2AW2A

Crystal structure of the human btla-hvem complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
CDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords B and T lymphocyte attenuator
publication title Attenuating Lymphocyte Activity: the crystal structure of the BTLA-HVEM complex
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 110
sequence length 110
chains with identical sequence X
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aw2A00
3MBEB 2R56L 2XKNB 1X5AA 1KT2B 1MEXL 3RVWC 3Q1SH 4G80A 4KKBD 4EJ1C 2X1XR 1D6VL 3WYRA 4F7TB 1I7TA 1QSEA 4FNLL 4CDGC 2OS7A 1E28B 3QPXH 3X11A 5MENA 4JY5H 4LP4A 2Y06L 4IRJC 2VLMD 4Z7VB 4APQC 1IJ9A 1LNUB 3MRGA 4XVTL 3O2DA 2F9BT 5CBAA 3VFSB 3E1F1 4RDQF 5MEPB 4P46C 4KZDH 3HN3A 1FORL 5F88B 4PTUB 1MJUL 4PTTB 3OAZH 1EZVX 3EOYG 4G8GA 1J1OH 4H0IA 4OZGE 3OGOE 2Y1VA 5EOQH 4N0UA 1MCPL 3GSUA 1EA9C 1RUKH 3O8XC 5DD3H 1NGWB 4DKDC 1I7ZB 2GJZB 1N0XL 4XWOD 2NY7H 5JHDB 3L5JA 4LLUB 4XXCC 5FYJL 5E9DE 1ZTXL 4XP6L 3EOBA 3MRQB 3RY4A 3U6RA 4N8VB 2HJFB 3HG1D 5HYFA 2JE8A 4RGMB 5D70L 4ZFGL 1A6WL 4MAUH 2R2BA 2OYPA 3E3QE 2HG5B 3GZKA 1T89A 1EHAA 5L2KD 1O5DT 3HMXA 4CN4A 5I2IA 1KIUA 4HS6B 1X3DA 3T4YA 2X4RA 2FYYB 1GGCH 4AQ1B 3PV6B 1QKZH 1SQ2N 2VXTH 5EC1B 5EO9A 1YNKH 1OF2B 1CE6B 3NIGE 3MRPA 4HT1H 5E8OB 3K80A 1MI5D 3C60A 5B39B 5IHLB 3EJYC 4TSAL 4PY8J 3K1KC 4ELKB 1NDGA 3X14B 4YXLH 1Z0NA 3KPPB 5C0JB 4S2SB 4MJ5B 3FMGL 1Y18A 2BY1A 2C1OA 4CVWA 4NKOB 4JO3L 5EBWA 1F6LL 4OQTH 2KKQA 3ZHDA 3MBEC 4EXPX 5CBEB 1P2CA 3NIFF 1XF1A 1BX2A 3ZYZA 2AJ3B 3VXTB 4DFIA 3QCTL 1QBBA 1MFDH 4PJEE 2PXYA 3FB8B 5FK9A 2JJTC 1FGNH 3KXFB 1FO0H 2WQ8A 3C08L 4OT1H 4I4WB 1MAML 3MRHB 1OAZL 3NPZB 2N7BA 3P40A 3NCJL 3CFJB 1CFBA 1ITBB 1J05B 5FA3B 1DVFC 1P5VA 3BPCB 2H8PB 5F93C 3RWGB 1AXSB 1JGLH 2A6DA 3TBYA 4DUWA 2ADJB 3DHJA 3VGAB 1QBML 1SYVB 3MRBA 5D5MF 2GY5A 1YYLL 2ADIA 1R3LA 1ZT7A 3GRWL 1XF4B 3MNWB 3QCVH 4UU9A 3ULSA 3TYGH 2ZZUT 4H88L 4EVNA 2JCCF 4Z0XB 5AZEH 4DVBA 4K8RD 1A1NB 5FO8A 3BW9A 4Z18A 1LILA 1FLRH 4PRPA 4CU8A 1VA9A 1II4E 4RGMC 4TNVF 3ULVC 5AZ2H 2HJLA 4P99A 5DA0B 2DM4A 1HXYB 3AS0A 1AY1H 2EYSB 4P2RA 3HE7D 1CR9H 1QBLH 1A7RH 2B8OT 4LPTA 4X9FA 3U0TA 3W5NA 4NYLA 3BKJH 3DMMD 4G9FB 5EUOE 4JRWA 2YRPA 2ZUYA 5L6YH 3QEGH 4S1RL 2V6HA 4NBXB 3WNNA 1SY6L 2A9NH 4JLRA 3X3FL 3HZYA 1DFBH 3RPKA 1I8LC 1EFXA 5FYJU 2EDXA 3GMMB 3MV7A 1LE5B 2IF7A 3CDYA 1XIWA 2P5WD 5GGTA 1BAFL 4LLWB 2R2EB 2PTUA 4KKLD 1OARH 5TDNB 2ICEA 3EOTH 5BS0B 1PX3A 1A64A 4O02H 3UP1A 4MCYA 3RNQA 4YX2H 2CDFA 4JFEB 1JUFA 3KPNB 5IVNA 4XC1L 2HRPL 3QA3A 3MSPA 4GBXB 3GI8H 5E56A 1N26A 1N5YH 1DBBL 5JLZB 1DQLH 2AGJH 2BMKB 5F7UA 4BJLA 1RULL 3S98A 3SE4A 2P7TA 5DRWA 5CSZB 4LPWA 4JQVC 4M48H 1OTTC 3VXOA 4YK4B 4Z7VF 3FB6A 2IBZY 4WY7H 1MF2H 5SWZB 3EYUH 3VWJD 1CFTA 1RZ8B 1IRAY 1P4LA 3PIQA 1IAKA 3CCHA 2ARJQ 3V2AR 3TH4T 2EKJA 2BVPA 2O5ZH 1NBVL 3VGAC 1BIIB 4IS6A 2FZ3B 3TBSA 4JRYB 2CDEA 1RU9H 5HYJD 2NR6D 3KLHD 1UWGH 2BNQA 5J7CC 4JN1H 1AGCA 5GGSY 1NGPL 3W9EA 1L7TH 2GK2A 43C9A 3FN0L 3G08B 1KPUA 1NJ9A 4YC2B 1KJVA 4NC0B 4NDMA 4UNUA 5F9OH 2XWBA 3IYLW 3QIBA 4QRSB 2Q7YB 4LCUA 4G9DA 5IB5B 3F5WA 3ULVF 1YJDC 2IH1B 5IBUB 4L8BA 1RZJL 1P1ZA 1MCQA 3JV4A 1E6OH 2WMPA 5FO7B 5IROA 1NL0L 2NY0D 1AGEA 5ERWA 1HCFX 4L4TD 5F96H 4WWKD 1P7KA 2CK0H 1WBYB 1JWMA 1JIBA 2R0LL 1FCGA 1HQ4B 2BNUA 4J6RH 4KROD 4JRXA 4XCNA 5HGDB 5K9OB 4G5ZL 1A7NH 2RBLA 4KJWC 4OI8A 5I1KH 1T7XA 1WBZB 5D7KD 1UZ8B 4XXDB 1IGJA 4MJ6B 1W0VB 4JY4A 3VI4E 5IT2L 3OKEB 2V2XB 1XGYH 4LF3B 4XNMA 3D18A 5ACMA 1MRDL 4P9HL 4KHXH 2E27L 4OGAC 4GW5B 4YQXL 1A1MA 4Z7QE 3MYZA 3KLAB 3P4MB 2Z93A 2YC1B 4P5KA 2JK5A 1IQWL 1NAMH 3C5JA 4PJ9D 4X4XA 5E7FA 4GBXC 4R7DA 4DKEL 1CBVH 1NCAL 2DQGH 5J1AA 4DKFL 1MREH 3RNKA 4HG4K 2BVQA 4G6FB 1ORSA 4KRPD 4YK4C 4P23D 2VJXA 4PJDB 2W38A 4I0PD 2UUDK 1T4KB 5CD3B 1K6QH 3QO0A 2ADFL 3P30H 4HJ0C 2DN7A 5GSVB 1I7RA 1A8JH 3UYPA 3MOQA 2W0KA 2CSPA 1H8NA 5KOMC 4NC1E 1JPSH 5D6DC 3D25A 4H8WH 4ODSL 5I8OH 2ZCHL 5C0RL 5T1KA 4PJHB 3KJ6H 3RTQD 3FT3B 4MWFB 2GCYA 3EYOB 3DSFL 1JGVH 5IJVA 3QIWB 4Q97A 4X9IA 5GZOC 2XQYG 3QUMB 1F3JB 3IJSB 4X7EC 1N8ZB 2W9EH 1MY5A 4YC2C 4KQ4L 2J8UE 4UT7L 2I9TA 5ILTH 4U6TA 5DLMH 4MSWA 4LEOA 3QFJE 2YD2A 4OZFH 3QQ9C 3O2DH 3TVMD 3W0WA 5IVXA 2ITCB 1QYGH 4V2CB 1HHKA 2CLZB 1SJHB 2ILLA 5IGXL 4KK6D 4E0RB 3DX6B 1IKFL 1IKNA 2YWZA 4M7LT 5IIEB 4Y4KD 5DRNB 3U9PL 2JJSA 3BI9X 3D39E 1QR1A 3C9NA 3GBML 3V5DB 2W9DH 2AJSH 2BVUA 3UTTD 5I0DA 4PRIA 1FL3B 5B8CA 2AJYH 3J7HA 3AU1B 4HS3A 3R8BB 3VD9A 5GS0H 5IVZB 1BVKA 2GYSA 4EI5C 3CDGB 4RQQB 1RY7B 3JSSA 3QUYD 3BGAA 1EHXA 3HNSH 2VN4A 4KI5D 3S7GA 5JR1H 5LVEA 2AKRB 1RZIA 3ZDYE 4KH2A 4NRXA 2X4UA 3HMXH 1YEJH 5SV4A 3DUUB 4MA8H 2W0PA 4MD0B 4I77H 2UZIH 2X4PA 3VXNA 4OBRA 1NKOA 1MHPL 1UEMA 3QUKA 4KQ3H 2P24B 1A6UL 3QRGH 5L88H 3MJ9L 3ZT5A 3MROB 4RGNB 1G6RB 3B83A 3LKNB 4BSVB 5T5NF 4AL8H 4MNQA 1B2WL 4KU1A 3GK8L 2BFVH 2HFGL 4KHTL 3IFPB 4BZ2L 4OGZA 2BDNL 3MCLL 2WNGA 3FO1B 5MP6H 1NCDH 3RWCB 2CK2A 2AXGB 2RR3A 3HPJB 3TYFA 1RHHB 5JQ6L 2P8MB 4UNTA 3IDIB 1A14H 3BJLA 4X7TA 3QXAA 4LPXA 1FGVH 5BZWB 3PUCA 2B39A 3FQRB 1MCDA 3K4ZA 4NQCE 5EU6D 3QIWC 3IGAA 4Q6IA 