA 4Z76A 4FCHA 4U3CA 2P42B 1ZT4A 2I27N 5FEBA 4LVHC 1CICC 1NMCC 5CJ5A 5BPPA 2G5BB 1T4WA 4L29B 5F7WC 3RFZB 3FO0L 1FNAA 2R23A 4PRPA 3SDXA 4EZMA 5KVGE 1J9TA 2GTZB 1UWYA 5L4FA 1KJ2L 1ROWA 1MRFH 2OMTA 5EZPA 1TQBC 2HCZX 3B3BA 2YAFA 3CBJB 4B96A 1TQTA 2CLRA 1P6WA 1UJ3A 2X28A 3R06B 4Y2NA 5GJSH 1HILB 4ODHL 4KI5C 4FJZA 1YNKH 3HRZC 5T1LD 2GJ6A 3FCSB 5K9QI 3DO7B 4K3HA 1IAOA 2VMDA 2ZOKA 3FUHA 1D5MB 3PAZA 4AL8L 5D8JH 1I3RA 2A77H 3GMRB 5CN1A 4Q8BA 5AWNL 1U92B 1GMEA 4N20A 3SGEI 4AMWA 3BPCA 1KYOJ 4NKDB 5BO1H 2HZHA 3IJ9A 1BFOA 1XGTA 2Q86B 4M5SA 5JW4N 5AFAA 3HC3H 2ZXQA 4LDOB 5TE6L 4XP4H 1F1GA 1FHNA 3W9DA 1XR8B 3SKOA 3MI6A 3NA9L 4R97C 1PFCA 3SO3B 1OF2A 3P2BA 4NQDA 4I77L 5H2BA 8PAZA 3EJZC 4CAGA 1U3JA 4NZRH 4DQOH 4HUXB 4TQEH 1RURH 4FNRA 2RTTA 4OZHE 5D4HA 5GJTH 3UMTA 3NQIA 1NA8A 2NY1B 3E7JA 4CKVX 3ARBC 5IMOA 3MXWL 4U3SA 3UCQA 3ZKXB 1CB4A 4BHUI 3O3AA 2Z31B 2VDMB 1E30A 2HWZH 4PJFF 4FMFA 4UQDA 4MA3A 1QFOA 4P5RA 4URKA 3JUZA 1E9QB 4ODWA 2AVGA 5F6HI 1HX0A 3OR6B 1TYJA 5HY9A 5J1SC 3AREC 5BMFL 5E2UL 4NNPL 4MJIA 4TNWF 2D73A 3CFEB 4I9XA 4O5LL 4XNZC 3CVCA 3KPOA 1HU8A 4LHUG 5FCUL 1KXHA 3MOAL 4O51A 4PJAF 4HK0A 2NYYC 4CVUA 1S9VA 4KI5E 2EE3A 2XN9A 3IS0X 5FGCB 4JGNA 2YC1B 3OKLA 1JVLA 5C7XL 3GI8L 1YEHL 5EO9A 3QCUH 1N8ZB 5I71C 3BKCL 4L3ED 2AEWA 2LGNA 1XH1A 4JGJA 4DPRA 4NM4H 4ENED 3IMSA 4JO2H 2G2PA 1IC5H 4HCFA 1GZHC 3JTSA 1KJ3H 1N6VA 4IRSB 1AACA 5I8OH 4P3WA 3AGWA 3GJFA 3KYNA 1MCWM 3O0RH 1D7BA 4AXWB 1A1OB 1J05B 2Y23A 1HHJA 5EC1A 2OAAA 1F13A 3OHMB 4L05A 2AXFB 1NLBH 2GEEA 4KFZC 2CBTA 4LF3A 4Z77A 2NY5H 2O6PA 5ABZA 4PS8A 4NYLA 3UJIL 5HHMB 1P5UA 4G8GE 4PRHA 1OWWA 5F89A 4HS6A 2YMTA 4YDJA 4BINA 2VXSL 2CJUL 4J3SA 5DUPL 4X50A 5F96L 1MIMH 1PVHA 3TNMB 4XO9A 1YMHA 4R0LC 1PD6A 3ARWA 3LD8B 1UD3A 2F7PA 4C83B 3TBWB 2OK0H 4B41A 1I9JH 1QPPA 3Q2VA 1USZA 3E0GA 3PPEA 4YSQA 1SOXA 3FBQA 4ETYA 1G9NC 5IBUB 1CFVH 3PP4L 1BBJB 1MCOL 1FAKT 1MAJA 4X7TB 2HKFL 3ZUCA 5EBWB 3G7TA 1UXSA 5EDXA 1DZ0A 4NENB 3O0LA 3MRGA 4NJAH 2MMXA 4LE8A 1KBVA 5KSAD 5FKPA 1S7SB 1NAML 4GKNB 4LP5A 4PRIB 3TN0D 2E46A 2ODHA 4OLYH 5ANME 3ARDD 1PJ9A 4J3VA 4XVOA 4MBOA 5I75C 3JVFC 5BRPA 3QUYD 1MHPH 5F71A 5MP6L 4PJFA 3T5WA 5K9QG 2C7FA 1MUJB 1YEEL 3EDDA 3HBGA 1MCIA 3RI5K 5D1ZA 1OGAA 4DO5A 1QW9A 4UT9A 3SDCA 3U9PL 3A24A 1UH4A 3MUGA 4TVPD 1P4BL 4K7FB 1H3PL 1URLA 4NQQA 1AIFA 3QJRB 4FJYA 3L9BA 5H35A