5ICUA

The crystal structure of copc from methylosinus trichosporium ob3b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
HSFLVDASPSAKDHVAASPKLVKLRFGGGVEPAYSSISILDSTGKLVVEGAKGQADKPRELTLDAPELAVGSYVVKFRVLSSDGHIVEGKYEFTVDPHENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords CopC
publication title The CopC Family: Structural and Bioinformatic Insights into a Diverse Group of Periplasmic Copper Binding Proteins.
pubmed doi rcsb
source organism Methylosinus trichosporium ob3b
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5icuA00
3BCFA 4AW4A 1O6VA 1NM4A 2UZYA 3FAWA 1OT4A 2WQVA 1M9SA 2Y5QA 2WQXA 3FAXA 1O6TA 1O6SA 3BZ5A 1IX2A 2YA1A 4CC4A 2OMXA 2OMUA 2OMTA 2WQWA 2WQUA 1M42A 2UZXA 3BC9A 2OMYA 3BCDA 4CILA 2RA1A 2C9PA 2C9RA 5ICUA 1XEUA 1H6UA 1LYQA 4AQ1A 2OMVA 4CC4C 1H6TA 2OMWA 2OMZA 2C9QA
chains in the Genus database with same CATH superfamily
2NYYD 4WKZA 4OZ4B 2FDBP 1MUJB 1QRKA 2A3TA 1CFSB 3AS1A 1JWMA 3QUYC 4L4JA 2D4FA 1E28A 4MA1B 1BMWA 2Z31B 3ESOA 2X3BA 1T4WA 4LDCA 5DUML 1ACXA 4RWHA 1UG9A 4XOCA 1U8IB 2VQ4A 1MJUL 3EXJA 4L1SA 3UCQA 3CSFA 5DR5L 3LN9A 3QUMB 4MAUL 2AAAA 4Z7AA 1XGUA 4LARH 4KXZH 7CGTA 4BK5A 2QJDA 2V3EA 4P5RA 2MWCA 2FIRT 4CA4A 4WCYH 5JHDE 4RMRA 2ZD0A 5HVGB 3OJVC 5JQ6H 1SN2A 4K5LA 1I9RH 1QLRA 2KERA 3UP6A 2WOYA 2BSTB 2BVEA 3GMNA 2P26A 5EU3A 1LDPH 2W60A 5E6ZA 3MYJA 2Q8BL 3IDGA 4PJ7A 5JZ7C 4RAUA 3FSOA 4M7ZB 1KXHA 4L4TD 4GW1A 1ZJAA 2JKXA 1NANH 2X9XA 3GEFA 3C6LA 5FLVA 1UOKA 5LCVA 1DJXA 2ATKB 4A2GA 2NT1A 3H9HB 3PJLA 2F54E 5GISH 3THMH 5IR1B 4U2ZA 1VCAA 3L4ZA 3PNWB 5DUJA 2VLRE 2OTWB 5DD5H 3QDJB 3SQBB 1SJHA 1NAKL 2VLJA 5J0BA 1NCCL 4JN2B 1M71B 3EFDH 1XGPB 3U1SH 2H8PB 3L4UA 5IZ7A 3CX5K 3T0EA 2F08A 1ZEAL 2ZG2A 4P2RB 1ZK5A 2IBZY 1HIML 2R69H 5D72H 5A2AA 1DFXA 3JTSB 3VQLA 1MRFH 2Y5EA 5D4HA 5EC1B 5JIHA 4M8RA 1FL5B 4F2MB 3LRHA 4Y5XB 3INUH 3FH8A 5AVYB 5DHXB 1NAMH 4GAYB 3SBQA 1XL6A 3HS0B 4FFZH 4OCSH 4U1JB 4K71C 1T5XA 4UIMB 5C0CD 1GJIA 1I75A 4PJXF 1MCHA 1BD2E 3AG3B 4XH2A 1D9KA 4MXQD 4F8OA 4N2AA 1I8MB 1CICC 4U6VH 4Q14A 3ZYJA 5KG9A 1WFUA 2PYFA 5EZJB 4H8QA 3BKJH 3DUHA 3U0WH 4M1CD 4QCIB 5E94B 1J05B 3HUJB 5TE7L 3FMGL 3FTGA 1FIGL 3DNKA 4GXFA 5E6ID 4OAWA 4LNVA 5L2JB 4E9WA 3U2JA 4S1SL 5IOKA 4XE0A 2J12B 2ZKXA 3N1GC 4KHTH 4GO9A 4QHUA 3CN0A 1ACYL 12E8L 3H0TB 3ZKXB 4PJ5E 5D4QA 2VZOA 2DV6A 4KKLD 3WNIA 2OV0A 5I15L 1L0YA 1WISA 2VMCA 2IFFH 5T3ZH 3ZT6A 5DDHB 1ZHLB 4JNXA 2GSIA 3GZQA 3D12B 4RDQF 1QLFA 1Q9KA 2O5XH 3GI9L 4XNQA 2BSCA 4EQ3A 3VFVB 2GTZA 4LRNH 4J3OH 4KMQA 2Y1AA 4F7MB 2EEXA 1SBBA 2FT8A 2HFGL 2YPLE 5H35A 4M4RA 3H9ZA 3S37H 2DIAA 5I16A 4GG6A 1R3IL 3QWQB 4O58H 3EYFB 4G9DB 4ZO6A 5ANMB 1N5YH 4JHAH 4FC3E 3T6XA 1P5UC 4XPAL 5ITFB 3OVUB 4Z7VE 25C8L 4LRIA 4O2CB 4G6AD 1ZDQA 5CHNB 3LKNA 2JCCE 4H2AA 4FXKB 3T4AA 2DLIA 2VTFA 5TQ2H 1OO2A 2FH6A 5IQMA 4G6KH 4PYGA 3X12B 1OVZA 2PO6A 3BEWB 5E8PB 4HKBA 3BRFA 3IETB 3BXNB 1QSZA 1IBGH 5B4MC 5BRZE 1LYQA 1F02I 3CXFA 4IKLA 1QRNB 1HT6A 5GGVY 3QFGA 4P48A 1T21A 4O2FB 5KOVC 3FB7B 1RZ8A 1OE1A 3L5XL 1U8HA 5AVXB 3KHOA 2IG2H 1UGNA 5MERA 5B3SB 1X3DA 2C3XA 3WXVL 2IOMA 3RY6C 3U2SB 3OV6A 1I8AA 3ATDA 5IB1B 4KDWA 5FUOL 5DD0L 4IBLT 4CGUB 1KZYA 3TXAA 4FQCL 4OF7A 4XHQA 3FF7A 2MSPA 3KPRD 4HMEA 2O5YH 4GS7C 4POZC 2IV8A 2QSCL 2I60L 3C5ZB 5FGCE 5FIEA 3U4BH 3WUWA 3VG9B 3ZTJG 1NFIB 3EH3B 5F1IB 4GLRI 1V3MA 1B90A 4AEIL 2FYYB 1HH6A 4LCWA 1UXMA 1B0GA 3HRZB 5EBLA 4X5XB 4WWNA 3Q6FB 1G94A 3GYRA 3U4EB 3TC9A 4Y2DB 3OKLA 2I07A 4Y4KC 1N6QL 1B9ZA 3CX2A 2X9YA 2CBQA 5D7JB 3RA7H 3UP1A 2FK9A 4PRPD 2CXGA 3WS3B 5F9OH 4R8WL 1C7TA 1V05A 5FHAH 2F53E 4PRHA 2QVIA 3ZMEA 1TU2B 3F7VB 2C8NA 3GS7A 4KWUA 3U9PH 1U9KA 4JHWL 3VACA 3D18A 4PLKD 3MRDA 3NIDE 1N7ML 5F3FA 5G5DB 3V0JA 4Z77B 5DQDH 3N85L 3NFNA 3RVWD 5EDSA 3T3PF 3E6FB 1RJLA 3IE4A 1F2XK 1HKFA 1YUHA 2PXYD 4NUGH 4NZRH 1KDIA 2F7RA 4JFTA 4HZ1A 3OR6B 5DSCB 3WTWA 4P23B 1FZMA 1AZVA 4WAFA 4JM2F 3SO3C 1N8ZA 4GBXB 4MYWB 2BDNH 4XCYB 5AVRB 3SD2A 4XP1L 5CP7A 5CSBA 4NUJA 1A4KB 1SBSL 5JOPD 3T1WA 3HKFA 4ZUVB 1EMTL 1O75A 2ADFH 5GRUH 1JNNH 4FTVA 4MMXC 4TPRH 1FVDA 3SDAA 5D8JL 1CPUA 4YUEL 4KMTH 4MS8D 1ZGLB 4BZ1H 1MCQA 3HVNA 4Q9CA 3NJKA 5AWNH 5JW4Q 4N1CA 4W70A 4P2CG 1YN7A 3QRLA 2ZWKA 3TL5A 5J12B 4FXLA 1AY1L 2GIMA 3HMXH 3NZ8A 3FHEA 4YHPA 5JHLA 1NL0H 1R9FA 4GAJL 3SDXA 1GHFL 3BC9A 5F7AA 2XY1A 3S8FB 1T89A 4JY4A 4I18B 3GSVA 1BPLB 5BXFA 1JGDB 1YYML 1ND0B 4XOEA 5EEUA 5CEXA 4FX5A 4W9ZA 1PZ2A 2APBA 3HBZA 4NHUA 1J87A 5DUPL 4L8CB 3BZEB 4KNSA 1EWHA 2EXSA 5IKCB 5T1MB 2YUVA 4FP8L 4PJGE 4XAWL 1UVQB 1MFDL 3HNSH 5C0RH 1YDPB 1AI1L 1RHHA 2GC7C 3H3PL 4GAFB 4L3FA 1K3IA 4Z7NF 2IALA 2KS0A 4WO4C 4MJIB 1KTJA 5E4EB 3EYOB 3WU1A 4TUUA 4AMWA 2ZXWB 4AGLA 2AXJA 1JF6A 1NGWA 4YSOA 1MVYA 3H2WA 5DD3H 1ANUA 1S5IL 3QFJD 5E2WL 3VI4E 4LSTL 4WFHE 2GEQA 2JB5L 1CTOA 1KTDA 3WJLA 1MDTA 3D7PA 5DJCB 3D25A 4YHIB 1F86A 1Q9LB 4I0PD 3GLAA 3PWLB 5FXCH 4I9WD 3E8UL 4R4BA 1A7NH 2NY0D 1NCBH 4AV0A 3F2LA 2AEQH 2XYBA 3H3KA 1OL0A 1T20A 3MBWA 4JFEB 4R0LA 2VQUA 3CU1A 2Q7AA 2A9MH 4J1UB 2DQHL 3B7YA 4LGRB 4ZD3H 2B0SL 2Z8SA 2NZ9C 4JY6B 5D7KE 2BIQA 2JSFA 4FZ8H 2D03L 4HKJB 5FC9A 3VFSA 3QPKA 4ZS7H 3F01A 3ABGA 