1WA0X

Crystal structure of w138h mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPHHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X02
4DP1X 3EH4B 3NJFA 2IDFA 1PMYA 1ID2A 3ABLB 5D4IA 3AY2A 2IWKA 2OJ1A 2EINB 1GS8A 1SFHA 2P80A 3NJKA 1A4BA 4PCYA 2W8CA 4CSZA 1NPJA 3FT0A 2VM3A 1L9QA 1NTDA 1BQKA 1JZIA 3X1GA 5F7BA 5AFAA 1GY2A 2RACA 2PCYA 1V10A 1A4AA 2CAKA 4BK5C 4BXSV 4CSPA 4YVUA 1NICA 3FQYA 1BQRA 3IBOA 5D4JA 3UADA 1NPNA 2FQEA 3ASNB 1JZEA 4HZ1A 2PPEA 2WO2B 1JZHA 2JXMA 2YAQA 4YVNA 2XV0A 2GI0A 1AS7A 2HXAA 2H47C 4AKQA 3DKHA 1ET8A 1MG3C 3AZUA 4YSOA 5PCYA 4A2GA 2AVFA 5A7EA 1E67A 1RCYA 2Q5BA 4YSDA 4HHGA 5I6PA 4YSAA 2EILB 4E9YA 4K9JA 2ZWNA 2IDTA 4KOBA 4BWWA 4E9SA 3WIAA 4FAAB 3C75A 2AZAA 2N0MA 1A65A 1BXVA 2EIKB 3N2JA 4JKNA 3ASOB 3ZDWA 1ASPA 1M56B 1SHWA 7PAZA 4UF7C 3FPXA 5F7AA 1NIDA 5B1JA 1N68A 1AZRA 2EIJB 4AX3A 1PLAA 3H4HA 2XLLA 2XX1A 3UAEA 1OCZB 1PZAA 2CBPA 3QJQB 2PLTA 1QHQA 1SFDA 1AIZA 2GIMA 4E9VA 1J9SA 3DIVA 3NT0A 5I5MA 2R7EB 3T6XA 3FSWA 4NB7A 2A3TA 3NYKA 3PXLA 3PAUA 1ILSA 4E9TA 3HEIB 5B3SB 3QJUB 1KCBA 1ILUA 4PAZA 1JERA 2EIMB 1BEXA 1JVLA 6PCYA 1KBWA 1WA2X 2ZONA 1AAJA 2PP8A 2E86A 3NSFA 1WS7A 4JHVA 2DWSA 2UX7A 4NAJA 3IE9A 3FS9A 4HCGA 1W6WA 2R7EA 1IUZA 1W6LA 1OCCB 4JHUA 4DP6X 4QLWA 4BDVB 2Y69B 4G7QB 2XV3A 1NZRA 2YARA 1AOZA 2LLNA 1N70A 5EHFA 1GY1A 3FYIB 5I6MA 2PPFA 3SBPA 3FU8A 1IKOP 1PZCA 3NJIA 1X9UA 2HZHA 1E5YA 4Q8BA 1TU2A 1AZCA 3NP3A 3TA4D 3EF4A 2GC7C 1PF3A 2TSAA 2CALA 1HAUA 4HALA 2HX9A 1V54B 1KDJA 2IDQA 3NJLA 5D4HA 1CURA 4BXVA 1YLBB 5I6OA 4GP8B 1A4CA 5I6KA 3KW7A 4HIPA 1RKRA 3NJGA 2YQBA 2UXFA 4A2HA 2VW7A 3T6VA 3MX0B 1CUOA 1W8EA 3V9CA 3IN2A 1JZGA 1OF0A 3NSYA 1KYAA 5B1KA 4ZK8A 2XV2A 4E9XA 3H4FA 4N8UA 1AR1B 3BVDB 2OV0A 5FC9A 5I5IA 1SNRA 1MDAA 3FYEB 1TEFA 5I5JA 1I53A 2HRHA 3EH5B 1M57B 2VSKB 3L45A 4P5RA 2MTAA 2IWFA 4GY4A 3UACA 5B1BB 1UATA 1VLXA 3N55A 4RH4A 1FWXA 1BYOA 2VW6A 1KGYE 3QJTB 4YL4A 3OMAB 3OMNB 1E65A 2BZ7A 3X1BA 5B1AB 1GYCA 4HCFA 1PCSA 2GC4C 2TSBA 2GB2A 3BQVA 3S3CB 1GW0A 4G72B 3NJNA 3OQRA 2IWEA 1TKWA 2AANA 2FJSA 3FQ1A 1FFTB 1BYPA 5E9NA 3OMIB 2BW4A 1L9SA 3X1EA 1PLCA 2WSDA 2VM4A 3NSDA 4G7RB 4A68A 3V9EA 4KO5A 3AG3B 1BQ5A 1L9OA 4UANA 3TU6A 3U25A 3AG1B 2BWIA 4G70B 2YAEA 8PAZA 2BP0B 3D12B 2YAMA 5I26A 3QJSB 2GHZA 2YAFA 4WKXA 5B7MA 3ERXA 3X1FA 1J9QA 4HAKA 5I28A 2VN3A 3EHBB 4GP4B 3OD3A 3ZBMA 1E30A 2GBAA 2J56A 1KBVA 2AFNA 4G71B 4KOCA 1J5CA 2BW5A 1AG0A 1J9RA 1E5ZA 2WO3B 2J5WA 4E9QA 3CZUB 3UABA 1ET7A 1OOWA 4KO6A 1BXUA 1DZ0A 2CJ3A 1EHKB 1OCOB 2B08A 2I85A 3PLYA 4DP8X 2XYBA 1CYXA 3PAZA 3QPKA 1NINA 4Q89A 2P80D 1ASQA 5I6NA 1DYZA 3S3DB 1OV8A 3WNIA 9PCYA 4A2DA 1SDDB 3CVDA 1OE1A 3PAVA 5TK4A 3WG7B 1AS6A 4F2FA 3T6ZA 1RZQA 2VW4A 2HX7A 2FT7A 3OM3B 1IBZA 4GYBA 1KCWA 5B1JC 2IH8A 2JKWA 1NIBA 2Q9OA 1AQ8A 1GS7A 2J57A 3CDZA 5PAZA 1PLBA 2Y1AA 5B7EA 2J55A 3FQ2A 2GSMB 3GXUB 2IAAC 1JZJA 3NSCA 1ETJA 2XWZA 3PCYA 4GP5B 4F2EA 1NWPA 1SF5A 3NJHA 3UAAA 1AACA 3JT2A 1FA4A 5IY5B 1KDIA 2BZCA 2DWTA 2XU9A 1AZUA 1B3IA 3NJMA 7PCYA 2IH9A 3ABGA 3AW5A 4YSPA 4MFHA 3S8FB 4KO9A 1R1CA 1IBYA 2VMJA 5I6LA 4AZUA 1ZIBA 2XXFA 4QKTA 3TBCA 4BWTA 2BP0A 2PCFA 4DPBX 4ENZA 2DYRB 3WKQA 1AANA 2FT6A 4DP7X 1JXFA 3T6WA 1NIFA 1GSKA 2YXWA 4GXFA 4YSCA 2XX0A 2H5UA 1PZBA 2QDWA 1WAEA 1NIAA 2BO0A 3TASA 3IEAA 4W9ZA 3T71A 4YSTA 2PPCA 4NERA 2X88A 3X1NA 1AZBA 1ZDSA 3IN0A 2YXVA 3CVCA 1SJMA 2XXGA 1V55B 1XMEB 4A66A 1J5DA 3DTUB 1PNCA 2FNWA 2PP7A 1CC3A 4HCIA 4X4KA 2X87A 1MG2C 4DP5X 2H3XC 2B3IA 2UXGA 1L9PA 2DYSB 2FT8A 2UXVA 4A2FA 1RZPA 1T5KA 1ZDQA 3CVBA 3FSVA 1XB8A 1QLEB 4L0PB 2UXTA 5AZUA 2FQFA 2BHFA 3FU9A 3SBQA 4DP2X 1NDTA 4A67A 1F56A 1A8ZA 4A2EA 4YSRA 1XB3A 3CG8A 3NJJA 1JZFA 2VSMB 3S3BB 3GYRA 1M9WA 2IDUA 3WKPA 1KV7A 2CCWA 1JOIA 2W88A 2ZXWB 4DPCX 1L9TA 2YAOA 3X2QB 1WS8A 1WA1X 1JXGA 2ZOOA 4DP0X 1MZYA 3QQXA 4EF3A 3HB3B 3KW8A 3TBBA 1SF3A 1TEGA 3FU7A 3FSZA 4WTQA 1BAWA 1HFUA 3QJRB 1GS6X 2AZUA 1ZIAA 3WNJA 2NRDA 1L9RA 1PY0A 2FQGA 4HHWA 3ZIYA 4P5SA 2PPDA 2FQDA 1ADWA 1OCRB 4W1TA 4E9RA 2XUWA 2BP8B 2HX8A 2DY2A 4G7SB 4DP4X 1GR7A 1NIEA 3FSAA 3AG4B 2MRYA 4E9WA 1NWOA 3S8GB 3FU7B 4YSSA 4YSUA 1A3ZA 3GDCA 6PAZA 2CUAA 1WA0X 1CYWA 4TXVB 3FPYA 1QNIA 1AZNA 4DPAX 4M4RB 2BP8A 1MZZA 3ABMB 2QPEB 4KNSA 2FTAA 4DP9X 2QT6A 4N4YB 2PPAA 5TK2A 1OE2A 1URIA 3JTBA 1ASOA 3QJVB 2FWLB 4UAHA 1BXAA 1X9RA 1J9TA 1ZV2A 4KNTA 4YSEA 2BWDA 2YAHA 3H56A 4FA7B 1JVOA 3WI9A 3ABKB 3CDZB 3RYMA 1PAZA 4AI7A 2HLEB 1IC0A 4AKPA 2HRGA 1JXDA 5ANHA 1ZPUA 3NP4A 1AG6A 4AKOA 2OCCB 2I7OA 1AS8A 3SBRA 1SHXA 4BDVA 2JFCA 3UGEA 4YSQA 5AKRA 1PNDA 4KO7A 1HAWA 4F7KA 1XB6A 2XVBA 3SQRA 3T9WA 1SDDA 1ET5A 3AG2B 3PPSA 2QPDB 3MBWB 3EH3B 2I7SA 2QDVA 2UX6A 2YAPA 2PP9A 4BWUA 4KNUA 4M3HA 5LDUA 5B7FA 2DV6A 3ZX1A 1OE3A 3G5WA 2IDSA 1EZLA
chains in the Genus database with same CATH superfamily
