5ICUA

The crystal structure of copc from methylosinus trichosporium ob3b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
HSFLVDASPSAKDHVAASPKLVKLRFGGGVEPAYSSISILDSTGKLVVEGAKGQADKPRELTLDAPELAVGSYVVKFRVLSSDGHIVEGKYEFTVDPHENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CopC
publication title The CopC Family: Structural and Bioinformatic Insights into a Diverse Group of Periplasmic Copper Binding Proteins.
pubmed doi rcsb
source organism Methylosinus trichosporium ob3b
molecule tags Chaperone
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5icuA00
1O6TA 2Y5QA 2UZXA 2OMTA 2C9QA 1LYQA 1O6SA 1H6UA 2RA1A 2OMWA 5ICUA 4AQ1A 4CC4A 2UZYA 2OMYA 3FAWA 2WQVA 2WQWA 2YA1A 4CC4C 3BCFA 1NM4A 2WQUA 3BC9A 3FAXA 1O6VA 2C9RA 1H6TA 1OT4A 3BZ5A 4CILA 2C9PA 1M9SA 4AW4A 1XEUA 2OMZA 1M42A 2WQXA 2OMVA 3BCDA 1IX2A 2OMUA 2OMXA
chains in the Genus database with same CATH superfamily
1MCHA 3FQ2A 1AKJA 5DHDA 4JFDA 2ZUQC 3F58L 4JFZH 4KJQC 4JGNA 2Y22A 4X2UA 4XWOD 2BVPB 4POYA 1JE6A 4ZMTA 4J3XA 2J3SA 4Q6IA 3SCMD 2VDKH 3PWNB 3JUYA 3SDCD 4IDJL 3ARGD 3HKFA 4HEME 4NM8L 4OUUA 4GKOA 3RUGB 4BCYA 5B1KA 2A9ML 1NCTA 4YSDA 3J2PA 3V0VA 2OTUB 3RWEA 1CD0A 1RULH 4QRQA 1MHPH 2CO4A 3NPSC 4G8IA 3VI3A 3P30L 3D85B 5DEJA 5KSVA 1RUMH 3MCLH 4JG1H 2RBLA 4GP4B 4AEEA 3KBPA 2VE6B 4RESB 4M4RA 4ZDHB 1A6TA 2AVFA 4I3SL 4Q2ZA 5DJXA 1MPAL 4X7EC 4TUUA 3JXAA 4DSYA 3E2HC 3WTTA 5DJ0B 4EKJA 1UACH 1OGPA 1T7WA 3X13A 1GPOH 1T4KA 3GBNH 5IUCA 1ZLWK 2HLEB 3V4VA 3O6KL 3DTUB 4OUOA 3G9AB 2Z31A 3LRMA 3UPCA 2JIXA 3RL1B 4GW5B 5F7NC 1CE1H 3DX7B 4H8WH 4N2MA 4P2OC 1CFNA 3HLKA 2NY6B 4X7SH 4KJYB 5L2KD 2APSA 4N2LA 1JNNL 2XN1A 4MXWL 1XSIA 2PPDA 4PWKA 4RAHA 1OXYA 3CDZA 3VXTB 1ZGLM 1QPPA 2XWBA 2BDNH 5I28A 1DBBH 1Y7VA 4Y5XB 2CJUL 4ZMZA 1P4LB 5KAQF 1K8DA 3KPLB 2EIMB 4YEEA 5D1QC 4FXGB 4PLNC 2VMDA 2Q7YA 1BZ9A 3ZDXE 3RNKA 4J27A 5L88H 3ATEA 2JCCB 2NY4C 5EC1B 2Q7AA 3IETB 2I85A 3MZGB 5ICYA 3SYQA 5FA4A 3BUYA 5FFGA 2YAFA 3Q5OA 1AGEB 4HV8A 5MENA 4UTAA 4HUWB 4BJLA 2YSSA 3CVDA 3K6IA 2JB6B 5AZUA 1R0AL 1LP9F 4LZKA 3DJTA 5JPNC 5KG9B 4HEMA 4QHLB 3U6XS 1X7TA 4MWFB 3X2QB 4KZDH 2DWYA 2X2HA 5D70H 3L9YA 1E50A 3IKKA 1DQIA 1T3FA 2ARJA 2YJLA 2QKIA 5T33H 4XNYL 4X6CF 1X5FA 3AQZA 3DI3B 3WMSA 4AMKH 5HBBA 5EUOF 3U4AA 3NCWA 3N9GL 3LVEA 4AXWA 3OLIA 2ID5A 3TU6A 1FC1A 4WDIB 1BA9A 3ULUL 3LKRB 4LF3A 4X8GA 4RZCB 1D5XB 3C8HA 4PRAB 3UACA 4OFYA 2NY3B 3M1BA 4G2AA 1UWXK 1W0VB 2D3VA 2GUOA 1Q9WB 3AY4A 4LEEA 4LHUB 5I8OH 1FFPA 1A65A 1Q72H 4MA8H 3NIDB 4TV3A 2ODIA 1SYVA 1V27A 5CN1A 4JKPH 2ZKMX 1LDPH 4DPBX 1C1EH 4L9LB 4MA3A 4PJHE 2PP9A 1S9YA 5JW4M 1A47A 2FZ3A 1A4JB 3K2UH 3RWJA 5C2BH 3CLFL 2BHZA 4DWHA 5IF0B 4EUPG 2DQHH 5E5LA 4X5WB 3T0EE 2CR6A 3LQZA 4B9PA 1UXSA 1NLDH 3QDGE 4Y2DB 2YUXA 4NZFA 1BG9A 4PJDB 1IE5A 3P3SA 1W72B 2WOBA 5CEZE 4UTAH 2FAUA 4V2BA 4M62L 5FX3A 1DQDH 1AQKH 1CZ8H 1XMEB 2QGEA 4PJAA 5E2WL 2ZX6A 3SPIA 4PJXE 1CD1A 3D34A 3WFDH 3W9EA 4ONFL 3H9HB 4GBXA 3C5SB 2JJUA 1FBIL 5KTEL 1ZLEA 2WD0A 4QRSB 3Q6GH 1SVCP 4U6HA 3OKEB 4HC1H 1UM6H 4B50A 4KNSA 1Y1UA 4GKZA 2A6KB 1MWAL 1WAEA 4GRLC 3TBSA 1RUKL 3DURA 5K1JA 2OX5A 3B2MA 4OFKA 1V05A 3Q8EA 1DBAL 4PJFA 5FW8A 3S36H 2F7RA 3AU0A 1OB1A 3UBXA 3BVNB 2AEOA 3BPNC 5FDWB 4QLRA 3MLXH 2A9CA 4NBYB 2Y3AA 3RJOA 1ZRUA 3NACH 1DVFB 3DK2A 1X5MA 4EXPX 4WWKA 3PCYA 4TLKA 1KULA 2ENQA 2IAAC 5FHAL 5GGQH 3VAEA 4ODUB 2IANA 5GZND 4ZT1A 1N7MH 1OF0A 2MOVA 2YS4A 3GRBA 1NKOA 4DW2L 4Z76A 3C5ZC 3MOBL 4PP1C 4NPYB 4YGVA 2XG4A 4X7TB 4P46B 5JPMB 3MRGA 1PVHA 3T0VA 2GSIA 5D7LD 2Z4TA 3SYCA 4PJGE 4AW7A 4HD9A 1GTNA 5SWZB 1D6VL 4LRNH 4OF8A 3R1GH 3MODH 4PLJC 4LAQH 1VJSA 5JUEL 2JFCA 4L9DA 3LMJL 1BVKB 2VLLB 1NH6A 1TCRB 3FTGA 4HHAB 4L4TE 5DRZA 1HH6A 5I74B 2R4SH 2V17H 2MOQA 3BN9C 1IIKA 4Z7UB 5C0AA 1U91B 2SEBB 3CFNA 2PXYA 3QQ4B 4WEMB 3MRJB 1CGVA 2J1YA 2WO4A 2WAQA 4GW1A 5C07D 2HA1A 1RY7B 2BFVH 3W11C 2EE3A 3CVCA 4QRRE 1ZXKA 3B2VH 4NO0D 4ZAKA 4EZKA 3LEYH 3WUWG 4DP0X 3B7YA 2EACA 4JO4L 1YNTA 3FPXA 1OGAB 4OD1H 1JHKH 4EZMA 2X0UA 3VSVA 3HJEA 3VJ6B 1HHIB 4L8SC 3L7FA 5T1KD 4QDGA 3S97C 1MJUH 5DD6A 3PQYA 5B8CA 2DQTL 1JYXA 3ZTNL 1NFAA 2HJKB 3B34A 3QPQC 1IQDA 4ZO9A 2VL5B 4L29A 1I1RA 3VTMA 1QLEL 3WTWA 3M07A 1YSOA 1BVOA 1RUQH 4A67A 2DKUA 4LGRB 4U1KA 1CLZL 5GIRA 5CGYC 3BP4A 3QIWA 4LVHB 3QORA 3HNSL 1QPXA 3EJRA 2NZ9D 3GHEH 4NAQA 5A7EA 3KLKA 1M1XA 1XVSA 2ICEB 3WD5H 5E51A 3NSFA 2DLHA 2G30A 1JPSH 3SGDH 2J2ZA 5HHXL 4YZFF 1YJDL 2OKMA 2OSLA 3MLRH 1E4WH 2LTQB 4A1RA 4KXCA 4OZGB 5D7JC 5SX4I 2F8XC 3C2AH 5IESL 5FKAB 2CM5A 3LZQA 1MCDA 3QG7H 4AWJC 2NY1D 1RK0B 3BHBB 3KPMB 1U2CA 2ZOOA 1CLOH 2C9VA 2V33A 1TSRA 1CR9H 5CSGA 2XWTB 3IM1A 2ZQKA 2Z93A 5C08E 3FQWA 3TONA 3WN5A 2VCOA 4OJFH 1SHSA 2GG1A 3EGXB 5KYUB 1NBQA 4E0RB 3FUEA 5M7QA 2PP7A 4JL2A 3WAKA 4PJGA 5DZAA 2Q20A 2N3JA 4X4YB 3EUUA 4P59H 3GK8H 3PDOB 3QNYA 4HA1A 5F9JB 5BUPA 1TR7A 4X98A 5FKPB 4IW4C 4PJBE 5JTWA 2ZAGA 1YAIA 4RMWA 3NOIA 4U1IB 3TNMB 3EOBB 2ZICA 1YMMA 2EE0A 3CHXA 2HT2C 4OV6F 4I0PA 1HAUA 2PYFA 5HJ3B 3W0WA 4E9QA 1TZAA 3CVHA 2QPSA 1CFVL 2P24A 3C60A 5TDNB 5TH2B 3SDAA 1XGPB 2P8LB 3F7VA 4HKZA 4QRRA 4XN9A 4JDTH 1OPOA 43CAB 4MDRA 4AEIH 3GDBA 3V5KA 