3U0TB 1OAXL 3OKNA 2YLKA 4XVUD 1RK1B 4RETB 5DFVC 1NMCC 3C6SA 4KI1A 4X4YB 2MPAH 5DRZA 1A14L 3NGBC 1JPFB 4KX8A 3EGXA 1GIGH 1U91B 1JGLL 2XPZA 2LFGA 4ELMF 5T8IA 1DQJB 1BOYA 3NTCH 1B4JL 1Q0XH 4XMXA 5G4MA 4AL8H 2EE0A 1SLWA 3RWJA 2EYRA 3TZVA 1HHGB 1IL1B 3VXTB 4JG5A 1SNRA 4YFLF 1CGUA 1EJOL 1LE9B 1G6VK 2Z4QB 3CVHA 1T1WB 5EH1A 1U3JA 2AJVL 2C9SA 3Q5OA 1W91A 2BRRH 4JM2D 1BDYA 1DQKA 3UZVB 3NSCA 4S10A 2GJ6E 1PIGA 5HYFA 4OLVL 1G7MA 4FN0A 2CQVA 1MIEH 4GAGL 3LPWA 5J6GA 4LL1A 4KXBA 1BZ7B 4IMLB 3VNYA 3V6OC 1CG9B 2YS4A 2HFEB 5HGBB 2FQDA 4NQED 4HHAB 3QQDA 3U4KA 1CQKA 2AK4E 1VACB 2HX9A 2NY3C 3MV11 3UJJL 1IGIH 4JM4L 3MRQA 3PUUA 1U92B 1LP9B 2KHAA 4Z23A 3CQFA 3QO0B 1QLEB 4LCCC 1KBWA 1MG2C 4UT9A 1FUNA 1IC5H 5AAWA 2IWEA 1VADA 1FL6A 5E56A 4P2OB 1IVLA 1I53A 5F8QC 3PV6A 2HTLD 5DS8A 1DUYB 1H3TA 4N90E 4FNQA 3UJIL 2N01B 3DYPA 1A3QA 1FO0L 3MLWL 2BVYA 1LMKA 1YSOA 2GAZB 1MCNA 2XU9A 2Z4TA 4L5FL 1REIA 2AK1L 2EVFA 4JKPH 3MLZH 4A39A 1E4WH 5FA4B 1KGIA 1KYFA 1RIHL 1TYEB 1EEZB 1FNAA 2CO2A 3ZJAA 1WIUA 1KV7A 3RJOA 4MCYA 1JMZA 2XTJC 2C7UA 2DQJL 4G8FB 5AB0A 4QRTA 2G3XA 3D30A 5HJ3A 4EI5D 5K1NA 3DOSB 4X80H 5L7XH 3F64A 3D33A 1NJ9B 5MENE 2BSDA 1AYRA 4G6FB 4H7VA 5I1IH 2EIJB 1S7SA 3MLUL 2CR0A 2WCSA 2KUTA 2XBDA 4GO8A 5D1XE 2PWDA 1XZ0A 5D2NE 3TYGL 3WXWH 4YXHL 2IMNA 2W0KA 2WAHA 2WC7A 5FFOA 4EI6B 3R7RA 3U7YL 3AQXA 3G6JB 3OAYH 1LEKB 1M7DB 4NM8H 1A4AA 1YNTF 2DN7A 2FWOB 1LWHA 4DGVH 1JRHL 4YHYB 3F7RA 4I1RA 1KCVL 4K5OA 1J8RA 1A6WL 1VZGA 3OG4B 3UZEC 1NM9A 2H3NB 1U8IA 3P73A 5KOMC 3I9AA 4NI3A 4ZMOA 3F7YA 1CCZA 3KG5A 3EYQD 2YN3A 1E7UA 4EOWL 1GGCL 3KEDA 5EO0B 2E3VA 5T5NF 2E47A 3WIAA 3PAYA 3L3DB 4S2SB 5KANI 3G5XB 3MRBA 3QCVH 1GXEA 5I73B 3VGGA 1W8EA 2XRAH 3LS4H 3MV9B 4MHHI 3ZW3A 3ECBB 2E8ZA 2X4OA 3AADB 4XN2A 3EGSA 3K6NA 3O3UN 1VGKB 5DEFB 4Y2OB 2PCPA 1I1AB 1J88A 1FZOB 3HI6L 3BAKA 4V1DA 5J6HA 4BSVB 1MJ8H 4XTRC 3QUXB 1IAIM 4QJ3B 5I5JA 4XN7A 3BSHA 4ZUSA 4B9KC 2ATKA 1SYSB 4UQDA 1NDMB 3U1PA 2OZ4H 5L0QB 3FUIA 2R4RL 2H4EA 5CR8A 3WLWD 4S0SD 4MNHA 4WW2F 1FYTA 3QDJA 4LK4A 3UYRH 2WO3B 3SQBA 4BK5C 4PGJA 4G8GA 4JN2A 4JPKL 2YN5A 1M71A 4P5TD 5HHOD 1AKPA 2OMXB 4W68A 3KLHD 3UDWC 3MGAA 3IU3B 3TBCA 4QHLB 2YEVB 1YEIH 1WCQA 2CM6A 5FF6A 1OP9A 4OJFH 4P2RA 4GT0A 4E42B 5B39A 1S3KH 4OLXH 3II1A 4LSUL 3JTSA 4PP1C 2FGWH 4XMPH 5EORH 4EKJA 2FZ3B 2WCGA 1IMHC 3OKKB 3KBFA 5C0BE 2UZPA 4CU7A 3G04B 4Q74A 4N5UA 3H9YA 3C6LC 4YIQB 5LGHL 1OARH 5F7FA 2X4UA 4DP4X 2VDQB 4L4TB 2J5LC 1A21A 4MJ2A 3HS0A 4U1JA 4UIMA 1BXAA 4MMYA 1JYVA 5CD5C 3NYKA 2LOEA 1N59A 1TO4A 4XMLL 1OAQH 3SE4A 4O9HL 1MXGA 4D8OA 1D5BA 1I8MA 2YD9A 4PJIF 1I31A 5EZJA 1FFNB 1RZFL 4PMFA 2WYZA 1TJGH 3B2MA 1J05A 3HUJA 2COVD 5BQ7B 1GCFA 3M6DA 1TENA 3KW7A 1WDAA 4KVCH 5FS5A 4L9LB 2DI9A 4BE6A 3REVA 3N40F 1BPVA 4DN4H 1DBMH 4RGNE 5EZOH 3SBPA 2K7PA 4UOQA 2ADGB 2H2PC 1MRCH 2WXMA 3BP6B 1ECZA 1N4XH 3FN0H 3FQ4A 1VEOA 5LBSL 2KZKA 3ZRFC 1FJ1A 1PTZA 1QHPA 2YA0A 5DDHA 4D9RE 1WRFA 2G2RB 1I3GL 4Z3TA 5BW7C 4QRAA 3BN9D 3BQUD 3DI2B 3RWGB 4RDQG 4LLMB 3BP5A 1D9KC 4FXGB 5BO0D 1GY2A 5L4FA 1YYLL 3GSQB 1D6VL 2Q86B 4UAOB 1UD3A 5C0CB 4HUMB 3JTTB 4U6TA 2NY5H 4F7MA 1CLVA 2E27L 2CGRH 3CMOH 3FSWA 3H53A 1CXEA 1P4LA 2VMDA 4PH8A 5KVGH 4KBPA 5FO8B 1X44A 1G9NL 1RFDH 2XETA 3EYFA 4G9DA 4F7PA 2VXUH 2X0UA 4HS8H 4NKMA 4GUOA 3WE6A 2J88H 3HG1B 3MRNA 4TVPE 2YA2A 2CKNA 2DYPD 2R0LH 4O2CA 1R24A 2GEEA 2HH0L 4FXKA 4DP2X 2IPUK 3V4UL 2FX8L 1O9ZA 3X12A 4DVRH 3IJSB 3HTLX 1A3RL 5J56B 3L3KB 8PAZA 1TQVA 2WQXA 3O6LH 4PI0A 2OULB 1YQ2A 3V7AG 2YGOA 3QUZB 1B2YA 5KTEH 4ETYA 4F58L 1OAKH 1YAIA 1XBRA 4O2FA 2BVQA 4Y1AD 1TYJA 5D1QC 2H1PL 3D06A 4IW4C 4PJAE 1UA7A 4ETQB 4NDMB 2PR4H 4JRLA 5IB1A 3TA3C 3VUAA 4CVXB 2LHAA 1UWXK 1YMME 3IMUA 1M7IA 2LVEA 4KI5E 1QSFE 3IDXL 3Q05A 3LKQA 3DROB 4BFKA 4HPYH 5FYKL 4OZIA 4FQPA 1BA9A 2O1AA 3C5ZA 4FNLL 1X9QA 3LSOB 5F1IA 3QZOA 1I8IA 4EVNB 1KB5L 1PAMA 2FYYA 4IHOB 3HRZA 4G8IB 4X5XA 1YEJL 3Q6FA 4OR1A 4WNQA 3PQYD 5DWUL 3UBHA 3AM8C 2B3IA 2BP3A 2XC8A 4HS6B 5D7JA 3ARFD 3TVMC 1PQZA 2ESVD 3P11L 2OXHB 4A2EA 2ICWI 3S3CB 4JKLA 5C0IB 5KYYB 1JHKL 4JRXB 7PAZA 1I4FB 4L0PB 3F7VA 2QQNL 1T6VN 2K45A 2VLKD 1YPZF 1WA1X 5EU5B 4WSKA 4WI7A 4HMDA 5HTSA 2VERA 5ISZB 3CDZB 2VE6B 4Z77A 3RB7A 3C08L 3PIQA 4KKCD 5IB5A 3ULUH 1A7QH 1I8KB 2L3BA 4MASA 5EUKA 2NR6D 1QFWI 4JQXA 3TN0D 4LHUA 5L6YH 4GKZA 5EFIA 3QXVA 2V7HA 4K3DL 1KELH 1XXDC 2CO7B 1RUAL 3OR6A 3KPRB 3DTDA 4XOBA 4QRUB 5C0FA 1G6RL 5IW1B 1DQQB 1CD1A 3I6LD 1QPXA 4A6YH 2E4TA 5DLML 3VNZA 4EZJA 1EANA 2YK1L 5DO8A 1XL4A 1KCUH 1N2RB 4YR6B 4ZFZA 2J8UE 3ZHNA 1A4KA 5DK0A 4MD0B 2WQAA 1TNNA 2OMVB 2Y07H 3CC1A 3NIFB 3STZB 1ZOXA 4DESA 4LPWA 1AP2B 1JVKA 1AQHA 2IV9A 2C1PA 5FDYA 4ZUVA 2JELH 3LNDA 4G2AA 3MRMB 4PRPB 4X9IA 3HZVB 5KWYC 1KPUA 1B0RB 1MQKL 1ZGLA 2IBZX 5CBAA 4AYGA 3RIKA 5JXAL 4JFUA 4AKQA 1JWSA 2D7PA 2N3JA 2XXMB 3EO0B 3S2CA 4GKLA 2VRQA 1EZSA 5E1HB 1G1YA 4WDIA 3D2TA 1U2HA 3KPNB 5AOKA 2EACA 3SDCC 3QIUB 1IQDB 2PXYB 2ZWSA 2D0HA 4LPTA 2QZ5A 3MOAL 4F7EB 1QTSA 4PTUA 3MLYL 2YEZB 4AENB 1ND0A 1IAOA 4KK9D 4X5WB 3N40P 5IKCA 2BCKB 5T1MA 1CLYH 1NFDB 1UVQA 3JXAA 1YDPA 2P5EB 5DRXA 4JM0A 3SDAC 4MA7H 4AK2A 1QYGH 2X1XR 5JPMB 5AOMA 