5F3BB 1K8IB 2O5ZL 3FZUC 2X9YA 1FO0L 4HF5L 4FULA 4L23A 1R19A 4JPKH 3AY2A 1OSYA 5FYJD 3CUPA 4Z3JA 4MTMA 3S5LB 1L0XA 2QVMA 5JW3H 2E7HA 1G9EA 3D7PA 3G5VB 4XN2A 2H3NB 3WIIH 3B9VA 2N4IA 3SDDA 2YPKA 5I1LA 3RTLA 2UZIH 3GMNA 2ZKHH 1OK8A 4ZNEE 2VB5A 2C1OB 3T8MA 4U6YA 2O5XL 1MFDH 3QFJA 2ZWYA 3DDGA 3E2HC 4K3GA 4Y9FA 5E08L 3M7OA 4XGZA 5EPMA 3HHSA 3TT3L 3V9FA 2VR8A 2F7OA 2ZOLA 4FKEA 1XH1A 3MRIB 1XGYL 4GO8A 3VGDA 2VN4A 4XZUA 1MPAH 3IETB 4Z7NF 4DFHA 4MA3A 3QE5A 2E8YA 3V4PL 3K3QA 1TQUA 3KLKA 1MCJA 5A7EA 5D96C 4QTIH 3A6BH 1AFVH 2C3XA 3BQUB 3UYPA 3VXMD 5JDJA 4X2UA 2NUPA 4NUPA 2AK1L 4XCCH 3MOAH 3LHAA 4K9JA 4KX9A 4N0UA 2RQEA 2OMTA 4KHXL 2H9GB 1FNEA 5JORB 1FE8H 4LSSL 4PRIA 2JNZA 1G0YR 5JHDB 2LVEA 3QO1B 4FJ6A 5EORL 4LU5H 4R97C 4N2NA 4RVBA 3S37X 3DX8A 3H9YA 4X98B 3SKUD 4POYA 5BZXA 2WXOA 3DRTB 1RUQH 3QXAB 1T83C 1DE4A 4HMDA 3SJVA 4W9FC 2WNGA 4M7LL 4JJ5A 5HGBA 3UJTH 2GIMA 1QLRA 3N1FC 4Y1AB 4TUOB 4D8PB 4N5EC 3CSYA 4G9DB 5I75B 5SWSE 5H4YA 4G59C 1LP9E 2WBJB 3F7VB 1KIQB 1BQUA 4AIEA 1LO2L 4AUJA 2NQDA 4UM8B 1KCBA 1JCVA 4GKOA 1U58B 1IFGA 2OI9C 5SX4H 3I6LE 1ML0A 2GT9A 3QEQB 3T3MB 4KWUA 2YKLH 5EN3A 2C9XA 3HUJE 2Z7WA 1EQWA 2BSTA 3EO9H 3P11H 4LLMB 3MNVB 4QAWA 4JFQA 2UX7A 4LDLB 1TZOA 4ETYA 1W6WA 2IV9A 4F1ZA 5IBLD 3KDMA 3TNNB 4P23A 3MGTB 1BCIA 4MBOA 4BDVB 4CN6A 1FFPA 1WGVA 2YARA 4MJ6B 2E9JA 1ECZA 4R96B 3ECWA 1DO6A 1SOSA 1HKFA 4A6YB 1BF8A 4XPBH 1EEUA 3MO1A 5ERWA 4JFTA 2TRHA 1TU2A 4HGWB 1M42A 3MCG1 3WBDA 3AGVA 1IBBA 2V5YA 4PRHD 3Q6FB 4DK6A 3PGFH 5D7KD 1KYOJ 1VACB 1K4DB 3K71B 1U3ZA 4Z7OE 5DD0H 4PJEE 1G6RA 4RMVA 4ZOBA 5E2TH 3NJLA 4Z77B 1IAIL 4XPGH 3C5SA 2YPLD 1UJ3C 2X10A 4X8CA 4JN1H 1R5IA 2WVTA 3QA3A 4HPYH 3UTTD 3ET9F 4BFOA 5BO1L 4OBRA 4HIPA 2VQUA 4XCNB 5GRUH 1ULVA 4MRBA 1G4MA 2CR3A 4DZBA 4FJZA 4HETA 4PB0H 4PWEA 1ZOXA 4M61B 1FV1B 2OJEB 1UCBH 3BMVA 5L8KB 1TVBA 5I1GL 2BSCA 3MYJA 4JFWA 3QNZA 1I3VA 4Z7VE 2J25A 3NFSH 2CHNA 2HFFA 1XR8B 2Z92B 4TSAH 4ZXBD 1FSKC 2NW2B 1XAUA 1KJ3H 4Z7WB 3C12A 1XGUA 4NN7C 4V1DB 5TPWL 1I8LA 5IW6B 3QEHB 1K8DA 2HWZL 3E3QE 4G43B 1T2JA 4HBCH 4LL9A 5FECA 2VMDA 4OW6A 4NO0D 2VH5H 4ODSH 3B7SA 4XN5A 2XTLA 3B7TA 2ITDB 3QAZB 5BS0D 2EEFA 1P4BL 5IB3B 4M00A 4G8GA 2Y1YA 1CDUA 2YKKA 1NGXB 4XOAA 2MPVA 2Y36H 2ZJSH 1GTNA 1KLUB 1YUHB 4WAFA 1KB9J 5F89A 3VO0A 1NQBA 2XG5A 2DI7A 2JTDA 1FL6A 3BH9B 1T0MB 4JO1H 1L5GB 2R4SH 3OLDA 3OSKA 3WNOA 5E9DD 4ZJ9A 3SDAD 2XRAL 4HUNB 1IC7L 4NC1E 4PI2A 3TBWB 4M8VA 5DD6B 3NJNA 4BZ2L 4Y4KB 2XSKA 4LHUG 4GRLB 4E68A 5HYQA 5E9NA 3VMNA 2BW4A 2G2RB 2GIYA 2H2SD 2YRLA 4JGJA 4N0RA 1E7UA 2VIRA 5DYOB 1K6QH 1JPEA 2XKSA 4ZDHB 4FF9A 3W39A 3WS3B 1IGYB 4KI5C 4X4YB 1VFUA 3GZPA 3Q2WA 3QZMA 4JPIB 4KO5A 4BZYA 5JORA 3GXPA 1XZWA 1JPST 1RLWA 3CX2A 2BH0A 8PAZA 4Z3FA 2Q76B 1QR1A 2YAMA 3A4EA 4J7RA 4ZMTA 4NQEE 4Z7OF 4J3TA 3QQNA 2VR3A 4FNQA 4PRBB 1T3FB 2HKHH 1INEH 3O3EA 1JRHH 1ACZA 4PJHE 1WWBX 4BH7B 2KL6A 3IFPA 4AM0A 2P24A 4BFBD 3KHOA 3MRMA 4MA1B 4S1RL 8FABB 1RY7B 1K2DA 3L3JB 4NQCE 1MAML 2DYPD 1IGJB 3KPRA 1GC1H 2G2NA 1I8KA 3GHEL 1ROWA 1GPOL 1ORQB 2QFPA 2HT2C 1HXYB 1UWGH 2DMGA 4UQ2A 1QQDB 2VQ1A 2ZUUA 4HLJA 1NC2B 3G5XA 5LCVL 4I3SL 4Q89A 2OYLA 2ATKA 3A6OA 3BO8A 5LVEA 2KS0A 3KPMB 1AGEA 4HC1H 1G7MA 2YPVL 3SPVA 3KM1A 4AQZA 4PJFF 3WN5C 4BCYA 5KUKA 4E42A 5DO2C 2MOVA 4HIIB 3K81A 3BIKA 5IVZA 5EF3A 2YZ1A 3GMQB 3PWJA 1S6NA 2GK0A 4PHXA 1ZMYA 4TVPL 4HSQA 1NCUA 5BRZE 4PJIB 3N43B 4QHMB 1KB5A 4AMKL 5DJ0A 5DHYA 1LMIA 2ZWSA 4K5LA 4ZTPL 5CEZL 1VZIA 2AJZA 1BMGA 4EVNB 4XRCA 3X14A 5D2NA 1U8MA 3GXUB 5FO9A 2AP2A 3PHOB 5DA0B 4XNXL 3U4EB 1WBZA 4HLEA 4KGLA 1Q0XL 2HFTA 1PEWA 1NFDA 4U2YA 4P5TD 4MCZB 4WWKA 1QSFB 2NDGA 4MLIA 5L8LB 4FQJL 1CLVA 1I1FB 1YSOA 3CDYA 3MJ9L 5E7FA 4GKSB 5EBMA 5EV7A 3KWTA 3RY6A 3HZVA 4JM4L 3RJOA 1UC6A 5ICYB 3G08A 7PCYA 3LB6D 4MFHA 5GGUA 1KSRA 4GI8A 2VMJA 5DGQA 3X3GH 4C56E 2HWZH 3TO4A 1U93A 2OSYA 4QKTA 1ZEAH 3V4VL 5EFIB 4ODVH 1KJ3L 1JPFA 2DYRB 1AANA 2AVGA 3MQIA 4CA4A 3EJYC 5AZ2L 4DN4H 4W9DC 4PSPA 4EXPX 3T6WA 3BHBA 2EDEA 3BFQG 2H5UA 3DOSA 5KSAD 1A14L 3S36H 1PX3A 4GBXA 2WWMC 3T71A 3DX3A 1S7QA 1S7SB 5EU6B 1WTGT 5HI4D 3MYZA 4M5ZL 1PD1A 3CMGA 5LHDA 5FX3A 4ZW7A 1UG9A 3V0HA 1KB5L 5CFHA 2GTWB 1PNCA 4R5XA 1U3HB 2C4FU 3KD4A 4H13C 1ZEAL 3V4VH 4YXLL 5KANI 2JJTC 4QHUB 2JCCA 3MZGB 3VFGH 2W65A 1I8MB 2F58H 2VDNB 3K5RA 4YE4H 1QLEB 5B1CA 5AZUA 3T77A 5IBLC 5T1MB 3ZE1B 4B5ZA 3LPFA 3MV9A 2VDPH 4Z7QB 4A2EA 2VE6B 3CG8A 3H3PL 1AE6H 3EAKA 2AV1B 4L1HA 5IQNA 1N3NB 5KVDE 1QYGH 1NAKL 4JLRB 3S2CA 1IEAA 2WZPA 4JGUA 4HS6B 3D52A 5D6CA 4NN6C 2OAAA 3FUMA 1CD1B 3FO1A 2ZYHA 1YMMA 4PRPE 1QSEE 2ATPA 3BLKA 4FXKA 4ZAKA 3VX1A 3FCBA 5C0AB 5CM1A 4EF3A 5J3HD 3FO0H 2YKLL 1ZWIA 3FCSB 4PGEA 2V2XB 1E4XL 3WS6C 3P9LA 1EJ8A 3LKOB 3QORD 4GS7C 1MJ7L 4N2GA 2Z91A 5D2NE 2A99A 2AZUA 2BVQB 2NR6D 3OJVC 1ZE3C 1HH6B 1X5GA 4DFIA 5IW1A 4E9RA 5GQBA 3VI4B 4MJID 3ZIMA 4LF3B 1VAHA 2NNAA 3GMPA 4KJQC 4WU5A 1FFOB 1GR7A 2EJ1A 2V9UA 2FWUA 3CX5J 1F4AA 4XOCA 4WLCA 5FHAH 3IRCA 3OZ9H 1FFRA 3BGFC 3WNKA 5I76B 1JIBA 3RX7A 4EUPB 5DFVD 2CDGB 3M88A 1GGBL 5E51A 3DLQR 1OGAA 3OHXC 4KJWC 1UWEH 5HHOA 4MXQC 4XMTA 1LO5B 2J6EL 4ATWA 2YA1A 1NCDH 3NACL 5JOPD 2YPLE 1YECL 2DLTA 5D7IB 4IEFB 4KY1H 4YXKL 1RIHH 1TTGA 1JTOA 3GRWA 4IRSD 4ZPVB 5LQBL 5CJ5A 4X80H 4KNSA 2R2HB 4P9HH 3Q5YA 2VDLH 1XSJA 4PP1D 1VJSA 4JDEB 3DJRA 3VGFA 3BN9C 5TDNA 1OARH 4XCFH 3K46A 4K07A 4RFNC 2FB4L 4YJZL 