1BPVA

Titin module a71 from human cardiac muscle, nmr, 50 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
b'SPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN
publication title The three-dimensional structure of a type I module from titin: a prototype of intracellular fibronectin type III domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Connectin
total genus 8
structure length 104
sequence length 104
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bpvA00
2VDOL 3MUJA 1P7QB 3P9LB 5E4IA 1HHIA 4L8DB 4NQDD 4DTGH 5L8KB 3HNSH 5F8QC 4PD4J 1MCBA 1SEBB 3TESA 4IHOA 1JHLL 2X89D 4U1NB 2YRZA 2PTTA 3U9PH 3ZSSA 1P5UA 4ZS7H 4HWZA 1KB9K 3GZKA 3QUYC 5AZEH 5JNYA 2BHZA 1VADA 3VA2C 1JWSA 3CFCH 1YMMA 2UVFA 4KQ3H 4DQOH 5EU5A 3TIDA 5ADOH 5AEAA 1I9RL 1BBJB 4UB0H 4Z5RA 3IU4L 3GSXA 4HSQA 4YDLB 2MJWA 4JHWH 1BMGA 5C0FB 5IJVA 1P84J 4D9LL 2VRAA 1C1EL 3OHXB 5IHBA 1N3NB 1T22B 3DROB 1OGTB 2KUTA 3N06B 1JNLL 2GUOB 4R97C 1BQSA 1ZAGA 4WO4B 2ZCHL 1ED3B 3UBXB 4JAMB 1IJ9A 2DWDA 1CFBA 1EZVY 3P73B 3MRQB 2D03L 2HLFC 3DSNA 1ZHLA 1R24A 3BH8A 5T1LB 4UDUA 4X6DB 2FIKA 2AXJA 3QEGH 3BWAA 3K2UL 2Y36H 2E27L 4NN6B 5GGSY 2PETA 4MNHB 3WLBB 4APQA 4LHUD 3MLUL 3MA9H 2BOBA 2XZAH 4S0TD 3QEQA 4QRRB 1CTNA 4O5LH 5EA0L 4H1LH 3GMMA 4N9GB 3H7BB 4U1JB 1MY7A 2PTUA 3O8XC 3X11A 4KC3B 2Q8AH 4F8QA 3S96A 2OX5A 3BH9A 3DETC 1P4IL 3VCLA 4RWYL 2VDKL 2UV3A 2Q76A 1CFVL 2AJUL 3KPRE 2O5XH 15C8H 3TPKA 3VXMB 1RIVL 1E4KA 3B3IB 1A3RL 5EBLA 4PJAE 4XRCB 2G5BB 1ORSA 3T04D 3DUUA 4MA1B 3NA9H 4OSUH 2X2YA 1X44A 3SDAC 4JRXD 5DQDL 4ZUWA 3V5HB 4C57C 1BVKA 2A9NH 2ORBH 4IRZH 3EOBA 3TCLB 5GISL 1DLFL 1RZJH 2L4OA 5KANG 4U6VL 4Z0BH 3FFCB 2EE6A 5DFVC 3V6ZA 2D7PA 3EYQC 5HDBE 4KK5D 1PJ9A 2FHFA 4AIZB 5IB2A 4EXKA 5J0BA 2V2WA 3VG9C 2DMBA 2DWEB 4LLYA 3C5ZD 4LBEA 4WENB 1UXWA 2WAHA 4OCYL 4HIXH 4P2YA 4QRSA 1GHFL 1UJ3B 2VLKD 3IDYC 4LPVA 1FFOB 4UUJA 3HB3D 1UADC 5E1HB 1QPXA 5I75C 3DV6B 4QEGA 5DJ2B 1MCFA 4XPTL 1JN6A 3WNNA 3CX5K 4D0BB 4WV1A 4FTVD 3O3BA 2UWEE 2MMXA 5DFWH 1G6RL 2V5SA 2W9DL 4XP1H 2R2CA 5AZ2H 4JO2L 4I2XB 3MV9E 1KNOA 1GGIH 3JWOH 4ZXBD 3C8DA 5A40E 4AEIH 1X5YA 4OB5H 3JV0A 1QP1A 1HCFX 1MHEA 4O9HH 2BSTB 5E8NB 2V5TA 3FRUB 3ULVF 1NCCL 4GG6A 3GSOA 4G8IB 1MJ7H 3PL6B 2H2PD 2ZKHH 1XIWB 3ARGD 4OTXL 1SBSH 4LLWB 1GGBL 2EYTA 3P0VH 3KWWA 1YEIH 4YXKH 2VDQH 5C0IB 1QVOA 2QHRL 1YNKH 5IMLB 2Q86A 4TTDD 2BC4A 2NXZB 4M6NL 5EC1B 3MRRA 4MJ6A 5CAYB 4JFFD 5D7KE 5D4QA 4X4ME 4WNQA 4HJGB 4LHJB 4GLRH 2QSQA 4QRUA 5C8JB 3C5JA 1A0QL 4X9IA 2FR4B 4HWBA 1C5CH 3LKSB 5CGYC 2FJFA 4AZ8A 1IEAA 1NJ9A 1E4WH 4QRPB 1VFBA 1OP3H 3RBSA 2VDRL 1A4KA 4AH2B 2YR3A 4Z7UA 3O3EA 1OTSC 2DLFL 2YZ8A 4XCFH 3L9RB 5CUSL 1M05A 5IP4A 4G6KH 4JCMA 2DQFA 3O4OC 2O5YH 2YA0A 3C6SB 5EIQA 1IAOA 1I1YB 4XVSH 2GITA 5HVGB 2V9QA 4N8VG 1F8TL 1HSAB 2YC1B 1HK6A 5HYQB 1KJ2L 4OZGA 2QHLA 2JF1A 3N1FC 4WEBH 4OGAC 5C0EA 2ADFL 3MLRH 1FV1A 3CDYA 3S5LB 3OPZH 4BH8A 5GS3A 1L6ZA 2EYRA 1EXUB 3DVGA 4GO6B 4JFDB 5EZIH 4M93C 1FL5B 4IM8A 5KOMC 4RMTA 2BP3A 2X4RA 2F5BH 1XGYH 2YD8A 3UMTA 1MREH 1WWWX 4DZ8A 3ILQC 5MP6L 3QQNA 5GS0D 3MCKB 2XWBB 4N8VA 2YBRA 2OTWB 4JVUA 2I9LA 4JGUA 1FNSL 1H3VA 1IAKA 4RGNE 4EN3A 3SDXF 4AL8L 3F7VB 5TF1L 1LNUA 3CX5J 3F6LA 4JE4B 1Q9LB 1KIRB 4M6ML 5KW9L 4RFEA 1OGAE 3SKNB 4Z7QF 3RWDA 3RP1A 3FO2B 4MD5B 3RIAF 5EUKA 1J86A 1LEIA 5HHQB 1N5YH 3NCEB 2NY7L 3RWGA 1RFDH 1MY5A 4JFPB 1ZGLM 4GRWF 2EO9A 3DRQB 5JA9A 4GXUM 3KGRA 5J6GB 1ZT1A 1NL0H 5FO8B 1I7RB 5HYJE 3W11D 1S9VB 4YQXH 5DZNA 3QCTH 1MRDH 4C59B 2E6QA 3ORJA 3EHBD 3WHE1 2AGJL 5HTSA 1W72H 5IM7B 3P9WB 3REVB 4K8RL 5DEFB 1I1AD 1MWAB 1GZQA 2NYYD 1T1ZB 3VXQB 2IH1A 3ROOA 4JFFA 4M7JH 4LU5H 5DHVH 4RAVB 4WU5B 4XB7A 4ODHL 1G7IA 3VXTA 1BREA 5BQ7A 1NBYA 4NWUH 5HY9A 3V4UH 3P4MB 1LHZA 3LEVH 3GBNH 1J0YA 3FOLB 5E6IA 4ODWA 5T5FH 1FLRL 3MLTB 1FYTB 4OZFB 3L95B 3X3GH 4FABL 5CJQL 4EI6B 4PJ8A 3E8UL 4MVBC 1J1XL 1U9KA 2FWOA 2HKHL 3ARFD 3ET9F 2A74A 1BFOA 1Y18A 2GJ6B 5JHDD 4KJPD 4PJGB 1UKSA 4NBYB 1MCDA 3S37L 5FA4B 1G7MA 1UWXH 4M61A 4YE4H 4DKEH 3S4SB 2W07A 3JTTA 3KLHD 5ERWA 4OM1H 1NC4D 4TNVK 3OKEB 4F37K 2H3NB 1MI5E 4LPCA 3MUY1 3O81A 4P46B 4EVNA 5J11C 4HT1L 1HQ4A 2Y5TA 4WUKL 2EXWD 4WY7L 2EDLA 4HXAL 1G7LA 1OP3K 2UZIH 1IM9A 1Q94B 3H0TB 3KLAB 4C55A 1ZLSH 3FB7A 43C9B 5FB8A 1UYWH 4GMTH 4NFDA 2HN7A 3DYOA 5T1MB 4H26B 3IF1A 2HWZH 4XWOD 1EHAA 3EOTL 5DUPH 5I8CA 4Q9QL 3QDJE 4KI5E 5EDXA 3NIGE 3OGCB 3MRCB 1QRND 3MUGA 5CZXC 3RQ3A 5LGHL 5BZDA 3QCVH 1YUHB 5ICYA 5GGUA 3LZFH 1DBAH 1JF5A 4NZRH 2G5RA 3IDGA 1CK0H 3ISWA 3FONB 1LWRA 1A8JH 1Q0XH 4GRLB 2JJVA 3GSUB 1F6AB 2F53B 4M62L 3QEHB 1H0DA 2W0FA 4WEMB 3AM8A 4YBLB 4JM2D 1I4FB 1P69B 1JF6A 3CCHB 5DO2C 4B53A 3DI3B 2RR3A 1KFAH 3BPNC 4BFBD 4IDJH 5FDWB 2Q3AA 1U8JB 1BLNB 1P1ZB 2WIMA 4ONHB 1JZ6A 5DLML 5KSBF 3TBWA 3VI3F 3B6SA 4TVPE 4HK3N 3WFCH 3WS6A 3F7YB 3QWRA 1U36A 1UQSB 4I0CC 1AJ7L 4WTZG 4TOYL 3NABH 3U0PB 4CMHC 4OFIA 4O2CB 1DN0A 5FF6B 2HTLD 2ZOKA 5BVPL 4PJ9D 3QI9A 4XBGB 3HMWL 4NBXB 2FYYB 2LV4A 4XBPB 5DT1H 4KZEL 1IMHC 1IGTB 2FEEI 5E70A 3GHBL 4M7LT 2BRRH 3ZT7A 3HC4L 4EKXA 3VFWA 4OZHE 2XXMB 1I1FB 1MHPL 4LGSB 5AD0A 5B3NA 3BT2H 3ZDXE 4NC2B 