1AQKL 4EDXB 4U2ZA 1J0ZA 2VERN 3DV6A 3HR5A 2WM0A 1FVEB 3S9DB 5BW7C 2QBWA 1NCCH 3QEQB 4M02A 4LRNL 1TCMA 3O6FD 3HMWH 5GZNC 3T0EB 4QHKJ 4PRAA 1CG9A 4FFYL 4L4VE 5LG1A 2AQ1A 3DO3A 5C70A 2G60H 3VE0B 1YY8A 5L2KE 1JF5A 2N7AA 2VLKB 4XMLH 4MCZB 2JTDA 2DQEL 1T0MA 4MA3B 2XRAL 3L9RB 3DIFA 3MJ8B 4HWBL 4QHUA 3HNVL 1IVLA 4N8PA 1GZQB 3FT4A 5EA0L 2B4CL 3GNML 1JMXA 4F9PC 4OFIA 4XP4H 2P46B 3O2WH 4NKDA 4KDWA 1KNOB 1QFWM 4P2QD 4KMTL 1AO7E 3PJSB 4PRHE 1T83A 1PY4A 3SO3B 3LPGA 1E0OB 4AMKH 1I9JL 1A4KA 5JORA 3WMSA 3MUZ1 4Z7NF 3LB6D 3RFZC 5FGCB 3V9FA 2QQLH 3QDGB 3RVVC 3IFNH 1BFOA 1KJ2A 3KWWB 4RGNC 4OZHE 3LEVL 4K3GA 3CFBA 4PJDF 2FGWH 5GGTH 1B4JH 5HHMD 2VXUH 3OAUH 4GAGL 1JWUB 1KXQE 3DETC 3WLWC 1JHTA 1T5WB 4ZTOL 2EH8H 1NC4B 5DQJB 3IF1A 5FECA 4I2XA 3C87A 1UCTA 4K55A 4Y4HA 4EUPA 4UQ3B 4M7KH 1LEGB 4ZD3H 3CH1B 3G6JA 3ZYJA 4PJHF 1A3RH 4FG6D 3WS6A 1DBMH 4RFEA 4E5XA 2V9TA 2Y9RT 2EDNA 1TETL 3SPVB 4LFHG 2Y36H 1TNNA 2HYMA 4HIJB 2XY1A 3QQ3A 5A3IC 5DDHB 4X8XA 4J8RB 5CIPA 2HTLD 2BSTB 4WU5A 5CWSB 3ZYOA 3OGCA 1BBJA 1X5ZA 2I5YL 1CICB 5DJYB 3UTZA 4MB3A 4OCLC 3HC3L 4BH8A 1MWAB 2I27N 3T0EC 4PLJC 4PB0L 4F2MB 1SEQH 3N9GH 3RWHA 3RY5A 4D0BB 5JW5B 1FQ9C 3L3KA 1L9MA 3LMJL 2R15A 3M45A 4ELMA 2A6IB 1FLTX 5D9SA 3HE6A 2VLRA 1C08A 2XA8L 3RVXC 4MJ4A 2IANA 1EHLH 4YIQA 4F80A 1DLHA 1ULVA 3MLTA 2IMNA 5JOPE 1WJ3A 3IFOB 2R8SL 1J0IA 4P9MH 4HWEL 4ALAL 3CUPA 2P43B 4PJXB 3WJJC 1P7HL 4S1QH 4OCRH 4ZTPL 3BJ91 3DXAE 1NH6A 3OX8A 1RJYA 3SGDH 4NUJB 1VACB 4LDOB 5CS7A 1BVLA 1H0DB 3TA3B 1CGSL 2BVTA 1A47A 3B2VL 3SO3C 4R3SA 5L8LB 3SEPA 1XGUB 1U91B 3ZHKA 4YFDB 3DUHA 3MREA 3O4LB 4XCCH 2XYCA 1GZPA 3M1BA 5IMLB 3NFNA 4CDHA 1AGBA 5BCAA 1NLBL 3MRMB 1FP5A 3TLRA 4RMTA 3FN9A 4HWZA 3MRLA 1FE8L 1S7TB 5FXCH 3ZKXB 4WUUD 2UZXB 1ZS8A 3FAXA 3UTSA 3L3JB 1Q94B 1QNZL 2KZ1B 5I66B 4UB0H 1PKOA 3OXSA 1TJHH 3IETA 4FQCL 2VN7A 5ICZA 4RMUA 1CGTA 4MQXD 4OLXH 3U7WH 4BH7A 2ICCA 4XZUB 3VFMB 3VGEA 2DQCL 1P7QA 4Z7OF 4WNQB 3FQNA 2EDWA 4J1UA 2F58H 2EDRA 3AS2A 1IC5L 3TH2T 3PWPA 3NCBB 5JA9A 4GS7B 1KGCD 1KV3A 4JB9L 2YWYA 4XC3L 1CICC 4Y1AB 1ONQB 3VFWB 1NFDA 2YA0A 1YEDB 4PY7A 4BK4A 3HS0B 4Y19A 1A22B 3DX8B 2MPAH 1E4JA 3WFDL 5J0BA 5KSAB 1FNLA 4LBEB 1Z9SA 4Z6AT 4GKSA 3E6HA 2JB5L 2H32A 4AK1A 1BM3H 4FQLL 5E70A 1LD9A 1YEGH 3DBXB 1DLFL 3LH2H 3MODH 4QOKE 4OFDA 1HHHB 1Z2KA 3Q5TA 4Y8AA 4XCYA 1UXWA 1W72A 4X9BA 1KPRA 2MMXA 3FAWA 1RZKL 2LTQB 2XZQL 2Y5EA 2VC2L 3Q6FB 1A6TA 3TA3C 3PWUB 4PRDB 3RDTD 1U93B 1UWEL 1KUMA 3JV6A 1R6VA 5JXEA 1FG2A 2V9RA 4P5TC 1YC8A 5FYKE 4OGXH 1EH9A 3WFHB 1T80A 3QG6A 1FSKB 3D2UB 1B6DA 2VDOH 2GTZA 1F6AA 4UUJB 2H2PD 4NNXB 4G6ML 1YNLH 1ZKAA 3MTRA 4PJ8C 3ZKXC 2IADB 2F54E 1T1ZB 3STLB 2HH0H 2C7UA 3SKJH 2BSSB 1OGAE 5DJ8B 3LZFH 3KPQA 3P9MB 4N1HB 4DCQA 4DUVA 1GVIA 3ILPA 5ANMB 5DEGB 2Z35A 1LO0H 3HRZB 1F8TH 1CXHA 4YXKH 3X17A 4XP9H 1KCVH 4K23L 3PV7A 3RVUC 5T1LB 3TP4A 2JIXA 3SGKC 1D7FA 5K33A 1OTUD 2R0WH 1YEHL 2Z8RA 3OTTA 2V5TA 1A3LH 4HGKC 5C0CA 3QPQC 1LO3H 2QLVB 5KBNC 1PSKL 2FB4H 3O3EA 3SDAA 5GGVH 2OL3A 1A9BB 3CLFL 3EYFA 2ZOKB 5CZVL 1ZVHA 5E8EA 1MFCH 4KTDL 2DIBA 3H0TA 2QQKH 1J88A 1KN2H 3DX9B 1ZANH 1CL7H 1F02I 3EGSB 2CMRL 3OSKA 3FCTB 4P4RB 3MCKA 4PBVC 5H94B 4P49A 1N64L 4QHNB 2AJVH 1AKJB 1T1XA 4HX1A 3GSNA 1OWWA 1HHJB 1CDBA 2DBJA 3OHXA 4UBDD 2LTQC 5I8EA 4OZIA 4PJXF 4ZMAT 2OM5A 3PP3K 4GG6B 2NXYD 2P45B 5GGSB 4RMVA 4ZS7H 1U8JB 1KTRL 5JDSA 4XMPL 1T7YA 3ARDA 4ACPA 5C09D 3TF7C 2K1MA 4NGHL 1FSKC 2EC9T 1BMGA 4QRPA 2DD8L 5C0BB 4ZAKA 3E6FA 3QXDA 3T2QA 1IAII 3VI3F 5EU4B 5DEZA 3S36H 1F4YL 1N6QH 1XGPB 1ZEAH 2EEDA 3QISA 5EZJA 2L4OA 5FUZL 2F53E 1MVFA 3NH7H 5HYEA 5IW1B 1J8HB 1QRNB 1AGDA 4KK5D 5HY9B 1U8HA 1FYTA 5BJTB 4NRYB 4EN3D 3OBAA 3BZDA 5HBBA 5INCA 4JCLA 1FHGA 2B1HH 3V4PL 3WNMA 4JQXA 3B43A 1Q9OB 1ZT4A 5DTFB 3CFEB 1BF2A 3T77A 4U1SA 1KJ2H 2FJHA 4MXWL 2C3HA 2OTWB 4R4NC 4R90H 1Q0YH 5GGRY 3TCLB 4NQXB 4W6XB 1PG7H 3CGTA 1RZGA 4K9EC 4ZNEA 3BH9B 3EYSL 1U58B 4Y16D 4PJAF 3N1QC 2IGFH 4P4KB 4EUPH 2R0KL 3Q5OA 3NACL 4ODTH 3WNPA 4AH2B 4JG1H 5D70H 3BVNA 4AM0A 1KCUL 1I9RH 4U6XB 1NSNH 1WZMA 2BY2A 4MHHG 2VZSA 1KYOK 4LHUA 4M4PA 1IGYB 2P8PA 3PP4H 2YRZA 1I3RA 5HHOE 5T3XH 2Z31D 3RGHA 5CIPH 1I8IA 3LQZB 5I1EH 4APQA 3ARFB 2VL5A 4U6VH 3UTQB 3MNVB 3SDDB 3HPLA 4P46A 4FFZL 2X7LA 1N6VA 2W60A 1FVDB 5F7DB 1EGJL 3NA9L 3MV8E 3BEVB 1RUMH 1RIHH 4GAYA 4Q7DA 3QDJB 4JREB 5CLWA 4QXGH 1E27B 4FQQB 3L3DB 2E8ZA 3VWKD 2RB8A 3JUYA 4C58B 2ED8A 3KNBB 2VDKL 4LCWA 4QRTB 3D3VD 3O8XA 2QV2A 5TDPA 3H9YA 1T1YB 2NZ9D 4YDJA 3SDCD 3TPUB 4IRSB 1RZJC 3MOBH 4Z78A 5BVPH 2HT4D 4RAVA 4MQ7A 1NBZB 4FFVD 4NBYB 4HH9A 4LEXL 4QHLB 1OT1A 4PRBB 4DN4L 3QG7L 5HPMA 1Q0XL 4CMMB 3FFDA 4OF7A 3GJEA 1AFVH 2VQTA 3T2NH 4YHZH 5EU5A 3BXNA 2OR9L 1FZMA 3B9EA 3IJYB 4L3EB 3S3PA 5FB8B 5C2UB 4QLRA 4JPKH 5DQDH 5DA4A 3TJHD 1PJ9A 1N7ML 2CD0A 4NCDA 5IB1A 3S37X 3NFPB 4TRPL 5IMMB 4NN6B 4KMQA 3AAZA 4PJIE 4GRWB 3RI5K 4ETYA 2J88L 3HI1A 1V8HA 3OR7A 5FCUH 2DQIH 3MPCA 4P4KC 5ISZB 1UT9A 2WP3O 1CYGA 3LKSB 4JO1L 2YD9A 4JANA 4HK3N 1KT2A 1DUZB 5K9JL 5FM8A 4EQ3A 2ZJSL 4F7TA 2FECI 4RX4A 2CJUH 2WBJD 1H3TA 3DTXA 1E28A 2JJTA 3M8OH 5D7JB 4HUVA 2XN9B 3LKQA 4IMLA 2VLJB 