1YJDL

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIQMNQSPSSLSASLGDTITITCHASQNIYVWLNWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of 5.11A1 antibody light chain
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL01
4JO1L 4MLSA 5C09A 3D85D 3G6JE 3V4UL 4PJEF 2CK2A 1SYSB 4WV1C 1AFVH 2PW2B 2CMRL 2E7LA 4Y19B 2EEDA 3FMGH 5C09E 4I18C 4KQ4L 4N0RA 3QULB 4WUUD 1AHWB 3ZDXE 4WFFE 3QT2A 5HDQL 3GJFB 1CD9B 4YZFE 3QEUA 1G7MB 1Z5LB 4M1CD 4L3EA 5K9KB 1A6VL 2NY6B 3EYUL 4KROC 3L3HB 1S8DB 1VFBA 3AREC 4L3EE 4MWFB 1PX4A 5DMIH 4UINH 2X4UB 3PQYD 4HWBL 2I24N 3GSNB 3D39A 2Z93A 4LPXA 3PP3H 5B39A 2C1OA 1MHEB 1BAFH 1NGZA 2GK0B 3HI1B 4L8SC 1DDHB 4XTRD 4TVSa 3D39E 4MB3A 5IVXB 3WO3B 4NQCD 2EDJA 3IS0X 1HN1A 4JZOB 4KK8D 5E00A 4M8QB 4WGVB 4I5BB 2X4SB 3NACL 3PDOA 4I0PC 1H8NA 1MHCA 5ISZB 1IAOB 3QG7L 4ZOBA 3TBYB 3WE6A 4JRXD 5DO2C 2IPTH 3FTGB 5CCKL 4F9PA 4U1LA 3TJEH 1AGEA 2FO4B 1JGDB 4QXGH 3OXSB 2C4XA 3CFDB 3RGHA 1ZA6A 4XBGB 4G9FB 1L7TL 1Y0LB 2PW2A 3SGEH 5DRWB 3ZKSD 1GGCL 4JPKL 4Y19A 5I1IL 3ZTNL 4XP5L 3P2TA 5EU6D 4J3XA 4CW1B 1T0PB 1AHWA 2C4FT 3HN3A 4JHAL 4QXTB 4YFDB 2PF6A 5IBTH 2FH8A 3GJFA 3QG6B 1G7MA 4Y19E 5A2FA 4R26L 2EDFA 5K9KA 4B50A 1U8LB 3SJVD 1JZ2A 1S8DA 1TTUA 1M7IB 4HGWB 3PG2A 4GQ9L 4ENEC 4MJ2A 4XC1L 4MWFA 1DANU 2W60B 5F97E 4U0QB 1ZANH 3CFCH 35C8H 2X4UA 3HRPA 4ZO6A 5JA8B 4FQCH 4NZRH 3GSNA 4X80L 5D1XC 2W65B 3FO1A 4WHYH 2W0KA 4EI5C 1MHEA 1LEGB 1DDHA 3KPMB 4DEPC 4AL8L 3IDMA 4I8DA 4LIQE 2XA8L 1MIMH 4XCEB 2DQHL 3QDMD 1X5LA 2HFTA 4LGPB 5EZIH 3SKUD 1VERA 4WFGE 1WT5A 4M8QA 2X4SA 1T89C 5DFWH 3VXME 1IAOA 1EH9A 4ODHH 4PJHA 3O41A 3RVUD 3ULVL 3W11D 1J05A 3FTGA 1Q9OB 4OTXL 3BP7B 1OB1B 5KS9F 2FO4A 3AXLB 4PJHE 