1RJLA 5KVEL 2P8MB 3DMMB 2LVEA 3M07A 4WRLA 2GFBA 1W8NA 1GRWA 1F5WA 3TN0C 4FQ2L 4NKDB 9CGTA 2HTKD 2XFXA 3ROLB 1YY8A 1I9JH 2H6PA 3KG5A 4YHLH 3S3JA 2EH8L 4WTZA 1FO0L 1A5FH 3CFJB 4W70A 3DUSB 1SM3H 4BKLB 5ENWB 1KCRH 5A2KH 4MNQD 1NFDA 4YDJB 3CFBA 2DQCL 3QPQC 3HTLX 4O2FB 4H0GA 1J11A 4P2QE 4F8TA 5BVJA 3UTPE 4O4YL 1AGBB 3ZLQC 3D3VB 4Y5VC 4F3FB 1DDHB 4WHDA 5E4EB 2WUCL 1HH9A 2A9ML 1BFVH 5C0CE 3LSOA 4FQ1L 1CL7H 3U30B 3HI5L 5IROC 2XTJE 1CD9B 1A6TA 1Q9KB 2VL5B 3O3DA 3FQUB 3RY6C 2X4PB 5C0AE 3L3DA 4NQED 1RIUL 3ARED 2OTPA 4OLUH 1FVEB 3W2DH 4QGTA 2XQYK 4GXVH 1MCKA 1Y0LA 1V7NL 3B9AA 4HGKC 4ERSH 3OWEA 1CXLA 1UWXK 2DBLL 3A6BH 3TO4B 1TQCB 5K9OB 4PV9B 1R3JA 1QRNA 1RU9L 2AK4D 3ETBF 2OTUB 4LSRL 4WW2C 3HI6L 1FLTX 5DEZA 1UCBL 3UC0H 2OZ4H 4R4FH 3UTSD 1L0QA 3CMOL 4HS6B 3W5MA 4MXQD 4K7FA 4JM2A 3HZMB 3G5ZA 1YEGH 4W68A 1OD9A 4YDKH 4L4VD 4I0PC 2X4NB 5JR1H 1TJHL 4L8BB 1LEKA 5C0BA 1CDBA 4R4BA 3T0ED 4KJWC 3KPNB 5BO1H 1D6EB 2ZPKL 2ILLA 3CLFH 2NZIA 2XQYG 1JRHH 2WMPA 3L5HA 3EDJA 1FAIL 3D9AL 4M4PA 4U1MA 1W72A 2A77L 2J8HA 1I75A 4M48H 2YOCA 1RUKH 3RZCA 4QLRA 4F33A 1JGUL 4JZJA 5A2JH 4P5TB 3MOAH 4UT7L 5CWSB 5DHVA 2CKNA 2RCSH 4HK0B 4V1DD 3V6OA 4JPVL 4YHYC 1WGOA 1I85A 1CE6A 3F62A 1I9EA 4UOW0 1F3DH 4WI2A 5GIRA 3QDGD 4KI5F 1A2YB 3FT2B 3CUPB 3D0VB 3UTZA 1DQDH 1TCRB 3N9GL 4XCNA 4I18B 2A83B 2GK2A 3QJHA 4EUPH 1KJMB 3IU3B 3CPLA 4XNMA 4PJHB 3O3AB 4ZQKB 5JPMB 3SO3C 2XA8H 5FUOH 2AJVL 1W0WA 5BRZE 2AJ3B 2ICWA 4MNQA 3L3IA 5DURB 4MCZB 1B0WA 3TGXA 4DGYL 1TQBC 1HEZA 3QIBC 4GAGL 2AJZB 2FJGB 1MHHB 1T66D 2HA1A 1X5GA 3HUJE 4C58B 4EDXB 2Z8SA 1J12A 1B0RA 2FL5A 4NQCE 2QEJA 4UMGA 5F1NB 2AV1B 4TN9A 3OZ9H 1U91A 5C09D 5DQ9A 1IL1B 2R39A 2ARJQ 1L7TL 4PR5B 3L3HA 2D31A 3B2UC 1HILB 4IIQA 4GRMB 5IMKB 1NMBH 3O6FA 5K9KA 2XY1A 5K59E 3AREA 3GSQA 4FQQB 3WJLA 3NCCB 3PP3H 1GAFH 5HVHC 3K8KA 3EFDH 2FBOJ 3JV6B 3EJJX 1P4LA 4KTDH 4OZHF 1JPFB 3B9KD 3ARYA 5DK0A 1A1MA 1F13A 4AY0A 2DM7A 2CDFA 4JREB 4IOFD 3H9SE 4UIMB 1E0OB 3O0RL 1VENA 2WQRA 3EO0B 5B39G 1JGLL 5TDNA 4HUVB 3PWUA 1MVFA 3CSBA 1UM4L 2N1KA 1HDMB 3CFKB 3ME0A 4HLJA 5ECJE 4LSPL 2KBGA 3OX8A 4P23D 5IB3B 2Q1EA 3P0YL 1QA9A 5ELIA 4QOKE 2FATL 4HC1L 3HHRB 5BZWB 1EO5A 1SJEB 5HD8C 4QXGL 4TPRH 4F9LA 3O6ML 2XOTA 5KVGL 4LAJH 3OKDB 3V0VB 5CEYA 4L4VA 3FL7A 4H25B 2IPKA 2R9HC 1U8LA 3IRZA 2VL4A 5DRXB 2XZQH 5DK2B 5EU4B 5E6YA 3ULVH 4CGTA 2CKBL 1NSNL 4OKDA 5B39A 3MV8D 3FN9A 3MRHA 2XRAH 4LQFL 1BM3H 3VXRD 3T1WA 3R1GL 5C08E 4YXHL 3FB8A 1C7TA 1X5JA 5DZOA 5A1AA 2DYPB 2DL2A 2EZ0C 1KELL 2XZCL 2ITCB 5AYUL 1WZKA 4K9EL 1YQVH 4WFEE 5I16A 1OAKL 3QDAA 5DD5H 5DR5L 4U05A 2APVA 5TE6H 5C6TL 3X12A 2V5YA 3QFJE 5C7XL 3WIHL 4M43H 1FN4A 2VDOH 5E8PB 2WWKO 4HUUB 3QDGA 1MLCA 4S11A 1JHLH 3NFNA 4RX4D 4AEHL 2BVOA 3QUML 5FFLA 5FGBC 3D2UD 3WLWD 4J3SA 4K9EC 4QRPE 3NZ8B 3QZWG 4JDVB 3UTQA 4JFEB 1VGKB 4LCWD 1GZPA 5ID0A 3RVTD 1I9RH 1Y6KR 2NY6B 4XVUC 1L9NA 3IU4H 3F7RA 5C07B 5LGJB 3SPVB 2X4TA 5KSAB 1KTRL 2LU4A 2NY3B 3KNBA 4D9LH 3BX7C 1XCTA 1C1EH 1H15A 3FB6B 4IJ3C 4RMWA 1JNLH 2GT9A 4BQ9A 1DQLL 5E9DB 1QKZL 3O4LA 5CMAA 4Y16B 4PRDB 4KTEL 5D5MB 5DWUL 3G5XA 4X6EA 3G6AB 2R2BA 2D03H 3QZWA 4BQCA 3STLB 2DQGL 4Y1AB 2VABA 1ROWA 2UYLB 1FFQA 1AGCA 1T89C 3K2UH 1NKRA 1CLOL 2E27H 3B9KA 4P2OC 3VI4F 3ARDC 3DGCR 2BCKB 2QV2A 4QRTB 1QACA 1M7DB 3MLUH 3O45B 1LO3L 5F6IB 2B5IC 4K3HA 4S1DC 4X6DF 4U6XB 5IG7B 1KLUB 3L3GA 4K2UL 5EA0H 5D1XD 3GK8L 2Z31D 3TZVA 4WFFD 1RI8A 1H3UA 4KGJA 3UAJD 1SYVB 5EO9A 1P4IH 4RWYH 2VDKH 3WS3B 1JUFA 3KXFD 1CFVH 2AJUH 4WUUB 5EC2A 2I9TA 1RIVH 4IMKA 3ZYJA 1A3RH 2IJ0C 4GRWH 4R2GD 4ZTPL 2ADGA 3VFPB 2CUIA 1QSFA 3GUTB 3PP3K 1DVFB 4Y19D 3TYFB 4HDIA 5BS0A 1UM5L 2FB4L 2QSCL 5DJXA 5DQDH 3LS5H 5B3JF 3I6KA 1DLFH 4U6VH 1ZT4B 4Z7WB 3VXUA 2WSKA 3ZTNL 4X9FA 1U3HB 3L7EB 2WINB 4I77L 5F70A 4NGHL 2JIXA 3VXRA 5AG8A 4EBQL 3BKJL 3BP6A 1UJTA 4OFYA 4LLUA 3QUYD 2BVUA 5C9JB 1AGEB 4M1GL 1I7UB 1L0YA 4OCYH 3TM6A 1IM3B 4MJIB 1MCWW 3U2SB 4QHLA 1GHFH 1HXMA 4MAYB 2HVKA 2IAMB 3G04B 5E00B 2HFTA 1HOCB 4EUPA 1T5XA 1PEZA 4ODXA 4XPTH 4N0CC 5I30L 3V6FA 2BY0A 4UQ2B 4G6ML 2EDYA 4LVOC 1WIUA 1CIUA 1G6RH 4LCWA 1QHOA 1LP9E 4JO2H 1FVCA 4Y2OA 1Q9OA 1F3DJ 2HLFD 4J3WA 3GGWB 3MGOA 4RZCB 4GQPH 5J89A 1P53A 5D2LA 1FVDB 3BQUC 4FZ8L 5ITFB 5H2BB 4D0DB 4ISVB 2EEDA 4NIKB 1X3DA 1DLHB 4OTXH 2R69L 1GGBH 3NN8B 1EUUA 1URLA 2QHRH 5HI4C 3IJSA 4M6NH 1F4AA 1U8KA 5CJXA 4TULL 2BJML 4X9BA 1A0QH 4GAYA 1KJ3L 2V7NA 4QRQA 1MLBA 3O8XD 4DCQA 3H3KA 4IRJC 3HFML 4Q6IC 4WU7A 1BZ9B 3BIKA 3VWJC 3OAZH 1QLFA 1EBPA 5JA8B 3TBYB 2VDRH 2BY1A 5HVFB 3IXAB 2D2OA 5FM5O 2X6MA 2HYMA 4Z7VE 1NMCC 4Z77A 2MHAA 5EU6B 2DLFH 4DK3A 5CUSH 5SWSD 1FG9C 3SDAD 4X4XA 3BPOB 2DJ4A 5D1XA 2HJFB 4NPYB 5CSGA 3QDMB 2Z31A 5CD3A 4P4RB 2IC2A 4F15C 3HE7B 4I48A 4J6RH 5E5MA 1JCKA 2A73B 4NN5C 2YXMA 5HHMD 1F8TH 5IQ9A 2BVPB 3PABA 1KJ2H 3LPFA 3EYQD 4YIQB 2DF3A 1MOEA 2Y1VA 2F53E 2ADFH 4YNYA 3RDTD 1E28B 2QQKL 5F3HB 5DJAA 1X5HA 2PO6B 2GJZB 4LKCB 2ERJC 1UWEL 2AQ1A 1RUAL 1T1WB 4HIIA 2JB6B 4U49A 5J13C 2J5LB 2CDEA 4WW1B 1KB5L 1VA9A 3FO0L 4PGJA 3OJVC 1QFWM 3FFDB 1BOGB 4Y8AA 2WBJC 4ZFFA 4X6BA 3HMXL 5MP6H 3GI9L 1J0HA 1N5AA 3R0MA 1FORH 3TA3B 3RIAK 