1WA0X

Crystal structure of w138h mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPHHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa0X02
2FT8A 4G70B 5PAZA 2TSAA 3G5WA 4NERA 5B1KA 1B3IA 2BP0A 2BWIA 1PLBA 2DWSA 1SHXA 1GY1A 1CURA 1GSKA 3HB3B 1BYOA 2R7EB 2YQBA 1AZCA 2IWFA 4L0PB 4A2FA 3KW7A 3FT0A 4HAKA 1J9SA 2DYSB 4AZUA 2FQGA 6PAZA 5ANHA 3CVCA 3EH4B 1AG0A 2QPEB 2W8CA 1AG6A 1AAJA 3FSVA 2E86A 2GC4C 1AS8A 3EF4A 3ZX1A 4DP7X 1KV7A 3U25A 2UXGA 4HIPA 3WNIA 2QDVA 3DIVA 4CSPA 2QT6A 1ETJA 1HFUA 3KW8A 4QKTA 3FQ1A 1M57B 5I6PA 4A66A 3MX0B 2GHZA 2Y69B 4A2EA 2FT6A 1TEFA 5B1BB 1V54B 2J5WA 1QHQA 4EF3A 1NIBA 2ZONA 5I6OA 1JERA 1E65A 1L9RA 1JZHA 1ET7A 4KOBA 4YSRA 1XB6A 2X88A 3C75A 2DY2A 2JXMA 3S3CB 3NT0A 3QJSB 4KNSA 4KO5A 1JXFA 2WO2B 2EIJB 1AACA 2FTAA 1L9QA 1WS7A 2DWTA 5D4JA 1ADWA 1J5CA 2N0MA 1OE3A 2J55A 3FPYA 3H56A 2BP8A 2BZ7A 1VLXA 3PLYA 3NP3A 1L9SA 2FQDA 5B1JC 4F2FA 5I28A 1NIFA 3AG4B 4F7KA 5AFAA 5F7BA 4KNTA 3ZDWA 1AS6A 1IBYA 4HZ1A 1A8ZA 1ZIBA 4TXVB 3S8FB 4UF7C 4A2HA 4YSCA 1SFDA 3CDZB 3UGEA 2YAHA 3CVDA 4G71B 1SNRA 2ZXWB 4QLWA 1SHWA 2CBPA 3PAZA 7PAZA 2XLLA 3PAVA 5F7AA 3ABMB 3ABGA 5I6KA 5I5JA 1BXVA 2UX7A 4K9JA 1OE1A 2J57A 1W6WA 4BWTA 4A67A 4GP5B 2B3IA 2MTAA 1CUOA 1NWPA 1TEGA 3GDCA 4UANA 4GP4B 1EZLA 1JZFA 2FNWA 2Q9OA 3SQRA 2HX9A 1AIZA 1OCZB 3WI9A 1TU2A 4AX3A 3CG8A 4FA7B 3CVBA 2IAAC 5B7FA 2IH8A 4GY4A 4AI7A 2FWLB 3H4FA 4YSUA 1ZV2A 3X1NA 1QNIA 2XX0A 3RYMA 5D4HA 1FFTB 2HRGA 3IN2A 2OCCB 2H5UA 4KO9A 3ABKB 1JZEA 2HXAA 1AS7A 1PLCA 3N55A 3T6XA 3SBQA 1NTDA 1GY2A 4AKQA 1PF3A 1HAUA 1GS7A 3T6VA 2IDSA 2GB2A 3V9EA 4DP9X 1XB8A 4N8UA 2HX7A 2IDFA 1PCSA 2PPAA 2IH9A 2QDWA 1BQKA 2HZHA 4Q89A 3OQRA 2PCYA 1PNDA 4YVUA 1WA0X 1URIA 3ABLB 2RACA 4YVNA 1CC3A 1FWXA 1ZIAA 4YSAA 3FU7A 5I5IA 4WTQA 2GI0A 1L9PA 1OE2A 3AZUA 3FSWA 1OOWA 2FQEA 1KGYE 4WKXA 3OMIB 1AQ8A 1DZ0A 3FSAA 1OCRB 3UADA 1QLEB 3AW5A 1E5ZA 2DV6A 3L45A 1KYAA 1RCYA 1R1CA 4E9TA 3TBBA 4KOCA 5A7EA 1ZPUA 2XV3A 2PLTA 3TU6A 1OCCB 1NDTA 1A65A 1BYPA 2P80D 2VMJA 3EH5B 4P5RA 3EHBB 5AKRA 4E9SA 2XWZA 1E30A 2W88A 3FSZA 4DP5X 4DPBX 1AZBA 1GYCA 8PAZA 3T9WA 2PCFA 2PPFA 1SF5A 1IUZA 1NIAA 1ILSA 1ASOA 4DPAX 2VW4A 2BP0B 4A2GA 4HHGA 4MFHA 3FU9A 4G7SB 4BK5C 3V9CA 4BWUA 5TK2A 1E67A 3X1EA 3X1BA 2LLNA 1IKOP 1PY0A 1AZNA 4JHUA 5I6LA 1GS8A 1ID2A 1JVOA 3EH3B 3FU7B 2ZOOA 1M56B 2XXGA 1JXGA 3PPSA 1IBZA 1YLBB 4RH4A 4DPCX 5IY5B 2J56A 1PZAA 4M4RB 1AZUA 3PCYA 3UACA 3X2QB 4E9XA 4HCGA 2YAEA 1DYZA 2H47C 3GYRA 3MBWB 2OJ1A 3NP4A 4G72B 3T71A 4CSZA 5EHFA 3ASNB 2IDQA 3NSCA 2P80A 4DP2X 2AANA 2I85A 1L9TA 2XV0A 1A4CA 2PPCA 3AG1B 4W9ZA 3NJKA 2H3XC 1ZDSA 1SFHA 5B7EA 1HAWA 2VW6A 4YSQA 4AKOA 2XVBA 3BQVA 3S8GB 1BAWA 2GIMA 4G7QB 4DP8X 3QJUB 1NIEA 3NSYA 1MG3C 1W8EA 3FYEB 1ET8A 4F2EA 3BVDB 2PPDA 2MRYA 4KNUA 3HEIB 4E9VA 1MZYA 2BP8B 4KO7A 3N2JA 2VM4A 2TSBA 2WSDA 4YSDA 1PLAA 1AANA 1V55B 4YSSA 5I6NA 3UAEA 3JTBA 4BDVA 1KDIA 2UXVA 3FS9A 4GXFA 1T5KA 2XV2A 5AZUA 2IDTA 2PP7A 5I26A 1BEXA 3ERXA 2JKWA 2WO3B 1PAZA 3QJTB 3WG7B 2DYRB 4BXVA 1WS8A 1IC0A 3WKPA 3FPXA 4HHWA 3OM3B 2IWEA 4ENZA 1JVLA 1KCWA 1SJMA 5LDUA 2YAQA 1SF3A 3QJVB 1CYWA 3TA4D 1A4AA 3NJIA 1MDAA 2YAMA 4HCIA 3ZBMA 2YXWA 2QPDB 2XU9A 4BXSV 1M9WA 4NAJA 3NJMA 5B1AB 2BO0A 4X4KA 1KCBA 2AFNA 1AZRA 2Y1AA 1WA1X 1SDDA 1BQ5A 3T6ZA 2OV0A 2FQFA 1PZBA 1L9OA 9PCYA 5I6MA 1XMEB 1I53A 3SBPA 2JFCA 4N4YB 3FQ2A 1ZDQA 4ZK8A 3DKHA 3QJQB 2UXTA 2VSMB 1PZCA 4HALA 3NJJA 2XX1A 1X9UA 1A3ZA 3PXLA 4YSOA 1F56A 2BWDA 1N68A 3FYIB 3UAAA 1JXDA 3WIAA 3NJFA 4JKNA 1BQRA 1WA2X 3TASA 4BDVB 2B08A 4YSPA 4BWWA 1GS6X 2CJ3A 3CDZA 3PAUA 1NZRA 5E9NA 2YXVA 3AG3B 4DP0X 1J9TA 5PCYA 4E9YA 1JZGA 2BZCA 1RZQA 3AY2A 1MG2C 3QPKA 1OV8A 4JHVA 1WAEA 2VSKB 1NICA 1J5DA 2BHFA 3OMNB 2FT7A 1N70A 2AZUA 1AR1B 1TKWA 2BW5A 3GXUB 3QJRB 4P5SA 3TBCA 1OCOB 1ILUA 2X87A 3OD3A 3WKQA 1JOIA 2XYBA 1A4BA 2CALA 2GC7C 3SBRA 1JZJA 3D12B 1JZIA 1OF0A 1NWOA 3X1FA 4FAAB 3AG2B 2CCWA 2HLEB 1SDDB 2EIMB 4YL4A 5D4IA 2IWKA 2XUWA 3ZIYA 5B7MA 6PCYA 1AOZA 2HRHA 1J9RA 1EHKB 5B3SB 5I5MA 1E5YA 2ZWNA 1XB3A 1BXUA 2AZAA 2EILB 1V10A 2BW4A 3IEAA 3JT2A 1KBWA 1MZZA 1NPJA 5TK4A 3NJGA 2A3TA 4GYBA 2VW7A 1CYXA 1NIDA 1FA4A 4YSTA 4AKPA 1RZPA 3OMAB 4W1TA 5B1JA 2PP8A 2PPEA 3S3BB 3S3DB 3FU8A 3IN0A 3QQXA 4E9RA 2NRDA 2GBAA 2EIKB 4GP8B 2FJSA 2PP9A 4NB7A 4M3HA 1X9RA 2R7EA 2YARA 3NJHA 3NJLA 3NJNA 4A2DA 1KDJA 1NPNA 3H4HA 3NSFA 2GSMB 2AVFA 4G7RB 2HX8A 1J9QA 4A68A 7PCYA 3T6WA 2EINB 1ASQA 4DP4X 1GR7A 3ASOB 3NSDA 1PNCA 2UXFA 1KBVA 2YAOA 2YAFA 1BXAA 4YSEA 4E9QA 3DTUB 4DP6X 2IDUA 3X1GA 1ASPA 2CUAA 1NINA 1W6LA 4DP1X 2Q5BA 3FQYA 4UAHA 2XXFA 3IBOA 2I7SA 3WNJA 1UATA 3UABA 2CAKA 1GW0A 2VN3A 2I7OA 2UX6A 2YAPA 1ET5A 4E9WA 1RKRA 4KO6A 4PCYA 3CZUB 4HCFA 4Q8BA 1PMYA 2VM3A 3IE9A 3NYKA 4PAZA 5FC9A
chains in the Genus database with same CATH superfamily