1S7QA 4LIQE 1E2VA 1K85A 5FO8B 3KL5A 1O9VA 4RGMC 1CBJA 2CO6B 3A4DA 3QQ3A 4TPRL 1KLUB 2FB4H 2UV3A 3H54A 4GXVH 4IKLA 3TJEL 4M1CD 2DQUL 4ANXA 4OF6A 1GSKA 2VLRD 3C6SA 1OP3K 3HPLB 2YD6A 1P84K 4HGWB 1VGEH 3KPQB 4ZS7L 4UIKH 3KBHE 1WRFA 4H0HB 4PBDA 1AKPA 3WNKA 2WAHA 1CFTA 4JO1H 4NZTL 3HRPA 5DK0A 3B2XA 3VXOA 1DQML 4N8UA 4RDQG 1HKFA 2O4EA 5GGVY 3JV5A 2OP4L 1AOHA 4CILA 4JDZB 1GOHA 1JYWA 1NL0H 5DS1A 4BQBA 3KCPA 2DEWX 4YX2L 1TVHB 3WKML 35C8L 1FYTE 1KC5L 2NNAB 4Q4EA 4N0UB 4ORGA 3BWAA 4AC4A 5IWLA 2Q8BL 3P77A 3N85L 3QB7C 3AS3A 3N50A 5C08A 1D5MA 2IFGA 4P4KC 3N42B 3LDBC 4GSQA 5B3JF 3VA6A 3DO7A 3NJHA 4X6DE 4MMZB 1ZOXA 2XKNA 4AG4L 3EIFA 4XO8A 4XC1L 3RWCA 2HLFD 2HRHA 1XF4B 1SJHB 1NINA 1U30A 5AAMC 2ED8A 4GG6B 5F8RC 1JV5B 1JNLH 2FX8H 4UT7L 4JUTA 2VN5A 3FB5B 4NP4H 5DLLA 2B2XL 1E0OB 4YEFA 1FFOB 2P8PB 3N1FC 4RLDA 2F53D 1JNHB 4NC2B 3DARA 2BIMA 3ZE2E 1YY9C 4OLZL 4YHIB 5CCKL 4HXAH 4ZS6D 3GXPA 4HWBL 4AE0A 4EDXA 1A7RL 1BZOA 4ZG1A 1PBYA 3LS5H 4PJ6A 3V6OE 1BVLA 3IJSB 3WJMA 2OXGB 4U6TA 1AZVA 1KB5A 1IM3B 4P2QD 1TDQA 2VISB 1GIGH 1IMHC 1CE6A 4KNUA 4X99A 5IMMA 4UMSA 4L4JA 3T2OA 3UBHA 4ZMOA 1X5HA 3P4MB 3D9AL 3BZFA 3LV3A 3X1NA 3EH2A 5F9DC 3EH3B 4HU2A 2ZXDA 5I17B 2Q8AH 5E08L 4D0DA 1Y0LB 5HYSG 4R8WH 1F42A 2LABA 5TGBB 3WHXB 1QSEB 2IH3A 4FN0A 4QLWA 4K71B 1U8OB 2D3LA 2F1BA 3SY0A 2YHGA 3BKYL 5CAYB 4G5ZL 4R4FH 3BLPX 4U0RB 5ABAA 4P2OA 5IGXL 5GRYA 3CDGB 2Y2TA 2F19L 5ENWA 5GISH 4YXHH 3BH4A 3MRDA 3D39D 2AITA 3OMZA 1JYVA 1YEKL 2AJVL 4XPHL 3VFWA 4QNPE 3K1DA 4FNLH 2DY2A 3S2AA 5ANMB 3BW9B 2VDOB 4ZTOH 5KUKA 4MZ3A 5D1QA 5JW5A 4W9GC 4I0KA 4XBPA 5EF3A 1FIGL 1U3YA 2QQNH 4WHYG 3DIFB 3KGRA 3AQDA 3BQUC 1JDCA 3K3QA 4P2CG 1KB5H 1MEXL 1Q9OA 3AMKA 4GQPH 5D7IB 2GEQA 1H15B 5JMOC 2VDQH 3OWEA 2YZ1A 3IJYB 4F33A 3MCYA 3OAWA 4KO7A 5FYJD 5JHDE 1OAYL 4OCYL 4Z0BH 4J3OC 3QFJE 4I18A 4KKAD 1COBA 1W8OA 2ZOWA 4GIPD 5IVXF 3KLDA 3TTSA 3KXFD 4TULH 3DBXB 1MCPH 5JPNA 4HJIA 2PTTB 2HRPH 4E9YA 1JZ8A 1XF3A 2NDFA 2VN6A 1UWEL 4WY7H 4L3AA 4OM1L 3O4LD 1WHOA 4EF3A 1WD8A 1RPQA 1DQJA 5IHHA 2BSRA 1WE5A 3VM5A 5KANI 1PZ3A 1G6RH 4TRPH 1KPUB 2FT6A 4H88H 5AOZA 5AVZB 4R26H 1B6DA 2L7UA 4U4BA 2ED6A 1MFUA 2P8MB 1Q0EA 5A2JH 1KSRA 5E8DL 3LEVH 1GL4B 3WIFB 4UDTA 3UG4A 2W9LA 3AXLB 3J8F7 5T5NG 2XNAB 3G04B 1L6XA 3O2VH 2UZYA 3JWNH 3IFPB 3P9WB 3NFSL 1CICD 3UP1A 1I75A 1RZIA 5EZLA 5GJTH 4W4OC 5LAXB 2QPUA 5EWIL 4TKWA 4DPAX 1CYXA 1RZGB 4HCRA 2VKWA 3MBEA 1EEZB 1SMAA 5IVZA 3UX9B 3UTOA 2ZXCA 2IWKA 1BX2B 4PJ8C 3C08H 3QCTL 4TVPD 1CBVH 1H19A 3EF7A 4KKRA 1P7KB 4DF9A 3L45A 1D2PA 1UB5A 2VDRB 3JWOC 5AD0B 4LSSL 5LN8A 1KJ2A 1X5AA 2VL4A 1AMXA 4KBPA 1F4YL 1GGCH 4Y7MA 1T1YB 3KM2A 2I9LA 4ODXB 4N9OB 1EJFA 2XTJD 4KU1A 1FC2D 5DR5L 4MBRA 1BJ8A 1F86A 3IMSA 1CLVA 1DVUA 1RL1A 2UXTA 3L5WA 1H8NA 1ZVHA 2ESVE 1DJHA 4GRLA 4HUVA 1BFTA 3T6QC 2HX9A 4RRPG 4XNUL 3X17A 4FQJH 4JZJC 4ELMA 1HSAA 4LLYB 1MNUL 2DQDL 3QJHA 3JTTB 1A1NB 4GKSA 4XMKL 4N1CA 5JHDA 4WTZG 5F9WC 3NVQA 2K7QA 1I3UA 3RJDA 1MJ7L 4F2ME 5LO7A 5AZEH 3LRGA 3MFGB 4AL8C 4XP1L 1T1ZB 1D7CA 1JZIA 4HCRH 3ROLB 2ZF8A 3CDFA 3TA3C 1C16B 1NAKL 5IB4B 2BNRE 1QWUA 4PR5A 3C5ZA 4XN7A 4GQ9H 4KH9A 2ADIB 4YAQA 3POHA 1G9HA 1MCEA 5F1KC 1U8KA 5IJCC 1Z9NA 5MEOB 2PCYA 3OKKB 5CGTA 4ZMAT 1LK3L 1MNNA 2FJSA 4N0YL 4YDIL 1ORQA 4GIOA 3EBIA 3B7UX 4FI7A 5C0RL 4NAMA 4RMSA 3UTTA 1B0RB 3WJLC 4DEWA 3MREB 1GA2A 1M2OA 4M8QA 4BRVA 1R3JA 5DWPA 4QOKE 4BK4A 1XSKA 3HC0A 4U1JA 4FQHB 5G4OA 4ZPTA 5FK9A 1AP2B 2CK0L 2PPAA 1QBLL 5C09B 5IB3B 2LU5A 1UXLA 4ZYKB 2DLEA 3B9KD 4JANA 4NUGL 4OLYH 4KHTL 5G55A 3I6GB 3FQNB 4WGWB 5KW9H 2AJYL 2DI7A 2KZBA 5H35A 3ZK0A 5J6HA 5HDBF 1GC1C 1S5IL 2X4OA 5AKVA 1MAKA 3NRFA 3OMIB 3RNQA 1UXMA 4JAMA 2VLKA 1PPIA 1MI5E 1IAIM 4OH2A 1XGYH 3QJTB 2Y07L 4I5BA 4ZZFA 4RWHA 1WBXB 3BIKB 5CD5C 3LIUA 5JHLH 4KKBC 3T9WA 2YPVA 2ESVA 1FZJA 4O2EA 1SYSA 2CU9A 1Q0YL 1L0YA 4MNQD 1AD9B 1H8SA 2ZCHL 3ULVC 2ZKHL 3RZCB 1RXLA 4BXVA 3KPOA 2AEPL 4BFOA 4F92B 1ODAA 1BXAA 3JVGA 4XX1E 2BNQE 4OZIF 1RSYA 2E6PA 1N5AA 4Q6KA 5CF3A 3VG0L 4TNEA 4F5CA 5D7JA 4IDLA 5HY9A 3TT3H 4LKCA 2ILLA 1HNGA 4MMXC 4NENB 4NO5A 5D6CA 1NSNH 2DDQL 2YPKB 3O3AA 4WNQA 4D0BA 1HWWA 1HK6A 3GMPA 1U8JB 2BNRA 2NUTB 4UQDA 3GI9L 2AJSH 5L4MA 1W0WA 3NP4A 5DYOB 4ABWA 5DC9B 1EGJH 5EIQA 1G7IB 4PRIA 4JRYE 3F7QA 2R0WH 1PKOA 3CFJA 5FUOL 4AK2A 3DHPA 3IXTB 1HL5A 4IRJD 5B38B 2CDEB 4WJ5B 1HSBA 4U6VL 3AWEA 4XAKD 3L5HA 2W0LA 2NX5D 3FT1A 4P2RD 3GC3A 2KC0A 1KIRB 5EZOL 1DLFL 2DKMA 5HGDB 1TJGH 4Y4FD 5B22A 3AGVA 4NQCE 5DHMC 2YPVH 1L7IH 5FV2A 4ZMVA 3HPJB 5CILH 1OAZL 3IS0X 2YGQA 3DGCR 3HE7C 1F13A 3GMLA 3KPSE 5ETUB 3LPGA 4FYSA 2D7NA 5DWUH 2BVEA 3FQUA 3FSZA 2OZNA 1CIUA 4R7NB 2FVNA 4LASH 4NSKB 1KTCA 3HR5A 1KCUH 1MCJA 4OLVH 4O5LH 2HTLD 3PHOB 1KG0A 2DIBA 5EPMB 2WQUA 3Q2WA 2L7JA 3NEXA 4PJEF 1GJUA 5LGJB 2X89D 4UINL 3TPKA 3D85D 3PABA 1G5AA 1MSPA 5HDQL 1IBYA 1UM4L 2JKSA 2WXFA 1KPRB 3PUUA 3EXLA 1ZTXH 4GO6B 2NXYC 3STZB 3IXAA 2O6CA 3V6BR 2D7MA 4YQXL 2B9AA 4WFHD 5DEFB 2F1EA 1CC3A 3ULSA 2AF2A 2G4GA 1LK2A 5E6IC 3S5ZA 1Q9LB 3JZYA 2ZOLA 1KB9K 1FRGL 4AQ1C 5AKTA 1TJMA 4XNZB 8PAZA 1LLAA 2WVVA 3QR0A 3RWGB 5I71B 3Q6FA 1J8SA 4H0GA 2V2TA 3WFCH 2Q9OA 5B4MD 5FOBA 1OD9A 