5J11C 3E8UL 1JGDA 1JHKL 4LAJH 5D1QD 3DETC 3CFDA 3MJ6A 4XBGA 4G9FA 4QEGA 4Z7UF 4JY6B 3TM6A 1IEBB 1P7KB 5CAYB 1Y0LA 2F53B 3VDAA 5DRWA 1AGFA 1K3ZA 4HWZB 1NJ9A 4KHXH 1A6WL 4G9FE 4YC2B 4CW1A 5HY9B 1ITBB 2B2XL 4QXTA 5KSUB 3VD7A 1QG3A 2NYYD 1FE8L 3JZ7A 5DYOB 3QG6A 4MQSB 3VXRB 3E1F1 1Q94B 2CLRB 3E2HC 2YXMA 4FZ8L 1UQSB 1NLDL 4OIBA 5GHWH 1U8LA 2Y06H 1JN6A 1I7TB 4ETYA 1MCCA 2H26A 4DTGL 4HGWA 3T4YB 1KCVL 5DDHB 2E9IA 4OFYA 2EC9U 4KAQL 3P77B 1EEZB 4KJWD 4ONOA 4XBEH 4DUVA 3DGGA 5C0CD 1N5YH 1KXQE 2H3NA 3RU8L 1FNFA 1LEGA 3KPMA 3LQMA 2XZAL 5SV3A 1X5GA 2JJSA 4XCEA 3RIFK 3GIZH 4DKDC 3RUGF 2R0KL 3HI5L 4KDVA 2FRGP 2XQBL 1R3KB 5J1AB 3BKYL 2PYEB 1F4XL 3U4BH 1NANI 3U1SL 3BDYL 1AGCB 3OF6A 5D7JD 4Q7DA 3GKWL 4LSTL 1U93B 3BP7A 1OB1A 2DQGL 3QZWB 4LLQA 1MVFA 3MZGB 1B4RA 2CKBL 3HMXA 4JY6A 1FG2A 2MPAL 4QHNB 1DEDA 5T5FL 2YUZA 2YRZA 4HWZA 5D7LD 4FFVC 1IC5L 5BO1H 3CGTA 3RVXC 5KSUA 2V2TB 4N0YL 1BGXH 1EX0A 3VXRA 1Q94A 1CLYH 2IBZX 1UQSA 2R56L 4D94A 4MA8H 5CIPA 4QRRD 1I7TA 4M43H 4PRPA 3QDGB 2YC1B 1MFDL 4QTIH 3T4YA 4OFPA 1MFBL 4X5LA 4TSAL 5DDHA 1RURH 4OIAA 3KPTA 4RNRB 3P77A 1EEZA 2HFEB 3ARBC 1ITCA 4PRPE 2DIAA 1DQML 3C09B 1H3WM 4LSPL 1FLRH 3HNTL 2MQCA 2HFFB 4GFTB 4LCCC 3C2AL 5F9WC 3GSXB 1KG0A 3WUWB 3DXAB 1I3GH 5FDWA 2QKIB 5BS0E 1V7MH 1A7OL 3WNMA 4XAWL 5E9DD 1R3KA 1DQJB 5J1AA 5IQ7H 4YO0B 1QPXA 2PYEA 4YUEH 4ODSH 3T65B 1UH4A 1X5KA 3QXVA 2MTPA 4R97C 3U9PH 4AG4H 1K9TA 5E56A 4XC3L 2CPCA 1HOCA 3NCJH 2D0FA 4FFYL 5L0QB 1CFVH 3TO4C 4AENB 4ZTOL 4U7SA 3L5XH 1PGRB 2BRQA 4QHNA 2GY5A 2ZCHH 3LH2L 5EOCH 5ADOL 3IXAB 1ZMYA 3O6FB 3TN0D 4MJIB 3F7YB 5BW7A 1SBBA 3BPNC 3N1QC 5F8RC 2J2ZA 3BN9C 4Z18A 4JG0H 3V8CA 4PJFF 4WHDA 2AEPH 1Z6JT 3QDGA 2YC1A 3HAEB 