2EDKA 2DM2A 3CSGA 4Z0BH 1LNUA 5D96B 1DVFA 2YPLB 3ARFC 1T04B 3AXLB 2VDLL 5FKPB 4PJ5D 2VO5A 3SDDC 5MEPA 4MNHB 3WL9A 1WFNA 5IB3B 2XA3A 2C3VB 4PTUA 4PTTA 2GSGB 2J6EA 3BP6B 1G9NC 4JREC 4IDJH 3BP4B 1AGFA 3B9KA 3KLSA 3QNZB 2NX5D 4ODVH 1NGWA 2H32H 1I7ZA 2DLGA 5GJTH 5JHDA 2AK1H 2XTJD 3MJGX 2WANA 5J9PB 3B6SA 3TO2B 1W72H 5JZ7D 1KCKA 3F12A 4GMSL 3ZE0E 5E1AA 5DD1L 4XTRD 5CKGA 3TT1L 2L0DA 3GMQA 3GMRA 1B9ZA 4IRZL 2VXQL 1TVBB 3HCVA 3GSOB 4OCYL 2V2WB 4LLQA 5E2TL 3V0AC 1NLDH 4YR6B 3T65B 4UTAH 4XX1E 4FQHB 2ERJB 3UBXI 3ARUA 5I16A 2GSIA 2IALB 3REVB 2FYYA 5GHWH 4U3HA 3PV6A 3QQNA 4W70A 4XBPB 3SCMC 3W11D 4M93B 3DI2B 1W2KT 5EC1A 1M7DB 5CJXC 3TWCH 1JZ2A 5CLTA 3CMOH 3AM8C 1I85C 2R23B 1ES0B 5E9DB 1I8LA 1YDPB 4KY1H 4JKWA 4NN6C 5E00B 5SWQA 3ZSSA 2C4FT 5JXAL 4AT6B 1KGCE 4KC3B 5AYUL 2XZZA 3OKLB 2A0LC 1S9XB 1YECH 4U1MB 2HKFL 4ELKA 1ROWA 3K3QA 4AYFA 4WEBL 5I30L 1U92A 5F1IA 3BDYH 1KCRH 3QWOB 4HFUL 4NKOA 5JIHA 4NOFA 1DQDH 5CBEA 4PV9A 3VXPA 5KS9E 3RGVB 4HXAH 2AJ3A 5I1IL 3L3IB 2W65A 5HI5C 5IQ7H 5ID0A 8FABB 2ZWLT 3FB8A 3U4AA 2ZKHL 4YFLF 4NWTL 3KXFA 3UJTH 5D7JC 3BZ4B 4G7VL 3MRHA 3VDBA 2DAVA 2Q87A 5C1MB 5D7IA 1J05A 5D96C 5FA3A 3FQXB 2OL3H 3CXDL 2R29L 3ARRA 3FOMA 2ADJA 4UDTA 3S35L 1SYVA 2ATPA 1G7IB 4U1JA 4OLUL 3TIEA 3MLSH 4ETQA 4PJEB 4GUPB 4HEPG 1CD8A 4J3SA 1EBAA 1VFOA 4Z0XA 2D3VA 1LDPL 3GSNH 4OD1L 1NCUA 2F74B 3GIZL 4LLAA 3O9WD 4FFWC 4K3EL 4MVBD 1LEKA 1H8SA 3GJFB 5H8DA 4PB9L 2X9YA 4KJPC 3ULUH 2IAMD 5HHNA 4HIIB 2UZYB 1NMBL 1P4IH 5E8DH 1PZ5A 3U36A 2MCPH 5JQHC 4OD2B 1IMHC 4G9FA 3NIDE 2ERJC 1G7HA 1AQDB 5TPWH 4IIQC 3RZCD 2LU3A 1EEZA 4M1GH 4R26L 1AJ7L 2ZCHH 2VZ3A 5CJOH 5ESVA 4U1IA 5FYKL 4BA8A 5TDOA 4GRWF 3G5VB 4HKJB 2R2EA 1T0PB 2VUOA 3E3QC 2W59A 3GGWB 2JKXA 3QHZH 4IRJD 4RWYL 5C3TA 3EJZC 5EUOB 3RGVC 5F9AC 2I26N 2DJUA 4HPOL 4GBXA 4XNYL 4K7PL 4JM2A 5JLZA 1TDQA 4I9WE 1LWRA 4K7PY 2BSED 4EBQL 3NTCH 4OAWB 3VGHA 4ZSOE 5CSZA 2XOTA 2R0ZL 2LV4A 1HNGA 1Q72H 4MDJB 5SWZA 2DLFH 1JZ3A 1BEYH 4FQXA 2OK0L 5FM5O 3WHXA 2X4NA 3MR9A 4G8IB 3AY4A 4W4OC 1NGYB 1EDQA 5D6DA 2FZ3A 2I9LB 2NY6B 5FDYA 1BD2E 3SKOA 5E6ZA 1OTSD 2PYED 4EDWL 1FC1A 3QIUA 5C6TL 2DIAA 3ROLB 5JNYB 5IG7B 5GXBB 3MLVH 4MJID 1TJGH 4NKMB 5DVNA 1AP2B 5JW4N 1AD0B 1UM6H 3O6KL 3V52H 1EV2E 4ZPTB 3CX2A 2FX7L 5I17B 4P57A 4JN2A 1JZ4A 1QEWB 2Z8WC 32C2B 5TE7L 2BHZA 4M5ZL 3HUJE 1G7QB 3U82B 4GW4B 4LARH 3BD5A 2ID5A 3I6KB 1U8KB 3EJYD 4OZGF 1KJ3H 1GAFH 4JPVH 5DVKA 3TV3H 3T2PA 1KB5L 5K9OA 3CVHH 4NKIH 2XWTA 4U1LB 2W92A 5FO9A 5BOZG 3MBED 1OLZA 4HEME 1AR2A 4XXDA 4EI5A 4MJ6A 5DMGC 1W0VA 3TGXA 4X9HA 4LF3A 3FT2B 4KDTA 3NZHL 3U4BH 1DSFH 4WI7A 3QDMD 5D2NE 4TNVK 1VCAA 1EX0A 3IDYB 4B41A 4U3XA 4MDIB 1MY7A 1TIUA 3LAFA 5KVGL 5MEOB 2EDTA 3PGDB 1N59B 3QUXB 1G9ML 2ARJA 3K8LA 1VFUA 1RAMA 4AEIL 4DTGL 3V8OA 3NIGF 1RJCA 1R0AL 2ESVB 1B3JA 3BP5B 3L6FB 1W8NA 4NZDA 4OV6F 4M3KB 2HVKB 5FYKU 1R5WB 1T4KA 5CD3A 3HZMB 2BJMH 1C7TA 3CD4A 4LCIH 4MNGE 4HXBH 5GRVK 1M71B 2GQHA 5HI3C 1AE6L 5D1QD 1QA9A 3NAAL 4G7YH 3ULVD 4PJEF 5BV7C 2FDBP 3PQYD 3V5KA 3D3VE 3QIWA 5HHVH 4DN3H 4PJFE 2COQA 2APTA 3CXHK 1IGTA 1NGXB 4KRNA 4HKZB 3QUMA 1F3JA 3IJSA 1KB9J 1FNGB 1N8ZA 1ORQB 2AEQL 5DT1L 3RAJL 1MRCL 1IAMA 3WEXB 1C5CL 1U2CA 5BW7A 3OJ2C 4IBLT 2ITCA 1VKXA 5DJCA 1SJHA 5EC2A 4E0RA 2J6EH 4CJ0A 5TF1H 5IIEA 2NW3B 3PL6D 1YMMD 4D9RD 4HV8B 1CE1L 1HN1A 5DQ9B 1GPOL 4GAFB 2YRLA 2UVEA 3K81A 4KI1A 1MCKA 3S3SA 1UB6A 2E6JA 1V3JA 1RZKC 2CLRB 4KKNA 4UV7L 2J8UB 5IVZA 1OAXH 3LQAC 3CDGA 3QFJB 2BC4A 3L1OH 5CHNB 3NCEB 5D71L 1E4WH 3HI6L 4F9PA 3D1MC 1D5ZA 4IOIB 5DR5H 3HFMH 4R2GB 5ADPL 1MFBH 4OLZL 2HT2C 5IFJB 4HMDA 3LQMA 4KRMB 3DUSB 3IDYC 1OTTD 3RWJB 5EUOF 3D39B 2FX9L 3DUUA 3BWAB 4QXUH 5GS0D 1A9EB 4TQEL 1MHHB 4TUKH 1ZK9A 5EO0B 3S34H 1JWSB 2P24A 3NCMA 3QXWA 3V5HB 4PUBH 1G6RA 1LP9A 4BSVA 4ENEC 5HYQB 3RIFF 3SGEI 4P59L 4WO4D 3GFUA 3C5SA 4PJ5E 4NHCH 3FO1A 1UG9A 1JHLL 5JOFB 2FWOA 4KK8C 2NNAA 4NUGH 1QFWI 3NFSL 2D9CA 2I07A 3LDBB 3VFUB 4RAUA 3DRTB 1T1WB 2QADB 5EZOL 5L8KB 4W68A 1CFVH 4ONFL 4EDXA 3WXWL 3D0VA 5DZLA 4R4FL 5CZXC 2XTJE 4X7SH 3B8SA 5DFTA 1OM3L 3E2HB 1FVEA 1YZZA 2VL4A 4PREA 1KG0A 1RZFH 2LVEA 4QTIL 4M7LH 3QEQA 3FQUB 4KJWD 3CPLA 1NCWH 4NC1C 2N1KA 2C4FU 3T0EA 1FVCB 3VD4A 2FH8A 3C8DA 1J10A 3VXSE 3VE0A 3QCUH 4WTZG 3MLUL 2P5EE 4X7CC 1ZAGA 1QFPA 4OGAD 1T03H 5IHBA 2IBBA 3PGCA 5BS0D 4LSPH 1K8IA 4XPFL 2I25N 1JPTL 4YAQB 3W5MA 4JFED 4DGVH 1FL6A 3U2SB 2XKSA 1JRHL 1YJDH 4ORZC 2PO6D 3X13B 2P44B 3QULA 3WJJA 1RD6A 2A73A 4R2GC 3L7FB 1FIGL 4HS8L 3T1WA 2VDMH 5I1LB 1KNOA 4LSQH 4L9LA 3G6DH 4U3CA 4GJTB 1F45A 1EUUA 5L2KB 4U2YA 3BMWA 4HJ0D 2KQNA 3MQIA 5C0ND 4UILH 4XH2B 4HIEA 1P6AB 5F9JA 1S9WB 4M1DL 4R96A 2NY3B 1WWWX 2CKNA 3QDGA 4JRYD 3KWWA 3PDGA 3B2UD 3VI4F 5IQ9A 3DROA 1V5JA 4OJFH 2R69H 1JWUA 1F11B 1A2YA 1S7SB 3T0BA 2X44D 4Z7QF 4AEHL 4NFCA 3VRIB 5DQJA 5L8JB 1AO7B 4Q9BA 4PRHB 1JZ5A 3W81A 5I1AA 4TN9A 3CH1A 2Q6WB 4I48A 3QQ4A 3LDBC 5TFSH 4K3DH 2QADC 1SM3L 3QJFA 4HDIB 2WIIA 3U46B 1XR9B 3UEZA 1S3KL 3UJIH 2FJGB 5DDHA 4J8RA 4OZHB 3DURB 2BSTA 3M07A 5CWSA 3GDBA 4X6DA 25C8L 1CICA 3T3ME 2PR4L 4OV5B 5SWSE 3BGMB 3UJJL 1MWAA 1TZIB 3RBSA 4F2MA 1K2DB 5JW5A 3SO5A 