4NYLB 1X9RA 4XPHH 4AEEA 3TBVA 3RX9A 4Y5YC 3LN5B 5JR1H 1MPAL 1N64L 5D1XC 2VM9A 2AC0A 3UPRB 1FG9C 2PYED 4N0UE 1S4IA 5EOCH 3V4VA 1P6WA 1W0VB 1IM3B 4D9RD 3VU2A 2LTQC 1A6TA 4LCWE 1J5IA 4NLHA 5JPMC 4I0PC 3NABH 2FSDA 4APQD 3PWVB 2PWEA 1AKJB 1UXSA 3ZGHA 5J1SC 1Z5HA 3G6JB 4J4PA 4UTAL 3F05A 3MCYA 1CU4L 3N04A 4AQ1C 4DGUA 4KQ3H 3ZW3A 4RLDA 2DOCA 2W0PA 1CXHA 2EYSA 4W4OC 1NBVH 2EO7A 3FCTB 3QWOA 5EO0B 5SWSD 1AVAA 1U93B 2YAPA 3US1A 4BWUA 5B7FA 2W80C 4LRNL 4PS8A 5TDOA 1NGWB 2JI3A 3W11C 4XNUL 2X42A 3AXLB 1AZZC 2E59A 3M86A 4DGVH 3LD8C 2IDFA 3CK0L 2GEQA 4HJJH 4UM8A 4GLRH 1IARB 4CVXB 2ARJQ 3KYAA 4XVJH 3F58L 1BJ8A 5KZCB 2R1WB 2VNCA 3VA2C 4PJXA 1HILB 5E0FA 4MMZC 3T8XB 2X1XR 1L9QA 1AH1A 1JPTH 1H0DB 5KYYA 2GBVA 3SJVB 3RUGA 5DEFB 3KPLA 4RGOH 4M1GL 4HUCA 1TJMA 3L1FA 5DZVA 4GW4A 2JXMA 4NPYA 2XQYG 2PO6D 3MRLA 5GRUL 2V0AA 3ARGB 3AT0A 3ALWA 2L8AA 3OLGA 4LCCC 4B6ZA 3I74A 1P53A 3EGXA 4JRXD 4QYOB 2G60H 2Z31D 4LL1A 4XC1H 4DEUA 3DROB 3U9PH 1U8NA 4XBMA 2GCYA 4HHGA 4KK8C 2OR8A 4OAWA 3ZYJA 1JZ8A 2H6PB 2EILB 2EDYA 3SKMA 2ICWJ 1OXYA 2VDRH 5CNHA 4E9YA 3TV8A 4GMTL 4M6NL 3HG2A 2Z4QB 3SHSA 3BPNB 3LPGA 4X9YA 4EI5D 5IIEB 4HSAC 5AZEL 1KBKA 3AREB 4H40A 4MAUL 3K2IA 4JRYD 3SE8L 3RGVC 3HC4H 4P5TA 1E8ZA 2X4OB 1TQBB 4U31A 3ROOB 1WUZA 1RZIA 4FL4C 2I9TA 1EHLH 3O8XB 3GSVA 4FE9A 3PL6D 4Q9QH 3VU1A 2HVJB 3HB3C 4OCWH 4NXKA 1FAKT 5IT2L 4WDIB 4X7SL 5DUPL 3VUAA 2ZPKH 3LEXA 1B0RA 1J18A 2Z9TA 2NXYD 1WP6A 4FG6C 4NB7A 3HC3L 1HQRA 1MH5B 4YGVA 2NZ1A 2UZXB 3HEIB 2Y7NA 3QG7L 5I8OL 4K3DL 5K9JL 4OB5H 4AK2A 4NP4L 1LVEA 4G8GB 1HL4A 3TZVD 3BI9X 3TL5A 4U1MA 4G5ZL 4NO5A 1F13A 1MOEA 1A9EA 1QLRB 4D8PA 3UJTL 3VRIB 3F00A 3IE9A 3GJEB 3EXJA 3SPHA 2Y2WA 4IOFD 4MAYA 1OCCB 3FKUS 5HY9B 4H2CA 2R2EB 4X0KA 5GS0H 2F7PA 4G7QB 1NZRA 4RMBA 3NAAL 1AOZA 3KVQA 5INDA 3FUJA 1Z9SA 5EORH 3DWTA 4I4WB 3SBPA 4GUOA 4NAMA 4DQOL 3QG7H 1HOCA 1F97A 2IO5A 2JK5B 1SVZA 1BMZA 3K1DA 2R56L 4NKDB 4QJ5B 3CFUA 1RUKH 2WNWA 1EFXD 4F37K 1TITA 3I3BA 3T3MF 3GTTA 1RIHL 5LQBH 1IVTA 1AFVL 4MJJA 4GUQA 4XVTL 5J6HB 4Q97A 2PW1A 5C6WH 3SGJC 4Z7WA 1KEML 2EQDA 2VXQH 4EUPG 4ERSL 1E4WL 4EZJA 1IGFH 2WTPA 4JPSA 2CXGA 3OZ9L 4UDUA 4Y16D 3GI8L 5GGRB 4ZO8A 3DTXB 5T33H 3WJJA 1XX9C 4A2HA 4PRHA 1ZSDB 5JIPA 2WKGA 1W8EA 2LVCA 5CLYA 4MNQB 2IANA 4ODWA 2ENSA 3RFRA 2ODIA 1WJ3A 4NZ8A 3K7UA 1JI2A 2XZQL 1HE7A 3H0TB 3O45A 4I2XE 1XEDA 4NQDE 1MDAA 3ML8A 3ILDA 1LYQA 2WYTA 1EBAA 1ED3B 2NY4B 1V7ML 3MCLL 4PJ6A 5KJRH 1YPZF 2J1ZA 2L0DA 5JW3L 4K8RD 1RPQA 2VSKB 1DO5A 1ZGLP 3B1UA 1W8OA 2VLKE 1Z3RA 4MB4A 1JRHI 4EO5A 5B1BB 1UATA 2YEZA 5IVXF 4FNRA 1QSFD 4RBPK 3I2CL 3MV9E 4A6YL 2NW2A 3C6LD 2QKIC 2YBGA 3QXTA 2FSEA 2DW5A 4F7TB 3OJ2C 2YUXA 3SY6A 2IFFL 3MXVH 5BUPA 2H8PB 3QXUA 1E65A 4AE1A 1OAYH 4G8GD 2YUWA 1H3PH 2TSBA 4OZIA 1MEXL 4Y19D 3DUSA 1ADQA 2HPTA 1TPXB 1SMAA 2IWEA 3PJLA 1JPSH 3BVVA 1F4WH 1A9BB 5E5MA 1T1ZA 3VFTA 3L6FB 2VYRE 2M83A 5H37H 1JHKH 4AM0B 2OS7A 4XP4L 3L3IB 1I1YA 5ABAA 1S7XA 4NO0B 4PRNA 4PY7B 1FLRL 3GUTB 3TU6A 4W6WB 1KFAL 2J5LB 1KJMB 1VEOA 1CLOL 2MH4A 4ZX6A 1PZDA 4ODUA 3QNYA 4N2IA 1OSPL 2HJKB 2DQIL 3O8XA 3HE6B 2WQAA 4KJQD 2Y6SD 3B4NA 4YE0A 4NN6B 2B8OT 2UVEA 5FO7B 4IM8A 3HHRB 4NT6A 5GGQH 4NQTA 4ISVB 3RGVA 4CADA 1MCWM 1R3KA 4J28A 4YFEA 4JZOA 5GRVK 5L4FA 4FFYH 4FA8A 3QFJD 4KX8A 3UO1L 5C0FB 3ZYIA 4LVOC 4WKZA 2BP3A 2ITFA 1IMHC 4IOIA 4DVRH 1TMCB 4LL4A 3NSJA 5D1QC 2GTQA 1EHKB 4WFFE 5C3IA 4OLUL 3KEHA 2R0LL 4R90L 3MRFB 4WWPA 3U0WL 3KLHC 5DJAB 5IFAH 1A64A 2QVKA 4PJ8D 4IGBB 1K4CA 3UBXI 2P5WB 5SWZB 5ISZB 1Z3GL 4YIQA 2A73B 3EYVA 1C16B 3S88H 2EDJA 2OZ4A 2WYHA 1I1AB 4AMKH 3V6OC 2DMHA 2HG0A 5I1EH 5CP7B 5EZJB 3TJHC 3HPJA 5EZLB 3U7WL 2BVUA 3IDIA 3VCLA 2EE9A 1U30A 1VGKA 4P4RA 5HPOA 2AXWA 3PNRB 3PJNA 3WTWA 3ZTNL 3IDNB 3AUVA 3ULUL 3OB0H 4MA7H 3OGCA 5F3HB 5D7SL 5F44A 3CSGA 5J8OA 1Y0LA 3NJHA 5GHWL 3UAAA 1WZLA 2QHLA 5D9SB 5FYKU 2CIKB 1LEGB 4AWJC 1R5WB 4Y9GA 5HXMA 3BSZL 5FUCC 3OKMB 3MV11 5EU5B 3HVNA 5HYJA 1F8TH 5TDPA 1H5BB 3IDUA 2FR4A 4X80L 4X5WB 3H7BA 4XGZB 4S1DD 5EPMB 4D0DB 1XTMA 2Y2TA 2WBXA 1G9NH 3EJYD 4QY8B 4WW2A 4QXVA 4AT6B 4CVWA 3V5DA 1WAPA 2KPNA 3DPBA 4J3XA 3LH9A 3REWA 4BWTA 1YCSA 1XF3B 1VENA 3OHXA 4PWJA 1HXKA 1WFUA 1F6AB 1FNSL 1JSYA 2R39A 3M1OA 4P46A 1S5HA 5GJTH 3TO2A 3V52H 3WGUB 3FB8B 4XXDA 3WMQA 4X9HA 3K6IA 2Q0ZX 1B4RA 4CC4C 3PP4H 1WSST 4X9IA 4JHZA 1TZIA 2OCJA 3ILPB 2VTFA 5F1SA 3CSPA 5GS1C 4XN7A 4KXZH 3MU3A 3BT2L 4XP6L 4A66A 4YBLC 2H4EA 2W07B 2AV7B 3NPSB 5EZOL 2F1BA 1FVDA 5C2BH 2BVPB 3TPKA 1OM3H 4ODBD 2CO7B 2OPCA 3SDDD 2NNRA 3M46A 2XWTB 1T5KA 1O6VA 5E56A 3ROLB 2Y4SA 5B8CC 1HCYA 1ZHBB 1PD6A 1NCCH 1OAQL 3DX4A 4JG5A 4APXA 5TFSH 4YSRA 3V7MA 3QUXA 4WI8A 4LAQH 3QNXA 5FIEA 4U3SA 1F45A 2CGRH 4XMZA 5D7JC 1NFIB 4RAHA 3QZPA 4O9HH 4QOKE 4PJ7E 1FZJB 1ZLVH 1GVIA 3VWJD 5FM4A 2VR6A 1SN2A 3T3ME 2ZOOA 4LOUC 4L1DA 4BFIB 3RWGA 5B38G 1UEMA 3MUGB 1J9CT 1TF4A 5TFSL 3WEXA 3V79C 1GS6X 3JTTA 4X99B 1X7TA 1S9VB 4XNAA 2IJ0C 3RTQC 5ESAB 1FYTA 4U1JA 3NCJL 4KROB 4P5SA 4L18A 4UQ9A 1PG7W 3W38A 5D70L 4CUCA 4F1SA 3QXWA 2VN6A 3MROB 3LZQA 1RJYB 2Y3AA 4G7SB 4JY6A 2VT0A 3VYNA 4ZTOL 3CCHB 3TWCL 