2AW2A

Crystal structure of the human btla-hvem complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
CDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B and T lymphocyte attenuator
publication title Attenuating Lymphocyte Activity: the crystal structure of the BTLA-HVEM complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 110
sequence length 110
chains with identical sequence X
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aw2A00
1I8KB 2DLHA 1VGKB 1I85C 3I02A 5MHSD 5IB2A 4FQJH 4WU5B 4MNQA 1OAZH 1AXIB 2HTLC 1F4XL 3WO4B 4MZ3A 4HK3J 4FABL 1NANH 4IRJC 5DSCB 4GQ9L 4NGHL 1NDMA 4UDTB 5J3HD 1CK0L 4LAQH 1X5XA 3DBXB 1QSFB 4NRZA 2FIKA 2ZCHL 1B90A 4JFFB 4X6BB 1LE9B 4EN3C 3CC5B 1NCDH 1JN6B 5ACMA 4FQQA 2DQGL 3IT8D 1XF2A 3KYOB 3OR7A 5HGDB 4Y4FB 1DR9A 4BH8A 4YFDB 1WUNT 1F3DH 4F57H 3S37X 3ARBB 1BQUA 4O51A 3TA3D 5DHVB 5CBEB 1PVHA 4XPGH 3U48A 2XKNA 3SJVE 4WU7B 4BQBA 4PIRF 4K94H 1OWWA 1AGDA 4NZTH 4KRPD 4WNQB 4U1MB 5B38B 3GSXA 4HIJA 3GJFA 5BW7A 3UTQB 1HZHL 5D1XB 3VXSB 1QRNE 3KG5A 3ZT7A 2OL3H 3SDCA 2VDPH 3BPCA 3GHEL 1RJZA 1IM9B 3ZHLA 3P77B 4XMKL 2G5BA 3U0PB 5FUOL 1I7TA 3BRGC 3JTTA 4HSQA 5HY9A 5DF0A 5KSVB 4L8BB 4M6ML 2DLGA 5CBAA 3JWNC 3TCLB 3ZKQD 5CFHA 5FYJU 4L8SC 1XCTA 1QFOA 1RJYA 5D5MF 3MFFB 3MBXL 2VSDA 1SM3L 5ANMA 3IKKA 5F70A 5I2IA 1FC1A 4OGYL 5F7HA 2WIMA 4X7SL 4Y19A 4YX2L 4HGKC 1UEYA 5J6GB 2FHCA 3EO9H 2XWTA 3ARGB 4LPCA 5JZ7D 1T21A 4FRWA 1KB5H 1SY6H 4FTVE 2CMRH 4K3DL 1FLRL 3EDKA 3CFKB 3OB8A 2V5TA 4FQPA 3VXSD 2P4AB 5E9DA 5FYLE 3F65A 1KB9J 5AZEL 3VFUA 2R1YB 1IM9D 4LDOB 3TM6A 4PUBL 5CSZA 4H1LB 2E7HA 4NBXB 2VLKE 3GO1H 5IW1B 4H8WL 1QR1A 3B3IB 2DQEL 2WW8A 2H8PB 2ATKA 3FRPA 3QUYB 4FQ2H 3BKYL 5KN5B 5EU6D 3VDCA 4JZNA 4XTRC 3F7RA 3CLFL 4GH7B 1A5FH 1S7UA 4RQQA 3W39B 5HI5D 3P4NA 4X5WA 3EOYG 3O81A 4MAUH 4W6WB 3FQUA 4HWEH 5C0CB 3KPRD 3SJVB 3WLBB 1AGFB 3T65A 3WIFB 1ZEAL 5AAWA 2C4FT 4F2MA 3BRDA 4HPYH 5HVWA 3DGCR 2HMID 4JPIB 1HYSD 2B0SL 5HYJA 4NUGL 4OLVL 3MA9H 1BZ9A 2FB4L 1QBLH 4F7PA 2MJWA 4HXBL 5EBWA 4I9WE 5EU5B 1JZ6A 1KULA 4N0UA 2W59A 1J0HA 1HWGB 3V5DB 1LEGA 3FONA 1QRNB 1BEYH 5AYUH 1VEOA 5DZOA 2VAJA 3H0TB 3L3JA 4B50A 3E2HC 4S11A 1BVLA 5CP3A 4Y16B 4MD5B 1LILA 2EDQA 3QQ9D 2NY2B 5FOBB 1T1ZA 2EKSB 1P6FA 3OR6A 4GG6A 1SEBA 2XA8L 3N9GL 3LKOA 4J12A 3VXPA 3KYMB 2AGJL 4XBPA 1OB1A 4NBZB 4EVNB 2VDQH 2DQTH 1H3TA 1NGPH 4JLRB 4KMTL 2VLLB 4XAWL 1CFVH 1BIIB 4HUUA 3SCMC 3P9MB 2MQCA 3V6FA 5GRJL 4ZFZA 3WKML 1S5HA 3IDGB 4KVCH 3U36A 4V2CB 5CP7A 4FTVB 1NLDH 4GS7C 1FL5B 1EBPA 1NEZB 4L8DB 1H3XA 5BO1L 2E5EA 5EU3A 1NJ9A 3QZWG 4FXKA 4PJEB 5K9JH 5JORB 3UPRA 2ZSVA 3EYOB 5A2FA 4L9LC 1CFQA 2VLKB 1K4DA 1YQVH 4X6DF 3B43A 4G6MH 2Q87A 3QXUA 5E8OA 5FM4A 2NTSP 1I4FA 2VXQL 3E3QC 5K9OB 3Q48A 2NQCA 4TPRL 4M8VA 1MWAL 3T0EA 2QQQA 2XZCH 3WNMA 3STZB 2J6EH 3DX9B 1EHLH 4YHIB 4TUOB 2PW2A 4KY1L 1L9NA 4XP5L 3ZKNC 2A6JA 3QPQD 4PRHA 2YRZA 4Z7UA 5T1MA 4FTVD 4WFFD 4LKXA 2CKBL 3U4EA 1NC2A 2CIKB 2EDDA 1CWVA 1J88A 1ZT1A 2VC2H 3VMNA 5FYLD 2X4PA 1HSBB 5EPMB 5SWQA 4H20L 1U36A 4E5XA 1CTOA 5BZDA 4ZO8A 2XPGB 3HI1B 1Q9KB 3PL6A 5JO5A 4NQVA 4WW2A 1MLBA 3H9SD 1FNSL 2VLKD 1UXSB 1OSZB 4M3KB 4XVJH 4FXLA 1K2DB 4L3AA 4OIIL 5D7IA 3OKNB 3C8DA 4Q7DA 3GSNB 3QG6A 3OJDA 1U92A 3T0DA 4Q0XH 1FNFA 1RK0B 1INQA 3V4VL 3CK0L 4NKOA 4RZCB 1BAFH 4XVTL 1I7UA 1YEJH 3QH3A 1U3HB 3C6SA 4G6FB 3P9WB 3F58L 4PREB 2VXSH 3HC3H 1AP2B 1KFAH 2OR9H 1J10A 1BQLH 4FFVC 3V52L 1IQWH 3FO0L 1LP9F 4TOYL 5EIVA 5SWZD 5FGRA 4WHCA 4EUPG 3DRTA 4C59B 5IEKA 2EDXA 3K2UH 3KLHD 4OZIE 1NPUA 1KCRL 4AQ1B 1CD1B 4WV1C 4AL8H 4PLNC 3GMPB 3RZCD 3HMWL 1SVZA 4N0FA 2XQBH 3NCBB 2IG2L 4K7PL 1E28A 1X7QA 3C6LA 5CEYB 3CVHB 5DT1H 4C56E 3QHZL 1NDGB 1C1EH 2VUYA 2X9WA 4WUUE 4EDXB 1U3HD 4G6FD 3RVUC 1KN4H 3WN5A 4XCYB 4AM0A 3NGBB 4H25A 5FYJL 3DUSB 1MJJA 5CS7A 1J87A 2YSSB 4Q74A 1G9ML 4R7DA 3WKNA 1KT2A 3EYQD 4PJBF 1CLZH 2Y72A 1NKRA 4LCYA 4X99B 2RIKA 1I1RA 2ZZUT 1U8JA 1J05A 5KS9A 3MRCA 3SDAC 1IAKB 5TDPA 1W0VA 4ZUWB 2OMNA 2AV7B 4RX4D 1ORSB 2JELL 2ADIB 4ONHB 1TNNA 1PQZB 3IDJB 4U1HA 5FIEA 5J6HB 3CX5J 4FOMA 1JHTB 5D1QC 5GZOD 1M05A 3NFNA 3ZE0F 1QBML 4ZQKA 1B4RA 1G0DA 4UIMB 2ZOLB 3P4MA 1HKLL 2FD6L 5E8EB 4NSKA 4E41A 4QRQB 4S1QH 2FL5A 5C0EB 2NZ9C 2VRAA 4QTIH 1INDH 3VCLB 2NX5A 1QYGL 4EOWH 3GJFH 4WWKC 5FM5M 4UUJB 4NN5B 2A0LD 4XBEH 5B3NA 4K07A 4X98B 3PDDA 4QHUA 2UUDK 2F74A 1TQCB 5KZCB 4MA1B 2HT2D 1Q8MA 2HKFL 3MGTB 3RWIA 3SHSA 4YEFA 4LIQL 2BCKA 2Q86A 4GRWH 3UPAA 3S35X 4TSAL 4XC3H 4NFCA 3JVGA 4KMQA 1MCRA 1YNKL 5BVPL 3TO2A 1HSAB 3B83A 5FHAH 1FZKB 3WEXB 5CSBA 3U30C 2EDTA 4BM7A 3LD8B 1Q94B 2V2XA 1MCWM 2EDWA 3BZEA 1I1FB 3SE3C 4K8RH 1I8LA 3C5SB 3GSRB 2Q1EA 4PJ8A 5C0BE 3ULUF 1HH6A 5GS1C 3ISWA 2K3TA 1HQRB 2IALB 4PJCE 3ARQA 1I3GL 1P69B 3OL2A 4JN1L 4XVSH 2FGWL 4NUJB 3KPSD 3HNSH 4EI5C 3BWAB 4XZUA 5GISL 4U6YA 1IFHL 3OKEB 4JY6B 1OQOA 2L7JA 4NC1C 4BSVB 1C5CL 1MFAH 1A7RH 4HT1H 4JHWL 2NXZD 4LCWE 1WAAE 3QXDB 1CF8L 4YHOL 1XH3A 2AK4B 1KIUA 2ZCLL 4GG8A 2FX9H 1UT9A 5BS0A 4DCQA 3PP4L 4YE4L 1T83C 3FN9A 4X8XA 4QRSA 1MJ8H 2AJZA 4WEBL 3ZKMD 3QHTC 1FNLA 1A3RL 4FFYL 1RUML 4RGNB 5JTWA 5HJ3A 4LSTL 4H88H 1F2XK 