4D0BA 1MVUB 1RHFA 5DWUL 5CEYA 5FEBA 5IEHB 2IQAB 1CT8B 4X5LA 3EDJA 2FO1A 3ABZA 4L3CB 2A6IA 3WIFA 2NYYC 4L8DB 4RMRA 4BQBA 1D5IH 2J8UF 2CIKB 3NZ8B 2RAMA 3LKPA 4TVPH 2HLAB 1C12B 3IFOA 3VXRE 1AI1L 1IL1B 4LCYB 4OIIL 1PYWA 1KEML 1S7VB 4LLDB 4G6FD 1KFAH 1H0DA 3TA3A 2MQCA 3DMMB 2ENYA 4ZUSB 3T09A 1LK3L 1I3VA 4PYGA 3KG5A 1EHNA 4P5TA 1FPTH 4TYUA 5C08E 5GJSH 4BFIB 1A1OA 3LD8B 4FQ1L 3RWIA 2CKBB 4TVSa 5IK3B 1RZ7L 3MRMA 4X0KA 4HPYH 2P5WB 4NQVB 1S7TA 4Y5YC 4PJ8A 3D85A 5E2WH 2Z4QA 1Q94A 4K2UH 1E4XL 5I66A 4JJHA 3S96A 1ZHNB 3VG0H 5I8CB 1J0JA 5ADOL 1ACZA 3F7VB 3ZDYF 4MX7A 2GFBB 1KN4H 1JPGB 4XZUA 3CFKB 4TUJB 2EO9A 1FRGH 5D1XD 4WFGD 3MV11 4LIQH 2AW2A 1HDMA 3DWTA 4XAKD 3SGKA 2XZAH 1MCWM 3CLEH 2ATKB 2FR4A 4JY6B 1U8NA 2H6PA 4Y1AA 5JIPA 2WBWB 4PGBA 3PWNB 4ZUUB 4HC1L 4XVUC 3UBXA 1YEDA 1AIFA 1T7ZA 3HS0A 3W39B 3DX8A 1ZLUK 4KJQD 1IM9B 4LBEA 1R5VB 4B53A 2G5RA 1UYWL 4OD3L 3BOVA 3T0WA 3QUMH 1K8DB 5HTSA 2EYTB 5EPMB 2X4OA 4JAMB 5K59E 2JB6B 4D0CB 5FYLH 3WKML 4JM4H 2ARWA 1HHHA 2DQUH 1FDLL 3BESR 4Q9CA 1JHKL 5IW6B 4OM0H 1P53A 4N0CD 3DO7B 5IFHH 1PG7W 3L5XL 1FFPA 4GQPH 1MCNA 2CRZA 3ILQD 4H1LG 2GUOB 3Q6FA 3RVVD 4PRDA 5BMFH 1RSFA 1U93A 2P47B 5ACZA 2NY0B 3DMMC 4WWKB 1KTLA 3MGOA 3BZFB 4RGOL 4UTBL 5A40E 3DETD 3C5ZB 3CK0H 4HGWB 5DS8B 1C5BH 5ITFA 2WWMD 5BRZE 4TULL 4WI6A 4FTVD 3D2UA 4UUJA 3FO0L 4QOKB 1F3DH 4HLZH 4OCSL 3MLXL 4Y4FB 2YOCA 4BELD 2VDPH 1EO8L 3KPRA 4NJAH 2J1KA 1T1ZA 1BGXL 2MKLC 3VW3H 3DV4A 2BSSA 2ZCLH 5DJ8A 1ZLWH 3V6OE 5E0QA 1U3HD 3RUGB 5AG9A 1AXTL 4WCYL 5FAAA 1ZLWK 2Q8BH 4YZFE 3PQYE 5E2UH 1CZ8H 1EVTC 3GHEL 5DJDA 4QWWC 4PLJD 2XZCL 4KV5E 4OZ4B 1LMKA 1C1EH 4UIKL 3O2VH 4PP1C 4KRPB 4OZHF 2VLKD 4YHMH 1OCWL 5F1NA 4CJ1A 4N8CL 2GJ6D 1FL5A 1A9BA 2MQ3A 3V0VA 4DQOL 1OGAB 5FUCE 2XY2A 1QSEE 1UM5L 4NQDD 1ZGLB 5GS2D 1YMME 2WINA 4ONHA 4U33A 2AI0H 4C57C 5MENE 1WZ1H 3KLHC 3MV9A 4TSBL 4Z7WE 4G42B 1HH9B 3EGSA 3FCTA 4P4RA 5H94A 1IAIH 3IS0X 2V9QA 5CEZD 4YPGA 2JJUA 4XX1G 1JNJA 3HNTH 4OF5A 3P4OB 2X9WA 4JDZA 1HHJA 1DBJH 1TZHB 4M6NL 4M62H 3V0WL 5MHSE 1CXIA 1KEGL 1J0YA 5I1CL 4GG6A 2FBJH 4GKNB 1CFSB 4ZUVB 4Y4KB 1OW0C 2NY0C 1U8JA 1LE9B 3G5ZB 4WWKC 2YSSB 1WTGT 5EOCH 4NZTH 1NC4D 3H9SD 1I75A 1ZHKA 4DEPB 3LKOB 3D0LB 5C0BA 4BZ1L 1WIPA 1YPZB 3KAAA 4XGZA 4Y4FC 3MRRB 1UM4L 4U1HB 4GXVL 1D9KB 5A1AA 2EYRB 2FHBA 3WN5C 5L7XL 5T1DL 2E7LC 5T3ZH 1YC7A 1G84A 4C55A 4ZUWA 1NC2B 3MJ7A 1N2RB 1KB5B 1A7QH 4C59B 3H6JA 3OMZA 4NBZB 4PJ9C 4HUUA 1J8HA 3P4NB 5CJQL 4NRYA 3ZLQC 3T0VA 3JWOL 1TENA 3PWVB 4OLYL 1JNLL 1Q9OA 4QRUB 4HF5L 1UQSB 1LEIA 2HWZL 2A1WH 1KELL 4KRPC 1XH3B 4U31A 3CU7A 2OTWA 4X7DC 4ZXBA 3SQOH 3X12B 1OSZB 1B0GB 1BREA 1YEFH 4NQXA 3GSXB 3LHPH 3BE1H 4PGDB 4ODUA 1U58A 5EZLB 4V1DA 4P4KA 3UPRA 2F53B 1T2JA 3DYOA 4YHOH 3X3GH 3C6LD 1T0NA 1SBSH 4X9GA 2IEPA 3Q1SL 1EO7A 4U6XA 5CJBA 1OPGH 2IQ9H 1KSRA 1Q9KB 1OLLA 3QPXL 1IC7H 3CX5J 4JY5L 5IESH 1MLBA 1CF8H 4NO0A 5F9WB 5FV2A 5I1HH 1OP9A 5FYJD 3S35X 3T8XA 2BNRD 4G6JH 2VIRB 4D9QE 2NPLX 4HUMB 3O4LD 3MNVA 4FP8H 3SDDA 1U8QA 5CCKH 1WICA 1MWAH 1RFDH 1IGFH 5DI8B 4KK6C 1KXVC 1S8DA 1FVDA 4KGJA 4CADB 4KZDL 3BEVA 5KSUA 4V2BA 2DTMH 4Y4KC 3QDJA 4M8QB 5EIIB 2NCMA 1J1OL 1E27A 3VH8G 3L3DA 1VESA 5EOQL 1L4IA 3KNBA 1KOAA 2YD4A 3STZB 4QRTA 1RUKL 5DD3L 3ZTJH 3MMEA 1T1YA 1KIRB 4DEPC 2NY7L 4NNPH 5HHOB 4PJBB 4FXKB 1IAOB 4XRCA 4S1SH 2BVOB 3MOAH 1D9KC 35C8H 4QHLA 1T6WA 4MAUL 4CMMA 1A0QH 3MV8B 4Z77A 3ETBF 5C07D 4KRLB 2YUVA 4NO2B 4O5LH 3UDWC 1NFKA 3QPQD 4X5WA 2OQJB 5FB8A 1AD9A 1GGCL 3MV7E 3MLZH 3SCMA 1QKZL 2VXTL 1FN4B 1YNKL 2GK0A 4NM4H 5CSGA 1I85A 4HT1L 5IMMA 5KSAD 2VQUA 5LXGH 3U79A 4JZJB 4Q2ZB 3LSOA 4LVHB 4WFFD 5DK3A 3OAYH 2BOCB 5AEAA 4YXLL 5IEKB 2PTTB 4NKQB 3OAYK 1G9MC 5ISZA 1IQDB 4OQTL 3BISA 3LKSA 4X6BB 5SV3A 4RRPG 2EKSA 4HIHB 2ICWI 1RUAH 2XQYK 5F21B 1DUZA 2DKUA 4PB9H 1MFDL 3MJ9A 1GC1C 5L9DH 4EIZC 3RKPA 3V4UH 1FGNL 1XF5B 4KKAD 4H1LB 5D7JA 1FO0L 5BZDA 1BJ1H 4OT1L 2XN9A 2VLJA 2VNCA 3CSBA 4P2CG 3NN8B 4PJIB 4BM7A 4Z7NE 4X6CB 2LU7A 3AXLA 1AC6A 5FKPA 1JGLL 4MNHA 4WHYH 4QEGA 2BNQE 2O26U 5IB3A 3VJ6B 4A6YH 4Y2DB 2GSGA 4Y0GA 3BKCH 4LCCB 2IPTH 3BP4A 5C0DB 4OFYA 1ADQA 3QCVL 2KBGA 2H41A 3GSRA 4LPYA 3TYGL 4L5FH 3L5WB 3T1FB 5DO2D 4NRZA 4WDIA 5AZEL 2GHWB 1MUJB 2OTPA 3VFRB 3VXQB 3N85H 2X4TA 3I6LD 3TO2A 1FFQA 1FLRL 4WENB 3KGRA 3TBVB 4XNZC 1DCLA 5AZ2L 3EO0B 2MFNA 1CFNA 3WUWG 4AIOA 1FFOB 5T1LD 4EBQH 5HD8D 1AY1L 4U1NA 4I3GA 1QSFD 2AEIT 2XFXB 1CR9L 3GSOA 4KZEH 1QBLL 1A7RL 2V2WA 4WI5A 3A67H 4YR6A 3BKJL 4OCXH 3T65A 1K3ZA 1CLOH 1HILB 5L6YL 4LKXB 3GBLA 5DJXB 3QEGL 1I1RA 4WFGE 4XBPA 1MLCB 3LB6C 4IIQA 2A9NL 1M7DA 2OSLA 2AQ3A 1DFBL 2G9HB 4PV8B 1YDPA 5E00A 3MRDB 4JZJC 2YZ8A 1BZ7A 1RK1B 4AT6A 4NWUH 4YLQT 3OKLA 4LVHC 1S9XA 1SEBB 4U1MA 4RMWA 4ZFZA 3HB3D 4RNRB 1OARL 1AKJD 3EOTL 3QWOA 4RMSA 3LN5A 4O02L 1QACA 4L1HA 1ZLVH 2DI9A 4MQTB 3B3IB 4LSSH 4YX2L 2E9IA 3WSQH 3RGVA 1S9VA 1MJ8H 4JDVB 3MNZB 3GI8L 5HDQH 1N5YL 2FHFA 1TVHB 2O5XH 1DQLL 2AGJL 4D8PB 4UZGA 4RBPH 4E41A 4G8EA 4AENB 3S37H 1S7UA 2W91A 3PDOB 2HTLC 4WY7L 1MF2L 3EYUL 2Q3AA 3FQXA 2CO7B 4K9EH 3LS4H 3R06A 5J06A 3I9GH 4W4OA 3ZSTA 4JR9H 5IHZA 5A16B 2O5ZL 4PR5B 4Y2DC 3BUYB 