4PRBA 2X70B 4WFHE 1CLCA 1EERB 1U3YA 4YPGA 4BUGA 2IMNA 1FGVL 5D1QC 4AL8H 5JPNB 2VLMD 5JHLL 1K5NB 3EDKA 4NN7B 1KJVA 5TF1H 3WO4B 5HVWA 4J23A 2OR9H 4M6MH 4UDTA 5KW9H 5CCKL 4HV8A 5I9QC 2J8UA 3KDMB 3IFOB 5IW6B 1NGQL 3BN9C 3OBAA 4TTGA 1VGEL 5JOEA 5GGRA 5D7IF 1ZS8A 3ILPB 4KMLB 2NY7H 1BZQK 4PJDB 4RGOL 3MRKB 4AM0B 4HEME 5CGYD 2AJXL 4XCEB 1MJJA 4OUUA 1UZ6E 1XF3B 5FKPB 2LTQB 1I7ZA 3EJYC 3STZB 1G84A 2AGJH 3T08A 4X6CB 4ESKA 2G9HB 4K8RH 4H88L 2N7BA 3L5XL 4OLEA 3K4DA 5FYJD 2H9GA 1WTLA 4OD2A 1OTSD 2R56L 1INEL 1G7QA 1PKQE 2WLYA 3PWJA 5F7FA 2ZUVA 2X1WL 5SX5H 1HKLL 3GJFH 1U8NA 1FNHA 2OP4L 4HKXB 5FO7A 4ODHH 3PV6A 1QFPA 5DMYA 4P4KC 1S7UA 3FHQA 4I13B 3LRHA 3MZGB 5DVNA 1ACZA 4IOIA 4PB9H 3SGEI 4JFYB 1FLRH 3SDXA 4HPOL 1VPOL 4OGAD 2GTWA 4ZDHB 4FABH 5I66A 5CJQH 1HYSD 1N8ZB 3E8UH 1J1XH 4J3OC 3MX0A 2HKHH 3D6GA 3DO3A 5D96B 3BEWA 3SDAA 4RGMC 3RWIB 3S37H 5D70L 1KIQB 4P57A 2VQ1B 2X09A 3FAWA 5CJBA 4XI5C 1EMTL 2J3SA 3MJ9L 3KVQA 5D93B 3EW3B 4TRPL 3ILQD 5GSVB 2GQHA 4XXDA 4HT1H 4PJGF 2VTFA 4WUKH 4WY7H 3O41B 2AXFB 4S2SB 4HXAH 1HWGB 3OAZK 1ZMYA 2N7AA 4X99A 1LE9A 4A6YA 3MLPA 3JWNC 1FIGL 2NNAB 3GMOA 1DN2A 1S7XA 4RAHA 1F6FB 1HHIB 5IFJA 3GSVA 1RUPL 3EOTH 5GGSA 3I85A 4GW5A 1Z2KA 2A6DB 2PTTB 5J6HB 3H9HA 4Q9QH 1REIA 3D5OF 3QWOA 3QQ4A 4HWZB 5E99H 2L0DA 5JNYB 5LGHH 2NR6D 1VADB 5KVMC 4HUMB 5HGDA 3UZVB 4ZPTA 5FO9B 1S9YB 2EH7L 3G6JB 1JWSB 4M1DL 1YMMB 1BF8A 1RK0B 3MLYL 5I1IL 3TIDB 3RY4A 3D69A 2IBZX 4Z5RB 4M62H 4NO0B 3IJYB 1OTUC 3BUTA 5I74B 3BD4A 5IJVB 4NO3A 1M4KA 3LD8C 1NDMB 3C09C 3VGEA 4U6YA 2AVGA 3VGHA 1T1YB 2VR5A 1MFNA 1RJYA 1AJ7H 2BNRD 1DQML 2VE6B 1LD9A 4B0MM 2DWDB 4TOYH 1ZHLB 2YD3A 5FHAL 1B4RA 4FXGA 3BH8B 4FFYL 2ZUQC 3ZKMC 4WDIA 3HMWH 4HMEA 1NBZA 3MO1A 1LDPL 4KZEH 3BWAB 3LRGA 3GHBH 3NIDE 3BDXA 1T6VN 5GRJL 4MVBD 4U6TA 2ICCA 4APQB 3HC4H 4JRYD 4RIRB 5L7XL 4L3CA 5I1JL 3PWPE 1MHPH 2X1XR 2BOBB 4YK4C 3UYRL 1J7VR 5KVEH 4LVNC 1U41A 4L1HA 3QEQB 3WUZA 4UU9A 4FQ2H 3ZZ1A 1CGXA 1NGZA 5DMJB 1A1NA 2D9CA 2W60A 4JZNB 3X11B 3B5GA 2EH8H 3S96B 1X5LA 1S7RB 4QHNA 3VCLB 4Y7MA 1FO0H 2Q76B 4KUZL 1H3XA 2VB5A 4OCRL 3AGVA 5EBLB 3BVNA 1ORSB 3DUUB 1RAMA 2DQCH 3VG0L 4LLMA 4ZUWB 1N6QL 3PDDA 1BVKB 1KJ2A 3EOBB 3HE6B 5D2NA 1TIUA 4O4YH 1FCGA 5SX5K 3GJFK 5IVXE 4Y4KD 4MQSB 2A9MH 2AAVA 4FQ1H 3SJVD 1G9EA 1DUYA 3W82A 3OKKA 5CZXD 4HZAA 4LBEB 1UXWB 3CVHH 5DD6B 5F9WB 4LCIL 1RIUH 2VN4A 4FQLL 5JW4R 5DJ0A 4QRSB 3QAZB 3KPSE 3FQXA 4XMPL 1BIIA 1V7NH 3D39D 4UUJB 3C60D 2EDQA 2Z35B 5F1SA 1ZT7B 4OT1L 5DO2D 4CVZB 2QSTA 2DBLH 3FJTA 3FTGA 1B2WL 3ZHLA 1JN6B 1I7TA 2OMBA 2CD0A 1B0GA 4L4TE 4U31A 5FYJU 5AUMA 1JK8A 1RU9H 3O3BB 4LSRH 3EIFA 3HI6H 43CAA 3BZFA 2J1KA 2W65B 3ZYOA 2NY4C 1KNOB 2ADIA 3CMOH 1MHEB 3KYOA 5BXFA 4K23L 4OD3L 2FLBT 1OTTC 2LAAA 4GG6B 1UWGL 3GSOB 5DZLA 1JNNL 2EYTB 3KWWB 4XNXL 2Q86B 4JFEE 1W8OA 2BC4B 1V05A 3MRRB 4JVPA 4MJ6B 5JQHC 2B0SL 4JHBA 2ZPKH 4CVUA 1UKQA 2VLRA 1ULVA 2HMIC 4PJCA 1DJSA 4N0FA 1FAIH 3H3PL 3D9AH 3TN0D 1PFCA 2M1KA 2A77H 5F7WC 2C9AA 4OF6A 4LSTL 4OQ1A 4J3UA 1AKJA 1NJ9B 1JGUH 1CG9A 3G5YB 1VFBB 4KDTC 4Z6AT 1M7IB 4JPVH 5F7YC 3GJFA 5CINL 1OAXL 4JRYA 1ITCA 4LHUB 4JQVC 2PW2A 3O3EB 4OUOA 3EYUL 1W0YT 5HXMA 5AWNL 4UAOC 1M05B 3Q48A 2DQFB 3B4NA 2AEQL 2XPGB 3QFDB 5E5RB 4TVSa 1XMWA 5T3ZD 5D71L 3SGDH 3N9GH 2W92A 1ZA6A 2PXYC 3GEWB 4RGNC 1WIOA 4OZGB 4MDIB 2OXHA 4OF3A 4OZIA 5C0EB 1FV1B 1ZE3C 4XPBL 3UPCA 2AJVH 5KAQF 4LDOB 1JMZA 4BH8B 2EYRB 2EDJA 2LE9A 2FBJL 3DVGB 5F1IA 4YHPA 4DGYH 1IEHA 1RV6X 3QT2A 2BRQA 4JRXB 4GAGH 1UZ8A 1UH2A 4X83A 4P5MA 1H3WM 1DUZB 4PJHF 2X4RB 5F97E 1MEXL 3ZE1F 1EHNA 3L1OH 3W39A 3SJVA 1KC5L 3CZJA 4EIGB 2LFGA 1L7TH 3LPGA 1X5XA 4WHTA 1H5BC 4N8VB 2YBRB 2I9LB 4B5EA 1K2DB 1IAKB 2MCG1 1BOYA 5E2WL 3UX9B 4MNGE 1TVHB 3IAPA 4WI8A 3ULSA 3BKCL 2VLKB 1MFDL 4G6AC 1LNUB 5F44A 3D39A 4XAKE 1ZV5A 2KZWA 4BZ2L 4RFEB 4N0UA 4PUBL 3RWDB 3K7UA 1QBML 5C0GB 4I4WA 3O0RH 4MA3A 1LK3L 4I0PD 1JGLH 1VKXA 1CD1B 1LEIB 1UM4H 2DJSA 5DMIL 4QO1A 4OI7A 3RWGB 4LSPH 4KJWD 4FP8H 1H8OA 1JWMB 1VERA 4L9LB 4N5UA 3SY0A 4MJIE 5I1EL 1T3FA 2VJXA 3P0YH 4CN4A 1ZT1B 2FATH 4HC1H 1FZKA 1OAYL 3CMGA 2D7NA 3CX2A 4HFUL 4QXGH 3O6MH 5KVGH 3IETA 4PJFE 3QEUA 4BH7B 2ARWA 3OAYH 3VWKD 1GZQB 3HLAB 1A7NH 2IH1B 3ROOB 4JFFB 2CKBH 3IB4A 1NSNH 4PJEB 5ICXB 5K9JL 2R1YA 1ONQA 3SE4A 4LQFH 1G7IB 3TN0A 4HX1A 3R1GH 4YXHH 5FOBA 5CSBA 3PG2A 1NBYB 2AABL 5HY9B 2XYCA 3ARXA 1F02I 4ODWB 3GJEB 5T3XL 2XZCH 3BYYA 3LRSA 5AYUH 4K9EH 4URTB 3L5WA 1OAKH 1CICC 5DR5H 4J12A 5C6TH 3WNMA 5C7XH 2FWOB 2A74B 1Y18B 4KROD 3QIBD 3MRMA 1G7MB 4QHMA 4QY8A 1C5BL 4M61B 4YHOL 4Q2ZA 4AEHH 2BMKA 3QUMH 1FO0A 3JTTB 1O7VA 5ERWB 4JVWA 4Y5VA 3WMSA 5C2BL 4LVHB 1RZKC 1AD0A 3CSYA 1SVCP 1WZMA 1CD0A 4JG0H 3MOQA 5ACMA 5I6XC 1BVLA 4MJ2A 5A2IH 4BSVA 4EVNB 2PW1B 4NRXA 5DEGA 4C83A 1HQ4B 1G9NL 2Y5TB 3B2UD 4F7CA 3MXVL 1QNZL 3DOSA 4S0SD 4N0YL 3RY6A 1XR8A 5F9JB 3G9VA 4HGMA 1DQLH 3IFLL 4CU7A 1QKZH 3HG1E 2ITDA 3IF1B 4KTEH 2AK1L 3LH2L 2BSSB 5DWUH 4XP4L 2ZCLL 3LEXA 3DGGB 4Y5YA 5EOCL 3FRPG 3MUGB 1D5IL 5L2KE 3P4LA 4WW2A 4CJ0A 2CO7B 5ICYB 3H8NA 5DD0L 2H8PA 2NW3A 3IDGB 2YD1A 5MERA 2H26A 1BZ7A 5D5MF 3C08L 4PRAB 1CLOH 1G7PA 1MFAL 1H0DB 