1LK3L 3P0YH 1N26A 2DRUA 3RWIB 1CDUA 3TA3D 3UO1L 3QIWC 5T3XL 3BT2H 4JO2H 4KDWA 3QQ4A 2HFEA 4UQ3B 4DK6A 3QIUC 2FX7L 4EIGB 1I7UB 3X11B 1KYOK 5HDBE 3K8MA 4C83B 1CR9L 4L8CB 1JV5B 3DVFA 4OF8A 3T8XB 1GGIL 1EBAA 5CZXC 4OLEA 1NGWB 4WI8A 2XQYG 1A6UL 1T3FB 3SDYH 2V5YA 1WBYA 2AJSL 1YECL 2NY3D 4M6AA 3DXAA 1A14H 4G8IB 4YAQB 2QKIA 1UT9A 2A9ML 3OX8B 2P8LB 4N90D 4XNMB 1X4ZA 1DQJA 3P0VL 1WZ1H 5D6DC 4YO0A 1LO3H 4GW1B 2D0HA 1ZK9A 3MTRA 4OZGF 3T65A 4TSCH 2X4QB 4GBXD 1CFNB 1BP3B 4IOIB 5E8DL 5EC2B 4NQUA 4OCRL 3SCMC 2EXYD 1A1NB 1Q1JL 2WBWB 4NBYB 5D70H 4YHIB 1ZLSL 3VFSB 4HD9A 4PJBB 1AKJB 5I19L 4U3CA 4MZ2A 5MI0B 4AENA 2HJLB 1IEAB 1IT9H 4L8DA 5GIRA 4F37F 1GZQB 3O6FA 1MIEL 4X6DB 4KKLD 3ULVC 2DYPB 4UNTA 1FLTX 4C56B 2AXJA 3RHWK 5FO7B 3CNKA 1W72H 4I77H 1QLFA 1LDPH 5ESQA 4X9GA 3GI9L 3FZUD 4XPHH 1CFBA 3I3DA 5I15H 2W38A 1BJMA 3RWIA 3HZYB 1RZKH 1K85A 1MCWW 2AK4B 1UA6L 1OQXA 4KI5E 2BSED 3TBTA 5MEQA 5BV7B 3QQNA 4NCDA 4K8RD 2CRZA 5H2BB 3X11A 1A3RH 2HFGL 4C83A 3JV5A 5A2IH 4K7PX 1JV5A 3QUXD 1MF2L 3T8XA 3F8UB 4PJIA 1INDL 4HIEA 3HC4L 1NGWA 4N1CA 1T3FA 4PP1C 4XVSH 4O5LH 1OW0A 5MENB 3OB8A 4PJIE 4XB8A 2LFGA 2P8LA 5FHBH 4XNMA 5I1JH 3ES6A 4LDEB 5DMGD 1T7ZA 1MCJA 2QLVB 5GRWA 5FGCB 4J1UB 1D5ZB 2X4QA 4IOIA 5EC2A 3F62A 4PJ9B 1XR8B 1A1NA 2FGZA 5FGBA 5MHSE 4YHIA 5TE7H 2WK2A 4NQEB 4PV9A 3I6LE 4WRLA 2BY3A 4UB0H 2JIXB 1DUZB 2HJLA 4FQXB 3OJDB 1F4WH 1GZQA 4X6BB 4XPGL 4X6DA 2DYPA 2GSGB 5BRZB 3QEQD 2PN5A 1RHFA 4YHNA 4C56A 5CSZB 4O02H 2O5ZH 4UU9B 4X6DE 5C70A 2K1MA 3CFBB 1LK2A 2VSDA 5DSCB 4OZ4A 4C56E 3MCLH 1WWBX 1DQTA 5BJTB 4HXBH 3MRPB 4GRWH 4PJ8B 4U4BA 3STLB 4TOYH 3HZYA 3T04D 3PE9A 2X44D 3R1GL 1XCQB 2AK4A 4NFDA 2DLIA 4XGZB 5LBSL 5JW4M 4NDMB 