1TZHB 2QL1A 5C2BL 5C09B 5KBDA 4MJIA 3PRZA 3EYOA 3H8NA 4HUNB 3V2AR 5JDJA 1A64A 4MDJB 5C0AD 1GS6X 3K72A 3PWPD 5HHVH 1T04B 4NN5B 4NZUH 4X9YA 4XODA 4E9SA 4TNEA 5HGHB 2Z93A 3U6XS 4TLUA 4W9GC 4ZW8A 1NEPA 3FHQA 4TUOA 5T5FA 2Q2LA 5DJCA 3ZIYA 2VGLM 4DHLA 1MHPH 1C08B 4F2ME 3OX8B 4YHIA 3VSQA 3KVQA 4LPUA 3KCWA 1N5AB 4E0RB 1JPGA 1DJGA 2R1XA 2X42A 3PHAA 2DMBA 4GQQA 4N0UA 2VSCA 4QRFA 1UD5A 1ZXKA 2Y3NA 3MLSL 4XOAA 5IMKA 4H26B 2PCYA 2RJMA 3ARDD 4LEXH 1N12A 4J1UA 1I3RB 4FG6D 4N26A 4KQ4H 5D6DA 4MB5A 5AVQB 1PKQB 4NQDD 4PJHB 5AVSB 3VAEA 3IFNH 5BRQA 3QRFM 4MA3A 1K3ZA 1RK1A 3DIDA 3ROLA 5ELIA 4X4YA 5DURB 3V4PA 1IM3A 4LU5H 1JPFA 3F5WA 4F15B 3TCTA 4KO6A 4HWUA 1DQJA 3BAIA 4DKFL 3QIWA 4FQHB 3AWEA 3EKCA 4DPCX 3QFJB 4KRPC 3DX8B 1EPFA 3BI9X 5LBVA 2BZDA 4AIZB 3ET9F 3GSNH 3VXTA 4S11A 4OLYL 3S7GA 4I0PB 4FQ2L 1QI5A 4OZHF 2WYHA 2AJSL 2DH3A 2NY0B 2Y5QA 1A1OB 2OK0H 3MJ9H 1A7PH 3QNXB 3LRSB 5M94B 4PR5B 1OGAA 4N6RB 3WL9A 1BZ7A 4IMLA 3LZLA 3LEYH 4HUUA 3OKDB 1A6AA 1DR9A 4OLEA 3AQDA 5IK3B 2VO5A 5ANME 2R56L 4X42A 1T3FA 2GIYA 3ZUNC 4RMSA 5JIIA 5DVPA 5A2CA 4ANWA 4HHAA 1VACA 5I1LA 4XN5A 2WUBH 3CVBA 4I77H 2X40A 1F56A 3AY4C 1EHLL 2HG0A 3GJFB 4OF5A 1L5GB 3WDIA 4GSQA 4QXGL 3MV7A 3QO0A 3O11B 1OP5H 3VGBA 1N10A 3T3PB 3HZKB 2R15A 2O4EA 3A4EA 4MNQB 1TUPA 2HN7A 3GXDA 2RBLA 5DJAA 2GJRA 4ZOAA 1DJYA 3H85A 4JQIH 3P0VH 3WEBA 5IREA 1HOEA 4ALAH 3B9KB 3V5DA 4JM2B 1TJXA 1MNUH 1H6EA 4L23A 1GYUA 2IH3B 5DEGB 3V95A 3ARED 3BO8B 3U2IA 2VSKB 2JKTM 4HEPA 4JFXB 5FA4A 3EJCA 1D5MA 4PPTA 1EHAA 2FD6L 1DN0B 1EEZA 4NPKA 3UBFA 4AZUA 5F1KC 4HPHA 1ZHKB 3DGCR 1JK8B 5CCGE 2F19H 4G8FA 4NQEB 5C8JB 3LKSB 2FCBA 3IXTA 3D09A 1X5AA 3ARBD 3W9EB 2MKLC 2DI7A 3FRPB 1E9PA 2E7MA 3BPOC 5HP5A 4JN1L 4Y4FB 1LEGB 1T5KA 3IGUA 2XVBA 4FMVA 4G3YH 4WWOA 5FFGA 3TJEL 1TQCB 1PG7H 2UYLA 3CFMA 2DICA 4K9EL 15C8L 3DX9A 1S7UB 1IAIL 1MF2L 3G6JA 3QUHA 3KWTA 3NA9L 1KTBA 5GGQH 3DX0A 2J43A 3QQ3B 3ARPA 2AI0L 5AL8A 3KGSA 3TX4A 3ASNB 3REWB 4L1TA 4JAMB 1F3JB 2WVVB 2CXKA 3KYKL 2H3NA 4NLAA 1SUJA 1ZV5A 2XZQL 1VKXB 1SRDA 4LLUA 4LVNB 2XT1B 4NHCH 2FJFA 3VXUB 4Q0XH 5EO0A 3VWJD 5DU7A 3L3DA 4AV4A 4IGBD 4S2SA 4PVLA 3G5XA 5T5NG 4XNXL 4EI5B 4TF4A 2B9AA 4KK5C 2CJUL 3VGFA 4YDIL 3LKRA 3VXOB 4OD2B 1D5ZB 2Q0ZX 1H8SA 1YG9A 4P9HL 2E6QA 3NCMA 5DEFA 1RK0A 1VGKA 5AAPA 2FIKA 1I1AA 1B2WL 1KTLB 1BZEA 2ZP8A 5TDOB 5B8CC 2V2TA 1GSMA 2GITB 4B7LA 2PNDA 4YSEA 5GJTH 3QJUB 5LGYA 4BSVA 2HG5B 4M3HA 4M6NH 3TBYB 1CD8A 3LZOA 5JNYB 2DBLH 2XFXB 1SYSA 1A1NB 3QHTC 4CVUA 2Y7NA 2EO7A 4OGXH 4AL8C 1LDSA 4Q52A 5HYJE 3B1UA 5LXVA 5BVPL 1SEQL 1UCTA 1CXFA 2V9UA 3V4LA 3D39D 3TT3L 3GXMA 1D7CA 2OMXA 1UKQA 2VH5H 3IU3A 4H8WL 1ZT4A 5AUMB 5AZ2L 1DN2A 4JZOB 4ZSOB 1J11A 1MWAH 2YD8A 2APXA 5KS9E 4E42A 2C3HA 2NPLX 4F20A 4P46C 3Q9QA 4FA8A 3MGOB 3TWCL 2FZ3A 2FEEI 3PFQA 1EGJA 1XB6A 4Q6YA 5ACZB 4KROC 1PZDA 3FQ2A 3G04A 1I9JL 4CW1A 2Z65C 4YIQA 4BINA 5B3NA 3EXLA 2BOBA 2DL9A 2AQSA 2YD0A 1RZKH 3U7AA 3TIDB 3SPIA 1LO4L 3FUEA 3FQNA 2EVGA 1S2EA 3C9NA 5EO9B 5FOBA 1PPIA 4YDJB 4ZK8A 3C6EA 3LXBA 4LNRB 5J8OA 4AI7A 5KJRH 2DQTH 3LQAL 1P7KB 1PZSA 2ZTBA 5HD8D 4BFGA 1XXFC 5DZLA 1PW3A 3FTYA 4JPWL 2EIMB 1V8HA 4HIJA 1QVOB 1YJDH 3K2UL 4LHJB 5BQ7A 4GOSA 4PM1A 4L9LA 4JFEE 4KJYB 4P5TB 4UTAA 3NZUA 5B22A 3Q48A 1NCNA 4HOZA 2J2ZB 1TDQA 2MKWA 5ESAB 2G0KA 1UM4L 5AW6B 4A7QA 1F1GA 1NC2D 2AJYH 2OJZL 4JFHD 1CUOA 2OP4H 4RFOL 2ADGA 4IKIA 2QPDB 1LWJA 1GKEA 1TQBC 1WTLA 2QVKA 5JIPA 4YNYB 1GTFA 3ARGA 2WBJC 5CIPB 3DRQB 3E9TA 2G2RA 3OAUL 4HQQL 4OFIA 1UB6B 2Z92B 4OLZH 1Z0NA 1CDUA 4QOKD 3NJIA 4H0IA 4H1LA 1MJ7H 4L37A 1EZUA 3Q44A 4PS7A 1OM3L 3EO9H 1BVOA 2R0KH 5IVXA 3GSQA 1XCTB 1KYUA 2NQDA 5BZWA 4D7PA 5DZPA 3BH8B 5I19L 4P4KA 4X6FA 3QXUA 3O8XA 5GGRB 1GMIA 1T5WA 2BPBA 4XMKH 3T4YB 1IGFH 5FO8A 2DKUA 3AS3A 4Z9KB 4R2GB 2YRZA 3H7LA 3CMGA 4J3OF 5E70A 1BFSA 5KSUB 3HG1A 3MREB 3QHZL 3HNVH 3CDFA 4UILH 3IJEB 3BCDA 3QB7C 3MUY1 5F93C 4WFGD 3O0LA 1KB5B 1U8NB 3ES6B 3IJSA 2XJKA 2AANA 3L3KA 4X5RA 2ADIB 4WWKC 2KLSA 4H88H 3HR5B 3BPLB 3V5KA 4A66A 2EXYD 3QUZA 4ABVA 4D9LL 3GHBL 2HKFL 4G42B 1CLZH 1Z3GL 1RULL 1AIFB 1A1MA 1A9EB 1XTMA 1E50A 2BNUB 5DEZA 3RUGF 3T65A 4B5EA 1AZCA 1FVCB 1LEIB 1EK3A 2EEBA 4TSAH 4FAAB 2IO5A 4YQXH 1VSCA 2V2XB 2D7MA 4Y9EA 1AR1C 4ETQA 3L3IB 4XAKD 4DJMA 5I71C 3SYPA 3BUDA 3QNZB 1F90H 3O3BB 3CBJB 2C4FT 4DP7X 1IKNA 1GPOH 3I02B 3S34L 2GUYA 2A6IB 2BIMA 4U1GB 3B8SA 3FB6A 4PJCE 5E5MB 3IDJB 1JJUA 1MG3C 4CC1A 3LSOA 4MRBA 5GZNA 1NC4B 1T1YA 4IHOA 2IQAA 4M56A 4G8IA 5IW6A 2FBJL 3X11A 4NJAH 3NABL 3J7HA 3FO1A 3W39B 5D7LD 4BWWA 5H4ZA 1IT9L 2E59A 4HS6A 1CYGA 1GL4B 4PCTA 2H41A 2ZCLH 1V3LA 1PJ9A 2BNRA 2OXHA 1F2QA 3VFMB 1FYHB 2Y22A 3T2LA 5C0IA 5SX5H 3RL2A 4JRXA 1CE1H 1JXDA 2NRDA 2DB8A 2Y25A 5FGBA 4KY1L 4FCHA 5EU5A 5TPWL 3RFZA 2ZXAA 2OX5B 2UY7B 4HKXB 2Q5BA 4Y1AB 3A24A 4HIPA 2E0PA 4LAQH 5ISZA 3CDZA 3TTSA 1SOQA 4WW2B 2XV6B 4Y19D 4APXB 1FWXA 2VDKB 1XIWC 5K69A 2ALWA 5DS1A 4Z78A 2YC1B 3WLBB 3DJ9A 3ASOB 2CO7A 4J3BA 3ARQA 2CLRB 4QRUA 2VL5B 1DQQA 4N8CH 4ACPA 2XPGB 1OKEA 5DRWA 2HVBA 4N2BA 1PMYA 5CN1A 2JJSC 3PS6A 4OZFG 4YR6A 3B5TA 1SQMA 4TTDD 1ET7A 1YEKH 4ODWB 4WCYL 3PQYB 3UAAA 5JQ6L 3PE9A 4MD0A 1JPTH 2OMVA 