3QI9A 5PAZA 2CBOA 5KVGL 4QTHB 4PV9B 3CDFA 5FYKL 5CAYB 1G7PB 1QSED 2FD6H 2BWIA 3C8KA 5AYQA 1UD4A 4XE0A 1NCWL 5C0EA 4M5YH 4B53A 4PJIB 2K70A 4ZO9A 1NQBA 1LTXA 1HL5A 3MC0A 4IOIB 4NYLA 1FZOB 1QSVA 1X5ZA 4B9KC 2JKRM 2DM3A 2H3NA 1ECZA 1KJ3H 3SQBA 4QR7A 4YDIL 4AQOA 5DS2A 5AWNL 4APQB 2R8SL 1HINL 5AW3B 5CJQL 4JFQA 1UOLA 4F2MB 2W9EL 4OGXH 4XCFH 4RGOH 3RY4A 3MI6A 5ALCL 4ZDHB 2H2SD 2BIOA 3EF4A 4YZFE 3FDWA 1G9NH 1C7SA 2PWDA 3PHOB 1NCDH 3V4PA 3VFMB 4ELMB 3J2PA 4MNGE 1KWGA 2BCKA 5F3HB 1TQBC 1QSFA 3WIFB 4L5FE 4UU9A 1ZK5A 3GNMH 4FQCH 4WEEA 5A3IC 2CKBH 1NIBA 2ZONA 4YHIB 1SPDA 2C1OB 2NW3A 2AEPH 2XN9B 3IS0X 2K3HA 3V52L 3DWTA 5J4MA 4HZLA 2N3JA 4YK4B 1KPVB 3OKEA 3TN0B 4ILDA 4J27A 2Q1EA 4QAMB 2ZKXA 4X9BA 5FV1L 3QEGL 2VXVL 1KENL 2FEJA 1FVDB 5B1CA 1H6TA 1ZCRA 1ACXA 4GRWB 1IZKA 5B1JC 2KLTA 4KRMB 4KAQH 4LNRA 4UQAA 5F7MC 3BISA 3R06B 5TQ0H 1ZSDA 5DMGD 3BPLB 4NC0B 3AC0A 4XPBH 2WZ0A 2YUXA 4GINA 3A24A 3K6NA 4Z7VA 2BIIA 4GJTB 3PDOA 4PTTB 1QSZA 3LEXB 4XNBA 2GITA 3T2PA 3UTPD 1T7YA 3EGXB 4PJBA 2G75A 1J1OH 3S8FB 1RPKA 1INQA 2NY7L 5INDA 3F3HA 2VLKA 4J5VA 5K9QG 4ABQA 1BG9A 1SHWA 1FE8L 3AREB 3T4AA 4AVIA 3H2PA 5IJVA 1I1AD 1TXKA 3BX7C 1V8HA 4Y9GA 3U79A 3S36H 4AQAA 3RFRA 1SDAB 3TTYA 1W6WA 5HYJD 4BWTA 1A2YB 3HI5L 1N0XL 5IMOA 5FLUA 4I85A 5A2IH 4FADA 4FQHB 3WLBA 1LQSR 2JIXD 5AAWC 2I32A 2QKSA 3JWNC 1YNLL 5KEZA 3VXMA 3ARFA 4NQDA 2NY2B 4NX0A 5FYKD 3S5YA 4K3DL 1MFAH 3GK8H 1UD2A 2W65B 3D9AH 4WNQB 3X11A 3MXVL 1ES0B 4RMBA 1BZOA 3VGFA 5DMKB 2L0DA 4U4IA 5LNDA 1H6EA 3K1KC 1QFWH 5DJ8A 4YSUA 2CXKA 2PKDA 4ZTPH 3P4MA 3LEYH 3BYYA 1EQWA 4AEFA 4K15A 3T2QA 4UT7H 1XF4B 4LOFA 3FHEA 5GZOA 3ABKB 4OD3H 4WI7A 5IFJB 1G43A 3HCVA 3T65B 2MNJB 1R24A 5IF0A 2YEVB 5T1DL 4LFHD 5DTFA 3ULSB 5BUAA 1EHLH 3LKQB 5AD0A 3HHMA 2R0LH 2XFGB 3MNWB 1CFSA 5AW2B 4NZRH 3CVIL 2WXFA 5F71A 2GTWA 4X5WB 4R3SA 3FUNA 1C5BH 1XB8A 3NZ8B 5DXWA 3HHSA 4UZGA 4U0RB 5FW8A 4D0CB 2HJKB 1MJJA 4U3SB 1TQCC 1DDTA 2B9BA 1FJ1A 2ROYA 3OTTA 2HZHA 2HFGL 1LO4H 1SBBA 4JHAH 4YVUA 4OFYA 4YHKL 5BS0E 2VR8A 2O61A 3F83A 5EU3A 2OYPA 3MNVB 3OQ3B 1U3HB 1T2QL 3D2UB 4PJFF 5HI4C 4ZUVB 1EH9A 1UKSA 4HWZA 4ZNCD 3OGCB 1OOWA 1KGYE 2ZKMX 2X1XR 2H0PA 3MXWH 3BLPX 2SODB 4YFLI 4IBSA 4D0DB 3KPOA 1WQVT 5B3JE 5L4MA 1F1GA 2WXGA 1A0QL 1AGDB 1G6VK 4TSBL 3SKMA 3IDYB 1PYWB 5KN5A 5I30L 3VXQA 1BYPA 1QPKA 5DQDL 3EH5B 1WZKA 4NZJA 3VDAA 5ITFA 4DT2A 2R2EA 4UQ2A 1D7CA 5C0FB 3CSBA 3FSZA 4ZOCA 2KL6A 1E28B 2F53D 4JY6A 1AZBA 1MAMH 3ZKND 3QRFM 3DJ9A 1DEEA 1QRNA 4HIQA 3QSKB 3KWWA 1C5CH 3DX3A 1NSNL 2LE9A 4WKZA 1TMQA 5B39A 4LQ1A 1CMOA 1DUYB 1LE5A 1A1MA 1R3HA 2XQYK 3LYRA 4NGHH 1SLVA 3A4FA 4MFHA 1YY9C 5TPWH 1QLRA 4RGMB 1UEMA 3X1BA 4HS8L 1IKOP 3MLZH 4RRPM 5KOVC 2C9QA 1U8IA 2Y1ZA 1GS8A 3KPNB 4OIIL 5F88B 2AQSA 1Z66A 1RHFA 1Z9PA 2HT2C 3B5HA 1JXGA 4FXLA 5DWUL 3G6AA 5JOPD 2X6BA 4CNIA 2WBJD 1JPTH 1VFBB 2DD8L 5T1LD 1SVBA 3MBXH 3UZVB 3E0GA 4GB9A 3EXLA 3QHZL 4H8WC 4S1DD 7TAAA 3MRHB 3K72A 4GG6A 2W60A 3UACA 4HCGA 2F68X 2ADGB 4GBXA 5EOCL 5HJGA 3BZFA 3T71A 3WFZA 1WISA 2WLLA 2G2RA 2IDQA 3FU0A 5FO2A 2HYMA 5BO1L 2A6DB 3PGDB 5CSZB 4ENED 3RVXD 2V37A 3QULA 1KCRL 5CZVH 2XZQH 3IPEA 1FL3A 2VDPB 1YHPA 3WL9B 4LLVB 1EA9C 4G1EB 2K6YA 4MKTA 5F7DA 5H94B 2XVBA 3RB7A 4BIKA 1KWKA 1WAAA 4G7QB 1KJ2B 4MQ7B 4CN1A 2M1KA 3O3BA 1KG0A 1NIEA 3NSYA 4G7VH 2OAAA 2DLGA 1ET8A 4WGKA 4XXCA 2EQDA 1P2CA 3PWLA 4N0FA 2B1AL 4FQ1H 4KO7A 3TO2A 3OKDB 4YSSA 3VG9C 1MI5B 3CLEH 3BP6A 5GPRA 1KDIA 4MXQD 3FAWA 2VISB 1P4UA 1DQLL 2H6PA 2RBLA 1Y07A 3WHE0 4F9LC 1GCYA 1XHHA 4JFVA 3WN5A 2FWOA 1B0WA 1K4DA 4E42B 3SGJC 5EEUA 1RZ7L 3VXSD 3KXFA 3IFPA 1KCWA 3OX8B 2V9QA 4BCYA 4HIEB 4LL4A 1KF9B 2AHIA 1YJDL 1NBVL 3KLKA 3RDJA 1ACZA 2WPGA 4HCIA 4PVBA 1EXUB 3MUGB 3SGEH 2GK2A 4F37K 4DW2L 3S97C 1QUPA 4YHMH 4PJDE 2D31B 3IK2A 3Q6GH 1BD2E 1L7IH 1UQSA 1FYHB 1JV5B 2FAUA 5KSBB 1QVOB 2LABA 3PUCA 4NKOA 2GSIA 3SPJA 3QQ9D 3BVNA 3UPAA 3IFNH 5DK0A 3MV7E 1CDBA 1VEMA 2DJMA 4XWOC 3VU1A 5KANI 2FSDA 4MRCA 1A1OA 1ZDQA 4YAQA 1SUHA 4X6DB 2V5YA 4HEPG 1MWOA 2WLJA 2WK2A 3V8OA 1II4E 2BY0A 1U8KA 2I25N 2A9DA 3L9YA 5JOFB 3KR3H 5E8OA 1AH1A 3UAAA 1H3WM 1KBPA 3TASA 2VSCA 3EDKA 3FCTB 4KJPD 4UILL 1OGTB 1EZSA 3HFMH 4BH7B 4R97C 4R2GB 2CRYA 4FZEH 3KBHE 3PYCA 2N4IA 3QUHA 4IRSA 3V5HA 3CSPA 4JMXA 2IF7A 3FUJA 5GGUB 1LP9B 1KIPB 1KLUA 1PX4A 1N59B 2OXGA 3F01A 3ZL2A 3E6FB 5BVPL 4P46C 5F9JA 1WT5C 3PABB 1F1DA 2AZUA 3TBTA 4G5ZL 2PTVA 4G6JH 3V5DB 1BZ7B 5JDSA 1OAUL 5J06A 1JOIA 3KS0J 2CALA 5D1XE 5G55A 2XRAL 3W5NA 3WNMA 5DVLA 5IB4A 1SYVB 2NT0A 1IFRA 3KHOA 4GS7B 5EN2A 2AAVA 3RNQB 3OKLA 2J73A 1J9CT 1XGTA 1LWJA 3U1SL 3VFGL 4OJCA 2ERJB 3DX9B 3ESNA 1E4XI 3EYSH 4ISVB 4NQDD 5GSVA 1GJIA 1RZJL 1W0YT 5C3TA 3M86A 4J3WA 2HRHA 3WIIL 2X9YA 1T7XA 5ID0B 4PJ5B 5LGYA 5EU7E 4BINA 2BC4B 4UWQB 4BE6A 2HT4D 3F7QA 4K9EH 3RNKB 3MYJB 3NIDB 1BBJB 3IEAA 1NMBL 1MZZA 4HIJB 2WKOA 3W0WD 3TVMB 5DUBA 2VW7A 4WK2B 1MLCB 5ESQA 2NNRA 2PYEE 2ARJQ 2WIIB 5KUMA 2YRZA 3TYGL 3CN0A 3UZEC 1WBYB 2HVJB 4G8GA 5HD8C 3D39B 1G7IB 4C4UA 3HAEB 1M42A 1ZMYA 5FX3A 3CX5K 5MP6L 4ZSOE 3VB9A 3JWDH 4F3FB 5CEZH 3ULAB 1TNMA 3PNWA 2D2CC 1P4LA 2XQYG 4XNMB 4A2DA 1OTTC 1G1OA 3WIHH 1QFUL 1BOGB 4JM2C 1WTGT 4LCWE 3DX8B 3B2VH 3UPCA 3WN6A 3S9DB 1ASQA 3FB7A 1LL1A 1Z3GL 3LRKA 2K8QA 5FA3A 4DP4X 5KG9A 1RZFL 1OK8A 1YRKA 1AP2A 1EMTL 3KYKL 1ASPA 1K3IA 2ZOTA 1DN2A 1TYEB 2APXA 3AS1A 2BK8A 2P5WD 3BMVA 4Z7UA 