2FZ3A 3BGFB 3F85A 1LDPL 3KYOA 4MZRA 2AJSH 2OYPA 3X11A 3RIFF 5JW5A 5EMYA 4BK5A 5C0CD 3ILQD 5L88L 1RZ7H 3DV6A 1CTMA 2PWHA 4N1CA 1AZNA 3OB8A 1OPGL 3R8QA 2IXQA 1LD9A 2WLMA 3BT2H 3GSRB 3PWNB 4TQ8A 4XP6H 1TFHA 3LQMA 2SEBA 1HKLL 3MCKA 5D7EA 4Y2DD 4Y5YA 4PW4A 2UUDH 2J8UF 1KUMA 5JMOC 3V6ZA 5ALBH 1ZV2A 1BA9A 5D7LA 5AW5B 3HE7B 3SDCC 4FA7B 1N2RB 1VGKB 5IW6A 3LDBC 4AI7A 1VERA 1L3NA 3S35H 3HVDA 4QAMB 4PJ5A 3VYOA 4QJ4B 5FPIA 3FN0H 1KENL 4YPJA 3AT8A 4OTXL 3U6RB 5E2WL 1ZPUA 5F0MB 1BX2B 3S5LG 1GJUA 3D5OF 1KJ2L 4FABH 2EIDA 1EEYA 2I7OA 4WEEA 5D7IF 2IAMB 4DN3H 3EOAA 4PG2C 2JFCA 2WIIA 3ZDXE 3GI9L 3LN5A 1KY7A 3UPRA 1FNGA 1RZKH 3I02B 5EO9A 3AG2B 2RALA 2PTTB 3BUPA 3F84A 5AYUL 4KZDL 4KH9A 5E6IA 7FABH 5H35A 5A2CA 3VXRD 1K85A 2QVFB 2X4RB 2EACA 3FC8A 1J87A 3CHOA 4IBSA 5C0JA 4UAOC 1A7RL 4XNQA 3ZDZB 2PYEA 1YQVL 3EH4B 4GRWB 3U2SB 2COVD 1SEQH 1EFXB 5L6YH 4F91B 5DLMH 1E2WA 3LN9A 4PV9B 1EAQA 2OW6A 2Z35A 5MI0B 3VD7A 4B9IA 1IKFL 3EJTA 3NJKA 4IJ3B 4M7LT 4HWUA 4PMFA 1PFCA 2QV4A 1F3DH 1IGTA 3F5WB 1AR2A 1YVLA 3B8SA 4TV3A 3LMJL 4BUGA 3QCTL 4IU2A 3VXOB 5I71B 1A4AA 1C12A 1ZT7A 5IFAL 5IQ9B 3RWDA 4MD0A 3CGTA 1UD8A 4J8RA 1QD0A 1QP1A 1DBKH 2Y36L 4KFMA 1A25A 3MBED 4O2EA 3M8OL 5J1AB 4PJ9A 4J3OG 1TZHB 1ES0A 4LKXB 4QNPF 4OVUA 4S11A 3V4PH 4ONGH 3FT4A 1MWAH 4J1UB 5CJOH 4XZ4A 5A2LH 2J88H 4Q6IC 2VN7A 3QIBC 4PCSA 3O6KL 4LEEA 5CMAB 3MV8A 5PCYA 4R7LA 3UTPE 1UM4H 3QJXA 4ANWA 5DQ9B 5ANMA 1DQDL 5EU6D 1N5YH 5BV7B 1TUPA 3SEPA 4U6YB 3JV5A 5EC1B 3WFCH 3VFOA 2IADA 1RZJL 3AUWB 3ZN6A 4KOBA 2FJHA 3ULVE 4KXBA 2XY1A 1FORH 1CDBA 2XRAH 3DX6A 1O6TA 3VMPA 1L7IL 4FQHA 1A65A 4YDVA 4GIPD 3ZDWA 2Z0UA 5J5EA 2YLHA 3EGXB 3LKRB 2UZXA 5KG9B 1AZVA 3O8XC 4LEOB 4Z7UA 1P1ZA 3TEYA 1YY8A 4W4OA 2VMEA 1OCZB 4M6OH 1CFTB 1TYJA 5CXPA 2ZOTA 4PJGA 2BSRA 1J9SA 3IKCA 5AG9A 2AJZB 4MD4B 2WBKA 4HBCL 1M7UA 5I5RA 2B2XL 2X4OA 2J72A 5CUSH 3HI1A 4U6XB 3EGSA 1MFVA 3KEDA 2G9HB 1G1YA 3GSUA 3KDPB 1XAKA 4OVVA 3ZZQA 4XCEB 1DTUA 2JVUA 2P8PA 4CGUB 3JVFC 3UBGA 4N0UB 3IMBA 3MCLH 3KPRE 5T1LB 1I7TA 1D6VL 5F0JB 3DSFH 5J6HA 5D1QB 1A3RL 5I1LB 2DTMH 1H15B 5EHFA 4JY5H 2VC2B 5I6MA 3DURA 2GSGB 4M62H 2QADC 5EDXA 1KWKA 1TETL 3HS0B 1ZHKB 3L4TA 1Q72L 3QCUH 4M43H 3RI5K 5EU4B 4JG0L 1IBHA 4QRTB 3DXAB 1F3DJ 1HAUA 1S7SA 1MFNA 1HIML 5C3TA 5BZDA 2XFXB 4TQIA 1UEYA 2HX9A 4FYSA 4Y1AA 2HT4D 2D7PA 1DVTA 1NCAL 3FFDA 3WSQL 5DMYA 1DJSA 4NKMB 3VSVA 3QDME 4HULB 1YLBB 4KKNA 2ADFH 4KV5F 4M48L 3KW7A 3RFZB 1UWYA 3PGDB 4G7VL 2IGFL 4PGDB 3TP4A 1YYML 1PVHA 4ZOCA 5JHDA 3LKNB 1CLZH 4HIEB 4QGYA 3T6VA 3MBEB 3OTTA 3ULUD 3FBKA 3KWUA 2D8KA 2YEZB 3QXDA 4JCLA 4A7QA 1R3KB 2EVJA 3LIZH 2AK1H 1THAA 3QCVH 1M6OA 1T1WA 3MJGX 2OMNA 5EUKA 3UP1A 3P2TA 3O6LH 5C0IB 3SJVE 3PIQB 4KKAD 3A6BL 4ONOA 5D93B 3ZHNA 4R96A 2ICEC 4N0FA 3G6DL 3EG9A 4M1CD 3RNKB 1I3RB 2WUCL 5TE4L 3IETA 3D08A 3L45A 4EEEA 5HBBA 3O9WC 1Q9KB 2JQMA 3NBNA 2DLGA 1HOEA 4DAGH 1R46A 2IPUG 5IFJB 4NP4H 1HN1A 2UWEF 3ABZA 3F8UB 1S7RA 1FWXA 1GGIH 1YEEH 2VW6A 3L4WA 1HH9B 2Q3ZA 3BD4A 5CZKA 1FNHA 3JWDL 5J1AA 2LTQB 1OB1A 3OC8A 4H44C 2IOOA 3QI9C 1ES0B 2UZIL 1ZLWH 3J8F7 2MOQA 3LRSB 3OHMB 2YOAA 3O3DA 2K6YA 2CU9A 4OGYL 2FO4A 2AGJL 1HTYA 4JPVL 3D0VA 4XMUA 2A7BA 4IBWA 1U4EA 3HC4L 3IMUA 3MMEA 2EH7H 3K8MA 2H45A 3KG5A 1UUNA 3D2TA 5A7BA 5FO8B 2NY7L 4IOSD 2A9BA 2IBGA 3VI3B 5AOIA 1QSZA 3MRRA 4LK4A 3TT3H 3PQYB 3NZ8B 3UJJL 1L6XA 4NM8H 5SWQB 3BWSA 2GHZA 1KF9B 5B7MA 3HFML 4WW2B 3TBSA 1J8HA 3O9WD 4HEPG 3BX7C 3J7HA 3ME0B 4NNPH 4WQOA 4DKEH 4MS6A 2XQ0A 2VLJB 4JAMA 1X5ZA 4UZGA 4UM9B 4TNGA 1LEKB 1EZUA 2X4TB 4DEPC 4ETQB 4LRIA 1QA9A 4OM0H 3CFDB 1JK9A 1FORL 2VAJA 4JPKL 4X6FA 3ZE2F 1EUUA 1I1AA 1MVYA 1QNZL 4W9IC 3UABA 4C4KO 3MO1B 4L2YA 4OZIE 4KO6A 1IJ9A 4U6XA 1R5WA 2I85A 2GI7A 1OCOB 2B08A 4PJ7A 1KMGA 4R0LC 3VCLB 2LQRA 3QPKA 4TQPA 2VRAA 3IGFA 2GAZA 4PJFA 3GSXA 4HFWA 3T0BA 2J88L 3WXWL 9PCYA 4L8SB 3MRCB 1VB9A 5C0EA 1IGJA 1JGVH 3I75B 1PPIA 4GRMA 2KZWA 4IS6B 1NMCB 4CJ1A 4XVJL 5FHBL 4NUJB 3CFJB 2Q7YB 2R4RH 3LAFA 4EI5C 2J6WA 5DVKA 2PKDA 3V95A 1JCKA 5K9QG 2AGJH 2BVOA 1RVFH 4XPAH 1FO0A 3O6FC 2JLPA 3ZKQD 1MJUL 3S2AA 2A73A 2AERT 2Y72A 2NY5C 2GSMB 3W2DL 4PRIE 1KBBA 2YEVB 1BVZA 1ZLUH 3OHXB 5JW4Q 4PJ5E 3HKZA 2HUEA 4F2EA 1WICA 3JXAA 4YX2H 2B5IB 4IDJH 4J3BA 2P49B 3FF7A 3KR3H 5KSBA 1MLBB 1TSHA 1YNKL 1D5IL 4UTAH 3AU1A 2G2RA 1T03H 1G7HA 1KXTB 3NJMA 1CE6B 1K5WA 5LCVA 4APXB 4U1JB 1RK7A 4NZUH 4KO9A 4NBXB 1IBYA 3KLLA 4JVWA 4MJHA 4WUUD 4Y2LA 4D94A 3U83A 1G6VK 3E6FA 4JO4L 4JR9H 2APXA 4OLZL 3H9SB 3GSQB 4NZTH 2XQYK 1BZQK 4FMVA 1LK2A 4S0HA 5D1XB 4Y4KD 1FL6B 3QCVL 3UP6A 3S98A 2HN7A 2YXWA 4GXFA 2ZUWA 3OVUB 4CW1A 4MJ4A 5HDWA 3V7AE 2MIZA 4YSTA 4V33A 5HDLA 3FN0L 4NUGL 5A16A 2VZSA 3WU1A 1JGEB 1DBBH 3HW7A 1IV8A 3AXHA 2DM2A 5DO2D 3QIUD 2R2BB 5JYLA 2P48B 3W11D 3N0AA 3QULA 1J5DA 3SDXF 1CC3A 3NCMA 4HFUH 3VXQA 2IGLA 2LR4A 2ZXDA 3ATAA 5I6XB 2KZKA 4Z6AT 1X6LA 2BIOA 4D0CB 3R0MA 5INCA 3EYOA 3B2DC 2FT8A 2UZYA 2WCSA 2WN2A 3EDFA 1NEUA 4X4MA 1DSYA 1XB8A 4PJHA 1HIMH 4KZDH 4XX1G 5CD3A 3QDAA 4KI5E 3FU9A 3S35X 3EW3B 3FQNA 5IESH 4BBWA 1O7DC 4NRZB 3GZQA 1MW2A 4NEHB 4U0RC 1MJ7H 