3O11B 3WJLA 3BP5B 3RWCA 4WO4B 1XIWC 2QLVB 3WNLA 2JB5H 4JKPL 4C56D 4MD0A 2YPLA 4OLYH 1KEGH 1EPFA 4U1LA 3MLWL 4WUUD 5LKNA 4BSJA 4DEPB 1JP5A 4EI6B 1NMCC 4RBPK 4MHHI 3EYFA 1MVFA 3HE6A 1HK6A 2BOBB 4LKCA 4X4ME 1XGTB 5CP3H 5I17B 1CGWA 4XP1L 3O6FD 5ICXA 1R3LB 3BAEH 5T1LB 4OM0L 2YWYA 2GYSA 4PJDE 5JXAL 5H94A 5IVZA 2J5LB 1JRHI 4IIQA 1JPGA 1MPAL 2DTSA 5C0FB 2WIIB 4N8CH 3JV0A 1KPUA 1Y6NR 4GXUM 1MAKA 3VFGL 2YUWA 2CK2A 5GJTL 4KC3B 3FN0H 3I6GA 1U42A 3L9RB 4MA3A 2FX7L 3ZSSA 4XPFH 5DMIL 1KJMB 5LBSL 2IPKA 3VFMB 5L9DH 1NBVH 1A3LL 3MLYL 1MEXL 4OZGF 2NY3B 5D6DA 4PJCB 1AC6A 3DUUB 3DARA 4UU9A 3BDBA 5F89B 1N7ML 4L29A 5F96H 4ZG1A 1BBDH 5FM5O 3ARDA 1K9TA 1Y6KR 3D9AL 1VACA 3KVQA 4Z7OF 1A6WL 1CXEA 4EQ3A 3DO7A 1MIEH 4QHLB 3FO9A 1EJOH 4LCWB 2X7LB 4JQVA 4DGYH 3BKCH 2J8UA 4P49A 5HDQH 4IDJH 1HHJB 4LSSH 3TYGH 4APQA 3QYCA 3D85A 1OSPL 1D6EA 3C09C 3TA3C 3K8LA 4LHUA 3SKUD 1F2QA 3HZVA 2X1PA 1BMGA 1IM3A 1T0PB 2JCCF 4BH7B 1X4YA 4KRPC 1NSNL 4XP6L 3WO4C 1HNFA 4G7YL 3OB0H 5BZWB 2DQUL 5J57B 4LSVL 5HDBE 1JNNL 3L95B 5I1DA 1NLBH 2CKNA 2FEEI 2HJKA 4N5UA 5C0BD 5CJ8A 1CFNB 1OW0A 4C54A 2D03H 4JN2B 1ZVHA 3OX8A 5T3XH 3E8UL 5DJDA 4U3XA 1KLGB 3VXUD 5F72S 3F7VA 4JG0H 1LK3H 5E95B 3SQOH 1A7NH 1CR9H 1OTTD 1WEJL 2XWBA 3OKMB 1LO3L 4U1JB 5H2BB 4P2OD 2R0ZH 5D2NA 3A67L 4Y4FC 3BT2L 3LPFA 5HYQA 4E9LA 3DSFH 3L6FA 1UWEH 2XTJB 1ZVSB 4HCRA 3ARBC 4GSDL 2XQYK 2FBOJ 1UJ3A 4PJDB 2FYYA 3LQZB 3HPJA 1XF3B 1KELH 4M1DL 3IRPX 3VXOA 3GNML 1L0XA 1CE1H 4JO3H 1K5NA 4CMMA 3O6LL 3HMXA 2VDLL 2VZ3A 3V6OE 4WUKL 4ZD3L 3PHQA 3QUXD 2ICEB 3IU3B 4JJ5A 4NPYB 5D2LA 4BQ9A 4O2FA 4MXWH 4D0DB 1MCJA 3O4LE 7CGTA 5C0RH 3TP4A 4WJ5B 4RISH 3ABZA 4ZNCD 4TVPE 1G7IB 3GK8L 4M7LL 2R1WB 4MYWB 2FCBA 3TGXA 4YO0B 4NHCL 1UA6L 1I8IA 3OF6D 4PJXF 1V7ML 4XHJC 4YBQD 1ZLUH 4IOFD 4M61B 4CDGC 4LSPH 2IH1A 3AC0A 5C0AA 5B22A 3WFBL 3MRBA 3L3HA 4ZXBD 3ARGC 3T0WA 5IESH 1R3JA 4LSUL 2Y07H 5DTFA 4A6YA 1EO5A 4RGMB 3P11L 1ADQA 2GCYA 3CPLA 3F6IA 2HMIC 1XZ0A 1J18A 3A6BH 4DFIA 2CIIA 4XNZB 3OAYH 5B3JF 2JJSC 2QQKL 1H0DB 5DRZB 1P7KB 3I2CH 4WW1B 3TFKD 4K3EL 3AU1A 1EK3A 1CICB 1JWSB 2DQHH 2R0KL 5DJXB 5E7FA 1KJVA 4HS8L 1SMAA 1WBZB 1C5DB 3RTQA 3OXSB 3QUYC 2Y9RT 1V3KA 2BMKA 1ZLWK 1QSEE 3QQ9C 5HHOE 4PRPE 1DFBL 2X2YA 3D25B 3MLTA 4KHTH 1R6VA 8FABB 3UTTE 1DUZA 4PY7A 4YBLB 5L6YL 3RJQB 2P44B 4OTXL 1UQSA 3RNQA 4NHUA 1DQJB 4G6KL 4R0LA 5J11B 4Q6YA 2R56L 1JUFB 1NAKH 1LEIB 3B9VA 1FO0A 3HCVB 2X44D 2D9CA 4PTTB 5MEQB 2C7UB 3HUJF 2M2DA 2YD3A 3QIWD 4JG1H 2DDQH 5DDHA 4X4ZA 2XFXB 3GIZH 2FJHA 4QRPE 5KSBF 1PKQE 1YUHB 3MRPB 3PNWB 1DQTA 3X3GH 2HFGH 3I50H 3D0VA 5L0QB 1FV1B 4P3WA 1ZT7B 4Y16C 1IGYB 5JQ6H 4ORGA 4UIKH 4JHZA 4JFDE 3ILPA 4YGVA 5TDOA 1QPXA 1T20A 4KDTA 3FB8A 1NGWB 1RJLA 2XKUA 3S97C 5AUMB 4WEUD 4CVUA 4FFZH 4EUPB 2K7PA 1E4JA 5J1SC 1OTSD 5I1AB 2O93L 4XBGB 3TC9A 4JM4H 4F15C 4K94L 5F1KC 3KYAA 3A6CH 2BNUA 4NZTL 4KPHL 4AEHH 3HHRB 3TO4B 1OAUH 2C3GA 3QPQC 4F7TB 4PS4H 4TUKL 5IBTL 3LRGA 2YR3A 3QDGE 4JGUA 3BHBB 2CDGA 5E6YA 1CFBA 3GMOB 2R2BB 3ROLB 3BIKB 1RUKH 3B6SB 1MCBA 1VADB 4M8QB 3ULSB 5F3HA 3O4LD 1JGDA 3ZL4H 4PLJC 3FJTA 2Z8SA 5L2KE 3GMNA 1E0OB 4D8PB 4TVPD 8CGTA 2APVA 1LMKA 1JF6A 3BPLB 1T2QH 3QUMB 3P9LA 4NM4H 5H35B 2OZ4A 4ZFFA 5J7CC 5FO7A 4OLUH 3SKMB 1QSEB 4PJIA 4OM1H 3SGDI 5HHOB 4PRPB 1KYOJ 3NZHL 1ZGLM 5IMLB 3IXAB 3BMWA 5D93C 4RDQF 1PKOA 5DUPL 1HI6B 3UTTB 2NNAA 4PY8I 1ETZA 2JK5B 2C4FU 4PGJA 5JR1H 1CT8A 4JDVA 4OCWH 4OIBA 3CXDL 4LLMB 3WE6B 1A2YB 3T8XB 2VXVH 3G5YA 1DQLH 4B7IA 3KXFD 2CDEA 5IW6A 2UZXB 4LCUB 1MREH 1BZ7A 4KUCF 5T5FH 1KNOB 4OFPA 2VYRE 2Z8WC 1AQDA 2G2RA 4I77L 3LH2L 3HZYA 4L9DA 5BVJB 4YHNA 3W9DA 3GO1L 5JW3L 4PYHA 5ECJE 1H9VA 3LAFA 3DUHA 4L4JA 4G80A 3MLZH 4FQHA 5H37G 1PKQB 3BISA 2OK0H 1DBBH 3WFEL 2HH0H 3ARFD 2VDRH 1D9KB 4OCMC 3KLHC 1KIQB 1QACA 2VKXA 4QY8A 3R4DA 1QSED 3MROB 1A5FL 5IOPB 1QNZL 5HHOD 4PRPD 3PWLA 4NRYA 4JO4L 1UC6A 3CSBA 3QNXA 1RIHH 3PQYA 4YXLH 5JHLH 2QTEA 1MNUH 4CNIB 1DN2A 5HVGB 3UTTD 1HIML 1JTPA 2Z93A 4HWEL 3RGVA 4XCEA 3BH8A 3P4OB 3DXAB 1KENH 3W0WA 3FQRA 4P0DA 1W8NA 1U3HC 3MJ9A 4MNGE 3EJJX 4HXAL 4L4VB 4Z8FH 2OI9B 2ZUQB 1UCBH 4YHZH 4PP1C 3GSNH 3QDGB 2F19L 4POZD 5AYUL 2FBJH 3O41B 5DMYA 3CFJA 5DVLA 4UQ3B 4D3CL 4WI8A 4QRPD 2WINB 3NH7H 2DICA 3VFNB 1GPOL 3MA7B 4L1HA 2A6IA 5L2KB 3LIZH 3FQWB 1TNMA 3PF2A 1ZWIA 4JFDD 4ZPVB 1D5ZB 1J5OH 1G9NH 1OAXH 1AJ7H 3HAEG 4LF3A 3LCYA 5CD5D 5JOFB 4GMSL 5CWSA 3MCKB 3TIDA 3NAAH 1CFVL 5E99L 4KZEH 1JWMB 3ARRA 4N9GB 3IXTB 4R4FH 5IB4B 4Q6IB 4M00A 4RMRA 3C2AH 2Y1VA 1YN6A 1K8DA 4Q97A 2BY3A 4MB5A 3NGBC 2GTZA 5TQ2L 3VDBA 1EA9C 3QDGD 4PJ7F 3T3ME 4ZFOA 2PCPA 4R7NA 2NR6D 4PBVC 2HT2C 2VN7A 1MVUB 2DD8L 4QRTA 5MENE 1KBGL 1YQVL 4YR6A 5C3LD 3EOTH 1GL4B 2ERJC 2IPUG 3C08H 1DUYB 1GGBH 2CK0H 2D7NA 1U8NB 2IPTH 2K1MA 3AREA 4HUNB 1YYMH 1KC5H 4I2XE 4HCRH 1S7TA 3SBWA 1P2CA 5LVEA 4RGOL 2NY7H 5T33H 4YPGB 4S1DC 1BGXH 4QTHA 5IVOA 5I1JL 1HXMB 3L5WB 2CJUH 2DI8A 3K4AA 3HMXH 5FCUH 4XP9H 1G7JB 1IT9H 2X1QA 3S3SA 1OOAA 1RZJL 4P5TD 4KJQD 1GC1L 3EGSA 4FZEH 1C16B 4HH9A 5JW5A 2X1OA 2Z31B 4NN5C 1F5WA 1DSFL 3KGRA 4QHKI 5E2UH 5CEZH 5I18L 1OGTB 5I1CH 4RMQA 1ES0A 3I9GL 1TQCC 3BWUC 