3BYYA 5KS9B 4LCCC 1CD1B 1RU9L 1N3NA 3QXVA 3VMNA 2B20A 3N1FC 2UYLA 5I15H 1UWGL 4GUPA 4JN1L 2IG2H 3BN9C 1L7TL 4LFHD 5IVXE 3L3HB 3W0WE 4FTVE 3FB5B 5DF0A 5F9OL 1QRND 2JJWA 3KJ4B 4PYHA 4FOMA 3U9UB 1WUNT 1C5DA 3GJFA 5E8NA 5DUPH 1PAMA 2YPKA 3I6GB 1IILE 5HI4D 1X7QB 4X6FB 5IMOB 3D6GA 4HIIA 5FIEA 1OD7A 5TQ0H 1GGTA 4E42B 1E6OL 5E8PB 3RDTB 4F7PB 4PRIE 5B3NA 5ID1B 3AC0A 4Z76B 5F96L 2CK0L 2BHYA 4GW1B 2H45A 2X05A 2XICA 5E5MA 4J6RL 1KIQB 2W9LA 4ZYKB 2DBLH 1A7NL 4UOW1 1ND0A 5I1KL 1ZA3A 5F7NC 4N5EC 4JHBA 2OJZH 5DHYB 2C1PB 2ZSVB 4P3WA 4Q0XH 1XGYL 3ZKNC 5DJ2B 1GOGA 5B4MD 2GJ6E 4KHXL 4RCAA 1WAAA 4LHJB 1Y6NR 4PJ7A 2NW2B 4P48A 4MQXC 3IU3B 3WNOA 3AS1A 1LVEA 1MH5A 5EUOA 1NAML 3ARBB 2GT9B 3ARFD 2PUQT 1Q9WB 4X4YB 2VUYA 3EYVA 4Q9QH 2DQGL 4MNQE 5B21A 1MREL 1XCTA 3P77B 1J86A 2D03H 2Y07H 3NOIA 1ZHLB 1I9IH 1M05B 3T0AA 3NGBB 1D3CA 1TXKA 2R4SH 3I02A 4MDJA 4PJIF 3VH8B 2A2QT 1WF5A 1JNHA 4H26B 1K6QL 3P30L 4DZ8B 1BZ9B 1L9NA 1VGEH 1NGYA 3IXAB 2A6KB 4IRSD 5GSRB 1JPSL 3TNNB 4H8WL 5I8OL 2I9LA 4PLOB 3C8KA 1JZ8A 3KJ6L 1WWCA 5F71A 1INDH 1JGVL 1CXLA 1IGCH 1I1YB 2DYPA 2AXFB 3D87B 3QT2A 3UYRH 4WI4A 3U48A 1LHZA 3KPOB 2D31B 1PQZB 1EAJA 2W9EL 4ZSOB 4WI9A 2FRGP 5ILTL 4L3ED 3KJ4C 1AD0A 4F8QA 3O2DL 1QYGL 1FAIH 1QTYT 3DPBA 4Z9KB 4L29A 3HI5H 3ECBB 4LGPB 3RVTD 3F8UB 1KACB 4P5MA 4WFHE 1QEWA 1CK0H 3RDTC 1BFVH 1G9NH 3VFVB 4MB4A 4GW4A 3CJJA 1BD2B 2NZIA 1WGOA 4KPHH 4G6KH 1MCSA 3QNYB 3SQBA 1L7IH 2W9DL 5C09B 2AJSL 4YHKH 4YDVA 2AJYL 5C7XH 2FX8H 4PJCA 5HHQB 5GS0L 2AV1B 4ZODA 3TEUA 2HKHH 2I60H 5K9KB 3ZE0F 3BHBB 4HMEA 3HNSL 1W8OA 3T0XA 3ARQA 5E7BA 4QYOB 5HHPA 5GRJH 5JR1L 1MCOH 1GGBH 2VLJD 3MRCB 3HMXL 1YEJL 3ARBC 2YPLD 1N59A 4HK0A 3PHQA 4MA8L 4DOHE 2BOBB 4I77L 2UZIL 4WV1C 3QSKB 4KJYA 1W0YT 1F58H 4NM8H 1U8MB 3K4DA 4KQ3L 3U7YH 1ZOXA 3DVGB 1OTUC 3QRGL 2ESVA 5L88L 3QJHB 4AL8L 1G7JB 2BNRE 3NGBC 1BWWA 2HVKA 1R5WA 1I8MA 5TH2B 3HZMA 2BFVL 4BQ6A 5D2NB 5CZKA 1PX4A 5MP6L 1NCDL 2GW5A 3SDYH 1JP5A 4NO3A 5ITBH 1M71A 5J3HC 2Z8SA 2VXSH 2A9MH 5KS9F 1A14L 2ZG2A 4UDUA 3QO1B 1FCCA 1FGVL 4O51B 3QEHB 1JZ6A 1A7OH 2H9GB 2PYFA 5T3XE 1EPFA 1KPVB 4NPYA 3ZDZE 1AHWB 3WUWB 1NGXA 5C0AA 2Z31B 1FNGA 1ORQA 2D7TH 4LPCA 3SJVA 2VKXA 1WEJH 5D7LD 2F8VA 3LKRB 4Q58C 4H5SB 4JVPA 4F57H 5IV2B 1AR1D 3VXMA 1NCCL 3FB7A 2X10A 3GKWH 2NXYC 4LSTH 3HMWL 4HKBB 5E9DD 4MNGB 4ELME 4PG9B 5C07E 5I75B 3ROOA 2VLRE 2G60L 1ADQH 3FFCA 4HV8A 1L0QA 3VWKB 4XMLL 2IANE 4ONGH 3VRJB 3MXVH 3D3VB 4PJFB 1H3WM 2XT1B 3MACH 1A02N 2CLRA 1FZJB 3F62A 4IEFB 4WHTA 4OIBA 4WFFE 1SM3H 1R3KB 4XVJH 1C16A 1G7MA 3OZ9H 4XP4L 1QFWH 3O2WL 3MRFA 3F7PC 1QO3B 1CGUA 3DUSA 1CI5A 3RKDC 4JCMA 4KK5C 3HZVB 3NIDF 4LSVH 5D2LA 3BWAA 4EN3C 3PE9A 1F2XK 1MHHA 2XNAA 3B9VA 5EO0A 5H35A 1QLFA 4MS8D 1QVOA 1NGQH 3IKCB 3HAEA 4GKOA 2EEBA 3O11B 5A2IH 2QQLL 3UTSE 3A6CH 3ARGA 2E6QA 3IFNL 4IJ3B 3WJLC 5CP3A 1VPOH 5HYQA 5EUKA 1UB5B 2AJXH 2VDNH 2FGWL 5GGTL 1B4JL 2VXUL 3OAUL 1MQ8A 1OAKH 3SOBH 3LVEA 1I1AD 4WJ5A 1P9MC 4Y16C 2EH8L 4OGYH 2X1OA 4BUHA 2HFFA 5JOFA 2D0GA 2FL5B 3VGBA 4M7KL 4ZD3L 3I75B 5DUBB 4BK5A 5IOPA 1TLKA 3HLAA 1JTOA 1A3RL 1BLNA 3PWPE 2WBJB 2DQFB 4H0GA 1DBML 2RCSH 1NEZG 1U2HA 5GISH 5FGRA 2DQJH 2VTFA 2Y36L 1XT5A 1H3PH 2Z31C 1NFDE 4LLYB 3I6LE 3RIAF 3OR6A 2M8XA 1ZLSH 4U7SA 3O3DB 4Y19E 1FZKA 5C6WH 4JFXB 4PJ5B 3FQUA 1QLRB 3H9ZA 1XGQB 5F89A 4XNXH 3G5YA 2G2RB 4IMKC 2G5BA 1JN6A 1NQBA 3N9GL 5DMGD 3ES6A 4R8WH 3BZEA 2FATH 3VWKC 1BF8A 1UACH 4K94C 2NX5B 4KUCF 3ARWA 5A2LH 1LO5B 2XTJB 2YUXA 1BZQK 2HT4C 2Y5TA 4NN7B 4R7NB 3WFZA 5F1KC 1UJ3A 3CIQA 3GBNH 3JXAA 4FFVC 1U8IA 2VH5H 1XZ0B 3U2SA 5HJ3B 3HG1A 3ARZA 4P9ML 4X80H 2IBGA 3X13A 4S1QL 4OCRL 4LVNB 3GJFK 1XCQB 5I1LA 5LAXA 3TO4D 3HUJF 1CU4H 4JVWA 2DDQH 2DTSA 5L2KA 2ZCKH 2P5EB 4Y89A 4IM8A 3ISWA 1D6EA 1XF2B 4N9GA 5JW3H 4XH2A 4X8JB 3TJHC 4NCC1 3G6AB 4XCCL 3UMTA 2RFXA 2NY6D 3QEUB 5HI3D 1OP5H 1F4HA 4IJ3C 4WW2B 1MI5A 4LPVA 4Y5YA 3P9LB 1S7RA 1MJJB 4OZFG 4PJGA 1RIVH 2F19H 4UB0L 5J13B 1H5BC 2OI9B 5ESQA 1TJHL 3TJEH 4OLXL 3U7WL 5E99H 3F58H 2ED9A 2Q6WA 5LWYH 3KYAA 2M26A 1IC4H 1QBAA 2IH3B 2WBJC 4HDIA 3U46A 1XR9A 2F58L 3BAEH 1R3JA 2AAVA 1D5MB 5I1DB 4MAYD 4NN5B 3DURA 3GMLB 5E5UB 4YHNA 5KANG 4U05A 3JVGC 5DYOA 1OAUH 3RIFK 3FJTA 3VA2C 3BGMA 4FQIH 3TN0B 3H2WA 1K2DA 1K4DA 2MPAL 5GIRA 1MVUA 5EB9A 4AIZB 1FO0B 1KTDB 2IQAA 1CT8A 5BV7H 2QR0B 1GHFH 4GXUN 3IT8D 5LCVH 4PJFF 2VITB 2YA1A 2XTJC 1BM3L 3WO4C 4OZIE 1F42A 1YEGL 3ZL4H 4NN7C 2CRMA 5ENWB 3O9WB 8CGTA 5GS1B 3LH2L 3MODL 4LK4A 3ULUE 4M61A 2HLAA 1C12A 5JZ7C 3VMPA 3QUXD 4PGEA 4XTRC 4O2CA 4FABH 3DGGA 1ZHBB 4D9LH 1IL1A 2CUIA 2ICWA 5SWSB 4UT9H 5AUMA 1FZOB 1I7UB 1A5FH 3HE7A 4LLDA 5DURD 3QFDA 1F4XH 5FUOH 3MA7B 3DMMA 3CZFB 1WQVT 4QRPE 4PP2B 4HZLB 3IKKA 5LGKA 3HC4H 5EO1B 4XT1C 1IZJA 3WDHA 2ITDB 2WAHA 4OGXL 5IWLC 1QSZA 3SY0B 2OJEA 3K74B 3ZHLA 2B0SH 4FQ2L 3VMOA 4HULB 2CKBA 2VDOL 1IM3A 5IK3A 4CVUA 3LQAH 4WW2C 2PW2A 1TTGA 1YNLL 2P5WA 4P3CH 4HK3J 1Z9MA 5AYQA 4PGZA 2ZOLA 1JGEB 2HH0L 4R97B 3SKJL 1FYTE 1ZHNA 2VRAA 5I8CA 4WEMB 2OI9C 3LZFL 2GAZB 3KPMB 2R2HA 2DM3A 3IDGB 4PBWD 1LO0L 3RY6A 1F8TL 1T2XA 3OKNB 4YXKL 5F3BA 4XP9L 1KCVL 5HPOA 5C08B 3TBWA 2Y72A 4OQ1A 