2W0FB 2HT2C 1DBJL 3EZ8A 2JCCE 3QXDA 4FN0A 4NQTA 1LO3H 4JQXC 4MCYB 3HPJA 2R9HD 2JJWA 2CR6A 1IVLA 2GHWB 2QL1A 5EBWA 4K2UH 1NCWL 1PD6A 2VLJD 5EFIA 3RX8A 4M7ZB 3EDFA 3B6SB 4JY6A 3VXPA 5EZJA 3DBXA 1IGJA 5IUSA 1EZVX 5ANME 3P9LA 3WIFB 3FRPA 4L8DA 3WHE0 4HWEL 2GY7B 2DKSA 1CDIA 1DN0B 1SEBA 2C4XA 5C6PB 5IIEB 1S7SA 4ZTPH 5JXEC 2EZ0D 1O5DT 1YNTA 2BK8A 3WEXA 1UM5H 2FB4H 2QSCH 3MNVA 3BD5A 4EZMA 1IGML 4JQIL 3VFWB 5AD0B 3LB6C 1BBJA 2YZ1A 4KKCC 3ZTNH 1XF1A 1SEQL 3CU7A 4I77H 4NGHH 4EBQH 2VKXA 5DMGC 3BKJH 4YPJA 3BRFA 4Y2DC 3V52L 2P5WD 2XFXB 2H6PB 2XTJC 1OGTA 4LPTA 4M1GH 4H20L 3T65A 3SGKC 1IEBA 3F58L 3DVFA 4Z7WF 4NRYA 2BNQD 4WO4A 4ZTOL 3NPZB 3NCFB 4JGMA 3ARFB 1ED3A 3UBXA 1FZOA 1NFDB 4ETQB 5JHDB 1C16B 3OAYK 3CGTA 4AMKL 4PJ7A 3QB7C 4N90D 4AG4L 4X6DA 3MRJA 3TT3L 4E42A 5BVJB 4G6MH 4K94C 3SKJL 4XX1E 3VGFA 1HH9B 3LSOB 4OZFH 4JR9L 5HHOE 5MI0B 5L2JB 3QO0B 2MKLC 4JPWL 4LSSL 4QRRA 5HI3C 4K3EL 3Q5YA 1HI6A 3DI2B 4K3JL 4FZ8H 3L3DB 1AO7E 5ISZA 3M17A 3QQ3B 3TNMA 4P2OD 3ARDD 2R69H 4FG6C 4M02A 2VXVL 1T80A 3VXMA 3W0WE 3S7GA 3OG6B 3GKZA 3B3IA 1UH4A 3PIQB 4S1DD 1CGWA 4XRCA 2G5BA 1NAMA 2O61A 1R3JB 1QRNB 4B7IA 4TULH 2KQNA 2C3WA 12E8L 1KJ3H 1EX0A 4R6UA 3WYRA 1VFUA 4LRIC 3HFMH 4PJIA 5M7QA 2DDQL 2VC2L 4OKVA 3WD5L 4CMMA 5LCVL 3ZTJH 5IW3A 2YK1L 4RCAA 1BD2D 2KPNA 1OWRM 4PB0L 1GC1L 1O0VA 1TTGA 4JM2B 5CILL 1GOGA 5TE4L 3G5ZB 3OF6A 2WP3O 1LO4L 2DWEA 2VLJA 2YUXA 5LKNA 1EEYA 1LEKB 4HC1A 4R4BB 3EDEA 1YMME 1UJ3A 5KVFL 3QIUC 1OD7A 2OCFD 3NCYP 3N1MC 4U1MB 1W72B 1MNUL 3DV6A 2QQKH 1AXIB 4PJ9B 4JFOB 4D0BA 5DF0A 2ZOLA 2CKBA 4M1CC 5DHVB 3WNPA 1UWEH 1RUAH 1CE6B 3A0OA 3ARUA 1KB5H 3QHZL 3FO0H 4WI3A 5FYKD 1R3KB 3QULA 5GIRB 4X7DC 3V9FA 1MCLA 2BSTA 1T03L 3X3FL 4N0CD 2FRGP 5FGBA 5M94B 3FO1A 1CXIA 2ESVA 3FRUA 3HMXH 3UTZB 4MGXA 1LVEA 1UM6L 4XCNB 1R0AL 4KKLD 1XF5A 3QJHB 4HUWB 5CEZH 1AP2B 3CPLB 3VXSD 3WIHA 2ZUTA 4XNMB 2R8SH 1FGVH 5JHLH 2OK0L 4X8XA 2IANA 5IMLA 4D8PB 5C0JA 1W0WB 3HNTL 2V9TA 3OL2A 2ICWB 4MNQB 3QUMA 3N85L 4JRWA 4WWKD 3TPUA 2GJJA 5C8JA 3BQUD 1D5BA 2JK5B 1UXSA 5CCKH 1HEZB 4DOHB 5LBSL 4L3ED 1S78C 1NGQH 1VGEH 2VLME 5GJTL 1B0RB 5FOJA 2FL5B 2V5MA 5E08L 3NGBB 4RGOH 5DQ9B 4NUGL 2X5PA 4OCLC 4X98A 4KXZH 3L3HB 2Z92B 4RMUA 4IIQB 2FSEA 2AJXH 3O6FB 3DXAD 5K9KB 4IRJD 4GSDH 4W6XB 3AREB 3GSQB 1CYGA 1IC4L 1T89A 3EBAA 5BW7A 3EDDA 4P2OA 4H88H 1HSAA 3L5XH 4PJDF 5DK0B 1A1MB 1DANT 2ZSWA 3H3BC 4BSJA 4E5XA 4XMLL 2CDFB 2R56H 1INEH 5C9KA 3S5LA 1Q1JL 1UGNA 5EG6C 1HKLH 2VIRA 4ONFL 5TDNB 4AQ1B 3PWUB 1G7JB 4JFDA 2AK4B 1S8DA 3ZT5A 4G9DB 4X6CF 4OCNC 4WGVB 5HHPB 3KJ4B 4HPOH 4PY8I 4JY4A 1BJ8A 2FIRT 3UTSB 3CSGA 4GH7B 4XNZC 3RWHA 4L1DA 4X5WB 3SGEH 4L4VB 5IHUL 4P2RA 2IPKB 1U8LB 1X5FA 2P5ED 5D70H 1UH3A 3T0EB 4GMSH 5D7IA 2EDWA 1HXYA 1KCVL 1U3JA 4PJXA 1NGPL 2WBJD 1EMTH 5B39B 1Q9LA 1WBZA 4YHZL 4Q0XL 3MRHB 4TRPH 1JHTB 2W0KA 3FB8B 4XVJL 1LO2L 1JI2A 3O2VL 2PYED 4NNXB 3NPSC 4W6WB 4DUVA 4GG6E 5D1QD 2LU3A 2NXYD 4V1DB 3OV6A 5I16B 1FIGH 4IRSD 3FQRB 5CSZA 4G8GD 3X12B 2EDOA 1FN4B 4EXPX 4J7RA 1S7QA 2EYSA 3QDGB 1I7RA 1S9VA 1RUPH 5FYLD 2VDNL 3BN9D 1QBLL 3K0WA 1EH9A 4ELMB 3BI9X 3H9YA 4QCIA 3REVA 1KGCE 2DICA 5DEFA 4KK8C 5C92A 3UTQB 2EH7H 4F57L 4M1DH 1ZWIB 3MLYH 5I1IH 1GZPB 5DQJA 3IVKB 4CVXA 4Z7UE 4RAVA 2COQA 3BQUA 2X4TB 3GM0A 3EJYD 2IFGA 1YJDL 4U1IA 1ZTXL 4L3EA 4NO2B 1DTUA 1QFWI 4KUCF 1H15B 2BY3A 4JKPL 3MLTA 3G6JF 1FYTA 3GKWL 4C54A 5CMAB 4XAWL 2FX9L 2ZJSL 4PP2A 4HZLA 2GI7A 3SQBA 1DQMH 2GJ6A 1YJDC 2R2BB 4NKQB 3QZWB 5FHAH 4IRJA 4Q6IA 4TSBL 5JOFA 3VWJA 1P7HL 2VABB 1LDPH 3ZDYF 4W6YB 3JV5A 3UTTE 2X44D 3VFTB 1AGCB 5E8DL 5GRJH 3B9KB 3OKEA 4P46A 3UZQA 5I1JH 1R3LA 5L7XH 4ZO6A 3HZVB 2X1QA 2XN9A 1BPVA 3VE0A 1JPSL 3L3GB 2XT1B 3CIQA 1I8MA 5KG9B 3KLAA 4OI8A 4XI5D 3E6HA 3A67L 1RSFA 4P23B 2EE2A 6CGTA 1WK0A 5FYKU 4NUJA 1S3KL 1PSKL 4KUZH 2I9TB 3ABZA 5T1DL 4HUKB 5DD3H 2IWGA 4OCRH 1H3PL 3LKQB 1LO0L 2ADGB 4S1RL 1QSFB 3MRCA 2M8XA 4MDJA 4TYUA 2BHUA 5BS0B 4HDIB 3VG0H 3P4NB 2AXGA 5DJXB 1N6QH 3C5ZC 1YUHA 4M5ZL 4HFWA 3I6KB 1KYOK 4XNUL 4XXCC 3MCLL 3VMPA 4X7TA 2WBJA 3LQZB 4GRLA 3F7QA 3WV0A 3QBTB 3MV8B 4GBXC 2KL6A 2JIXB 4M8QA 3VXRB 3QUZC 4XZUA 4DFIA 3HB3C 3BP6B 2YN5A 2V2XB 3BGFC 1I4FA 4LLUB 2N56A 4ZFGL 8FABB 3PQYA 2PYEA 4U2YA 1BLNA 1KB5A 2NY1C 4LCIH 1ZGLP 4QHLB 5ITBL 5EPMB 1HXMB 2R1XB 1UQSA 3HMXA 1LEGA 1S9KC 1Z9SA 2G60L 4XMPH 1IILE 3MJ7A 5F88A 4ZXBC 3U7YL 4O2CA 5FF6A 1T5XB 1J1OL 3TFKC 3ZE2E 1B2WH 3D2UB 3V6FB 3LS4L 5D7SH 4N8PA 5I73C 2VZUA 3ARGC 4LCWB 2JKXA 1FVCB 4MXVE 3DVNA 1Q9OB 3T8XA 3UO1L 3KPRD 5KTEL 3ULUF 3MGOB 2WANA 3QJFB 3DX8A 3MV7E 5D2LB 4K23H 4OD3H 4NKDA 5JTWA 1K4CA 1A22B 1UWGH 1RUQL 3ROLA 4J2XA 1JNNH 3RTQD 3P4OB 4XNXH 3IJSB 1QG3A 4BKLA 2B0SH 5SWZA 1U8KB 5CHNA 4N1CA 4DW2L 4DUWA 4JO3L 4P4KA 2JJSC 2XG5A 3H3PH 1VESA 4XPHL 4GAYB 1XGTB 4QRQB 1MLBB 4LSTH 2H45A 3PGFL 3BIKB 1QLFB 5BCAA 3BZEA 4X7EC 3D3VA 4F3FA 4TSAL 1OAXH 4NCC2 4Z77B 4L8SC 2MHAB 2ED8A 3EYUH 3JV4A 1MHCB 4F58L 4CNIB 5AWNH 3EYSL 3C6LC 3QISA 5F9DC 2AEQH 3BO8A 5D1XB 2Z31B 3FQUA 5FEBA 5CD3B 2NY0D 5IFHH 1J1PL 3HC3L 4I48B 1CR9L 1FVEA 4KK6C 4PBXA 5E5MB 2Q20A 2BY2A 1I3UA 2ARJB 3PABB 3MROA 2J4WL 3KXFB 1F00I 