3K8MA 4XMLH 1A14L 4I0PA 4ELMF 1T89A 4UTAL 2A6KA 3KWWB 5E03A 4JAMA 3Q5TA 3FT4B 3T1WA 5D1ZB 5K59F 2CXKA 3LD8C 3ZKMC 1CU4H 5MEOA 3RL1B 3QJHA 3HC0A 4BFGA 3QDJE 1BAFL 1I7ZB 3L5IA 5DMJB 4A6YH 1ADQH 1GXEA 1JFQL 5C70A 1P7QB 4D9LH 3TT3H 4HAGA 4XX1G 5DJAB 2H32B 1JHKL 4POYA 3NACH 5JUEH 1EUUA 4RAVB 1P1ZB 4M7ZB 3EO1B 4P5KB 2P7TB 2LFGA 4PR5B 1KJ3H 1NH6A 1S9WB 4JO2H 5GQBA 2DYPB 3JWDL 3LEYL 4GLRI 1IAII 1G7LB 1A7OL 3NTCH 1HHKB 1MHCB 1CGXA 4PG9A 3O6FC 3C60D 4KJYB 5D5ME 3HR5A 5MENB 4HS3B 5DMGD 1F4HA 2XRAH 4UQ2A 1BM3H 1PLGL 3SDXF 4YHYB 5EORH 5BOPA 4XRCB 2FDBP 5FA4A 1A0QH 4AT6B 2AS5M 1MHHB 4RGNC 2K9UA 3RAJH 5IHBA 3FOMB 5CUSL 1MIML 3VFWA 1TIUA 4LGSB 2YA0A 4DQOL 4JZOB 5E2JA 4WO4C 2JE8A 5D6CB 3GGWB 4BZ2H 1FO0H 1UH3A 5CJBA 4F58H 3GSQB 2J7LA 4IEFB 1HE7A 1HEZA 4LVNC 5C0DA 1RK1B 5IW3A 4PPTA 4PJAE 3KPMA 4DEPC 2GAZA 4DVBB 4XCNB 1V8HA 5EOCL 5ACZA 4M1CD 4NNPH 1JK8B 3BGAA 5EN2A 3VDAA 2RCSH 5FKAB 4JO1L 5B39B 5EC1A 1KACB 1MLCA 2J5LC 5HHVH 4NM8L 5GGSA 5ICYA 3V2AR 4WTWA 4NOBA 3QA3A 3C9NA 5DEFA 2D7QA 3LB6C 4DTGL 1L7IH 3KS0J 5GRYA 1YMME 3PWPA 3QG7H 43C9A 4P23B 5HI3D 1TQBB 1ZHKB 3GI9L 3ZMRA 1MCCA 5LWYL 2W60B 4M02A 3NZ8A 5ISZB 3Q0HA 5CD3A 4X6CA 4R4NC 2HRPL 4P9MH 2ILLA 2VLJE 4LNRB 1A9BB 5EO9A 1IGML 1PX3A 3PWUA 1BFOA 1G7MA 3HKFA 1OTTC 4NQDE 5IHZA 1YEEH 1FJ1B 1TZGH 2DMBA 4HEME 5EO0B 3VXRA 4OD1H 3VD5A 3F62A 2VIRA 3QEHA 4AIZB 1NBYA 4JDZB 4U49A 2VDOH 1J0ZA 2XN9B 4Y5VB 1T0NB 4PJHA 3VXTA 3VFVB 3BP6B 3UJTH 4PD4J 1I8MA 4JFPA 3DVFA 4X9HA 2CO6B 3NCJL 4LHQB 2GUOA 2IADB 4XCCL 1VFAB 2VH5L 4TRPH 2EEBA 5TE6L 5D7JA 3QDJD 4PJFB 4HDIA 1TVBA 2DM3A 1X5JA 5ACLA 5E2VH 3HI5H 3UMTA 5DJ0B 5F88B 1KB9K 3PABA 1N4XH 2V5SA 5CGTA 2IC2A 3MRIB 4HKXB 5GGUA 5BRZB 4LK4A 4XB8A 1N5YH 1U8QA 4FZ8L 2G75B 4PJAB 2AXHA 5CMAA 4DZ8B 3KPLA 3KPOB 2NY6B 1RZKL 5HGAB 1AXSB 1A7BA 1JGLH 2PO6B 3MNVA 4DVRL 4OCXH 1RHHB 1N64L 3FQTB 2FX9L 4RFEB 3MRMA 7FABH 4QF1A 4OGXH 1FNEB 4NP4L 1MJ8L 3L5HA 4LEOA 2F53A 3DTXB 4LEXL 1CZ8H 2BVQA 3M1BA 3RWEB 2P5WA 1A1NB 2VXUL 2V2TB 3LN4B 5EU7E 4H88L 2PXYD 1J12A 1IC5L 2IAMD 3T04D 3PDGA 3QXAA 1E4KA 1R5WB 3HC4H 4PJ9A 1ACYL 2FJFA 4JE4B 2C1OB 1J0IA 3V5KB 1YMMB 4FQ1H 1XIWA 3VXQB 3MJ9H 4OLYL 4ZYKB 1YY9D 3GSVB 1AGCB 5DJ6B 2R29H 2VNCA 3J7HA 4IRSB 5ID0B 3TYFA 2IAND 5E1AA 5E2TH 4X7TB 4G3YH 1ORQA 5FUZL 4J8RB 2HJLA 2VO5A 1AD9A 2NY6D 4DW2L 2VLJB 3QEUB 3EHBD 5L88H 1A1OB 2EYRA 3BI9X 3FB7B 2QHRH 1WZKA 1T3FB 4NQDB 5EB9A 3OPZH 1OF2A 1AR1D 4M3JA 1FN4A 5ALCH 1KIRA 1QLFA 4ORZC 4BKLA 5L7XH 4MQ7A 2IFFL 3WS3A 3JWOC 5JW4M 1W8OA 4YHKH 4F80A 4L1DA 4RGMC 4NQED 1JF5A 1NGQH 4XH2B 4U33A 1YMMD 5DD3H 5AWNL 3MCLH 3MLUH 3QFJB 4XNZC 1XF5A 2M1KA 3QXVA 5E4IA 5FKPA 2Q20A 3IJSA 3FOLA 3L3DA 3P30H 3CFDB 4IRSD 4MA8L 3T3PF 2EYSA 4DOHE 1LP9E 3KPNB 5HI4D 1CICC 5TFSL 1PSKH 2ZUVA 1KCVH 1WK0A 5KJRH 3CMOH 1OP5H 4WGWB 2OSLB 1QFWI 2VLJD 5TGBA 3SOBL 1CDBA 3K2MC 3PJSA 4NN6B 3WSQH 1DDHA 4WTZG 3SKNB 3LKQB 2JB6B 3SDDB 32C2A 3S96A 1GHFH 4LSSL 3TYGL 5F7WC 2B1HL 4YC2B 1BX2A 3TA3A 4YBLC 1OTSC 1FFOB 4LQFH 1Y6MR 3TF7C 4M1GL 2XACC 4R2GB 5J11C 4GKOA 2EZ0C 4F33B 5DJZB 4CN4A 4C57C 4MJ5A 5JOPE 4U1SA 2R15A 3RDTB 3O3EB 4Z7NF 2H9GB 3RVVD 1E27A 1Y18A 4P9HC 2JJTC 5CHNA 1NMBH 2FECI 1GIGL 5DD5L 4PJBE 3I6LE 4ZUTB 5C08E 5T3XL 2N7BA 4GOSA 3V6OC 3QI9A 4WHYG 1PDKA 3O3AA 1QQDB 3ARUA 4MJ4A 1A9EA 3LKPB 3IDXH 4JG0L 1ODAA 1JNJA 4HKJA 4JFQB 1ZANL 5L0QC 4F9PC 2VDKL 4ZDHB 1HDMA 4XP4H 5LCVH 2CR3A 1TZHB 4DAGL 1FP5A 3U7WH 2A73B 4ODXB 5KSAD 3WXWH 4TQEH 4HK3N 2FO4B 4HH8A 2R4SH 4JCLA 3T0AA 1BECA 3MXWL 1OGAE 2YBRA 5KSUA 3DX6A 5HGHA 1M4KA 1F02I 1F3DJ 4Z0BL 3KYNA 1B2WL 1XAUA 4R2GD 3ESVF 2Y36H 1GGIL 1XGRB 2AJUH 5B38A 5HVHB 3UDWA 1QSZA 4NJAH 2A2QT 3QRGH 3RDTD 3CFCL 3HAEB 1HXYB 1PEWA 4KQ3H 3GBNH 5BMFL 4LLWB 2FWOA 5K9QI 4F7CA 4XX1E 4KV5E 3EDDA 2JTDA 3G6DH 2FIRT 2EDJA 4MD4B 5SX5K 3QPXL 3RHWF 1TETH 1CDYA 5ICZB 3GRWA 2OQJA 4U0RB 2I9TA 4QXTB 4DOHB 1N2RB 3BEVB 5C07D 3RY4A 3R1GH 5EOQH 2GK0A 3BPLC 4GRWF 5CJQL 4PTUA 5EU6A 5F9OH 2H45A 3U9PH 4BELD 5HYSG 1MFBL 5D8JH 2ZCKH 3FO1A 3O0RH 3ULUE 3BGMB 2AQ3A 3KPRA 1FIGH 1L7TL 3SY0B 4XGZA 4MCZB 1NFDE 3CFKA 3UO1L 3FB5A 2HVKB 3B2UD 1Z0NA 1QTYT 4UBDD 4AENB 4ZS7H 1Z3GH 4LSRL 35C8L 2Y23A 4GKNB 3FO2B 3I2CL 2Z8RA 2GSGB 2OR8A 3RWFA 1PEZA 5J9PA 4AH2B 2X89A 4QOKA 5IROA 3H7BB 4ETQB 3BEWB 1KEMH 3M17B 1GZPA 1D9KC 5LGHH 3CXHJ 3K46A 5DJCB 4HIHA 3QO1A 2AJYL 4RDQG 1G0XA 4PB0L 1W2KT 1FH5H 1YEKH 4PRIE 2PR4H 4RA3A 5IV2A 5I8CB 1BVKB 3IGAA 1OAYL 5DJYA 1WBXB 3DHMA 2NY4D 3DGGA 5ITFB 1IGJB 1OGAB 4PJGB 2C9AA 4MGXA 1WICA 1CE6A 1FPTH 2A77H 1CDJA 1FG2B 3VGEA 1G7QB 4KTDL 2W9EH 4WI7A 4Y1AB 4YNYA 5BXFB 2OI9C 4YXHH 2EH8H 1KCSL 2ZUQC 4Y4KB 5JOPD 1ZSDA 3QWRD 4HIXL 1URLA 2BNQE 5KVMC 3GIZL 1A64A 3I6LD 4MDJA 5C08D 4P4KD 2DM4A 4XNQA 5J89A 4MWFB 3IJYB 1FZOB 3W11D 2HG5B 3FFDA 1MI5E 1KTDB 5DVKA 1G7PA 5CSGA 2XZZA 3BSZH 4X5XB 4C4KT 4RIRA 4GG6F 5DA4A 1AD0B 3UZQA 3OKOA 5CGMA 5FOJA 5IFJA 3RWJA 5FYKU 2X4QB 4JM4L 1J8HA 1OGAD 5C0JA 3BPNB 3G6AA 5BQ7A 4YQXH 1IGIH 3V6ZA 2E9JA 1KLUB 5GIRB 2AXFA 4M5ZH 4OZGE 5HHPA 3MV9B 1AFVL 4P5TC 1CTNA 4Y4KD 3MNWB 4FNLL 4JQXA 2DQFA 1WITA 1NFDB 1K4CB 3P4LA 4Y2DB 3KPQB 