3STZA 5LCVH 1I9RL 4HC1A 2DLFH 5ADOL 4Y16D 2P28B 1BGXL 1VDGA 5E9DD 5I75B 5IROC 3T0DA 1SXCA 1WAAE 1LDPL 3T0AA 4A7UA 3WCYA 5SWSD 1II4E 1AD0B 5T3ZD 5DJYB 1A7OL 1JGEB 2YGVA 1YLBB 2IH8A 4FNPA 3MV9E 1HXYA 2BP5M 2D3LA 2VLKB 3S96A 4CUCA 4AWJC 4PJIB 4Y5YC 3S4SG 3MOBH 1Z9NA 3MYZA 1IIIA 4LHQB 1EERB 4TKWA 5GISL 3B4NA 3PREA 1FGNH 4J3OD 2MCG1 2QLVB 2FO8A 4H0GA 2HJKB 1GZHC 5E9NA 3QIUA 1IQDA 4HHWA 5DD5L 1VPOH 2R9HC 3EFDL 4XXCA 2BJMH 4ZOBA 3U1SL 4FA7B 5J3HC 4MZ2A 4HOXA 3IMWA 5KJ4A 2NZ1A 2CJTA 1JNJA 8FABB 4D0DB 3NAAH 1U93B 4PGZA 3V0AC 2P5EA 3HG5A 5D72L 2R69L 4XC3H 3N5AA 3HRPA 1J1PH 1J8HA 1MRFL 1UASA 1WFJA 3UTTA 5JPMA 2F53A 1TZHA 1Y6MR 3MR9B 2P48B 5C09A 3KYMA 1BG1A 1HI6B 4AQOA 1PS3A 4UV4H 2W0PA 3INUL 2J8HA 4IRZA 3UG4A 2Y06H 4WHDA 2DQEL 3H55A 4FFZL 4OCSL 2ICCA 4LL9A 5B3JF 5C0EB 1AO7D 5K9QG 3BWSA 2AEIT 1F45A 5FV1L 2AITA 4Z3HA 4KKRA 2XFGB 2X89A 3OX8A 4O00A 2E9GA 4U6VL 3T2PA 1N5AA 4B9FA 4L4TE 3BKJL 5FEBA 3U0WL 5AQ0A 1A3ZA 2ZXGA 5IG7A 3GRBA 4H26A 3IDIB 3RTQD 4X6DA 3SGDH 2IADA 2UX6A 1FFOB 3U6RB 3QIBC 2ADYA 5E8NB 3WIFB 1D3CA 4E9VA 3KWWB 2R83A 3CH8A 2AVFA 4Y5VC 3NPSC 4KHTL 3CCHA 1LO3H 2JJTA 2YMTA 1BJMA 4NN7B 5T3ZL 2IFFL 4MQ7A 4PRNB 4L1HA 1CLOH 1FFPB 2XWRA 2OW6A 5CWSB 1F5WA 3GB7B 3LZRA 2O5XL 3OAZH 3ZGHA 5C0AB 3PWPB 3LDBC 4W9FC 5C9KA 1X7TA 3QEQB 2WK2A 4LRNL 4GRMB 4YBQC 1SJVA 3K74B 4MMZC 1XMEB 2F7PA 3TBTB 4JHUA 2X88A 4AE1A 2GYSA 4JO2H 4IRJD 4JG1H 2WN3A 4WTXA 3S37L 2NUPA 2NW2B 1PJWA 3L9RB 3RIAK 3FQWA 4O51A 4QXWA 1GW0A 1OGPA 1U8KB 4O58L 3CFJA 5C0CE 1N5YL 4JHAL 4PW3A 4GINA 3QNXA 2ZP0T 3T09A 3LRSA 4A2FA 3NPZB 3BKCH 3O6KH 2K8MA 4WWID 3RZCA 1A0QH 3FS9A 1N64H 2CBMA 3OKDA 5IK3A 3ENEA 5TQ2L 2XQYG 3OJDA 4G6KL 4X83A 3IF1B 2PCFA 1H3XA 3DO4A 4L4VB 4NQDB 1AKJB 1L9NA 3B3BA 1JI1A 3OF6D 3CSBA 1IBGL 2DDQH 2FJHA 1T1ZB 3VD1A 3QIWC 4JFOA 4EAEA 1YPZB 4IJ3C 4I48B 3KCPA 2CNZA 4FJ6A 1KXQE 3X2QB 4IU3B 1X5ZA 3QWRD 4NC2B 4AIEA 4GFTB 5IEHB 1SYVA 2CIKB 2BVOB 1FNSL 2DTSA 3E1F1 4MNQA 4YHOH 5FO9B 1UB5A 1DVSA 3OB0H 4PRDB 1M9SA 3LPFA 2MJWA 1BREA 2E76C 1BSIA 3EH4B 3JWOC 3MXWH 4WU5A 3B9KA 1KXTA 4KX7A 1DBKH 1S9VB 3KWUA 5CZRA 3ARTA 4EKXA 2O5YL 1YCSA 2JWYA 5IHLB 1IFHH 3M86A 1E65A 1H19A 3BO8A 3FCUB 1UADC 5JPNC 1FNEA 2DKMA 3AB0B 5TGBB 2Y6SD 3CAFA 1TVHB 1XGYH 1XMWA 1S4IA 5KJ7E 1IAKB 1OCRB 4PUBH 4FI7A 4KJWC 1DZ0A 4YBLC 2H0JA 1Z66A 3RA7L 3FCGA 3LKSA 3ZE1B 1OF2B 4KGJA 5F9OL 4KQ3H 3RDTC 3W9EA 3FRPA 4YSTA 4TL5A 3G5VA 3TBSB 1KN4H 4XPTH 3CSTA 1RJYA 5FYJH 4Y4FA 3DX7B 1LEGA 2BM3A 4JKKA 3X1BA 5DK3A 1S8DB 1JF5A 2J57A 5DQDL 1KNOA 3GSWB 2D7TH 4LLAA 5F72S 2YD5A 4NUGL 4NZRL 5HJGA 4MDIB 5JHDD 2Y36H 1M3IA 3P4NA 2VITA 5KSVA 4QDGA 1R19A 1DE4A 5AYUH 3AREB 2WVVA 5CZKA 1SZNA 2BDNL 1MLBB 2J6WA 1VKXA 3DXAA 4J6RH 3KPRE 3VXUA 4Z76A 5EOCJ 4KKQA 1AXTH 4ZXBC 1PX4A 3LN4A 3N1QC 4YN3A 4U3SB 2EVJA 2ADFL 3OLEA 5GRUL 5JHLH 1TTAA 1JNNL 4TPRL 3VXOA 4DEWA 3ARBB 4KMTL 1QPPA 2CUMA 1KXVA 3EJZC 3MCLH 2LW3A 3H2PA 9CGTA 2R2HA 1T7VA 5GRZA 3DBSA 4PRPE 2GITA 4LCIH 3HMXL 2VB5A 1B88A 3VXQB 4HLEA 5EU7C 1QEXA 3D4ZA 1EX0A 3LCYA 4ODSH 1NL0L 3QT2A 5JNYA 2YPKB 2Y2TA 3L9EA 2XFXA 3LH9A 1A1NA 1E8WA 4M48H 4MNGB 4GRLA 2AV1B 3SCMC 2OR7A 4ZODA 1EJ6A 4R6UA 3SE8H 3LZPA 1M7XA 3KGRA 5GS0H 2P52A 1TF4A 4N28A 2AJXH 4PS3A 5HGAA 5IMMA 3L9BA 5E5RB 2QTEA 4UIKH 3HNSL 3L17A 3NJFA 5C0RL 4CC4A 5AUMA 1F4YH 1G9MH 3AQZA 4H20H 1I3VA 4JZOA 4ZSOA 4JFFA 3HLAB 1P7QB 1DJIA 1QSVA 1UZ6F 4IGBB 4KJPC 4M6OH 3WKYA 5IFHH 1NFDE 4MD4B 5K5YA 2HJFA 1J1XH 1ZSDB 3FYIB 4Q8BA 3ZX1A 4DUWA 3V0VB 4N8VA 1Z9LA 5DD3L 5JOPE 5ACZA 2WLKA 2DWYA 1Q1PA 4LSDA 4V11A 1C5DB 2WINA 1MY5A 1G87A 1TKWA 2BP0B 3TCXA 2DQDH 2Y7QB 4EDXA 3ORJA 4YXLH 1A7NL 3UGUA 1JVOA 4GW5B 1X5KA 5HDBB 4W81A 2AEQL 4TN9A 1P7KA 1HEZA 1JPST 5CKGA 1OB1B 3R4RA 1FGVH 4I0KA 3WFHA 1MCRA 4OTXH 2A9ML 4ZD3L 3GS4A 1JZJA 1AOHA 2ZOKA 1SFDA 2WYIA 3FSVA 4FZ8L 2UXGA 4ONHA 4WV1A 5B1KA 1NEZA 4ZS7L 5ICXA 5IJBC 2FB4H 3A4DA 1ZWIB 4W6WB 4JHZA 3CG8A 5C07D 2MPAL 4EPSA 4U7SA 3V7AE 1MCJA 1UWGH 3LXAA 3DSFH 3CVHH 1NCAL 4FERA 5FW6A 4D0BB 5K9OB 1GIGL 1PKQE 3TP4A 2CIIB 4YNYA 1FLRL 2CAKA 5KSBB 5AB1A 3NTCL 1ZE3C 4Q9QH 1Q0XL 1JRHI 1HQ4B 4KOCA 1UB6A 4YVUA 3D2UD 2XKNB 4YDNA 5D1ZC 5HI5C 5J4MA 1PYWB 2F7QA 1XCTA 4BZYA 1XF4A 4NAQA 2K3HA 5DJDA 3FOMB 4IQHA 3RIFK 4GKSB 5KAQF 2PPAA 2BRRL 3NOIA 3QFJE 3LPOA 1QEWA 5DJ6A 1UFUA 5GGRA 2C9PA 1F1AA 5EBGA 3T4YA 1XEUA 4DZ8A 2VN7A 2X6MA 4D3CH 4DK3A 1MIEL 5INCB 3II2A 3WO4C 4I9WE 1ACZA 4N87A 4N2LA 5KSUA 4DH2A 4UT9H 3MREA 4J3OG 2A5UA 3FQRB 3MUJA 4HAFA 4YDZA 5JXEA 3IJEA 4E9QA 3C12A 4KDTA 1UOLA 4K7FA 1J9TA 4NO0D 4XNYH 2WXJA 5DC0A 3ARGC 4DSYA 4L5FE 1IGIL 4NZ8A 2JKRM 4XXDA 2C1OA 3RI5K 3E3QE 1SDYA 4O4YH 3HR5A 5CSGA 4M3KB 4AYDC 4K94C 4XHJC 5I24A 5TK4A 4DFHA 3TT1H 5I66B 5KSAC 3NCCB 1A9EA 1RQ5A 2E9IA 3QQ9D 3ZY7A 3R8QA 1XGTA 3MBED 3MV8D 4P4KC 4QOKB 3FFCD 1V3KA 2VW7A 3B2VH 3O8XC 4FNRA 4A68A 1LEIA 5AW9B 2EUZA 3X3GL 1MVUA 4ZFGH 4HSAC 3T3PE 5F9JB 2EECA 4LE8A 4HGMA 4ZS6C 4CRPA 1NGYA 1BZ8A 2J1ZA 4NQUA 3UTOA 3EBIA 4N1EA 5ETUA 3PDOB 4C4KO 4G9FD 3P54A 2A6IA 4JKPL 3MLZL 4X2UA 1E4WL 3IMRA 1U95A 3UTSD 1TTRA 3VCLA 5E5MA 4I2XE 3IDJA 5FKPB 4HWZB 2V37A 5T1DH 4ODBD 4HOWA 4XWOC 