3MV9D 4KHTL 4GW4A 4XPBH 3T3ME 4YNYB 1F4YL 1KYOJ 3TO4A 3GNML 4R2GB 5K93A 4C56E 3V4PL 5DJAB 2FBJH 4PV9A 1EVTC 4Y19B 3CJJA 1R5VB 1V5JA 3MJ9A 2OTUA 1R3IH 4KRPD 4PGBB 2CDEB 2EXYD 4OZGF 3RX5A 1MEXH 4HH9B 3RUGA 4U7KA 5CP7B 1K8IA 5D7KD 4Z18A 4ZFFB 2D7MA 4P49A 2WQ8A 3QUYB 1RZFL 1X7QA 3HZMA 1N5AB 1A7QL 4KRLB 2X4NA 5E2WH 4E41D 3SDDC 1VSCA 3MRPA 4QNPF 2NY4D 1PX4A 3G5VA 1MFDH 1KJVB 3LAFA 3SKOA 3MGAA 2WZPD 1HSBA 4BZ2H 1OTTD 1Z6JT 1SJHA 1JP5A 4HV8B 4PUBH 5GS1C 1QBMH 2J8UB 3U1SL 1DANU 1LK3H 1HE7A 3G08B 4R97B 1ZS8B 3VGAC 5CWSA 4HK0A 1U95A 1IKFL 2L7JA 1FDLL 1I1AC 4FQJL 5I1EH 2YUVA 2F54E 2HMID 1OAYH 1YC7A 1NFDE 1U8MB 4PJAA 5D7LE 1A2YA 2I25N 1MJJB 4HFUH 4OUUB 4F7MA 2CXGA 4U0QB 3CUPA 4Q9BA 2E7LC 1I7ZB 1TCRA 1TQCC 1K6QL 1U2CA 4TQEL 3NIFF 2A83A 3IU3A 2H9GB 4PJHA 2IQAB 4BJLA 4YHIA 3O3AA 3IFNL 4ZQKA 5BOPA 5JPMA 5J12B 1YN6A 1G7QB 3PWJB 5K9JH 4ETYA 1U8NB 1AR2A 1I8IB 3PV6B 5ACZA 3TIEB 1S7UB 2ZUXA 4YGVA 2AABH 4XTRD 3O8XB 4G80B 2JB5L 4IOIB 2PXYD 1ZA3A 3UCRA 3FN3A 1HINL 2C1OA 5T3XH 2GTWB 4TSCL 1EBAA 2AV1A 2EIDA 4PJEF 1I3VA 1IL1A 4D0CB 3K3QA 3SHSA 3G6DL 3OXRA 5SWSB 3SDAB 1OGAD 2EXWC 4ZUUA 1C5BH 4ODBD 4YHOH 4P57B 1J9CT 2AQ3A 2B2XL 3KHQA 5C2BH 2UWEA 3AXLB 5HHMB 3VGDA 1NEUA 2ADJA 1IGFL 4PRPA 1F97A 3C8KA 3VFVA 5BV7C 3QRGL 1PG7W 3VG9B 4XWOC 1G9NH 4CU6A 4D94A 2EDRA 5F1OB 3MXVH 5HYJD 1QNZH 4YJZL 4N0YH 2WK2A 4PRIA 5L88L 3I9GL 4X99B 1LE9B 4A6YB 1LO5A 4TUKL 2VWEE 4J3TA 1NFKA 3IDYB 5C0BE 2WUBL 5EOTA 3GMOB 4G6AD 5IB3A 3RVVD 1S7XB 1JFQL 3W5NA 1LQSR 3IFLH 3IAQA 4UI2A 2BSRA 2YPLD 4Q9CA 5IFJB 2HLAA 5I75B 5KS9E 4HG4J 3LH2H 3IRPX 4GW5B 4XP4H 2ZCLH 3L3OB 1WAAF 3TYGL 3QWOB 3QQ4B 5EOCH 1H9VA 1KIUA 1D5IH 4OCMC 5H35B 5HGDB 4ZPTB 5DRXA 5DD0H 4EI5D 5IR1A 1VDGA 4YFLI 4HH8A 3C08H 1ODAA 4P2CG 3AAZA 4FQXD 1KXVC 1NUNB 1MFAH 4S1SL 1DBJH 1IGYB 1GPOH 3O3UN 1P7KA 4NO3B 2H2SC 2DYPA 4YZFE 1NCWH 2JELL 5HI5C 5MHSE 3ZL4H 1FG2A 4U6YB 3SDCC 3BKYL 4WVRA 5J9PB 4NQVA 4ZO8A 2HFGL 2X7LB 4LDLB 1MI5D 1RJYB 2D7TL 1KTDA 5E8PA 2P1YA 4HUUA 4OD1L 4HWEH 3JWDH 4JKWA 1ZVYA 4FXGB 2J8OA 2R15A 1S7WA 1KUMA 2X4QA 4KDTA 3BFOA 2E6PA 5DC9B 5TH2B 1CICD 4JDVA 4JQVA 4F9PC 1IGMH 3GIVB 4JQIH 4L3CB 1TJIL 5T1KD 5EWIH 3O4OB 1SEQH 3S36L 3SPVA 4Z7OE 5KSAA 2GIYA 4UU9B 3QDJD 4KI5D 3NTCH 3RGVC 1NGZB 1Q72L 1A1NB 3Q6FB 4GS7C 1I9IL 2DI7A 4HJ0C 4H20H 4OCWL 2EDTA 4QHNB 3F58H 1X9QA 4K07A 2OL3L 4UNUA 4Y89A 4ZTOH 5FHBL 5DJ6B 3GSNL 4LEOB 1E4XI 1TZIB 2ZNWA 5GS2H 2RIKA 3G6AA 4M93B 4AMKH 1EFQA 1UB5A 3STLA 4LLMB 2DLGA 4Y1AA 4AG4H 1RD6A 3RVXC 3TBTA 3TT3H 1FFNA 1NCDH 3CDCA 4NZDA 4I9WD 4TVPD 2AJSL 3SKJH 2V6HA 4P3DA 3WFBL 2BCKA 1NFDF 1P9MC 3O6KL 4K3DH 1H5BA 5HYJA 4JR9H 5K9QI 2VXSL 3SE8L 1KENL 4JPWH 4LSSH 1KULA 4PLOB 4K3EH 2PN5A 4K3JH 5DJZB 5DJ0B 1SYVA 1T83C 4NRZA 2FO1A 1S5HA 2EDNA 1DEEA 3FQXB 4PJ5E 4JO1H 2HT2D 1BIIB 4PGZA 2VXVH 4LMQE 4YC2B 3AUVA 3FHAA 4OLZL 3FTGB 1N26A 1I7TB 3VFPA 2BDNL 1TLKA 3GUTA 1DVFA 5E7FA 1JK8B 2OR7A 2DQUL 5FUCE 1NBQA 4R96B 4M7LL 5GGTA 5C6WH 4XT1C 2DDQH 2VC2H 2HJKA 3BZFB 3WD5H 3OR7B 5LCVH 1ZT4A 2ADIB 4MYWB 1JZ5A 2X1PA 3D1MC 2YK1H 5LXGL 3QUXA 4NZUL 5EH1A 3ARWA 4PB0H 5BXFB 3RL1B 3VFGL 2C5DC 5JXED 1GC1H 3V95A 3GRWA 3ALWA 4Z78B 5CILH 2HKFL 5TE4H 3FT3A 2VLLB 4LLVB 1FBIL 5T33L 1AGEA 3DSFL 2DD8L 1T2QL 5EU7E 4NKIH 1A7OL 4P2QD 1GGCH 3UTPD 1J8HE 1FCCA 1JPTL 3LB6D 2NY5L 3QNXA 4KKCD 5KVFH 3AVEA 3K74B 1BVZA 4RFOL 4PJCB 2IAMA 1EEZA 4N0FB 5DMGD 5E00A 4JM2F 1HOCA 5HGHB 1MNUH 2ZNXA 1GGTA 4KWUA 5EBMA 2I26N 1GGUA 4ODSL 2XTJD 5JXAL 5F6IC 3WXVL 1CG9B 5C0AD 1CN4A 4UQ2A 1CGTA 2NY5C 1V3MA 3GJFB 1U93B 3O4LE 4JRYB 3QG7L 1NH6A 4JLRA 1J0JA 2PW2B 3QHZH 1IQDB 1DL7L 1A4JA 3GGWA 3OJMB 4NQXB 1ZVHA 1T03H 4MAUL 3X3FH 1F6LL 1FVDA 3JVGA 5ITFA 1UM6H 1ZA6B 3ECBA 2BSED 1KXTB 3NN8A 1T66C 5J11B 2OK0H 4OZIB 3PDGA 2KQMA 3HNTH 1P7QD 4XNQA 1RULL 3HPLB 4O2EA 3QHFL 5JIKA 3N85H 5HI3D 1QTYT 5F1IB 1WITA 4YHPB 1F58L 4KRNA 4YZFF 3GMNB 1U58A 3D25A 4Q6YA 5LBSH 1UZ8B 4P5MB 1TPXC 5HPOA 1TTUA 5LWYL 1ZXQA 5GJTH 2X10A 3IXAA 5E08H 2NX5E 3W39B 3SJVB 1VACA 4NUGH 5EU6A 1SBBA 4WHTB 4IOFC 3T1FB 4LARH 1PBYA 3VD4A 1QSFE 2R23A 1X6NA 2P47B 5BS0E 1MCIA 1FNLA 5CD5C 3ULSB 3E1F1 3BRGC 1IC4H 3C87A 3MJGX 3P77A 2A73A 3BHBA 5GRWA 3VXUE 1K9TA 3D39B 4YIQA 4FS0A 3N0PB 4HPYL 4XMLH 4JQXA 4N0UB 3BPNB 1E28A 2NPLX 1Q1JH 4I4WB 4Z7OF 4MA3B 3DXAE 5F3HA 4HHAA 5SX4H 4ONFH 3QXUA 1VKXB 1T0MA 2MNUA 5I1KL 1TZGL 4K71C 1QUNA 3QIUD 3SY0B 1B4JL 2HRPL 5A3IC 5J3HC 1FZKB 3FFDA 4CMHB 3OKLB 1DZBA 5BRZD 5GGVY 4OIIL 5JXEA 3IETB 2Z8VC 1BX2A 4H5SA 4LOUC 4YGAB 3IAGC 3QEUB 4M1CD 5IHUH 3LEYL 3QO1B 1D9KC 2DM2A 4LRNL 1N0XL 3DV4A 5HHNA 1KLGB 4F2MA 4OLVL 1KEGL 1T5WB 1KCVH 3KPQA 4NQCD 1NGPH 3FQTA 3CH8A 4R0LC 2R1YB 3WDJA 4M8VA 4YHZH 5C0CA 4Q0XH 4I0KA 4Y2DA 3VD3A 3TN0B 5E1AA 5FOBB 1FE8L 4XVJH 1CVSC 1VFMA 3RVWC 1LO2H 1KCSL 2FECI 4LPUA 4MMXC 3KDMA 4LFHD 3O2VH 5GHWL 5C0AA 3SGKA 2VDML 3ILPA 5D6CA 4WHYH 5TE7L 4HS8L 3TT1L 4PJDA 5MEQA 1P84K 2ZZUT 4AM0A 2OJZL 3VFRA 1SJVA 1ZKAA 3H9SD 3MRMB 4QHMB 1S78D 2VDNH 4Q2ZB 1QBLH 5CIPA 2B4CL 3DIFA 4Y5VB 1TTFA 3CSYB 3NMEA 4FHBD 4LHQB 3CNKA 5GGVL 2XQBL 3B5TA 4NJAL 4F57H 1BVLB 1ERNA 4BSVB 1JYVA 4QOKD 4NRXB 