4V1DE 2O61B 4PRBA 2MTPA 5ADOL 3ROOB 3TVMB 4OCRL 2BSSB 3DVNA 4BZ1H 4R96B 4Z7OE 4ZTPH 3PIQA 2IBBA 3H9SA 5ITBH 2UWEF 3IF1A 1NCWH 3QQ3B 1H5BB 3MRKA 4QGYA 4PRAB 5DK0B 1OLZA 1IEAA 4JKWA 4LL9A 5IVXB 1SBSL 2X4TA 5F3BB 3FQXA 4XI5D 3MRQA 3DO3A 5IB3B 4ZOCA 1JGVL 1B6UA 4PRIB 4IHOB 1IKFL 3MXVL 1FAKT 1MRCH 3L3KA 3ULUD 1R3IL 5JR1L 1XCQB 1DVFD 4MJ2A 3D2UD 4K23L 2ICWJ 4RAUA 2JLLA 2DWEB 4X4XA 3UTZB 3ZDXE 5I66A 4Y5YB 1C7TA 2Z31C 1NL0H 5EUOE 1H3PL 1RFDH 1CL7I 1EFXB 4QXWA 4LU5H 5LQBH 2F15A 3S37H 2UY7A 5BJTB 5SWZA 1U8PB 3ULVH 3G9AB 1LDPL 1B0GB 3P0VH 1JZ2A 5GS0L 5LGJA 1JRHL 4GW5A 3D3VE 5IFAH 4CUCA 3EYUH 4LDLB 3C60C 4EJ1C 4FQXD 2LVEA 1AHWB 5DMGC 5D1ZC 2GJZA 3RZCA 2YEZA 3H9HA 4U6VL 4MCYB 4PG2C 4C83A 5JHLL 5BV7L 3ZHKA 4N0CD 3FFCB 1MRFH 4Z7VE 2F58L 3WD5H 4Q2ZA 1N0LA 3FAWA 2E7LC 5ADPH 1KENL 2CSPA 2AEWA 4M7JH 3RA7L 3MFGB 3V0WL 3MYJA 3N1PC 2ARJB 3BMVA 3WHXA 4U6HB 4ZUUA 5I19H 1RZ8B 2F54A 2PN5A 2F8VA 1DQML 2V7NA 1FGNH 2YOCA 2BNQD 4V1DB 3IJHA 2FBJL 1DBMH 3W9EB 1YDPA 5C0IB 1KG0B 5B4MC 5ALBL 1D5BA 1OT1A 3NBNA 1OPGH 15C8L 1CN4A 2EE3A 4PP2A 5A3IC 3JV4B 4Q9RL 4RX4A 1IKNC 4KDVA 3I6KA 5HHQA 2WAHA 1HILB 2XWJB 1MI5D 1WC7B 3P73A 3MREB 4I3RH 4YHYC 2RHEA 1G9NL 1OAXL 3FCTA 3U79A 3RJDA 1ZTXH 3D18B 3INUH 4NO3A 1DQQB 2FEEL 2MFNA 3PWVB 5EULV 4HUXB 3RPIA 2F9BT 5HI3C 4NKMA 3U1SL 4R4FL 3IETA 2XNAB 2Y4SA 4OFKA 4AYFA 5GGRY 1JGEB 1G1CA 4S2SA 3BDYH 4WI5A 1S7WA 4ZFGH 5H8DA 1YJDL 4W6YB 4QEGA 3FT2B 5FGCE 3AS3A 4V1DD 3DIFB 3F8UB 4PGBA 2Z35A 3OHXB 5EUOB 2AJXH 4U6TA 4G8EA 3T2NH 5C92A 5IQ9B 5IFHH 3L5XL 2AV1B 2YPKA 4AJ0A 3NA9L 5KVEH 3DURA 3IKCA 3QDMB 2IPTL 3D3VB 1ZLSH 4G7VH 3CUPB 3LKSA 1QUNA 1KC5L 4NDMA 2VLRE 3KPTA 4ZAKB 1MFCH 1A7PH 4OSUL 1LD9A 3DVGB 3QNYA 1DTUA 4TULL 1UWXK 3A6OA 1S5IH 2ICCA 4P23C 1TQBC 3D87B 4Z7VB 1V7NH 2C1PA 4HBQA 1JPSH 3MOBH 1J1XH 2WWKT 3KPSA 4AMKL 5FDWA 3O45B 5DQ9A 2D7PA 3DMMB 3R0MA 4H0GA 3DX8A 1LEKA 1S7RA 3TNMB 5KTEL 2IGFH 3MUGB 1CLYH 1IGFL 3GRWH 3WFDH 3CU1A 3CSYB 3K0WA 1FE8H 1QZ1A 3FRUB 2C3HA 3KNBA 3LZFH 4ODUB 1BFVH 3CZFB 2ATPA 2DB8A 3D3VD 4NWTH 2Q8AH 5E4EB 4OZIA 3VWJB 3T2QA 1DEEA 3LQAL 2L7UA 1K8IB 3MC0A 3O3UN 2IPUK 4LASH 3SE4C 4X9FA 3V8OA 4IOSD 1ADQL 2JKXA 1IMHC 4LP4A 3X11A 3GMMA 4D9LL 3Q6GL 4C56A 4M5YH 3G5VA 1U8IA 1JNHA 1FL6B 1RZ7H 4WUUA 1Q9OB 1BD2D 5IB1A 4NNXB 4NO0B 5JUEL 5EG6C 2Z0BA 3DMMD 5JHDE 4HK0B 1YEFH 1KJ2B 3WYRA 2YC1A 4OFIA 2A6DA 2PYFA 1IZKA 4A2LA 4LPUA 5EFIA 3SO5A 4CU6A 2NY6C 5FYKL 1C8PA 5FGCB 5I1IH 2PO6C 3EYVA 3EHBC 2HFFA 4HJGB 4TNWF 3MLVL 4XPTH 3O6FA 2DLEA 1FNGB 1OQXA 3TBVA 5DS8B 2ESVE 4RWHA 1AR1C 3BE1L 1XR8A 3VWJD 4CN1A 3KPPB 2VISA 4JFZL 5EORL 5IM7A 1RUQL 2OXHA 4YGAB 3MV8E 2VLRB 4PJEF 4UILL 4E0RB 5DEGA 3REWA 2V2WA 5HDLA 1C7SA 4ODHH 5J56B 4G8GA 3LV3B 4IRZH 1FO0L 3ZHDA 5JW4Q 3QEGL 1EHNA 5IP4A 4NO0D 3TN0B 3FQNB 3U0TB 1WWCA 4IRSC 4CVXA 5IEHA 1ZA6B 4RBPH 1MWAA 1WFOA 4JRXA 1JYNA 3G6JE 3ORJA 4HMDA 3MOAL 4KHXH 1VSCA 5AD0A 4NNPL 3WUWG 1NGXA 3O3DB 1EZVY 3B9KB 3U82B 2VABA 1RIUL 3QQ4A 5DRWB 2PF6A 5B8CB 2CKBA 3QP3A 3GUTA 3TZVB 1SJHB 3GKWH 4W4OA 2F8OA 2P5EB 2UV3A 3HR6A 1IL1A 2EIDA 2ENSA 2QR0B 3UBXG 2VLRD 4PGEB 3VGFA 4PV8A 4YDLC 2ZSWB 1XGQB 4KZDL 5HYSB 1KCKA 4KGJA 5DC0A 3MLPA 4NJ9L 1ED3B 4BSWA 1ND0B 1F00I 5C0BA 5F6IB 4X0KB 3OG4B 4NQTA 2OTUB 1MHEA 5C09E 3TN0D 1ZHLB 2E6JA 2VDML 1D7FA 3OGOE 5IWLC 4S1RL 3VXUA 1YECH 3QJFB 3IAPA 4L3EA 1S9XB 4YWGH 4ZUSA 5JHDB 4ODVL 4HHAB 1T5WB 4P2OA 4NN6C 1PJ9A 4F3FA 4HX1A 4P2YA 1AGEB 3SDDC 3AVEA 4OFYD 1KTLA 3MRLA 5E24E 5KSAC 2AEPL 2OZ4L 1W0WA 3DPBA 4PGDA 3LKNB 4YC2C 1UKSA 5ID1B 1DE4B 4WI3A 5HHNA 1WLHA 2DQCH 2QQNH 1R24B 1WT5A 5IK3A 3TV3L 2IMNA 3T0VA 1RAMA 1HINL 2BSTA 3VGAB 4R2GC 1BJ1H 2APTA 3VG0H 4ETYA 4J3UA 2NY5C 3RDTC 5EU7C 3EO0A 1MOEA 3QUXA 3RY6C 4ZTOH 5I1KH 5FF6B 1RULL 3U4BH 4JZJB 4P2CG 2D0GA 1LO0H 4S1SL 5TE7L 4I18B 1N5YL 3BO8A 4M48L 3IU4H 5JHDD 2BFVL 4P2QD 4LSQL 5CIPB 3RBSA 4JFYB 2VMFA 3CH8A 3OF6A 3G6JB 2ID5A 2VJXA 3QCTL 3TIEB 1YEGL 2CUIA 3QIBB 2GIYA 4OCXL 3QUKB 5D7LE 1F4XH 7FABL 4FABH 4OGXL 2OTWA 4GQ9H 3GM8A 4XWOD 4NGHH 5SX4I 3SGEI 1N6VA 2ESVD 1CK0H 4I48A 3VWKA 4IMLB 4ZXBA 2ZCHH 3BDXA 3GJEB 1MUJB 5EU4B 2A74B 3BUYB 4XNXH 2R1XB 4JGJA 5HVHC 3MV8D 2GJ6E 2HA1A 4QO1A 3PHOA 4FQ1L 1UB6A 1JWUB 3B2UC 3HZMB 4M93B 4L4TD 1INEL 2ORBL 3QNZA 5LXGL 4EEEA 3ZT6A 4KUCD 1Q9WA 3I75B 4I1NB 5F7MC 1A4JA 5C09B 2B4CC 4U0RC 3C5ZB 4ELME 3BJLA 2JJUA 3HNVL 2SEBB 2Q7NA 4JQIL 3QZWA 2QHRL 5EA0L 1KPVB 4OGAC 4J7RA 3ECBB 3STLA 1I9EA 2IH3A 2YZ1A 1TPXB 3L7EA 1AGBB 4GW4B 1FVDB 4XMKH 4ALAH 5FUOH 3ALWA 1NGQL 2DN7A 2PYEA 2AXGA 3V0VA 4M6MH 3VMOA 4R6UA 4OZHE 2Z91B 5I75B 4D0CA 1QKZL 4P5MB 3QIWA 3VD7A 4NQXB 1RZIA 2R2HB 3EFFB 4GRMB 3TNNA 2Z4QA 3LHPL 5IB5A 5DJXA 5TPWH 3MBXH 3S5LA 1VHPA 2I9LB 1SM3H 1ZE3C 4P4KC 4OGYH 4NZUL 1F11A 3C5ZD 4YX2H 3MV7D 3MZTA 1ZLWH 4UT9L 5F9DC 5GRVL 3CVIL 5CZXC 1O5DT 5KW9H 3ES6A 4OZFG 1FLRH 3SDXE 2HRLA 2YXFA 1B0RA 1G1YA 4LLDB 5D7LB 1FVEB 3D39B 5M7QA 3RL2A 1I1AD 3CH1B 5AZEH 5TH2A 1W72B 2DLTA 4PUBH 4JM2B 1SYSA 4HZLB 2DF3A 2KDGA 1FQ9C 4J4PC 3L3IB 4OZ4A 2NYYD 4H8WH 2VITB 2EEAA 1A4KB 4GXVL 5EZIL 4JFXB 2W91A 3WDHA 3HE7B 4Y4KC 2Q7YB 43CAB 3BKYH 1IAIM 2UZIH 