1WA0X

Crystal structure of w138h mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPHHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
total genus 91
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X02
2HXAA 2E86A 2IDQA 5EHFA 1OOWA 1A4AA 4EF3A 1XB6A 4YL4A 1ZIAA 3X1GA 2IAAC 2QDWA 2BZCA 3TBCA 1AAJA 2PP8A 1HFUA 1AACA 2UXGA 2XWZA 1NZRA 2N0MA 2IWEA 5A7EA 2W88A 3N2JA 4YSSA 1ASQA 4DP7X 2P80A 5F7BA 3ZIYA 3WNJA 5PCYA 3ZBMA 5I5MA 3UACA 4HAKA 2VSMB 4WTQA 1W8EA 1WS7A 1DZ0A 3TA4D 2DV6A 2EIJB 1KDIA 1KCWA 2XV2A 4NERA 3FSAA 2PPDA 2DWSA 2EIKB 1GSKA 3NP3A 2X87A 1SDDB 2CJ3A 3UAAA 2XV0A 1ILUA 1NIBA 1GY2A 2JFCA 2J55A 1F56A 5D4HA 2OJ1A 1JXGA 2UXTA 2BZ7A 3D12B 1AOZA 1TU2A 2IWKA 3HB3B 3H56A 7PCYA 4CSPA 2GC7C 1J5DA 3S3DB 1BYOA 1AZCA 4G7SB 2OCCB 3SBRA 2CCWA 1L9QA 4Q89A 4HCGA 3OMNB 2BP8B 4AKOA 5IY5B 1ILSA 1BQKA 3JTBA 1TKWA 2PP9A 2HLEB 4YSQA 2HRGA 1T5KA 4KOBA 1NTDA 1J9TA 3ASNB 1J5CA 2GC4C 5B1AB 2VW4A 4AKQA 1GR7A 2LLNA 2QDVA 3WKPA 1NIAA 3ABGA 3NJKA 3DTUB 2PP7A 1TEGA 3AG3B 3PLYA 1AR1B 3NJHA 4DP9X 1XB8A 3CDZA 3TU6A 1RZQA 7PAZA 3NJLA 1CURA 3FS9A 1N68A 1MG2C 3WKQA 3WIAA 2CAKA 1VLXA 2EILB 3GYRA 2J5WA 3SQRA 4BXSV 1MZYA 4A2DA 4JHVA 1JZIA 3FQ1A 1QLEB 2BP0A 4M4RB 5I6OA 1M9WA 2H3XC 1ASOA 1N70A 4L0PB 3OM3B 1CYXA 3CVDA 2IDSA 1J9QA 5FC9A 1MDAA 5TK4A 2YXVA 2DWTA 2XVBA 4GP4B 1NDTA 4YSTA 3PAZA 2CUAA 1GS8A 3IN0A 1A8ZA 2QPEB 4G7RB 5B1JC 2H47C 3NJJA 2FT7A 2HRHA 3ABKB 5B7MA 3QPKA 2Y69B 4DPCX 3T71A 2UXFA 3NJIA 4GP8B 4E9TA 1L9TA 3X1BA 5PAZA 2XV3A 2GHZA 2ZXWB 4HZ1A 3C75A 4BWTA 3X1FA 2JKWA 1CC3A 1HAWA 2DY2A 4DP4X 4G72B 3WI9A 1KV7A 1JZEA 1X9UA 4AZUA 5I5IA 1PAZA 2R7EA 2A3TA 6PCYA 1IBYA 1L9SA 1MZZA 2H5UA 4DP1X 3KW8A 2AANA 2XYBA 2AZUA 2YAMA 3X2QB 9PCYA 4YSCA 1BQRA 1JXDA 2DYRB 1NIDA 1KBWA 2PPFA 4QKTA 1WA0X 3HEIB 3ERXA 1OF0A 2AFNA 3H4HA 1B3IA 2FTAA 1ASPA 2BO0A 1L9PA 3CG8A 2OV0A 4KO5A 3X1NA 3QJUB 3NYKA 2DYSB 1ZPUA 3T9WA 2MTAA 4E9QA 2CBPA 2YXWA 1QNIA 2IDUA 4KOCA 3FU7A 3MBWB 2Q9OA 4WKXA 3QJRB 4A68A 2VW7A 1MG3C 3IE9A 1NPJA 2UX6A 1R1CA 1OCCB 5F7AA 1GY1A 1ETJA 1PLBA 2WO2B 1GW0A 2HX9A 2Y1AA 1URIA 5I5JA 3UADA 2VM4A 1V54B 3OMAB 4UF7C 4DP8X 2AZAA 2EIMB 2IWFA 1W6LA 4AKPA 3OQRA 1ET7A 5B7FA 3U25A 1JZJA 3V9CA 4HIPA 5LDUA 2I7OA 4HCIA 1SDDA 4RH4A 4BDVB 1IKOP 3SBPA 2VW6A 2ZONA 2GSMB 3FSWA 3NSDA 4G70B 1AG0A 4HALA 3QJSB 3DKHA 5I6MA 3AG4B 3CDZB 4FAAB 1YLBB 1W6WA 2FQGA 2VN3A 1BXAA 4W9ZA 3GXUB 3EH5B 3FQYA 1AZUA 1OCOB 2BP8A 4G7QB 4YSAA 4E9VA 5B1JA 3NJNA 3NSCA 3FYEB 2XU9A 3AG1B 3BQVA 4A2GA 6PAZA 1BEXA 1A3ZA 1SHWA 5I6KA 1E5YA 4ENZA 2MRYA 4KO9A 1BAWA 3EH3B 1V55B 2TSAA 4ZK8A 2CALA 1ZIBA 2XX0A 3L45A 2PCYA 1PNDA 2UX7A 3QJQB 3QJTB 4YVNA 4KNSA 1KDJA 2WSDA 3IEAA 3PAVA 1UATA 1EZLA 2EINB 2JXMA 3FPYA 5B1KA 2VSKB 3PAUA 1TEFA 1AS6A 3ZDWA 4YSOA 4X4KA 1J9SA 1RKRA 4KNUA 2TSBA 2R7EB 4MFHA 4P5SA 3SBQA 2Q5BA 1E67A 2FJSA 1E30A 1RCYA 3X1EA 4YSPA 1SFHA 3CVCA 4DP2X 3PPSA 1KGYE 1BXVA 1KCBA 1ZV2A 4E9SA 1HAUA 3QQXA 3NJMA 5I6PA 3ABMB 1PCSA 1JOIA 4PAZA 4DP0X 4CSZA 3CZUB 1BXUA 1OCZB 3MX0B 2HX7A 4AX3A 3WG7B 2XXFA 1GS7A 1CYWA 1I53A 1NINA 1PZBA 3AG2B 2GIMA 2J56A 2GB2A 4A67A 3NJGA 1PNCA 4BWUA 1NWOA 1E5ZA 1BQ5A 2FT6A 3ZX1A 4N8UA 4A2EA 5I6LA 2ZOOA 5I26A 4NB7A 4E9XA 2NRDA 1OV8A 1OE2A 4N4YB 4W1TA 2IDTA 3ASOB 1NIEA 1NICA 2WO3B 1KYAA 1PY0A 2XLLA 3FU7B 1FFTB 2I85A 1JXFA 1IC0A 1EHKB 1RZPA 2B3IA 2FQDA 1SF3A 1NIFA 3T6XA 4BXVA 3CVBA 2YARA 2AVFA 4E9WA 2IH8A 4G71B 1AS7A 2FQEA 1XB3A 2XUWA 3RYMA 4YSDA 1AANA 2GI0A 4KO7A 4A2HA 3N55A 3UABA 3H4FA 4GP5B 4Q8BA 1JVOA 2X88A 3PCYA 2BW4A 3TASA 2IH9A 1M57B 1SNRA 4NAJA 2PPCA 1GYCA 2QT6A 3NT0A 3EHBB 4A2FA 2YAPA 4JHUA 1JERA 1OE1A 1SHXA 1CUOA 2XXGA 3NSFA 2FQFA 3NP4A 3UGEA 3WNIA 3EF4A 1BYPA 3FQ2A 3S8FB 5B7EA 1L9OA 3AY2A 4JKNA 3ABLB 1FA4A 1A4BA 4QLWA 4E9RA 1PMYA 2RACA 2VMJA 1AIZA 3OD3A 4AI7A 1AG6A 2GBAA 4GXFA 2PLTA 3FU8A 4YVUA 1PZCA 1M56B 1E65A 2YAFA 4BK5C 1ET5A 1FWXA 2B08A 1OE3A 1WA2X 3NJFA 1DYZA 3V9EA 4DPAX 3PXLA 1JZGA 1SF5A 2I7SA 5ANHA 3IN2A 3FPXA 5B3SB 1L9RA 1NPNA 2BWIA 3FU9A 5AFAA 2XX1A 3QJVB 3FYIB 1AZNA 4M3HA 5E9NA 2FNWA 2BP0B 4DP5X 4E9YA 1A65A 5D4IA 3NSYA 2VM3A 4YSUA 4BDVA 1PZAA 2QPDB 2FT8A 1PF3A 1J9RA 1ADWA 2PPAA 1XMEB 5AKRA 5B1BB 1AS8A 3T6VA 4FA7B 2HX8A 5AZUA 3AW5A 4DPBX 1JVLA 1ET8A 3EH4B 4K9JA 3TBBA 1V10A 4F7KA 4BWWA 4HHWA 4TXVB 3S3CB 4YSRA 1IUZA 4YSEA 1A4CA 4A66A 1WAEA 3KW7A 1KBVA 1ID2A 1SFDA 3OMIB 2YAQA 2BHFA 3FT0A 1JZHA 2FWLB 4GY4A 4DP6X 2W8CA 3FSZA 1PLAA 3AZUA 2YAHA 3DIVA 3UAEA 4KO6A 2P80D 1IBZA 1QHQA 2IDFA 2PPEA 1NWPA 4KNTA 1ZDQA 5I6NA 3IBOA 4F2EA 4UANA 5TK2A 3S3BB 4PCYA 5D4JA 8PAZA 4GYBA 4F2FA 1SJMA 4HCFA 3GDCA 1WS8A 1AQ8A 1X9RA 2PCFA 1ZDSA 4HHGA 1AZRA 4P5RA 1JZFA 2YAEA 2YAOA 1OCRB 1PLCA 1GS6X 3BVDB 1WA1X 2BWDA 3FSVA 2HZHA 2UXVA 1AZBA 3G5WA 2BW5A 3T6ZA 4UAHA 3S8GB 2ZWNA 3T6WA 2J57A 5I28A 3JT2A 2YQBA
chains in the Genus database with same CATH superfamily