5DEGB 2YD5A 4F7CB 5GZOC 3TNNA 2HT4D 4LSQL 4ZNCD 4QHKI 3PUCA 4HKXA 1XR8B 4PGEB 2ED7A 4ELMF 4HIHA 1C5DA 1P4BL 1YJDH 2O26U 1ZTXH 4MZ3A 4KV5F 4DVRL 3KPOB 4JFYA 3GKWH 3TA3C 3KJ6L 2YUWA 4XAWH 2ITDB 2FX9H 2C3HA 2ZJSH 5KZCD 2OI9C 3V7MA 3U9UA 3BMWA 3V5DA 2A0LC 3GMQA 1TCMA 4L29A 4Y5YB 4G9FA 3RWIA 5DJDA 3K46A 4LRIA 4WW2B 3ULVE 1OQOA 4OCXL 3X14A 3K4ZA 5F96L 2QQLL 2H8PB 3OQ3B 2NW3B 5MERB 5CEXA 4WFED 4G6JL 1CLYL 5E8DH 3CDGB 1G7PB 1DE4A 2R1WA 2NXZD 3QFJD 4Q9RL 3WFZA 2YKLL 3QXDB 3MNWA 4I0PB 3O41A 2HRLA 4XPAL 1JPSH 1SVZA 3D85A 2GAZB 3FZUD 4FRWA 4JY6B 3VXPB 2O5ZL 3A67H 4QRPD 2NNAA 1PYWA 3O2WL 3MLXL 5EZJB 3DX7B 5FAAA 3DBXB 4LFHG 3T0WA 3QXVA 1IGJB 1NANI 2XG4A 3UYPA 1N6UA 5T1DH 3I84A 4X4ZA 1NGXB 1H3PH 5KN5B 1S7SB 2A6DA 4UV7L 5J6HA 3BN3B 2F8XC 1LO0H 2RBLA 4S1RH 2J8UE 1T7ZA 5D7JC 5JIPA 1YNTB 1A6ZB 1MFBL 3DRTA 3DUHA 3WEXB 4YHYB 4KJYA 4UQ3A 3MNVB 5FO9A 5TDPA 1S9YA 3G6JA 4M5ZH 5SWQA 4XNUH 3HUJA 1RK0A 2GSIA 2X05A 4NQCA 2F74A 1RVFL 1YC8A 2MQCA 2Q3ZA 1FH5L 4NO0A 4CN6A 5FV1L 3IJYA 4N5ED 1JI1A 1YZZA 4ZFGH 1K4DA 2D0HA 3BP5A 4KK8D 1JYNA 1NDMA 2G2RB 3SO3B 2L7UA 3T65B 1IEBB 2EKJA 2JTDA 5INDA 1A9BA 5ITBH 2D4FA 4NRYB 3WL9A 3K81A 4LCCC 1QLEL 1T1YA 3DECA 1LK2A 5HGBB 4PREB 1U8HA 1FZOB 2G60H 2VE6A 4CDGC 5JORB 1TQBB 4HUXA 1WISA 3QIBB 2DQEL 3U7YH 3H9SA 3TH4T 2QADC 4PJ7B 1J1OH 5D1ZC 1CE1L 3MRJB 3FB5B 5KBNC 4E42B 2LU7A 3LS4H 3SDXE 4BSWB 1AXSA 4WEUD 1BQHG 1SMOA 3MBEC 1WICA 35C8L 3LMJH 4RIRA 4QOKA 2W9EL 4MQXC 2VR9A 5BMFL 3K1KC 1MAJA 1J88A 3UO1H 5KTEH 2YPVL 1NBVL 3DHJA 3LN9A 3QYCA 2YEZA 4Z7QE 2J12B 5I0DA 3LKNA 1HI6B 3LKPA 3FQWA 5HVHB 5ISZB 1AHWC 3M17B 1RUQH 3T3PF 3NZHL 2V17L 4JZNA 3TNMB 4LASL 1WBXA 1KPRA 1S7RA 4DGVL 4GRWE 3RWCA 3F7PC 5IMMA 3WSQL 5D2LF 2J6EL 1NAMB 4JO3H 5C08A 2X4SB 2O61B 3ARQA 1JJUA 4XPHH 3DYPA 1TNMA 2DIJA 4Y5XA 3RRQA 1J18A 4PJIB 3HE6A 5E94B 3U4BH 4OKVB 3ZKNC 5C86A 4CMMB 4JJ5A 4A6YL 1KG0B 1A6UH 2JJUA 4TSAH 4YXLL 3QFJA 4UTAL 1EAPA 3B9EA 4PRHE 1MCHA 1YA5A 4F58H 3RDTC 3EYSH 2VLJB 1YEHL 1EEYB 5DD6A 5CGMA 4IBLT 4WHYG 5GS0H 3HC3H 1CR9H 1VFOA 1ZK9A 4XNYL 1VB9A 4GBXD 4M3KB 4OIAA 5DRWA 3PP4H 4OLXL 1Z5LA 4NQDA 3VD7A 3QUZD 7FABL 2J4WH 3I02B 4PP1D 1RHFA 2Z35A 4KHTH 1EDQA 1ZT7A 3PNWA 2X89A 1F4YH 4CVZA 3GNMH 3V4PH 1S7VB 1PZ5A 4JHZA 2ZOLB 2NY1D 2CKBB 4FQCL 4LPXA 4R90L 2VOTA 2IPTL 2W65A 1CGUA 1EJOL 4MHHI 2CIKB 3QULB 4P5KA 4BQ8A 4DN4H 3PHOA 3TFKD 3QRFM 1BGXL 1DSFL 1GL4B 3C2AL 4LHUG 4KAQL 3FO1B 2ESVB 4Z95L 3V0WH 4OI9A 1RZFH 2P5WB 1J0IA 1A7QH 1XF5B 1KV3A 2ED9A 2MPAL 1JGEA 3MYJA 4PY8J 1XGRA 2IANB 4HMCA 5C0JB 5KANI 5FYJL 3QUMB 3TPUB 2JJTA 1D5BB 1UXSB 1CGSL 4IJ3B 3U1SH 1AGDA 4E41E 3G5YA 2AI0L 4BFEA 1M7IA 1IKFH 4BK5A 1FDLH 3DO7B 4LHUA 5IF0B 3BP7B 5F7KC 3HS0B 1CZ8L 4X98B 2F53D 1XCQA 1U8QB 2IMMA 2FSEB 2J8UF 5HGGS 1ZLVH 2XPGA 3QFDA 4HLZH 1RZGB 2ZUYA 1K6QH 4TQEH 5TFSL 5KSBE 3VI3E 5D2NE 4P2OB 3ARDB 4WV1C 2ZUSA 3BIAX 3IFNH 4MDIA 5EUOB 5JW3L 2ZSWB 4XC1L 4E5XB 4JGJA 4POYA 4OIBA 1PAMA 2W9LA 3P11H 2B5IB 5FGCE 1HYSC 3DX6B 3C6LD 3IFPB 3A6CL 2VIRB 3RBGA 1MJ8L 2ZUUA 2E7MA 1L7IL 4JRXA 1S8DB 1ETZA 4KK6D 5INCA 2JB5H 4KVCL 1DUZA 4WFHD 2AEWA 1HINH 1DP0A 3GI8L 4U1LA 4JY4B 4MMZC 5C0NC 4TSCH 1BD2B 2DQJL 1KPUA 2B7DT 5IWLC 3RWHB 2VKWA 2MSPA 2YD2A 4P2RB 3C5ZA 4JDZA 1K2DA 2E9JA 4X9HA 2GTZA 1TVHA 2RFXA 4KY1H 1UA6L 5D7IB 2B2XH 3RL2A 1HXYB 3BDBA 4PJXB 1EEQA 2VLKA 3FT4A 4GBXA 1IGFH 2XTLA 3BPLC 1WBZB 1LP9A 2HH0L 3QRGH 3HN3A 5C0GA 4PV8B 4LL9A 1JHKL 3LPWA 4WFGE 3LV3B 3U0TA 3SDDD 3I9GH 5L88H 1CD1A 5TF0A 4FTVA 4TUKH 4DGIL 2WUBH 1JWMA 2NR6C 4L9LA 5CSZB 1AFVL 1JFQH 4IS6A 4ZXBA 4X4YB 1S7QB 2EYSB 2V7HA 2VLRE 4YWGL 1RY7B 4O58L 3IDJA 2VQUA 3OSKA 4LVOB 4BH7A 4QCIB 3VXSB 1MSPA 3ARGA 3DHMA 3HLAA 2PNDA 3AU1B 2YPLE 3E2HC 5DQJB 1JZ4A 1EO8L 5JW4Q 4PJEA 5ICXA 4CVXB 5I8KH 4LCUA 4Z7VA 4PLJC 2R4SL 3BQUB 4S1SH 5A16A 4MQ7A 1YN7A 1F3JA 4U1IB 4U33A 1PY4A 3LN4A 4L3EB 1YYLL 2JLLA 2JELH 3GJEA 2FHCA 3AFLA 4EN3C 4PP2B 5ADOL 4HZLB 4OZIE 3T77A 2HFGH 4ZYKA 5C0RL 4L4JA 2JJSA 2D7TH 5IBTL 5BJTA 4OD1H 1X5KA 1T7WA 4IRJB 4Q6IB 4MWFB 5JOFB 3VWJB 4ZNEA 1CXEA 1M71B 5HYSG 4OGYL 2VAAB 3PWNA 5GXBB 2EDKA 1NMCB 4L8SA 5DS8B 1R3LB 1TJIH 2PW1A 3C6LA 4K7PY 5IB5A 3VFOA 2XN9B 3S36H 3LDBC 3MFGB 1WAAA 5CS7A 4KH2A 3VE0B 4F15B 5F9JA 3GMLA 1I8MB 4GUPA 1OWWA 3E6HB 4WWID 1Q72H 2FD6L 4Q97A 1P6FA 3RWFA 2PCPA 4PTTA 4OCWH 3QR2A 4OGZA 4UZGA 2B1HL 4NUJB 2OL3H 1F2XK 4DKFL 1ZLVK 4YHNB 2BSSA 4G8FA 4Y4KC 5FHBH 4D3CL 5HYSA 3GSNH 5MENE 3DGGA 2ERJB 4MDJB 2R0WH 2ZG2A 4UOW1 2AXGB 1IGCL 4HFWB 2OQJB 1QHPA 4GAFB 4FQHB 4UBDC 1KBGL 4X7TB 1NUDA 5E6IC 4ZSOA 3WFHA 2VITB 2WBJB 1MRFL 4PRAA 4NYLA 2AJSH 2CRIA 4ZPVA 2FGWL 4M8QB 3WFBH 1RQ5A 4PJ8C 4XZUB 3O6KH 4YX2L 3C60C 1HZHL 4LP5A 2VXSH 4MCYA 3KAAA 3SE8H 4RBPH 3PQYB 2PYEB 1KENH 3SDDA 1KB5B 2LVCA 5D1QB 2EDBA 4N8CL 2HT3C 4I9WE 4UT6L 4BFGA 4KZDL 2OLDA 2DQIL 4K7PL 4OF8A 2FLRT 1LEGB 3WIFA 1PKQA 4MQTB 3MJ7B 3PWPD 5DDHB 3QG6B 5F88B 3NA4A 5I9QB 4KKAC 4OLZH 2H2SD 5IIEA 2RB8A 4HLZG 5E2UL 1QSEE 5J7CC 1IGIL 2AEIT 2BDNH 2ENYA 2W38A 3P3YA 4TUOA 5HI5D 2ZCKL 3SDCD 4OM0L 1I1AA 2DQUH 3H6JA 4M7LH 4O02L 4OAWA 4Z7NF 3DVNB 3T8XB 4CL7A 5I1GH 5LXGH 1AD9A 4NZUH 