4S1RH 2VDKH 5DJAA 5IB3B 1EAJA 2AK4E 5SWZB 5LGHH 4MVBD 3VWJC 1I1AB 2D4DA 4KDTA 1MLBB 3BSZH 4B7IA 5IVNA 5MENA 2XFXA 43CAB 4Z7WF 1RU9H 4R96B 2AV7B 3MRJA 1RUMH 1WUNT 4N8PA 2HKHL 1XF4B 5MENE 1H5BB 3OWEA 2Z35B 1D5ZA 4J1UA 2DLTA 4JLRB 4FP8H 4HV8B 2EH8L 4LRNL 4U6YB 4PJ9A 5FA3B 3UJIL 2ARJQ 5FGCE 4DOHB 4Z0XB 5C7XL 2JIXA 3JV0A 1HYRC 1YEIL 3IDUA 1DUZA 3O6KL 4NNYB 5IBLD 4K71C 1TJGH 1MFAL 3OJDA 4X6BA 4FMKA 5GZND 2GSGA 1JWSB 4AQOA 3LEVH 3LB6D 1NGQH 2GQHA 2APVA 8CGTA 1ZGLM 1MQKH 1MAKA 1MAJA 1CGVA 2ZJSH 3ZT5A 3CFBA 4ZS7L 2EKSB 5DSCA 3CSPA 2YPKB 4NO2B 4XTRC 5BJTA 3H9SA 3KLAB 3MRPA 4TQEL 4K23H 4PJ8A 3STLA 1IKFH 1LNUB 3B6SB 1XCQA 1YEEH 3H9SE 3RFZC 4KK8C 4KKNA 1T83C 3MFGB 4NDMA 5CINH 2MJWA 4GOSA 2RBLA 4Y4FC 2DWEB 5SWZA 5J6GB 3D1MC 2C26A 2F54E 1VACB 3GJEB 3UBXG 4P46D 1I1AA 2W59A 1VPOH 4WY7L 2KL6A 1MLBA 5SWZE 5J1TC 4XNZC 2UUDH 4KV5F 43CAA 4BH7B 1HI6B 3EJJX 4M7LT 5I8KH 1QNZH 2DQJH 3DIFA 1TVBB 2AV7A 4R96A 2Q8BH 4LRIC 1HQ4B 1VEMA 1KIQA 4IDJH 1XF4A 2ERJC 5I75C 4ACPA 5B3JF 3RBSA 3WFCL 4L9LB 5B38G 3FQNB 2GSIB 4S11A 5F1NB 5FA3A 4U6YA 3HUJB 4OQTL 5CLTA 4OT1L 4KU1A 1U8KA 4DUWA 4Z0XA 4FXGB 4OLXH 4G7VL 3FCTB 3KPRA 2YD3A 3MREB 3FAWA 3SDXF 4DOHE 3V5HA 5AWNH 4X7TB 3RZCC 4L4VE 3OG4B 3VXPA 5CJXC 1U8MB 2AGJH 3I2CL 3KPRE 1JWSA 1KT2A 2Z8WC 4NPYB 4NN7C 2OMNA 2YPVL 4AMKL 5C07E 4Y1AD 5E8OB 3U7YL 3MXVL 1ND0B 2EKSA 3B9VA 5I18H 2YPKA 4NO2A 2J8UA 4PV8A 1JK8B 1JGLH 5KTEH 2NY0D 3HG1A 4OCXH 5FOBB 4MA1C 1GGUA 4Y4HD 1LNUA 3V6OA 3B6SA 3BW9B 1EJOL 3D18B 2Q76B 2J8UE 1S7VB 4YQXL 2XPGB 3HG1E 4Y5YB 3O8XA 4P2OD 1LO4L 4Q6IB 3WFBL 2NX5B 4O2FA 5D7SL 3WFHB 1LE5B 3V6OE 4U33A 4PYHA 2DWEA 1RULH 4LLDA 1TQCC 3GJEA 1QD0A 3W11C 3QHZH 3AS2A 1J0IA 5J7CC 4XNYL 