4GRLD 5T5NG 3WLBA 4N1CA 4ZNEE 5KVDH 2R0WL 4NN5C 5AWNH 5DC9B 3W9DB 3F6IA 1A3LL 2QKIB 3VWJA 1TCRA 5CEXB 4QCIB 1LO3L 2R1WB 5DD0H 2FB4L 5GGVL 2P48B 4MD4A 4ZUUA 4DAGH 1YEEH 3Q48A 1MFCL 3DI3B 5GGVY 4F9LA 3TN0C 1MHCB 3W39A 1DJSA 3L3GA 2C3GA 2QQKL 3QFJD 4Z8FH 1KN2L 5HYJA 1ZANL 1CL7L 1U3ZA 4LLVB 1BBDH 4F33B 1JTPA 1K8DA 1IBGH 2AJVL 2JB6A 4D0CA 3O9WC 3D39D 4PLKC 5GS1C 1YN7B 3SE3C 4MVBC 2R1XA 2XWJA 4XPGH 4QY8A 5IW6A 4JFPA 3BYTA 1B88A 1UWXH 4QF1B 4W6YB 4JFYA 1MCJA 2VISB 4LCWE 1UWXK 4ZS7L 4MMZC 5E4EB 1HHIB 4L4TA 4WWKA 5J6GA 3BZFA 5BQ7B 1KLGB 3OKKA 3IFLH 1PD6A 2VLLB 3LY6A 5D6CA 3SKNA 4HGWA 3RZCC 5C9JA 2VAJA 4JO4H 3INUH 1ETZA 4WW2F 4XMKH 4R0LB 1IFHH 3RX7A 4NQTA 5SX4I 4EIGB 1MHEB 2EE9A 2QADD 2GJJA 2HFEB 3WDJA 2WBKA 3QDHA 3QDMB 3WN5A 3S36L 4MJ2A 4R97C 1N6QL 1HSAA 1ZEAL 1NEZB 4DZBA 1A6PA 4NNYA 3RUGA 1EJOH 3B5GA 3WKNA 4PJ9A 2VAAA 3NH7L 4HZAA 3V6FB 5IP4A 1MCIA 2W0FB 5HYSA 3R0MA 5D7SH 5DJ6A 2B1HL 4HJGA 3C8HA 4EOWH 2QSCH 3A6BH 3JV5A 5MERB 3HAEH 5BRZB 4OZ4A 1DQJA 2VDRH 4PRNB 5FHAH 1KJ2L 5CP3H 5D7LE 4P23A 1BQUA 4R90L 2EEAA 1MIMH 4NQCD 5ACLA 4I0PA 1Q0YL 1RJLB 4ZFOB 4WTZA 2YEZB 1S7QB 2NYYD 1PG7L 4HW6A 5J6HA 2VYRE 3HZKA 1LGVA 1M6OB 2IFFH 2IGFL 1M4KA 3H7BB 1KB9K 1DL7H 3BGFC 4ODTL 5D1QB 3LEXB 4JEGB 3RTQA 1OTSC 4JG1L 3HC0B 5T1MB 3AGVA 4YJZL 3PQYB 1QPPA 4LMQI 1I9RL 4G42A 3MLPA 1YA5A 5IR1B 1NSNL 2A77H 2K3TA 5TJWK 4L4VD 5EOTB 2V7NB 3PP4L 1YNTA 5T3XL 1CGYA 2B2XH 2FSEB 4CNIA 5I1EL 3I50H 3P4OA 3TIDB 4OB5H 3TVMA 1P5UA 4JKKA 4YHPA 3T3MF 4U6VL 2EDFA 1F13A 5DRZB 2HLFD 4G80B 1CN4A 3F6LA 2NY3D 1QSEB 4WVRA 5E4EC 4YDKH 1RUML 3PL6B 1RIHL 4Y4KA 1YMMB 5C0GA 4C4KO 1LE9A 1JK8A 3G5ZA 3DX7A 5JHDE 5MENB 3PGFH 2YSSA 4QXGL 4Z7WB 4X7FC 3ALWA 4QTHA 1EMTH 1I1CA 5I9QB 4B7LA 1TPXB 3P73B 3UTTA 2BXYA 4OZFB 2F5BH 1AO7D 4RFOH 4PRHD 3CC5A 3D0LA 1WWBX 1E6JH 1ZMYA 5K9QI 5DK2A 5H37G 3MOBL 5BVPL 1CDUA 2BSRB 1YPZA 4R0LC 3QUYA 1Z3GH 3MRRA 3O41A 4U1HA 1F5WA 4LKCA 2EYRA 5E6ID 1J5OH 2FEEI 1AFVL 4UT6H 3T2NL 3LS5H 4YHZL 3IVKA 5D1ZD 4Z7UA 3EOBB 4FXGA 4JPKL 5DQDL 1UKSA 4XVUD 5CD5D 3WDIA 4KTEL 4QRUA 5DHVA 1UQSA 5E24E 1HINH 2R2BB 1FBIH 2HP4A 5T3ZD 3VD3A 4WO4B 4Y5VB 3DYPA 3QDAA 2IMMA 1NCBH 3MBXH 3PNWA 1ACYH 3IDNA 3V6OC 2X4RB 5FCUL 3S88H 4GMTH 5EZLA 2DQIL 4HJJH 5FM5M 3TZVD 1RIUH 5EO9B 1BJMA 5D1QC 5KAQF 3KXFE 3NVQA 4JJ5B 3GEWB 5EU6A 1CLCA 4S0SD 3WS3A 3C60B 1N6UA 2CJUL 5D7IE 3M8OL 1PEZA 3GIVA 3B4NA 3EHBC 2ZUWA 3S4SA 5A2JH 1Y18B 1N4XH 4Z0BL 2VIRA 3V6ZA 4I3RH 1P2CB 4H8WC 1BX2B 3O6FA 2CO6B 2NY4D 4R9HA 4JKPH 4HIXH 3EDKA 5FUCC 2AS5M 1ZSDA 3CFCH 2PXYB 4XBEH 3V7MA 4OUUA 4CADA 5BO1H 1EERB 5BVJB 4ZPVA 1Z0MA 5EIVA 4AEEA 3PL6C 5JOPD 5DUMH 5EIIA 3O0RH 4IDJL 7CGTA 4HUNB 4BKLA 5DC0A 3STZA 3DXAD 5I9QC 3B9AA 4ODVL 1TPXC 4XAWH 1XF3A 4K8RH 5GJTL 4M4RA 4ZUTA 1NBQA 2AK1L 3PHOB 4PJBA 5K59F 4FXKA 5DJZA 1IAOA 3JWDH 2A6DB 2BVOA 5E2VH 3TBYB 1W72L 4LDEB 5FFLA 2PO6B 2ADIB 4QWWD 4MLSA 1ZT7B 3ARPA 2P8LB 3MXWH 4ODHH 4RMQA 3ULSB 4YHLH 3MRNA 4P2QA 3KPLA 4PP1D 3PXJA 1NLDL 4DVBB 3GMOA 4UTAL 2FEEL 5B22A 1U3JA 3VCLA 4NQUA 5GS0C 4TNWF 3BW9B 4XNQB 5GHWL 2R4RH 2FIKB 2X4SA 2R2CA 1NDMB 5CMAB 3TWCL 3CMOL 2CKBH 2K7QA 3BKMH 5C86A 3VRLE 4KY1L 2VWEC 2VZTA 1IM9D 4JZJA 1X5YA 5EN2A 1JJUA 4Y5XB 1T89C 1YECL 2V17H 4WO4C 4Y5VC 4NCC2 4NYLB 3O3UN 1A6VH 1R3IH 1KIPA 5KVFH 1IEBA 4U0RB 3BDYL 1KCRL 4J3OC 1DQDL 2QJDA 3HZYB 2O93L 4HIHA 3PF2A 1DUYB 3VFTA 4HXAL 2R9HD 3DVNB 2F8XC 4YZFF 1Y6KR 5IQ7L 1XIWB 1BQLH 5SWZE 4K07A 4BQ8A 4KV5F 1XF5A 2Z91A 3TT3H 3UJTL 4W81A 2ICEB 3NN8A 1G1CA 1HNFA 4XPAH 2CDFB 4K7FB 4X6EB 4LL9A 3C5ZD 4X6CA 2OL3L 2RIKA 5DMIH 2PXYC 4QOKD 1G7PB 5AAMA 1HSBA 3L7EA 4Y4FD 2P7TB 5C0DA 3V4VH 1QP1A 5IKCA 3MLSL 4Z7WF 4YE4H 3VXOB 4TTDD 5IB2A 4TVPE 3T1FA 2DWDB 1CFTB 1INQB 1TZGH 2MHAB 2YMXH 2CXKA 1MUJA 4PD4J 3VFRA 5HGBA 1NBYB 3GSNL 3WHE1 2BVPB 3ZT6A 4HUWB 1CDIA 4OLVH 2PO6C 3TBSB 1UADC 5FYKD 5C0FB 1PY9A 3N1MC 1TNMA 3OB8A 4OCMC 1FFOA 1T66C 3ULUL 3EOAB 2EE2A 2UUDH 1P4IL 5E8DL 4AEFA 2MCPL 4EUPG 1KPUB 1NJ9B 1KJVB 2F54D 4LKXA 4JFZH 2KUTA 2APXA 5DJXA 5C0NC 3G9AB 3P11H 1OGAD 3LN4A 5TPWL 4G9DB 4M1GL 3F5WB 4PV8A 2VR9A 4L8BB 2Q7NA 4JZNB 1X4XA 3MRDA 1T7VA 4HBCH 3B2UC 5CJOL 4Y5XC 4ZOCA 1SEBA 2B5IB 4WUUA 1AGEB 4PGCB 5ERWB 1J1XH 4M00A 1DQMH 4ZO9A 4U0RC 4CVXA 2GITB 2ED7A 5F7MC 2ZUUA 3QHZL 2BNUB 3B3IA 3TBTA 4HWNA 4LIQE 2MCG1 4XHJD 1X5KA 5D1XB 3IU4H 1FIEA 1ED3A 1IGJB 3UPCA 4GAJH 4QHMA 1TVHA 3R4DA 3UTOA 3D18B 2JLLA 3RWDB 3NTCL 5HSFA 1V3LA 5GGUB 1A1MB 1P84J 2NQCA 1Q72L 2DLFL 2Z93B 1BEYL 5T33H 2NY5C 5ESAA 1HWHB 3C5JB 4X4XB 2OXGA 3BO8B 5DGQA 4R7DB 5J1AB 4J3XA 5AG8A 1H8OA 4ZDHB 3K2UH 5JW4R 2BVQB 4FQJH 1D9KD 5FKAA 2BCKB 1IEHA 3DECA 5FYLE 2NLJA 2ORBH 3TM6A 1MOEA 3L3HA 1NC2D 3OB0H 1F4AA 1UKTA 3RL2B 1NFIA 3MLVL 1BVZA 2FH6A 3QR2A 1TJGL 2DLHA 4I0KA 3BH8A 5KOVC 3OB0K 1UM6L 3V52L 3F7RA 1XGTB 1X7QA 2GCYB 4X6FA 4HCRA 4M5YH 4G6AD 2O5YH 5IJVB 4AJ0A 2ENSA 4E42A 4JHAH 4F7EB 3RDTA 4WHDA 4JFFD 4J3UA 4LARL 3RHWF 4Z76A 4ZO8A 1KJ3L 1GAFL 4GW1A 4OF8A 1H9VA 4JPVL 4MSWB 5EBLB 4LEOB 3TV3L 4AQOA 3QH3A 1KIQA 3CVHL 4NKIL 3IDUA 3W0WB 4FTVB 2F53D 3QZWG 2VR5A 5ALCH 4AG4H 5DHYA 3V7AE 2B5IC 3MGTA 3G04A 