5C92A 1ZLDA 2C7UA 2HLAA 2J4WL 3GYRA 1BBJA 1XF5A 4OGXL 3RDJA 1UKTA 5GRYA 4ZMAT 1P7HL 3H9HB 2NQ3A 4QT5B 4WJKB 2JWYA 2V8MA 3KPQA 3O0RH 4DP0X 1M2VB 5B4MC 3V0VB 4KXAA 1OGTB 4NZFA 1UOWA 2M8XA 3ZDXB 4GJTB 3UROR 4Z1PA 3BKCL 4YGAB 2NY1B 3TBBA 2AEIT 1CICD 2FECI 2GJ6D 1TJGH 5F7WC 3WV0A 1MCHA 3IS0X 4L8CA 4XE0A 3B9KA 1QSEB 5GZOC 3RY4A 5DD5H 1B0GB 3CWGA 5HHME 1JNLH 1KYUA 1WK0A 4ETQA 2A2QT 1SN5A 2BP8B 3PWNA 5GXBB 3HS8A 2EADA 5A2FA 2XBTA 4M4PA 1BQLL 3QIUA 2DQMA 3VFUA 3L17A 5C7ZA 3P9LB 5EBGA 2VLMD 4KMTL 3RHWF 1ZXQA 2V5SA 3MGAA 5I1HH 1A6UL 4UOW1 3EO0B 4F2MA 4Q4EA 2E9WA 3MJ8A 1WWAX 2BOBA 2KT6A 4PR5A 4K7FA 3L3OA 5CHNB 2EDOA 4ZO9A 3IXAA 2WXIA 3TWCH 4CVZB 3DRTA 2NR6A 3QWRA 1T4WA 3T0WA 1RZJH 3WTUA 4RMUA 3SYPA 2XN1A 3CNKA 4N22A 1UASA 1EEQA 3K6NA 2F53D 5C0GA 1G4RA 4JZNA 2XFGB 4TMPA 5BNXD 2AI0L 1V3JA 5C0CA 5C2BL 4Q6YA 3E8VA 3UAFA 5AZ2H 5AOJA 1C9SA 2W65B 1IC0A 4TNVF 3C6SB 3VGAC 2OMVA 3HMXA 2Y5TA 4ODVL 1FVCA 3CN3A 5FUCE 2GTZA 4BFKA 4G8EB 1KYOK 5BJTA 2IAMC 5DRNA 3UBXG 3HG5A 3PNWA 1MI5B 4G80A 4RNRB 1NSNL 3MRDB 1DJHA 1CLYH 1GHFH 2C26A 4KPHH 5AKRA 3UGEA 4RRPA 1OGAB 2DQUL 4M6ML 2R59A 4F7KA 3NRQA 3P0VH 5IM7B 1HHKA 4MB5A 1KPRB 4JFYA 3IT8D 3PDGA 4M7ZC 5T3ZD 3SE3A 1MW1A 5EC2B 2WQXA 4I13B 3KJ6L 3RWHB 1SN0A 3H9SA 4X8JB 3OKEA 4FI8A 1UACH 4ZTPH 4N1HB 2IDSA 3RTQA 1ADQH 4DIXA 2EUXA 2NXZD 4NP9A 5TE7L 3VH8A 4FG4A 3NJFA 2YWZA 4LSUH 3ZL1A 4JM2C 5T3ZE 2BVQA 4LNVA 1D9KC 4ALAH 2E76C 3C2AL 2EINB 4I3SH 1GS8A 3EOTH 3IFLH 2YJQA 2K70A 3T8VA 3PV6B 1GZHC 5IB2B 1MWAA 1W15A 1R4XA 3S3PA 3PY9A 2VM3A 4BSWB 1U95B 1UWGL 1X44A 2B59B 3HZYB 3U36A 2NYYC 3FQWB 2CAKA 1CD1A 3FO1B 2FAUA 1AGDA 3IAPA 5D4JA 1R3LB 4FABL 3BWUF 4LPTA 3LKPB 4X83A 3CH1A 1C5DA 4DGYL 1LO5A 6CGTA 5T1KD 2CHXA 4CMMB 2V2XA 1S9YB 1SPDA 4ENEC 5FEBA 1SLXA 1TJHH 2GI0A 2P5ED 3HR5A 1AS7A 4ZBJA 3VX0A 5B8CA 3K2MC 1EK3A 3KLHD 2NX5B 1DP0A 4LQFH 5I18L 1S9WA 2OMUA 5DK2B 1DQLL 2F53E 2I26N 2H32B 2D03H 4JO2L 4J3SA 5EO1B 2DYPA 3D51A 1BFSA 3KPLB 4P9MH 5EIQA 1F11B 4X7TB 2VLRA 1PX4A 4B9GA 4Z7VB 4TOYH 4WTZA 3VG9B 4QXGL 4GI9A 2XG5B 2DI9A 1BFOA 1BXVA 3NIDE 1NAMA 3FCGA 5I1DA 2AQTA 2WMPB 5JPNB 1QHPA 3MV8B 1HSBB 3BWAA 4YR6B 3VXSD 4HUVA 2GSGA 4Y1SA 5L0QB 1AZRA 1RULL 3IDXH 4WU7B 3B9KB 5FV2A 3IB4A 4I9WE 3OKYA 3I84A 2ZWZA 5KS9E 5LG6A 1S7WB 3MLZH 5F7LB 2BOCA 4LNRA 1G7IA 3VMOA 4ZTOH 4AW4A 1UWFA 5C0BB 1V7NL 3IDMA 3EO1B 3CFEB 3EG9B 4WUUA 5HHMD 4YHML 1PG7L 3RNKA 4G6AD 5IHHA 4JKKA 3QNFA 1E6JL 2MNWA 5J89A 1QPKA 1IGIH 5I30H 5DJDA 3K6SB 2BCKA 1T5XB 3NH7H 5JUEH 5KVEL 4TNFA 2YRPA 4XH2B 1N4XH 2AJYH 3EDDA 3L4VA 4LSTL 5IWLA 2DS4A 2NXYB 4MS8D 4XHJD 3WEOA 5JTWA 3ORJA 1W0VA 4UYQA 3LKNA 4RETB 4YUEH 1U92A 3T4YA 2CO4A 2P52A 2W59A 4EE2A 3ZSTA 4AC2A 4HDIA 2VAAA 2J3SA 4H7VA 2R0KH 4U0QB 2ADGB 3DIFA 4L37A 4AGNA 1NPUA 3B2XA 4JZNB 3GK8L 4HIJB 5I82A 2M26A 1D5BB 3JWOL 5DYOA 4LB8A 4XX1E 2P1YA 4WEMB 5H8DA 2XJLA 4YHPA 1D9KD 4J3UA 1PZCA 1UCBL 5HJ3A 3UTTE 1J0KA 4BSVB 4ZMXA 2HZHA 4NJAL 3ARZA 4GKZB 3A0OA 2IQAA 4WUKH 2GC7C 2WLHA 2GSIB 5ICZA 3KLAA 1X5MA 3WIFA 1PU0A 3PP3H 4Z7WF 2QSCH 4FP8H 3VXSB 4G8FB 1AGEB 2FJFB 1B90A 4P5MB 1H9DA 1IC5H 4K7PX 3BPLB 2YD1A 3DURB 4Y7MA 4BXVA 2FGZA 3I50H 3T65B 1A47A 1B4TA 1P0SE 3GFUA 1MCEA 2YZ8A 3HS9A 3EKCA 3QUZB 2EC9U 4JDZA 1FL3A 1M3JA 4K7PH 2NOYA 3VXME 4AV4A 4Y5VB 1J8HB 2HG5A 3PWJB 4AYSA 3CLFL 2ZT9C 4LOVA 4G6KL 4B9CA 1JWUB 4NKDA 1IM9B 2HB0A 3IN2A 3WTSA 2I24N 5BO0D 4UM9A 1RZIB 4Y16C 4AVIA 2WNKA 1WT5C 3NDZE 2H0FA 3H4FA 3ZTEA 3PGFL 1E8WA 2Z93B 4A37A 4FQQA 5BS0A 3R7QA 3SO3B 1BZ8A 2WAHA 4Y19A 1BVLB 4KHTH 1U8LA 3NZUA 4HISA 4O02A 1WFNA 4X5XA 1M57B 1T0OA 3PQYA 3HG1A 4PY8I 5CCHE 4P5RA 1MY7A 4A2LA 1DEEA 1RUKL 2DJSA 4HXBH 3O4OB 3APMA 4DKFL 3G08B 1UH3A 1HHHB 1QPPA 1IKNC 1CTNA 4RH4A 1BV8A 4OGXH 1AGDB 3EO9L 3EDJA 3ZMEA 3JWDH 2WV3A 2P5PA 2A77L 2BZ7A 3FDWA 1EFQA 3OL2A 4XP1H 3WDHA 1MCDA 3IJEA 3TJEL 4F7MB 5HJDA 1CCZA 1SVCP 3W81A 2DLFL 2DMBA 2VXQL 4N3TA 1LE5B 1MIML 4W9LC 5F6HI 3IPFA 5K9JH 5DR5L 5FA3A 4X7DC 2ITCB 2W0FB 4LLDB 1NDMA 5EOTA 2XWCA 1AGCB 3IGLA 1TTFA 2FK9A 1YC7A 3Q2NA 4X7EC 5HDOA 1Q38A 4HWBH 3FU6A 4P46C 4YBLB 4JFEE 2QL1A 5ES4B 2KI6A 3NPSC 4G70B 3QR0A 3K2UL 5ITFB 3P40A 4EDXA 3MLSL 2Q7NA 4LCCB 4JCMA 4WW2C 3O2WH 4ZFFA 3FQ4A 4WO4C 2WLIB 1J1OH 2Z8RA 4PJAA 4F7CA 3EYUL 1EHXA 2MJWA 4K8RC 2ADFL 1BW8A 4ZW5A 4FLSA 5HY9A 5C86A 5CBAA 4JUTA 3H9SE 1YAZA 3GLEA 5AUMB 2FATH 5KVFL 5F3FA 2EUWA 1KBVA 3EOBB 3T04D 3IWUA 4K7PY 2OL3A 2VDRL 5T5NG 3IMTA 2FGWL 3DX9A 1BWWA 4UNUA 5C07B 3VQMA 5DEGB 4HOWA 4HUKB 2YO3A 2VDOL 12E8H 1Y6NR 2X6AA 3CMOH 1TETH 4F80A 1A6ZA 1BLNA 1INQB 2CPUA 2L7JA 1QFWM 4HWBA 5JXED 1TVHA 3THML 5HDRA 5I6NA 1HEHC 2EDHA 2OXGB 2AJ3A 2ZKHL 1CYGA 3QUML 2CIIB 1VZHA 4HIXH 5F21B 2AV1A 5IW1B 1Q90A 3LDBB 4EOWH 3AVEA 3RP1A 2B9AA 2VW4A 3QEUA 1KBGL 4XODA 4OI9A 1IBZA 2RFXB 3O3BA 4F7PA 3UGXA 5K1JA 4H25B 1ETZB 4PRHB 4E36A 3SODB 1QVOA 1LILA 5JPMA 3ZDZE 4GRLC 1NIBA 3RY6C 5L4JA 1X4ZA 1OTTC 2X4NB 4IJTA 2B2XH 2OTUA 2B1AL 3KXFE 3VXSA 2P44B 4DGIH 3BZEB 2IAAC 2IFFH 2XG4B 3HI5H 4AQEB 3HB3D 3NSCA 3UTQA 1II4E 1UHVA 3T65A 1JWMB 2QHRL 1W0YT 5G2NA 2YD5A 1T0NB 