2VL5A 5LGJB 1ED3B 3ARVA 3HI6H 4BH7A 5JQ6H 1HI6A 5D1QC 1HIML 3L5JA 4XXCC 1JFQL 3BD3A 1HQ4A 1B88A 2ZCLL 4OM1L 1NCCH 5CP7B 5I74B 4L9LA 2N1KA 4J3WA 1NMBL 2DMKA 3FQNA 5F1NA 3P3YA 3HUJA 1UM4H 1A6ZB 5IHUL 2R29H 1UG9A 4JQXA 3FCTA 4XX1G 4JHWL 4GRLB 3MREA 5DK2A 3ZDZF 4X7TA 3WIIH 5AD0B 1P7QB 4D9LL 3HE6A 1U8MA 5GISL 2DLEA 4WIQA 1JBJA 4WUKH 2VQTA 1T7WA 4KJWC 1RIUH 3PGCB 4MAYD 5E8OA 4BSWB 2A83B 1ND0A 4N9GB 5DJZA 2BY0A 3CX5K 4DKEL 2LABA 1K8DB 3QUYB 3ALWA 1JK8A 3FO0L 3DVNB 3X14A 4NWTH 5GGQL 3GSRB 5FOBA 4UTAL 2DQTH 2R0ZH 3MMEA 1H0DB 3BW9A 2B4CH 4NSKB 1EGJL 5E2VL 2YWYA 3CXHJ 5HGHA 1S7VA 2XPGA 4Y5YA 1HH6A 2IAMC 3KLDA 3TCLB 4Q6IA 4GJTB 1DLFH 1GHFL 1LE5A 3DYMA 4IRZL 3V7MA 3GI8L 2R2EB 1MCDA 4FQJH 5D7JC 1NC4A 4E42A 1OTTD 1TPXC 5LGJA 1ED3A 1J8HA 2LAGB 1VENA 3B8YA 2HLAB 3U7AA 3U82B 1YEKH 1NBYA 2HWZL 1R3HA 1WFTA 4KJPD 1J8HE 2V2WB 2VDRH 3N1GC 4MD5A 5DJCB 1A5FL 1GOGA 4D2NA 1A6ZA 1E6OL 2AJVH 3O4LB 4PRBB 3E3QC 2GKIA 3WN5C 4UOW1 3RGVB 4F9LC 1ADQH 4BQBA 3RRQA 3VXTB 1JZ8A 4RZCB 4NN5C 2GJ6E 3MYJB 1B4JH 3MROB 1VB9A 4LAQH 1LP9B 1FZOB 3TO2A 5AD0A 3VI3F 1P7QA 1CGSL 1H3GA 2XKNA 1CGUA 1A47A 1MCLA 1Z3GL 3FT4A 3PGCA 3NCFB 2B5IC 1WFNA 4BSWA 4XCCL 2A83A 4D8PB 4K3HA 4H5SB 2HH0H 4N9GA 5DI8B 3JVGC 1CF8H 2NY2C 3AGVA 5E5MB 1K8DA 4U1HB 4BFBD 4S1QL 1QBBA 5A2KH 1OPGH 1T2QH 3BEVB 1W72A 4G80B 3K4AA 3ZTJG 4P5TA 4J3TA 3TCLA 3T0EA 3HTLX 1A9BA 5F89B 5C0BD 3WL9B 5GZOD 4RSVA 4HKZB 4O51A 4JFDB 2IEPA 3GMPB 2R2EA 1N6QL 3IAGC 3T0EE 3ARGA 2JB6B 5IIEB 2PO6C 4OLYH 3MJGX 1LVEA 4MB5A 3MRRB 3LN9A 4OUOA 1NDGB 5I1GH 4DVRL 2CUHA 5KANI 1OAZL 1OAQH 4S1SL 4DGIH 2V2WA 5I1HH 3GBLA 3LKSA 5DJCA 2DM2A 2EC8A 1MHPH 5FUZL 4UT7L 2BRRH 4PIRF 4G6JH 2E5EA 4JFQB 3GJFK 