1NC4A 4DOHE 3CDCA 4L3EE 3T5WA 2VWEE 4X80L 2W81C 3AJ7A 3W39A 1YAZA 4UDTB 1YECH 4Y88A 3NJGA 4QEGA 2X3CA 5I1IL 3WFEL 4AZ8A 1HZLA 4Z5RB 3CHSA 3LXCA 3WXWL 4NQEE 5C6TL 2ZICA 2OAAA 4ZFOA 1OWRM 1A22B 4BHUA 1JIBA 1JZGA 3PCYA 3MRFB 3QWOB 2OX5A 4LKXB 5F6IC 4HWNA 3L1EA 4NM8L 3QUMH 5DJ0B 2WAQA 2YUXA 4APXA 4DGVL 2AQRA 4Q4IA 5ENWB 3HE6C 1XD0A 2YUZA 4Y1TA 1HWWA 3F58H 2BINA 1F6AA 2X2JA 2OPCA 1XGRB 5GZNC 1D7BA 4BQ8A 1WT5C 2MNJB 4YFLI 4TSBL 2VL5A 3ULUF 3GJEA 2XPGA 1SLUA 5CR1A 1R3KB 5HHQB 2VLMD 2WIIB 4Y2LA 4PJ6A 2HT3D 1U8JB 4YSRA 3QCVL 1DVXA 3TV8A 2XRAL 3LS4L 1F1DA 5D7LB 3CLEL 2Y7SA 3J07A 2W88A 2IOOA 3RFZC 1R5VA 4PJEF 2R4SH 3ILEA 4ZZKA 1AD0A 3ME0A 3CWGA 5D7IF 5DJYA 1JK9A 4A2HA 1JGEA 3VXMD 4ICWA 3LY6A 1MJ8L 1SJEA 1AQDB 1BIIB 5J13C 1KPRA 1AHMA 3EOAB 3VM5A 5E1IA 2E9BA 4F9PA 1PZAA 5G2NA 4Y19B 2DWEB 1INQB 4OIIH 3A6OA 2HJKA 5TJWK 4B97A 3UYRL 1JDCA 2ITFA 3FPXA 4RX4A 2WVTA 3KYAA 5IHHA 1Q38A 2NT0A 4FQJH 2ZOUA 2R1WA 1PLAA 1YEIL 3CPUA 3EOYG 4AUYA 1Y6KR 3O3AB 4QRBA 2EAEA 4OJFL 3TO4C 3LKPB 1S3KL 4OLXL 4MCZA 2BNQD 4Y4HD 3SKMB 3VRLF 1GC1C 4U4IA 4XMPL 5EORL 5C92A 2VN6A 3QBTB 4DP0X 3UROR 1NFKA 1ZA3B 3BSZA 3SGEI 4Y16B 3MR9A 4N25A 1JPSH 3MOQA 3GEWB 4JGNA 3QJVB 2JIXB 1E4XH 4MXVF 4ELME 1OARL 3HS9A 5SWSB 2FRGP 3T6ZA 2YMXH 3FB5A 4N8UA 3JWDL 2P24A 3MXVH 4WJ5B 5C0EA 4OH2A 1WICA 1S7TB 5IQ7H 3H9SB 4LF3A 1OAQL 2OMBA 3I6GB 5E1AA 4DKTA 5EBMB 4NRYA 4M43H 2DY2A 3C60D 4LEOA 5T1JA 1JXJA 5AVZB 3CHOA 2WWOA 1TJGL 1MLCB 4K2UH 2DQMA 4KVCL 5A2JH 1WO2A 1O0VA 5IV2B 2XG5A 1UJ3B 3EG9B 2J8UA 1FFOA 1UC6A 2ZYHA 4W6XB 1K72A 5D96C 3KWWA 2BVTA 4YFDB 5EIIG 1DBML 4DN4L 5GS1B 1IBHA 3FONB 4U05A 3N1MC 1MRCL 2MOVA 5HHOE 3BEVB 1JTTA 1N4XL 3FN0L 4IJTA 1HILA 3H56A 4AM0B 2HSIA 4U1NB 5F7EH 1FFPA 2MTPA 1HS6A 4HUWA 1GGBH 4OGAD 4FQLH 1BQ5A 2W94A 2EZ0C 5I2IA 3NT0A 3QEQA 3NZHH 5F1OB 3AVEA 4MGXA 2NY5L 2EDDA 2CGRL 3CMOL 4F2EA 3KGTA 1I8LC 4NKDA 1JWUB 2NW2A 4LEEA 3L9RA 3ULUD 3BGMA 1JPEA 1RFDL 2RTTA 1JCKA 2WXHA 1U8KA 1BWMA 2VXUL 3LQZB 2J88L 3QULB 3MLPA 2B5IB 2ICWA 2V8LA 3IAGC 1UZGA 3BVVA 2JE8A 4JO8A 1WGVA 5F96H 4RMTA 1HE7A 4CNIA 3MNWA 5EEVA 2EH8H 2YLHA 1TMQA 1H0DA 3IF1A 4DVRL 3RU8H 4L4VA 3B2XA 1AKJA 3X17A 3OC8A 1B6DA 2XNAA 4TXVB 5SWZA 2ENJA 4JRYD 5KTEL 4I48A 2F15A 1OAKL 3QS3A 1W16A 3BMWA 5IEHA 3EF7A 5A6MA 5FHBH 4KXCA 3QRBA 4BSWB 4RESB 2CIKA 4UMSA 4HJTA 2Y9RT 5B38G 3O4LA 5FO9A 5GGUB 3LN5B 4MSWB 3EH1A 4IRSB 2X3AA 2PR4L 4HWBH 4ZOEA 4Z3IA 2KI6A 1K4DA 4PRDA 3FQXA 4X8JA 4IRJB 3L3GB 3W9DB 4N2CA 1SVBA 2L7QA 4NFBA 4P0DA 2YRLA 3FW6A 2IBBA 1CXHA 2J4WH 2IAND 3K46A 4HPYL 4LT7A 4YGAB 1DLHA 2F68X 1YEEH 4RDBA 2IBGA 2R0WH 3LHPH 1RMFH 1ZHNA 3JZ7A 1RZJH 3KJ4B 5TGBA 3VFTB 3ZSSA 1TVHA 2EO9A 4LLWB 3UZQB 3RNQB 5I0VA 4F33B 2VDLH 3MV01 1S7VB 2WWKT 4HIXL 1OF2A 1XQ4A 3BVXA 1S78D 4GNKB 3DSNB 4X8XA 3RGVC 4AXWA 3IWVA 3E0GA 3MUHL 4OCRH 1UCBH 3TBSA 1T22B 5IQOA 3DX7A 2DQFA 1S8DA 3R1GH 5EF3A 5C0GA 3NACH 1CVRA 1RCYA 3UIYA 3ULUL 4OM0H 1JMXA 1X4ZA 5I6NA 2WLMA 1FHGA 2MRYA 3AU1B 4WRLA 4PS4H 4Y1AE 4MDIA 3PAZA 2CBPA 1E5YA 1KELL 2CGZA 4B9PA 4JZJB 2L7JA 3NJLA 1GSKA 3RVVC 3ZVVA 5EZIH 1YY8B 5AKTA 4A6YL 2CZNA 2CR6A 3VWKD 3WDJA 1KCUL 1WD9A 2M26A 5EU6D 3TLRA 3RNKB 4MAYD 1T0MA 4PY8J 2Y07L 1KEGH 2VQTA 5I6OA 5K9JH 4GIAA 2JELL 2I69A 4RRPM 3ZUCA 3D34A 2BC4B 3IDYC 2V5RA 5DO2C 1LO5B 3QZPA 3PQYE 1KWGA 2DWSA 1BQHG 3MLTB 2K4AA 4JR9H 1WWBX 4AT6A 3BUQA 4LLYB 5HI4D 5C71A 2ESVE 1GMEA 3ZMNA 1C5BH 1ASQA 1KEMH 3DX6A 1MPAL 1U8MA 1AS7A 1YN6A 2UZXB 2ZAHA 2YPKA 5IY5B 2VLKE 4PJIE 4P04A 4DVBB 5HDWA 2BFGA 5TDNA 2ZCHH 2QBWA 2ZKYA 3R7QA 1I1YA 1CLYL 1VAHA 2N7SA 1P69B 4QT5B 3VGAC 2X1QA 3CH1A 4HSCX 2G9HB 2XWZA 4MA7L 3OHXA 3FQUA 4NIKB 3K8KA 1QYGL 1Y6NR 5T5FH 4LLDB 3I6LE 2YXVA 3TIEB 1P7QA 1A6VH 3IMBA 2VMFA 1KGCD 4MD4A 1CK0H 1XF3B 4OZGB 1VA9A 2QADC 1P6WA 5HHVL 4NZUL 1TSHA 3I3DA 5BO1H 3MROB 5DUBA 3HCVB 2J73A 5A3IC 1C5DA 3VO0A 4DP9X 4WI2A 1MHPL 3PL6A 1W72B 3EOTH 5KBLA 1A66A 1TZIA 3RHWK 4BKLB 1S9YB 4GW5A 2OBGA 4LVOC 4Z95H 1DVFC 2BCMA 4LZKA 3V4PH 1OB1A 2DEWX 2EC9T 5BUGA 3HNTH 1GKOA 4CJ1A 4LEXL 4FJZA 1SDDB 1OTUD 3TOPA 4LCUA 4H8UA 3QFDA 3HE7D 4KQ4L 1J8SA 5D1XC 4YBHA 5D2NC 1S7QA 3BHBB 3CZUB 1BJ1H 3IFNL 3ROOB 3FQ1A 2ZIDA 4AQ1B 1ZWIA 1JZFA 4UU9A 1MY7A 4U7KA 3BUYB 3UTQB 1UQSA 3RWFB 3EJQA 4LU5L 5B38B 3FTUA 1IAII 4D0BA 5K9OA 5FECA 4J7RA 3P4OB 4ZO7A 5KSBA 4AKOA 1EIBA 2J6EA 2BH0A 1GW6A 2XKNA 3ZDYB 2ETWA 1W80A 3GSNL 4A2DA 1WEJH 3ARYA 4NQVB 4MBOA 2E74C 4MTMA 2NY4C 3PWPE 3QDGD 5C0AE 3EYVB 4GKSA 2CH8A 5KAQG 3MJ9L 3ZQXA 1A7PL 1GS8A 5JW5B 3M17B 3QCUH 4QTFA 4BWTA 3MDJA 4NNXA 3D3VB 3B43A 4ZNEA 2DOCA 3LEYL 3PPEA 3STBA 1QLEH 1UXLA 1YEWA 1YY9C 3VD9A 1QWHA 3F62A 3N9GH 4N9OB 3GBLA 3ETBF 2R29A 3NIGF 2WUBL 4I77L 3C09B 3K6FA 5E4IA 1OK8A 2WJ5A 4NQDE 1L0QA 3DHPA 2ZX8A 4KRLB 1CGSH 1TTBA 3VFWA 4PJBB 4TULH 4HUXB 1YPZE 1DCLA 2N1TE 4Z7UF 2CO6A 3P0VL 3WIHA 3T6QC 5EUOF 4ALAL 4DKAA 2OR9H 3Q2LA 1MJUH 1QO3B 1X5FA 3L3OB 5GRVL 1MNUL 2JH2A 5K9QI 3DMMD 3L4CA 3VX0A 2NZ9D 1HQRB 1ZLDA 3O9WB 4NKIH 5B7MA 3GRWA 3BDYL 4BDVB 2WV3A 4KK6C 3ZDXB 4ZMQA 3DDGA 2XIIA 4WUKH 3RKDC 4OIAA 1N68A 4UT7H 2VN4A 3L95B 5GS0C 2DYSB 4UDTA 4LEBA 1YHPA 2AERT 2MNWA 4O2EB 1OPGH 