4M00A 1DBKL 3DX8B 1D5ZB 2FEEL 2E7LA 1A64A 3VFGH 3HCVB 2AERT 2F8OA 4Z0XA 2HKFH 1K4CB 4M03A 5EIIA 3WN5C 5T33H 1FBIH 5JLZA 3DSFH 5KSVA 2DD8H 1A3LL 2FDBP 3ARPA 1T2QH 5C3TA 2WWMD 5T3ZL 3HZYB 1JPTH 3BDYH 5AZ2L 1WFOA 1KTLA 3LKRB 3WJJC 5SWZB 3ARFA 5E8OB 5CHNB 3P9MA 4RFOH 4ETQA 5JHDA 1C16A 4P4KB 4UV4L 1F4HA 2FGZA 3RGVD 3ZKQD 5LQBL 4GKOA 4ODSH 4GLRI 4HJ0D 5DXWA 5JXAH 3WXVH 2ZKHL 5DJCA 4YXKL 5D72L 3BZEB 5F9AC 1NC4A 3JWOC 1HWHB 3Q5OA 3QG7H 2GK0A 4HD9A 3KPSD 5IGXL 4PJCF 4RGMB 1DL7H 3JV4B 3OAUL 4DUXA 1EGJL 3MLZL 5L2JA 3QO0A 3RVXD 3BO8B 4MAUH 3IS0X 2Y06L 4L4TD 4GKNA 1A6PA 1QO3A 5KJRH 3QI9C 2FJHA 1C12A 3QQ3A 1A6WL 3MROB 1N59A 4ZOEA 2DKUA 5B38G 4GW4B 3PIQA 1RULH 4KK9C 4XCFL 1MRCL 3QHFH 4G6KL 3EFFB 2CUMA 3LY6A 1QOKA 3F65A 1N0LA 5LWYH 1TENA 3AC0A 4OZIF 4JFED 3RUGB 2X41A 4AEFA 3AB0C 5HDOA 1K8IB 3UJTL 2EIZA 3IGAB 3FOMB 3OPZL 3QSKB 1X7QB 4PLNC 5B38A 3Q1SH 4KJQD 1RK1A 4AEEA 3MRPB 2W0LA 4YFEA 2ICEB 3G5VB 4HW6A 4KU1A 4Y16D 1T04A 3SKOB 4RWHA 1HSBB 4MJ5A 4PY7B 5K33A 1SJHB 1G7HA 3LD8B 4PJ9A 4JFOA 3C09B 5GGQL 5GRXG 2WM0A 1OAZL 1U95B 5I1KH 4FXLA 3VWKC 1DQQA 3F8UB 3CDFA 1B4JH 4LLDB 2HRPH 2WLZA 3KPRB 3VI4E 1R3KA 1QRKA 4RBPK 3T2NL 2ZUQB 4PJAB 3T4AB 5CZKA 4F7MB 4POZD 1YYML 1ADQL 4UTBH 4X6DE 3T4YA 3LEYH 5ACLA 4HUWA 1N0XH 1AP2A 3LVEA 3C5SA 2EDHA 4OLVH 5E2VL 1KEGH 4YHIB 5GJSL 2Z4QA 5IBUG 4D8PA 1YN6B 4YK4B 3KYKL 1A21A 4LVNB 5IVXA 3RVUC 1QFHA 4PTUA 4X6FA 4KROC 5ACZB 3RGVA 2JK5A 4QRRE 1FE8H 4YGVB 1MFCL 2QTEA 1KCSH 2DM4A 4YUEL 5ISZE 5GHWH 1ZA3B 2VDMH 3OKOA 2C1OB 2DOCA 5TE7H 5B3JE 4HS8H 2VWEC 1OAUL 2C3VA 2FO4A 4XC3L 2ATKA 2DTSA 3TT1H 4ZFZA 3KPSA 1I8KB 4RSVA 3VXME 2DLEA 4XAKD 5IESL 2YN3A 3OXRB 2OJZH 1U3HD 1TZHB 2Z92A 4I3GA 2P45B 4ZUUB 1A1OA 4NQSB 5I71C 1TVDA 4UOJA 4NQEA 1NAML 4XGZB 3FKUS 5CBEA 2OL3A 3RZCC 1CDGA 2B4CH 3VRJB 3ZE0E 2UWEB 3NACL 2ADJB 4JZJC 2HG5A 1F90L 2ICWI 3JTSB 4PRPB 4MJID 3GSNA 1YEFL 4L3AA 4KGLA 5GGVH 2XQBH 3C8KB 3VFVB 4NJAH 4JB9L 3MV9B 3FFCE 5K9QG 3N50A 1I85C 3P30L 4YFDB 4MAYD 5CLWA 3INUH 1NEZG 3TJEL 2AS5M 4LSQH 4JG1L 4PRIB 1WTGT 1G7JA 4YAQA 5CD5D 4YE4L 5E5UB 3PXJA 3HZKA 2AK4A 1P4BH 1LO5B 4G9DA 3VD9A 4WCYL 5EOTB 3ESUF 4XCCL 2FZ3A 5HHPA 3KJ6H 2BSRB 3UTSA 2HLAB 1OF2A 3SKMB 3UZEA 5F7HA 1A7PL 5EN2A 2KDGA 5CJ8A 1MH5B 1TVBA 4X5WA 4LGPB 1XGUB 1UB6A 4TUJB 2GKIA 2OS7A 4OCXH 1ZLSL 3BD3A 2FEDC 2QQLH 3MGTA 5IR1B 3T0EA 2NY4B 1NEZA 5A3ID 5J3HD 3PWLA 3IXTA 5E8EB 4G6JH 1CLYH 3AAZB 2IPUG 4I2XE 1SJXA 3SE9L 2VXUL 4QKXB 1JHTA 4Q9RH 2YKLH 3MXWH 4LOUD 1P7KB 1D9KD 1PG7X 2ESVE 4WW2F 3BWUC 4XPAH 4NNXA 1FG2B 1FFPA 4V1DA 1AQKL 1ZSDA 2O5ZH 1MCWM 3FQRA 3O2WH 3MLXH 4NQVB 3WJLC 5IT2L 1FZJA 1KTDB 5I17B 2ZG1A 2J88L 3RVWD 2DJUA 2V9RA 1VFAB 4DFHA 3RHWF 3ZDZF 3GSWA 1S7WB 1NAKL 2X4QB 5EBGA 4ELMA 3MFFB 2IGFL 1MFBH 4LMQI 3HE7D 5I1HL 2EO1A 3WFCL 5IBLD 1ZWIA 5FM4A 4NOFA 3HG1D 2Z93A 3IVKA 1BJ1H 1RVFH 1AR1D 4FZEL 4PRNA 1FH5H 1Z9MA 2RGSA 3V4VL 2CK0L 3K4AA 4F9LC 4NO2A 2PXYB 5L2KD 3O11A 4MNGA 2ENSA 4ORGA 4RGNB 3UEZA 2BRRL 4DN3L 3ZKXC 5C09A 1F3RB 5GZOD 2ZCHH 1ES0A 2G75A 2YXFA 5ESVA 1OGAB 2UUDH 2DQEH 1UB5B 5JW5A 4JFDE 2Z9TA 3BUYA 3TBTB 1CE1H 4HKJA 1CDUA 1FNAA 1UEMA 1FFNB 3TA3D 1QBAA 1KPVB 3T2OA 3VFTA 5FUCC 3NOIA 2NY2C 5FA3B 1FNFA 35C8H 3MRDA 4P3DB 2W9EH 3MUHL 3EGSA 2A0LD 5IEHA 5BMFH 3CXHJ 1H5BB 2YMXL 1QR1B 4QHUA 4WHCA 5HYJB 3I3DA 3RJDA 1RZIA 3HZVA 2YPVH 1NBVH 4PJ7F 3P0GB 4NCDA 1CL7I 2IALB 4PJFA 4P2RE 3T0DA 3PGCA 5FIEA 5KG9A 2Q7NA 3M1BA 5CP3H 4NRZB 4P23A 5D7IE 1S5HB 3NZHH 4PBWD 2DQHL 4HWNA 1DEEB 4LASH 3KLSA 4DGVH 5EU7C 1V7ML 1BFVL 3UDWC 2P7TB 5EO0A 5DJ8A 2IFFL 5CJ5A 3T0VA 2P24A 3LKQA 3E6FA 2J6EH 4YDIL 1Z9LA 1UG9A 4G8EB 5DA0B 1G1YA 3P4NA 1DBML 5EO1B 5DRZA 1EA9C 3W2DL 1UEYA 4NZTL 5GISH 4MJ4A 2HJKB 5CBAA 2H32H 4A6YH 4GXVL 3LQZA 4KMTL 1XH3B 3MV8A 2E7CA 4NC1E 1IAII 2VZVA 3QUXB 4YXLH 3TF7C 4UTAH 3D0LA 2XIDA 5D7JD 5FYKL 2V2XA 5IB4A 1D9KA 2F19L 3FT3B 8FABA 4PJIF 3ZE0F 1WF5A 1YEHH 2DRUA 4J8RA 1QQDA 5I2IB 1IAIL 4G7VL 4R0LA 5EPMA 4L8CA 3QNXB 4XNYH 4NT6A 4R4FL 3SKUD 2R1XA 1MI5B 2EDEA 4OLXH 1R5WB 5LAXB 7FABH 1EEZB 4U1SB 1B3JA 2Y7QA 5HHOD 4RX4A 5EBMB 3PXHA 1JRHI 2EDDA 3TWCL 4RFNC 5DMKA 1C08A 3D2UA 5D6DA 1AO7D 1CICB 4FQCH 4KKLC 1FYTE 2YD9A 3EYVA 4R90H 1ORQA 2IEPA 1YEDA 2IPTH 3MTRA 3TZVC 1T7XA 3CC5A 2W9DH 4JLRB 3HG1A 1W0VA 1U42A 2M26A 3RKPA 1A4JB 3G9AB 3W0WD 1N6VA 2GJ6E 2QADD 3LN5A 3QJFA 3I3EA 4PJGE 5D1ZD 1BGXH 1DSFH 3C2AH 4WWKC 3T0XA 3QDJB 4KAQH 1FL6A 4IMKC 4Z95H 5L2KA 1GVIA 1NCCH 3ECBB 1I3RA 4GKZA 3MBED 2DI9A 3Q5TA 3U48A 2MPAH 5I6XB 1IZKA 1FL3A 3P4OA 3RPKA 4MQXD 2F5AL 4RA0C 4XNQB 4G6FD 4OF0A 5FYJH 4O2EB 5E7BA 2NMSA 2JCCA 1ITBB 3GMRA 4E0RB 2AKRA 4LK4A 3SO5A 1CGSH 1U58B 3D25B 1XGTA 2XWTA 1W2KT 3FCTA 5TQ2L 2D3VA 2AI0H 4KUCD 4NKMB 4AT6B 1D5XA 4ODVL 1YMMD 1WUNT 3KPPB 1YPZA 3HC0A 4GW1A 2EKSB 5ANMA 1VACB 4U1KA 5GZNC 1MCJA 1CZ8H 1CDYA 1QFUL 1MHCA 4CNIA 3MLSL 1Q9WB 2R23B 4OLYL 2OJEB 3WNKA 3ZKND 3P77B 5DVKA 5TFSH 4CAGA 4PG2C 4UNTA 5JDSB 3BHBB 2I5YL 3SEPA 4ENED 2ARJA 5JW3H 2UUDK 1IZJA 3KXFA 3BP4A 1NGWB 2SEBA 3SGJC 1GCFA 3QHTC 5LJYH 3BE1L 4Z76B 3A6CH 4XWGL 4HHAB 4MD4A 1MJ8H 4XX1G 1XEDA 2VZSA 1NC2D 3PQYE 4Y19A 1T0MB 