1UJ3A 2X4SB 4BEIA 2VXQA 4DH2A 1CL7H 2F74B 4CW1B 4PBVC 1LWHA 3SQBB 3STZB 4PJ9B 1CJYA 3FFOA 2IH9A 1QSEA 2KQNA 4NZRH 4U1IB 5DMKB 4JKPH 4OI8A 4B97A 2LU3A 1A4KB 2XTJD 4WO4A 4IBLT 4C83A 1UOLA 4L4VE 5E9DB 3SDAB 5IG7A 1QLEL 4NENA 3EYVB 2G4EA 4C58B 3OAUH 3BN3B 2FT6A 3HRZC 4F27A 1BVNT 2LV4A 4XAWL 4HGWA 3WNMA 3HPJB 3L95A 2Z31A 3ZUNC 2O6CA 2BRRH 4ELMB 2MHAA 2OJZL 4L4VD 4P46D 4S0TD 5I1IH 2X88A 5BZWA 5T33L 3IN0A 1CGVA 5CWSB 4FERA 3SDCA 2VL4A 1SLVA 3CK0H 3CZFB 3ZYZA 2N1TE 2K9UA 2PP7A 2YC1B 1ZE3H 1T7XA 1PEZA 3G5YB 3O2WL 4M93C 4O2FA 4V2BA 4PVBA 2D4FA 2B3IA 2OR7A 1BQHG 2WTOA 3BH9A 1Q1JH 2VQTA 2VDQL 4PJDF 4ZFOL 1B9ZA 2CKBL 2AXGB 4HG4J 1TJXA 1XCTB 1GCYA 3QNYB 4AIZA 3P1VA 2YRZA 1A8ZA 1H8OA 1B4LA 4H5SB 4IKNA 4HX1A 3SCMD 3NJJA 1JZFA 4DQOH 2MNUA 2B77A 1WD9A 3QDGD 5H37G 3BP5A 1NMBH 5DLLA 5I0VA 1GGBH 1S7VA 5L4MA 3TA3C 5MI0C 4I0PA 1G6RL 1G5GA 2WXPA 1UCTA 2APBA 2EE6A 2R83A 3ZVVA 4P9HC 5HHNA 1EGJA 2ZUQB 1R34A 1JXGA 1ZHBA 2ZSWA 3QQXA 2X4UA 3EJRA 4CNIA 2X2HA 3LKQA 1NJ9A 4YBHA 3ZZSA 1BAWA 3FUKA 4TLUA 1JHTA 3KL0A 3AB0B 1QFWI 3GTVA 2AV7A 3QQDA 5DQDL 2YJLA 1FG2B 1WEJH 2EKJA 2CKBH 3IFPB 3L5WA 3RBSA 1U3YA 2QGCA 4NKIH 2VDLL 1VEPA 4NI3A 4YIQB 1CBVH 3N42B 4HJ0D 1FVCB 5AB2A 2GTZB 4OD2A 5F9DC 1HE8A 5IOPA 1SZNA 1E2VA 5A43C 4GAJL 4L5FL 4HXAH 1JI1A 4YDLC 4OKDA 1ZJAA 5I66B 3R1GL 4YQXH 2IBZY 4JG9A 5J11C 3S8GB 3GRBA 3RWGB 4EI6B 2BERA 4YL9A 4L9LA 3BAXA 5FFLA 4RQQA 2E3VA 4PWFA 1NFIA 5LXGH 1KNOB 1JGDA 1XEUA 4NNXB 1BJ1H 4D8OA 2B4CH 3CFTA 1FZJA 3VFMA 4AZ8B 5MERA 3L13A 3HS0C 2HT4C 1TCRB 4HGKC 1AXSB 3G6JF 4W6XB 4YHYB 4GG6F 2Z7ZA 2NY0B 4TSCH 5F1IB 4ZUVB 4E42B 4R26L 1DVZA 5TGBB 3GO1H 4HIIA 3C5XA 3FOLB 5EU6E 4JFVA 1ZCRA 2CHZA 1B0RB 3JTBA 3Q48A 4BFIA 4WK4B 5DD1L 1RH8A 3V0JA 2ZXGA 3RDTA 3D69B 1RZFH 4UV4H 4XP9H 1GGCH 1RU9L 2H32A 1BLIA 3BH8B 1F4YL 2JB6B 5EF2A 2ZX5A 3LEVL 4JFYB 4UZSA 4AKPA 3TURA 3GGWA 4EN3A 1EXUB 2QTEA 1CFNA 1XXFC 4P5TB 2HFEB 1W16A 3HG0A 4LPCA 3VD0A 2J12B 2WZ5A 1CIUA 3DHJA 1MJJB 1CN4A 3LKPA 1NAKH 2D3LA 4KGJA 4X0KB 3QXVA 5D1XD 2DQFA 2XJKA 4E41A 3ZY7A 1HAWA 4R2GC 5IQMA 4BHUI 4HJSA 1SDDA 2OMVB 2AKRA 2O4EA 5KOVC 2RD0A 5HGHA 3EH3B 2EXWD 1G0XA 1NCWH 3ATFA 3T4AA 4LMQE 2H3NA 1C5CL 2WGNB 4NDMB 2VLRE 1OPOA 1FYTB 3WJMB 4K8RH 2ESVA 3MFFB 4G8IA 2W0LA 4OF3A 5F2FA 1F86A 2B20A 3ZPDA 3T2NH 1T22B 1A9EB 1DDHB 3DGGA 5I0YA 4JQIH 1KC5H 4JQVA 3QJFA 4TSBH 2CGRL 1HEJC 5FYLD 3CFCH 4MJIA 4POZC 4Y2OB 1OSEA 1JYXA 5MEPB 1CBJA 1LP9F 1OCWL 3SYCA 2ZCKH 4KTYA 5GGRA 5CEZH 2VDOH 1G1CA 2NY3D 3F62A 5DMGC 3RWHA 5KBDA 4WTWA 5I16B 2H1PL 3KWXA 5SX4I 4ZMPA 1J11A 3I6KB 5IJKC 2ATAA 5J57B 2BZDA 1KJ2A 4PJXF 5DRXB 5FB8B 1BIIA 3ARDB 1P2CB 2ZSVA 3ASNB 3QO0B 4RZCB 1XBRA 2FEEL 5FCSH 2WO2B 2YD7A 2NW3B 3VVWA 2XV0A 2X4TA 4AIZB 2IFGA 2YN3A 2IXQB 3EYUH 3GSRA 2GUOB 3U1SL 1PKQA 3PP4L 5GGVL 3CN4A 5DUBB 4E9LA 4IU2B 3VXOA 1MW3A 3V0AC 4AY0A 1OF2A 5DZ9A 4FQXA 2FJFA 2EIZA 5I9QC 3NIFF 1GPOH 4QRSB 4UDUB 1BG9A 5F7DB 43CAA 4YSAA 4CGTA 4BRVA 4D9RE 1QSED 3UTZB 2PYEE 1A3QA 2I9LA 2H8PA 5B8CB 2DBLH 3LB6C 2IPKA 4S1RH 2WNXA 1ASPA 4TN9A 3TCLA 1OB0A 3GNML 1LWJA 3LKQB 4JDVB 1J8HE 1QX1A 2X2IA 2W9EL 4QTFA 3E3QC 4LXFA 1I31A 2BSSB 3IDGA 2GQHA 4PJ8B 5IB4A 3VFNA 5MENB 2QPSA 3E1F1 1USZA 1LO0H 4AX3A 2NUTA 4WWKD 3UAEA 4GKNA 3ULUF 1EAPB 2GJJA 2ZAIA 1G43A 2LE9A 4WFGD 2WXFA 5KSAC 5C8JA 4EIUA 1J8HD 2YGVA 3O9WA 3PQYD 3UPCA 3II2A 5KSUA 5ICXB 4B9KC 4WHDA 3PAUA 2RTTA 3BESR 4HKBA 4ZXBA 1A4JB 3FFCD 1CICC 1XL4A 1HHHA 1HL9A 5G4NA 1JVLA 4IKIA 5ID1A 1EZSA 5B3JF 2LABA 3HBPA 3NSFA 1WS7A 3OKDA 1QSVA 4IRJA 4YC2C 2DWSA 3IDMB 5EEUA 1EJFA 4XO9A 4HCGA 1PG7X 2G0KA 1ESOA 2O5NA 1PKQE 1QI3A 2R8SH 4L29A 1G7JA 1NUGA 5DJ2A 3L1EA 5DS1A 5TGBA 2HKHL 5ILTH 4F7MA 5BS0B 5MHSD 2AEOA 3KPSD 1N70A 4WJ5B 1X4YA 5J0BA 3FU8A 1IKOP 1HH6A 1N59A 1X9UA 3MNVA 3QIWA 2YD8A 3B3IB 3RWEA 3H2QA 5JHLL 4G5AA 5EOTB 1V54B 4IIZA 2DMCA 3QAZC 5DJAA 4EI0A 4UQDA 2YN5A 1Y7VA 2QQKH 2K7PA 1IC5L 1XGPA 2XIIA 3VFOB 4XVSH 4K5NA 2OI9B 4R5TA 3ARSA 4GP8B 1KB5H 3DUUB 3JVGC 1HU8A 5CAYB 4D0CA 4FL4B 1NFDE 5IVXB 1IC7H 4LLAA 4IEFA 2FDBP 2ZXBA 3V4PB 3PPEA 4Z7OB 3F7RA 5G5DB 4HEPA 4J23A 4S1QL 3SE9L 4PB0L 2XV2A 3GKZA 5DVLA 5E1IA 1A1MA 3LKRA 1GYUA 3T2NL 2D7NA 4JO8A 5D2LA 3QFDB 1AO7E 3EADA 4Y5VA 5F7YC 3FOMA 4PJ9C 1Y0LB 4H0GA 1C5CH 4W9HC 3UAJA 5I24A 4RISL 5FLUA 5HD8C 3FU3A 5ITFA 3PWPA 2MTAA 3SDAC 3BW9B 3TBTB 3MNWB 1NANI 3P2BA 4LSTH 1LO4H 4KK5C 1F2QA 2G9KA 3I9AA 1SBBA 2X1WL 1D5XA 3MJ9A 3H53A 2ADYA 5EUKB 4FXLA 1HYRC 3EJZC 4LP4A 5KBMA 3KLSA 3OMAB 3QARA 1SXSA 1MFCH 3GRGA 1GYCA 3FCTA 3V55A 5HYEA 1SJHB 3I2CH 1A1NA 3IFOA 3CPUA 4GW1B 4FGMA 2P5EE 1D3CA 1U8NB 1HSAA 2DDQH 1KLFA 2PXYA 2AANA 4AMWA 2XZCL 4R3SA 2HFGL 3RILA 4ZPTB 4OF8A 5I71C 4OIBA 4UINL 1E8XA 4WEUD 2ZCHL 3C2SA 1BEYH 4TVSa 3QH3B 1TZ8A 3T3PE 5CGYD 4TUUA 4I48B 32C2B 3N41B 4N8VG 4UQEA 1L9OA 2BNQA 3EOBA 3PWPD 3GQFA 2QJDA 4Z7UE 5JO5B 3D0VB 1SYSB 1TJIL 3TM6A 3TO4C 4XPBL 3ERXA 2FHCA 4I1NB 4M56A 3BKMH 5DC2A 4R5VA 2FLMA 2VGLM 1FGNL 2EKSA 4HHAB 5E1GA 3GINA 2ZX6A 3ZHFA 4CRPA 3ZHKA 4X4ME 4JN2B 4KRPB 3TTYA 2GBAA 5MEOA 4YHOL 1FCCA 4AQOA 4WV1A 4OZFB 5TE6H 