3RWHA 5IB3A 2EJ1A 4Z5RA 2XCMC 2AXFA 3P1VA 5IUSA 1JYXA 2D9CA 2IMMA 2YXFA 4G3YL 2PTTB 1IGJB 1PG7L 2X87A 2ITCB 3L81A 1G1OA 3MRFA 1H8LA 2EQDA 4KK8C 3FFCB 4LKXA 3QR1A 5DJ0A 5GGTA 5GGQL 5ENWA 2A2QT 5FCSH 4RGOH 5C3IA 4S0TD 4OCLC 1OHQA 4RGNC 5C9JB 2CK2A 5T3XH 1MKFA 1KCRH 1XGRA 4ODUB 4WI0A 4WHCA 3CLWA 2KZ1B 1M42A 1QA9B 3SJVD 4G80B 1R5IA 1QX1A 3CN3A 4C56D 1XFPA 2CPCA 1ZA6B 4QKXB 4NHCL 1R3KA 5HHQA 2XWTB 4Q0XL 1Q9OA 3ABLB 3BSGA 2OQJA 3WEMA 1W2KT 3UX9B 2ITDB 4ZAKD 1GY1A 1PDKB 2ENQA 1U3NA 1JXFA 1CFBA 2A74B 3NSXA 4YSQA 1Q90A 1IGMH 1RURH 2IH1A 4YDKH 3PWVA 1FA4A 2X1PA 1M1XB 2XX0A 4MYPA 5J89A 4AEHL 2PP7A 2Q20A 1CZ8H 1MCCA 3QORB 5GJTL 4HSQA 4GEJA 3ARRA 4M6NL 5AVUB 1BIIA 5CBEB 1Q4NX 2DBLL 5GRXG 1G0YR 1D5IH 4OGXL 4PJGF 1INQA 2EKJA 4S1SH 3K8LA 1H3UA 1I7UB 2H6PB 2OW7A 5BV7B 4KHXH 2XA8H 3SY0B 4MNGE 1EAJA 1EGJH 4HWEH 2XTJD 1INEH 4C83B 2VH5L 3BZ4A 5HYSG 4QRRD 2NX5D 2VDQH 5D6CB 3W0WD 2D31B 1MWAL 4NQTA 4QIRA 2C9XA 4HKZA 3OQ3B 3JYBA 3VI4F 2ARJQ 4LLVB 1T66D 1UUNA 4PTTB 2NY2C 4PP2B 1ZA3A 1HYSD 4JB9H 5A2BA 2WTRB 2ZF8A 4OI8A 1K6QH 5DMGD 1QBAA 2HFGH 3PU7A 2GCYB 1RZKL 4XNZC 5IP4A 1CXKA 4KI5C 3VXMB 4MZRA 4WJ5A 4F57H 1DBBH 5T33H 4UTAH 1LK3H 3R0NA 1FRGH 4GI6A 3I6GA 5FCUH 5KJRL 3O4OB 4OZHE 3TFKC 2FJGA 1I7ZB 5KYNA 2CHNA 4LGSB 1D5XB 4L3CA 3L4TA 1YJDL 2F8IA 3DX3A 2Z6FA 1YQVH 2D3VA 3CBKB 5AW5B 1X5JA 1UJ3A 2IJ0C 1JUFB 3EG9A 1RD6A 1IBFA 1UYWL 4AUJA 4H1LH 4X4XB 1X4YA 2JB6B 3FONA 4H5SA 1F11B 2AJYL 4NN6C 3NJMA 4PJ9B 3BD3A 2OP4L 4YL9A 3D39E 4Y4HB 2BNQB 2W65A 4G6MH 1Y0LB 3LNFA 3ALPA 4U1NA 5ALCH 5LLIC 4ZW6A 3WXVH 4OLZL 4UTBA 4FFWC 3KVPA 4QJ4B 1HH9B 5HGDB 1MJ7L 3CDYA 3IDNB 4FOMA 3EO9L 3BIAX 2R0KL 1AZNA 4HJ0D 3G5YB 3EGDA 3V0GA 4IIQB 2FHFA 3QUYB 2C4FU 4GKNB 3LVTA 4QWWD 4FZEH 4X6CB 1JWUA 4KXZI 4MA8H 2CALA 4XMKL 1IGFL 4I5BB 5I76B 4XVOA 3C60B 2X28A 1KGYE 5HHMB 4HJEA 1W9XA 3FKUS 5IJVA 2OYPA 3QULA 2EVHA 1IFGA 1JGUH 3HNVL 1KJ3H 2YQBA 1XX9C 4J8RB 4UILL 4XZ4A 1F8TH 2X7LA 1JDAA 2DJ4A 3K4ZA 3DPDA 3P4LA 3QI9A 5AW1B 3UGXA 4MKMA 3CZSA 1NANI 3RX7A 4H88L 3CHPA 4M7LT 4RBPK 3C6LD 2OMTB 2G3ZA 2P3YA 3R19A 1CLZL 4M00A 3K80A 5D5MB 3N85H 4M7ZC 3LNIA 4JFHE 4AYFA 3GZOA 5F7YC 4BSWA 3L3HA 4F9LC 5D4JA 4TSAL 1YEHH 4HAGA 4YQXL 3QXAA 4PI2A 5GGUA 2VLJD 4IRSA 2XG4A 5KBMA 4KJQC 3VE0B 2H3XC 4QXUL 1DANT 3ESUF 1F90L 1NDGA 1ZD6A 4PV1C 4QOKE 3BWUC 2PETA 5FYJU 3T0ED 1GPOL 1T2JA 1Z5LA 2DWTA 3W9DA 2HRPH 4OGZA 5CEYB 5AENA 3NCYP 5K9KA 1CFNA 1BEYH 1JD7A 2VXTH 1X5IA 1F3DH 4U3CA 4X0KB 3GSUB 1PU0A 1KT2A 2K3TA 3ZXAC 3S98A 1SOXA 4XBEH 2H2PD 3P2DA 5MHSD 5JYLA 4HEME 4LLWA 4NJAL 4AW4A 3HEIB 3CK0H 5KYUA 4G1MB 4IDLA 1S7VA 1ADQA 2A6KA 2ZCLL 3VA6A 3DJSA 3NSDA 2HWZH 2WLLB 2EE2A 3DSNA 4JRYB 1D9KD 4KUCF 4PCKA 4Y5XC 1CE1L 5C70A 3V79C 1ONQB 3AT0A 4WFGE 2X9ZA 1E90A 1JE6A 2UZYB 4P2QB 2BZCA 3KW8A 4UNUA 3GSOB 3WY3A 4K71B 4QRPB 4LAQL 1TCRB 3UAEA 5IT2H 3O2WH 3QC5X 2CDEB 1JVLA 1CICB 4UM9A 4AG4H 3S37X 2OFQA 4F1ZA 5MI0B 4R96B 3A23A 5GGSB 5HYSB 1BLNA 2YFNA 4XAWH 3DI3B 1WC7B 1MHEA 4OM1H 2IANB 2V5TA 2YFOA 1AD9A 2EDOA 3F12B 4P07A 1IZJA 3FCTA 4N8CL 4XAKE 4D8PA 4IOFC 1AAJA 5IQNA 1IUZA 1YEKL 1H3VA 3ZKXC 4ZX5A 3ELQA 1JPTL 4C47A 3IYLW 5LCVL 1R34A 2DLFL 4E5XB 1KGUA 5E2WH 6PAZA 3LRKA 2BC4A 1P5VB 35C8H 2PCXA 1JF1B 4PJDA 4QUOA 3JV4B 3ARZA 1OE2A 5IQLA 2H32A 4N2GA 5D7LE 2WQVA 4UB0H 4KY2A 1BBDH 3P3TA 3EADA 3O6FA 2EE3A 4PLJD 3SDXF 4I4WB 4MB4A 5MEOB 5ICZB 1FGNL 4LLQB 2C9AA 2UZXA 5IF0B 1JI2A 5CJXC 4EN2A 2CHDA 3QG6B 2P9RA 4LFHD 6CGTA 1VPOL 2PO6D 3WMQA 1IRAY 3UAJA 4TUJA 2WQSA 2BJML 3OXRB 1OAXH 4Y19E 5SWQB 1IZKA 4F5CA 3DETC 2P5PA 3VWKB 3CTTA 3NAAL 4QT5A 2G2NA 5EU6B 4AGQA 4N2FA 4MAYB 4OV6F 4ZDHB 1I7TB 1OP4A 4LLDA 1B4JH 3TIEA 3IJ8A 2H2SC 5C6PB 2DM7A 1QTPA 4P4RB 4UV4L 2YBGA 2Y06L 5B1BB 3WO3B 3QR2A 3ZKMD 1KCLA 2AJVH 2WXQA 3MCG1 1LXMA 5E9DE 4ZMNA 1KB9K 4JX0A 3PV7A 1W72A 3FK3A 3B3IA 5SWSE 3VM7A 4WI9A 5T3ZE 4GAGH 3FCSA 4YC2C 4BKLA 4LCWD 3DPBA 3GSNB 1KLFB 1QFWM 4IHBA 5CLXA 5F9WC 4K8RC 4CDGC 3HB3C 4DNLA 3G08B 1A4CA 4ORGA 2XZAH 4NNYA 3VG9C 1OAYH 2WKOA 4HD9A 4D9QD 4XO8A 1COBA 3OHXC 1KCKA 2PPFA 1EUUA 3VX1A 1TNMA 2B1HH 4Y4KB 3VVWA 4Y2DC 4FS0A 4PRHD 1WIOA 3INOA 1LO3L 3FT0A 4KUCD 4ZTEA 1HHIA 2BVUA 2BSEA 4U6YB 4XX5A 3VYNA 1TPXB 2BWDA 2WXFA 4IBTA 3UTQA 1HDMA 5A16B 1CLOL 3MRHB 1VFAB 2WM0A 4LOVA 1RZJC 4GMTH 1P2CA 1GYVA 3P4OA 3PL6C 4R5TA 4TQIA 5GJSH 4UF7C 3UJIH 3KEHA 2VR4A 1XCQB 4PJXA 3RUGE 5FYJD 1U8CB 1NCWH 4R26H 3FUHA 4YAQA 4JCMA 4JO2L 4NQVA 1HEJC 4UYQA 1RERA 4XMZA 2CA3A 2XTLA 2NYKA 1E6JH 3NFPA 2QFRA 3HI5H 4P23C 3WAJA 1J5HA 1T7WA 1AO7E 2NDFA 4ENEC 3MN8A 4M7LH 5JW5A 2CMRH 3BKCL 5I8KL 3O6KL 3SO3B 3D3VA 5I18H 5IHWA 5MEPA 4LQFH 4BSJA 5TF1H 4GBXC 4MDRA 2FT6A 1ZVSA 1A0QL 1N64L 2BWIA 3QZLA 4FTVD 3HE7B 3SDAD 3FAWA 4FQQB 1IGTA 5B1JC 3U0PB 3BWAB 2P46B 3IM1A 1TQUA 2DDQL 2EXWC 2G30A 4JO3H 1HOCB 4PGDA 5J1SC 2YJLA 3ETBJ 3AUWB 5CJ5A 4PJAF 3Q8FA 3SDDA 1PF3A 3VFRB 5FM8A 2I24N 1BV8A 3EDKA 6PCYA 2EDYA 4YHOL 3ZK0A 4HUXA 5I1JH 3BUBA 5AZUA 3TYFB 3EJYD 4GW4B 4QRSB 4X6EA 4NOFA 1ETB1 2MH4A 3MXWL 4I18C 1E67A 3QDGB 1DBKL 1QO3A 3WKMH 5CO1A 4GSUA 1X9RA 3VFNB 4JDTH 1GGCH 1DYZA 1HQRA 1IFHL 2WCPA 3O9WA 4ADIA 4BFNA 3KMDA 1ZKAA 