3CMGA 3FF8A 3EGDB 3LH9A 25C8L 2XV6B 3VCLA 1IAII 1CI3M 1EDHA 1JDDA 4LOFA 2ISDA 3ZT5A 4EF3A 4F5CA 1G7MA 2OL3A 2QKIA 4O2FB 3QJHA 1KF9B 4QHPA 1D9KC 4KROC 2ATKB 3QR1A 5F3BB 5F7NC 4MXVF 1M1XA 1GGYA 1A2YA 1RUPL 2GVYA 5T8IA 1F3DJ 2IWEA 3D2TA 5A7EA 3OZ9L 3HHSB 4LSQH 3N2JA 2PR4H 3N43F 5AWNH 2MIZA 3ZOAA 1JPFA 2ZCLL 3BGMA 1I8LA 2C26A 5DF0A 1JHTA 3D3VA 3T77A 3U2SA 3FJTA 4JFZL 4FQQA 3VRJB 1WK0A 1MPAL 4AXWB 1WS7A 2A9BA 4FXKA 2ZE0A 2JF1A 4MWFB 3UTZB 4P9ML 1XO8A 3ULUL 3QPQD 4V1DA 4W9KC 2I60H 2VERN 2VDRL 1KY7A 4RDQF 2X3BA 2VT0A 4YHLL 1ZLSL 1ZWIB 2H2PD 3MRIA 2YFOA 2XKNB 3OX8B 5L9DH 1F90L 5KVDH 3QWNA 2OJ1A 2R0KH 3VFUB 2X4PB 4NQSA 4QXTB 1VGKA 1RK0A 2L7JA 1MFDL 4UINH 4CC0A 2Q7YB 1H8LA 3QIUC 1I1AC 3V8OA 2X09A 4U1HA 3SODB 2H0FA 2C3VA 3FO2A 3R06A 4I88A 1FSKB 4ANUA 5JPNA 2DS4A 32C2B 2L7UA 2NT0A 4WHTB 5DUMH 3PY9A 5LKNA 1L0XA 3KYKL 3C2AH 4NRZB 2CCVA 4HC1A 4TVPL 5DLLA 2H32H 5HJ3A 4CNIB 3WTWA 1OQXA 2EXWD 3HZVB 2PW1B 1I8AA 3FFCB 3DETD 3CDYA 1CLOL 4OKVA 2ADFH 3WHXB 2FYVA 1OSEA 1TEGA 2XFGB 2RR3A 4U4BA 5EU3A 2IH3A 1AR1B 4BKLA 3OTTA 1AJ7H 1XSOA 3I3BA 5TE4L 1WFNA 2YXMA 1N68A 1MG2C 1TG8A 4AMWA 1IGJB 1TNNA 3M8OL 2RBLA 3IJHA 3X17A 4AJYV 4BUGA 3T0XA 4OLEA 4KVPA 4AYFB 5AB0A 4HK0A 5IKCA 3VI4A 4A2LA 1U93A 1CF1A 1M6OB 3SOBL 3MLTB 2GFBA 1BDYA 4MLSA 4RNRA 5I6OA 3PWLA 4FGMA 1DUYB 4NQED 4LLQB 5FC9A 1RMFL 3RTQA 5KJRL 2PTUA 2VQTA 3U48A 4RBPK 3EJUA 3KXFD 1DFBH 2VLRB 4I0PB 1AGFB 4OCWH 5GGUB 1WZMA 4MS6A 3P2DA 2QSTA 3VSVA 3SYAA 2JJTC 4LIQL 1B9KA 3VWJB 4JY5H 5IB2B 1G4MA 3Q9PA 2UY6A 1UXSA 4RZCA 4LLVB 1MFEL 3ROLB 3SO5A 3HI5H 3LRSA 5FDWB 1T5XB 2GJRA 5I1DA 1Z1WA 2ZXWB 3BN3B 4GG6F 4ES9A 2LVCA 4BWTA 5BOZG 1QEWA 1SM3L 4OAWB 2X4SB 5ICXB 4C56A 4NWTH 2X2UA 3CPLB 3T3PE 3WEBA 1VADB 4TRPH 2E74C 3VGFA 2VNCA 2ZWKA 3JVGC 4J8QA 4UTBH 4N85A 1TCRB 1IT9H 1M9SA 3QPXH 3R4RA 4NQXA 1AIFB 3JYBA 3BJLA 1E6OL 3B43A 5D1QB 1QATA 2YFNA 2DQCH 2YPLE 4N2FA 4OLXL 1NC2B 4K55A 4ZS6D 1H5BC 3DV6A 4PJIE 4F7CB 1BOGB 2XYBA 3IMTA 4M93B 2O93L 1KT2B 1XH1A 2I07B 1YEGL 5LHDA 1V3KA 1DJXA 5D7KD 1IGYA 4ZW6A 1NIDA 2DLTA 4A2MA 4JFUA 2O6CA 4MJ6B 4CU6A 2CLZA 3DROA 4B97A 4HH9A 4GIPD 4KUCD 4LSDA 2ZX9A 2OCFD 1C7TA 4KX8A 2Y9RT 3QUXD 4I0KA 3N85L 2JKTM 1LK2A 1IJNA 4J3SA 5KG9B 1NBCA 3X1NA 4M3JA 2DDQL 5ABAA 4IK7A 2X4NB 4WUKL 1JV5B 5AAMC 4OM0H 2A9ML 4HIIA 2WVVA 3EJZC 3PUUA 2GIXA 4Y9FA 4DCQA 4WDIA 4Y5YC 4WI0A 5C0AB 3LEYL 5D4QA 2X28A 1MI5A 2V33A 1GW0A 5IQMA 4S1SL 4WU5B 2JB5H 4IMLB 4PP1D 1J48A 1ITCA 4LSVH 1U4FA 3ATBA 1FFPB 1V54B 4NPJA 2BSSA 1U3ZA 5I75C 2KPWA 3EJPA 4ACTA 1J8HD 2ICEA 3DJZA 4QAMB 2WBXA 4XPBH 1JL8A 3V52H 1K85A 5CBAA 1DN0A 1LWHA 1HDMB 3SBPA 4NO5B 5ANMB 3KJ6L 3BO8B 3S48A 3D87B 4FQXA 4KAQL 4DVBA 2JCCB 3F84A 4ODTH 3QZLA 1S7TA 4PLJD 5FA4A 5AQ0A 4AENB 4OJEH 3VGBA 3TOPA 4XO4A 3UL4A 1XAUA 5DJXA 3G9AB 1C5BL 1AO7A 5AYQA 3CHPA 1GHFL 3RJDA 4YZFE 3NSCA 3MPCA 4F7MB 3H3PL 3S34L 5KTEH 1AQDA 3FFCE 4XO8A 5E8DL 1BPLB 4NP4H 1RI8A 2R2HB 1ODUA 1P1ZB 2MRYA 3GD1C 2EVJA 1ZXQA 1TTRA 4JFEA 4M56A 2PO6D 3R1GL 1VFBB 1F4YH 1B0RB 2TSAA 2NW2B 4MA7L 4ZK8A 4Y9GA 1E9QA 1ZIBA 3KPOA 2TAAA 3HE7D 5DK2B 1L7IH 1OT2A 2EEBA 4O02L 1ZANH 3HRZC 1EZLA 2Q86A 5KVGH 2WXRA 3L2LA 3QG7L 4ZI8A 1Z3GH 2VM9A 4MJ5A 4ZO6A 5B1KA 2QHLA 5GHWH 3S96A 3WFDL 2G3MA 3LKSA 3OMZA 4LVEA 1MWAA 1OGAD 3D0VA 4AT6A 2V3FA 1ES0B 2JKNA 1CFMA 2VLRE 2BNRD 4YR6B 4DZ8B 4PRHA 5FB8A 5E2WL 4C83B 4EOWH 2XKUA 3JWNG 2F61A 4XNXL 1ACYL 4MNGA 3VI3E 2IAMD 4LGPB 1BXVA 1H8SA 4PJCB 5HYSA 1BAFH 3M86A 4G9FB 5MERA 3LQAC 5I76B 1UASA 4L8BB 5I6XB 3A4EA 1PFCA 1LE9B 5E94A 1BWMA 4JFPB 3QC5X 1OAUH 1KXTB 1ZVSB 3QRFM 2IVFC 4L18A 2BZDA 4R26L 1TQCB 4ZFQA 1ZLVH 2NY0C 4A67A 4TQ8A 1BEYH 4CSSA 5IEKA 4XWOD 4YOKA 4PJEB 3ARBC 1ZTXL 5EULV 5C71A 5MEOB 5LQBH 1EXGA 3EJYD 1EZVY 1OSPH 1UFGA 5ESQB 2J12B 1PKQA 1F4XL 4N0FB 3BAJA 2Y07L 4LEOA 1LEKB 1ZV5A 2WLNA 1HHIA 2WO3B 4LRIA 1ONQA 3APCA 1QI5A 3A21A 4Y88A 3TBYB 4RIRA 1N59B 3JVFC 4R4NC 5E2UL 2JK5A 2K8MA 1ZJBA 1CICA 2XIIA 4AGMA 4ZRGA 3BPOB 3CXHJ 2XUWA 3L3DA 3FAWA 5C8JB 1ACZA 4L3CA 5I1HL 3DOHA 4OZHA 2I32A 2K9UA 4TNEA 1E9PA 3L2NA 4OFPA 4F2MA 4CVXB 2DLFH 1HSBB 1FDLH 2F7QA 3B9KC 1AH1A 3TF4A 3WD5H 1M57B 3Q2NA 4NAJA 4UUJB 3V0JA 3DMMA 3MJ7B 4XVTL 3SPHA 1GGBH 4PMEA 4JR9L 4NM8L 2J2ZA 1G7QA 2J4WL 4J7RA 2Y7SA 1KIQA 4QRQB 5EDSA 4K3EH 3KCPB 1H9DA 1PJWA 4HHAA 3AY2A 5DXWA 3SDXF 5JDSB 4LCWD 1AHWC 4J3OG 2AERT 4XN2A 3WEXA 2DWXA 2Z31B 2H3NB 5ESVB 4L3EA 1B6UA 4LT7A 4AMKL 1D5RA 3MNDA 5CJQH 3B7TA 5D7IB 2BIMA 1GPOH 1GZPA 4J1UA 2VDLH 3REWA 1GGIL 3DPBA 5EIIB 5ID1B 1SF5A 4NOFA 4GQ9H 4X6FB 1TTGA 4XNDA 1XWVA 2AQQA 1A47A 2YHGA 1LLAA 4UM9D 5I9QC 2ZOLA 3V0VA 3OKYA 3U4BH 2RFXB 5JW3H 2AK4D 4R7DA 5LG1A 1RIHH 2ADJA 3HAEB 5HI3C 4F7TB 4IQHA 4YSUA 4GSUA 2JCCE 3WLWD 4O9HH 5J5EA 2W9LA 1QYGL 3M7FB 3NCJL 1JF1A 5DWUL 4U1MA 4QHMB 4XO5A 3IBEA 3SKOB 2AQ2A 2OMNA 5B1BB 3V6FA 4NZUH 2HX8A 4XXCC 4NENA 1T0NB 2W60A 5AZUA 3WIHH 4DPBX 2PTVA 3MO1B 2F2HA 1J1PL 1NCDH 5DZAA 4PJGA 4ZUSB 5KSAA 1F42A 3GJEB 3UTTD 2D3NA 4HBCL 3REVA 2FE0A 4Q9RH 4B53A 1A6WH 4P9HH 1A3RL 4PJ9D 5LN4A 4NUJA 3TV3H 1FN4A 4ONGL 1PLAA 4RSVA 5F9DC 3VXNB 4RAUB 1ZCRA 5EU5A 1YA5A 5DZOA 1QACA 4ODHH 4HS6B 5DUPH 5F0PB 1GGCL 2AABL 4HIXH 1BLIA 5FUOL 5EEYA 5IB5A 1G7HA 1ND0A 2HYMA 4GBXD 3FQRA 4ELMA 3QJFA 3F85A 3QO1B 3U1QA 4NJAL 5ICYB 3WMSA 1MCSA 4MJ4A 4F2FA 4JPIB 