4ZFZA 4NN7B 4UAHA 3F7KA 3WNJA 4HOWA 3BGMA 3OZKA 1YEKL 2CAKA 2IJ0C 3MMEA 1X7SA 1Y6KR 2K6WA 5CMAB 1U42A 4LCCB 4MAYC 4I3RH 2NY6D 1J1XH 3MNZB 3H54A 4I2XA 2VDNH 3VACA 2VLRE 1XO8A 2X6CA 1T1YB 1U8MA 3ATFA 4LEXH 2C9RA 4U1IB 3PQYB 5C0IA 4IS6A 4ZMZA 4KXZI 1QBLH 1KB5A 1VJSA 1X5AA 5ID1B 5GZNC 5IW3A 5J0BA 1CGTA 2AQRA 1B3IA 1G7LB 4XMVA 1GGIH 4MD0B 2DQUH 2FNBA 3G5YA 2XACC 1J0JA 2LTQC 3DXAE 2VABA 4EUPA 3P3RA 3SO5A 4KH2A 4KZ0A 2IAMA 4PGCA 1HOCA 3FTXA 3ZL4L 2FR4A 2X0WA 1TF4A 4FA6A 5L2KA 1TZGL 3KW7A 2E47A 1UJTA 5C0BE 4R7DA 4JFFE 2DYSB 1JNNL 2APVA 1RZKH 4PBWD 5CHNA 3TNMA 1OANA 4JFDE 3FT3B 2CLZA 1HXKA 2H8PA 2KDGA 4PWEA 3RGVB 4X9IA 4EOWH 3QCUH 3SE3C 1AS8A 4L8SA 4EI0A 4W9LC 1U8QB 5ACMA 4QHPA 1FZKA 2XQBH 1IX2A 4PRIB 5D1XC 2V5RA 2VITB 3SKJH 3KW8A 3N41B 1EFXA 1FC1A 1OIOA 5CJXC 4G59C 2J20A 3IRCA 4LVHB 4FQXD 4GBXD 4A66A 1T1XB 1K4CB 2FT6A 2QFPA 3ZE0B 3DOIA 1QHQA 5DYOB 2R29H 5SWZD 2VDOH 4X50A 4Z0XA 5EZLB 4Z7QB 1PDKB 1JERA 1QSEE 4GW1B 4L9LC 5BJTA 3LZPA 2G2PA 1L9RA 3TT1L 4F58H 3REVA 1ET7A 4EZKA 1EZVY 5F7KC 1ZT7B 2OI9C 4N2MA 5DVNA 4XNUH 1Q0XH 1XF2A 4Y4KA 3IVKA 3SDCA 2FTAA 4HWBH 3KCWA 2B3RA 4Y16D 4EDXB 2VLJD 2F74B 1EXGA 2F18A 4IU3A 4KRLB 4LLYB 3OSKA 4P5TC 4MB5A 1S7WA 4WZ9A 4KNTA 4HXBH 3CXHJ 3ELQA 4DGYH 3UH8A 1XH3B 2B7DT 4XOEA 4KXDA 4XC3L 5GRJH 4MMZC 5D71L 5J1AA 1WIPA 4A2HA 2BRRL 5JW3H 2XY2A 5HHNB 2X42A 1VADB 4Q74A 4H8VA 1RAMA 4K7PH 5BUGA 4I3GA 5I6KA 1AGEA 4XAWH 3ZHNA 3ZLQC 2J57A 4UUJB 1BIIA 2BRQA 3SPGA 4Z23A 4FHJA 5KS9E 3UTQA 3ZKSD 1TEGA 3OKMB 3QHTC 5FKPA 4OQTA 4GP4B 4QYAA 3QWRA 2VRQA 4IM8A 5I8CB 2ZX5A 1KLFB 1SXCA 2OMNA 3BQUC 5IOPA 5FYLL 5BUPA 1AKJD 4MMYB 4JREB 3MU3A 2LVCA 4OT1H 3K4ZA 2FEDC 4IBWA 2PR4H 2JKNA 3G9AB 1NCUA 4LSQL 3NFSH 4BFKA 2D7PA 3PAYA 4GUPB 1S7XB 3HZKB 4KXCA 4Y1AB 3UTPE 3VH8A 4NPJA 3BDYH 3VNYA 3ULVH 1J8HD 4YDZA 5T1MB 1RZGA 1DJHA 4FFWC 4C83B 1EO8H 3ECBA 1Y6MR 2C4XA 5I73B 3FO9B 4FC3E 1Z9SB 4JO1L 5GGVL 2A99A 2ZYHA 3QEUB 4M7LT 4NFBA 4UM9B 4LOUC 5AB0A 2GTZA 1SEBB 5HYJE 3U4AA 3BSZH 2YUVA 1OSEA 3NCBB 5I8EB 5IR1A 3WE1A 2A77H 4WTXA 4PJHA 3O0RH 5JHDA 1TPXC 1KB5L 2NNAA 1FV1A 1J05B 4TULL 2WLYA 5KVGE 3DMMC 4EN3C 1IE5A 3THML 3BYTA 4TSCL 3WFBL 1EDYA 5I1DA 4YVNA 1CLZH 1ZIAA 1GKEA 1UM4H 2V6HA 2QTEA 5DWPA 1S46A 2XN1A 4FFVC 3T0WA 1OE2A 4H1LH 3Q3GA 1IGTB 5FHAH 4Y4HC 3JUZA 4MJ2A 3EDFA 1JPSH 4UDUA 2JCWA 2AQTA 2YOAA 3QQDB 3UIYA 1S7UA 4H5SA 2ITEA 2KHAA 4O51B 2L7EA 5LG1A 4D7PA 5BW7A 5DRXA 2WZAA 3TBBA 2ZOKA 3HS0A 3ME0A 3WUZA 2P45B 4OM0H 2YGOA 5JIQA 3TU6A 5JPMC 5KBDA 3LQAC 1NDTA 4IMLB 5FM5O 1A66A 2P80D 4L3CA 4P5RA 3U2IA 1S7RA 3PE9A 4PY7B 1S7SB 4M1CC 4KK9D 1YNKL 3HE6A 2O5ZL 3KYMB 1CFVH 1NFDB 1H0DA 2MH4A 3O3EA 4YZWA 3HE7A 1BAGA 3BHBB 1LO0H 4GT7A 1OARH 5LAPA 3D0LA 1MWAB 3C09C 1P9MA 2CO3A 4X6EA 2QFRA 3FFOA 1KN4H 4GFTB 1I4FA 5K59E 5JW4R 4I5BA 4L8BB 1A7NL 2GAZA 1A9EA 4P9ML 4KQ3H 5E6RB 1KLGA 1JCVA 4TPRL 5FYLD 4DPCX 3DROB 4LXFA 2J56A 3SYOA 1S9YA 3QZWA 2QR0B 4J3VA 3WFDH 5DMIH 5J13B 2CDEB 2Z4TA 4MGXA 3MLXL 3PIQA 5E1AA 4G9FA 4B0MB 2OSXA 2RCSL 1UA6H 5D9SA 2W92A 5IROA 3UCRA 1BQSA 3KEHA 4IU2B 2P5EB 4KUZL 3WOVA 2UZYB 2NYYD 2QLYA 1N9PA 2F53E 3CCHA 2AJYL 2ZCHH 1FSKC 3DSNB 3DGDA 3NPSB 3ZGIA 3RTQA 1J0YA 2O6FA 2X41A 4AIOA 4OCNC 1JRHH 2NX5A 4AW7A 3VFOA 4LSDA 4OCRH 5HSFA 4DERA 2Y36L 3KPLB 3UAJD 4DGWC 2YSSB 4YXKH 1CFNA 1IC7L 4XBGB 2EKSB 4P4RB 5JIHA 3RWJB 4AGOA 5JOPE 5C9JB 2VM4A 5KOMC 4N2IA 3BUYB 3JTBA 4C4BA 4HJEA 4JPIA 2JLPA 4EIBA 4TTGA 3AUVA 3DARA 3PG2A 4ZQKA 2OJEB 5I26A 5EZIH 2BVPB 2EC9T 4W9FC 2G5RA 3JVGC 1NUGA 1YG9A 2DI8A 2JKWA 3P0GB 4JRLA 3DX7B 5L4FA 1U95B 4KVCL 3WV0A 2FIKB 3FPXA 4NHCH 4NNPL 2O4EA 2FUQA 1A6ZB 1MCFA 15C8H 3ARGD 2UVEA 1YPZF 3GGWB 3QUXA 2J8UF 1DQVA 3VXOB 4OZGA 2P26A 3O4OC 2FX8H 4UAOC 3FTYA 3IJHA 1FNHA 5DHXB 4YE4L 4BRVA 4RFEB 4YEFA 3LN5B 1BEYL 1JGVL 2AQ3A 3REWA 3RY6A 2ARJA 4KKQA 3ZHFA 1AOHA 3IMVA 3F58L 4X8XA 3MA7B 1FAIL 2LW3A 4LVEA 3NZHL 4Q4EA 4OF5A 2YC1B 3F65A 4JO4H 4YDJA 4JO5A 5T5FA 1S7TB 3EJZC 5KVDH 1FHGA 2VXUH 1NGPL 2XWEA 4LLUB 4DOHB 3QUYB 3QWQB 4P2OD 1QP1A 1ZXKA 1H3VA 2GUOB 2C7UB 3GUTB 1N5YL 1SJHB 3QEQD 3UP6A 3D06A 4Y7MA 1IL1A 1ZHKB 2MNUA 4P3WA 4X5XA 3SDCD 1FNFA 1JHTB 3AABA 4NP4H 4K3GA 2V9TA 2VSMB 3CVHA 5DCCA 2G0KA 2NZIA 3NOIA 4HALA 1SHMA 2XX1A 3GHBL 3SPHA 3WFCH 4Y4FA 3B8SA 2YS4A 4Q6IC 2CHWA 1NC2A 3OHXB 4JRWA 4R7LA 1AHWC 4QJ4B 1OAKH 2G3NA 4A39A 1CFMA 3QIUB 3VXSE 1IGYA 4BWWA 3V4PH 4H0IA 3JV0A 2DLFL 3PAUA 3EJQA 4NAQA 3D87B 1BVLB 4O5LH 4P9HC 5AL0A 2CBTA 3FTSA 4J1UB 4QRRA 4Y5XA 3CFQA 3GMRB 5DC2A 3JTTA 1ADQL 2QLVB 3KPRD 4FQLL 1MHHA 1N70A 5TDPA 1AGCB 2AI0H 2BW5A 3TO4A 4OD1H 1LHZA 1OCOB 4U3HA 3S5LG 2A4CA 2VT0A 4BQBA 3MGOB 5C6PB 4EI5C 1PG7W 1DL7L 2FHCA 4DF9A 3WEBA 3WJJC 1TETH 4JKKA 2OMXA 4ZS7H 1NCBH 4ZFFB 2D03L 5EA0L 2ZSVB 2EDFA 3US1A 1M9SA 5BS0B 1M05B 3K81A 2JB5H 3VFUB 2OMWA 3BP4A 5EBMB 1W72A 1AOZA 1XX9C 3AADB 4PS7A 4BFJA 2D73A 1Q72H 2YIHA 3FRPA 2YD0A 4PJGE 1KEGH 5C2BH 4B9FA 1S3RA 3L3JB 3PJNA 4DVRL 2FO1A 2NXYC 4AL8L 3WEXB 1ZS8B 1SUJA 5C7XL 1WFMA 5C0CD 4HBCL 4L23A 3QNYB 3PHAA 2IOMA 3CFNA 3MV8B 3QDJA 1U8CB 1CTMA 4JN1H 5F1NA 4WY7L 