3VH8B 5C86A 1SHWA 3CFBB 1XGYL 1FF5A 1L6PA 1CL7H 2NY7H 2GVYA 4BDVA 1H6UA 4PUBL 1SEBB 1UM6H 3KXFB 4BFFA 1I1CA 3QZWB 2Q10A 4WO4B 4XE5B 3L95A 1PL3A 5GXBB 4WVRA 5E4EC 5IFAH 4O2EA 1WIPA 3B2UD 4X9GA 3KLKA 4KRPD 1KN4L 3HC2A 5FYJL 4GQ9H 2AF2A 1IGJA 4HFWB 2OLDA 5E7FA 2D7TL 4JGUA 3MA7A 1T83A 4NRXB 3KPSB 4KKAC 2R1YA 1WLHA 4XNMB 4G7QB 4N0CC 1A9BB 1BVKB 1OW0C 2V8MA 5DGQA 4ZMZA 3ZE0B 1GZPB 2Y36L 2K8QA 4RRPG 2O72A 5DHYB 3DMMB 5AYUL 1T6WA 1WS7A 4IOIA 3G6DH 4DGYH 1NCGA 1QA9A 4X99A 4G80A 3OLIA 2HVJB 2ZOLB 4BQ9A 5J06A 1T80A 2IF7A 5E8EA 2KYIA 5BVJB 3B9VA 3JWNE 1LWRA 5M7QA 4J6RL 1NMCB 4RZKA 1AXTL 4IS6B 4L2YA 2HRLA 3MI6A 2HMIC 2V5YA 1KTKE 2CBTA 2FEDC 3NGBB 4PBWD 3VXNB 2GBTA 5FYLH 5JHLL 2Q6WA 4ZFFB 3TZVD 5HPOA 3BD5A 1MWAB 2H1LM 3MCLL 4PWEA 2XOTA 3MRRB 3WKNA 3WY2A 1BG9A 4HBCH 3UTZA 3AACA 3PP4H 5CP3A 1JBJA 3GIVB 2R2EB 3TV3H 5F1NB 3QORA 3EFOB 5B3JE 4ODSL 3HAEB 5CBEA 4E41A 1FFTB 4BCZA 2OM5A 3OL2A 4M48L 5JMRA 1J18A 1BAFH 1BFOB 1I1FA 1R4XA 2G4GA 2WZ0A 3OMNB 4LKCA 2IPKA 1KCWA 1XCWA 3TBVA 3SE8L 4WTZA 3CFEA 2A9BA 2BW4A 3UABA 1I7UA 4X7CC 1DQTA 3PHQB 3KHQA 2XJLA 1ZGLM 2AJXL 5FK9A 3BFWA 4ZPVA 4UIKL 1U8LB 4H44C 1PZ5A 1KG0B 4OF0A 4L3EA 3HI1B 1F4YL 1G9ML 4H20L 2NY3B 4HF5L 1Y18B 2JJVA 3S48A 5IJKC 5IHUL 2B77A 1VEMA 1MCOH 4M6OL 5IFHL 4ZAKB 3KLQA 4LLVA 2X2IA 2VKWA 4HIHB 2Y23A 4LCCB 1GYWA 4Z0XA 1S5HA 4UCFA 3FO0H 1JCVA 2O30A 3I2CH 3WHE0 2BS9A 3CJJA 5CCJA 1E5BA 4UQAA 3ZLQC 2DQDL 4UANA 2P8LA 4YXLL 4JANB 5I1DB 5HXMA 3K6SB 1TEYA 1QR1B 3O41B 3C2SA 5EIQA 3UBXB 1LJMA 4JJ5B 1BF5A 3B2PA 4PRBB 2QSQA 4X7TB 4BK4A 1KC5L 4LOUD 1I7ZA 3FU9A 3HUJF 4OUOA 4OTXL 2FO1A 4ATTA 1BXVA 4X8CA 2FX8H 4IKNA 3PHSA 4B9CA 3WTTA 5FUZH 3VGEA 5CIPH 3NIGB 4GQZA 4LCYB 4LPCA 3ZOAA 5CZVH 3GLEA 4X5PA 2XTJB 2OS7A 4X4XA 3FC8A 4JPVH 5IFJA 2Y3AA 1A6ZB 4U1LB 2DZEA 3W0WB 4J4PA 4OFYA 1J7VR 3JBG7 4PJ9A 3DSFL 3CVHL 4XNUH 1CD0A 5IIEB 2Q3ZA 1Y0LA 2W91A 2Y7LA 2RQEA 1OIOA 2H1PH 4ZYKB 1QOKA 4Q9QL 4ICXA 4PY8I 4U0QB 3V4VB 1HNYA 1FPTL 1HH9A 2ZWLT 5EUOB 5HGDA 4LCVA 1ZS8A 1ETJA 3GWJA 5IJKA 1OLZA 3E8VA 3G5YA 4JHBA 2HTKD 3OPZH 4B7IA 3FUMA 2HP4A 2VQ1B 4F37K 2ZAGA 2B15A 3V6ZB 4KKBD 4Z3JA 3QUYA 4IOSA 4P9MH 4GKNA 4Z7QF 1AGDB 4YHYC 3SYCA 4NSKB 5IM7B 1E42A 4NO2A 4JJOA 3AUVA 1TJIL 1BVZA 1CDCA 2ADJA 4D3CL 4YSPA 1EEQA 2HLFC 5DWUH 2NOYA 3WMPA 4UT9L 3TS8A 2W9EH 3T2NL 5DK2B 5JA9A 2XN9B 1OTSD 3BT2H 3MCYA 1M53A 3QPXH 4LFHG 1GGIH 4XNYL 4A04A 1JHKH 4R7VA 3ZTCC 1ILSA 4V1DD 3KPLB 4WI3A 3DV4B 4RSVA 4WI5A 1KCSH 1DBJH 2UUDK 4O4YL 1ZLWH 3GBNH 2GSMB 2XSKA 1O5DT 3BVDB 5D5MA 3TT1L 4B60A 1EFXA 1MFEH 5C07E 1G84A 1JWMB 2Y69B 4NZJA 3QUXC 5GZOC 4JK0D 3B2VL 3C87A 3MBXH 4QJ5B 2F58H 1GTNA 1FYTD 2NYYC 2ZYIA 3QDJD 3IBOA 5L0QC 4G8GD 3N0PB 3VE0A 4XP6H 4P05A 3EH2A 1NPUA 1TQTA 1XGUB 5PCYA 4OZIF 4NCC1 3RAJH 4P2RD 5FM4A 1TFHA 4OLWH 3T2QA 5M95B 3WUWG 3FT4A 1F13A 1RIVH 4X0KA 3DTUB 2YKLH 4CL7A 3PP3K 1TSRA 5HDLA 3GMNB 3ML9A 2E7DA 3IDGB 4PJ7B 4X6BA 5EO1A 4RAUB 1YECL 2KLRA 4PHZA 3ZDXE 3ZYOA 3P3SA 4GW1B 1EXGA 1X9LA 2EDNA 3C6LB 1NIAA 2VDKH 4NQCA 4ZNCD 3BKMH 5CN3A 3B34A 1TG8A 2JNZA 5KVDH 1ONQA 5H2BA 2J5LB 2UZYA 3LZFH 4P2QA 5HBBA 4K7PX 4PBVC 3EF4A 4QRPA 4XC1H 2FNBA 2BRQA 3FU8A 1UT2A 3QUML 1A47A 1UXSA 3VXSA 1SJHB 1C16A 1CICA 2LLNA 2NNCA 2VLJB 5D2LB 4L1LA 4MQXD 4TV3A 1ROWA 3F58L 4R96A 3VB9A 3MV8E 5GGSA 3FFCE 1WHOA 4Q9RH 4LQ1A 4DPBX 4WY7H 2C4XA 3F12A 4WO0A 3QEUA 5ALBH 2EH7H 2E8YA 4ANVA 4PV9A 1A6UH 5FGSA 3RJDA 4G9FE 5KBPA 5JHAA 3WKPA 3JV5A 4LASH 2ED9A 3J2PA 3UTSE 4GH7B 3LB6D 5A2KH 1UZ6E 1XSKA 2UWEA 4E5XA 4AQZA 3FDWA 4X50A 1ZLSH 1KIQA 2PPEA 1T5XB 2YEQA 5DTFB 4BXSV 2JQAA 1P5VA 4XH2B 4JDZA 1D9KB 4FXGC 1DTUA 4JQVC 3MRJA 3JV4A 5L2KE 5KG9B 4UAOC 3RFRA 3BQVA 4HLZH 1YNTA 2H45A 7FABH 3VYOA 4MXQC 3HZ3A 2V0AA 3O3DA 2ODHA 4JPQA 2FYVA 3FTGB 4CN1A 5ICZA 1SOKA 3EYSH 4OAWB 3OZKA 4OIIL 4OCNC 3BVNB 3QG6A 1P5UA 3QCTH 4M1CC 2JI1A 4TNWF 5LWYL 2UY6A 2GTQA 4QHUB 5E6IC 4HUVA 5LN4A 3V9CA 1CWVA 4GT7A 1OM9A 1TTFA 4FQJL 3FTWA 4OBRA 1B9KA 4ZZFA 3BISA 1QRND 1ERNA 3ZHLA 2CRIA 1QLFB 1Q9KB 4PW4A 4XNQB 1G6RA 1I7TA 4KKLC 4ZDHA 1MFCH 3F6IA 2GTZB 5IJDC 4MKTA 1JPSL 2VLME 3K1KC 4P5MB 2CDGB 1E4XL 2XVKA 3BFQG 2LQRA 3O6FC 2NXZD 4M4RB 4GG6B 3EW3B 2AJSH 3MXVL 1N0LA 3RY6A 2FTAA 5IQ7L 1CYWA 4M8QB 2WTOA 2HT2D 3C5ZD 4L2LA 3IRCA 4WEEA 4M43L 4C57C 4XZUB 3VXME 5DHVA 2Q7YB 2EDJA 3T4AB 3LOWA 2DW5A 2K70A 5FUCE 4K2UL 4ZRGA 2R56H 5CM1A 5AW4B 4XMTA 1RJCA 4ACTA 1P84K 2CRYA 4C55A 4HKBB 2XPYA 5D7JD 3IDMA 3WENA 2EUXA 4K07A 4Y4KA 5HSFA 3ABKB 5BNXD 5HPMB 1FC1A 1T21B 2CD0A 4U2YA 1RZ8B 3TVMB 4DPAX 4U6YA 1U8HB 1AXSB 3N41F 1EAPA 2GBUA 4KAQH 1U2CA 5A16A 1ASOA 5F7EL 3MRHA 1G7HB 1TLMA 1VFAA 4PBXA 1M3JA 3ARFA 1GGBL 2J1YA 5E2TH 1MHCA 2BNQE 4LHUD 2R23B 2V3DA 3NZHL 1SPDA 4F1SA 1XCQA 4KZCA 4PJFB 3BP7B 1U8CA 4JFVA 4MLSA 1G0DA 2X2YA 3TCLA 3JV6B 3WUWB 1X5YA 1N3NA 4F3FB 2Q3AA 1HH6B 4LCWB 2PYEA 3CVCA 5EBLB 2VRKA 2BY1A 3U82B 2L7EA 3UERA 1JG9A 1T0NA 5F96L 2BSSB 3HC3H 4KO7A 1WP6A 2YBRB 4S0HA 1XF5A 2EH8L 2EABA 1UWFA 1ZPUA 2X6UA 4HJJH 2I27N 1UT1A 4TQHA 4PRHB 3Q0HA 2LFEA 4YEFA 3U0PA 3BWAA 4P06A 1HOCA 2AXGA 3KAAA 5CEZH 3D18B 4MMXA 1LP9F 5AOJA 3FBQA 3BPCB 5BUPA 5DA4A 3NFNB 