2VDMB 5L4IA 3D07A 4KDTA 5H35A 3ULVC 4QJ5B 4OQ1A 2BMKA 1TQVA 3POCA 2P8MA 3ZQ9A 3P9MA 3U4EA 5C09A 1BIIB 3MRKB 3D9AH 2FECI 4DO6A 4AYDC 3VRLF 4Z7WA 4FG6D 4R7LA 4QHNB 1CFSA 2R29L 4AYBA 4BFJA 3T6ZA 4UAHA 3UC2A 3KXFB 3GSNA 5GIRB 4HS8L 2WWMC 5I28A 2ZX5A 2O4EA 1GRWA 4PJCE 1LP9A 4G9FE 1MVFA 1P9MA 1F3JA 1MLCA 2WXJA 4IU3B 5FUCC 3QB7C 3ZRSA 1N0LB 5KVFL 4YL4A 4CN6A 3H55A 3MACL 4PWFA 4XXWC 3TBCA 4BZ1H 1HH6A 4HOXA 4F3FB 4X4YA 4EI0A 1L0QA 3MAWA 3JV6A 1KG0B 4IMKA 1OTSC 1GL4B 2VAAB 1ZOXA 5F71A 4CDGC 5E00B 3UZVA 2I26N 4GUPA 4PJEE 1KELH 2YK1H 4KTGA 3N42B 1XGRA 4LDCA 2P80A 1E2ZA 3QEUB 4N2LA 3ZIYA 4TNGA 4FFWD 3O3UN 4P2YA 3SE9H 3MRFA 3T65B 2FX8L 2OTUB 3TA4D 4N2IA 3ZTNH 3QCVH 5C08D 4BH8B 2R8SL 1TSHA 1OAXH 1L9MA 2XHNA 4HS3A 4M8QA 4YXLL 1IQDA 3HR5A 5CBEB 4G83A 1QQDB 2FB4H 4ZW3A 3FN3A 3LIZH 3GZOA 5HTSA 4L8SB 5LGHL 1F56A 5I1KH 2C4XA 3DECA 3MBWA 2B1OA 1FZKA 2X5PA 5DT1L 2XWCA 5G55A 3ZQWA 1AP2B 4N6RA 3C60D 2BFGA 1GYVA 4WTWA 5AVZB 2AEPL 2ZOWA 3CCHB 2F08A 2NQDA 2W95A 2E7MA 2EDRA 4G42A 1SEQH 2OYPA 1RUKH 2IOIA 3J8F7 5ACZB 1HL8A 3T0ED 3WIIL 5GGTH 4NRXB 3MGAA 4XNZB 4QIRA 5E9DB 1J88A 1K8DA 1UD4A 4GS7B 3TF7C 3S36H 3HG1B 3QH3B 4O5LL 1WWAX 3ASNB 1G6RA 4PWGA 3RZCC 5E5LA 4UOW0 2LLNA 3APMA 1ZE3C 2F7OA 3DTUB 3GRWH 2E76C 2C9AA 2YN3A 1BF8A 1JTTA 1HC1A 2G2RB 4RQQB 4LSUH 2ETWA 4X4ME 5D2NC 4GKZB 4RMQA 5EN2A 1COBA 3IK2A 1RUMH 1IAIL 3GK8H 4BXSV 3HPJB 3DYMA 4DKFH 3OZKA 4N9OB 3LEXA 1MW0A 2LGNA 4YFEA 2R2BB 2ZPKH 3L13A 1EDYA 3H9SB 2YXVA 3KJ4B 3N43B 4XP4L 3SPVB 5IBLD 5TDOA 3VFMB 5CJBA 2BS71 3ARSA 4QF1B 3ZSSA 4YN3A 4BFIA 1HHKA 3U0TB 1NMAH 4XZ4A 3UXFA 1FZJB 1M7DB 3GMOB 2BHUA 3GNMH 1VFMA 1ZLUH 3K80A 4MJ2A 2QGBA 4FJ6A 4XHJC 1OPOA 3DX2A 4PR5B 2B59B 2CUMA 3CZLA 4CJ1A 4Y2DD 3PF2A 1LK3L 1NAML 4AQ8C 1IIKA 4QT5B 1D2OA 5IQ9A 4OB5H 3PHQB 2DMKA 4PJ7A 2VC2H 1KYOJ 3HE7B 3Q06A 3LZOA 4QHKJ 5KVEH 3HA0A 1HZHL 4UIKL 5CS7A 1A9EB 5A3ID 4NQEE 4IIZA 1HOEA 4H2CA 5D9SB 5E5MA 4YHOH 3KXFE 2AXGA 2XQBH 2Q8BH 1P84K 4YE0A 1M2VB 1O7VA 3EOBB 1I8UA 2JLLA 4HFWB 1K8IA 4KJPC 2G3NA 4MD5A 4BK8A 2IAMB 2KERA 3DJ9A 3HEIB 3VYOA 4JE4B 2NR6A 2MNUA 4Y2NA 1XHHA 2E7LA 2AK1H 4Q7DA 5DR5L 2FL5A 3GINA 4JFDA 3IDXL 3QCUH 3CFCH 3QXUA 2HFEB 3PU7A 1KEMH 1QNIA 1MAML 3PGFH 4D3CH 4HWEH 3B2UD 5HGHA 1MRFH 1XH3A 2DMGA 4U1SB 3C9NB 1DLHB 2QR0B 1R1CA 3BPNC 4M7JH 4PP2A 1IC5H 4LKXB 3BN9C 4XMVA 1UWEL 1PLBA 3DX9B 1WCBA 1M05B 2BK8A 3L17A 1IAOA 1R3LA 4L1LA 3ETSA 4XN8A 5K33A 5KANG 4AEIH 3TIEB 3GMLA 5JOFB 3OKOB 2W0FA 2BNUA 4JHBA 1CICC 3WY2A 2A74B 1U92A 4D0DB 3Q7JA 1ET7A 1JGVL 5K9KA 4Z7QF 5D7KE 3T08A 3ARXA 4KI1A 1WAAE 3W38A 4G6KL 2ZAGA 1IGTB 3QAZC 4IRSC 1F8TH 5F7FA 4Y16A 3OVUB 4XO9A 4PRPD 1ORQB 5C0GA 2GBUA 3C5ZB 1G1YA 4MBRA 4NBZB 1AG0A 2ICWB 3RL2A 4GG6B 1XF4B 3VXTA 5FCUL 2CLVA 2WHVA 5EOTB 2Q0ZX 2W0LA 2YGVA 2AV7B 3MLZH 3OAUL 3O6FA 1KFAL 3TO4A 2GJZA 2EC8A 1GKEA 5IB1A 1OP5K 3NCEB 4NO2B 5IMOB 5E9DE 5KW9L 3ARQA 3BP7B 4AIZB 2D0GA 3I9GH 5FYLD 2A77L 3VM5A 2Q10A 3Q6GL 1QASA 4KMLB 3O0RH 3RRQA 5DHYA 2NZ9C 4FEMA 2ZUQC 3JZ7A 1EBPA 4PJ5D 4ZS7L 5T1LA 4A2GA 4I0CC 4XNUL 1SHWA 5MEPA 1ML0A 4UILH 3M07A 1WFTA 2K1MA 3HI6H 2AJUL 2YGPA 3EH3B 1DBML 1J86A 1MIEH 2AJZA 1J8HE 2FIRT 3IKKA 3LHPH 4HLZH 1DANU 4UM9B 2CALA 4HPHA 2NXYC 2VC2B 2XX0A 4MA3B 2QQNL 4ZUTB 2F8XC 2MFNA 4XH2A 1FNEA 2P24B 3LQMA 5CU5A 2MJWA 1T66C 2AK4B 2MQ3A 2AAAA 4KC3B 5ALCL 3T3MF 5IHZA 1CDGA 5IK3B 3MBXH 3D50A 3MLSH 3NAAL 3P9WB 3MJ8B 3QEHA 4G8EA 3WFZA 1FPTH 2Z1KA 3H9SE 3T4AB 3GSQA 1YECL 1XXDC 3W0WA 2OMBA 5G4OA 4IRJD 4L2LA 4U7MA 4LBEA 4JFHD 3VGGA 1XGQA 4QI3A 4YPGB 2CO6A 5TDPA 4ZFOB 2QPFA 3SDYL 3O3EA 2HJFB 4UV7H 3UTTB 1T4KB 3FQXA 3QQXA 4GSXA 3MV8A 3A4AA 2DQFB 5CO1A 1ROCA 3HNTL 3MRBA 5GGQL 2XT1B 4PJ9B 5A7BA 1F3DH 5EO0B 3DUSB 4P4KD 4URKA 1WT5C 1KJMA 5FW8A 5I17B 1WE5A 1BVLB 4IKIA 4QYOA 4ZW8A 3WG7B 3OB0H 2CO1A 4C54A 3NDZE 3CUPB 3ENEA 3O4LA 4OGAC 1NGZB 1N0XH 4JRXB 2DQDH 4GBXB 4KDTC 3SOTA 1XGYL 4CL7A 1AY1H 5GRUL 5AZEL 4WU7A 4AQEA 6CGTA 1NGXB 5JO5B 4JQVC 2Q8AH 3AY4A 3PP4L 2FVNA 4XBEL 4IS6B 1TVHA 5E99L 2VDOH 4AYGA 5EEXA 1OGAE 4YQXL 4UT7H 3S35H 3DV4A 3NVQA 5F3BA 1RZPA 1AKJA 3LS5L 2BNRE 3L5XH 5DUBA 3C5JA 1L7TH 1P9MC 1XCQA 3M1CA 1BM3H 3F6LA 4GQPH 3Q8AA 3HHSA 3H4FA 1PW3A 1X5XA 4B9CA 5FYJH 5AVVB 2KZBA 3NTCL 2PWGA 4HPYL 4LHUG 1RH8A 4KKPA 1EUUA 1QRKA 3J2PA 5J1TC 3KPLA 4AXWA 4AQ1A 3UTZA 3P77B 1AYOA 1I1YA 3OKNB 2FQFA 3EF4A 1J87A 4BCYA 3S8FB 4WV1B 5EEWA 1ZWIA 4OD1L 5FHBH 1NFAA 2NY4B 3OV6A 1SJXA 1MCJA 2O5ZH 3ZHFA 2XKNA 3OX8A 1K2DA 4ANKA 3VFUA 3RWGA 4M7LL 2FBOJ 2VISB 4FI8A 2IBGA 4GKSB 2NOYA 5C08B 3P0GB 1RIVL 2Q7YA 3SGJC 2J6EA 2WNXA 5D1XA 3IXAB 4UAOC 2AI0H 4XXDB 1EJ6A 3HIZA 1IO4C 1AE6L 4A63A 32C2A 5FAAA 1JP5A 4Q52A 4WHTA 1DVFA 4ALAL 1IFRA 3IDNB 3VGAC 4NRZA 5JXEC 1FVCB 2E9JA 2Q2EB 3TT1H 1O9ZA 3IGLA 4CNIA 1PF3A 1T2QL 4ZXBD 4IGBD 2JKSA 1TZOA 4OJCA 3VG0H 4TV3A 3C5SB 2X53A 4XVUC 3SPGA 1OW0C 1KPVB 2NTSP 3T0EB 2V17H 1HXYB 4H25B 4YGVA 4EN3B 3K2UH 1NLBL 2MPAL 5AOKA 1PSKH 5DYOB 4MB4A 2W9DL 5AW6B 4LCWE 3IGUA 4TXVB 1JN6A 3O6LL 2V8LA 3V4LA 4NZRH 3CNKA 3KLLA 4IHBA 3EYSL 3WY3A 1IGJA 2FUQA 2FWLB 5I15H 2Z4TA 1DDHA 