2YQ3A 2NRDA 5C08B 2FJGA 1CT8A 4LU5L 2EEXA 5CD3A 2PP9A 5C07A 3I9GL 4IEFB 3R7RA 1R6VA 5FOBB 3P4NA 2YA1A 2IADA 4S1DC 1S3KH 3QW9A 4XCEA 2AVFA 2YPLE 2VWEE 3P0VH 4YIQB 4LZKA 1WCQA 4CMHB 4L3AA 4RIRA 5DK3A 1EAOA 4OF8A 4YBQD 1FPTH 3X3FL 3WY4A 5JZ7D 3QJXA 4AJ0A 1Z0MA 2AJSH 5BRQA 2B4CH 4GSQA 4KKBD 3IKCA 4O9HL 4ZBJA 4E9QA 3BLBA 5I1GL 4PG2A 1UWEL 1RUPH 3L3OC 1MFCH 3UEQA 5L2JA 5JPNA 1U36A 4PSPA 3W0WE 3WJMB 3L3HB 1R3IL 2CU9A 2VGLM 1JGEA 3IBOA 3MLTB 3WLWD 5LWYL 2J1YA 1NGQH 1L7TH 1PKQB 3NRQA 5J12B 2BNUB 3MFFA 3VUAA 5LGHL 3GHEH 3CZNA 3CNKA 3DUUB 3Q0HA 3DGGB 5SWSB 5C1MB 2WWMD 2MOQA 2P8MB 4UZUA 2X70B 3ZKXC 3NMEA 5FLVA 3KCPA 1K6QL 2X28A 4JJ5A 5B1KA 3DO7A 1ZWIB 4LLWA 2Z4QA 4OV5A 3ARXA 1TZIB 4OZFB 4DH2A 1B0GB 1L3NA 1GSKA 3L95A 5T5FL 4XBEH 5E6ID 5J6SA 4DKEH 2C4FT 2YQBA 2IWFA 3CFCL 3QG6B 2C9SA 3IRPX 4HKXB 4UBDD 4Z6AT 5I66A 4GQRA 5F7FA 1U8OA 5DRZB 1UYWH 1VFAB 5IBUG 3ATAA 5KBPA 2HFFB 4M62H 1MHEA 3BAIA 1FZJA 3GSNB 3QAZC 2P5WE 1GRWA 3NN8A 3RPIB 3QIBD 2VJXA 5ALBL 1D5IL 1AAJA 3GJFH 3LHPL 2GC4C 4AITA 1XV8A 1CG9A 2EDKA 1BQUA 1B3JA 2XTJD 4BRJA 2ZNXA 1IGFL 5JR1H 1B9KA 3I9IA 1F90L 5I1IL 1DQJB 4XCYA 3E8UL 3FTGB 3IE4A 3M7FB 4A6YB 3QQ9C 2FRGP 3GMNB 1KIRA 4PCKA 3ARDD 3TV3H 3LDBB 2FVNA 5EO1A 4ZFQA 3AU1B 5AVVB 2EUVA 5I6PA 4JE0A 4E0RB 5MEPB 4MHHI 2DQHL 1D5BA 5IWLC 3TV8A 2P52A 4EDWH 1NANI 3QGVA 4Z1PA 4LVNC 1YMHB 1KYOK 1TJXA 1XQ4A 3RUGF 3CFIC 1BD2B 4I0PB 5BQ7A 1I1FB 1TEYA 1R17A 4XB3A 4UQIM 3RTQD 2LLLA 1HYSD 1WWAX 4JEGB 2HFEA 2ZAHA 4Y7OC 3WSQH 3DRQB 5A6LA 1LJMA 5I6XB 5ERWA 4XO4A 1XZ0A 1O9VA 1LXMA 1VF5C 3B8YA 2L4OA 1LO2L 2J6EL 1WUNT 2FQDA 4J3OH 3SDYH 1A6AA 3O3UN 3ZDWA 1EZUA 1OQXA 2H9GB 4FFYH 4HUUA 3U6RA 1U2HA 3L1GA 5HDQH 3HI6L 5HDOA 2Q6WB 4PLJC 3RZCD 2NY0D 2MNWA 2BVUA 4UQEA 2CO1A 4XN5A 4X2UA 4ZPVB 4XMPL 4YDMA 3ZZSA 4AUYA 5DJDA 4ZMLA 5IFHH 3V0VB 5F7NC 3M7OA 3ARPA 4N8CL 4MX7B 8FABB 4OKVB 4I7ZC 1DZBA 1NCJA 4YFEA 2EJ1A 3NCXA 4B9YA 1JNHA 1KGCD 5SWZE 4XO5A 2BVEA 1RIUL 1MFUA 5CJOH 3BKML 3ULUH 4AQEA 2ED9A 3HN5A 1WJ3A 5HJ3B 1S2EA 5CO1A 3GMMA 3GJFK 4S1QH 6TAAA 4XNZC 2HTLD 5LGKA 4PN6A 1XMWA 2BSRA 1OKEA 3KLAA 3IU3B 5AW7B 3G5ZA 3VX1A 2X4UA 1IM9B 3DV6B 3PFQA 3MCLL 4JFZL 4X7DC 3SQRA 3TEYA 2VLJE 5DZ9A 4D9LL 5F93C 1IC1A 1RZFH 1JGUH 3E3QE 1AGFA 2A6IA 1WE5A 4JY5H 5IHUH 3S37H 1YEEL 4HD5A 3U36B 3U0PA 4GRLA 4JE4B 4RVBA 2WQWA 2J2ZA 1D9KD 1KGIA 2BNRA 4FLSA 5I28A 1T4KB 3UBGA 3HMWH 3TA3A 4NLHA 4OTXH 1DJWA 5C0ND 4RAVB 3MBEA 3KM1A 2O5YL 4PWJA 1D5ZB 1NH6A 2DRUA 2NQDA 3C6LC 1AQHA 4G80A 1J5OH 2VC2B 2WY3B 2JKXA 4QGYA 4IQHA 4NRYA 5FGSA 3GEFA 2JNZA 3ILQC 4JFYB 1AS7A 1CBJA 4HJJL 4IW4C 5EO9B 1NGWB 3QYNA 4MQSB 1E3FA 1NL0H 3FO0H 4HSCX 1KT2A 2DF3A 3NAAL 4FQQA 2IDSA 3FOMA 1LEKA 2PYEB 3TVMC 3VWKC 2DWEB 4XPTH 4H2CA 5KYYA 3S3SA 3SCMA 3QDGA 3DX6A 3V6OE 2G5BB 3MLUL 4CJ0A 4ZSOB 1OEZW 4HUCA 4G42A 2X4OA 4PYHA 5I8OL 2QHRL 2OMUA 43CAA 5DJYA 4YLQT 2QMJA 1JMXA 4Z76A 3FU7A 1F4YL 4XPAH 5BRZA 2EO7A 2HPTA 1JNNH 1U30A 2BJML 1BAFH 2K3TA 2C9UA 1BQHG 4WKXA 1E27B 4JQVC 1LQBC 3KH4A 1JFHA 4HWNA 4UTAL 1J8HE 5HY9A 4E68A 3TXAA 1MAJA 4ADIA 1TLMA 5D7JC 3CFTA 3ZHKA 1KYAA 4IKKA 4F37F 1Z0NA 4HMEA 2Z93B 4CL7A 3BP5A 4LDEB 2H2PD 4BKTC 3CZEA 1N8ZA 3FOLB 3G5VA 5GIRB 1OSZA 3WYRA 5C8JB 1MCOL 3RVUC 1S6NA 4UT6L 1K9TA 4KTEH 3SO3C 2EDMA 4KITB 4LLDA 2B1HH 5D2LA 1BXXA 3FCUB 3BVXA 4XPHH 3CDYA 2VLRB 3QJHB 4DTGH 3D18A 4HUXA 2WV3A 3QZPA 1P5VB 3MV9B 4U1MB 1JN6A 2BHZA 2R0KH 3W9DA 1MCIA 5IGXL 1ASOA 4DPAX 2VW4A 1I8KB 3GPSA 1OD9A 3FO2A 3LZQA 3LMJL 4M6OH 1X3DA 1T1WA 2JKLA 3GMOA 3OWEA 4XVUC 3SBWA 1Q9WA 2VXTL 2P42B 5IVXA 2WYZA 3QCTL 4HEMA 4HF5L 4UIMA 1I8AA 4X42A 3EH3B 3LH8A 5E5MA 5C0RH 1M56B 3JWOH 4FYQA 4B9PA 2GKIA 2F1EA 4NQEA 3UYOD 1PZUB 1Y18A 3K6OA 3P3UA 4JFFB 4UQBA 4QCIB 3FJTA 4XZ4A 4I18A 5DJXB 1WBXB 1X44A 3CXFA 1YEJL 1YY8B 3PGCB 4ZFGH 4WI0B 4BGDA 1G9ML 5EHFA 4Y16C 3GFUA 4JGUA 2OYLA 3K2KA 1OAYL 3BE1H 4OCXL 2YEZA 1YUHB 2O5XL 4JBSA 4P2RE 4TSAL 3PJSA 2XKSA 3OGOE 5ADOH 2HCZX 4QF1A 5IIEA 2Y25A 1NEUA 3EOYG 4WCYL 4X0NA 4ATTA 3CPUA 3FK3A 1BAWA 1D6EB 3RPKA 3B9DA 4I4WB 3EXJA 2GSGA 4KKNA 3HG1A 4LIQL 2AJVL 1YDPB 3NH7L 1PVHA 4N22A 4WU5A 2PPDA 1U6AL 4R4BA 3S3PA 2WTRB 1LK3H 2ZKHH 2UZXA 3HPJB 2IC2A 2CIIB 3P4OA 4MXVE 5CNHA 5MENB 4FMKA 5T3XH 1JD7A 1WWCA 2DEWX 2C3HA 4RGNC 1SXZA 3L9RB 4JG1L 4M48H 4YXHL 2VKXA 5DRWA 4NENA 1EBPA 2XHNA 3FQWA 1CD1B 2E4TA 1DSFH 2BWQA 1DBJL 3MRCA 3O3AB 1WHOA 4QAWA 3C5SB 3PWJA 5I19H 4FMVA 2AQQA 4M29A 2EZ0D 3QFDB 5DS8A 3IDJB 3K46A 4CMMB 4H40A 2ZX6A 1PKOA 2XU9A 1BVKB 1YNTF 2W07B 1SXAA 1I7UA 3I3EA 2EH8H 2P48B 1NLDL 2FO4A 4P23B 5I0DA 4BKSC 4JPWL 2EEDA 5GGRB 2AFNA 4EUPH 1BFTA 1FBIH 5KS9B 5LCVA 2FSEB 4N24A 4ACTA 3B2PA 1PZBA 3SPCA 1GIGH 1TTCA 2HG0A 5FYJL 1T20B 1VSCA 3RA7L 1D2PA 5CCGE 2WMPB 4HX1A 3O2VH 3KVQA 3H7LA 2EYRA 5D7SL 4XCCH 1ZHBA 2B59A 3D0AA 1XVSA 1Q9KB 3LN9A 1DQKA 1N6VA 1X9UA 2JCCF 4PGEB 4HS6A 4PJXF 4NRXB 1YEGL 4ZPTB 4MASA 1MIEH 3WIAA 1MXGA 4G8EA 2KZKA 2AK4A 2VTFA 2Z8WC 4I2XE 4AVJA 4PJEA 2WLIA 5K33A 2CHXA 1VPOH 2P49B 1X5FA 1FDLH 3BXNB 4FE9A 3JYBA 4R5TA 2DN7A 2JK5B 2WB7A 5PCYA 2EEFA 2EADA 1MH5A 4R8WH 1ZVHA 2YR3A 