2NY6D 1JDAA 5BZZA 4OT1L 5F89A 3OX8A 4WFFE 3SPCA 3L3KA 2A83B 4Z5RA 1RK1A 3FK3A 5HI3D 3LKQA 1XD0A 2ZCKL 4QXTA 3TO2A 5CEXB 5A2AA 3L54A 4X4ME 3B7SA 3U25A 3DVNB 4P4KA 4PY8I 5DFVD 2XWJB 4JN1H 3GRWA 3V52L 3T65A 2KL6A 4YSUA 3L4TA 2W92A 4IRSB 1Z0NA 3ZE0E 4PRDB 4MZIA 1R34A 1JYNA 5AAMA 3W2DL 2QBWA 4O02A 4YPGA 1CIDA 4CNIA 1RZJL 5D9SA 2PW2B 3CFUA 1U93A 1XB3A 4WKZA 4RWYL 2COQA 3VGGA 4FLSA 3ZKXB 1JI1A 5DRWB 4IRZL 4NQCA 3O0RL 2N1KA 1S3KH 4WUKH 3TWCL 2H45A 4FP8H 4OW6A 25C8H 3PIQA 3K4DA 4JVPA 3SPHA 3VTTA 3G5VA 3REWB 2OULB 4C59B 2WNGA 2DQEL 2E7CA 1ES0B 1U8IA 4NKIL 2Z64C 1J0HA 3MFFA 3O2WL 5I66A 1VCAA 1YN7B 3QAQA 3BYYA 3F7PC 5DURB 2Y6TE 3FTVA 3EJUA 3LZRA 3QQDA 2BOLA 2DQCH 1AO7E 3VRJB 1FNSH 4WNJA 3L1FA 1K6QL 4ZNCD 4F91B 2WLIA 2WYHA 1TQWA 4NNXB 3QUML 3T1FB 2RALA 4R0LB 1VSCA 2CIIB 4P46C 4HPOL 4QRTB 5BNXD 2X1QA 3IEAA 2V5TA 3T77B 1DQKA 2ZYRA 1XD1A 3NRPA 2QVTA 2FWLB 5EBLA 1EHAA 3QR1A 1OZUA 2FSEA 4ATTA 4XN8A 2NY3D 2Y5TA 3F5WB 3KPRE 4RFOH 3L5XL 1CXLA 3JTSB 4LGSB 2JK5B 2EINB 1MFAL 1N8OE 4CSZA 3ARXA 5DZVA 4E9RA 3ISRA 2Y2WA 3L3DA 5I74C 3GTVA 1EK3A 4KKZA 2VR5A 4E68A 3BLBA 1EXUB 5DSCB 4GT7A 2WKGA 5KSAB 5T3XD 2VLJB 3D2UB 4NCDA 5DUPL 3NYKA 2FGWH 4Y2DD 1O5PA 5GHWL 1KIQA 3QR2A 4XP4H 3FN0H 1A02N 4UT6L 1FJ1B 1VEMA 2ENYA 4HT1H 3M88A 2C1OB 2G5BA 5GRJH 3VXMD 1AR1C 3LD8B 4Z7QE 5I1DA 2NUPA 2OTWB 3GLEA 1OP4A 3KBEA 2DJMA 1A3LL 4ZFOB 4QF1A 4NZRL 3V5HA 4BQ8A 3BP6A 3A21A 4WTQA 2PCPA 3H4FA 2L3BA 3EYVA 2PNDA 2V3EA 3KYNB 3IDUA 4WI0A 2ZTBA 2CUIA 4PY8J 2BRRH 2YLKA 5I1HH 1S7TB 3GZOA 3KLAA 3LNEA 3VXPA 4PS8A 1TKWB 4OZ4A 3ARDC 1LO5B 2VXQL 4KY1H 5HHNB 3LH2L 2PR4H 3BUTA 4FTVE 4DO6A 3JT0A 1MH5A 1VFMA 3HZMA 4OIAA 3TURA 3QUYB 4NRXA 4AUYA 5DTFB 2LR4A 3F7YA 3HHSA 2ITDB 1Z0MA 3DUSB 4TQHA 4WV1B 3STLB 1PNDA 3TA4D 4K3EH 2HKFH 1MXGA 1MFEL 4ZOCA 4XVJH 1QFPA 1P5UC 2NNFA 3FO1A 3CSYA 4W9FC 4JFZL 4EEEA 4TTDD 5F0PB 1M7XA 1A7NL 1IAKA 1MFBH 1OK8A 2CJSA 3HI1B 3RQ3A 3V6ZA 1F18A 2W38A 1IKOP 4GRWB 3WYRA 4Z3HA 1TG8A 4XPBH 4XP9H 1A0QL 4KX8A 4QXGL 4IU2B 5C0BB 2XXGA 4BUHA 2FR4A 4GLRI 5ESAB 3NCFB 3ZHNA 4IOIA 1SUJA 5AW9B 4JK0D 5I26A 5J1AA 1RUML 3MCLL 2FHFA 4RMUA 5DHVA 1KY6A 3G3LA 2FBJL 1EHXA 1D5BA 3FJTA 3QEGL 4J3OH 4URKA 3EYQC 4RAUB 1FDLH 4NNPL 3S4SA 2A73A 1IGTB 2I5YH 4BZ1L 1HHJA 4FDWA 4U7MA 1NGQL 5LGHH 1UACL 3JV6A 5JZ7D 3D08A 4F7KA 4XGZB 1S7WB 5EF0A 1GPOL 5HHME 5F1OB 5D7KD 2EABA 5IK3B 3DROA 3QO0A 4OFPA 3SEPA 4D0CB 2X09A 2IC2A 4K55A 2EDJA 4L8DB 2MCMA 3HAEG 1L9OA 3N43B 4CADA 1L0QA 1IKFH 4KO9A 1ZT4A 3FOMB 2W95A 1G7MA 3H0TA 1L3WA 1DSWA 2P44B 1XB8A 4JZJA 4X7SL 2F2HA 3QIUB 2BHYA 2OJEA 2YPLA 4A2FA 2YIHA 3CH1B 4NZUL 1H6FA 1T2JA 3QDJE 4L4VE 2Y72A 4H1LG 5E9DD 2BDNL 4AITA 3DX8B 1P4BL 5ID0A 3DX9A 4G43B 4UAOC 4BFEA 4G1EA 4DGYL 5ESVA 1HESA 1AG6A 3QUXD 2X4RB 4QYOB 2R1YA 4XCEB 3KYOA 1F6AB 2BWQA 1C5DA 4YIQB 3U2JA 2GT9A 4IIQC 1KZQA 3WL9B 1JK9A 4N20A 1ZLVK 4JZNA 3VWKB 1OP3H 1GZPA 3TA3A 4C4KT 5IHBA 2YZ8A 4BSWA 4P3CH 3VXSA 5L88L 1UD4A 5SX5K 2YD7A 4HFWB 1YPZE 5E6RB 5H94B 3HN5A 4LDLB 3AVEA 5C3TA 1HXMB 4N8VA 4DEPC 4ZQKB 2ZP0T 5CBAB 4FHJA 4PS4H 2C9AA 4DPCX 1BM7A 4NKOA 1NBZB 5DEGA 3S8FB 1HU8A 3WJLA 5B3SB 3V4VL 4JFEB 5CM1A 2VDML 3D0LB 3H3PH 2V3DA 2AZUA 5D70L 1Z3GH 2YA1A 3G08A 3LPPA 4X80H 3GZQA 1BQLH 4I88A 2VXUH 3IDNA 4KMTL 3SBWC 2OK0L 4ZD3H 3PPEA 5DJCA 3QZPA 1AXSA 2E3VA 3GXNA 4OCXH 5JQ6H 4LLDA 4PB9H 1MLBB 2ERJC 4V1DA 1OWWA 4F8QA 1S7VB 4M61B 3QO1A 2F5AL 1L6ZA 2EDNA 1Z2KA 4L3CB 2BSCA 5I75B 2EEXA 7PCYA 1M7DB 4XBEH 5I16A 4JREB 2VDNL 4AL8H 5D1XB 2HLAA 4ZMNA 4Z78B 4JG0L 1Q72L 4MA8L 4MA7H 1ED3B 2VAJA 2IDCA 5GQBA 5EN3A 4TSBH 4JKPL 1F2QA 1TSHA 1Z5LB 2EDWA 6PAZA 1C7SA 2NOYA 3K2UL 3NFPB 4JPWL 4RNRB 3MX0B 4XC3H 4AVIA 1QFUL 5IMKA 2VZUA 3QIBC 4KWUA 3BSZH 3I75A 4S11A 2X42A 3BCDA 1MIEL 2D3JA 1KEMH 4LRIC 5DD3L 4ECNA 2E7DA 4UTAL 3WMQA 3LQAL 2IH8A 1AQKL 1MREH 2ZX5A 3KJ4C 3N41B 1E42A 1ZS2A 3ABKB 1HXYA 4PJCB 4NUMA 1GOGA 3KWXA 3WFDL 3BGMB 5DZNA 2RTTA 4FABH 4Q9RH 1NFIA 3VXUB 3HI5H 3ATAA 1QZNA 4NXSA 2H47C 3Q05A 4WI3A 1X5GA 2X12A 2DOCA 4MMXA 3D8MA 4HC1L 4ZTEA 2HP4A 3WFHA 3FH7A 3LKNA 5I82A 4YBQD 1HOCB 5E8NB 4FQLH 2W07B 4NT6A 4EOWH 1S5HA 5IQLA 4FQQA 4AQ8C 5D2NB 1GC1H 1QFWM 4LVEA 1L9TA 4S1SH 4DTGL 2HJFB 3KL0A 3QEQE 3AT0A 4GXUN 5CJBA 3NN8A 5C0DA 4QXUH 2AJUH 2Z3FA 4U1GB 3EDJA 5GS1B 4XPAL 5AW4B 3U30B 1P7QB 1DSYA 1WC7B 3H6JA 2VQ1A 5JOFB 5B39A 3NZHH 4ODWB 7FABH 3ECUA 3GF8A 3P11L 3QEHB 1IEBA 4PM1A 2DYSB 4FFYA 5H37A 3U83A 1WZ1L 3NJNA 4N22A 1NA8A 3V0EA 4JO5A 3HE7A 1PFOA 5JYLA 1G87A 2EO1A 1IVTA 1ZHNB 4MJID 3L6FA 1A6WH 1E8WA 2HFFB 2UYLB 4XWOC 1KTJA 3E3QE 1ZKAA 1UZGA 3OJ2C 3SCMC 3PWPB 4FZEH 5GRUH 2Q3XA 5C9JB 1SJEA 2JCCF 5L9DL 5EZIH 3BUBA 4L8CA 1TXKA 1MW1A 1OSZB 3QEUB 5ISZB 5I19H 1T1XA 3D4GA 4JB9L 1ADWA 2ETWA 1CK0H 1RZFH 4PCYA 4M03A 1IM3D 3ILQC 2V17L 4UV4L 1QEXA 2GI0A 2PUQT 1GVIA 3SJVB 1E5YA 3TBWB 3FCTA 2Z7YA 5E6IA 4G1MB 1WO2A 2CNZA 4XO3A 5IG7B 5DRNB 4BFIB 3HLAA 1IRAY 2D3NA 3D18A 4AQ1A 2PLTA 5FW7A 5AG8A 1QSED 3QP3A 4WO4B 5T3ZH 3Q5YA 1Z5HA 4KRNA 2OZ4A 4KI5C 1A25A 4I77L 3E6HA 1AIZA 5FGSA 3FT3A 1IGIH 1MJUL 4AJYV 1IZKA 1V55B 5HGGS 5GSRA 3UPAA 4PUBL 1TU2B 2QDWA 5F88A 1H0DA 2YC1A 3AJ7A 3DRQA 