2VGLM 3DHUA 4K9EC 4DP6X 2QGEA 3FB6B 4AYFA 1QFUH 1A6TB 2MHAB 5F96L 4ZMYA 3MLTA 5IJCC 4PG2A 1QABA 5CP7A 1DUYA 1PFOA 3QZMA 4LLQA 2D7TH 4KKBD 4TSAL 1Y6KR 4GYBA 1FG9C 2WWKO 1YC7A 3H3KA 3INOA 1GZHA 1EAJA 4YDVB 3VXOB 5KVEE 3K3QA 2AK4E 4LCUB 4Y4HC 2DD8L 5EBLB 1DEEB 1ZD6A 3G04B 4IOSA 5FIEA 2GBTA 2EO7A 3FSOA 5E4IA 2HVKB 5IB2A 2OK0H 4ZODA 2VDOB 2J44A 5IGXH 2W65A 5CUSH 4RAHA 2ADGB 2VLLB 3ROLA 5FDWA 3LRKA 4FL4C 3LQZB 1ZLWH 5D96B 3NABL 4KHXL 2BW5A 2X6MA 1T2XA 3CH1B 3T2QA 2XACC 3DARA 3WJJA 5I2IB 5LBGA 5ICXA 4EDXB 2X4SA 1QI3A 5FHAL 2VDQH 2BIOA 4QRBA 4LGSB 3UTTE 5J57B 1WD9A 5J3HC 2HT2D 2IQ9L 1P4IH 1HEZA 4R0LC 3KWVA 2GAZB 1AIFA 2P8LB 4LOVA 5D1QA 2WGNB 2CDFA 2M2DA 4F57L 2VTFA 2UZYB 4LE8A 1Q0XH 1NC2A 1JD7A 4AYSA 3KWWB 3LPOA 2KL6A 4AIEA 4HV8B 4OIIL 1BOGA 2ZICA 3OPZL 5BNXD 1KT2A 3GBLA 2I07A 3D25B 3HZMA 3SKJH 2EDMA 3IU4L 4HAKA 5DEFB 3Q13A 4J2QA 4A38A 3RDTC 4LLYB 4LVHC 5K69A 2X3CA 3QJZA 2JQZA 5GZND 4E5XB 3NP3A 5KG9A 1BMWA 1DJIA 1PDKB 2CJ3A 3B6SB 3KPMB 3MNZB 1ZSDB 1OAJA 2X4NA 1JV5A 5D7JC 5FUZL 1HWWA 3MBED 3RVVC 3CHOA 2EYSB 2AXHA 1V7NL 2F18A 1MCRA 2OMTB 4BYHA 3HB3B 5C0AA 4L5FL 7PCYA 5GRYA 5D6CB 3PL6C 2D2OA 3SKNB 1YCSA 2H32A 4JMXA 2GC7C 1J5DA 1CZ8L 2R0LH 4NKIL 3BUYB 4WNSA 3SBRA 4HWBH 4WU5A 3BAIA 3TBWA 4B50A 1BVOA 3QNYA 3LNGA 3VMPA 4LAQL 2C5DC 1VF5C 2GT9B 5DJYB 2ZKWA 4KJQD 4KZEH 5A40E 5J1SC 4LO9A 2NY2D 4LEXL 4ZMOA 4XCYA 3BFWA 1H8OA 2WYZA 5C08E 4NO5A 4ERSH 3LNEA 5GS1B 5AVRB 1KTJA 5ANMA 4JG0L 4WW1B 4I4WB 4NNXA 4F8PA 1Q0YH 3ZHNA 2JCCA 3BUTA 5TF1H 1F3RB 2LU7A 4R7NB 3CHSA 3SZ6A 5AL8A 1K72A 4AENA 2XRAL 3MKKA 3FO9B 3A3YB 3HC4H 3OWRA 4KDWA 4PRPB 1A7QH 4ZUUA 1AQKH 1EFXB 3BSZH 3OJDA 2KLRA 1A6PA 4JPKL 4JM2A 4MA8L 4WI8A 5SWZA 4A2DA 5IUCA 2D73A 1XD1A 2P26A 4J3OC 2NY3C 2DBLL 3MXWH 5E1IA 5C9KA 4XMKL 2NYYD 2Y7OA 5CHNA 1FIGL 1YEHH 2HRPH 2J1KA 3TEYA 3TVMD 2R2HA 3T0EE 1JHLH 1P1ZA 3MR9B 3RWJB 3VD7A 3LZNA 2VDQB 5I8KL 5L7XL 4PTTB 4UV4L 3BVUA 3EO0B 1VFBA 4I85A 5E95B 3TCLB 4AQAB 5DC2A 2VJ0A 4UTBA 2HRHA 1BZDA 4PUBL 1O6SB 4Z77B 4JO2L 2A6JB 5DK2A 2VDKH 3BP4B 4PJ5B 2AITA 4K8RL 4X8GA 3OXSB 2FATL 4XAWL 5H2BA 4TUOB 4ZTOL 1BQLH 2R9HC 3T4YA 1E7UA 3CFDB 3TJEL 1NLDH 5HVWA 1X7SA 2IPUK 2OTWB 4M6OL 3U9PL 5I5IA 2Y5QA 1ES0A 4LDOB 2BIIA 2VMFA 4YR6A 2UUDH 5IQ7H 1M71B 2H26B 4J3WA 4C83A 4EO5A 4M6NH 4PJCA 5C0BD 3KEDA 4G9FA 4QXUL 5I76A 1DQIA 3VFNB 3GSOB 3K6DA 2OMYB 2XWTB 4HF5L 5EEUA 3V5DB 1S7WA 1UQSA 3MCLL 2VLJA 4GPVA 4MLIA 3SDXE 3X2QB 9PCYA 1XAKA 4JFPA 4LL9A 4NSKB 4X8JB 3QRBA 5IP4A 1ZVSA 5H37H 2HT3D 1KBWA 5D7LD 2W07B 3WN5B 1MHPL 4XODA 4LL4A 2DQIL 3K71B 4D9LH 2VN7A 5CWSB 1P1VA 2XN9D 1C1EH 5HDQL 1NCAL 2YUVA 4PJEA 3SB3A 2NZIA 4XE5B 5FYKL 5MEOA 2H0JA 3RPKA 3UC0L 5LCVL 5BVJB 5MI0B 1KGWA 1IEBB 2EC9T 1AGEA 4N0FA 4MSWB 4NUMA 1LEKA 4GQRA 2R4SL 4LCYA 5FGSA 1DVXA 1IC7L 5C3TA 2OR9H 3TBYA 1E6JH 2FSEB 2FX9H 2ERJB 1N59A 4KXZH 4ZFGL 2UX6A 3AY4C 4DN3L 5E6ID 3L95A 4HFUL 2ORBH 4NHCH 4OLYL 1QX1A 3EOAA 1HU8A 3FUKA 1XD0A 4KZCA 4IDJH 3WUWB 1TKWB 1WZAA 1TR7A 4CVXA 2C3GA 1HSBA 2A7BA 4J6RL 1E4XI 3RPBA 2KZWA 5HHOD 1FAIL 1NCHA 3MJ7A 2B9BA 3CBRA 2OR8A 2ZIDA 4LHUA 4HCIA 4G43B 1BPVA 4QDGA 4K7PX 2RA1A 2GTZB 3FAXA 4QRQA 4AL8C 4BDVB 3KCPA 4WEUD 3N50A 3AWEA 1XSJA 5IQNA 4JFVA 2WKLA 3MVSA 3QUML 4N20A 2I9LA 1UWGL 2KDGA 2XBDA 3U46B 4AW4A 2Z31A 2H3NA 4GRWF 3HKFA 3MRHB 3CDCA 2EDDA 5ESVA 2OP4L 1W6WA 3EGSB 1U2YA 1FORL 2FQGA 2CPCA 5AVQB 4UQ9A 3QGVA 1CI5A 1CXKA 5D7IA 5JTWA 5KS9F 3AREA 4E36A 1Q72L 3VQ2C 3WGVB 2IFFL 1MH5B 3OLGA 3KLQA 5HJGA 4J6IA 2P45B 1IAMA 5F1NB 2VDKB 4H40A 2K0RA 2JJSC 5BVPH 1LO0L 3VRLE 4QWWD 3U1PA 1IC1A 4F7TA 1YEIL 5IESH 3BWSA 3IXTB 1UKTA 3G9VA 2BNQD 4RGMB 1PLGH 1FSKC 3V6ZB 2YWYA 5CP3H 3W9DB 2HKAA 1F02I 4FQJH 4ODBD 4R8WL 1DVSA 3FB7B 1E8XA 4QHMA 3P3UA 3SKOA 3U7YH 4L9LB 1XCWA 1T0NA 4PRPE 2IDCA 4NYLA 4I77H 3PAVA 3BUQA 1GXEA 5TDNB 2HTLC 2DL9A 4ZUVB 4ZUSA 3AFLA 3CVHB 3GJEA 5EFIB 3RL1A 2PW2B 2BVPB 1X9LA 5I1LB 1Z3RA 3FT4B 3LXCA 1NCUA 3UYPB 2CIKB 2QZQA 4KKRA 5TPWH 3RVWC 4GMTH 4IGBB 2W80C 4HGWB 4N2BA 4OM1L 4U6VL 4WO4A 4A7GF 2TSBA 2FYYA 3UPAA 4BH7B 3T2PA 3DSFL 4JKKA 2K78A 3VXNA 1E67A 4CGTA 1UEMA 5FYLE 5EN3A 4N26A 4DP2X 1E0OB 4F58L 4Z7VE 4YBQC 2IXQB 3PFQA 5JDJA 3H42L 4LHQB 2R0ZL 1R5WA 3WTYA 2ZF8A 3VXPB 3HKZA 5DMKB 4PJ5E 5ICYA 4JPIA 2D3LA 5L4FA 1E2VA 4JG9A 1FV1B 1UTDA 3K1DA 3FT2B 3BE1L 4Z7QB 3KPSD 4AX3A 4F1ZA 4IRZH 2QQKL 1UUSA 2H8PB 1AZVA 3ZKNC 2NNXA 4DVRH 1X7TA 4I0PC 1CE1H 5JW4R 4NT6B 5DJAB 1FH5H 4APQB 5HHPA 4QHNA 5I24A 5CN2A 1S78D 2EO9A 3VWJC 3KXFA 2AQNA 5I6LA 3PREA 1SN2A 5DJ6B 3LRMA 3ASOB 4P59H 4NN5C 4PRDB 4XNAA 4GUQA 1CQKA 1UHVA 1N0LA 2ZT9C 4GG8B 3FU7B 5DJ8B 4P48A 4FG2A 4UIMB 1CDYA 2EXTA 4JFHE 4FERA 1FE8L 2X6UA 2WB1A 4OLZH 3WMQA 4DERA 4PV9B 2EIEA 2VAAA 5DA0B 3E7JA 5E00A 1DQKA 4LSPH 4AIOA 5IB4B 5AW8B 4OVUA 1RZKL 2YSSB 3PJSB 2UZIH 5K5YA 2CKBH 3T65A 2EVGA 1X4XA 3OAWA 4IOIA 4MASA 1SHXA 2OTUA 3LKPB 4QRFA 2ATPB 4M93C 3PS6A 1T89C 2ZJSH 1SBSL 4BH8A 4XMTA 3KG5A 4Q0XL 5IW3A 3FRUB 5IHUL 1L9OA 4JHZA 5FA3A 4XMPL 7FABH 3OLDA 1QQDA 3T3MB 4EDWH 2DM4A 5CCKL 5I1IH 2BERA 3WBDA 1S7XB 5GS0H 2KC0A 4LVNB 5ENWA 4PSRA 