3RPKA 5GS1A 1J9RA 2JQAA 1E5ZA 4Q9BA 3CZUB 3OKLB 1ET7A 5E6SB 1QKZL 1MF2L 5EULV 3R4DA 4F7CB 4KI1A 2H26B 1DJWA 1QLFA 1N9PA 5E6ID 3ME0A 3BVNA 5C6TL 5F6IC 5IF0A 1MWOA 2WLLB 1E7VA 5DC0A 5AOKA 4JFEB 2PN5A 1KJVA 2ZAGA 4O2FB 1RHHB 1EAOA 3DVNB 1NGPL 2CD0A 3FB7B 3IM1A 4GEIA 4Z95L 3NZ8A 1B0IA 1UOKA 3UEZA 4KQ4L 3OKEB 1ZT1B 2K1MA 2EYTA 1Z9SB 3GBLA 3KJ6H 4GYBA 3ZE1F 3LPPA 4BZ2H 1JHLL 4JDTL 4N28A 3BEVB 2VL5B 5D71H 1PZ5B 4GKSA 5EBMB 4DW2H 1GS7A 4GFXA 1OW0C 4ODTL 4H20L 1C5BH 5HYJE 1C8PA 3X12B 1EIBA 4NRYA 4R2GD 4WSJA 5E99L 3A47A 4JQIL 1ETJA 4ADIA 2CHDA 1S9VA 4J39A 1QFWL 3FFCA 5AALA 1FA4A 4PN6A 4HV8B 4OKVA 5DJ0B 2A6IA 5FR3A 3SE3C 3APFA 2E7LC 3DX2A 3MLUL 3MRGA 1AXTL 3QDHA 1S7QB 5EU6A 3BWUC 3L7EA 1S7RB 4MKTA 5IR1A 4AZUA 2ARJA 4ZZFA 1VKXA 3PHOA 3U4EA 1KT2A 3QZWG 4AQEA 3OAWA 1XGRA 3ZDYF 2AXFA 4JFXB 4ADGA 4I89A 3LIZA 3EFDL 3PP3K 4A1RA 1I8IB 1DEDA 3OKOB 4NFDA 3ZZ1A 1JUFB 1XD1A 4W9JC 3S4SB 3VE0B 1TENA 2KDGA 5BVPH 1F3JA 1GZHA 5HDBF 4C56B 3LS5H 1HHGA 2OMZA 5T1JA 3GBML 3S5ZA 1U8JB 1E8YA 3GMMB 1AGFB 3MNWA 1BFOB 4LMQI 3UMTA 1QA9B 5I1HL 2BNUA 4AEFA 4DK5A 1JPFB 4HPYL 1A6AB 1WTLA 2FNWA 5LBGA 1M7XA 1QWUA 2ZCLH 5GRZA 2W91A 3WGVB 3VRJB 4EKJA 4PLNC 2OMYA 2GBTA 1OGAD 1R6VA 3HRPA 1OIOA 3LIUA 3AM8A 4NM8L 3AS2A 2R29L 5C0JB 1DSWA 4TUJB 3WUWB 1EMTH 4WSKA 4A7TA 5E2UL 3BPLC 5DD5L 4Z18A 5B38A 1YQ2A 4XI5C 1WV7T 1XIWD 4JPWL 5DJYB 2Z3FA 2Z35B 3AITA 4CBZA 5ANME 4OLWH 4P05A 3ZXAC 4RQQB 1R24B 5GS0C 4X5QA 3JWNE 1M9WA 5JIHA 4RA3A 2XQBL 3EYFB 2R1YB 3TYGL 4ELME 4Z7AA 1J7VR 4WSGA 5LGJB 4E5XG 1OVZA 2ICWI 5T1MA 2D0HA 5E6IB 5KW9H 4KBPA 3FN3A 3A3YB 4XBEH 4LF3A 4HDIB 1F4YH 4TLSA 3LV3A 1HNFA 5CZXD 3ENEA 3QZBA 4J1UA 1WEJL 3OX8A 3VDBA 2DWEA 3CN2A 3IF1A 3GRWH 1WZMA 3K72A 5A3IC 2X3AA 1RK1B 3ZIYA 1AJ7L 5HHXL 4PJAE 1KEGL 2E6QA 1PAMA 1ADWA 5ERWB 3KVDD 3L5XH 1PYWA 3LEYH 2HX8A 3NABL 1E40A 5DRZB 2I60H 5CEXA 1KCLA 2VQ4A 5DEJA 1OGTA 2MRYA 5IQOA 1HESA 5BW7A 3H55A 1RFDL 5DHDA 6FABH 4RDQF 3DYMA 1UA3A 1E4WH 4G42B 4P4KC 4RGMC 4NYLA 2BY1A 3R1GH 4GG8B 4YQXL 3CDGB 1DUYA 3L3IA 4K73A 4GAJH 3CXFA 1ORSA 1S7XB 4IBTA 4NO0A 2KUTA 4Z7UB 3QDJD 3K2UH 5ISZA 1ZA6B 4GUPA 4YH6A 3WFDL 5GGSB 4Y4FC 4MXWH 4L4TB 4N2KA 1QTYT 1WZ1L 3QNZB 4KY1L 1EJOH 2JKRM 1EDYA 6FABL 1FJ1A 3LXBA 4LVNB 1RZGA 4J2XA 2HYMA 4NZJA 2AXJA 3FQXB 5FGCE 2C3VB 4G82A 3F04A 2DJMA 1S7TA 2IADB 4B5EA 2DQFB 5AAWC 2QLVB 5JHDE 4XMWA 4NZUL 3WI9A 3L9RA 1BVLA 3WE1A 3MLVL 5I0ZA 4NHCH 3RVWD 4J3OH 3CLWA 3L1OL 1RFDH 2XWEA 4U1LB 5FYJU 3WUZA 1P9MA 3GJFB 5LBVA 3NP4A 4GBXC 3FAXA 2O93L 5JZ7D 3QDMA 4IOIB 5KSVB 5ID0B 4M5SA 4PJBB 1P7QA 1IFRA 4MCYB 1NMBL 5D9SA 4ALAC 3LZFH 4LARL 2X70B 4WK0B 5KUMA 3WIIL 4IHOB 5IMKB 2DZEA 2XBDA 3HBZA 2ZG2A 2X4PA 1L5GA 1T0MA 1XQ4A 3SO3C 2I7SA 1JGIA 3RJQB 4HIHB 2DPKA 4A7VA 1SJEB 2R0WH 2E4TA 4R6UA 3V0WL 5KW9L 1I7RA 5ETUA 2BFGA 5CP7A 3NTCL 5ALCL 2A4ZA 3CSTA 5ESQB 1NLBL 3QO0A 3POHA 4MJIE 3RGVD 4G43A 5FECB 1CG9B 5I1KL 5EUOB 4HZLA 2CK0L 1FPTL 1KTJA 5IB3A 4KFZC 3QIBA 4RZKA 2BINA 3M17A 2HUHA 2RACA 5F7BA 3L3HA 3LS4L 3P54A 4NXSA 3DROA 1AKPA 1JF6A 5AVSB 3FQYA 1BQRA 5IROC 5EF1A 1DDHA 3ZT6A 5C8JB 4PYGA 1YEDA 1JZEA 4L3CA 2O72A 3HG1E 4N6QA 1CR9L 4L3EB 4KKLD 3QDJE 4C59B 3AU0A 1T2XA 1SJVA 1OHQA 1QBLL 2VXVL 5T3ZH 1DZBA 4JDVA 2GJZB 3ZRFC 1NBQA 4M1DL 1Q9WB 1H0DA 4UNTA 3VG0H 5KYYB 1LP9B 12E8L 3B2UD 4P46B 1QAWA 1CF8L 3MV7E 3P3TA 1EAPA 4KDTA 5D5ME 4UQ3B 2GBUA 2YD2A 1Q8MA 3ILEA 3MKGA 2ZWNA 3UO8B 4HJ1A 5AKTA 4ONGL 2E27H 2N0MA 3F2LA 1WBYA 2RR3A 4JKNA 3VXMA 4CSSA 1MFAH 2OP4L 1NIDA 2CJUL 5B1JA 3VB9A 3MJ8B 4PR5B 1A4JA 3OXRA 3W37A 5I8KH 4HKXA 4CL7A 5IM7A 3KMDA 5KTEL 2D2OA 1LMKA 1NGYA 2X0UA 5ECGA 4BH8A 2CBPA 2VLRB 5DUML 1OP3K 4XNYL 2R7EB 2ETWA 4LIQL 3EH1A 4YFDB 4ZS7H 4KQ4H 5I73B 3U7YL 1KGIA 3T0EB 4BFEA 1DVFB 3MLWH 2AS5M 3B2VL 5IB5B 1JERA 4XP5H 4MCZA 3W82A 1G84A 4JGMA 2ZONA 1SM3H 2E86A 4U05A 4XVUC 1XCQB 3S8WA 1DN0B 5KVFH 3UZVA 4NO3A 3WS6A 4X4ZA 3GHPA 5HI5D 3UZEC 1MAKA 3ECQA 3CIQA 3LIZL 3BUTA 4A7SA 1GY1A 1OP5H 1O9ZA 4LLVB 3EJZD 1E5YA 4ZPTA 4AYMC 1NCIA 5K9KA 1S2EA 4XNZB 3U0TB 2TSAA 2F8VA 2XVKA 3MA7B 4ZFOB 3GSXB 3C8HA 3HAEG 1BFTA 2IDQA 4HFWB 1D5XB 1XH3A 3NCYS 4ZQTA 3IK2A 4X42A 3P30L 3M45A 4BSJA 4P59H 1N8ZB 2ZOKB 3GMLB 5FFGA 4Z3IA 4IIQC 1L0QA 2NUPB 1RK0B 3FQTA 2UWEB 4WNQA 4MS8C 4XHJC 5E4AA 3ARED 2VW7A 1A1OB 3VXSE 4UB0L 1S7UB 3RIKA 3D34A 3V4LA 4XP1L 4X6FB 5C08B 2XN9E 4AQAB 2HFGH 5GRJH 1M3IA 2ZX9A 4ZK8A 2BIQA 5I1DB 5IGXL 3UIZA 3LNGA 3T4AC 4YO0B 4PJGF 1FVEB 2DEYX 3UOAB 2WB1A 1LDPH 1LE9A 1T4KB 3WXVH 5DFVC 2ZF8A 4UINH 5LBSL 3IDJA 5I74C 3ZMNA 5HHQA 4FXKB 1LK3L 5GGTA 2ZICA 4LHJB 4ES9A 4M6MH 4PP1C 4KKPA 1A0QH 3GS0A 4ZT1A 3MUY1 2PW2A 2N59A 2MCG1 4JFUA 2DQJH 4ODHL 3LZOA 3HE6C 4Z5RB 4YAQB 5SWSB 1FNEB 2MMXA 3INOA 4MLSA 4PRIB 3ARBD 1FG2A 5KVGE 2RGSA 2PTTA 1T89A 3F01A 4UIMB 5AKSA 1E4JA 2VDPL 1QRND 2V7NA 1NDGA 2WCGA 2P5WD 5SWZD 4PUBH 3K2KA 4AGMA 1HQ4A 3NEXA 1ONQB 3F6LA 3O2DH 3SE9H 3FQ1A 3W1ZA 2AJYL 3GLDA 3TN0A 2DQGH 4N8VA 5CGTA 1PLCA 3QHZL 1DQKA 5HI3C 4ORGB 3W9DA 1BPLB 1ZSHA 2FX9H 1NCCL 4G7RB 4A68A 1H3VA 4BK8A 4LO9A 1QACA 4ZUWA 4YZFF 3VD2A 3BZ5A 3V2AR 7TAAA 