3WCYA 4RMSA 4Q9QL 4HWZB 3CLFH 1T4KB 1I1CA 3BKML 2NY0B 1J8KA 1CG9A 1UKTA 3O4LA 3WO3B 3T77A 4KK9D 3D69A 4UT7H 1FZMA 1H3VA 2LTQC 2PW1B 5FO9A 3RRQA 5JXED 1FYTD 2WP3T 4YFLI 2A9NL 1ZEAH 4N9OB 1JCKA 5IG7A 4TQEL 3V5HA 2R4SL 4NUGH 4OLVH 4Y5XB 1KN2H 4X9IA 2FB4H 4UV7L 5F1IA 4G43A 1JPFB 1M7IA 4XI5C 2APXA 4XPHL 3HFML 4GAGL 4KXZI 3BPNC 1QLEL 3MRHB 1DLHA 1E6JL 1P4LA 3O3BA 2RQ8A 3E6HB 5FYKD 4QHNA 2GJ6D 1FZJA 4Z78A 4OF7A 2A83B 3KXFA 3IFOB 3MBED 2DQDL 4ZOAA 4OCSL 3TVMC 4OZHB 2OL3B 2XA8H 2NY0D 1IAIL 3REVA 3GSOA 3MJ8B 1GGYA 1RURL 2AGJH 2EDFA 4HBCH 4NZDA 1U8OA 3MO1B 1H5BC 4KMTH 4LLUB 4OAWA 3D48R 3SDYL 2HTLD 3NIDE 3ARFA 4XAWH 1R5VA 1L0QA 4DN3L 4ZNEE 3TBWA 1KCLA 1F13A 3WKMH 1S7XA 4FQXC 4M9PA 5DRXA 3PWNA 5IKCB 2GT9B 3U9PL 4NO5A 5IF0B 1TZIA 3IFPB 4PJCF 1R3HB 4LRIC 3QEQE 5GJSL 2QEJA 1QVOA 2XI9A 5IR1A 5FAAA 2BDNL 1R5IA 4EN3D 3DV6A 5GGVL 1FL3B 3AY4C 4J23A 3O2DA 1S9VB 3O8XB 4YUEL 4PRDB 1XR9B 1KB5B 1UJTA 5I9QB 3UTSE 3JV6B 5J1AB 1WAAF 2D7OA 2ADGB 4WFHD 4Y5YC 5SWSA 4Z7QE 5DEZA 4QRRE 2D4FA 2VXQH 1EGJL 4HUWA 4TPRH 4X4YA 4NNYA 3NCFB 1MWAH 4Z7WA 3UEZA 1KPRA 5CILL 3BUTA 5AYQA 4JEGB 4NYLA 4QRPA 1P6AB 2EDYA 3SO3C 3OXRA 4KY1H 3MMEA 1M71A 5F7LB 3TWCL 4G8FA 4JRYE 1FCCA 1BBJA 1AHWC 2DLFH 4MAYB 1F4YL 1P4BH 4JFDA 5EZLB 1BP3B 2CKBH 2BZDA 1YEKL 4PYGA 4XXCC 3C5JA 4AIOA 4LRNL 2PR4L 3VFSA 1DANT 1UACL 4Z76B 12E8L 2GY5A 4ZSOB 1IVLA 4WTXA 5DRNA 2X4SA 4F37F 3LKRB 1ZGLB 1YQ2A 4HC1L 4H20H 4P2RD 2WLYA 2O26U 3D6GA 3FTGB 3QWOB 4J6RH 1ZHNB 1FNSH 2MMXA 3DX7B 3WNPA 3QXTA 3ZE2F 3DRQA 1RQ5A 3BH9B 4PJ5A 4BFIA 1PG7W 4K9EC 4KJPC 4OIIH 1R3KB 4PJDF 3CJJA 1LNUA 4F9LC 4KMLB 1C12B 3VXME 1MCEA 3V4VH 3D1MC 4YPJA 3WJJA 3PV7A 2IQAB 3PG2A 1UB5B 4XVTH 3MRJA 3NFSL 2VL5B 4FFWC 3NCMA 4MAYD 3BSZL 3QIUB 3HB3C 4NRXA 2EDNA 4LLYA 3UP1A 3BIAX 4P46B 4OD2B 3IDIA 3UJJL 2HFEA 4B7LA 4CJ1A 3WHE0 4PD4K 3F58H 3PE9A 3GMRB 2B5IB 4HJ0C 4YQXL 3QEQB 3AMKA 1REIA 3V52H 1U3YA 4TOYH 1QLRA 3GHBH 2W9DL 4KK6C 4P5TA 2GI7A 4HKZA 2AKRA 4YDVA 1GCFA 1N3NA 4KI1A 2VE6A 3O9WA 1KCRH 4XTRD 4P3DB 3NVQA 4OLWL 4LOUD 2Q76B 4BZ1L 1ZT4A 2VLME 3HMWH 4UV4L 1HQ4B 4QRRB 4NN7B 2IG2H 2RJMA 3PGDA 4A2MA 4XAKE 1G6RL 5SX4H 3BESR 2PTTA 5C9JA 3GMLB 3QHZH 1C08B 1LO2L 2QKIA 1HHGA 4LLVA 5HDBF 3WUWB 4ZAKC 1M7DA 3TPUA 3CCHB 1G9MH 3QEQD 2AJ3B 1D5XA 4HF5L 2E6QA 2ICWB 5GHWH 5EUKB 4KQ4L 4PGCA 1IGTA 5JDSA 1OP9A 4QHMB 3IDMA 1YZZA 5CINL 5T3ZL 1U8LA 3HPLA 3UBXB 2ZNXA 5DFVD 3UTSD 2JELH 2H6PA 4MNGA 3L3GB 4DFHA 3DMMC 3VI4F 3S37L 4YXKL 3MJGX 1ONQA 5TE4L 4QRRD 1LK2B 2R2EB 5E94A 3VE0B 4O02L 1QBMH 3RUGA 1P7HL 2BVPB 3IRZA 2BY2A 3KLSA 4YIQB 1AI1L 1HKLH 2FD6H 3C60A 3VXMB 3SCMD 1CLOL 4OBSA 4H1LG 4ESKA 5D9SA 1QYGH 5E4EC 3CDYA 4ZUVB 3VWJC 4F7MB 4JRYD 1L4IA 4G8IB 1MCHA 1T5XA 4RMVA 1AKJD 3RL1A 3DROA 1VCAA 2ITCA 2DKMA 3JWOH 3WD5L 4YFLF 1PX4A 2RBLA 2JIXA 5KANG 3MGOB 4LVOB 2FZ3B 4I4WB 4GUPA 2HKFH 4QT5B 1CDIA 3I3BA 5I76B 1I3UA 4TSAH 4WDIB 5J12B 4WHDA 5I1GL 2HTKD 4GJTB 1YNKH 3RI5K 5BVPH 4HMEA 3BPOC 4Y8AA 1QFWL 1U8HB 2W07A 1VB9A 1LDSA 4O2EB 2P24A 3KR3H 2G9HB 3FB6A 4GRWE 4N8VB 2W65A 5EC2B 5I71B 2Q6WA 4ZO6A 2E27L 1EXUA 4MLIA 2DQIL 1WCBB 3VXMD 1SJXA 3WUZA 1A6TA 1I3GH 1EZVX 4JN1H 4F8QA 5ANME 4GAYA 4MX7B 5HHME 3VFPB 3CU7A 3IS1X 2BERA 3GMQA 1A8JH 1RSFA 2O5XH 3LVEA 4I2XA 5GISH 2CDFA 1IFHH 1NAMA 1C5CH 4JHWH 4R97C 5JPNA 3I02B 2FECL 5IB2B 2YK1L 1ZLVK 3X17A 4MNQB 2AXJA 1CF8H 3MRFA 4YHOH 4GAFB 2V5YA 4P9HH 5C0GA 4DK6A 1A22B 2ZCLH 4HFUL 2FO1A 1N5AA 1NDMB 3TN0C 3WDJA 3PP4H 1MCIA 1IC1A 4NRZB 2FIKB 5ILTL 25C8L 2AERT 1A3RH 4FFYH 1RUMH 2EE2A 2VLMD 3B9KC 3RVXC 1T1YA 4LSTH 2ITDA 1K85A 4FQQB 3P0YL 2W1NA 1TXKA 4XAKD 1XF2B 3OR7B 4BH8B 1ZLSL 5E5UB 3LEVL 4G7VL 3LS4L 4POUB 3TZVC 4LVHB 1BFSA 3MLWH 2O5YL 4O51B 3LPGA 5IHUL 2XKNB 5T1KD 4JANA 3QDJA 1AGDB 4KUZL 4C55A 1JPSL 1NCCL 4QWWC 5TQ0L 4P4RA 4BYHA 3CFBA 4M4RA 1EX0A 3GSXB 4LFHG 4HIJB 4OM0H 3GJFB 1MCOH 5IJVA 1MPAH 3SDCB 1NUNB 3O2VL 1KXQE 3BPCB 1RJZB 5FGBC 4U6XA 3PHSA 3VFGH 3WFDL 1WIOA 1AY1L 3M07A 1BOYA 2G5BB 1I7TB 5GJTH 1U3JA 4HS6A 3JTTB 5HY9B 5IQ7L 4GG6E 3LZFL 4MQXC 3OKKB 5HYIA 1BFVL 2FX7H 3QHFL 5CBAB 4ZPTA 5DMIH 5LBSH 4XWOC 4YFEA 5C8JA 4NWTL 3RVUD 2Q8AL 1ZKAA 1T1WA 1A3LH 3FAXA 1MEXH 5D5MA 1XCTB 4QRUA 3Q5YA 4MA7L 3WNKA 1RJYB 1X5IA 2YUZA 4AG4L 2R39A 5ANMB 2EIZA 5I2IB 3VGAC 1JHLL 4Y19B 2PXYA 5ESQA 4LASL 1QFHA 2IAMA 1N7MH 2XWTB 1JV5A 1P9MC 4KKBC 3R06A 1T21B 3D9AH 1A6WH 3SEPA 1S3KL 4LP5A 3QCUL 2F5BL 5J0BA 2EECA 3WS6C 3B2VL 5FM8A 1Q9LA 1WFTA 4KJWC 5E9DB 5D1QD 2IANA 4I18C 1OSPH 3VFUB 4FS0A 3BRFA 1CI5A 1YPZF 4RRPA 3CIQA 5CSZB 4EBQL 1UWGL 4GBXA 1XF4A 3LMJL 1QR1B 3QIBC 1RHHA 1NSNH 2YD9A 2MPAH 3ZKSD 2ATKB 4G7YH 4M6NL 2DQUH 1XGPA 3CXHK 4LSVH 3V8CA 5I15L 1JNNH 2HWZH 3LSOA 1TCRA 2E3VA 3T0EE 3UAJC 4WWKD 4JZNB 2MCG1 3ZT5A 1S7UB 3E8UH 4RQQB 4NC2B 5HHMD 3P4NB 3S4SA 4X5WB 4Y4HA 4K8RD 4NQEA 1AO7D 3FQUB 3HRPA 1WEJH 1UCTA 2W0PA 1LO3H 3T65B 5JIKA 1RVFL 2Z92A 2B2XL 2FSEA 3A67H 4YEEA 4M93C 4F2MB 3UCRA 2DMCA 3BT2H 2D7TH 4Y88A 3MZGB 4MNHA 3RIAF 5HYJB 1BZ9B 3DYMA 4N1HB 4F7PB 4LCCA 5EBWB 4JFOA 1OAQH 2QSVA 4OB5L 4N0UB 2J88L 3VG9B 1RPQA 5E6ID 1LEGB 4C4KO 3FONB 4M1DH 3C5ZC 1A6VL 3GNMH 