1YN6B 4UT6L 3DX0A 3MGOB 4HLZG 4XPTL 1E65A 5I66B 4WCYL 3U1SL 3RAJH 4DPAX 3CSPA 3MV01 1DQJA 2NT1A 1G5GA 2OL3L 2HFGH 4MAYD 3CCHA 4PJAA 1F11A 5HHXL 3RX9A 3WSQL 5DD1H 4HOMA 1CDUA 4XMLH 3WIHA 4FABL 4RGNB 2VRAA 2Y2TA 5E9DA 2BP0B 4N5UA 5HGDA 1VCBC 2XI9A 3HBQA 3W2DH 4E9YA 4K7PL 3IFOB 3TV8A 1KN4H 1WP6A 1E50A 3ALPA 3HG1A 2QPDB 3QH3A 3QK0A 3DHMA 3CFMA 2CKNA 4X6EB 4EI5C 1J9RA 3ARWA 5J8OA 3AU1A 1MFCH 2ZCKL 2YMXH 4N9GB 5AKRA 5D93C 3SPJA 4CU7A 5L8KB 2IALB 5KSVB 4X2UA 3V5KB 1U3YA 2G2RA 2VERA 2A0LD 2WZ0A 4NZJA 2O6EA 4A7TA 1SFDA 4ZYKA 3FT0A 1ZHBB 4GY4A 2NY2B 2WLLB 2XJKA 2WY3B 3NCMA 3NCXA 2R2BA 3OKMB 5AVYB 3SPIA 4JNXA 3SYPA 3UP6A 3WXWH 5DD0H 1NUGA 3GLAA 3H9SA 3CLFH 4J3UA 2AV1A 3SPVA 4B5ZA 4AJWA 4BQBA 1RZJH 1F4WH 2BC4B 1AQHA 4QF1A 2J88H 1NCJA 2FX7L 1I7TB 3FBQA 4YDJB 3U0TA 4ZMPA 1FZJA 4E0RA 4M1GH 3GMOA 4TOYL 5B38G 2HG0A 5A2LH 4BZ1A 4HC1L 5AOIA 2JMRA 2UZXB 3I9PA 2WCGA 3IKCB 4N90E 4EI6B 5EOQL 3IDIB 4BA8A 1TTFA 2P7TB 3BQUA 3VAEA 4PR5A 2F0CA 2B59A 1MNNA 1FYTD 4LPUA 3MODL 3T2NL 2LTQB 2XQ0A 3CQPA 5DJZB 3VA2C 1DQDL 5LGYA 4YDKH 2B1HL 4K2UL 4M4PA 4OI7A 1MEXH 4AGQA 3PHQA 3US0A 5T3ZH 3G3LA 4R5VA 4MAZA 4XX1G 3IGKA 2JNZA 4R2GB 2CDEB 4Z7QE 3BKMH 3MCYA 4YXHL 1QR4A 5IJKA 5GZOC 3CVIH 5DT1H 5HI4C 5F7EL 4IM8A 3O3BB 1ZS8B 1AGDB 1A9EA 4EBQH 1KULA 3CH8A 2EJ1A 3ULVL 4KUZH 4N8PA 4B3VA 1FRGH 3LIZA 1MCLA 3C08H 4GAGH 3EOBA 4DKEL 3VGDA 3CSYB 1OTTD 2Y1ZA 5A16B 1DHKA 1INQB 5ISZB 4QNPF 4E5XG 1F58H 3GI9H 2BM3A 5I6XC 3EYUH 5IJBC 2EH8L 2VJXA 4WTZG 1MAKA 3D18A 1FUNA 2BIHA 3NZHH 1YJDC 1KCUH 2AJ3A 4FNRA 1EK3A 2X87A 1TQCC 2WQVA 1GIGH 2XETA 2DYPD 2HFEA 1OM9A 1J18A 2DOCA 5GGTA 1E27A 1PZ2A 1KJ2H 3GBNH 3KPQB 3UTPD 1WGOA 2IWKA 5IBTH 3KMDA 3AUVA 4U1SA 5FO8B 2XN9B 1DQLH 1DLHA 3C9NA 2QR0A 3PGDA 4AYEC 2DQEH 5E0FA 4LKXA 1Y6MR 1BYOA 4OD2B 3DX9A 5KYYB 1HX0A 5JQIB 2V3EA 4Q89A 5DJDB 3ZMNA 3TIEA 4GRLC 3QZWB 3GRWA 4HUUB 1WTGT 3LPFA 1G9ML 5JOFA 1RPQA 3T3ME 4D0DA 1NC4B 1ZGLM 2CRZA 4FI7A 2BOBB 3BPOC 1F1DA 4N2MA 3EF7A 5E6IB 1FLRL 1VERA 1ETB1 3WY4A 3BUPA 1IGTA 3A6BH 1E42A 3X13A 2VDPH 1WQVT 3K1KC 5CGTA 4UTAH 2ZYRA 3C5ZA 5FGCB 3HR6A 1PD1A 3QHFH 1A7BA 5MP6L 4DGIH 1RP9A 5SWQB 2ICWA 4GG6A 4CDHA 5H4YA 1XF4A 1ZHNA 3UPRB 2AV7A 4J4PA 2O6DA 1CR9L 2CBQA 2IG2H 2VL4A 4FN0A 4IU2B 1E4KA 2BVUA 3NCBB 4NIYE 5C0ND 4XN1A 4NO2A 3WE6A 2A1WL 2IV9A 2QHRL 3BP7A 1S5HB 1NAMH 1E4WH 1U3HD 3U2IA 1RPUA 3GZPA 5T33H 1F0LA 1ETZB 4JHWL 1MZYA 4JM4L 1IILE 1I85A 3K46A 5FO9B 3L7EA 2MCAA 1S4IA 1CT8B 1EJOH 3QHTC 3KH3A 3MRQB 2WWOA 1J9QA 1E3FA 3QPQC 1QLFA 2M83A 2F54D 3V0GA 3ATEA 3RFZB 5CZVL 5EZLB 1CGWA 4RAVA 2H2PC 1MNUH 5DD5L 3F7LA 2CHDA 4UM9A 1FG2B 5J7CC 5IVXF 1BFOB 4MA3A 4ZUTA 4HJEA 3CN4A 3N0AA 5BS0D 3AROA 4Y5VA 3DURB 2P24A 5D1ZD 1GCYA 4NKQB 3S3JA 3W39B 1RK1B 1IGFH 5BV7L 1H3PH 5SV3A 1D5IH 1HAWA 2NY5H 2APWA 2L3BA 1QFWH 1P4UA 4P2RA 5IV2B 1V5JA 4PVBA 3RGVD 1JZEA 4ZMXA 2CM6A 4JB9L 1NBZB 6PCYA 2HP4A 4JO3H 4BGLA 3FRPB 2CK0H 2VLKA 4NAQA 3SYCA 1KV3A 4XP9H 2HJFA 4X80L 2CA3A 2EXWC 4XNYH 3WKYA 3DETC 4PJ9A 3O8XD 2AZUA 2YKLH 5EO0A 1CVRA 3DUSA 3GKWL 5TJWK 2C7UB 1KLFB 3E1F1 3P73B 1U8CA 1DJGA 3A6CL 3H0TA 1A7NH 5D8JL 3IE4A 3QQ3B 5HGAB 1INDH 4YXKL 1SEBA 1NGZA 1WZ1H 3FCSB 4FA8A 4JRXA 1OF0A 1ZRUA 1NKOA 4KQ0A 1JUFB 1RHHB 3L9RB 2WC7A 3FQUA 3GMPB 2ZCHH 4MDJB 1JGEB 2NXZD 4FOMA 3UERA 3NPSC 1VPOH 2WXKA 5JO5A 1S5IL 3LRGA 2O5YH 1DJSA 3UJTL 4LP8A 4P3DA 1P84J 3ZL2A 3ZTJH 3KPSB 5F8RC 4QXVA 5EOCL 5IW1B 3K6SB 1KXVA 4K15A 4IS6A 1Y0LB 1A9VA 3WKML 3H1ZA 3AS3A 3HZYB 2APVA 1MWAL 3WUWG 1GY1A 1H3VA 4Z76B 3OLEA 2QSVA 2VDPB 2HRLA 4GRWH 2F7RA 2EDBA 5I5JA 5LNGA 4MJIB 3CGTA 4XVJH 4NI3A 3ZMRA 2Y36L 5AB9A 1NUNB 2GJ6D 3I6SA 4AKPA 5AKVA 3GC3A 1AFVH 1IARB 1KBPA 2WP3O 3LKRB 2OXHB 5D7LE 5EZPA 3P77A 3RWIA 1GMEA 3M1BA 4JRLA 2XN9E 3JWOH 3KLSA 2OYMA 1OARL 2YEZB 4K0OA 5L6YL 4HOZA 4O58L 4EZJA 2X4TB 1KIPB 3ARDB 1RSYA 3RILA 5DHVB 3L4CA 3WFEH 5EZOH 2VISA 2BINA 1AQMA 5DHXB 5C0EB 2ATAA 4GKSA 5C0RL 5AD0B 1EXUA 4JZOB 3AVEA 4HKXB 3IXAA 4L8SC 3MTXA 1UD8A 4U3CA 4BRJA 4R7VA 3AS2A 4XXDA 5J13B 3QEQD 2CH8A 1IAKA 1KCVL 2VDNH 5JZ7D 1RFDH 3NJNA 4FQHB 5T5NG 1TQSA 4KDVA 3UZQA 2IBBA 5FGCE 2V5RA 2V8MA 4M48H 3IDNA 1NSNH 3WEMA 5HHOE 3VFSB 4M7LT 2P49B 3LTVA 3Q3GA 4IBUA 3D39B 3C5SA 3MOQA 4GSRA 2J8HA 1OGSA 1KPVA 4GS7C 3TN0D 3LZFH 1CBVH 1PY9A 4EN3A 5LLIC 4P9HC 4HIJB 2N59A 3NSJA 4XP1H 5DYOA 3I6KB 2HFTA 5FR3A 2VSKB 2UWEA 3HPLA 4PP1C 3LVEA 2EXYD 5H37G 2LU3A 1XF5B 4UDUB 5KOVC 4R90H 5LDSA 1BVNP 5DHEA 3FMGH 1UA7A 3UJJH 1AMYA 5E6UB 2NY7L 4NJ9L 3FB6A 1A6TA 5CINL 2MHAA 5HVHB 2D0FA 2FGZA 1FZOB 1B88A 2PTTA 4EUPH 3SE6A 3EIFA 1CU4H 3SDAA 1HAUA 1T4WA 3WFCH 2IQAB 2MCPL 5I6PA 3VXOA 1MHEB 2NTFB 4NPKA 5FO7B 1QFHA 2CHNA 2VSDA 4LCUA 5CZKA 2EEAA 1B0IA 1YEKH 1GAFL 3G04A 1JNLH 5E1GA 5TH2B 2BY0A 1OCZB 2IAND 1JPTL 1RZ8A 2HVKA 4PLJC 1KTBA 1E4XL 3KJ4C 3L8QA 1DL7H 4KVCH 1UWXK 4L4VB 3CZKA 2WBJA 1IEAB 1SLWA 1PNCA 2ADGA 1ZHKB 2VLLA 2WW8A 3DWTA 3ESVF 1R17A 4URTB 3IAPA 1BQ5A 1WVZA 4S1RL 3LQZA 4DGYL 4AVJA 5A6MA 3CH1A 4FI6A 5I2IA 3KPTA 4EDXA 1B90A 4XN5A 2WUBL 4GRWB 4HUWB 2AEWA 1NICA 5FM8A 5TGBB 4NKOB 3V79C 3TTYA 2N7SA 5KS9B 