3DV4A 2F7RA 4Q4IA 3U30B 5DEFB 3D52A 4HWEH 4IBTA 2MKWA 3F7RA 2P47B 5DHMC 5HYJB 4QLRA 5A40E 3ABZA 1AFVH 2LAAA 5D1QA 5A2FA 4MB3A 3NA9L 3UPRA 3U7YL 2HKHH 4NKQB 4AG4L 2X4RB 1SOKA 1BLNA 2JIXB 1OK0A 2DLIA 2YKLH 4PLKD 4RWHA 5E2JA 4CSSA 3IGFA 3SBRA 3C5ZD 4Z3EA 3QEQE 4XODA 4MCYB 2QKIA 1M7DB 3KPSD 4NZUH 5D7LE 1E4WH 2JB6B 5BV7L 4ELKA 4K3JH 5E08L 2Z7WA 4PG9A 1UM6H 1MFEL 4RISL 4AGQA 4NUJA 4P2QA 4Y88A 5AOLA 3EDJA 1J87A 3ML9A 3DRTA 1D5MB 4EBQL 5HGHA 3TEXA 2H1XA 1PD0A 1DE4B 3ULVD 1E5YA 1IKNA 2CDFA 2CLRA 2ZUYA 4N1HB 3UERA 1E3XA 4H1LB 3QQNA 1VENA 4MCNA 1N10A 4XNXL 2RGSA 2V17L 1NPJA 2OP4L 3O9WD 1KCLA 2A3TA 4RZKA 3SGDI 4OFPA 3KPRE 5T5NF 1UM5H 4HPOH 3F5WB 1CL7L 3PUUA 4EIUA 3DURA 2W0FB 1SDYA 5DD1L 3I75B 1JXJA 2FBRA 1T83A 3CDCA 1IGJA 3QZNA 5HJDA 1T3FB 4OQTH 4NO5B 2C1PB 3JXAA 2FBOJ 4TV3A 1MF2H 4GMSL 1KOAA 2CGRL 1HH6B 1E9QA 3NK4A 4PWHA 5LNEA 1JGIA 2F5AL 4PGDA 3UDWC 2V2WB 1K8IB 1BFOA 3AJ7A 4QNPF 3QUZB 1Q9LB 2A9NL 3MCG1 3VU2A 3NDYE 5ICXB 4TUKH 5IW1A 2H32H 3Q8EA 5I1EH 2CO2A 3GSQA 1NFAA 3OZ9H 3BKYL 4ZUTB 4KDWA 3GIVB 3JV6B 2WXNA 4FA8A 5I8KH 5F1IB 4F15B 4HLEA 1KYDA 5C0CE 4K23H 2FATH 1IE4A 2V3EA 1G4RA 3CGTA 4EI6A 4UNUA 3L5WB 3US9A 1E5AA 1ZXQA 3Q6FA 3O6KH 1UB5B 4X6FB 3GDBA 4WWKA 2IQAB 1A14L 3L4ZA 4KROB 3MPCA 4PY8I 1Z1WA 3CZFA 4G8IA 1D7DA 3RL2A 4QRFA 3G5WA 9CGTA 4P5KA 2IV8A 1IGCH 3LH2L 3DOHA 4U6HB 2HAZA 3LKNB 3Q2CA 3LY6A 4NWTL 2COQA 5LCVL 1G9NC 5DJ0B 4YXLL 3NPSC 1R5WA 1RJYB 1S9XA 2YO3A 1CQYA 3QEHB 5E8PB 4OLZH 5DURB 4A2FA 3ARGC 2JKJA 3ALPA 3QYCA 3C5JB 4DKFL 1LEIA 1UWGL 1DVFA 4WSGA 4Y2DA 3GINA 2EE0A 3Q8AA 4X5RA 3RP1A 2F58L 5AVYB 1G6RA 2GPZA 3ESVF 1F86A 2LV4A 3Q1SH 4NKIH 2OLDA 4OLUL 1ZJBA 1A6PA 2DLFH 1NEZA 3FSVA 3VWJD 1T22B 4XBPB 3KBFA 1A7OH 3HRZA 1IAIL 5HPMB 4Q97A 1DJXA 1KJVB 1U8PA 2ZAIA 3ZMEA 1FO0A 2EO1A 3ISRA 4P2OC 3PY9A 3FQ1A 1M57B 3V8CA 3Q8FA 4PRBA 1JHLH 1YEHL 5DDHB 5MEOB 1CF8L 1XIWB 1LNUA 2EE6A 3TJPA 2A9MH 2C3VB 3DA0A 2BDNH 3IXTA 4JHZA 1JZ6A 3VSTA 2Y7MA 5EU5B 3UBXG 1FF5A 4LCIH 2D03H 1MNUL 3TP4A 5F3BA 3CSGA 3DHPA 5GGTA 3QI9B 3PL6C 4JRXD 2RHEA 3WE6A 3C8KB 1QW9A 3KL5A 4FKEA 5C0EB 4XT1C 2BZ7A 4G7YL 3UTTA 3TJEH 1C08A 4Z7WA 1AS6A 5J8OA 2XTJE 1FG2A 4Z5RB 3L4UA 1RURH 3SQBB 3VXNB 1YEDA 1EO5A 2BMKB 2WC7A 3KS0H 5EIVA 5HI5D 3RU8H 4JFQB 1GH7A 3VXSB 4OCSL 4K5NA 1F6AA 3ULVF 3QRGH 3RAJH 1JWMA 1XTLA 3LKSA 2X2JA 3OHXC 4QIRA 2MSPA 1UXWA 2NPLX 2XLLA 2AF2A 1A6WL 1YUKB 3SN6N 3D50A 5F9OH 3FF7A 2UX7A 1KXVC 4RA0C 3O4LA 1QSFB 4A67A 3ZDYF 4PVNA 2B3IA 4DQAA 2AS5M 2IGFH 4UU9B 1X4YA 4N5ED 1CN4A 2WLHA 2WNXA 5I24A 3T3PB 3ZE2E 5E2VL 4KZEL 1CLYL 3WKML 3FN9A 1TU2A 4HZLB 2MQ0A 5EF1A 1V7NH 2CE6A 2IAAC 3K80A 3AXLB 3OKEB 5GS3A 6FABH 2CR0A 3SOBL 3WEMA 1ZANL 3CTTA 2JJTA 2WQVA 5AVQB 4KMTH 2CHDA 5HYSG 4HIXL 1ZHLA 2V7HB 4LNRB 4W81A 5EORL 5HHXL 1F8TL 4ZQTA 1ZSDB 1CXHA 4IBLT 1CGSL 4HFWA 2EKJA 2WD0A 1JZEA 2VAJA 4Z7VB 1IIKA 4JDTL 3RHWK 3ZY7A 3N55A 2P44B 3PDOB 4AQ1A 2YN5A 1KGCE 1TG8A 2GITB 4KK6D 5IKCA 3D85D 4KHTL 4J4PA 2UWEA 3GI8H 4N6RA 2D3JA 4YBQC 1HJBC 2Q20A 3WFEL 1INQB 2IQ9H 4MNHB 3EYQC 3LTVA 2VLKB 4POUB 4EN2A 1GKOA 4NO3A 4GMTL 3T4AB 4K8RL 1KJMA 4DVBA 3CFJB 2IO5A 2IH9A 2PPAA 2Y7LA 1WFJA 3LRLA 4AQAB 5T5FH 3L5JA 1THCA 4WW2F 5L6YL 2Y07H 3OJDA 1EVUA 4UV4H 5HI3D 5IMOB 1DP0A 4D8PA 4X9HA 3WLWC 2EYSA 1CC3A 1I9RL 1TLKA 3WLBB 3L3DA 2Z35B 1EEQA 3GMPA 3R1GH 1Z3RA 3CVHH 1L3WA 2XKUA 3VXMB 4GH7B 4NQDB 1DBMH 5EOQL 3S98A 3DIDA 4F92B 4WDIA 4JDEA 3CLFH 1G6RL 4LT7A 3UADA 3DBXA 5DJ8B 1E4XH 2CBQA 2DIJA 4WU7A 4NN5B 4U1NB 4X6CE 3PWVB 1OT1A 3P4MB 5FHBL 3V7AG 1FYTA 1JUFA 4NSKB 4DK3A 1JJUA 4PJAF 4KKCD 1XGRA 3Q8CA 1OCCB 1BQLL 4S1SL 5E6IC 3K91A 5AZEH 2ZQKA 4H88H 4X80L 3U4BH 3WS6A 3A5VA 4LSSL 3P0YL 4PJ9A 1R24B 1U93A 5DD5L 4HOZA 2HRLA 5DTFB 4HJGA 2Z0UA 5AD0B 4TQIA 2A1WH 4X7SH 1CFSB 1Q38A 4H0HB 3BFOA 3QIBC 5E1IA 2GTWB 5D1ZA 4R3SB 1PFOA 4PJCA 4QOKA 4ICXA 1Z9NA 4Q2ZB 1ZEAH 2XFXA 2JCCE 4EAEA 1I7TA 1MJJB 4U1HB 3RWIA 3FU9A 1FJ1B 3EOTH 3WHE1 2KH2B 2FLMA 4JLRA 3UJIL 3U1QA 3NTCL 4LSPH 2C9PA 2ZCKH 1AZNA 2ZPKL 3V0HA 1W72H 3ZO0A 4WO4D 3TBVA 3MRKA 4ZMOA 3WFHB 2XN2A 2O61B 1IC4H 1KGWA 5IY5B 3FN0L 3QJFA 4H8HA 4HWZB 1G9EA 1A7BA 1H6UA 4M1DL 4MJIA 3FN3A 1HS6A 4L1DA 4AMKH 4HYTB 3GS0A 2CIKA 3N9GL 1S9WA 2EDLA 3BSHA 2ZUWA 4N2EA 5C09D 2WP3O 3GTNA 1ZS2A 3QNZB 3ZUNC 4UV7H 3OR7A 2NY6B 3NSCA 2C4FU 4EIGB 4Y19D 3MJ9H 5E9DD 4R6UA 1UJ3A 2XV0A 2HVKA 3SKMB 3RX9A 3MRGB 3RDTA 5HVHC 5KN5B 4NLAA 2J21A 1FVEA 1U58B 4OLVH 4QRBA 4UQ2B 4PV9A 4XVOA 5ILTL 3B5TA 2VL4A 2YD6A 2EUZA 1AQDB 2VM9A 4HZAA 4DKAA 1DEEB 1QRNB 4KXZH 4PJIA 3LVEA 4F5CA 4WKZB 5EF2A 4MZ2A 4ES8A 4HU8A 5I18H 4JKPL 3UC2A 3HEIB 1A1MB 4XRCA 4YBHA 3UGXA 1DBAL 5IESL 3S4SG 1QLRB 2O5YH 1PW3A 5CJ5A 3UG3A 2XWBA 2Z31C 4F2MA 3S35L 1U8IB 2PP7A 1BEXA 3WMPA 3TWYA 4N3TA 5FM4A 4ZDHA 2YD9A 4MA8H 5DMJB 3U2JA 2OL3A 2EECA 2NY4C 4YR6A 5I75B 3PHOA 4YDVA 3ILDA 4JFTA 3NSJA 1SJMA 3HS9A 3JYCA 3K72B 4GG6B 2QVKA 3HTLX 4FQXB 4GBXB 4K94L 1MDAA 4OF0A 2NUPA 4WAFA 5EC2B 1TTGA 1OPGH 1TFHA 3L08A 5H37G 3BZFB 1D9KC 1SLWA 5ETUA 4X4ZA 2WLLB 2NW2A 1CQKA 1PEZA 4OZHE 2C1OA 1KPUB 2QHRH 4ZW5A 4KMQA 3QULB 