3K8KA 4P3CL 4Z95L 3L3JB 3OJ2C 4QXUL 1BVLB 3X13A 3O6LH 5EOTA 4L3CA 2VDLH 1BQHA 4FG6D 1QSFE 4ZD3H 2H26A 3KJ6L 1T1ZB 4JFFE 3OR6B 4JDTH 5HD8C 3GKWL 1YNTA 4GG6B 5BCAA 1SEBB 5D7SL 3C8KA 3LKOB 2LQRA 1TPXC 3VXPB 3RY5A 1OTUC 4XBPB 1OB1B 2DOCA 1DL7L 2IQ9L 3OWEA 3KLAA 3GK8H 3H3PL 4NHCH 1UA6H 4HUUB 4KK8C 5I75C 3V6FB 4U7KA 4ZFZB 5I73B 1S5HB 4LPWA 5FEBA 1V3JA 5KVGL 5HTSA 5CP7B 3JBG7 1YECL 4JREB 4I3GA 4O58L 4R3SA 3CFIC 4UINL 4UNUA 1D6VL 5FYLL 2FH8A 1NJ9B 5EU3B 3ZE1E 2GITA 4CVZB 5TF1L 1WFUA 5DMKA 4FXKB 2L4OA 4YHMH 4LSUH 4Z18A 3UPRB 2ZSVB 1FFPA 1L9MA 1I3RA 2OCFD 3PGFL 4YHPA 4X6DA 3P11H 2KBGA 1CFQB 5KSAA 1K4DB 5T3ZD 4FQLH 4L5FL 5E8OB 4GKZA 1I4FB 3RWHA 2DQCL 2QQKH 5K33A 4YHLL 1ZS8A 1E6OH 3OKDA 5CLWA 3T0EB 1I1YA 5CZKA 3AB0B 4K3EH 4JM2C 2ZUUA 2R0KH 1FRGL 4HS8H 2PW2B 3P0GB 3T3MF 1D3CA 3TBSA 1CL7L 2A6JB 3HE7C 4NKDA 4G9FA 4PRHB 4HPOL 4Z7UB 5T1MB 5FA3A 1DFBH 1I9RL 1NC4A 4LKXB 5I8EA 1TJGL 1A47A 3U4EB 2LAAA 5DI8A 1NC2B 1U91A 1LO0L 1JTTA 2NY0C 3NFPA 4UB0L 3BP7A 3RX8A 5L6YH 5KS9E 2DBLL 3OZ9L 3ARSA 3WV0A 1ZT1B 4M6OL 4PV9A 2X10A 2X4PB 5C07A 5SWQB 3PXHA 2ZUYA 4E5XB 1Z5LA 4MZ2A 5BZDB 3PL6B 4G6KH 2R23B 2R56H 4NQVB 4XCFL 4WW2B 1MLBB 5JO5B 3OKLA 3MYZA 1UFUA 5T5NF 2OJZH 4YDJA 1S9YA 1ZV5A 4Y5XC 3Q1SH 3KJ4B 5D7IB 2WZPD 3T0ED 3IDNA 1X4ZA 3QG6B 3OJDB 1TENA 1U92B 3PDOA 2G5RA 4XNXL 4K94C 1INQB 4E41E 2DKSA 4NKOB 4OUUA 1QSVA 1F58H 2NX5E 4ENEC 1I7UB 3QH3B 3S35L 5HPMA 1A1MA 3HI6L 3C6SB 5EDXA 4GRLA 3IDYB 4DKDC 5C0CE 2WM0A 3HRZA 2APWA 1LP9A 3CFEA 5FGSA 3KHOA 2CRMA 2DQJH 5ERWA 3RPKA 4KPHH 4K3GA 1RV6X 3DRTB 1MRDL 5DLML 4TUKH 5IEKB 3MUJA 3TT1L 4JFHE 5IBTH 3WXVL 1DLFL 1TLKA 1ZHBA 2P8PA 1QSFD 4FP8L 4JFFD 1YMHA 2AEQL 4N0FB 4F7EA 2VZTA 2BXZA 4ALAL 2DLIA 3CVHL 1E28B 3ZSTA 4ELKA 2ZJSL 3ZTNL 1X7QB 1XF1A 5I9QC 3C6LB 3AXLA 2KPNA 2QJDA 4Y4FD 2LVCA 2NPLX 2GW5A 2MOVA 4BFBD 4UOW0 2YZ8A 3DYPA 4OJFL 5EZOL 3JSSA 3WN5B 4NT6A 2I07A 3NIGF 3ARBD 4AM0B 1IZJA 5TPWL 1RZFH 4H25B 4PJBA 5C08A 1MJJB 4P4KA 3NZHH 4R7DB 1KT2B 3K1KC 4LCYB 5DUPH 4MQTB 1J86A 1CBVH 1U8JB 3ARWA 1J05B 5KS9B 3MRCB 5KW9L 5BS0E 4PJFF 5FUCE 2EO1A 5DZLA 5TDPB 1IC7L 1W0VB 1I7RA 3VA6A 4MAYC 3CXDH 3CDGA 4J3XA 5D1XD 1H15A 2EC9U 3JTSA 2W38A 4U1HB 4PJEE 4ZOEA 2VWEE 2D7MA 1CXIA 2WWKO 2ADFL 3LEXA 4I77H 5E08L 1M05B 3NFNB 4PJAF 3DV4A 4ZQKB 3LH2H 5GS3A 1HOCA 1B3JA 5JW3H 1BLNA 1OL0A 2VDNL 1A6AA 3WL9A 1X5HA 3P4MB 4JY4A 3D0LA 4NSKB 4E41B 3WFEH 2FL5B 4BK5A 4CW1A 4XHJD 3ZKXB 2UZIL 3FT3A 4GQPH 2NX5B 4OFDA 1NCUA 2FEDC 2VTFA 5CJOL 2R8SL 4U4BA 1QNZH 3GJFK 3SKJL 4LOUC 4JO4H 3EOAA 1IILE 5CZVL 3OBAA 1AE6H 1U2CA 3WFZA 2P45B 3ARGD 4UT7L 3RHWK 4QHUB 1HIMH 2F74B 1EHAA 1H3UA 3RWIB 3BD3A 4OCNC 2BCKB 2Q86B 2ZKHH 3WFHA 1IAOA 4HXAH 1KN2L 3TO2B 1MFDL 4QYOA 3QDAA 3NA4A 2B5IC 1Q0XH 1XMWA 2F19H 2D9QB 2V2XB 3BZEB 2FH6A 4LSDA 4D3CH 1DVFA 3D2UA 3QUYD 4PJ8B 1T0MA 1HH6B 1GPOH 4U2ZA 5HVFB 5DFVC 3N0PB 5E00A 5CJXC 5FO8A 5IJKC 2F5AL 4NO2A 2BHUA 2EXYD 4XZUB 4U6YB 4HBCL 4EIZC 4NN7C 2QL1A 2NTFA 4BQCA 2BHZA 4GMSH 4CKVX 5C0CD 3SJVD 3J8F7 4HV8A 1BOGA 1YA5A 3H6JA 4CADA 5E99H 1XH3B 4FQXA 5DVMA 1F6AA 4GG8B 3U6RA 5BS0B 2BP3A 3QUZA 4X6EB 3MQIA 5TDNA 2J8OA 4DCQB 1DANU 5E70A 5TQ2H 2FR4A 3CZJA 3RIFK 4HWBL 4QRSB 2AJZB 1GSMA 3F6LA 1QRND 1FGVL 4ODWA 4YZFE 2I24N 5HJ3B 1XGUA 4PJ8D 2DD8H 3MJ7A 4Y16D 2WQRA 1KBGH 2NY2D 2P49B 3VRJA 1T04A 3RWCB 1JYXA 1QA9A 5I8KH 1TVDA 2HTKC 4MD0B 2YPLB 4U1LB 3IFLL 1MY7A 4JPKL 1YEDA 2BNQA 3H42L 4X80L 3ZDZE 1F4AA 1WZMA 4RGOH 3ARPA 3HA0A 5D2NE 3EYFB 3HE6B 2YPVL 5I1JH 2CQVA 4LKCB 2DS4A 2DJ4A 3N1FC 2DLFL 4PFEA 5ICXB 5FK9A 1MI5A 1P4BL 1RZJH 3IS0X 2X4RA 1Y0LA 4XXCA 1GC1H 5H94B 5IVZB 2EDBA 4IIQB 1JPGB 4KVNL 4TUJA 4UDUA 1PY4A 2LU4A 1DSFH 5I18H 1GAFH 1KPUB 3WIIL 5EZJA 3I9GH 4LPTA 4LVOC 3Q3GA 4PLJD 5DK2A 4J6RL 2N56A 3V0AC 3DSNA 3G08A 5D2LE 1S7SA 3I6GB 4U7MA 5JQHC 1A14H 2GSIA 3BZDA 4MA3B 5J12C 4CVWA 4UTAH 3PWJA 2IPKB 3BQUA 4OZGA 2BC4A 5CEZE 5GSRA 1HN1A 4F9LA 2H2SD 4LFHD 1F90L 3VRLE 4UU9B 2HJFA 4L29B 3HE6D 5DD0H 5DJ8A 5I71C 3GDBA 3HG1A 3ARDB 4H5SA 1VACB 2NXYB 3BVNA 3DO7B 3KDMA 4RMTA 2WMPA 3FO9B 1JFQH 3NCEB 5DUBA 4YK4B 3MREA 2J8UB 5J1TC 1JHKH 2CRZA 4APQB 3D85B 1D6EB 1Z9MA 4WCYL 2I26N 4LHUB 4I9WD 2JCCA 5HBBA 3HZVB 1QFUL 4LMQE 2D31A 2Y06L 4F8TA 3AROA 3GHBL 1IM3B 3JWDH 3LEYH 4UOW1 1F3RB 3STBA 3EUUA 2OJEA 3T4YA 1A7OH 3MUZ1 5EO1A 5I1DB 3OB0K 2HJKB 5JNYA 4MQSB 5EBLA 3T1FA 1UM4L 1J0JA 2YUXA 4RNRA 3OX8B 4OT1L 5DJDB 1PLGH 1MCPL 4U7SA 2Y25A 5ESAA 2QSQA 3F7VB 5CUSH 3RWDA 1MIMH 2XWBB 2NXYD 2VL4A 1KSRA 4DQOH 1SVCP 1VKXA 2OP4L 5D2NB 5F9JA 5T1DL 2O5ZL 2PNDA 5HYQB 1CD8A 4LVHC 4XNUH 3L6FB 3K4DA 1UWXH 3AFLA 4PP1D 1UJ3B 2QQLH 4KK5C 4TNVF 2FYYB 3HPJB 4ZOBA 5EOCH 5GHWL 3G5ZA 3VXOB 2AK4E 1MJ7L 1K5NB 4CMMB 3RVTC 4MDIA 4I5BA 1YEHL 1BD2A 4JO1H 5BW7C 1BVZA 3PHQB 4JJ5B 1Z9OA 5D2LB 4NM8H 4O2FB 4RGNE 1BZQK 3SDCC 3VH8A 4TVSa 1U58A 5DJ2A 2B4CH 1EEYA 5F8QC 4DTGH 4PJGF 5ENWA 4LLQA 3FRUA 4LBEA 4PJXA 2P42B 1I8IB 3GI9H 6FABL 3ZO0A 5LWYH 4FXGA 4HWNA 1P5VA 4OBRA 2IH1B 5C0AB 2HRPH 2X1XR 2R9HD 3JWOL 2X4NA 4KV5F 2V9TA 3MRBB 3NIFE 4KH2A 3L3HB 1IGMH 5AAMA 4K8RC 1CCZA 3RVWD 1R3JB 5F7YC 1P53A 5DTFB 4A6YB 5EIIA 