2QFPA 2GAZA 3WNMA 3QDGD 1JPGA 2P8LA 2OSWA 2PO6C 1C12B 1F6AA 3UAJA 4EJ1C 1RPKA 3TWCL 1FYTB 2UZYA 2V37A 2Z7YA 3GSRB 4XTRD 2FQEA 3KD4A 3HE7C 4HV8A 4JPVL 5I74B 1YVLA 1F00I 1MFBL 3D25A 1OWRM 2CDGA 1SXBA 1F4HA 1ZA6B 3DVNA 3KPSE 5DEFA 3V0WH 1YNLL 4A2FA 3WNPA 4L8DB 4LPVA 2ZNWA 4GKNB 3MA7B 4LLYA 1NOLA 1DEDA 3EDFA 4E5XA 4LOUD 4HMEA 4CVUA 4BV1A 2HJLB 2I9TB 3I6LE 1PDKA 2YUZA 3KPMA 2OTPA 3MNZA 5CR8A 3WV0A 2XWRA 1ZSDA 2IAMC 5TQ2H 1A0QH 2VMJA 5B4MD 5LNDA 3LKOB 1AIZA 1KB5H 2EYSA 1AG6A 1D5BA 3GSNL 3PWVB 4MHHI 4MXWL 1NBVH 3BZEB 4B96A 4MJIE 2OMTA 4WNJA 4JDEA 2YAFA 2YRZA 2B08A 5AW0B 5D6CA 4JJOA 4PS3A 3SKNA 2J1ZA 2IIJA 4W9CC 3IN2A 4DQOH 1UFUA 1PG7X 2F8OA 1TOXA 2YD8A 4M1DL 4XWOC 1I31A 5ADOL 1QFWM 4N0YH 2ZOTA 3EJYC 5IFJB 5BUGA 4UBDD 1TJXA 1A4KB 5IBUB 4L4TB 1HS6A 2OJZL 3HG4A 2GT9A 3EH2A 5DJYA 1BBJB 1Q8MA 4JX0A 3FN0H 3S37H 3ETTA 2A74C 3U0PB 2E7HA 2DEWX 3D4GA 2DWEB 1JVLA 3E6FA 4PGCA 4WW1A 3UEZA 4I4WA 4ZTPH 2LW3A 2AJSL 4FG0A 2PYEA 2AJYH 1WFJA 4M43H 4R7NA 1LJMA 4NWUH 4RBPH 5GGVY 3ISRA 5LAXB 5CIPH 1KBVA 7CGTA 2Q2LA 3DJTA 4XCNB 3QORB 1X5IA 4L05A 2Y2YA 5CD3B 1EFXA 1MFAL 2EP6A 2ZUUA 3KLKA 1RZFH 1NWPA 5L0QB 2XN0A 3S3BB 2DQ6A 1I9IH 1TFPA 3D39E 3FBKA 3MNMA 4LL1A 3R0NA 3VXMD 4PM1A 1DQML 3EYVB 4HP5A 3NA9L 4GAYB 3RWJA 1R19A 3B4NA 4UOZA 1U3HB 1GZQB 3EO0A 4NC1E 4MD4B 3UBHA 4KTEH 4XX5A 1O6SA 1XCTA 3JT0A 4KX9A 1T1WB 2A6JA 4FXGB 4Z8FH 3FU6A 1G6RL 4PV8B 4LCCC 4PJ5A 5DRZB 3FQTB 1FYHB 4D0CB 3FOLB 1N67A 4QRTA 4JVUA 3B3IB 2P8PB 2B0SH 4R4FL 1P2CB 2VR3A 4F7PB 3S5ZA 4R9HA 3GSXB 5GGVH 2OTWA 3MLXL 3FHQA 3TYGL 1A4AA 4CAGA 4R3SB 1U91B 3OHXA 4NO3B 5D71H 2G3ZA 3BT2L 2PKDA 4F8LA 1M71A 5E23A 2H26A 5I73B 2J71A 1UM5L 3WLWC 5D1ZB 5HHMD 2QLVB 1BFTA 4HUXB 1IB5A 1R3JA 3T4AC 4AV4A 1SYSB 4L4VE 4JDTL 4U0QB 2DQUL 3VFNA 3VG9B 4K94C 1JDCA 3N06B 4Y9EA 5J9PB 2VXQH 1KB5B 4X8JA 1SOQA 1OTUD 2W07A 1W8EA 1JRHL 3WN5A 4PY8J 2B7DT 3IYLW 4FKEA 2X1WL 3K6NA 4Z5RB 1FL3A 4XOAA 4PJ9C 1QKZH 4U6XB 5CWSA 2EIJB 4Z0XB 4DEPB 3K71A 1A02N 2B5IC 1KDIA 5E8PB 3ZJAA 1JS4A 5KS9E 1O5PA 1MW2A 4K7FB 2GUYA 2PYFB 3ESMA 3IJYB 4NUGL 4TPRH 2Y7LA 1MRDH 4HWBA 1IEBA 2V7NB 1FYTE 5CSBA 4YFLF 3CWGA 3W3BA 4MSWA 3WELA 3FQWB 4GBXC 5HJDA 2XTLA 3BAKA 3OKKB 1V3MA 5IVZB 2X9YA 3P0VH 1AOZA 3HMXH 2FSEA 1GCFA 1FGVL 4GSDL 2GSIA 5MHSD 2QVFB 3RVXD 3V6OC 3DRTA 4HEPG 3V55A 1VAHA 3BEVB 2GTWB 4HT1H 3AT9A 1N6UA 4X7EC 3TH2T 3WUWA 4Z95L 1NGQL 1ILSA 5JW4Q 1IM9D 3D69B 1TKWA 2WQ8A 4FG6C 3ULUD 2WLYA 2QADD 5AYUL 1WHPA 3TBVB 1UVQB 4YHZL 4X6BA 5J4MA 5AALA 4RMSA 1ED3B 5CIPB 1CXHA 4JGUA 2XWEA 1A64A 2GTZA 2YD7A 3LRHA 4TLTA 1U8MB 1B4RA 2BPBA 3MDJA 4Q97A 4LLWA 1ZA3A 3AQXA 3VYPA 4OFVA 1KBGL 1Y7VA 4FYSA 3P40A 3U46A 4F20A 3NCYP 3NJHA 3MRHA 1XB8A 1RIUL 3STZA 3EGSA 4DSYA 4WV1C 1CURA 1YYLH 2NY4C 2HKFL 3NCFB 3OR7A 4IBTA 3U7WH 1PG7L 4FFWC 3F58H 3CD4A 2FDBP 4OLWH 4L4TE 5AZ2H 4OUUA 5DD3H 1JZIA 3FQ1A 4LLAA 4TVPD 1I9EA 4N87A 5F1NA 1U42A 4LMQE 1ZAGA 1OAKL 1JYXA 2VE6A 3UROR 5LN8A 3IXTA 5ITFB 4PTUA 5F72S 3HS0A 3MLWH 1LQBC 5FV2A 2QPEB 3V6ZA 2GYSA 1HINL 3W9DA 3T1WA 3C87A 1OAYH 2QSQA 4AK2A 4OJDH 5B7MA 1DP0A 5J0BA 4K23L 4L9LA 4JKMA 2Z8RA 2E27L 1DZBA 4EKJA 1D9KB 1BD2B 3C60C 4KROB 2R2EB 4W9IC 5TDNA 2XV3A 2VH5H 3CLEH 4TL5A 4ZUVA 3CVHA 3BESR 5HDQH 2PW2A 2BVPA 3FT4A 3UYPA 5DLML 1HT6A 2K7PA 5DJ0B 2ZAHA 1KV7A 5I19L 2ITDA 3FRPG 4TMPA 2YXFA 4IGBA 3T0EC 4FZEL 3ZLQC 5I0XA 4BH7A 2XBZA 1QWNA 5H37A 3BDYL 2CLRB 5HD8D 3RKDD 4K73A 3TN0B 4U7SA 4ZX4A 1GJWA 1MZZA 2CNZA 2H5UA 1JF6A 4JKPL 4K5MA 1DCLA 2IXQA 2QEJA 1P7KB 2FJGB 4L9DA 1E9OA 4XVSH 4YHNB 1NDMA 2F54E 2A4ZA 3D34A 3U79A 1FV1A 4M6MH 4DZBA 4WWKD 5IQOA 1PBYA 3VDBA 1S9XB 2Y0SA 1CYGA 4P0DA 4F33A 5I0ZA 2A9AA 4NQDD 2J1YA 3BLBA 4TUKH 5EH1A 5CEZL 4NT6A 5C1MB 2AFNA 1JCKA 4APQA 4S1DD 3IJ9A 5BS0E 3HFMH 1FCCA 1I1AB 5ELIA 2DYSB 2IANB 1J5HA 1G9NC 2C1PA 3S2CA 4GG8A 3O9WD 1QA9B 3FU7A 5DJ8A 5IBLC 5FF6B 1ITBB 4A68A 4AEFA 3EFDH 4UIMA 2OFQA 3UFIA 4QTHB 4OTXH 5BQ7A 1AXIB 1M7UA 4P5KA 4P5TD 5DGRA 1ETJA 1H0DA 4PV9A 3MV11 3UO1H 4S10A 2ZUYA 4F8TA 1HWHB 4BRVA 4N8VG 1IQWL 1UD3A 2NNAB 2WQRA 3QCTH 5IB4A 4ODSL 4UF7C 5A2FA 4KKAD 4W70A 3EDJA 1O6VA 1UOWA 4U1LB 4YZWA 3IMBA 3FFDB 2YSSA 3PJSA 3V4PH 2QVKA 4B9FA 3QDGB 1IM3D 4Y2DC 2VR5A 3PPEA 4P57B 2WAQA 4HPOL 3MXVL 1TQBB 3LKPA 2I7OA 1IKFH 1C16B 2ATPA 3LXBA 1U58A 4NXKA 4W6WB 5IVXB 3A67L 2WZ5A 5MENB 3SPCA 4WI3A 5IMOA 3EXLA 2XN2A 3LS4L 3GS4A 4UNIA 5DUJA 4LFHG 1JPSH 3VFOA 3LD8C 1Y1UA 1FNGB 3LKQA 2FH6A 1QBLL 2KQNA 5EBWB 5A3IC 1NFIB 1YN6A 1XH0A 3MGOA 5FOBB 2GEEA 1KYUA 2YLHA 5I66A 3GHBH 1WTLA 4OFYA 5E51A 5CP3A 4PJ8D 1FJ1A 4Y7OC 5LGKA 5G5DA 1H6TA 3KPPA 5E2VH 1YC8A 4QOKD 4XCCL 5HDLA 4HUNB 1BJMA 3CZEA 3ABZA 4OD3L 3S2AA 1EUTA 4Q9QH 5J12C 1V3JA 1BEXA 4DEWA 2LVEA 3L5HA 3BP6B 4XMZA 4K5LA 4LU5L 2NUPA 4B95C 3R7QA 3FH7A 3IFOA 3CZGA 2GJ6E 1U8HA 3VM7A 4GINA 1X6NA 4AL8L 5MEQB 2WXOA 4X6EA 1KN2H 2VJ8A 4N9GA 3B2UC 2WXIA 3QJOA 5KSVA 2BJML 4EXKA 3V5KA 4PS8A 4LVOC 2EDYA 2EINB 2QGCA 1HOCB 1I3GL 1R5IB 5GS1C 1GKOA 2H1LM 1TZGL 2WLZA 1MRCL 3ZZLA 3GT6A 1YAZA 2WLLA 2ED8A 5IT2L 1G43A 4WKZB 4IRZA 1YNKH 1MW1A 2DQJL 1RCYA 2G5UA 3OKMA 