4HCFA 2DN7A 5E24E 1O0VA 1KLFB 3V5DB 4X6EB 2OMXA 3GMOB 3NIDF 4F3FB 1ASQA 5LQBL 1J1PH 3WD5L 4YO0B 3BAKA 4LLWB 1HEZA 2G2RB 2AABL 4L8BB 4Y5VB 4APXB 1DSFL 1R3KB 4ZZKA 2VT0A 5EZPA 4ZX5A 3MLRL 5JDJA 1E4WL 1HHHB 3HVNA 5KYYA 2MEJB 3N3EA 1RV6X 4R2GD 1IM9A 2EDYA 4PJDF 3RB7A 4E5XA 1LP9E 3OR6A 3QG7L 4QTFA 1NJ9A 1LHZA 1J9CT 1FVDB 5D71H 5IW3A 3NCXA 4HS6B 2PKDA 3QWRD 1CLOL 1I7UB 4WK4B 3CG8A 2P5EE 3QJFB 4A7GA 1G7PB 5FYLE 2V2WB 4ZSOE 1E9OB 3SDDB 4JPKH 5C70A 5EUOE 3FHEA 4KVCH 2OZ4H 5I18H 4JX0A 4X6FA 2Q3AA 4O58L 4GAFB 2Q86A 1NBYA 2OTPA 5IFJA 2EIKB 4P59L 3GK8L 5I0WA 2HT4D 2XG5A 2PO6B 1RHHA 4PQXA 1KF9B 2DMKA 1JWSA 1EV2E 4XNQA 1SJVA 2HX8A 3A6CH 3BJLA 1PQZA 3RDTC 4JQIA 4YHOL 5JIPA 3W1ZA 2DH2A 3QXAA 4OVVA 1ASPA 4FLOA 1Z9OA 4X0NA 2HKHH 5JOPE 1NMBL 2Y4SA 4OGAC 4U0QB 3EJYD 2EYRA 2Y23A 4UNUA 2XN9A 4PI0A 4YE0A 3U79A 2HG0A 3ARSA 4C47A 3K6SA 1ITCA 3IFLL 4I2XE 3B1UA 4GPVA 4NRYB 5CP7B 4YFEA 4ZFGH 2DD8H 5EC2A 2ROYA 1JHLL 3PV6B 2IMNA 1DUYA 3G6AB 2FB4L 4NYLB 1F3JA 1EAPA 3DGGA 5TDOB 1Y6MR 4MJHA 1ZANL 2CRYA 4L37A 1MWAB 5GGSY 2CCVA 2YD9A 1VGEL 4QRPE 3PAYA 3EYUL 4UIKL 3T0XA 4JFVA 2KPNA 4W81A 2W0KA 4IJ3C 4MXVF 3COOA 4Z7UF 1KNOB 1KDIA 2FATL 1CLCA 3MRLB 3VFVA 5DVNA 4JFWA 5LCVA 4PW3A 4ODTL 4TF4A 1LP9A 3W5NA 1J05B 2XFXB 4Z9KB 4YSQA 3OAUH 1HE8A 1YVLA 3ARDA 4E9TA 3FB7A 4G6AC 1M53A 1LEGA 1HOEA 1M05B 2YGNA 5DK3A 1WEJH 2BWIA 1QX1A 2P46B 4J6IA 3N6YA 4ZSOA 1I7ZA 1DFBH 2X4UA 4M7ZB 1NIDA 2EDRA 1SDAB 3IGFA 4GUCA 5F3HB 3MV7B 4ZODA 4JPSA 4PJ7B 5F7MC 3L9RB 2FX8L 3SE9L 1P5UA 1F4AA 1EZUA 4UF7C 3E6FB 5HGHB 3UGUA 1OGTB 4Z7WB 2Y36H 1OM3H 1T5WA 2OXHB 2P4AB 1URZA 1IAII 4D9RE 4Z77A 4AYID 3BRFA 4KUZH 2NXZB 3PL6D 3V55A 3MRCB 4HXAL 3HNVH 3ETTA 3HG1E 4OZGF 2C4XA 3UYPB 3FQRA 1FH2A 1PZ5A 5HHQA 2ZCLL 4M4PA 4WWOA 2D0HA 2AXWA 5CJQL 2HWZH 2VSMB 1I4FA 2HN7B 1FV1A 4POZD 2GB2A 2EKSB 3X14A 5IEKB 2PPFA 1SOQA 1FVCA 4HLZG 2DIJA 2WTRA 4KK9C 4RFNB 3RX5A 5IROD 3WIIL 1PCXA 1QNZH 2Q76A 3O0LA 2AQRA 1KLGB 3BGAA 1OE3A 1QLEB 5IFHH 2PPCA 2WQRA 4LOUC 3GMQA 4LSTH 4CW1A 2NY7H 4B5EA 5C6PB 3GBEA 2LLNA 1EFQA 3KNBB 4MDJB 3O3EA 5EUKA 1GGUA 2F08A 3ARBA 4NNYA 5F1NB 1EEYB 1BXXA 4G8EA 3P2TA 1SY6A 3DHJA 1OLLA 2R1WA 1LD9B 2E9JA 2IQAA 2NTFB 1JL8A 1J0JA 2C1PA 2OMVB 1M71A 4RX4D 4WWPA 5DD5H 1ERNA 1EZVX 4CSTA 4KDVA 1DCLA 1F8TH 5J13C 4ONOA 5GISL 3DOHA 4YZFE 1GYVA 4YXHL 1EMTL 3TIEA 4OM0H 3F7RA 3FO9A 4KDTC 4LVNB 2QQKL 1G9EA 3VCLB 3VFSA 3RZCD 2AK4D 2FECL 2XA8L 4P5TA 1QSFE 3S96A 4FG4A 4ZPVA 5LNGA 4IIQA 1ZHBB 2H1LM 2QQNL 2ED9A 4IBZA 3DUUB 2Z8SA 1KB5L 5DFAA 4OR1A 5KN5B 1AYRA 4FOMA 1CU4L 3L9BA 3UTQA 1NANI 3ZMEA 2J8UB 2DV6A 5JW4R 1XH1A 2VR7A 4KRLB 2FX7L 3DV6B 2GC7C 5F96L 5J12B 1GXEA 4RSVA 2DYPA 1BYNA 2OA9A 2XTLA 1FZMB 1F45A 4OIFA 4UIMA 1ETZB 1U3ZA 3RBGA 1UEYA 1C5CL 1F3DH 1QPKA 1G0XA 1JAEA 4S0HA 5D93B 4IRSC 1MCPL 4NZ8A 3LSOB 4X9BA 1O7SA 2HRPL 4TUOA 2AEIT 3QC5X 4KKLC 4WY7L 1A9EB 2ICWB 4XP6L 3VNZA 3NIFE 1WK0A 3KPPA 4X0KA 3VGAC 2X4PA 4FQCL 5EU6A 2XZCL 1T66C 3LNGA 3N42F 2O61B 1J9SA 1M9SA 4JJ5A 2WZ5A 5IB2B 1ZHKB 1E6JH 1XMWA 3HRZA 3L2NA 3LEVL 3QULA 4J8RA 4X8JB 5E94A 1PD0A 2WTPA 3LN4B 2X70B 3BPCA 4I89A 3TV8A 3TASA 5CKAA 1X7QA 1PCSA 1S4IA 5AW2B 4JHBA 3GSOB 1AI1H 3L1EA 5BRZB 1FGVH 2WNKA 1E5UI 4R0LC 5KBNC 3QIBA 3DX3A 3Q44A 2WZ6A 3C08L 5IHWA 5C71A 3IGAB 4LRIA 3BWUF 1JZJA 5HGBB 4XBGA 4NBZB 1CURA 1BOYA 4FADA 1YAZA 1GGCL 2I26N 4LVOB 5LKNA 5LHDA 1YEEL 4PGCA 3BWZA 3H1ZA 3QA3B 1F58H 2H0JA 4F2FA 4RRPM 1ZGLA 3HS9A 4R4ND 5LDSA 2CCLA 5BZXA 5B3JE 5TE6H 1OCWL 2E9IA 5L2KE 4K23H 3P0YH 4WU7B 1S9WA 2K3TA 2WWNA 2R7EA 3FTYA 4OI8A 2XPGB 5I1KH 3F7LA 4NJAH 3LNFA 1KCSH 3C09C 4AQ8A 2BP8B 3MRMB 3I50H 3RVWD 3APMA 5HI4C 4JL1A 1XCTA 3HMWL 4LPYA 1XSJA 2Y7MA 5F0JB 4Y1SA 1I53A 5ESQA 2WLZA 3S5LA 4XXDA 4NUPA 3C2SA 1JV2A 1YCSA 3G6JA 4FI6A 4HWUA 3ZRSA 1J5OL 4IMLA 3U7YH 3TN0C 1A6ZA 3QVAA 2R4RH 4HCRL 2K78A 1S9XA 1Q1JH 1KXTA 3C75A 1IJNA 1JDDA 2GK2A 3BI9X 2H32A 3MRKA 5LXVA 1P84J 4XX1G 5A43C 4CMMB 1S78C 5IY5B 3OSVA 3VB9A 1SHMA 3MLSH 3KWWA 3O3BA 3K80A 4IKKA 4UQCA 3SCMA 4IBVA 1XGUB 3LX9A 2ZYHA 5D7IF 5FYKH 4QO1B 2BVQB 2O5XL 2QLYA 3ARGA 4MNGE 4XWGL 1N6VA 3ASWA 3QXUA 4TVUA 2DM4A 5DURD 3BESR 5DUBA 1F4WL 4Y19B 2H1XA 3RWDB 4LLUA 5DJ6A 2A77H 3TVMB 3O2DA 1DQQA 3ESVF 2WMPB 1XCQB 5KSBA 2VW4A 4FQIH 4WSKA 5INCB 3CLEL 3VQ1C 4OLYL 3ME0B 1QTYT 4JG9A 2YO3A 4MX7B 1TNMA 1YDPA 3LCYA 3PGDB 2BLFA 3K1KC 5KW9L 4FZ8H 1W15A 1TJHH 3QH3B 1YNKH 3CN0A 3B2DC 4MD4B 1BAGA 3CE1A 2HCZX 4N6RA 1T03L 4KGJA 2X3CA 3QZWA 5HPMA 4M3HA 3PXHA 4G8FB 5E4AA 3OB8A 2NCEA 3D3VB 4IKJA 1ZIBA 1GYUA 5LJYH 2A4CA 1HEHC 1MVUB 3TBYB 4ZW3A 5JHLL 4FE9A 4G6JH 1JRHH 4PG2C 4YSCA 3CC5A 5KSAD 3D2UD 2Q2EB 4BIKA 3U9UA 1A2YB 2VNCA 3RGVC 4GUOA 1MHCA 5DQDL 4X83A 3MN8A 4GO8A 5HPOA 3KL3A 4IU3B 1YYLH 4PG9A 5KYNA 1Z1WA 2AXJA 3MRHA 1SHXA 4N2NA 3WCYA 4NKMA 3T0BA 1C8PA 2CALA 1AANA 1QUPA 3EBGA 4IHOB 1XGQB 2CSPA 4LEBA 3S9DB 3JWNE 3ELAT 1ZT1B 5DZJA 4YK4B 1ZMYA 3RKPA 1PY0A 3C9NA 4MXQC 3F62A 5D2LF 5J3HD 2IGFH 5IZ7A 1J5CA 3D12B 3HFML 4P4RA 5D1ZD 4ONHA 1EWHA 5F7BA 2XT1B 4W1TA 1MRDL 3AACA 3WDJA 5GS0C 2BY2A 1MRCH 4ZQTA 1GJIA 3LKOB 3EKCA 4HWZB 5DO8A 1N59B 1TZHB 4E36A 2JLLA 3HE6C 1FQ9C 1ONQA 