1AZRA 1KPVA 1A7PL 1PJ9A 3FT4A 2NXZD 1GA2A 4LVOC 3F12B 5I9QB 3HA0A 4LQFH 2VLJB 3BGFB 4WEBL 1FVDA 1WEJH 4ODVL 1FGVH 2VZVA 1KG0B 4DGVL 2YPVA 4ODBD 5T3ZH 3CXHK 3PWLB 1P2CB 4PEEA 3UMNA 5EU6D 1WG3A 4ODTH 3WS3A 2PWGA 1N68A 3TO2B 4PTTA 4UQ3A 3LEXA 2ZAGA 1MCPH 3BVTA 5E70A 2I24N 2H6PB 2HP4A 1MCSA 4AQ8C 2OR8A 1IQWH 4PJBF 4XMUA 3WN5B 1E8YA 1GHFL 2FWOB 1NGYB 2KS0A 2BZCA 4WGWB 4LRIC 4JG0L 1NFIB 3X3GL 3OB0H 3E80A 3KVDD 4P4KA 2XA8L 3MROA 3HVNA 1UKTA 1Y6NR 1T7ZA 2X4SA 1YAZA 1H3UA 5A16A 4K9EC 4RSVA 3FB8A 5JNYB 2EYTA 2BPBA 1NC4D 2I07B 2CD0A 4WHCA 2YGVA 2W65A 3V0JA 1XCQA 4NKOB 1AKJB 5CD5D 4IGBC 2GSIB 5E1HB 3BVNB 2R27A 3O2WH 3QXUA 5DK0B 2NY3B 2PN5A 2X6UA 2BS9A 3QXWA 1EHKB 1QATA 1I3RB 2F7IA 5B3SB 4YAQB 3JWDC 1J8HB 1XF4A 1Q8MA 1KBGL 1PZ2A 3QQ4B 5E8OB 3OKKA 3T65A 4Y1TA 5AYUH 5IG7A 2A7BA 4PV8A 4ODUA 4WEUD 3ULSA 2J72A 2Q8BH 4LAQL 1DLFH 4F7CB 3MNWA 1F41A 3DX1A 2PO6A 4IRSB 4BK5A 4I0CC 3V5HB 2J1KA 4KJQC 4X5WA 3NZ8A 2ZTBA 1JFQL 5F1OB 3MR9A 4AEHH 2PW1A 2C3GA 1MRDH 1U92B 3DPBA 3TBTB 1HSAA 1KNOB 1XF5B 1EO7A 4ONGH 5C0AA 2EH7L 3HFFA 3MO1A 3FTZA 3KPSE 1E5UI 3OXSB 4PB0H 4W9CC 4UTCA 4DUXA 4TRPH 3K5RA 3P73A 3VD9A 3BZ4A 4LIQE 1U3HA 5IB4B 2GY5A 3HN3A 4A7QA 1N18A 4ZUVA 3OB0K 3OGCA 5EN2B 5CUSL 5DQ9A 3ULVE 3X1GA 3QISA 4NWUH 1QMUA 2XXMB 1RMFL 2ZXEB 3VFSA 3BW9A 3BIKA 3RILA 4D9RD 5GSVB 3T0EA 4KUCF 3BUQA 4ALAH 2VDRH 5EUOE 1KN2L 1KCKA 4IMKA 3MJ7B 4JFEA 4WTZA 2OL3L 2R56L 5DFAA 1QUNA 1GPOL 5EN3A 5FUOH 4AK2A 3ECQA 3MLYH 4I9WD 3UP1A 5SX5K 3MLSH 5DUBB 4H4NA 1HHIA 1X4XA 3C60A 4KQ4L 3UROR 4Y89A 1RZKC 5E2TL 1AXSA 4CC1A 1E28A 3NYKA 4KRPB 1QKZL 4I77H 4D8OA 2LFEA 5TF0A 1CZ8L 1NCAL 2DI9A 4BJLA 1INDL 3D2TA 2FX7L 3KD4A 4PJ9D 2M8XA 4G8GB 1FH5H 2AEIT 1PLBA 5I1HH 5FDYA 5A6MA 2RFXB 1TTUA 3MLRH 3MREA 1OSYA 5ANHA 3AACA 1YMMD 3MRIA 1F4WH 1P4LB 1BA9A 1U8JA 1AIFB 4JPKH 4MA7H 1IT9H 3LNHA 2EZ0C 2GFBA 5F88A 3NFPB 4IJ3B 4RFNB 5JMRA 2MCG1 1P84J 3FB7B 5FA3B 4YLBA 2X3AA 2IPTH 2DMKA 1CFBA 5AZ2H 3LXUX 3DYMA 4RQQB 1BCIA 1PJWA 2EDJA 1SGKA 1AP2B 2EE3A 3A4DA 3CHQA 4OY9A 4J3OF 2VLLB 4FNQA 1R0AH 3EIFA 1CICD 2ADGA 4CSPA 4GG6F 5GS0H 1ETJA 1WFUA 4Z7UB 1F4XL 3BGMB 1P6WA 2IBBA 3PP3H 5BVJB 4JX0A 4Y8AA 5AB2A 2NCMA 5LQBH 3GC3A 3MMEB 2JF1A 2A6DA 3PGDA 1WYJA 4PUBH 3SZ6A 2Z8SA 3QG7L 3BKJH 3MRPA 4IOSA 4M6NH 2GBTA 4K3EL 3BRFA 1U8MB 2AXFB 3ULUF 1A22B 3CHPA 1QWUA 3ZE1B 4HPYH 4L8DB 5C0IB 4IS6B 3F85A 3IJYA 1WAAF 1KB5B 5BV7H 1LD9B 1P6AB 2E5EA 3LNFA 1F45A 1YSOA 4UT9H 4WVRA 1MFEH 1J5CA 5INCA 1OVZA 1MJ7H 1OE3A 5IUSA 3G5YB 3HUJF 4GAJL 3V4VA 5SV4A 4G6KL 2VABB 4H20H 3OKDA 1A6UH 1MI5A 4W93A 3PJLA 4PGCB 1HOCB 2MQ3A 5T3XD 1Q9OA 1QR4A 4N20A 5L2KB 1EHNA 2J6WA 2XZAL 4XP1L 2E8YA 1VESA 3HZ3A 4DQOH 1S7VA 2Q0ZX 5CHNB 5KZCD 5K69A 2CLZB 3C5ZC 3Q2LA 4F8QA 2JJSC 1GZQB 1H3PL 3AM8A 4QRUA 4IDJL 2B5IC 4YDLC 2CBPA 2YUZA 4OZ4B 2GBUA 4HIEA 3PAVA 2ZICA 2Y23A 4XMKL 3LPOA 1EXUA 2R23A 3WTVA 1EFXB 4PSRA 1H8OA 5K93A 2OCFD 4W9EC 3ULVC 3NABH 4IDLA 1E4KA 4KDTC 1H6FA 5KSBA 4P3CL 1T7VA 2KKQA 3DJZA 3GDCA 4JRXE 4Z0XB 2F8IA 2J5LB 5JHLA 2HX9A 2CJSA 3OKNB 5BJTB 3BGAA 2HPOA 4PMFA 4UIKH 3B83A 4JQIL 4W4OC 3O9WC 3PP3K 2GJRA 3KLQA 1MEXH 3QEQB 3U9WA 5HTSA 3QH3A 1XF2B 1CU4H 3QFGA 4GY4A 1MREH 4X6DA 3SDCB 3IVKB 1RFDL 3X1NA 2WXKA 2XX0A 5CWSB 4M7JL 1G9HA 4IU3B 5D4HA 3O6FC 2CHNA 2EAEA 3U2SB 2OJZL 3H9SD 2H1PL 3FCTA 3OLDA 5TE6H 4V1DD 3ARQA 3GTTA 2G0LA 4XGZB 7FABH 1PLCA 5GGUA 1KIPA 4AKQA 4PV1C 5J1AB 1TCMA 3BN9D 3NQIA 2ICES 2WUCL 5D93B 2HX7A 5HGAA 4D0BA 3OV6A 4KY1L 3OAUL 4F1SA 4O58L 3D0VA 5KVDE 4RRPG 1BIIB 2QV4A 2VDML 4M1GL 2ADJB 4HIHB 1SYVA 1U3YA 4DFIA 1EEUA 2RACA 2P3YA 5DUMH 3VXRA 3UTQB 5KJRH 1JI1A 3U9PH 4DO6A 4WTQA 4GAGH 1HX0A 2VXQH 4ISVA 3FTVA 1E8WA 5JXED 5DD0L 4ODXB 4WW2C 4HLJA 5IOPB 3MRJA 5C97A 5ID0A 4PJ5A 4Y5YC 1JF1A 2BS8A 1BZ9A 2BC4A 5CBAA 2EO9A 3WTTA 1BBJA 5LB1A 1A9BA 3HNVH 1RIHH 3VH8B 3B2MA 1RZGB 2WKOF 2J88H 3ECBB 1NBZA 3P9WB 2J71A 4D9QE 5AKRA 1JGLH 3SKOA 4Z8FH 4OB5L 1WBYA 3QAQA 4ABVA 5AVZB 1FIGH 1JD9A 1G7IA 2PXYD 3HAEA 4L4TA 2GTZB 2A2QT 2PPFA 1NFKA 3AS2A 4U6VH 3QS3A 5IR1B 3VQ2C 4Z7NB 4A2GA 1Q94B 2K1MA 3A67H 3GMLA 4PJHB 1DCLA 5JHDB 1BOGA 1NUFA 1FV1B 1O6SA 3ETSA 2AITA 1Z9MA 3ARBD 2LLNA 2BSTA 5I1DB 2H45A 4HCRA 4HK3J 4LESA 4NO0A 3V4VL 3NG5A 4AXWA 1OM9A 1P4IH 3MTXA 3Q3GB 4MJ6B 2TRHA 4XP9L 1Q1JL 4M4RB 1AC0A 3CD4A 3LNEA 4BGLA 4JZJC 1AZUA 1N6QH 1IQDB 2CMRH 3GLEA 3PGFL 5CMAA 5JQ6H 1GGCL 1XDTT 4LCCA 4M7LL 5L9DH 1VAHA 4XXWA 1AY1L 3LRSA 5DRXB 3MNZA 3QUMA 2ZOKB 3ME0B 4HC1L 4DEUA 1T1YA 3AB0B 1ZTMA 3BAEH 1GAFL 4DWHA 4IRZA 4L3CB 4OLEA 3OAZH 1S7RB 3CPLA 4JGMA 4AKOA 1QYGL 4E41D 5HI5C 4MD0A 2GJJA 3HE6B 4TVPH 3RWFA 4CUCA 1H0DB 3QJUB 2C9VA 3O3EB 1MG3C 3HE7B 4HLZH 1FRGH 1S7QA 2NR6D 4KVNH 5BPPA 4ZMQA 2D3VA 1QEXA 3UYPA 3D0LB 2EDBA 3N2JA 4JGJA 4X6EB 1TYJA 4NJAL 1QLEH 5I6NA 4BDVA 3VQLA 1DBBL 5HHXH 1CXLA 4W9JC 1TQSA 3M46A 3RB5A 3VGEA 1A9EB 1UD8A 2WO3B 4ZTEA 2XTJB 5C09E 1U8QA 2Z65C 2QQNL 5KSAD 1OM3H 1S9YB 3FT2B 5KVFE 4PPTA 3NIGF 4Y19E 5E9DE 2ARWA 2OBGA 4G9FB 5E1AB 2QVTA 5ACLA 1T1XA 2AXHA 3AY4C 3GJEA 4Y5VA 1MHPH 4PRPD 2HSIA 3P2DA 2Y7SA 2BSSA 5DYOA 1M9WA 