1SFHA 5BRZD 2R1XA 3BWUF 3NQIA 3RPIB 3PPSA 3CK0H 3TBTA 3TYFB 4QNPE 3CFEA 4QGTA 2RHEA 4HMDA 3ZTJG 5HI5D 4JN2B 3LQAH 1WYJA 1RAMA 1BD2E 4DP0X 2WD0A 4CSZA 5SX4H 2WXQA 3DLQR 5B39B 4YDJA 2HX7A 5ADPL 2APXA 4UI2A 4W4OC 2VN5A 2X42A 2Z8VC 4KPHL 5KWYC 4ZX3A 2VL5A 2LHAA 2UZXA 2BSRB 3IKCA 4OZGF 4Y4FD 1IC4L 3IDIA 4FFTA 4XPGL 3WJMA 5B3NA 3FUNA 2Z65C 4MDIB 3R7RA 4W9JC 1UKQA 2Z1PA 3KS0J 1OHQA 2H1PH 4JFFB 3V4UH 5HYEA 2IWGA 1KYAA 1YMMB 1Z2KA 1UWYA 2VAJA 4PG9B 1CLZL 4RGOH 2A4EA 1SXNA 2CKBA 2CDEA 2CR0A 1SF3A 4H8WC 3WFBL 4AITA 4AY0A 4RWYL 5EIVA 2IH8A 1ZS8A 1AGDA 1T7XA 1XB3A 4X4XB 3BCDA 3RYMA 3GHEL 3C6EA 3II2A 1S7RB 3PNWB 2HMID 3B2XA 5IW6B 5B1CA 1WDAA 1FH2A 1C8PA 4G59C 2QT6A 4GAJL 1PQZA 1INQA 2IANE 3GO1H 5ISZA 5HYQA 2VXSH 2WQXA 1QFPA 3MV9A 1T1YB 3UGEA 2XVLA 4NS0A 4U2ZA 2ICWI 2JJUA 1JSYA 1K3ZA 3KPNB 3RGBA 3CN2A 2XZZA 1HCZA 1ADQH 1Q9KB 3NOIA 1WWWX 1HESA 4XBMA 4GXFA 5F1IB 4LSQL 2XSKA 2PR4L 5AWNL 5FO8A 5MI0C 3K4AA 2E7BA 5D6DA 3V9EA 3VWKA 4P4KC 3QDGE 2K6YA 4OD2A 1U33A 2RD0A 3KYNB 1CLYH 2PXYD 1EV2E 3QJVB 5DJDA 4HEPA 5IVXE 4OLVH 3AMKA 3QZWA 1AI1H 5E2TH 3H9YA 5DK0A 4NKDA 5C86A 2I60L 3BEWB 1NC4A 2BOBA 3IPFA 4R97B 3GZKA 3CJJA 1WIPA 3BW9B 3BAEH 1UM4H 3GJFK 5E6IA 2FT8A 3ZSTA 5BMFH 1L0YA 1D5XA 2GSGA 3EGXB 5KVDL 3GTNA 4EUPG 2JSFA 2C9UA 2R0KL 4KH2A 2H0PA 2ZX7A 3T6VA 3A6OA 1IM9B 1M6UA 4MS8D 5SWQA 4WK0B 1N6VA 3KPRD 4N86A 4PS7A 4UINL 3WTSA 2VDRB 4K9JA 3P3RA 4KU1A 1SDYA 2O72A 3UPRA 3ASWA 1SMDA 3MMEA 3CXFA 3L9YA 4IU2A 4Z3HA 1ID2A 4DN4H 2NX5D 5A1AA 3L16A 5DUML 3B2VH 2CG9X 1ETZA 1IGIH 3C2AL 1EBAA 4GXUN 3LV3A 1IBZA 5FO9A 3WTXA 4M7KH 4JAMB 5I6NA 2NY0B 3ZMEA 2VR4A 5DQ9B 1RLBA 4F27A 4XP5H 5FFOA 1N64H 3OSKA 3VH8B 5J06A 1PYWA 1OLLA 4PH8A 2ADFL 5EZLA 4ZX5A 4CUCA 3QUKB 4W68A 3MOAH 1UB5B 3BPCB 5D7SH 5TQ0H 4IJ3C 5B8CB 1DLFH 3QUYD 4P3CH 3QQDB 3ZYIA 5LWYH 1FG2A 1AJ7L 2F1EA 3EJSA 4ODVH 1YG9A 1BFOA 2MKWA 3NIGF 3AQYA 4JJ5B 2AS5M 3MSPA 1PLCA 1R3HB 1H15B 4NGHH 3W39A 5CCHE 3MRCB 4TF4A 1RK1A 4DT2A 5IFHH 2ZWNA 1H6EA 3QE5A 4AVKA 4M5YH 3U30B 3NJXA 3I3DA 5JHLH 2X7LA 3FUHA 1Y6NR 5IV2A 3QYCA 3ZDZB 1HHGA 2DI7A 2IAAC 1DFBL 3DBSA 1CGXA 3FRPA 1BZ9A 4OCWL 1KYDA 3EH1A 3SY6A 3RZWA 5ID0B 4RLDA 4U1KB 5HDWA 4ZXBC 2YD0A 1HL4A 4IGBC 3S5LG 3C6LA 1HFUA 4JY5L 3LMJH 5K9QI 1F4AA 2CNYA 4TQEH 2F5BH 3VXME 4NHUB 3KL0A 3HI5L 3SYOA 4G6AD 1OPGH 5GGRY 3GXIA 2X9WA 1NH6A 3C8HA 3EBAA 1W0WB 4OF3A 3PABA 1KLFA 3P73A 1XTLA 1LWRA 4P46B 4N2NA 3OR6A 1F45A 1KJ2A 4NWTL 4DWHA 1YEJH 4TRPL 3QQ3A 5HGAA 4QRUA 1FC1A 4IIQC 1X5FA 1JUFA 2ZKXA 4FNSA 4UTBL 4TYUA 4MDJA 3FSAA 2YPVH 3DVIA 3QPXL 1IT9L 4PBXA 1MUJB 1QWUA 2VUOA 5A2AA 35C8H 2P5WB 2DQCL 3K6SA 4KKBC 3VFRB 4YLCA 2BZ7A 4Q2ZB 3PAYA 1OB1B 1SJEB 3HZYA 4ZD3H 3ARGA 4BQCA 2XWBA 1P4LB 3VQ1C 4PW4A 4FP8H 5HHME 1BZEA 3TNNB 3OMNB 4UTAA 5IWLC 1RLWA 1FBIH 3JTBA 4MJIA 2X1QA 2Q6WB 5FWQA 3ZUCA 4IKJA 5DYFA 2C9SA 5BZZA 3ZT6A 4YSQA 2UV3A 3WENA 4N8VA 4Z78B 3B2MA 3IDJB 2F53D 3DJRA 4AGLA 3OJMB 2CO7B 2BXZA 1SHMA 3UDWC 4N2CA 4DH2A 4P5TB 1IZKA 1KBKA 2J8UE 2VR6A 4OM0L 5DC0A 1OP5H 2V7HB 5EC1A 3TA3D 1U3NA 3Q1SH 1BYNA 2YEZA 3NJKA 4WHYH 2X6VA 1ZE3H 2VZTA 3BKYH 3B9DA 4JFWA 3T09A 2X4TA 1KIPA 3ARDA 4LSTH 3GBMH 3KGRA 5J6HB 5I30H 4JO1H 3D0AA 3WGUB 3QDJA 4NQCA 2BY3A 4PCSA 3VFVA 2JB5L 3NJLA 4P2OA 5C0EA 4LSVL 4M8VA 4FCAA 5AD0A 4JZOA 1C5DB 2FO1A 1HEJC 1EVUA 2PCPA 4JO4H 2W0KA 4LVNC 3FHAA 2ZXQA 1HCVA 2FK9A 4XPBL 1M53A 3CVDA 4POZD 3V52L 4BFFA 2A6DB 5K93A 2ZXBA 5GZNC 3F8UB 3B2DC 3QI9A 2PETA 1X5AA 2X1XR 1YEWA 3D4YA 4XCFH 5LO7A 4DW2H 5KVMC 4TQHA 1A8ZA 4PJ8B 1EH9A 2JQAA 2P5ED 1TVBB 5E56A 3MBEC 3JZYA 1RVFH 3VFSA 2CE6A 5JQHC 4ODTL 1ZEAH 1TJGH 3MREB 4QOKB 3W81A 4QY8B 3D39A 4JRYA 3QUZA 3DPDA 4TVSa 1A7RH 4G1MB 5JW4N 4IOFD 2R59A 4HIJA 1NCBH 4HZ1A 1DE4B 4Q56A 3I6KA 1JFQH 3VXRB 1BXXA 4NN7C 3CZJA 2OW6A 1XF5A 4JCMA 4I3SH 5KTEL 3UTSA 2VOTA 3D06A 4KKQA 1WBXA 4NP4L 3O45B 1I8KB 2CMRH 3UBFA 1FZOA 1RP8A 1RURH 2N7BA 2YKKA 1IRAY 4KJQC 4F9LA 1F4YL 4TVPE 2I5YH 2NY2C 3PDOA 2X0UA 2IQAA 4AE1A 3TT3H 1PZ5B 4QEGA 1MHEA 5FO7A 1YZZA 2WQAA 1LYQA 4JG1H 5K59E 1L7IL 5TH2A 2FJFB 2WP3T 2RMNA 1ZANL 4NCDA 5KVGL 1BAGA 1G84A 4HJSA 4P3WA 1Z3GL 4P07A 4FJYA 4L4VA 5GHWL 4QKTA 1ZHKA 3LZLA 2YBGA 1XGTB 3RQ3A 2XZCH 5AG9A 2NY1D 2YRLA 2FEDD 5EF0A 1URLA 3HJEA 1KBBA 4EOWL 1PPIA 3VQLA 1HCYA 1BAFL 2K70A 3WTUA 2BFVH 2F15A 2DQTH 5DD6A 2Z92B 4KZ0A 5GGRB 3TVMC 1MOEA 1QTYT 4Y4FB 4BFOA 3RVUD 5D5MF 3MRDB 1X5ZA 3T3PF 1C12A 3GMMB 5F7AA 1FYTA 3RZCB 1OAUL 3GSRA 4LIQE 2HJKB 3AM8A 3I6GB 3SE8H 1UC6A 1G1CA 2Y1AA 1BEYL 3N41F 1IE5A 3B8SA 3QIWD 5LQBL 3FXIC 1OSPL 3OQRA 4JZNB 1TLMA 2CIIB 3MI6A 4LKCB 4BBWA 3V9CA 4L8DA 2VO8A 4GKNA 2GCYB 1SDDA 3MA7A 5C0IB 5GS0C 3BZ5A 2HJLA 5BW7A 2I9TA 1EGJH 4HJGB 5FECA 3BISA 5BRPA 1B2YA 3GLEA 1HVXA 1QUNA 3BWZA 3LKOA 4XAKD 1MQ8A 1ANUA 3PWVA 5L8JB 3BZEA 1JXJA 2BH0A 3L6FB 3U9UB 4GW5B 4RISH 1L3WA 2VN6A 2DLFL 12E8H 3UBXB 2BIQA 4MMZA 1FDLL 2BP8A 4G7QB 1IBBA 1SDAB 4M5ZH 3UH8A 3WD5L 2D31B 5C6WH 2HT3C 4HKZB 2JKJA 4FC3E 1HILB 4PCKA 3ZO9A 4G8IB 1GGBL 5HDBF 3VD9A 1WZKA 1X5KA 3DI3B 1F86A 1OANA 4L1BA 3ZN6A 2GPZA 2JJWA 4OCXH 3U6XA 4D8PA 4PJHF 3S36X 