4PRBA 4YFLI 3MJ9H 3TP4A 3WKNA 2K7QA 5C0NC 3TV3H 2A2QT 1D9KB 3GNML 5GGTL 4RZCA 4LEXH 3MYJA 4U6VL 1AO7B 3UTSD 3MROA 3V7AE 1LP9A 1NBZA 3SEPA 3TA3C 4WO4D 2ZCKL 1N4XH 1EVUA 2DL9A 4GAGH 1LP9E 4KTEL 5FYKD 1B90A 4OZFH 1C12B 3SKJL 4QRTA 3VH8B 5DI8A 2X6MA 5DZNA 1U3ZA 4U1HA 1E0OB 4G6FB 4KGLA 3BEVA 4G80A 5IHLB 2NY3C 5CLWA 5JMRA 4MMZC 3RVVD 1E6JH 1KLGB 4HIIB 3U0PA 4KZDL 5F89A 3WL9A 2DIJA 3OJMB 4HKZA 3V8OA 5KVGH 2XIDA 4H25A 3GMPA 3NA4A 1KULA 1RJLB 4JE4B 2J1KA 1NFDB 1JI2A 4JM2B 5IIEA 3LZFL 1YC8A 3UPRA 2EXYC 1CQYA 1MRCL 1ZHLA 3FB5B 4GRWE 4MSWB 2C3GA 3LIZH 1EAPB 4NQDD 2IMNA 1NDGA 3RKDC 5CMAB 1HHGB 4U49A 4YHKH 2AEQL 1WWCA 3EOBB 3ZT6A 4XVJL 3HA0A 4YDVB 5HI5D 4NZUL 4PJCB 4KKLC 3MV7B 3MLRL 5T1KA 1AE6H 3OKEB 3ZYZA 2YD2A 4ZUTB 4YX2L 4OSUL 1LD9B 4JFQA 4H1LG 4ZOCA 3QJHA 5K9OB 3FZUC 1F58L 1IBGH 5FDYA 4N8VB 3DX7B 1AO7A 4I1NB 3JV6B 5L2KB 3Q5OA 4HIXH 4X7SH 3FO2B 1UXWB 4UTBL 1RUPL 1YN7A 4OM0H 3VXOA 2YD8A 4HFUH 5C1MB 2OZ4L 2C3VB 1YDPA 5JXED 2H32H 5SWSD 1IC4H 3BO8A 4RAVB 2NW2B 4NWUH 1NCBL 3KXFD 4LLYB 5DMYA 4ELMB 4HLZG 5F21B 3VD9A 3BKJH 4OD1H 3S5LB 5FFLA 2IBGA 4PPTA 3C5JB 1AP2B 1L7IL 1MPAH 4XHQA 1KLGA 4HIIA 2ADFL 3DSFL 3MRLB 3PUCA 1A6TB 3GMMB 4U6HB 1DP0A 1NBQA 3TZVD 3QUKA 1EHNA 1RJLA 1A6PA 1MRFH 1NFDA 3GZKA 1ZLVH 3JTSA 5TFSL 3FB5A 4MSWA 1RUQH 1I8LA 4MNQA 1P2CB 3P9LB 3AFLA 1HXYB 1QFUH 4K94H 2VXUH 1EAPA 3BX7C 2P42B 4ODVH 3I9GH 5CMAA 1HHGA 1GGBL 3S35H 1SEBB 1JVKA 1MJ7L 3EOBA 4MNQE 2ADIB 1CLZL 4YDVA 3PWPD 4TSBL 4AEIL 3F58L 4OCMC 5IHBA 1L4IA 4I9WD 2H41A 3OG6B 5EZOL 1OSZB 5CILH 4P2QD 1S3KL 3OKEA 5ALBH 1F6FB 4WFHD 2BSRB 4KVNL 3IFLH 5K9OA 2VXQL 3BQUD 4YHPB 2DQIL 3KR3H 4PY8I 1J1OH 4N8VA 3DX7A 3VXSE 4OIIH 3JV6A 2G9HB 1YMMD 