4XNAA 3EDFA 5FHBL 3VFRA 2LLLA 3U36A 1HXKA 2X6BA 2YGQA 1XB8A 1BVLA 5EN3A 4UDUB 4GW4A 3RVWC 1KJ2B 4HWBL 2AI0H 2W0FB 4QRSA 4U1KA 1K8DA 1FZMB 1XZWA 3TEUA 2PXYC 1N8ZB 2J4WL 3UTPD 5HHXH 2RFXA 5CP7B 4G7VH 4NUJB 4KH9A 1YEEL 3LHPL 2R0WL 3DARA 1RMFL 2J55A 3MFFB 4MJID 3ULUE 2IAMA 3CFBA 2NXYD 1MFUA 2DBJA 1OCZB 4MJ6B 3RPKA 4FTVB 3SDAB 5EU4A 1AE6L 1SEBA 4YDVA 3KXFA 2ZXCA 4BFEA 2VDLL 3ESPA 4FNTA 1A3LH 4WO4A 5PAZA 4L8SA 4UQ2B 1YN7B 3TH2T 2H47C 2JI2A 1ZGLP 2N7BA 4ZUWA 3F6LA 3DVFA 4MS8C 4OCRL 1UCBL 4NNPH 3SDXB 1AHKA 4JGMA 1Z2KA 4PJEE 4XB8A 5D7IE 5CMAA 3BPNC 1QFPA 5DGRA 1HNGA 3GXPA 3WHE1 3G6JF 2G75A 2QGDA 4JRYE 3VG0H 5BXFB 4OM0L 4JFPA 1KOAA 4NRXA 3KPSA 2VKXA 2VR9A 4PS4L 1CMOA 1DQVA 5L4MA 1A9BA 1BVKA 1RHHB 3A4FA 2B14A 5EF1A 4AJ0A 3N44B 5EZIL 1HSBA 4NEHB 4ZW3A 3W5MA 2IALB 1IM3D 1NICA 1K4CA 2PMZA 2HVJA 2ZOLA 3QJOA 3PDDA 4YK4C 1Z9MA 2IANE 3DK2A 1NGWB 1KEGL 3QIWD 4IS6A 4PCSA 5K9JL 3T3MB 2YOAA 2W5PA 2IC2A 4Q97A 1I9JH 3VRLE 3VXNA 4F15C 1FH5L 3FJTA 3GQFA 4Q7DA 5ACMA 1KTDB 4N1HB 5EWIL 3MRRA 1VFOA 4AIOA 4KRPB 4MXVE 4JR9L 2E9WA 1IE4A 1PVHA 1T83C 2Y7MA 4L3AA 2FUQA 1CF8H 2QQLL 3US1A 3QRGH 3GMQA 4NERA 3L5HA 1T20B 3LQAH 5F1NA 1NIBA 1FORH 3ZL4H 1C5BL 3EFOA 1KEML 4I0PC 3ABMB 2IDFA 1OGAD 1SMAA 2NY0C 1YC7A 2EC9U 3OZLA 1Q94A 3P2TA 4J2XA 3VFSB 3UMNA 3V9EA 4D0CA 4Z8FH 2ZCHL 4Z7WA 3OKNB 3W37A 3BW9A 2DS4A 2B8OT 3V6OA 1SDAB 4TVSa 1O6SA 5GRJH 1U8LA 3EGXB 3G6AB 3ILQD 2PABA 1RZGA 3SSGA 3MV7D 3B1TA 4XVUC 4BM7A 5T5FL 5B39G 1A6VL 4P2OD 5ESVA 4KITB 1CK0L 4KTYA 2XV3A 4ZO8A 2OYLA 2HRHA 3RWJB 3TZVB 2HRGA 4HIHA 4LCCA 5EU6E 5J9PB 1ADWA 5I1CH 3WFZA 5BO1L 3O81A 1PG7X 2V6HA 2CKBB 3RP1A 5K93A 3EOTL 5JQIB 3FAXA 1QZ1A 4JANA 4G1EA 5LDSA 5J6GB 2P44B 3O41A 4JM2C 4YE4H 3UBXA 3UCRA 1M7UA 2KMWA 3PWJB 1KLUB 1P4BH 2BMKA 4XB3A 4Z95L 3V4PL 4PRIA 3OWRA 3HNTL 1E4JA 3NMEA 2VWEC 3O0RH 1NQBA 4AK1A 5JOEA 4QTIH 2WKGA 4LSRH 4PGEB 1XO8A 1HU8A 2J6EH 4LCYA 2K4WA 2AVGA 1MRDH 2NSMA 2CSPA 4GPVA 2X10A 3OGOE 3GIZH 4D9LH 3ATAA 3R06A 3CUPB 1Z3GH 4X4MA 1VADB 1FL6B 2ENSA 3QISA 2K6YA 4HGWA 3DK0A 1C1EH 3BPOB 4KRMB 1SVCP 3PV6B 1J9CT 5I1GH 1HE8A 3FU6A 4XN8A 3OXSB 5KYWA 2CWRA 4IYKA 5F70A 3L7EA 3SIKA 2HKHH 3K4DA 1X5LA 3AY2A 5IVXF 3V5HB 1BQKA 5ABZA 4JBSA 1KGCE 4HUCA 5ACLA 1WEJL 1NSNH 2HTLC 3ILDA 4W9JC 1KIRB 3WNNA 1JXGA 1RH8A 5CJ8A 1UA6H 3FXIC 1AGDA 4NXSA 4NSKA 2YRBA 2R29H 4FYQA 5ABAA 3QCUL 1TZGL 3SBWA 2ZZUT 2X2HA 4ONOA 1AOZA 2VDPB 5D55A 2C7UB 2FBJH 4FLSA 5TTRA 4YSCA 5T3XD 4EBQL 1QLEL 2GFBB 3GK8H 3ETTA 3KNBA 4J4PC 3MCKA 3N9GL 1S7SB 2XN9A 1IC1A 1XZ0B 2P5WB 3WYRA 1I1AD 4EI5C 2Q2EB 1E2VA 1XT5A 5BZZA 3KPLA 3WIHH 5ITBH 4QY8B 4YLBA 5D7SH 3SGJA 1VFUA 4HHGA 1YNLL 5TPWH 1CGSL 1HVXA 2WQ8A 4PD4K 5HJDA 2ILLA 4GRWB 3SGKC 2EIZB 3OR7A 4TULL 4UINH 1R3JA 4A67A 5EOCH 5I1KH 2G60H 2OR9L 5F88A 3P73B 4H25B 5E0FA 2N1KA 3LRLA 3F7YB 4N3TA 5FX3A 1KCBA 4NKIL 3CZFB 5DZ9A 3VGHA 2XQYA 1F4XH 3QDGE 3MRBB 4JUSA 3UDWA 3FRUA 3APDA 4NPYB 4ZMPA 4WUKL 5CU9A 7PCYA 1BGXH 5ADOH 1EVUA 4HX1A 4UT7L 2X4OB 4OKVA 3EGSB 4P46B 5CJBA 3ILPA 2PCPB 4QHPA 2Q76A 1A7OH 4V1DB 1AMXA 5GGTH 1OPGL 5DMJB 5ESQA 3H4HA 4M5YH 1G0XA 4KROB 4E9YA 3DV6A 2AV7A 4ZUTA 3RTLA 4ZUSB 2WLIA 3S35H 4MJHA 2GJZA 3LIZH 2X6CA 3HOGA 3MRKA 3VI3B 4AC4A 3RY5A 1JN6A 4WI6A 5C08B 5D7EA 4MNHB 4HVBA 4GP4B 1FYTB 3SPGA 3L4YA 3IJYA 5D2LA 4G8GB 1IIKA 3KH4A 2E7CA 1AQ8A 4B53A 4RGOL 3WLWC 5LAPA 3CC5B 2FT7A 2PWGA 5T3XL 1KCRL 5FF6B 3SKOA 1LL1A 2EP6A 4UMGA 4BEIA 1G9NC 5B39B 4G59C 1UGKA 2FH8A 3KPMA 3QH3A 3ZE0E 3KLHC 1QUNA 2X41A 3ARGD 3ISRA 3QVAA 1VLXA 4HV8B 5AYQA 2LGNA 2XTSA 3NIFF 1S9WA 1UH2A 1AC0A 2X4UB 3IPEA 2AS5M 2DQEH 2AXWA 3FTVA 2CBOA 1IGML 1RURL 2WBJB 4YDKL 5BW7A 2QHLA 5DTFA 2V9TA 3OSKA 5J1TC 4MMYB 3QYNA 2X53A 1N59B 4P4KD 3GTVA 1NCIA 3O8XD 1CZ8L 3QARA 1D5BB 3BP4A 3DVNA 5I0DA 1PD1A 1QSEA 1BF2A 3MNVB 2I7SA 4I1NB 1ZPLA 1D5IL 2KT6A 3HG1D 4O02A 4YEEA 1G9EA 4N4YB 1XH3A 4K0OA 2YSTA 5CS7A 4ZJ9A 3REVB 4YHZH 3GMLA 4XN9A 3BVNA 3NCFB 1DQLH 4KHXL 2XA8L 2HT4D 2GBAA 5IBLD 1EGJL 4HWEL 2YPVA 4OKDA 1INEL 1N67A 1NFDF 4YO0B 3QUZD 1TTUA 2CE6A 2HZHA 3MLXH 1FJ1B 1E6OH 2VDQL 3FYEB 3LKOA 4WUUB 5GSVB 1MH5A 4F8PA 2YSSA 5CLZA 2TSBA 3SJVE 4WWKB 1GJWA 3BH4A 1GOFA 4C56E 2VNCA 3BP5B 4UT6H 5CLYA 2KH2B 2F74A 4JFDA 4JB9L 2RCSL 4ES9A 2B08A 4FG4A 2CDGA 1M05B 3AS0A 1K6QL 4P5MA 3BQUC 2YD6A 2APFA 3HPJA 3LS5H 1HFUA 1P4LB 5D1QA 2YO3A 4YDMA 4Z7QB 2J8OA 4YVNA 2P45B 3N2JA 1AR1B 1V54B 4F57L 1DBBL 2PW1A 5T33L 4UTAL 1LK3L 4F7PB 3TA3A 1FRGL 5I71B 4NKMB 4M8QA 5E6RB 3WE6B 5FCUL 3MRNB 3ZYIA 5GZND 1HEHC 2E6JA 3H3BC 1R24B 4XZUA 1L9TA 1GGYA 5A7EA 2Q7YA 4AYID 3RWDA 4XP5H 4X6DF 4Y8AA 4W9HC 4JUTA 1YQVL 4R5VA 4M7KH 5E2JA 1ZVNA 2XLLA 3IKCA 4ISVB 4UTBH 3X14B 1MCDA 1MJJA 2BNRD 5H37A 4PJHF 3AM8A 4K94L 3R0MA 2BW5A 4JRXD 2Z34A 3EUUA 4JZNA 3VXRB 5HPMA 1PCSA 3LZNA 4JO4H 2BVQB 4NENA 4RAHA 4G6ML 3NIGE 3TVMA 1JV2A 1AXSA 2XTJE 2ZUYA 3QQNA 4FKHA 5ISZD 1FNSH 4QRRE 1XGQB 2NX5E 4XPGL 3W0WE 5ALCL 1G7HA 1PX3A 1O7SA 2H6OA 5E9AA 1EHXA 2W9DH 2NXZB 2DWDA 2R23A 1BJ1J 3R8BB 1M7IB 3C5JB 1DANU 4PJFA 1E8ZA 2BOCA 3BP7A 3LKQB 4GKOA 4WW2C 4OZIB 4Z7UE 2GG1A 1XIWB 3FSAA 4FZEL 3JV6A 5EUOE 2L04A 4MA8L 1XR9A 1I8IB 1QHQA