1TMQA 4K3EL 4ZMLA 1MCCA 1X5LA 1A4KA 2OMZB 5INCB 1F13A 3LVTA 4WHDA 3ZVVA 5IHBA 4L4TA 4YHIB 1Q9OB 1W0YT 3VTAA 1JNJA 1FLTX 2CHXA 4NQVB 3RP1A 3U0PA 1DQTA 3MV7B 4QTIH 4G6MH 3D7PA 3QJQB 2DWEA 5CJQL 2EZ0D 2E7DA 2QMKA 3GMQB 1GPOL 4EUPA 1U36A 1X44A 2VDLL 4N0RA 5E6IC 1SRDA 4GQ9L 1G4RA 3W9EB 1C8QA 3FPYA 5DRWA 1PTZA 1E3ZA 3HVDA 5LAXA 2P52A 1JWMB 3SIKA 2ZCZA 4G7YH 4ZMZA 5GGSB 1P7QA 1MAJA 2XIDA 3AXIA 4GI8A 3U4BL 1PZUB 1GC1C 3QORA 5JW3L 3KBEA 1RIHL 5C0CB 3EO9H 3V0HA 5IVOA 1F1AA 4YSPA 4O9HL 4F80A 2CGRH 4QOKE 5FM5M 4CN1A 1FFOA 3A0OA 1OO2A 4E9SA 5CLXA 4RMUA 3F3HA 3H9ZA 2GUOB 3EYVA 5B39G 3HI1A 4JGNA 4NZUL 2BSEA 2EDXA 3WIHL 3R8QA 2FO4B 4LGRB 3DOSA 1NCDL 4YZFF 4NCC1 3O2WH 4BEIA 1LO4H 4MD4A 4QRRA 4Q9RL 5C07D 1CE6B 3JYCA 1T1WA 4FXGA 1A6WL 4KQ4H 2PNDA 4P9HL 3RFZC 3GM0A 5DRZA 5DQJB 3TV3L 3ZX1A 1XIWA 1GOHA 2R56H 1HYRC 1DSFH 1KXQA 3FTZA 3VTMA 1OV8A 1N9PA 2P8PA 4ODHL 5IB3A 5DUPL 1P2CA 3ZGHA 4F7PA 1V7MH 4HIXL 3GSXA 2R1YB 3QUYB 3DUUA 1XGUB 1BA9A 4QWWC 1G94A 4PW3A 3B7RL 3GGWB 4R3SA 1SLUA 4PJFF 3JTTB 1G9HA 2WUCH 4QPEA 4TKWA 4A39A 1UM6H 3QAZB 1LHZA 3HN3A 2VUYA 1NUDA 4IRSB 4BELD 4MMXC 4P23A 1YO4A 3D9AL 3N55A 4KNQA 3S5LA 2RJMA 5A2KH 5IOPA 1JVOA 3HBPA 3X14B 4X7SH 2I24N 3CFTA 1PGRB 1KB5A 1MVUB 1VEOA 5F7HA 3HMWH 1N8ZB 4Z5RA 2FHFA 1MELA 1YUKB 2G2PA 4Z0XA 5BUPA 5DRXB 5E8PA 1XDTT 2DMHA 3MA9H 5C0FB 1UD2A 2EVFA 2A4CA 3IJYA 5F97E 3HRPA 4BZ1L 4N0UB 4HUKB 3EZJB 4MNQD 4QJ4B 2QVIA 4BM7A 3MRGB 4UT9H 1PMYA 2AJXH 4PHZA 5A2CA 2ZUQB 5C7XH 3OKKA 5GSVB 3CDFA 5IVZA 4J2XA 1NGPH 1M56B 3FOMB 1KELL 2YK1L 4ISVB 3MYJB 4F9PA 3UZEC 3PXLA 2MQCA 1CCZA 1TVDA 3PHOB 3ESUF 3SE9L 2E75C 1KLUA 5BXFB 5IHWA 2BWIA 3BEVA 2GTWA 4ODXA 3MNVB 3UG5A 3Q5TA 4XNBA 2NSMA 2ZUWA 2NDGA 3IAGC 3QUGA 4RFNC 3F12A 5EA0H 3ZTNL 4TN9A 1C08B 2ICES 2N7AA 1CFQB 3QCVL 3LHAA 4JN1H 5CILH 5JIHA 3TBVA 1S78C 4YGAB 1UVQA 1OAXL 2X05A 1ZTXE 5E1AA 4Y4KA 2FB4L 1CF8H 5CIPA 1SLXA 2ROYA 3LIZL 2MOVA 1A14H 2WSPA 2A6KB 3AS0A 3EO1A 2EEDA 4HUMB 4TLSA 4OZGB 5I1KL 4P2QD 4NI6A 4MBOA 5EUOB 4AW7A 5AAWC 2YMTA 2AJVH 4FLOA 2F53B 3KGSA 4ABUA 2APSA 1IUZA 3LSOB 4YSEA 1QFOA 2G30A 1UJ3A 2O5XH 2YA1A 2R1WA 1OD9A 1SEQL 1QSEB 1RUKL 3AQDA 3ARVA 3G6JF 1NGWB 5AVWB 1JZHA 5BO1H 4AM0Q 1JZDC 4XPAH 4TLKA 5GGTL 3ARDC 3TA3B 4K9EH 3ES6B 2NCEA 3D2UD 4YL9A 5E6RB 4GT0A 2ESVD 1C7SA 1WF5A 4U3XA 3S36L 2WAHA 3KGUA 3VH8G 4C8XA 3DK2A 2D3JA 1T0MB 3MV7E 1F41A 3FCTB 5DDHB 2B4CC 2BS9A 3DOIA 5ITFA 3GRWL 3X3FH 5J13C 4XC1H 4D7BA 1KTRL 1MCPH 2DQUH 3KDMA 4LSUL 1AZRA 1EAQA 1DQQA 3LJ3A 4FXTA 4KXZI 4AUJA 3GMNB 1HQRA 2ZF9A 2NY5C 1D9KA 1BD2A 1YSOA 1JG9A 2R2EA 4MD0B 3G5WA 4TNFA 1RUML 3GK8L 5JW5B 4MAYC 3KPRE 4PRBA 4DKFL 4C4KO 2P5EB 2ZPKL 5DJ0A 4JQIH 2IGLA 3DHPA 3GBDA 5KBDA 1TYEB 2IADB 2VXQA 3EKCA 2NX5E 4OVVA 4CU8A 1T22B 2GEQA 1PIFA 4KQ3H 2D9QB 2CLRA 3FQNA 1K4DB 5E5RB 3TN0A 4QUOA 4NC1C 2XVGA 1LQSR 1D5MA 5FOJA 1NMAL 2A9NH 1MQKH 1P7KA 1NZRA 2WKOF 2Y3NA 2N0MA 1EHNA 3GNML 2PWEA 4YHNA 2RH0A 2W88A 4OF6A 5HVHC 1GYAA 1BJ8A 5LGJA 5F7BA 1DTUA 2LFEA 3RFRA 2D03L 2VR8A 5FX3A 4ACPA 1E8YA 4MX7B 4OT1H 2A0LC 4RX4A 1EAPA 3HMXA 3U36B 1E90A 1LO3H 4HJ1A 4OB5L 1KCWA 3K4DA 1HNYA 2D7MA 5FKPB 3NEOA 4GRMB 2VC2L 1I1AA 3D85A 3O2VH 4N6QA 3UAAA 5KVEL 3K8KA 4QCIA 5T1DH 2IANA 3S35X 1PY4A 2ZTBA 1IKNA 1LO5B 1JWSB 5D4HA 1QA9A 1Y18B 3G7TA 4YHOL 2Q76B 1IX2A 4X9YA 4GXVH 5ABDE 5H4ZA 5LG6A 3TURA 2NY1B 2XQBL 2Q8BL 1S7QB 3PQYB 2QVTA 3SDDD 3X11B 3NCYS 2XWDA 2YA0A 2MQ0A 4AQOA 2CCLA 4OBRA 2NNAA 3G5XA 1CWVA 3RKPA 4L8CA 3VXUD 1HXMB 4U1LA 1X3DA 2AK1L 2GABA 3FFDA 5CZRA 2HVJB 2EADA 4WSJA 1RULH 3JWOC 3TJHD 4P57A 3L9BA 3QCUL 3CFCL 1KWKA 4GOSA 2EQDA 3HG5A 5I74C 1C16A 1KEML 4NFBA 4Y89A 1CGYA 3NIGB 3PGFL 4D3CL 5MENA 4HWEL 5KVFE 4L37B 1MRFL 1ZK5A 3K2MC 4OCNC 2VLMD 4CC1A 4HETA 3ZRCC 3O4OC 1N5YH 4M7JL 5T5FH 4ZUWA 1IC5L 1FNGA 1WIOA 5EBWA 1SGKA 4JHAH 3TEZA 5FOBA 2H7WA 4XWGH 1W0VB 2KI6A 5BW7C 3D08A 4Y4HB 1NM4A 3STLA 4P06A 1OTTC 1JHKH 43CAB 3BD3A 3DIFA 1YY8B 3WNLA 1U8OB 3EFFA 4OZGE 1QTPA 1F8TL 3PDDA 4FL4B 3BP6A 1NDTA 2YLKA 3PAZA 2HTKD 2VN4A 4XCEB 2F53E 4OFIA 5MEQA 2MCG1 3K72B 3MLZL 1U2HA 5DS1A 1QSEE 4PWKA 3IMVA 1A1MB 3QIUD 4HEME 1OEZW 5IM7B 3I9GL 4H1LB 2X1PA 1BBDH 2CHZA 5ETUB 4MCYB 1HOCA 3HVNA 3BH9A 3O0RL 2EDKA 4MDRA 4Y1AA 5DC4B 1Y1DA 3F01A 1DJHA 3KS0H 2X4UB 2ADIB 4UILL 4WKZA 4OI9A 5E7BA 3HI6L 2XWXA 3RPIA 1Q94B 3PWPD 4Z3JA 3TYFA 4BFKA 1MIEL 2WVTA 3GRGA 3LHPL 2DW5A 4OZFB 4LVHB 3MCKA 3QORC 4PREB 5EOCJ 3ECBB 4AVIA 4EPSA 4JN2A 4I2XE 2F1BA 4K8RD 1JI1A 4U0RB 3ZTDC 2YAMA 4ES8A 2OMWB 3EYOB 2NSXA 5L0QC 5B39A 1AD9B 2EYTB 2OQJB 5EZJB 5AAMA 5D7JB 3MBXL 2P5EE 3MLSL 2EDTA 4Z23A 3E3QE 4O51B 1FPTL 5C0NC 3H7LA 2BSRA 4Y5YA 3QC6X 1CK0H 4A37A 1U3HC 4WK4B 3FU5A 5E8EB 4PVNA 1U8JB 1F6FB 1L9PA 2CJUH 4O00A 2FR4B 4MDIA 2V9QA 3SHSA 3VFPA 2J25A 2BSBA 3GTVA 4FXGC 3FONB 2MTAA 4JFFA 3VA6A 4UV7L 2XY2A 3FKUS 1YMMA 4AIXA 2K4AA 1XXFC 1CTOA 5C07B 3V4PA 2B2XH 4PRNA 4PWEA 4OZ4A 3HS8A 4PWIA 5CZXD 3DHJA 4ZFZB 4WHYG 3EJCA 4PHXA 3WJLC 4N2KA 4E68A 4Z7UA 1YMHB 5ESAB 1S7RA 5I73C 4JE0A 3RWEB 5CM1A 1N0XL 2VM4A 2DQDL 2Y23A 4K3DH 5D1ZC 5FYKD 4ZMAT 5IW6A 4DUVA 1H9VA