4LEXL 1L7IH 1NQBA 3WIIL 2WP3T 1NMAL 1R5VA 4G5ZL 1E27B 4PGBA 3TCXA 4KVCH 3EFDL 1MVUA 3GI8H 5EUOF 1SYSB 1T1XA 3V5KA 4HH9A 4U1HB 4XHJC 5CP7A 2P8PA 1VCAA 2DQJH 4M7KL 4NNYA 1U8IA 4QHKJ 3MCG1 5CEZE 3JXAA 3IKKA 1AGFA 2P49B 4X7SL 1BX2B 3AROA 3QUYA 4H5SB 2MOVA 1FNSH 5FYLL 3DV4B 5HHNB 4F2MB 1OARL 1Q38A 5F89B 1UA6H 4ODUA 7CGTA 2OSLB 2NXYC 1RMFL 3GB7A 3KPQB 4IRSC 4Y0GA 3FQTB 5DUBA 1UKTA 5C0CB 4ZAKC 2HH0H 5FXCH 3MRBB 4Y2DB 2EICA 3THML 3IYLW 3ZYZA 5E1AB 3IDMA 1HIML 2XTJB 1JL8A 1TETL 5ESQA 3G08A 5IB1A 5C0AB 3VA6A 1IAMA 3WE6B 3EAKA 2DIBA 5D6CB 3JUYA 4LCCA 4PJXF 4OBRA 4DGIH 1S7TB 5JIIA 1AFVH 5MEQB 4JO4L 1EV2E 5SWZE 3W0WA 3VFRB 1XR9B 1U8MA 5DHYB 5D1ZA 4YWGH 2AP2A 4OCSL 4O58H 2D7QA 4JPKL 5CIPB 2R2EB 1U8OA 3DIFB 3WNOA 3ULVC 1IC7L 3SQOL 4YLQT 3D3VE 1DFBL 2IQAA 1F45A 1WV7T 4U0RC 3VH8G 1CXFA 4MA8L 4OFDA 2CMRL 3V7AE 1EO8H 3TNNB 5B8CC 1WIPA 1E6OL 1BJ1J 2R4SH 3ULUD 1I8IA 5JMOC 3TIEA 1AHWA 4HIHB 1C5DB 5MEOA 2PYFA 3O8XA 4G80A 4CJ1A 2YHGA 2XXCB 3ALXA 3C8HA 2Y25A 1EO7A 1YYLH 5A2LH 1J05A 2AV7B 4V2BA 4CBPA 3U9UB 5HJ3A 4D0CA 5C0RH 3U6RA 3TO2B 3V5DB 3GMQB 4JPIA 4L29B 5IBTH 5HSFA 4G9FB 5SWSA 5CP3A 5DJDB 3CVIL 3S36X 2EDXA 3PJSA 5F7EL 2AW2A 3VH8A 3X14B 32C2A 1T0NA 4OGYH 3VRLF 5IEKA 2W91A 5C0ND 3AXLA 5CEXB 3VDAA 4FFWD 4U1GB 4NCC1 4AIOA 1DE4B 2R1WB 2DM3A 1MJUL 2J6EA 4DWHA 3RUGE 3RDTA 3MNWB 4QTHA 1NC2A 2B20A 2H32A 3D85B 1KIPA 3SE3C 3QIUB 1PYWB 2FD6H 1KGCD 4LIQE 4OBSA 2NCMA 3PWVB 2CXKA 2B1HH 4DKFH 5BRZB 5J12C 3MJ8B 4D3CH 3L3OA 1MQ8A 1AIFA 4MLIA 3I6LE 3DRTB 1I8LC 5CKAA 4KJYB 4UQ3B 1IGCH 5H35A 5TDPB 4X8JB 4MHHG 2VSCA 5SWQB 3HUJB 2X9XA 2GSIB 1KBGH 4NQCB 1BWMA 2F74B 3TP4A 5JO5A 1MRFH 2UVEA 4G3YL 2FGWH 1FHGA 1IGYA 4YX2H 1HZHH 1K4DB 4HKBB 3BP5B 1OT1A 2HFEB 3UPRA 4N0RA 3GMPA 3LS5L 5DLMH 5F21B 2E8YA 2VMFA 4N8CH 3C9NA 5INDB 4UT6H 1A9BB 4PJHE 3UTTD 4KZDH 5F71A 5J9PA 5TJWK 3WL9B 2DQIH 4K7PH 1CBVL 2DI8A 1LK2B 5ALBL 2X7LA 4JN2B 3ZE1E 4PLJD 5F7NC 1U8HB 5B4MC 4NO5B 3MZTA 4HUXB 3QIWC 3H9SB 2APTA 3KS0J 5BVPH 3TV3L 4P59L 1QZ1A 5E2UH 1IGIH 5HHXL 2ZCKH 5TH2A 4OM0H 1WZLA 4EN3D 1X4ZA 1AXSB 2F9BT 2OR8A 5C1MB 4I3RL 5I8EA 3RTQC 1RUML 4O02H 4QOKB 3GIVA 1KB9J 1D5MA 1A6AB 3HAEG 3X13B 2A6IB 3V2AR 1DBKH 2YEZB 4YO0B 1FNEA 3LKNB 4NC0B 3LKPB 3FQWB 5IKCA 3VW3L 3L7FA 3Q6FA 3SCMC 5F3BB 1RZ8A 1A3LH 1WBXB 3VFMB 1KPRB 4PG9A 3BZDA 5T3ZH 4PRPE 5KZCB 1RZ7L 3RWCB 4E9LA 1JTOA 5IMMB 4X5XA 5DJ6A 4LEOA 1S5IL 1JNJA 5C08B 1XF2B 1TZIA 4UV4H 4PRIE 1BQHB 2PTVA 5LQBH 1Y6MR 4Y5XB 3PHQB 1FZMA 3DURA 4JFHE 3D18A 1YNLL 3IDUA 4FA8A 2NY0C 3HAEA 2D4DA 4JJ5B 5D72H 4AQOA 3B2VL 1T2JA 4XNZB 5IWLA 3QFJB 1FJ1A 1EAPB 2Y4SA 2WUCH 5HGAA 5IGXH 4R4NC 3BEVA 2CSPA 4N9OB 3RY5A 3OAUH 1NCTA 3NCYS 3HI5H 1EGJH 3MLZH 3VD5A 1ZVSB 2Y06H 5DJZA 1U92A 4UBDD 2FX8L 5E6ID 4MX7A 3OXSB 6FABL 2ZUWA 1JPGA 2Y5EA 3R06A 4KRPC 5FM5M 1DBBL 5DRWB 1A6WH 3QXAA 1Z5LB 2EXYC 4NQDB 3IDXL 4PJ8D 1FSKC 2X4UB 1P6AB 1RIHL 1CFSA 1CT8B 3PNWB 4CDHA 3NPSB 1MRCH 5M95B 3MV7D 1PZ5B 1WFUA 4XH2A 2HT3D 1NGYA 1MAKA 3O9WC 4R96A 1WWCA 5FK9B 4J6RL 2IQ9L 2P44B 3U79A 1UCBH 3OR7A 3RWEA 4KKAD 1WWAX 4P5KB 3UJTH 1T6WA 3PHOB 4JJHA 3RL1A 2R2HA 3U36A 3VU2A 4Z78A 1CTOA 2VLLA 4LLVA 1IM9D 1TJHH 4NKOA 4FMKA 1EIBA 1JGEB 1WCQA 3MYJB 5DFTA 1XGRB 3UTTA 2B39A 3RUGF 5D2NC 3KLDA 2BNRA 1PEWA 3LIZL 5C07E 5HGHA 1SY6L 5IMOB 1AGDB 1FORL 3MRLB 4V2CB 4Y4FC 5GGQH 4UT7H 1OAZH 5E9DE 1U93A 2IADA 1UCTA 4JY5L 4PFEA 5D5ME 1IQDA 5DVMA 2OR9L 2X4OA 1XCQB 1PLGL 3T2NH 4KDVA 4NQXA 4YC2C 4C56D 2DL9A 4U3CA 3IS1X 1YYMH 1ADQH 4Y1AE 4G42B 3M8OL 4XTRC 1DEDA 5IVZB 3FMGL 1U2HA 3KPLA 4PJBA 2Y6SD 5E2VH 5GJSH 3QWRD 3KYKH 5HPMB 3HPLA 4PJAF 3NCMA 4JKLA 3GMNA 1ETZB 4H1LG 3QI9D 1MFCH 4GOSA 1D7FA 5INCB 5JOPE 4YUEH 3GBML 4FFZL 2NLJA 4FQPA 1NLDL 4R7NB 2C4FT 4U1LB 1OAUH 1KCKA 4XC3H 4Y4KA 2Q87A 1UT9A 4KK9D 4JFXB 1KPUB 4BM7A 4WUUE 5HDBF 3V8CA 1MF2L 1YEJL 5IESH 4OF5A 3T1FA 3BKML 5JQ6L 3C5ZB 2IH3B 4JDZB 4P48A 2GTZB 2RFXB 3F6IA 4K8RC 4PB9L 1NAMH 4TNWF 5SV3A 3RL2B 3WFDL 4KI1A 2CIIA 3QNZA 3FT4B 3NACH 4GBXB 3TJHD 1F90H 1ND0A 4QYOB 4Z7WE 1YEFH 3QUZB 1LP9B 3RVVC 5GGTL 2F54D 3C60A 4JB9H 5HYIA 3BGFB 3P30H 4H1LA 2CGRL 2E5EA 3TJEH 5D7LD 3MV7A 5TPWL 4JG1H 4MZ2A 3U0TB 2NY1B 4FTVB 3GRWL 1K8DB 2UWEF 2YPKA 4WCYH 5BOZG 3QUKB 4XCCH 4EI5C 5IFAL 4C4KO 4IS6B 4ZXBB 4NHUA 3OKLA 2V7HB 1CI5A 2AEPL 4HS3B 1F4WL 4FQXC 3F12A 4ZODA 1A7PH 2ATPA 2CO6B 3IDJB 3DLQR 3ARSA 4QWWD 2XKSA 5I73B 3QO1A 3FN0L 1WSST 1FC1A 3ARGB 1KLGA 2Z8WC 2YD6A 1T5WA 3CZFA 1OSZA 3HNVL 3TC9A 2ICES 4LCUB 3OB0H 4Z7VB 3SE9H 2VXUH 4WI5A 5A16B 4MQ7B 4F7EA 4KRMB 1YN7B 1F3JB 2NZ9C 2EC9T 3WN5A 4HJJL 5T3XE 3LN4B 5E99L 3RHWK 5ADPL 3EOYG 2B8OT 1KELH 4HCRL 1AQKH 1RZKL 3REWA 1K85A 4LLQA 4R7DB 3WJJA 5C2UB 1NUGA 3T77B 4Y4HC 4ZYKB 3RVUD 5IT2H 5B21A 3WIHH 2Y07L 4KVNL 5BJTB 2J88H 4QT5A 4C56A 4PLKC 5L9DL 1NAKH 4EIZC 4KI5C 3TBSB 4MA7L 2IGFH 3PWNB 1YECL 5C0BD 2EEAA 2ZSVB 4A2MA 4HUNB 1FRGL 1OT2A 5I1HH 1PX3A 4L8SB 3GO1L 4TVPL 3C6LB 4ZD3L 4FZEH 5IROA 2Q7YA 1CFQB 5EU6E 4FQIL 5IB5B 5HDQL 3VFOB 4QTIL 3BRDA 4QF1A 3V4VH 2CK0H 3E0GA 1IC5L 3GIZL 3GMLB 4PGEA 3B8YA 4GUPB 3RZCD 4RQQA 2YWYA 3QDME 3MRGB 4OV6F 3KPOA 3RWFB 2PCPB 4EQ3A