5EZLA 1XSJA 1PDKA 3TBSA 1KCVH 1QBML 1NLBL 3CCHB 3ZT6A 1EEYA 4R5VA 1A4KA 1J10A 2F61A 3WY2A 5F44A 3QORD 2X0UA 2VDKL 4GSDL 2E4FA 4IOSD 3RTQB 1T03L 4K71B 4OVUA 1L9OA 1NANH 4EZMA 4Q58C 3P4LA 2OYMA 3ZE2B 5ADPL 3D3VD 4EDXA 3VFOB 1DVZA 1E40A 2F74A 2E27L 4N4YB 1KB9J 3FQ2A 4LLYA 3U7WH 3EAKA 1G7JA 2Q86A 1G87A 3TESA 1JMZA 1CFNB 4LEEA 3ZK0A 2MQCA 2G4GA 2QQKH 3Q01A 5B38A 3MLVL 3MTRA 3QXDA 4M03A 3T4YA 3UO8B 1UCBL 1AMXA 1MOEA 2JELH 2B2XL 2A5UA 2E59A 2B08A 3QDMD 4AK1A 4WI2A 1FO0H 5EO0A 5F7EL 1F2XK 1NOAA 2DKSA 1N64L 3VRIA 5HI3C 3W37A 5IBLD 5HHNA 4DAGL 1IVLA 4JCMA 5D7IF 5I74C 1J5DA 3GSRA 4F7MA 3II3A 4MDIA 5EDXA 2FT7A 3T3MF 2WTOA 4FFZA 2V33A 3GXUB 4OZGB 4P5SA 3S96A 1XAUA 2DYPA 3ZTNH 5HP5A 1ILUA 4LLQA 1URLA 3HB3D 3OD3A 5GGTH 3FUEA 5IQOA 4X99A 4U6XA 2ITCA 4ELDA 2VO8A 3IAPA 2GC7C 1WC7A 3K2UH 4H25A 5D70L 3NCJL 2ZPKH 3T4AC 3IDXH 4NOBA 2B15A 1SOXA 1TVBB 4R90L 4YDJB 4MMYA 2QSQA 4FP8L 1F1AA 4Q6YA 5EU6E 4HCRL 4ZW3A 2OZNA 2F6AA 1E4JA 3IJ7A 1B4JH 4GUPA 3TBWA 5T1KA 4BD4A 5I15L 4FKHA 2WZPA 2GJZA 1LMIA 3N9GH 4MYWB 4OLYH 3ARFC 5T1MA 4GQPH 5FUCC 4L8CB 4ZUSA 3FO9A 1NC2B 1Z9SA 5E7BA 3U0WL 4GYBA 4FULA 4N28A 5CIPA 1LWHA 4FHKA 3VSQA 1AD0B 4NNYA 5HYIA 3NBNA 1FA4A 3I6LE 4GI9A 3HC3H 1CXIA 1SEBA 5B1JA 2B4CC 4WO4C 5TE4H 5I8EA 4LHQB 4YFLF 4LMQE 4WSKA 2ZG1A 3S36X 4KU1A 4QRRB 4BA8A 4Y5XB 5GZOC 4W68A 3HUJE 4PJHF 3JTTB 5FUZH 1J05A 1MHHB 2E7CA 5TDPB 4F8TA 5JXAH 5HHOA 3TO4B 4QPEA 5GQBA 3JUYA 4X7CC 4A68A 2FBJH 4N2CA 1I1YB 1JNLL 1S5IH 1I8MA 2CCLA 1PNCA 5E6SB 2BXYA 1F3JA 2IFFL 1JGDA 2OMXB 3G5XA 3QPXH 2FECL 2CJUH 3IPFA 1IIIA 3DTUB 4X4ME 5KYNA 4R96A 1MCHA 1P5UA 1KC5H 2VR5A 4B3VA 5FV2A 2OMWB 3BP4B 4FYTA 3QQDA 1TZ8A 5HHMD 1HWHB 4O51A 1LE9A 4UOW0 3GHPA 5D5ME 4ZO6A 5JHBA 3IGUA 3FRPB 3GM8A 1HC1A 1KIUA 1KV3A 2N1TE 4HAFA 3LOWA 4RETB 5FYKU 2DQMA 1EEZB 4FG0A 2PUQT 2K7QA 1UXMA 2IALA 1ZAGA 4GQ9H 3IE9A 3KYMA 3QDJB 5F1NB 1RULH 3T2NH 4DN4H 5IV2B 3BHBA 1CT8B 4MDJB 3KLHD 1RIVH 3B9EA 1SHXA 5CD3B 1AXTL 3DBSA 3H0TB 3KL3A 3P4NB 4DGVH 2I26N 5IVZB 4KH9A 4ZUUB 3ZTJH 1K5NB 4LNVA 4M02A 3D51A 1I9IH 1JG9A 3S3JA 1OXYA 1BFVL 2DQDH 3VGAB 1XZWA 3RLSA 3D7PA 4N0UE 4UCFA 3SY6A 2BLFA 1XGYH 4D9RE 3FSOA 1RK7A 1UOVA 1YEIL 4WGVB 3Q1EA 1ACYL 4OSUL 1QX1A 4RFOH 3FBKA 4GKOA 2IBZY 4NO0D 2D7TL 4M5ZL 3GWJA 3J7HA 3K6IA 3H6JA 5DVPA 2YMXH 4MAUL 1KPRA 3BWZA 4I3SH 2A4ZA 4I9WE 5L2JB 1R75A 4NM4H 4IU2A 2DBLH 1JGEB 4ZFOL 1A8JH 4CRPA 3UYRL 1JZ3A 4MNGA 2DQEH 5E0QA 4A2EA 4W4NA 5D2NE 1XD1A 3B34A 1V54B 4GRMA 4J3OC 3SIKA 2CRMA 3E9TA 4JKWA 2WXOA 2WXHA 4HW6A 5DJAA 2VERN 5I6OA 3FQTB 4QWWD 4FFZL 2AJXH 2HWZH 5DHVA 3CH1A 5ISZD 2D8KA 4KOBA 4LBAA 4OZHB 3TZVD 5IQ9B 1SJEA 1OGAD 1HL8A 1HIML 3FFCD 3HPLA 4GAAA 3QJSB 4KNSA 1UURA 1YMME 3I74A 1JXFA 3KCPB 1FGNL 2W59A 5IFAL 5HBBA 1HDMB 4LLWB 2Z4QB 4OV5B 3SKUD 2EKSA 4P4RA 1AD9A 3UFIA 3Q5OA 5HYQB 1DQTA 5C9JA 3L95B 3PLYA 3ULUC 1L9SA 5TH2A 1AMYA 1ZVNA 4WK4B 5LUMA 1FZMA 2OJEA 5I66B 2BVPA 2HRPL 2QL1A 4YEEA 1CK0H 3NIFE 4WFHD 3OC5A 3CN2A 5AQ0A 3L1OL 3DX7A 1MHEB 3HZMA 5E99L 1SVCP 5ITBL 3G6JF 4XXCC 1HKFA 2FIKA 4KV5F 2CWRA 1HSBB 3CVDA 1A6ZA 1MFMA 4QLWA 3LEVL 1ULVA 5A2BA 3VXOA 1PBYA 4XZUB 4LDOB 4XCYB 5KTEH 5AKSA 4IRJD 3ABGA 5SX4I 1BXVA 4A7TA 4X7TA 3LN5A 1U4EA 1AR1D 4YLCA 4X9GA 2BFVH 1CDHA 4XX5A 4PI0A 4K4KA 4JQXC 4J3UA 2DTML 3MA7A 3P11H 4POZD 1D5BB 5TGBB 2MCPH 3GZQA 2YC1A 1JZFA 3F6JA 1S7TA 1HHKA 5AB9A 2CCVA 2PW2A 3UTSD 2X2IA 1A6VL 2CDGA 3MGAA 3I02B 5BQ7B 1L4IA 5T3XE 3WUWG 1ZV5A 1GJWA 2OR9L 1ZHKA 4N2AA 4FNLL 4AI7A 5T3ZD 1JHTA 3ORJA 2HFEB 3SE9L 1T6BX 4KPHL 5JIPA 3D4GA 1F4HA 2BIHA 1XZ0B 4OCWL 4MHHG 4X5PA 2C34A 2KI6A 3PNRB 3S5LB 1EAQA 2Y7NA 4NZTL 1J0IA 1A6AB 4ONHA 3WKYA 4MJ4A 2HXAA 3FRUB 4JRYD 4JANB 5I82A 4JGNA 1KCSL 1I85A 5E4AA 5EWIH 1JDDA 4FYSA 1PEWA 1VCBC 4TKWA 2IXQB 3STZB 2UY7A 4B95C 1SM3H 3GMRA 5DJDB 1XCTA 3VM7A 3K1DA 3V9EA 1JYWA 2P9RA 4XP6H 2Y1YA 1AGCA 2LFGA 4F9LA 1UOWA 8CGTA 1JPEA 3MODL 3ESMA 1RJLB 4JK0D 2VKWA 3MGOA 5K9OA 3LIZH 4AQEB 4KZDL 4BSWA 1PNDA 5CSBA 3GMMB 3MN8A 3ABLB 4ZT1A 4OLXL 1RZIB 4GRWH 4HG4J 2X4UB 1G7QA 2YPVH 2WVUA 4B7LA 1W8NA 3OF6D 4KXAA 3VXUD 5BS0A 1M05A 3KGRA 1E90A 3KYOB 1DQQA 4Q9CA 1MCNA 1FG9C 5EBMA 3RWCA 4PS4H 4J28A 3NIGE 2A6IB 2ALAA 4TL4A 4JVPA 2K0RA 3F05A 3H9SE 5D2NC 4GRLB 4LASL 4V1DE 2N7AA 2V7NB 3QWNA 2BNRB 1RCYA 1R1CA 3H42L 1H9DA 2GT9A 4HJ1A 3BAKA 3NEXA 3LZFH 1DO5A 2HLFC 2XWRA 3BI9X 5DR5H 3ZVVA 5EUOB 1SOQA 1ZS8A 3EFDH 3WGUB 5C6TH 4BKLA 4YL9A 4LHJB 1EK3A 4NRYB 5GS1B 1A7QL 3QNYA 5LLIC 3JWOC 4IKJA 1G7HA 4TMPA 3SGDH 4L5FL 2H0JA 3ZDXE 4XMWA 1GYCA 3VD3A 3W56A 2X6VA 3S5ZA 4IEFA 1IGML 5FOBA 5H35B 3EO1A 3L9EA 4YPJA 3E9UA 4HHGA 3V7AE 1ACCA 3RVTC 1ORQA 3D33A 5FKAA 3DX6B 3FUHA 3PHQA 2XNAB 4YIQA 3I6GB 3CFMA 3P3TA 4G42B 3ILEA 4R84A 1HL4A 2OMUB 5JW5A 3D48R 5DJYB 43CAB 1J12A 1XH1A 3AT9A 5GJSL 4Z76B 1BX2A 3FU7B 5BRZB 5EPMB 3CN1A 1NCCL 3HZVB 5DO2D 4UTBH 1I9JH 5D7IE 4OM1H 3TIEB 3QR1A 4P8QA 3L3HA 3V0WL 4JO3H 1I31A 3QFJD 3MLTA 5HY9B 4RNRB 3QNXB 2ALWA 2R8SH 3MKGA 1UHVA 1DQMH 1Z5HA 1IM3A 1O9ZA 2YRBA 3TF4A 2WWKT 4CSZA 4HQQL 3ASNB 4RMUA 3PWPE 5KW9L 5I0WA 2I85A 4R26L 1QPPA 1N8ZB 