3U4BL 1DSFL 1QR1B 3C9NB 1U3HB 4LRIC 3IU3A 3VFGH 4PRIB 5B8CB 2WV3A 1DE4A 4PGJA 4HS3B 1M7IA 1Q9WA 1BVKB 5D1XC 3T4AA 1LP9E 4WV1A 4WUKH 4UIMB 4G8FA 3SDXA 5DHVH 5GRUH 1HI6A 2HMIC 3H7LA 1MFEH 3I3DA 1FFRA 3P77A 4HKXA 4Q9RL 3WUZA 2E7CA 4WI2A 1M05A 2PCPA 3VH8A 2GJ6B 5ALBH 2X4UB 4H26A 4M7JH 1A3QA 4DZ8A 1BZ9A 2BJML 5HHOD 5B38G 3IXAA 1L0YA 2A6KA 4LCIL 2X4PB 4NQDB 3TNNA 4HXBL 2YN3A 4KJQC 3VFNA 1F4WH 1ERNA 3QUKB 3KS0H 5FDWB 4G7YL 3K4AA 5HHVL 4DN3L 2AXFA 2BVYA 1YUHB 4A2LA 3MV8D 2HN7B 3KPOA 3QEQE 1PQZA 4ZSOA 4L8SB 4HC1A 3QP3A 3WFEH 4N0CC 4YWGH 1J1PH 3MJ6A 2AK4E 3QXAB 4X4MA 3ILQC 1JFQH 3CVIH 3ECBA 43CAA 4Z5RA 5DFVD 3IGAB 2J6EL 4JFOA 5TF1L 3F7YA 3U0PA 3HR5B 4WFEE 3CSYA 2C26A 1JGDB 4I5BB 1U8PB 4OI7A 5C09A 3H9SB 3DOSA 2WWMC 4K3JH 4IHOB 2CIIB 2OZ4A 4MYWB 1KYOJ 2AV1A 1OAXL 1HH6B 5K9KA 5T3ZE 4PRAB 5IFAH 1R24A 3L1OL 1E4WL 3MRJA 5KSBA 5J57B 1YY8B 2JJSC 1HEZA 3EJJX 2HVJA 4PY8I 3HFML 5DR5L 5F1SA 1MFBL 1CXFA 1T0MB 3LRSA 1RK0A 1U3HC 1FNFA 3DIFB 5B8CC 3MRCA 3S5LA 4QHUB 4C56D 1QR4A 3QDGE 3TNMA 4EN3A 4KVCH 4QXUL 1NMAH 4TUKL 5BXFA 4MB5A 4XPBH 3S34L 4KFZC 4Y2DD 1G0DA 4URTB 4PUBL 2PN5A 3WJLA 5CP7B 3ZDXE 3B9DA 3QUZD 5D8JH 5DJ0B 3O6MH 2AEWA 4JZOB 5TH2A 3GMPB 5EU3A 3BN9D 3P9WB 4NHCL 4Y16A 1RI8A 4YBQC 1BIHA 1T20A 1KCSH 3CX5K 3C6LB 1FJ1A 1VADB 3SE9H 4ODXB 4NUGL 3VG9B 5TGBB 2AEPH 4M8VA 4DOHB 3ARED 4I13B 1HQRA 3BEWA 3MYJA 2VSCA 2F15A 3CFBB 1CFVL 4X6DE 4HUKB 3BMVA 3G5XB 4LAQH 2Z31A 4X7SL 1T5XA 2H3NA 2C3XA 2AABH 4L8SC 3IF1B 2BNRB 3LKRA 1T22A 4Y4HB 4EUPB 1RZFL 1P4BH 5KW9H 3FRPG 4M7LL 5E1HB 3QHFH 1OAYH 1NCWL 2PKDA 4HKBA 3P4LA 2PETA 1BQHA 3AMKA 1NMCB 4RFEB 4IMKA 4E5XB 2FD6H 4N5ED 2VXVH 3ZKND 2EZ0D 3QCUL 1SYSA 3QQ3B 3VWKA 4TTGA 3D3VA 2DQHH 1T03L 4YHIA 1LO4H 4PJFA 3MLRH 1Y0LB 4LSPL 1T3FB 3WIIH 5IVXF 3MLYH 1JNNH 3SDCA 3UTZB 5C92A 1FZJA 4DGVL 3MFFA 3N0PB 2DLEA 1QLEH 4U1KA 2Y6SC 3MUJA 5JO5B 2DWEA 3RWHB 1R3KA 5L2JA 1YJDL 5EZIH 4YBLB 5GRWA 2VKWA 1X6NA 4DGYH 3L3KB 1JF1A 2VDML 3DJ9A 4ELMB 2UWEE 1QO3A 2F5AH 3WIHA 4LSQL 3VDAA 5C07B 3G6DL 3HE6B 2VLRB 4D3CH 3H42H 5CKAA 2IANB 4YUEH 3RP1A 4POUB 1DLHB 3MLTB 5L0QB 4PG2C 4UILL 4GKZB 4PJAB 4RISH 3J8F7 3LPWA 3IKCA 3NCYS 3O81A 3BKYH 4LHUG 1RJYB 2AJUH 5HVGB 1U95B 5HDOA 1MRFH 1ZVSB 1T83C 3A6OA 1BOYA 2R69L 4OJFL 4R3SB 3DYMA 5JIKA 4N0YL 3LOWA 4JHWH 1H5BA 3B5TA 4XPTH 4KMLB 1S7XA 1RJZB 3MREB 3C6LC 5EORH 2EDEA 3O6LH 2FL5A 2NMSA 1GZPB 3M1BB 5DRXB 3I75A 3QAZB 5DUBA 3Q0HA 1AGBB 2MQ0A 1C7SA 3P0VH 5TFSL 3UZQA 4HWZB 4K3DL 5M95B 2H26B 3MRLB 2WBJA 2DQFA 2J8HA 2WP3T 3MRIA 5FF6A 1S5IH 4JDTH 2VE6B 1ZS8B 2V5YA 3UJIL 3BN3B 3OXSB 3IETB 5ICZB 4J7RA 4Y4HC 5JOEA 4BH7B 4MA1B 3JV0A 3JVGA 5F8QC 4JFXA 4BQCA 4PJ5A 1U36A 1CQYA 2EIEA 3BPNB 2AV7A 4FQ2H 4J12A 2OBGA 1NMCC 2G2RA 2Q86A 3VGFA 5IMKA 2IJ0C 3WD5H 3BWUC 3QZWB 3U1SH 1EAPB 2XTLA 4ORGA 4YO0B 2EXWC 3SN6N 1VENA 1HK6A 4U1GB 2NX5A 3M17B 1LO5A 3GO1H 3OKOA 4L4JA 4WRLA 1NFDB 2OP4H 1D5IL 12E8H 4OM1H 4U0QB 3ARBD 1XMWA 2DF3A 3BX7C 4FXLA 4TVPL 3SBWC 5HJ3A 5E4IA 4RSVA 1F90H 4YBLC 2EH7H 4HCRH 3BSZH 1HKLH 4GKSB 1HIMH 4JFDD 4KKCD 1QSFB 3P0YH 1KFAL 2QEJA 2H2SD 4GS7C 3HE6C 5E95B 5CFHA 2V5MA 4O2EB 5HHXH 4ZQKA 3I84A 4XCYB 1FPTL 5GJSL 5IWLA 4NSKB 3KPRE 5B38B 5J3HD 5KSAC 5HDBE 2DQDH 4NT6A 1DDHB 1O0VA 4WW2A 1YQVH 1CD0A 4HPYL 5ETUB 1B0RB 1Q1JH 2APVA 4M1CC 3P9LA 1EEUA 1VEMA 4I9WD 2VDQH 4N0FA 4F7MA 1MJJA 3ZYIA 5E2WL 4K2UL 1FG2B 3KYOA 3MGAA 1XR8B 2DMBA 3VG0L 4OFPA 5CAYB 3PP3H 1GJIA 3D9AH 1KN4L 2GIYA 5JMRA 4BSJA 1QQDA 4OBSA 1FRGL 1NPUA 5ECJE 4KKAC 4LVOB 4LIQL 4XP1H 2EDOA 3PHSA 1I3UA 2XZAL 1BD2D 3CLEL 1JI1A 1YEKH 1S7WB 1GIGH 4MA1C 4OQTA 4KUCD 5C0IA 5DC4B 1KLFA 5KVEH 4MQSB 4MZ3A 1EIBA 3MV9E 2FJFA 1RURH 3O45B 3TN0A 4JFFE 3BDXA 1UJTA 4XCFH 1T2QH 2SEBA 1YY9D 4RZCA 2QR0A 4WGWB 4U1GC 2Z92B 3BRGC 3ZDZF 2VITA 5DO2C 4XNUH 3QUML 4QRQA 3VFPB 1MCLA 3O3EB 5KN5B 2HJKA 2OL3B 3EYFB 4FRWA 5FOJA 3RKDD 5FYLL 3O9WA 3VDCA 5E8EB 4GG6E 1HKFA 1CFQA 4JM4L 2AQ2A 2DQUL 3C2AH 4OM0L 3NABH 1CGXA 5IFHL 3ZKMC 2DB8A 3KDMA 4WWID 2IAMA 5HD8C 1WIUA 2MSPA 2EIZB 5LGHH 5TQ2H 2J12B 3O3BA 4ELMF 5LGJB 5BMFL 2WUBH 3MA7A 4X99B 1UCBH 3CZFA 1JYXA 3GKZA 1T1XB 4HX1B 3GSNB 2A38A 1PGRB 3EFDH 1Z6JT 4HZLA 4P2OD 5FOBA 3CK0L 5EO1A 3RZCA 1C5BL 4LQFH 3U0WH 2Y4SA 5I8EB 2OZ4H 1UGNA 4QT5A 2D2OA 1BJ8A 3WNKA 3FO9A 2VQ1A 2VDPL 3ME0A 4NJAL 3HB3C 1JGEA 4OTXH 3KYNA 4J3WA 1J11A 3VW3L 4WI3A 2ZCLL 2C9AA 4J4PD 3OXRA 3ARDB 4IRJA 2GAZA 1UVQB 3KPMA 1JPFA 2XQBH 3IDGA 3VXUD 2JELH 2Q8BL 4QRPB 4PS4H 4ZAKB 2D0FA 2NY1D 1KJMA 1CZ8L 3QXDB 5E2UL 3RPIA 5KTEH 3LRHA 3GMNA 4LVOC 3ZT7A 5D5MA 4N1EA 1C1EL 2ICES 1MIEH 5HGAB 3O2VL 1I1FA 3QNXA 5EZJB 4YHML 4V1DE 3W9DA 2QKIA 3OJDA 3QB7C 2MKWA 3Q6GH 1PEWA 4DGIH 4NHUB 5C0EB 2JCCA 4XB7A 3T2OA 1AGDB 5F97E 4TOYH 1FYTB 2MWCA 2ZUXA 4XXCA 5CILH 3UZVB 2DQTH 1CLYH 1HXMB 1MHCA 2DLIA 4HFWA 1ZT4B 4QHKI 5DJAA 2AI0L 3CFDB 4QXTB 4U1SB 2PYEA 4F7CA 4FMKA 1WZ1L 3P0GB 4LLVA 2FJHB 4F33A 5SX4H 1IAIL 1X5FA 1NFDF 4MJIA 2YKLH 1GOHA 3GB7B 1QRKA 3HNTL 1YN7A 1DBJL 5FGSA 3CAFA 2X70A 4X5XA 4M62L 5EWIH 4LHQB 3QDJE 4KTEH 4G43A 5HI4C 3BVNB 4AM0B 3H9HB 5KG9B 4P9HC 3MZTA 3C6SB 4O9HH 3H3BC 2FBJL 2VISA 4XP5L 1YYMH 