5F6HI 4PY7B 5SWQA 1JGEB 2GJZA 3QUYD 1VZIA 4ZK8A 2VDRH 2DQGH 4I3RL 3TPUB 2YPVL 3VSUA 3MRFB 3D07A 3L7EB 3H4HA 1D9KC 4W93A 1AJ7L 3ZZQA 4NN6C 4G8AC 5IQ9B 3LB6D 3T3MB 5MHSD 1HAWA 1ULVA 5D7LE 1FL5A 2FHBA 3H2PA 2X6MA 1QEWA 2A6DB 2VB5A 4HF5L 5KUMA 2VLMD 2V2XA 4Z7NE 4IGBB 5JW4N 1CL7I 4JNXA 4U1NA 3VFRB 4XP5H 1A9VA 3LRHA 5C0BD 2AQNA 3WIHH 2D4DA 4G80B 3M17B 5DJ8A 4OCLC 3QDMB 1D7DA 1NBVL 3APNA 3EH5B 5D5MB 4DESA 2B39A 1ZTXL 3NFNA 3TCLA 1QYGL 1EJOL 2O5NA 1H3UA 1PG7L 4OF7A 3WNNA 1PZSA 2CJTA 5C07E 2R9HD 3L4ZA 3MDJA 1LO0H 1C7TA 3D09A 4K8RC 4XT1C 2CA3A 4BUQA 5DJZA 2NW2A 1FI8C 1Y1DA 4ZUVA 3QXDA 1XHHA 4WLCA 2CO3A 4MD5B 4OSUL 3QWQB 1FN4B 3WFCL 4Y88A 3OJDA 3QIUD 2BJMH 3FUJA 4A04A 4RAVB 3RWHA 3UMNA 2GCYA 2BPBA 1I1CA 1E5ZA 2FEEL 3DMMD 3BUDA 4NFBA 3VRIA 3KMDA 3BKML 4KTDH 3LPFA 4XMTA 4XNMB 2WBJC 1J5HA 2GPZA 3U1SH 1TVBA 3WN6A 4AUJA 3CTTA 4HIIA 1JFHA 5ABDE 1PYWA 5GGVH 3NA9L 3QT2A 3MJ8A 3VWKD 2FLRT 2W0PA 4Z95H 2JKXA 3KWTA 5LWYL 4OJYA 1TITA 1KXHA 4HHWA 3IPEA 5CU9A 2QADB 5AVXB 3ZYZA 5I8CA 5LBGA 3LKSB 1LMIA 2Z35B 4FP8L 5GZNA 5FO7A 5BW7C 3MCKB 4FI8A 4DN3H 4TNGA 3RE0A 2UZPA 2EO9A 4FMVA 4MYWB 4OY9A 3SQBA 4K5OA 1JZEA 5F6HJ 4U1GC 4U3SB 1BBDL 4LKXA 4YC2C 3QPKA 1I3GH 4GI6A 3US1A 1IAOB 1XGRB 3ES6A 1H5BC 5CGMA 1SPDA 5I73B 2P5WB 4Y1AB 2DQCL 2J73A 5E1QA 1FNSL 2ZAIA 4OKVB 1IC4L 4GKNB 4QKXB 5HDBE 4PTUA 1G1CA 3MOAH 3DOIA 3GBML 2X6VA 5ILTH 1VESA 1U3HB 3VW3H 3SBRA 3D4YA 4NZJA 3KPNB 1E40A 1ETA1 3VGBA 4JQVA 4K7FA 1CWVA 5ITBH 3GRWL 3I02A 3OKOB 3GSRA 4U1MB 3HUJA 5DO2D 4RFOL 5AB0A 3AFLA 4ATWA 2PMZA 3KBFA 4F7TB 3QZNA 5D1XD 3MNVA 1U8CA 3GB7B 3DECA 4JY4A 4OLUL 4MJJA 3Q9PA 4OZIE 4TTGA 5T1KA 1QVOA 3IMTA 3VXNA 4PGBB 2AV7A 1RJYA 2R0KH 4G8GD 3OZ9H 2VLRE 4JRXB 3H42H 4B53A 4QGYA 1MIML 3LRKA 4PGZA 4XP4L 1E8YA 2A74B 4OVUA 4XVSH 3ZO0A 2MPVA 3BKJH 3FRPA 4WO4C 1ZSDB 1CMOA 3TX4A 5GRJL 2NLJA 1M7IA 3DV4B 2GIMA 3K8LA 3CSBA 1N6QL 1G94A 3SGEI 4HZLB 1LO3L 5A6IA 3VXUD 2P3YA 3AT9A 4DKEL 5F1IB 3OAYK 5FGRA 3P40A 4BINA 3M1OA 4TNVK 1BECA 1IFHH 1DL7H 3JTBA 4YHNA 3EG9B 3QW9A 4A7QA 2W5PA 1BEYH 1H3PH 3EAKA 2BRRL 3DXAB 5DJDA 5I1HL 4EJ1C 3OB0K 1J11A 4CN6A 3BPLC 4KY1L 4PB0L 3V0AC 4R7DA 4JM2C 1EZSA 2YN3A 4Q9BA 3FL7A 3T1WA 3H9SB 4L1SA 4FFWC 4K4KA 5DJ2A 4BFKA 3P73B 3NUKA 3NRQA 2NYYC 3I9GH 1P7QD 3S3SA 3Q8AA 2XYCA 1SXBA 1AZZC 2F53E 1OAQH 3JT2A 3K8MA 3B1TA 4GMSH 3I84A 1P4UA 4PJEE 4LSRH 1EO8H 2GJ6B 3KHQA 4IOFC 1SFDA 4M7KH 4PSPA 2DMGA 1ET8A 2R2HA 1DVZA 4W9CC 5HYJA 2PYEA 1F11B 1HIMH 2B1HH 4P57A 4XPBL 5KOVC 3VE0B 4R3SB 5IB1B 4XE5B 2N01B 3ATFA 3CFKA 4BKLB 4X5LA 2HTLC 2NY0B 5ISZD 4ZUWA 4P2QE 4JFYA 3AG1B 5LUMA 1NMAH 1BVNT 2DWDB 2EDQA 1A6UH 1EX0A 1AOZA 1KJVB 2GY5A 2CKBA 2Z6FA 3EJZD 3EO9H 3ZL4H 3V79C 2I5YL 1JFQH 4UT9A 3DA0A 3F12A 1RK7A 2E6QA 2JE8A 3SJVD 3VFMB 2X6CA 4OCMC 1EXHA 4HISA 1HJCA 2CE6A 2W60A 4F80A 1G1OA 1WICA 2GIYA 4WEEA 3FC8A 3INUH 3O9WD 3PXJA 4DP9X 5CD3A 4N2EA 1VKXA 1IEHA 2VOTA 1QG3A 4WEBH 4EI5C 3S7GA 4R4BA 1T0NB 3MV9D 2XFGB 2WUBH 1IKFL 1J5DA 1WIPA 1UFUA 2CBPA 3DOSB 2E8ZA 4NJ9L 4I7ZC 4H26A 1IUZA 3TBVA 5TQ0L 3NABH 1E6OH 1RZ8B 4B0MM 3AS1A 4AH2A 1JGDA 3MPCA 5HHOB 1H3GA 4OAWA 3WTUA 3D39E 4ZTPH 1PG7X 3MHZA 1ZK9A 4BE6A 1PY4A 2X87A 4M3KB 4L18A 1NFDA 3SE4C 3PNWA 3M8OH 2FGZA 1U6AH 2YFOA 5AZ2H 5LBSA 2B16A 3VWJB 1WAAA 2FJGB 1F02I 4FNPA 1RQ5A 2QL1A 3TN0A 1IC7H 1YEFL 1W9XA 3RP1A 4PRPB 2PTUA 1JHTA 4B3VA 2BIQA 3Q9QA 3OQRA 3FU7B 2F61A 1L6PA 5CLTA 2C4FT 3JWOL 4U1LA 4MKTA 5D96B 1F00I 2WP3O 4ERSL 5FYJE 3IE9A 3I3DA 4KVNH 1FF5A 1NDTA 1KGJA 2F74B 3QUMB 4YDNA 1WBZA 2F53A 5DS8A 4PS4L 3KXFE 2PPEA 4Z23A 3HBZA 3SDDD 4ELKB 3FFDB 1DVYA 3LXUX 4M9OA 3ULUD 1KB9J 3BX7C 4HH9B 5LG6A 1ZVNA 3OBAA 1F3DJ 3TBBA 3G5YB 3O4LE 2HFEA 4XMLH 1F41A 1Z3GL 1UOVA 2O6FA 1XT5A 5E4EC 2Z7UA 4DQOH 1OIOA 2EIEA 4PRNB 3QCVH 1Q90A 2V8LA 3AREB 3MMEB 2PO6D 1AH1A 1SEBB 5DZOA 1DE4B 4UDUA 5BOZG 4M7LH 2K4WA 2NXZC 5AVSB 4G59C 3GIVA 2XV6B 1VADA 1J5IA 3D87B 1QFOA 3CNKA 3IVKA 3NP3A 4X9HA 2C9QA 4D94A 4H8UA 4NC1E 1Q38A 4WW1A 4XPFH 3NCJL 2Z8WC 2R39A 2UWEB 4Q58C 4TVPE 1O7DE 4GS7B 4PG2A 1TOXA 4GRWF 4LCIL 3FQTA 1EO7A 1WH0A 3MJ7B 5F9AC 3CMGA 1PU0A 3SDXB 2FL5B 1JVOA 1SNRA 4R5VA 4P9HH 1IV8A 1J8HA 2H9GA 2L4OA 5K33A 3WJJC 3FT9A 2XTJE 1OP5K 2XVKA 4YSAA 1S7SA 1JPFB 1PEWA 1JRHI 5IJVB 5K69A 2ZX8A 4MB4A 3VX1A 3O41B 4OZFB 4N0FB 2BFGA 2W91A 1IKNA 3LKPA 2EVJA 2HFGL 3BGFB 2R29H 2R2BA 1IARB 1ECZA 3AB0B 1W0YT 1L0PA 4GRWH 4ZOAA 2DTSA 4GXFA 1I8KB 3I9IA 4BGDA 3VXQB 3A67H 4U1SB 3U46A 5BZDB 3OXSB 5DQ9A 5CP3A 1GC1L 1QACA 5E2TH 4NHUB 1LJMA 1JMXA 3N43F 3PJNA 1QI3A 5JIDA 1CXEA 2IPUG 5CJXC 5KANG 1U41A 1QR4A 2WY3B 3F83A 1E90A 5AB2A 2AJUL 5BZWB 3O8XC 1S7RB 5F7AA 2OSYA 4BH8A 5KAQG 3MV7D 1CFMA 5TQ2L 3C6LC 3CCHA 2ZG2A 3MV8A 1FFRA 5GSVA 4OQTA 3NZHL 2FO4A 7FABL 5FA3A 2WLLA 3RIAK 5KVFE 2D7QA 1BXUA 1JPGA 4HWNA 1IL1B 1INDL 4N2FA 1Z7JA 4X4ZA 4R84A 5HXMA 3ULVL 1KENH 2J5WA 3QUZB 1RZPA 1XF2B 4ZFQA 4OB5H 1A6WL 2ATAA 1THAA 4LXFA 1WBYB 2RFXB 1JN6B 4HS3B 2JELH 4YHMH 4FZEL 5GRUL 3QJZA 3W39A 3HHMA 5EZIL 4WRLA 4APQC 3LS4H 5I19L 3P69A 1USQA 1DYZA 4KUCF 1TMQA 4HS8L 4ADJA 1RZFL 2EQDA 3L1OH 2YXMA 3O3DB 2FNBA 3BQVA 4HP5A 2XKSA 2XXMB 3P9MA 1AKJB 1V10A 