5HDOA 2V9RA 4X6FA 2GCYB 3CPLB 2DIBA 4J3VA 1TCMA 1XZ0B 2OM5A 2CIIB 1EEZA 2VQUA 1X9QA 1PFCA 4FQIL 5CEZD 1MSPA 5GRWA 5FDYA 3EDJA 2J4WH 3KR3L 3AU1B 5E6IC 3C2SA 5I30L 4KAQL 1KJVB 3NCJH 4S1DD 2CXGA 1NUFA 4XCCH 4IOIA 3RTQB 3VRIA 2VH5H 3F12A 1U41A 3U7AA 5HGBA 5TE6H 2BMKB 4FG6C 3TH3T 4B41A 1NFDF 3MLTB 4FQCH 3I3EA 2O5XL 2HN7A 1DUZB 4PY7B 2CUHA 1UQSB 2HVJA 4FZ8H 2ED8A 5KZCD 5C6TL 3RNQB 5L2JA 5I8OL 4NHUB 5JIIA 1RZKH 2JJVA 4R0LB 1Z9SA 4P9HL 4DVRH 3LRSA 4K7FA 1N64H 3HUJA 1FO0B 4N0YL 3U46A 1N59A 5GZND 2CLRA 5IVXF 2WP3O 4NP4H 3E6FA 3VG9C 5DDHB 3BP4A 5KSBA 1YY8A 4LEXH 2YHGA 2FJHB 1CGSL 2VXUH 4TVPL 1IC5H 4QXGL 3D0VB 1ACYH 1EEQA 2FJGA 4OFYA 2VR5A 4ORGB 2EDLA 2OXGA 3ILPB 4W4NA 4YGVB 3U2SA 5TDOB 1T20B 3UJIL 5CEXA 3FB8B 1RJLB 5INDA 4PBXA 4LGRB 2BK8A 2CGRL 1FVCA 1S8DA 5FUZH 1T03L 3EOBA 1U8KA 1VFBA 1BFTA 2BNUB 2BOCA 3ZE2E 4DW2H 3ULUH 2IBGA 2XTJE 4N1CA 2AK4D 1CGYA 1LO5A 1SJEA 5I73C 3GFUA 1MCOL 1EDQA 4FA8A 1UYWL 4JREC 5B21A 2GJJA 2CDGB 3L7FA 3O2WH 4P2QA 1FSKB 4R26L 2YRPA 3S7GA 2IFFH 2E6PA 4RGND 3N1QC 5F3HB 3HLAA 4IMKA 1MFNA 1JGDB 2BX5A 1MJUL 3GMNB 3QUML 4WO4D 2GQHA 1XT5A 4TNWK 5AWNH 3VJ6A 3P9LB 1H8SA 4WI6A 2HLAA 1OVZA 3SGKA 4ZFFB 5FO7B 2ESVA 3MRGA 1R24A 2R0WL 4PJIB 2BNRA 4MA8H 5F7DA 3T0EC 2ADJA 3AB0C 5TFSH 1WBYA 3MV8A 2WLZA 4X7FC 2HYMA 1HH9A 5DQJB 3PGCA 3O2DL 2NNAB 3SOBH 1ETZB 2YD1A 3X12A 4M7KL 3WIHL 1RMFL 4LLAA 1BJ1J 5T1LD 1CT8B 4JDVB 4L4TA 3SPVA 3WLWD 3WS6A 1FBIL 3PV6A 4TN9A 4UZGA 1X3DA 1PYWA 4MJ6A 3G5YB 2B1HH 2CDEB 2VXTL 3G5XA 5IW6B 1BZ7B 3OV6A 1AQDB 2G2RB 3EFDL 4MB4A 2OYPA 3RFZC 3LB6D 1EMTL 3HZYB 4M1GH 3W9DB 4YHNB 1IE5A 1JVKA 3F5WA 1LHZA 4WW2C 2MPAL 4G80B 2HWZL 3F7YA 5DR5L 5HXMA 1AXTL 1OP3H 5MERA 1ACZA 5MP6L 4QY8B 2NY3D 1MAJA 1GIGH 1N26A 3KJ4C 4IMLA 3KYKL 1J9CT 3MNZA 4R4ND 5DD5H 1HHIA 5JW4N 3TPKA 3ZDXF 3PWLB 4NRYB 2A74A 3QNXB 3PQYB 2AP2A 5EUOF 2D0FA 5K9KA 1CVRA 2D2OA 2Z93B 4PB9H 3RGVB 1ZANH 4XCEB 3BH8B 5LAXA 2VDKH 4DGVL 4U1IA 4LCWD 4Z0XA 3VI4E 2D7TL 3W0WB 3C8HA 3FQRB 4DAGH 3L3OA 2CLZA 2MSPA 4L8CA 4ONGL 2GTWA 1OAQL 3MXWH 3QULA 3MV7A 3RNKA 4FMFA 5T5NG 4Z0BH 4X7EC 1B2WH 2V5MA 5KVFL 3CFJB 4EDWL 1GGIH 2X70A 4Z7VF 1CFTA 3CDFA 4OKVA 3CFCH 5CCKL 1CVSC 1T7WA 2NLJA 2EDHA 5D1XC 2A6IB 2CRIA 2J1KA 3NPSB 4JDTL 5BMFH 4O9HL 1JZ8A 2P1YA 1I1AA 1ZWIB 4G9DA 3K81A 1JYVA 3OGCA 3QPXH 4LF3B 5B39G 1SEQL 3VFOA 4U1KA 3RGVD 5CWSB 3C6LC 3Q2CA 3TIDB 3X3FL 4W81A 2VOTA 2P8MA 2ZUXA 2ZUWA 5CJQH 1D5IL 2XTJD 1QEWA 3WN5C 1WZ1L 1K8DB 1YN6B 5DYOA 2GTZB 3H2WA 1MFBH 5D7KE 4PJ7A 4JCMA 4GMTH 1OAKL 4ZFOB 2PCPB 4YHML 4R7NB 2YD5A 2EYTA 3BX7C 5JXEA 1FYTA 1L7TH 4BQ8A 2C3WA 4QRTB 2ZPKL 2P46B 3OAUL 3GI8L 4YR6B 4FQLL 3UO1H 4OD3H 2UYLA 2I5YL 3L1OH 4LSRH 3V7MA 1E6OL 35C8H 3AREB 1JF1A 2NMSA 1S7TB 3QBTB 1JIBA 1KCUH 1P2CB 1P84K 3RKPA 3BZ4A 2A9ML 4QTHB 4X8JA 1LE5A 2GJ6A 4K2UH 4PLOB 3ZKXC 5E8NA 4LPXA 3FZUD 3MBEA 2AJYH 1A6PA 5DO2C 4PB0H 3EGSB 1NANI 4HH9B 5JW5B 4I8DA 3BZFA 2WNGA 2EXYC 2DIAA 1OAYH 1I85A 1ES0B 5KVDL 2RFXA 4BQ6A 4WWID 1EAPA 3BD5A 1QPPA 4ELMA 2BVOA 2B39A 4Z77A 4KTDH 5E7BA 4RFOL 3U9UA 4IRJA 2OJZL 4I0PB 3JVGC 3D5OF 2A6KB 1R0AL 1KCSH 3Q1SL 1BHGA 4JAMB 5CLTA 3AS2A 4HIXH 1DCLA 1MY5A 5ESVA 1RU9L 1CICD 5GGRA 4M7LT 5MEOB 2AQ2A 4EN3A 3QJHB 4HG4K 4WHTA 3GBML 3HC0B 4S10A 3ZTJH 1F58L 1I8LC 5DD6A 4PJ8C 1FLTX 4BJLA 2NY2C 3V4UL 3VI3E 4OF8A 2X05A 1YN7A 5JIPA 3MJ8A 1OD7A 2HT4D 3DXAE 2DQJL 4I0CC 3VXRE 1T80A 4WHYH 1U3ZA 2EZ0D 5CKAA 4L4VE 1FAIL 4I0PD 4GW1A 4PJHE 4PG9B 3S6CA 1AFVH 5FUCC 4XPAL 4FNLH 4P99A 3HR5B 3VMPA 3SDXA 3QCVH 4UQ2B 5ADOH 1L0YA 4MJIE 4NBYB 1FFNA 4OCRH 2NW2A 1NFIA 5FA4B 5E8DL 1NAML 2VWEC 3NN8A 4G42A 1SY6A 4P2RA 3BW9A 1AH1A 3ARZA 3VFWB 3RKDD 3VGBA 5JMRA 5JLZA 3LOWA 3WJLC 4PGZA 2FLRT 4L8SA 4P57A 4OLZL 5F6HJ 1YPZE 1HEZB 1X44A 5C0DB 3AS0A 1RZFL 1SBSH 3KPMB 3VD9A 1F45A 2GAZB 3UC0L 2H2SC 4HIIA 4Z7WF 2J3SA 1JZ7A 1CBVL 5D7KD 5ACZB 4D9QE 3HE6C 1JGVH 4HQQL 3TO4D 4WFEE 4D0BA 1IKFH 3MXVH 4HKBA 5F9AC 1I9IH 2VZ1A 1R3IH 5EN2B 2Z8VC 4K23H 1WV7T 1C5BL 5DGQA 2F53E 3IFNL 1WTGT 5EC1B 1DZBA 1MLCB 4CMHB 1UADC 2ICES 4IIQC 2P5WE 1K3ZA 2XY2A 4TSBL 1H3PH 5GGSB 5ICYB 3EJZD 1JL8A 3R8BB 1VGEL 3QA3B 3C9NB 5DEFB 2QBWA 2AABL 3PWPB 43C9B 3G6JF 1LDPH 5GS0H 3BOVA 1JRHH 1NBZA 2XG5A 3NZ8B 1IAMA 3MUHL 5D6DC 5CD3B 5GSVA 4X6CB 1ROWA 3AAZA 3ULVE 3ME0A 1RZGA 4U6VH 1AE6L 1MHPL 4YAQA 5BV7H 5EO9B 2AJVL 5FCSH 5JOEA 2F58H 3PWUB 4EKXA 1BFOB 1G7MB 1IQDA 3G04A 5I16A 2NXYC 5IHZB 1AIFA 2LAGB 4DGIL 2BSRA 1W0YT 3VXRB 2ZKHL 2VIRB 4JQVC 4O4YL 1U2HA 3QEHB 3RA7H 3V0WH 1NBYB 1MF2L 2V7HA 2H1PL 1TTFA 4PJHB 4APQC 3VXTB 5MHSE 1G9NC 4KI5C 1Q0XL 1DQMH 1I8MB 4ZS6D 4JFPB 2J12B 4BK4A 3AUVA 2GUOB 4MJIB 3W2DL 4HUVA 1GH7A 5ALBH 3W5MA 15C8H 3UYRL 5D7JB 4NIKB 4HDIB 4Q9RH 1D9KD 3UTSA 4QCIA 2YKLL 1TVBB 3NCYP 3SE9H 5IMOA 3MR9A 3S36X 2X40A 3PABB 4OV5A 3U7YL 1N6QL 5KAQG 5GGUB 3LN5A 1YPZB 2FX8H 3WFCH 1U8QB 5CMAB 3HNTL 3KPLB 4Y0GA 3DXAD 3SCMA 4HMCA 2BVUA 5D2NC 3VXRD 3U1SH 3RI5F 3MNVB 3X14A 3LY6A 4L4VD 3MRMB 5IT2H 4QF1B 4JRYA 1KXTB 3FHQA 1IEBA 1AKJA 1UJ3C 2CLVA 1YJDH 2D0HA 5DFWH 2R9HC 2J6EA 2F53B 2X4OA 4LEOB 2EICA 3O6ML 2BVQB 3MCG1 3M1BB 3GSWA 1HNGA 2P5WB 3SN6N 4MJID 