5HVFB 1MHCB 1XV8A 3QJSB 1IEBB 2YAFA 3EOYG 1IGMH 2ARJB 1VKXB 4HWEL 3RWDB 1KT2B 2L7EA 3VRLE 3WFBL 2DLHA 1FL5A 4MWFA 4UMSA 5CLXA 2HTKD 2OR9H 4M5YH 4XN8A 1IM3A 2OBGA 1JV2A 2VR9A 4YLBA 4OSUH 1W9XA 1JG9A 4JJOA 4TOYL 4WI5A 3N41F 2A9CA 1JNNL 5CN1A 5ILTL 3W57A 3TH4T 2NR6C 2CDGA 5I2IB 5E4EB 4OLVL 4ISVA 5I30L 1RSFA 2OMXB 4FFVC 1CYXA 3QFGA 3WLBA 5DDHA 1QUNA 1OSZB 4RAVB 5T5FH 1CXKA 4ZMOA 3GIZL 3CFBB 5CEYB 4OZ4A 4POUB 4ONFL 3MLZL 4QHNA 4KI5D 4DGYH 1A7PL 4ZS6C 5AYQA 2WQWA 4WCYH 2EH8L 4Z76A 2R1XA 4LEOA 4QCIA 5IROD 1FDLH 3ZL4H 4Z23A 5HYSA 4P5TC 5CLTA 4C56A 2AABH 3D3VE 2WXQA 3PL6A 1RUAH 1RHHA 2DIEA 5FK9A 4HMCA 2C5DC 4XO5A 2R1WA 4QXGH 1LE5A 2J55A 4JRYA 3DBSA 2OKMA 3FFCE 3VXUA 4B9YA 4GSRA 4LSRH 1YEJL 4K3JH 1NCNA 3NK3A 4HJ0C 2AQ1A 2HVKB 4ZZKA 1A7PH 2ZNWA 5FA4B 1KDIA 2DWTA 5LAXA 1HYSC 5CN3A 5KSBF 1RK1A 1Y1UA 3DYPA 1TVHB 4N0YH 4I9XA 3QXDB 4N3UA 4PIBA 3VSTA 1AD9B 2F8OA 2BRQA 1NUDA 4FADA 1NCHA 2Q20A 2CIIA 3C9NB 2PCFA 5BPPA 2OULB 2E5EA 3HZMA 2EYRB 4DTGH 3UTSE 3PIQA 2GCYB 1NIFA 5FYJL 2I27N 3QJZA 25C8H 4MDIB 3GHBH 3N5AA 3AMKA 3BUQA 5CBEB 2N7SA 4NQEB 1NLDL 2BO0A 2ORBL 3N50A 5DZJA 4Y5VC 3V4UL 1PSKL 5F7FA 4Q14A 3VJ6B 2JI2A 3T2QA 5B3SB 5B39A 1ORSB 1AZBA 2Q86A 3DX9B 2X3CA 4AQ8C 3CVCA 5C0AE 1O9VA 5HYQB 1UZ6E 1UZGA 4KVPA 5AAWA 5DJXB 3W3BA 3VG0L 1F42A 3ZDYB 4TPRH 4YXHH 3H42L 3R19A 4QYAA 2Z8WC 4L4TE 3BKJH 4KROC 2G5BA 2OXHB 3LQZA 1I85C 2Z8SA 3IJSA 5CO1A 2WXMA 4ZFFB 2VCOA 2K8QA 5G4OA 4X7CC 4LASH 5KTEH 2P9RA 3HI6L 1GXEA 1Y18A 1COBA 3IYLW 3DETC 3L3KB 1J1PL 4YDIH 3IGKA 3CXHJ 3LS4H 4PG2A 2WZ6A 4PJBA 4WW1B 5DZOA 3CV5A 3Q1SL 1XIWA 2YAOA 3QDGB 4FG0A 1ZA3B 3SSGA 1WA1X 4KTDH 2Z4QA 3GLAA 1WHPA 3L2NA 5DEGA 1LLAA 1UURA 2DH3A 3RPIB 4WTQA 4Z9KB 2Y7QB 3KBHE 1I9IH 2K7QA 1RJLA 4WFEE 4M1DH 1CI3M 3DA0A 1XTLA 2NY4D 3EYSL 4MYWB 4OZGB 3L08A 1QBLH 4Q58C 4ZX5A 1Z66A 2H2SC 5HSFA 4U1LA 2AJXL 2XUWA 4KKQA 2MQ0A 5BQ7B 2A9NH 2OSLA 1T5WB 2Y06L 3HZYA 4YK4B 3GBDA 1NJ9B 4QHMA 3NK4A 1RZGB 4YZWA 5E9DA 2WGXA 3SDAA 4KKCC 1SEBA 4GG6B 1KG0A 4GXVL 3QHFL 1Q94B 1RZFL 2OMXA 4EZMA 1E2ZA 2CBTA 3HR5B 3EBGA 3RA7H 2W60B 3KYMA 5FO2A 4YDKL 3SCMC 1JNLL 3FUEA 3OPUA 5GISH 1DVFC 3UZEA 3CFEA 5E6YA 1BD2D 5ESQA 4BYHA 3AM8C 1OO2A 3D1MC 4U1KA 3C5JB 2IANE 3BJ91 3QJVB 2YOCA 3GWJA 4L5FH 1OAKL 1U3HA 1XR9B 5E00A 4A7GA 5ISZD 4Z7VA 3QQ4A 1EJOL 1Z5LA 2Q7AA 3QHTC 2ZXQA 3SD5A 4DUXA 5IUCA 3M1BB 3FULA 4B0MB 5FK9B 3TO4B 2Y07L 3ARFB 3SDDB 1E5BA 4HS8L 2SEBB 1JF1A 2J7LA 4LZKA 3PWLB 4HUVB 5FLVA 5F1IA 1XCTA 3LZFL 4LARH 3BHBB 3SBRA 1PJ9A 35C8L 5DK0A 1YEDB 4JLRA 4XXCC 3ISRA 4YHZH 4HZAA 3VWKD 4AITA 2LW3A 5BZWB 4BD4A 4L4JA 1LO2H 4AC4A 3WN5A 1K5NA 3T9WA 2XPGB 2HRPH 2ATPB 4ZAKB 4JKMA 1MI5D 3T08A 4R4ND 5HHOE 1Q1PA 2CQVA 1T03L 3UBXA 3ZKNC 3LCYA 4UIKL 3KLAB 5DO8A 4WGWB 4Q0XL 4EBQH 3T4YB 1XZ0B 4LIQH 5F8QC 3LVEA 4NSKB 3T0EE 5H35B 4XCNA 5IJVA 2B1HH 3PRZA 4MHHG 1E5CA 1UB6B 4CSZA 3BAEH 3E0GA 3T4AB 5H2BB 3J27A 1XXDC 1BQKA 2R69H 1PQZA 5L2KA 2JJUA 3MOAL 1F02I 2B39A 3S34L 5FF6A 4ZTEA 2HJKA 5HHNB 2QKSA 5I76A 2JH2A 4F33B 2A1WH 2FIRT 5L8JB 5HHPB 5IB1A 5AZEH 4PH8A 2E6PA 3Q6FA 4PV9A 4PGBB 4L3AA 4HOMA 1VIWA 1QASA 4KVNH 4CADB 4A55A 1J8RA 4I1RA 4YDNA 3G3LA 4GXUM 4M7KL 2NPLX 5FYLL 1JPGA 4LIQE 1SJXA 4NJ9L 4D3CH 4N2HA 4QRPA 5JOFB 1FHGA 3ARQA 4R4FH 5T3XH 3WEAA 4YX2L 1CK0H 1XH3B 2DKUA 3MDJA 4JFQB 4MRCA 4TRPL 3T2OA 3UJIH 1FFOA 4Y16A 2AMGA 1Z9LA 4IRSC 4OUOA 1JHKL 1H3TA 2K45A 5J13B 4LLYB 3DGCR 1MRDH 3WFHA 1XIWC 4X7FC 3ULUE 3ARFD 1F4WL 1IQDB 2D7MA 4MNGE 4L8CB 1JPTL 5JOEA 1TR7A 2EIJB 4NNXA 4AYID 1ZT1A 1CL7L 1PLAA 1M7DB 1ZV5A 4OCNC 1R9FA 2NMSA 3H4HA 3EYSH 1OGPA 3EYOB 2AKRB 4Y4KA 3UDWA 5HYJD 4LAJH 3D33A 1XCQA 4E41B 3UZVB 3QORB 1VACA 3IE4A 1LHZA 1UQSA 3MLUH 4EIGB 4FG2A 5CSBA 1IGYA 1U2CA 5FM5O 3CPLB 4MNQD 5E4OA 4C47A 1KLUA 3T1WA 1CD9B 3KYKH 2KDYA 3QDGE 1U3NA 4XR8C 5J6SA 5F7UA 9CGTA 2JB6A 4MDRA 2VOTA 1H8NA 5FYKL 1CMOA 3FT1A 5CHNA 6PCYA 5KYXA 3CZSA 4CN1A 3GGWB 1AAJA 4EN3B 3MJ6A 1A1OA 1XBDA 1S7UA 2XA8H 3CIAA 2CRIA 5BVPL 1T89C 1IUZA 1HL5A 5DRXA 3MRMB 4JHUA 3BYYA 5LDSA 1ZPLA 2XV3A 4UQBA 2BK8A 4V1DA 5E6IC 3UZQA 4R8WL 1ZHNB 1HCZA 2W0FA 4LLDA 4JW3A 3FU0A 5EZLA 1UM4L 1TDQA 3IGAB 4Q8BA 1HS6A 1AZCA 4EIBA 5AW9B 3O2DA 5ITBL 1TVBB 4PS4L 4G8EA 4KK9D 4LHUD 4MQ7A 2NY7H 2JV6A 2FATL 3EGDB 3FRUA 5D4HA 5KSUB 2NY0C 1E4KC 1RPKA 4NX0A 4PRBA 3BN9D 25C8L 1YZZA 1T1WB 4H8WH 2A74B 2BVPA 2E7LA 4MXWL 3P2DA 4DTGL 4MAYD 2CCLA 3G9VA 3NCEB 5BXFB 4H20H 4YHOH 5I8CB 3MX0B 3TVMC 5LN8A 4MB1A 2Q6WA 2ZUVA 2J6EH 4QY8A 3VFNB 5D6DA 5GSRA 4L48A 2CO6B 2IPKB 1H6FA 3S7GA 3BFOA 3NAAH 1YY9C 3D4YA 3PABA 5F97E 4FHBD 4K9EH 5ISZE 3D3VA 3TJEH 3KNBB 4OJDH 2IAND 4XMXA 4DAGL 1UKQA 3U0PA 1OEZW 2P42B 1YEJH 4K3JL 2G3MA 1XWVA 2W5PA 1YYLL 2BSBA 3BFWA 4LGPB 2EDNA 2P7TA 2WUCH 5TE4H 3WL9B 4B9ZA 3WENA 3NRPA 4P48A 4U1IA 4WK2B 5K1VA 2YK1H 1Q72H 1IEHA 1OD7A 1QKZH 5JLZA 4ACPA 1MH5A 4YGVB 3B5GA 2W95A 3O3UN 1SLWA 3FO0L 2OK0L 3L9YA 3PDOA 1WBXA 3SKOB 3R06B 3OKKA 4WCYL 3UYRL 4OCWL 2X89A 3QUYB 5DFAA 2GC4C 2LAAA 4AYBA 3RWJB 3S3CB 1YYMH 1O0VA 2Q76A 4PJCF 3S5YA 4M8UA 4EVNA 4CSTA 3ULVH 1FIGL 4HG4K 1KN2L 3QQ9D