3ARUA 3TBTA 1BIHA 4JFDB 3P2DA 5GS0H 2DWEA 1MCWM 1OT4A 1LILA 4Q6IB 3RTQC 3DPDA 2PN5A 2O5YL 4OUUB 4LNVA 5F9OL 4H2AA 1P7BA 1X5XA 4UZGA 5I6LA 3GM8A 2CBQA 3SGJC 5JR1H 3V0VB 1IGIL 4NQXA 4QRQB 3V7MA 3ZDYF 4B27A 3QRGH 3ZE1B 3DX0A 4G8IB 3L9EA 4JFPB 4FFYL 3DSNB 4FG6C 3VI3B 5KSVB 2Y69B 4K2UL 4O2FA 1XTLA 1JPTH 1OB0A 2Y7QA 4MNQE 4M4RB 1EIBA 2BS9A 1A3ZA 1A6TB 3DUHA 4Q2ZB 5DJXB 4J3SA 3RB5A 4GAYA 4S0SD 3X13B 2WBJA 1NBCA 2H7WA 4G3YH 4M93B 1T4KB 1ZK5A 3MXWH 2XZQH 1J18A 3V4VB 1MJJA 2VDMB 2Z31B 1L9QA 1KTDA 3UP6A 1AZNA 3M7FB 1SDYA 4P5MA 2P43B 1UC6A 2JIXB 5KYWB 2JKLA 2ORBH 4KQ4H 1CFNB 1BQHA 1A66A 3N41F 4J5VA 5C0GA 2BC4A 3QQNA 4PJCF 3BT0A 3BC9A 2GEEA 4LCYA 1H3TA 4JE0A 2PWHA 4XI5D 3CDZB 4AV5A 3O6LH 2XWBB 1DO5A 2KQMA 5SWSA 3Q3GA 3NCYP 2CH8A 2OZ4L 4KVCL 1U0QA 4LEOA 4Q97A 1T0MA 1V7ML 4XAKE 1H5BA 3EOTH 4BEIA 3ZO9A 2NX5E 4ETYA 3BZEB 2BY3A 2VDNB 4P2RE 1K8DB 4YE4H 1DDTA 2QSTA 3BDYH 3K0WA 3VTAA 4DK6A 3TF4A 4QHNA 1B4LA 2YLHA 1BZ9B 2EDBA 3LIZH 2Q7YB 5L4FA 3RNKB 1D5ZA 3SKUD 3UXFA 4WI6A 3ARFC 2DQFA 1GGIH 3V4UH 1FHGA 3AG3B 4OGXL 3VQLA 2AVGA 2W94A 4UM9B 3S88L 5GRZA 2EVHA 2CK2A 4NM4H 2X1XR 4K3JL 3O6FC 5CN2A 3JVFC 5FA4B 3FQ4A 1E28A 2VAAA 2CMRL 4NI3A 3QC6X 5MENB 2NTSP 3NCBB 4KJWD 2VN7A 1HYSD 5DJYA 1WFOA 2HKHL 2YSSB 3MRBA 4N1EA 4FJYA 2QQQA 4KITB 3WSQH 2W65A 2K9FB 4HJ1A 2Y0SA 3A6OA 1T3FB 2ARJB 3HMXA 2QKIB 2P49B 5BRZD 3F58H 4ZMLA 5EA0L 4J23A 3U9WA 4P9MH 4OJAA 4AXWB 3FUHA 2NR6C 4WFHE 4IDJH 4NM8H 3ZTJG 2EIBA 1B0GB 4LF3B 4B9JA 2A9MH 3OF6A 1N10A 3HNTL 1X5IA 1TQCC 2IWFA 3KS0H 4NQDD 4WW2C 3M1BB 2FT8A 3U6RA 2E7HA 1U9KA 2GUOB 4LCWA 3RA7L 3F65A 1FFPB 3NJMA 1YA5A 4NN7B 4PD4K 4LLMA 2IAMC 2K8QA 1SYVB 1W8EA 2X40A 4MA3B 5EU5A 1S9YB 3DPBA 2FZ3B 4I3SH 1CVSC 3PWUA 3RWJB 3FUIA 5A7BA 3UPRA 1UQSA 5B1BB 5I30L 3LQZB 1UXSB 4PV9A 4DZ8A 4MAUH 5ITFA 4XVTH 4D7PA 4IOSD 2V7NA 1QAWA 1CDBA 4JM2A 1WEJL 1NGWA 4PJ5D 1DFBL 5INDA 4AYGA 2E76C 3O6KH 4PJAB 4OZHA 3GJEB 3W82A 1CD1B 4DOHE 3NGBB 3W9EB 4GBXB 4ZW8A 1K2DA 4XZUA 3RVUD 4LCCC 4P04A 3KLSA 2A7BA 2NX5A 3MGTB 4P2RA 2WOYA 1JNNH 1TEGA 3CXFA 1NEZG 4MXWH 4U6HB 2JCCE 3Q2CA 3VRLF 5T3ZE 3AXHA 1J1XL 3EDEA 1UWFA 4FYRA 1RH8A 2Y36L 4HG4K 1OM3L 1EANA 5ANHA 3X11A 3TBSB 3P2BA 1C9SA 3WNIA 2R83A 4HBCH 4NIYE 3DURB 3GEFA 1YO4A 4NKQB 4WI9A 2OX5B 1PF3A 4PJFB 2BVPA 5JIQA 4ZUUA 6CGTA 3OGCA 1OB1B 3UBXB 1U95A 4E9LA 1HHGA 5MP6L 4BSVA 2VN3A 2MPAH 4Y19D 4WU5A 3TVMD 5LCVL 1OSYA 2B59B 4F1ZA 1BQKA 2P7TB 3WKYA 1J1OL 1QRNB 4WWKB 2X89A 3F2LA 3TO4D 2IANB 3ULUF 3K2KA 4Z76B 4AYMC 2P26A 2VE6A 3LH9A 4HDIA 5EOCH 4HJEA 2MKLC 3F85A 1D2OA 1QTPA 3OKNA 4YGVB 2XG4B 1R0AH 3QPXL 2GHZA 3MRGB 3FB6A 1INQB 2EXWD 2FEDD 5FYJU 1J9QA 2BSSA 1NM9A 2ADFH 4EI5A 1M3JA 2WUCL 4CUCA 5KBLA 1OVZA 3I85A 3RDJA 2BP3A 3NIDE 2WN2A 3GJFA 5AAPA 2R2CA 2EJ1A 5DD5L 4WVRA 4Y9BA 4PBWD 3L4CA 4J39A 1AGDA 1W16A 2QVIA 2A6JA 2EAEA 3D3VD 3N9GH 4Z1PA 3RL1A 1SM3L 3FTGB 5DRZB 5C0AB 1HH6B 1MCSA 4P2AA 4KJYA 4KOBA 4PJDE 3EYSH 2PXYB 3R4RA 1H9VA 4U3CA 4UBDD 3SY6A 4U6XA 2GTQA 3MA7B 4GW1B 5E5UB 3VXME 4TLUA 3NSYA 5L4JA 1QLFA 4ZAKB 5I1CH 1LEIA 1EDYA 3R7QA 4XN5A 1YNTB 4Y5XA 1I85C 3CZKA 1A9BA 2P5PA 3L7FB 4UQ9A 4FHKA 3PQYB 5DD6B 2JWYA 5B8CB 2EH8H 4B95C 2HPTA 4MCYA 1IQDB 1B90A 4L29B 5JXED 2BOBA 4DGVL 4M62H 2DLGA 2Q87A 5C7XL 4OF5A 5E2WH 2XZAH 4U1KB 5GIRB 3CGTA 3BP4B 4ONFH 4N2KA 1FHNA 3QORB 1N8ZA 1SBSL 3FSVA 1FBIH 5EHFA 1SY6L 1M1XB 2XY1A 4H25A 4P3WA 3VYOA 1CF8L 3MTXA 1P4IH 3FU9A 3DX6A 3GJFH 5I8EB 3JQOB 5AVYB 2Y5QA 2J2ZB 4D9QD 5BO1H 1JWUB 2OSLB 2DH3A 2J6EA 4QHLA 4GQQA 1RIVL 1MWAH 4YDVA 4LK4A 5CZKA 2W0FA 1CDJA 2HT4C 1J12A 5A16B 1RUKH 3KLLA 1DBAH 1TFPA 1T20A 5DMGC 3BVDB 4KXDA 1NAMA 3FTUA 2Z93B 3FQWB 3CZJA 1NGXB 1UASA 3WN5B 4N5ED 5TD4A 4PJ7F 2YD4A 1GS8A 1QW8A 5TFSL 4M00A 3VXRA 5HGAB 4IGBD 3QJSB 4PJGB 4N3TA 3UBGA 5FHAH 4Z7WF 4PMFA 1JD7A 1MLCA 4MJ5A 1OT1A 3QNYB 3SYOA 1DQVA 4XCYB 1DN0A 5BQDA 1U3HC 2UX6A 3VFOA 2C3VB 4NQVA 4MXVE 1OTSC 3E9UA 1PX8A 4Z7UE 3GIZH 5FECA 1IT9L 1YMMB 3UABA 2CHNA 5DF0A 4I0PB 5D1ZI 1D6VH 1FSKB 4AZUA 2BW4A 4J2XA 4G7QB 3T3PB 3W0WB 3J27A 5D7KE 3CVHB 2IOMA 2P24B 3C60B 1MN4A 5JUEH 1NCHA 3VXMA 2YD0A 3M86A 3SDAB 4HKZB 3F7VB 1MOEA 2QMKA 3C5SA 3V5KB 3MROA 1S7QB 2K9UA 2X41A 1MJ8L 3KE0A 4JR9H 4K23L 3P0YL 1ZPUA 2QZ5A 3QQ3B 4MA1B 5F44A 4CGUB 1RPKA 2BSED 4WUUA 4EAEA 2A74C 1AC0A 4JHAL 4DJMA 1NEUA 1K8IA 4HETA 2EC9T 2LQRA 3C6SB 5E9DE 3I50L 5BJTB 4KHXH 3QE5A 5GGUA 4AM0A 5IBUB 4UNIA 1V3LA 3CHPA 2HT3D 4EN3D 1CFTB 4DAGH 4OJEH 5CMAA 3O8XA 5DK0B 4TNVF 3P02A 5DDHA 3BVNA 1KYAA 3O6MH 3TIDB 2DQTH 4E41D 1GCYA 3C6LA 2I25N 2R4RL 1B6UA 4OZGE 4BZ2A 2CLRA 1QLEH 1A7BA 2GI7A 1CF1A 1HQ4A 1JTTA 4L2YA 3IDYC 5GS3A 3OKMA 1CLZH 1MCWW 5AEAA 3R06A 3HNSH 3P0VH 4KK5C 1BJ1H 4ORGB 3MLSL 4PLJD 5FF6A 2X9WA 3P77B 4NPYA 1RU9L 1CO1A 5FYKL 1YJDH 5C08B 1D5MB 3CZFA 3TCXA 2WXIA 2IF7A 3DO7B 2CR0A 2XWRA 5LNEA 4APQA 2Y1VA 3JWNG 2A4ZA 2J8UF 2ZD0A 4FNRA 4KK8D 4TNWK 4IBUA 2A77L 3RWCB 2OMTA 1YEDA 2BK8A 2BY0A 2ZOUA 5IESH 2P5WD 3IFOA 1HKLH 4W9HC 2Y7LA 3IMUA 5J11B 4QWWC 3WXVH 2DRUA 4Y4KC 2X4SA 4FQIL 4UNTA 2ZUQB 5AENA 4J1UA 4MAYD 1KV7A 5CBEA 4EUPA 2EXYD 2YMXL 2A1WL 3RTQA 4GAAA 1U91A 1XIWC 1CI5A 2WSKA 4FZ8L 4RA3A 