2Q20A 2QQNH 2XXMB 5CINH 1IGMH 4LHUB 4C56E 1KLGA 4LAJH 4K94H 5EOCL 1I8IB 4YGVB 1KLUA 2VLLA 4HQQH 3KPSD 4S1DC 3MO1A 4MXVE 4NZTL 3MBEA 2VL5B 2XKNA 3CXHJ 3E8UH 2IBZX 2X7LB 1GL4B 2IFGA 4GAYB 5B4MC 2X4QB 1OY3B 5FHBH 3BD3A 3QDMA 1FFNB 5T3ZL 2YZ1A 1NEZA 2Q1EA 4LCWB 5TDPB 3WIHH 3E0GA 3ARDC 2UY7A 4Z7VA 1ZXQA 1A7QL 3CVHB 3BT2H 4YDJB 3V6FA 4Z95H 2W0FA 3VFSA 5EG6C 4ZAKC 1DANT 2WWKO 4NQED 4EKXA 4RAVB 4MQ7B 1U3YA 1WFTA 4RA3A 4HH9B 1KC5H 5F88A 5MERA 3H8NA 4HWUA 1NUGA 2UVFA 4ONOA 4PRNA 5DMYA 2QSTA 3RA7H 2A1WL 3FFDB 3K1DA 3GJEB 3SQOL 3QWRA 1RJLA 4ZFOA 4M9OA 5E94B 2GJZA 1YEFL 3BXNB 2CRYA 3LHPL 3AFLA 3BE1L 4LLUA 3OG6B 4IRSC 3H7BA 3MLWH 3MRQA 4YHOL 3X3GL 4N8VA 5D1QA 5IB1B 3LEXA 2HJFA 1SBSL 3HC0A 5T1MA 3EO9H 1K9TA 3PQYA 3AAZB 1OPGL 2HG5A 2IQ9L 1RVFH 4FZ8H 5JDJA 1IC7L 5IESL 3HI1B 1CF8L 3VXSD 4OZGB 5D7LB 2FSEA 3OR7B 4HS6A 2P5ED 1FG9C 5I1HL 4M3JA 4G6JL 3TIDA 2GKIA 4JANB 1OF2A 3RVTC 5DRZA 1CE6A 5CCKL 4FP8L 1MWAL 1RFDL 3QI9D 1IGFL 4HLJA 3A0OA 5E8OA 2E3VA 4UINH 3PL6A 2DTML 1YMMA 3DTXB 5E08H 1O7SA 5B39A 1E4KC 3ZE2E 4HUVB 1K3IA 2GI7A 4Z7WA 3X14A 3KPPA 3AMLA 3LKQB 4IMLB 4P3DB 4ZO6A 5C0JA 4S2SA 1GGIH 4MJ5A 3P73A 1OD9A 1VERA 1DVFB 4OZFA 1DBAH 2OMNA 2WUCH 4KAQH 2FO4B 4NNPL 1X5JA 1UXSB 4OZIF 3V95A 2A74B 4I3SH 3OJMB 3WL9B 3VXTA 2BSRA 4S1SL 2CH8A 3O3AB 3ULUF 4RWHA 4F58H 3MOAL 35C8L 4N68A 5F7FA 4FQPA 1AGFB 3B9KB 3OF6D 3OAZK 4I4WA 3WFBH 2FECL 1A0QL 4JQVA 3CFJA 4O5LL 5J56B 4BUGA 3BPCA 4GQ9L 2H8PA 3RWGA 3B6SB 1AXSA 4ERSH 3MLZL 2CXGA 3F12B 5E1AB 2ZUQB 2NY2B 4I18B 5IVOA 4NM4L 3TN0D 2P49B 2HTKD 3GMRB 3GMQB 2ZPKL 5LXGL 1XF4A 3MNWA 1S9YB 3HCVB 1QFUH 4LLQB 4WO4A 5F7HA 4Y5VA 1JI2A 1I1AB 4H20H 5I16B 2GSIB 1A1NA 2QHLA 2CQVA 4PLKD 1MQKH 1WV7T 4E41E 1RUAL 1TJIH 3ALXA 1J18A 4JJ5A 5SWQB 1FC2D 5SWSD 5L9DL 1HXYA 1JV5B 2EYSA 3V4UL 2V2TB 3BQUD 1U92B 5F1IB 2YS4A 3L3OB 3I2CH 4U6HB 1V3KA 1AR1C 4M93C 4HLZG 4PV9B 2N56A 3VXPB 2B4CC 5IBTH 2W65B 4E9LA 4JFDE 5I8KH 5KZCB 1F97A 3GMMA 5JHLH 1VFMA 5ID0B 5BVJA 4A6YL 1LE5A 4NZRH 2EICA 3BKCL 3V7AG 2IPTL 3VXRD 4GO6B 3UX9B 4LLWA 2ZUSA 1AC0A 5TDNA 2A83B 4L5FL 5BS0A 4QRRD 5D7IB 1NKRA 1IGIH 4JFEA 3PHOA 2HFTA 3KPNA 5IJKC 3N85L 3PWLB 3FOMB 4J3TA 2OXHA 4C83B 4UDTB 2BMKA 2ATPB 2PO6A 4U1JB 5C08D 3TIEB 4YNYB 2P8LA 4S0TD 4ETQB 3B9KC 1IZKA 2X89D 3MA9H 5F70A 5LBSH 3TO4B 4KZEL 1DP0A 4HHAB 3A67L 5FA4B 4OCXL 1RZ8A 1CLOL 1FNSH 4XNQA 2EC9U 4M6OH 4MS8C 2FIKA 3HA0A 2CRIA 2ZUQC 2NY2C 4I18C 1NDMA 1LEKB 5CMAA 4AY0A 1BIIA 3W82A 5EULV 1WAAE 4BZYA 4JRYA 1ZGLM 5HHNB 2BZDA 4PJ7E 4NWUL 4YDIH 1PZ5B 4Y5XA 3U36B 2VABB 3W2DH 1I1AC 4ZS6D 1G7HB 5IW3A 3G08A 4TUOB 4LSSL 5J11B 1EEZB 1G1YA 1Z5LB 4QRSA 3UC0L 3WSQL 1DUYA 2Q7YA 5F7EH 1MJ8L 5I76B 3DVNA 1VEOA 5IB5A 4J3VA 2IH1A 3NBNA 5HDQL 4LGSB 3CMGA 4U1IB 3N50A 5ESVB 2O5XL 1PLGH 1KBGH 1G0XA 3KYKH 5TDOB 4JO2H 5FO7A 4MA7H 3RWFB 3S37L 4MAYB 3ET9F 1WBYA 2VR4A 2DKMA 1HQ4A 1SMOA 4X6EA 2KL6A 4K7FA 4JFQB 5HGDA 3S6CA 4K9EL 4WHCA 3FHAA 4U6YB 1LK2B 3LS4L 3I9GL 3FRUB 4JR9L 1WBZA 1EEYB 4JM2B 1UZ8A 1J87A 2XI9A 5DHXB 4JFHE 1G7PA 1U9KA 3OKEA 2V2XA 4YFLI 4QNPE 1JYWA 1NAKH 3JTSB 3JWNC 5I15L 4GW5A 2IG2L 2DWDA 4FQXB 1INQA 4LSRH 3KLAA 3P4MA 2MHAA 3K7UA 4QGYA 4WEUD 4MXQD 2X4NB 2YC1A 3WHXB 3MR9B 1NBYA 4YFEA 3GSWB 1QOKA 3ARYA 2MJWA 4PBXA 4HUWA 5C0FA 5DUPL 4TPRH 3SKOB 1QSVA 4WI8A 5BRZD 4GLRI 4N5UA 4GSDH 2FLBT 3EOAA 5TQ0L 3QIUB 3TO4C 5DURB 4Q9RH 5MI0B 1YN6B 4PJDA 3VXUE 3QWRD 4OLEA 2W0LA 4PJCE 1OP3H 2PTVA 5GSVA 4H0HB 1QUNA 1UH3A 1PBYA 2DBLL 1OP3K 2NY6C 3GHBH 4JZNA 4PJHA 3G9VA 4P57B 4JN2B 3FT3A 4MWFA 4PIRF 3EYOA 2YXMA 2OJZL 5B3JE 4Q0XL 1U8OB 1MNUH 4PGCA 3T04D 4L9DA 2X5PA 2GITA 1OSPH 5JPNB 3EZJB 3EHBD 3TFKC 1VGKB 4LRIA 4I8DA 5J11C 2XWTB 5FO9B 1HHGB 1DQQB 2ESVE 5D1XA 4EI5B 2J7LA 2CLZA 4Q9QL 4NO5B 4XCEB 3OV6A 3DX6A 4GRLB 4TNWK 1QSED 3ZTJG 3RWDA 2O61B 5DRNA 2D03L 2WK2A 4MAYC 5GGUA 2Y07L 5MEND 1I9IL 1V7NH 1Q38A 2R4SL 3V5DA 2QSQA 4N90E 2D7QA 1FL3A 5E03A 2WLZA 4XI5D 1UZ6E 3AU1A 3BO8A 4FZEH 1F3DJ 1VGEL 4JM2C 2ARJB 4RQQA 4B5EA 3IDXH 4ZDHA 3ULVH 5C0AE 3OWEA 4LSUH 3VD7A 5MHSD 1INDL 2BCKA 4G8GD 4LOUD 3SJVE 3KPSE 2D7MA 4O4YH 1IGCL 5I1JH 5C2BH 1I9EA 3UYRL 4FQXC 5D7IF 4WTWA 1FH5H 2AKRA 3VXME 3RL2A 2QTEA 3AY4C 4XPHH 1UKQA 4MD0A 1A21A 1DANU 3QUXC 1IT9H 1FAIL 1QA9B 3FFCE 1XGTA 3HI5L 5DGRA 3CZJA 2OTUB 3V5KB 3QIUC 1CK0L 4F7EA 1A6AB 3MROA 1BFVL 3LKNA 3SHSA 5MI0C 1G9NL 1IGTB 2BHUA 3UTPE 4WW1B 4KPHL 3IFPA 4G6KL 4NQEE 1X44A 5EBLA 1L7IL 3RWCA 2AXGA 3HPJA 2VZUA 4YHKL 2RGSA 2VMFA 4M6MH 1VKXB 1RHHA 5DJCB 4FTVA 2P8MA 5C7XL 2FX8L 4ISVB 3IDIA 5ICYB 1LDSA 3SE8H 5BZWA 4RA0C 2HKHL 2I60L 4PPTA 1Y6MR 3FQRA 5EC2B 3WCYA 5GGRB 1PKQE 5IB4B 3C60D 3H3PH 2DL2A 1WFOA 3O4OB 5D2LE 2P4AB 2D7NA 5GRJL 1MCOL 1U3HA 2DJSA 4YGAB 3UBXG 1GGBL 1UB6B 4WHYG 2CLVB 5M94B 2GY7B 4F8TA 2JJVA 4RAHA 5DZNA 5KJRH 1CGWA 4GT7A 1BP3B 2BC4B 4NM8L 4UIMA 1F58L 2PXYD 4GRLC 1SJVA 2PF6A 4KDTC 3U7YL 1D5ZB 2L7JA 5EOCJ 3VRLF 2VLKA 2LFGA 4MCZA 4NQCB 1QD0A 2YUWA 1RUPH 4MA3A 2GJ6A 3L9RA 2MNUA 2X42A 3MJ8A 1G9EA 4M43H 3DLQR 1CGVA 5IBLD 3SDYL 1GZQA 4JM2F 4NQDA 2V5RA 3IRZA 4UOW0 5ITBL 1H3VA 2VXSL 2A9ML 2BRRH 2LABA 4D9QD 3UO1H 5FDWA 1AXIB <