3RVWC 1I9JL 4NZJA 1U93A 3QXAB 1CIDA 4L9LA 4PJ9B 4F37K 1PGRB 1UVQA 2FJFB 2EH7L 4H26A 3L5XH 4ISVA 5I8KL 5L2KD 1XIWB 3IYLW 2Y5TA 4M9OA 3NA9H 1T6VN 1QHPA 3UBXI 3MACL 2A1WL 5IVNA 2E8YA 4YLQT 2RR3A 2HT3C 4OSUH 3V6BR 2NY1B 3TYFB 5E1AB 3SKOA 4JM2F 5FB8A 1NMCB 4TULH 3IDUA 1ORQB 1B0WA 2HJLB 1UH2A 3HS0A 1AD9B 1G6VK 4D9QD 2EYRB 4R8WL 3IVKA 4WFED 5DHYA 4Q58C 5E1HB 1OF2B 4AMKH 3QO0A 2AI0H 1FN4B 3MRRA 1TVHA 1KIRB 1UEMA 1QLFB 3T4AA 4NQUA 4BKLB 1GAFL 5INCA 4JPVL 4MQ7B 5KTEH 2P5WD 3WS3B 4MA1C 5E8PA 4J1UA 4U1NA 1IGFH 3TBTA 4PJ9D 5FECA 3JXAA 1MCFA 3LDBB 1XF5B 5GZNC 2MHAA 3MUY1 5FKPB 3IJSB 3FOLB 3L3DB 3N85H 2EYSB 1UZ8A 3LQAH 3S3JA 5DD0L 1F4WL 3H9YA 1RIVL 5GGQH 3RTQC 2HLFC 5TGBB 4NQSA 2XZQL 3GIVA 5ISZE 2VQTA 3PJSB 4TTGA 1DDHB 3Q6GH 32C2B 3S96B 2Z31D 4OZHF 5KBNC 2R0LL 1BX2B 4G5ZL 3TA3B 4LVEA 1MH5A 4KDWA 5T1KA 1JI1A 3ELAT 3QFDA 1TTUA 2CR6A 4R0LC 2OS7A 2NY5L 5FYKH 4KRPB 3JZ7A 1KXVC 4NFDA 2XN9E 3MLVH 3S34H 4MJ5B 3GSUA 4U1SB 3NIGE 1E27B 1Y18B 2MCPL 2R69L 2Y7QA 5F1NA 4WV1A 5CHNB 2Q3ZA 3RWGA 4LCIL 5D1ZD 3BE1H 4QOKE 2ZG1A 3QI9B 4JFZH 1F3JA 1IRAY 1II4E 3O3AB 1RUQH 2R2CA 4GKSA 1A9EB 4PJFE 3UZEA 4UILH 5A16A 1RHFA 4HKJB 2EDKA 4K3HA 5EWIL 4Z5RA 1HDMB 3ARYA 3DYOA 2NW3A 1P7QD 5LG1A 3VXNA 4U1GB 2VSCA 1JMXA 4XNUL 4KDTC 4N5EC 1EO8L 5BRZE 3HZKA 3QEGH 3W81A 3BYYA 1EGJA 2QQLL 1X5ZA 2YBRB 5KSUB 3DX6B 5HGHB 1NGYA 4DZBA 3BXNA 3KYNB 1YYLH 3MOAH 3SDAA 2DYPD 1T1XA 5B4MD 2XKSA 3MRDA 1T22A 2FATL 5A3ID 4NCDA 5EH1A 1ZMYA 1TJHL 1NCAL 1N8ZA 1OARL 1RIUH 3WLWC 5MEND 2FWOB 5D1QA 4F7CB 3QI9D 1Q0YL 2HP4A 4R4BA 1FSKC 2B4CL 3I3DA 2X4UA 1MAML 1J1PH 1KTRL 2OQJB 4HC1A 5IMMA 2I9TB 3GZKA 4KZDH 5MEPA 4G6JL 3CSPA 3OKKA 4NJ9H 4O00A 4ERSL 2GK0B 3N06B 2BJML 4PTUB 5EU6B 4WWKA 3MRNA 5C2UB 2NY3C 1QO3A 4OZFA 5IMKA 1J8HE 2K7QA 2VDMH 4S1RH 2WUCH 3FO1B 4MMZC 1I75A 1AO7A 1U8MA 1ZA3A 4WFFE 1GZQA 3KPRB 4ODVH 3Q5OA 4XGZB 5JPMA 2DTMH 1JPTL 3SGDH 1A6ZA 3FB5B 3MLSL 1NUDA 1SYVA 2AEPH 2OZ4H 1NMAL 3NIDF 4JFEA 2W0FA 1AR2A 4JGMA 2J4WL 5E6IA 3H9SE 1UXWA 3RWFB 4O2CA 3TV3H 3MTRA 5J9PB 4QOKB 1HINH 1PZ5A 2B1AH 3SE3A 1FDLL 3QFJE 4XXDA 3N50A 4P23D 5GS1A 2IEPA 2XZAL 4PLKD 2H3NA 1BIHA 3GKZA 4OQTL 1GZPB 3U0WL 5ISZD 4HIHB 3QO1B 4FQCL 3THML 2GHWB 4EI5A 3VFTA 3VFRA 5J06A 3ZYZA 1HHHA 1RULH 5EIQA 3R8QA 4R90L 1KIPA 4S1SH 5TE7H 5IV2B 4Z7QF 3IGAB 5DJYB 4M48H 3DETC 4HGWA 3DGGB 5E5MA 2BFVH 4LSQH 2DL9A 3RGVC 1G6RA 3T09A 1S7QA 1CE6B 3H8NA 1FFQA 5HYEA 3QCTH 1YEGH 1JYWA 2EDEA 1CFSA 1HYRC 1JJUA 4YNYB 2IF7A 2XN9D 2XTJC 5EBMA 1T83A 1MCLA 1ZSDB 3MV01 4HIEA 5LGKA 5SWZE 2ZOKA 4WRLA 3P40A 2X89D 2VAAA 4MDJB 4QOKD 1V5JA 4XNQB 1DEDA 1M6OA 2W0LA 5C0ND 3OAZH 1PG7L 3M8OL 3FFDB 1ZXQA 1K6QL 3NPSC 1G7PB 4FN0A 3E0GA 4K7PY 5IIEA 1INEH 5TF0A 2ORBH 2GFBA 4NQCA 5LXGH 1S7VA 4GAJL 1M7XA 4RIRB 3OKOB 5BRZD 3OJMB 5IFJB 5ETUA 3RWJB 4NZRL 4F15B 1J8HB 3C87A 5C0JB 3G6AB 5BQ7B 3ULUL 3HNVH 3V6ZB 2PO6D 4IS6A 2AXFB 4N0RA 4JQIH 2DWDA 2YXMA 3Q6FA 4HFWA 5EA0H 5HHPB 2P48B 1G7HA 2F54E 3FZUC 3ZYIA 1BREA 2EE9A 2DQFB 4D94A 1D5MA 2AQ1A 3O2WL 4PRBB 1VFMA 4JHAL 4E42A 4CVZA 4DN4L 3DVNB 4MSWA 1TTGA 3PIQB 2UWEA 3H9SB 2P43B 3IF1B 1JMZA 2VQ1A 3U4AA 3FN3A 3MRKB 4UTBL 2W0KA 2C3VA 5I1LA 2EIBA 2YS4A 1QKZH 2ZWLT 1HCFX 1IEAB 3AREC 4XNYL 2P8LA 2X4TB 3SBWC 4XNMA 3LHPH 1J1OH 1DN0A 3FQXB 5D93B 1J8HD 1OLLA 3MRQB 4NZUH 4YDIH 5DC4B 3MODL 5GS2D 3TH4T 4UT9H 4YBHA 3SGJC 3AM8C 3CVIH 3L3KB 4NQDD 4RAUB 1EVUA 3S5LG 4X4XB 3MX0A 5F9WB 1U95A 1X6NA 5I66B 3GB7A 4CU8A 3RIAK 3TBYA 4YDKL 1NGZA 5KG9A 1I8KA 2HT4C 1VGKA 4WU5A 2ZG2A 4JHBA 5SWZB 2R23A 5C2BL 3O6KH 2F8XC 5LGJB 5DSCA 4GXVH 4GW5B 4I0PC 5EZIH 1T89C 3QFJD 4UDTA 1KV3A 1VPOL 2YMXL 4EIGB 3S88L 4EXKA 3DBXA 4XB7A 4DKFL 1QSFA 2L0DA 2GJZB 4JFFA 4Q9QH 4X6BA 3RZCB 2YEZB 4R9HA 3H9HB 1LE9A 4FHBD 3BKMH 3B9EA 4C83B 4GFTB 3CC5A 1JN6A 4PB9L 4I3SL 4Q2ZB 3RKDC 3KYOA 2OX5A 5HGDA 3RGHA 3KPSE 4Y4FA 4KRLB 3UX9B 4Z9KB 3SDDD 2A9NH 3MYJB 1YEIH 2DAVA 3JUZA 5HHXL 4K9EL 3WHXB 3ARBA 1E4XI 4OGZA 4NFBA 5DHVA 5CBEA 4ZUUB 4N68A 4PJGE 4UV7H 2F54B 5AZ2L 3ZZ1A 1RUAH 4WU7A 3ALPA 2V7NB 4XPHH 3HFMH 4GAGH 4Y1AE 3IJHB 3LRHA 1QLEH 1E6JH 4WNQA 5E2WL 4U1MA 1YDPB 3TO4C 1D5BB 1DBJL 5CGYD 4PP2B 3UTQA 5D1XA 3I6KB 3VXSA 5HHQB 2WBJB 3P73B 2DQDH 4OCSH 1IM9A 3P77A 3EJZC 4GLRH 1IAIH 3FCTB 1CGUA 1ZVYA 3U0PA 1RURH 2C5DC 4NO3B 2MKWA 5DA0B 5KSVA 4L8BA 1MCDA 3RPIB 4NKMB 3TCLA 3SDYH 3VW3L 4J3WA 4DN3H 1PZUB 5DUMH 3IETB 3LS5L 2M8XA 2M26A 3MFFA 4S2SB 2F54D 1S7WB 4GMTL 5J6GA 5GJSH 3ARGA 4PGBB 2Z35B 4LHJB 2WBKA 4V2BA 2BDNH 3MV9E 4G8EB 5GGVH 1Z9LA 5D70L 4YUEH 5DWUH 5GRUL 4XMPH 4OD3L 2YPKB 2ERJB 4CMHC 2X9YA 3DURB 2JJSA 3IKCB 2WBJD 3L1OL 3LKSB 2R1YA 4NDMB 4B5EA 4OF0A 1EGJH 1LGVA 1KCUL 4H1LA 4IM8A 1LD9B 4ZS6C 3QNYB 5CILH 5IW1A 3B3IA 2H8PA 1ZGLP 3QUYA 4G8GE 2GY7B 4XWGL 4K2UL 5KN5A 3DVIA 5IVXE 2C1PB 3TWCH 5DK3A 1AQKL 5HSFA 3KPSB 5FDWB 3RIFF 4OGAD 3CX5K 3W39A 1UG9A 1F4YH 4JRXE 3T0XA 5DQ9B 5TJWK 4LRNH 5KANI 1LEKB 3DX8B 1UACH 1S7RB 12E8H 1U6AL 1Q1JL 5F7NC 2NXZB 2BVYA 5C0CA 4JPWL 3SJVA 3WLBA 2VUOA 1AGFA 4WEMB 3WIFA 4HC1H 4JPIA 1TJIL 3KNBB 2ATPB 5EU5A 4OZIB 3V5DA 4OZFH 3ET9F 1QRNA 1DEEB 2UY6A 1PAMA 4MMXC 2RB8A 2E9WA