12E8L 3HJ0A 1YNKL 2RQEA 4EDXB 3E7JA 1IO4C 2VYRE 4KROC 5K1NA 1VFUA 3BH8B 3SGJA 4L23A 4UTBH 1QSVA 2Z91A 1BVLB 4NEHB 3R8BB 3WJMB 3UTSA 1NIBA 2H8PA 1G43A 1KB5B 4C54A 5EOQH 2JLPA 5C0JA 5I5IA 4BKSC 1X3DA 4G6JL 4KJPC 4X99B 1XF5A 5IMMB 3K91A 2VL5A 4P23C 5F2FA 3BZFB 3E2HB 3MLWH 2EIZA 5HSFA 1MG2C 2CLZA 4F8OA 1VACA 5E9DA 5J06A 4HJ0D 5DC0A 4D0DB 3QUXA 1KCVL 2AXFA 2IH3B 3MRIB 1WUZA 3Q48A 4F27A 3O2DL 4ZXBC 3SY0B 5HDRA 3RX9A 4YDJA 3VQ2C 2G9HA 1LE5A 1O5DT 5I1AA 2DQUH 1J9RA 3A4EA 4P2OB 1NUNB 1T22B 3MBWA 2H6UA 1JGVL 5F72S 5ENWB 1OARH 4J3WA 3A23A 1E7VA 4KGLA 3MRDB 4ZS7H 4EUPH 5JLZA 1KBWA 5HVWA 4N0UE 1T89A 3VFWB 3AS2A 5LBVA 2DBLL 4ZO8A 4PW9A 4Y89A 1WD9A 5TJWK 8FABA 2GITA 1DQMH 2W9DH 6PCYA 3EGXA 4PSRA 4W9LC 1WT5C 2H0FA 2OP4H 5DA0B 3QNZB 5D1QB 5JW5B 1VF5C 1CGUA 4FKKA 3H9SD 3FHAA 2VDRL 4FA6A 4XXWC 3ARFA 1Q9OB 4X4YA 2NY4B 1X4YA 4MQXD 3SOBL 3WKMH 1FAIH 2W88A 5F9JA 35C8H 1KC5H 2J71A 1PIGA 4JHWL 2HJLB 2Q8BH 2NNCA 3O6FA 1ZA6B 4F33B 3N85H 4MJIE 1LTXA 2AQ3A 4UTCA 4ENED 2FUQA 4I18B 5GGSA 1EA9C 5F21B 2GJ6D 2BSDA 1T6BX 2DJUA 2J72A 4AG4H 1AACA 4XC1H 2WXMA 5JPNB 1AMYA 3IJ8A 1XF3B 4FC3E 3ZYJA 2QSVA 2C34A 3AREC 1I3RB 4UT7H 3WUWA 3CFEA 1JIBA 2B2XH 2NY0D 4AI7A 1DQJB 3M45A 4Z0XA 4Y1TA 2BSRB 5CZXC 2H0EA 3LZPA 4JS7A 1ILUA 4OLZH 4EI6A 2NR6A 3E8VA 5CCKH 3P0GB 2OCJA 4HWBH 5KS9A 4W6WB 1NPUA 4OV5A 4UDTB 4WW2A 2CGRL 3QG6A 5AVUB 3AM8C 3VFTB 5AB9A 1QSEE 4DN4L 2UZYB 4PYHA 4WNSA 5E1AB 2FK9A 1RZIB 5EZLB 2IAMA 1UZ6F 3OD3A 1KPVA 2WYTA 3OJMB 1JOIA 5G5DA 5IVZB 4JDZA 5EIIG 1MAML 1Q9KA 3GZPA 2HH0L 2PCFA 5HHOD 3ZRFC 5C86A 1RERA 3MRNA 1A1MA 3N40F 2APXA 5E08H 1UB5B 4CC4C 3WEBA 1AE6L 1MZYA 2ROXA 5ANME 4KTDL 3MJ9A 3VWJD 3BKYH 2WVUA 4G5ZH 4ELDA 1BD2D 4OLWL 2NNXA 5IMLA 4LCCA 1HX0A 5GGVL 4DKDC 1V3KA 5D7IE 2X9YA 4Z95L 4PRPD 3WGUB 3V95A 3LZFH 2PETA 5KVDL 3APDA 3L5WB 3ZHKA 3E80A 1YEKH 2AJVH 4IHBA 4GRLB 2WQSA 4HUVB 4BK8A 3UAJD 5MEQA 3FB5A 3KDMA 1I1AC 1OP5H 2L0DA 4K3DL 1HSAB 4RMQA 4ELMB 5FFOA 3HS8A 3QJHB 4GKSB 1QQDA 5JHDB 4MJIA 4Y5YA 3KJ6L 3NK4A 4YHIA 3BPNB 1IC0A 1FIGH 4KRPC 2AP2A 1IBBA 4G11A 4NIKB 4I1RA 1E4JA 1MEXH 1U21A 3RIAF 5JA8B 2EDDA 2IJ0C 4H44C 5AWNL 3GD1C 4DGIL 4A37A 2DYRB 3DTXA 1YN6A 4F58L 1K3ZA 1OAYH 4HKBA 4R6UA 5E2VL 1WZAA 4PR5B 5CEYA 1ZA3A 3C5ZB 3P54A 2DB8A 4LCUA 4YAQB 2FJHA 3GGWA 3OHXC 5ITBL 1U8KB 1JCKA 4N0CD 3MJ9H 1QKZL 1KXVC 1UWEH 3MKKA 1ORQB 1BGXH 3TM6A 3GQFA 4FQXC 3UTTB 2YGPA 3WHXA 4CAGA 2AI0H 2DI8A 3M46A 4KC3B 2C4FU 4M8QB 3MXVL 1CYGA 1I9JL 1R3JB 3AG2B 1I8MA 3T3MF 5ICUA 3HC0B 4U1JB 4C83A 3C8KA 4ZPTB 5FK9B 1NCIA 4KRMB 4TSAL 3TZVC 3BP7A 4DT2A 4OCSH 4XMPL 5EORH 5E8DH 4FXKC 3RKDD 1N67A 1CDHA 4HIHA 1JGLH 4JANB 3BKJL 5D4IA 2VH5L 1AIFA 4HK0A 3HN8A 4FMKA 2WLJA 5IB5A 3HTLX 2EKJA 5H35B 4WKXA 5D2LE 3GFUA 1I85A 3MC0A 3DETC 4HPYL 2X4OB 4OBRA 5IEHA 15C8L 5D5MF 1AXTL 2YQBA 1FNGA 4FS0A 3RNQB 4JAMB 2YQGA 2VLKB 3AQXA 1FA4A 5ACMA 4PBXA 3Q2VA 3QCTH 1BQSA 3F04A 3WY2A 4W6YB 1LMKA 3AC0A 1IFHL 4LSSH 1DL7L 1T0OA 4YSOA 1H15A 4V33A 5DCCA 5FGBC 1LNUA 4OBSA 2W8CA 4MDIA 1H3PL 1U8HA 2ESVB 1FZJB 4O2EB 1SYSB 4UQEA 1IGYB 2O30A 1KT2A 2FNWA 3E9TA 2KS0A 1U8PA 3QDHA 4M93C 5TPWL 3KPOB 5J3HC 1PG7W 4TMPA 3CVIL 1IBGH 5D1ZC 1K5NA 1N5AB 4BELD 2Z31C 3EO1A 3RY5A 1VLXA 1GGBH 5E8PA 4PN6A 4M5ZH 5E2JA 3NJJA 1UJ3C 5D7JB 5HY9B 2BIOA 2VM9A 3IT8D 4LKCB 4XNUH 3U0TA 3IN0A 1SQMA 3NJIA 4QHPA 3L3HA 1MNUH 4NO5B 1HQRA 5D6CB 5EEVA 3HIZA 4WNQB 4XMKH 3WLWD 4D0BB 3N1GC 4L1BA 1KPUA 1VERA 2ZP9A 2BNRB 3GMPB 2YUVA 2XLLA 4LSRL 3II1A 3PXLA 4UV7L 1QZ1A 1W0WB 2PWGA 3QUZD 1S3RA 4I3GA 1A7OL 7TAAA 3QEQD 1SHWA 4PRIB 4S0TD 3BXNA 4XMZA 1G9NL 1HIML 2I9TB 4XP1H 5I1LA 4UQAA 2XNAA 5ERWB 4BD4A 5HYSA 2VXSL 3FCBA 2FTAA 1HSBB 3AS0A 3EOAA 1CFQA 1OPGL 3Q5TA 1NMAL 2VUKA 2ADGA 2CRIA 4FQ2H 1RZGA 3BEWA 1ILSA 3NIGF 3ZL4L 3TJHD 2UY6A 1G7QA 1JWMA 2P45B 1JFQL 4HWEL 1AKJD 3TCTA 1TPXC 4JFDD 5H2BA 2EADA 2YXVA 3AABA 3GMLB 5FB8A 1HCYA 4PJIA 3FQUB 3VGFA 2B5IC 3DC0A 4EIZC 3FOLA 4AIXA 4WWID 4NC0B 4K3HA 3G5XA 3HR5B 3ZOAA 4YVNA 2PWDA 2WUBL 5D2LA 1KG0B 2CK0H 5AOKA 4JN2A 2R2EA 4L1LA 3VG9C 4PH8A 4HZAA 3PABB 3HB3C 4CN1A 3ZKMD 3GPEA 4DETA 1PZUB 5L8KB 4A6YA 2AJYH 3IXAB 3F8UB 1U92A 4K15A 4QHMA 1S5IH 2AK4E 2BCKA 4XB7A 5AZ2L 4G6KL 4X4XA 2BNUA 5DFWH 2EXSA 3RY4A 3ULSB 1B88A 2X4QA 1LK2B 1IC7L 3DMMC 2ZOLB 2R23B 3MACH 5I0XA 4FFVD 4EZJA 3VNYA 4E9XA 1G1KA 5G4NA 2QZQA 1KCWA 2WVVB 3Q6FB 2CKBL 1HI6B 2JIXD 2V2TB 1Q0YH 3GS4A 5FOBB 4KVNL 2VR3A 2ZCHH 4UT9L 2ZKHH 2IPTL 5CLZA 1JBJA 2EEBA 1RJCA 2OMYA 4MAZA 3OX8B 5F89B 2OMBA 1AAJA 1AGFA 1XFPA 2ATKA 1RK1B 2ADIA 4NBXB 2WINA 4XNAA 1DBKH 3QI9D 4QXTB 3TO2B 4M43L 3NGBC 3PL6A 4P4KB 3LDBB 3GO1H 3OKKA 3T65B 5CWSA 2QVMA 5D4HA 4XMVA 1CLYL 1KGCD 4AENA 4XMLL 2K4AA 4AMXA 5IM7A 4YPGB 2AV1A 2DDQH 4CNIB 3QQ9D 5D9SB 1U93B 2X5PA 4WKZB 2HTKC 3NEEA 1GTFA 1W91A 2BXYA 4UM9D 3UTZA 1SRDA 4M7LL 1SOXA 2Y2YA 5E7BA 4NQCB 3QHZL 4GQRA 5FUOH 5E6UB 4BFBD 1XIWA 1CDYA 4Z7OB 3G5VB 5LBSL 3DHUA 1U8IB 4U6VH 4ODBD 5MEND 5HI5C 3MFFB 5I66B 1TQSA 1XZ0A 4RH4A 3FUKA 2QHRL 3I6KA 4F2EA 4UNVA 1B4JL 5J1TC 3QQDB 2FX9L 4RX4A 4KH2A 3OR7A 1FAKT 1RIUL 2LE9A 2YD5A 2Z7WA 2DMCA 3FT4A 4P23A 2ZIDA 2BIPA 4ACPA 4HMDA 2WKOA 4EIUA 