3G5VB 4LRNH 3IB4A 3GXIA 2Y5TB 4OGAC 4W9ZA 3DGGA 5IBUB 2P8MA 4PJ7E 1C1EH 4LLDB 5D2LB 2B0SH 2CO7B 2Y9RT 3M6DA 4H8WL 1TZIA 3D18B 1UH3A 4HUXB 4OZFA 2YZ8A 4WK0B 1ZLSL 2GIMA 4PRDB 1JN6B 4XC1L 1CS6A 3A22A 1W8EA 4F2EA 3O2DL 3FO2B 2XIBA 4HKXA 4FQIL 2K9UA 3GMOB 1A6TA 5F96H 1MFNA 1Q9WB 4FI8A 5DRZA 1FI8C 1VFAA 5IVXB 4OVVA 5BV7B 5DT1L 3GSNA 4UIMB 5GGSY 1J1PH 5GJTH 3VWJB 7CGTA 2IG2H 4OCLC 1TVHB 4CAGA 4LKXA 4G6ML 2QMKA 4NQEB 2IAMC 5AB1A 4BXVA 1Y18B 2DQJL 1DQJA 2HH0L 4JM2A 3VFVB 3APDA 2PMZA 1SYSB 3FTGA 4BZ1L 3MA9L 4PWFA 2WN3A 4I18B 4LHUG 2Z9TA 4LSUL 1SF3A 1RUAH 3WXVH 2ZNWA 5LN8A 1A4AA 3IJ9A 3BPOC 4PGJA 1NUNB 3ARTA 3LD8C 2N7SA 4O58H 2X1QA 3BP7A 4WENB 2BNQD 5HI4D 4L8SC 4E41E 1KCUH 2Q76A 4HUKB 1RLWA 2H4EA 4PJDA 2G60H 3C2AH 4YFDB 3SDAA 1HU8A 1BD2A 4UINH 4OLWH 4I0PA 1CBVH 1ERNA 5IIEB 3G3LA 3PHSA 4JRXB 4YHZL 2WQ8A 2DQGL 2F7OA 4MZIA 3DRQA 3UIZA 2NCEA 5LXGL 2B20A 3MV7A 4GKLA 1KXHA 1FNGB 2O26U 5D55A 4M00A 4YDKH 4UQ9A 3ARVA 3K71A 3NJJA 4G43B 4U0QB 2X3CA 3IDUA 1TSRA 3UO1H 4NUGL 5EV7A 5GZNA 4UB0L 1BDYA 4A37A 4Y4KC 3P4OB 2R0ZL 5F7LB 4FL4B 4YSPA 3ZYOA 1EJ6A 2Q6WA 2GQHA 5AW8B 1HI6A 1PZ5A 5K5YA 4MCZA 4HXAL 3V0VA 1ROCA 5DRWB 2ZE0A 8FABA 1BPLB 2GCYA 2YXMA 3FQWB 4PRPE 4E9YA 5CKAA 3QPKA 1YY9D 3MRCB 1ZLUH 3L5XH 2BHFA 5JXEC 2VDPH 2WXIA 1QA9B 4MA3B 5JW4M 2PYFB 3MOBL 2Y0SA 5DS8B 1TJGL 3N43F 3E1ZA 2HT2D 4KI1A 5IP4A 1IM9A 1I7UB 3DV6A 1KFAL 4J8RA 1BYNA 2FO4B 3D3VE 3EDEA 1O5DT 5D1XA 1CLOH 4AGLA 3VYPA 3H3KA 3CBJB 1ZTXH 5DF0A 3U36A 2EICA 4QRPD 2IWKA 2HN7A 4FHBD 4HX1B 3T8VA 5F21B 1T4KA 3TBYA 2PXYC 3AAZA 3ROLA 3TT3L 3DVIA 4MD5B 3QDME 4N9GB 2W0LA 4RA3A 2NY5H 5E2UL 1FLTX 4HS6B 4V2BA 3SGKA 3TH2T 3M1BA 4G8EB 2AK4B 5EO9A 1NGWA 5ENWA 3D85B 4PJEB 3ARBC 3SDXE 4P5TA 1OZTG 1PY4A 2PYEA 4K7PX 1BQHB 1MH5B 4FKKA 1T5WA 3DV4B 4IK7A 3UJJL 1SN5A 2R4RL 1HE7A 2E9IA 2AMGA 4S2SB 2G5BA 5JHLH 3O8XD 4URKA 4F20A 1Z9LA 1HWGB 2YMTA 4MMZA 4ZSOA 4YWGL 4ZD3L 3UBFA 5FO7B 4DHLA 3NSFA 1N0LA 4G7RB 3EZ8A 4L2YA 4YX2H 5EZOL 1BLNB 2EINB 3BWAB 3T1FA 3VQMA 4LCWA 2UXFA 3OJMB 1KBVA 1JVKA 3EO0A 1O0VA 3EUDA 3G6JE 3H7BA 3PRZA 4RCAA 1O75A 1BXAA 1FC2D 2QKIB 2D7MA 2YAFA 3RWHA 2KZBA 3HZYB 3JQOB 5GRUL 5BOPA 1UWYA 2X38A 2WUBH 3RI5K 4ODSH 4RMVA 1VZHA 3EJTA 1FLRH 25C8H 1YECH 4NUJB 4P2QB 3AS0A 5HGHB 2Z93A 1LDSA 4Z7OF 1I8LA 1QAWA 1JXKA 2CLRB 2JE8A 4DGIH 5GIRA 2UX6A 5JTWA 3I50L 5C8JA 2RJMA 2LQRA 2Q10A 1AI1L 3MUUA 4TNVK 1R3KA 3OXRA 3FQUB 3BKCH 4Q8BA 2H3KA 2Z7UA 2VM3A 1GXEA 2AABH 3K4DA 5J5EA 1HHJA 5BW7C 2FGWL 3V6BR 3HS0C 4X7EC 5IVNA 3DURB 3MLPA 1OP5H 3C08L 1SHSA 3W39B 1J0ZA 4FCHA 2VJ0A 3BEWA 4KTDH 3DXAA 2WYTA 1AZCA 5IVXF 2R4SL 1E9QB 2OZ4A 1E6OH 1JE6A 1SXBA 4AV0A 4CVZA 4BFIA 1IKFL 4PGDB 1WVZA 1JDCA 3PPEA 4GUCA 5I71C 2VYRE 4P46D 5C0BA 5HHME 4JFFA 1JZ8A 32C2A 4QXWA 5GRXG 4F8OA 1N64H 1N7ML 4JFDA 4EN3A 35C8H 2DJ4A 1P9MC 3QORC 4JHWL 3EH1A 5IW1B 3GIZH 4RZCB 4A1RA 3JTSB 1YY8A 4HIPA 2JV6A 2ZKWA 5C09B 3GSQB 2CSPA 1SY6H 3SHSA 1ZLVH 1HQRA 5GRVL 1YUHA 5EEVA 2JTDA 4Y19B 3HAEH 4Y4HA 5E9DB 2F8OA 3GF8A 3QIWD 1PFCA 4U1GC 3HJEA 1OWWA 3H9YA 3Q6FB 1ZLDA 1KTDA 4DK6A 1F6LL 2RB8A 1E65A 4ODWA 3JSSA 1QPXA 1TOXA 5IROC 1QSEA 2BOBB 5FWRA 4M43L 3BZEA 3NT0A 4ORGB 1D6EA 1MRFL 3V6ZA 1WP6A 3AQXA 4P5KB 4IJTA 3L3GB 5EOCJ 5IBLC 5AG8A 2A9AA 1YDPA 1JF6A 1OSPL 3L4TA 2FHFA 2NUTA 1R5WB 1S9XB 4OIAA 1JPST 3RWGB 5AFAA 3TIDA 1WD8A 3WNKA 4HOMA 2CBMA 4F57L 1LEIB 2X44D 3OZLA 3L9RA 1QNZL 2ICCA 4Y2DB 1A8ZA 3HB3C 1ZVSB 3TPUA 1G6RB 1CD1A 3UX9B 3I6SA 5D8JH 4UF7C 4M93B 4P2CG 1WZLA 3QUMH 1T2XA 4JRFA 4D3CH 4PP1C 5CN3A 3R0NA 4ZS6C 1HKLH 4ODHH 3HRZB 3J27A 3KLLA 4UDTA 1EXHA 1JHKL 1U8PB 2X1OA 1EUTA 2UZIH 4IRZH 1U4FA 1BVKA 2W07A 5ISZE 2QVIA 2EXYC 4PRBB 1OGAE 1IU1A 3FFCE 2D7NA 3E2HC 1T5XB 4PW4A 4WF7A 2UUDH 1LNUB 5IT2H 4UANA 5KS9A 5A1AA 5CM1A 2NXZB 4LOVA 3IFOB 3QUXC 5BNXD 3CU7A 1CGUA 4P05A 1ZLVK 2ORBL 1CTNA 2AQ2A 4I48B 3AGWA 1BFSA 3HC4H 4GQZA 4MAYD 4XMXA 3WE6B 1Q9KA 3OKOA 3NCYS 5LBSL 1MJ8L 4WFHE 4A7GF 1D6VH 4P06A 2VDQL 4NRXA 5ELIA 4ZPTA 4PB9L 2OCCB 2H5UA 3DO3A 3SDDC 2DIAA 1AZVA 4RMTA 4AE0A 1C08B 4EXPX 2F19H 4FJ6A 2ADFL 4PHXA 4Z7WB 1FG2B 3BXNA 2E6QA 2PTUA 2JK5A 4XH2B 4W6WB 1OTSC 3L4XA 2R1XB 3B5GA 5DZNA 1SXSA 1I1AA 1DANU 4Y4FC 4ZMAT 1BGXH 1F6AB 4TQEL 4CU7A 1JWMB 4XPGH 4O02L 5HYJA 3LKSB 2BCMA 5J11B 3VI3E 3DVFA 1RVFH 2XVGA 1PCSA 1EV2E 3F7VA 3JVGA 1ZJAA 2F54D 1FNEA 2X4RA 1GL4B 2JIXA 3IPBA 1IVTA 3O4LB 2EIDA 3S34H 3UTSE 3KBEA 5DJ2A 4LL9A 4Y5XC 3MUHL 1X5LA 5I5IA 1EHXA 1IEAA 3BDXA 4TOYL 4YHLH 5AW9B 5T3ZE 2DJUA 3E7JA 3QCVH 1YN6A 3B9KC 4ZNEE 3ILPA 1XEUA 1W15A 3TO4C 2OZ4L 4MSWB 3FSWA 1TU2B 3SQOH 4KK5C 5MEQB 3ES6A 5JIMA 2YJLA 2BINA 2FUTA 2O1AA 5C86A 2RIKA 5AVUB 2UUDK 5K9JH 1ECYA 1F00I 1JTOA 3P54A 1AQKH 1QD0A 4J3BA 2F7QA 5JUEH 2YWZA 4JRYE 5IB2A 1A3RH 1V05A 5FCUL 3DTXA 1NCNA 1ZHLB 4L0ZA 1PG7H 3S88H 5D96C 1CYGA 5D5MB 3MCKB 4KXBA 4N8VA 4HFWB 3F62A 3BPCB 4J8QA 4NM8H 4ABWA 5FDWA 5IKCB 4AQ1B 3KWVA 1E6JH 1S8DB 2UWEB 2CM6A 4TUUA 4NO5A 4RWYH 1IUZA 1ROWA 4OJAA 5ICZA 3JZ7A 2YUWA 4ONFL 4NO3B 3CAFA 4U1KA 1HH6A 3A21A 1TJHL 4DVBB 3VXUE 3V9CA 4C56D 3LQAL 3X1EA 4M7KL 4XP5H