4RRPA 5HHVH 2WXOA 3B9DA 2SODB 2C3XA 2QELA 1RURH 3H9YA 5EBLB 3RZCA 4WTZA 2AK4A 4IK7A 2FSEB 4ALAC 3OVUB 4OFYD 2Y5TB 3ZDZB 4ZXBA 2X2JA 1TYRA 4LQ1A 4UINH 4EPSA 1PKQA 5DZ9A 1JUFA 2ICWI 4PRHA 5HDQH 2AXGA 5T1MA 3ET9F 3L3DB 3HEIB 1PLCA 2COVD 3ABGA 4YQXH 3AADB 1BF8A 3T0EC 5E8EB 1NCNA 3IPBA 5E1GA 1NGPH 3A67L 3RVVD 3WEXA 1KIQB 5T5FA 1AG0A 3WE6A 5DYOA 1FRGH 4C4KO 2JQZA 3IU3A 4EIGB 2Q5BA 3BZ5A 4GI8A 3ZUNC 2G5BB 5I1DB 2NUPB 2CDEA 3BQUB 4XXWA 5B8CC 4GBXD 3X3GH 3QXVA 3OTTA 3V5HB 5CHNA 2I60L 3K7UA 3BP6B 1INEH 2MMXA 3CHSA 4FNSA 1A7QH 2B1OA 2MCAA 4OT1H 2PCPB 5EO0A 3OLDA 2CGZA 5E1IA 2ZE0A 2DIAA 3EYVB 2ZCKH 3BDBA 2WXGA 1W2KT 3QIWC 4WI0B 5ICZA 3V52H 5IR1A 4GRMA 4RGND 3B9AA 1F90L 4OB5L 3KLAB 3VXPB 2JELL 4OZ4B 4YXLH 3KLHC 3W2DH 2G3NA 4PGEB 2EDLA 1FO0A 1U8LA 3U9PL 1BJ1J 1MH5B 4M48H 3HZMB 1DDHA 1OE1A 1U3JA 3V0IA 3ZPDA 4NRXB 2H2PD 2I07A 3MRQA 5CKGA 3KVPA 3F7YB 3HHSB 3PHOA 3V0DA 6FABH 4N3UA 3O0RH 3L1OL 2B1AL 3TWCH 1GAFL 4KKCD 1YQ2A 1QRND 1X5LA 2KZ1B 4WWKD 4YWGH 3UGXA 3ZL2A 3KGSA 2DQEH 5FYJL 3FO1B 1Q8MA 2IAND 3CSYB 3OV6A 4NKIH 2NY5C 4NDMA 5GS0L 1RD6A 3O2WH 4OCNC 1XGTA 4WI8A 4Y9GA 3RPIA 3STZA 4R9HA 5ALCL 3U2SA 3V6ZB 1NWOA 5C0IA 5HJDA 5C0NC 2X88A 3V7AE 1BZ7A 1UB6B 4PWIA 3TESA 2OYKA 3VVVA 3UO1L 5GRWA 1P2CA 4WJKB 2OMUA 3QRGL 1K6QH 4OQTL 2FR4B 3ZZ1A 4LCVA 2GJRA 3ATDA 3RVTD 3ZL1A 1YEWA 4IOIB 3RPKA 2KLRA 4HPOH 2OYPA 5J1AB 3LN5A 3TTYA 4OGYH 4GAGL 1D5BB 2BP5M 9PCYA 2H2SC 3T5WA 2G60L 4CC4A 3PGFH 1DQLL 1YLBB 5C0AD 3S4SB 4I0PC 3H7BA 3GSQA 4HIEA 2A73B 4WHTA 2BWDA 5GRXG 1ZDQA 2R8SL 1HHJB 4IBYA 4DO5A 3L5XH 3JV6B 3GMMA 1BP3B 1XAUA 2C9RA 5BPPA 1FO0H 1FFNA 2UWEF 2XWJA 1K72A 2WB1A 4ZAKD 3DROB 3QO0B 2ICWJ 5IW6A 2XZQL 4RCAA 3GSUA 3INOA 4HUMB 2NCMA 2WKLA 1A7PH 2X05A 1O75A 4CADB 2VIRA 5E1HB 3SDXF 1OTTC 2ORBL 1ZT4B 1G7MB 2A6IA 2OM5A 3H0TB 5DUPH 5K59F 2XY2A 1I1AA 3BMVA 5GHWH 4JZJB 5A2LH 3BPOB 1ZPLA 2ZSWA 1IAIL 2YPLB 4ISVB 4HBQA 4KNQA 4K8RL 5IREA 5F9WB 2KI6A 2RH0A 3MUJA 1XV8A 3O4OC 3REWA 5ID0B 3DX9B 4G1EB 3AUVA 4R90L 4DPRA 3QORD 4NZRH 4WTXA 2OR8A 2R1YB 3RAJL 3EOTL 4ZO6A 1C5DB 1YN7A 4YE4L 2GT9B 4PV8A 4PJ9C 1JK9B 3DJ9A 4JZNB 3HG0A 4K7PY 5B1JA 1EEUA 1GZPB 3LIZL 3TA3B 3T6ZA 5ADOH 2DL9A 4BSWB 3VXSB 1GGIL 4YLBA 3PWJA 1NICA 2D31B 3BT2H 3OHXA 1WG3A 4X8CA 4N8VB 1JVLA 5MHSE 3VGEA 3LH2H 4GINA 1XZWA 3BSHA 4TNWF 1KXVA 4FCHA 5TTRA 1RJLA 2VLME 2CHWA 2GTZA 1DVSA 4GRWE 4OZFH 1JF1A 3CH8A 4NKOB 5DEGB 1A6AB 2RACA 3KVDD 4UM8A 3WSQL 2EECA 2VWEE 4A38A 5CCJA 3K72A 3KR3H 3MLUL 5C0BE 3JSSA 5JO5A 5I9QC 3CFBA 4JRFA 1MFEH 3G08B 1OAKL 5E9NA 5DYFA 2Z7ZA 3Q06A 3IDNB 1Q94A 5E5RB 3TZVA 4XOBA 4FXKA 5JDSB 4P9ML 5DJCB 1AXSB 5DI8A 1A7NH 4PLKC 3WNPA 2KBGA 2N0KA 5KVEE 4G42A 2G0LA 4V1DB 3VFUA 1ACCA 1YMMD 3QO1B 3FZUD 1E5BA 3N5AA 2D7TL 1A0QH 2XQYG 4QXGH 5JQHC 4JRWA 3W0WD 5CZRA 2MIZA 1FJ1A 2FJFA 4UYPA 2HLAB 3C60D 2WJ5A 2FWSA 1KFGA 3SDAD 2AMGA 1K4DA 2FBJH 1ETJA 3GKWL 3QEGH 4NNPH 1MQKL 3U2IA 4JHVA 3FT0A 5FGBA 1Y07A 4GW4A 1L9SA 4BZ1H 2V4LA 5DGRA 1SUHA 2MCPL 5IMKB 1NGQH 3HZYB 4FFTA 1XF1A 4JGUA 4N28A 4F1SA 1E5CA 4MAUL 1IFRA 4XVTL 4AGQA 1SEQL 1BLNA 3LQMA 3RY6C 5LGKA 4LHUG 1JG9A 3MVSA 5D1ZA 3ZE1F 5I8KH 1HXYB 1LO5A 3VI3F 3MCG1 3X3FH 2LAGB 4X50A 1UJ3A 1NFIB 4PCKA 5IWLC 1F6LL 1FE8H 1KXQE 2WXLA 3HMXL 2ICCA 2JJVA 3B43A 1AVAA 4MMXB 1IIIA 3BZ4B 3TWYA 4A7UA 4Z3FA 1SQ2N 3QFDA 4JDEA 3WFHB 3SKJH 3DUSA 4NZUH 3FFCB 3NSJA 2VW7A 3RVXD 1TUPA 3LKNB 3Q1SH 4N6QA 3ENEA 1P4BH 5F3BA 4DGYH 2XBTA 4NT6B 1S5HB 1MELA 1QFHA 4HBCL 1NEPA 2B0SH 2L7EA 4ZW7A 1QUNA 4FQQB 1T2QL 2FIKA 3JYBA 4XAWH 1KBPA 5GGRA 2CXKA 2VABA 1ZSHA 1S2EA 4XMXA 2BSBA 4H7VA 4K5PA 2BP0A 4JFEE 4DVBA 4ZW6A 4HFUH 2NRDA 3NN8B 5C0DB 2IDTA 2OMZA 1RMFL 3QUKA 2MPAL 3I6SA 2F8OA 3VSTA 1IU1A 4IU2A 1PTZA 1S46A 5FIEA 1JZ4A 2VQ1B 5B39B 2EC9U 1UUNA 2F8IA 2XPZA 3ECBA 1KCKA 1IEBB 4I18C 4YL9A 3ZDYE 5EOCL 3HE7B 1KTRL 2HAZA 1YYCA 5PAZA 2C26A 3P4LA 2H41A 2VSKB 3EGSA 4KJQD 5A3IC 4M1GH 5T1LA 5BCAA 4JVUA 4IYKA 3V4VH 2VDMH 2Y5EA 4UWQB 3L6FB 3PE9A 4L5FE 3DO4A 3ALWA 5IUSA 4EE2A 2ADFL 5D1XE 1U8QA 4XGZA 1SJEB 4KMTH 1S9VA 4FFZA 4M5YL 3V6OC 4BFJA 4L8CB 2OK0H 2CDGA 5E99L 4JO3L 1T1XB 3WLBA 4HEPG 1DZ0A 4TNFA 3WELA 4G8GE 2ARJQ 2F5AH 3Q1EA 2YRBA 2NXYB 4WWNA 3EYSL 1R46A 2BSTA 3DDFA 3ESUF 2WHVA 3T2QA 1MRFH 2VDNH 1YRKA 4RSYA 3FCTB 1CD8A 1X9UA 4JG0H 2KMWA 5E6IB 3RWIA 3DMMA 4PJCE 4Z5RB 5I1CL 3HLAB 4G43A 1NC2D 3D18B 4LFHG 1NIFA 4AQ1B 4N1HB 3VXUE 4EZLA 4Q74A 4JPWH 3E6HB 3FF8A 3FT3B 3MBEC 1QFUH 4ZNEE 1WGOA 5GSRB 3GPSA 2EH8L 4P2OD 1MIEH 5DD3H 1FIEA 3LQAH 3MLTA 1H0DB 2YC1B 2XVBA 3DRQB 3LYRA 1IJ9A 2E59A 2XZAL 5EU3A 5D2NE 2OMXB 3ZTEA 5CBAA 2GK0A 2QHLA 4LT7A 1P4IL 1HEZB 5MEPA 5BO1L 3BKCH 5D1QD 4S1DC 2OQJA 5KYYB 1A22B 3ZHLA 1IM9B 3DBSA 3QAZB 4E5XB 2NY4D 4WQOA 3QYCA 3EF4A 3OR6B 1NJ9B 1O9ZA 5A2IH 3MLVL 4AEFA 4AVHA 4PJAF 1G7HA 1GW0A 4MCNA 2IALA 4F7EA 4DTGH 3BMWA 2NQDA 2W59A 3PHQA 3CLWA 3PWPE 4G7YL 2IBZY 4XPAH 5D8JL 1FGNH 5CCGE 1M7DA 1TLKA 1TO5A 2H1PL 2Q86B 5D1XA 4PRBA 5ISZE 1NBYB 1XTMA 3P11H 1EXGA 5EFIA 2XG5B 4QAWA 1WZ1H 2B20A 4PWGA 2QGDA 1RHHB 3HAEA 1UT1A 2Z0BA 4N2DA 1Z5LA 3NDYE 1KTLB 3FUMA 4PJFF 5EBGA 4KXZH 2BRQA 2BVOA 4G8GA 2D73A 3GIZL 3NA4A 2NDGA