3FO2A 3VCLA 3PL6D 1UXWA 5C2BL 4FQLL 1NANH 1MQ8A 1RZFL 4XT1C 5F7KC 2C3VA 4Z6AT 1FNHA 4FQ1L 3MO1B 2XG5A 1CXEA 1URLA 1NEUA 1DUYB 1UACL 3MUY1 5C71A 1L0XA 2QHRL 3HC3L 3TJHC 4D0CB 3V95A 3S5LA 3TC9A 3MC0A 4JANB 3O2DH 3N9GH 1KN2L 3TT1H 3C5JA 4XP9L 2Y1VA 5C0EB 4K3JH 4LLAA 2DMCA 5FYJH 5I30L 4FHBD 1A6TA 3GMMA 5LKNA 3FRUB 5ADPH 4JDZA 1A7QH 5CBAA 1F3DH 3WD5H 4NC1C 4G8GB 3P9LA 2NY1D 2GJZA 1HXYA 5DJYA 3G6AA 4XNUH 1FAIH 4HPYL 2PR4H 3FB8A 5I1LB 3BZEB 4JO1H 3K3QA 2Z9TA 1SEBA 4J8RB 1IGTB 3V4UH 5IBLC 1QR4A 2ADIA 4YWGL 2EE2A 2CMRH 3I6GA 4JAMA 2A9NL 1QRND 2NLJA 5GZNC 4KQ4H 3QWRA 4LGSB 1WTLA 1HE7A 3LB6C 5HDQH 3ARFC 1T4KB 2WLYA 1HKLL 2O61B 2VKXA 3AMLA 4P2RB 4UAOB 4JFFE 4YGAB 4YXKL 2Y7QB 1F6AA 1A6VH 3EYUH 3IDNB 3BISA 5BCAA 4X9HA 2PKDA 1ZSDB 2JJTC 3CSYB 1RMFL 4WHCA 2V9TA 2NY5L 1KEML 1A1MB 4ZFOL 1G9EA 3O9WD 4HWBH 4Y2DD 3ARXA 1CD1B 5BZDB 4WW2F 4KI1A 3HPLB 1DUYA 1EERB 4JO3L 3O3EB 2ZKHL 5DEZA 3OBAA 4CAGA 4P46C 2VYRE 4HBQA 4ZO7A 3O3UN 1X9QA 3L95A 4D0CA 5HHPB 4JANA 1E4KA 3IXTA 1EO5A 3QFJB 4LNRB 4LPWA 5C0EA 1JNJA 1ACYH 4QRSB 3STZB 3A6BL 3FRUA 3QG7H 5IG7B 3P0GB 3WEXB 1ZVSA 3O11A 3DO7B 5IMLB 1CDCA 4FXLA 4JFYB 4TULH 4G8GA 3BE1L 5FYKL 1NCUA 5I1LA 3AUVA 3BZEA 1P1ZB 3SGJA 2J7LA 3VRIA 2BNUB 2ZSWA 4J8RA 1IGTA 2YUVA 4I18B 1M6OB 2FD6L 2VNCA 4OKDA 1L7TH 1NMCB 3FHQA 1XF5B 1WZMA 3ALPA 2GYSA 1GGCH 4JPKH 3O81A 5I1IH 3ZTNH 4XP5H 4C4KT 4Q9RL 5IF0B 1BVZA 4KROB 1T4KA 2O61A 2HT4D 4CJ0A 3NCMA 2BNQD 2A6DB 3AREB 2YHGA 4OF3A 5D7IF 2Y7QA 4LCWD 3W5NA 1Q9LA 5FO8B 1ZSDA 2NY0C 3CSYA 4IRJA 5FB8B 1U2CA 4XC1H 4Y4HC 3ESVF 1EEYB 2F8OA 5TF1L 3GMRB 4L8BB 4P2OC 3VD5A 4RGOL 1FG9C 2IH3B 4X80H 5BZDA 3HPLA 1DVFB 4Y5VB 1UWXH 4JFZL 4XPTL 4MAUL 1H9VA 3FT3B 5CUSL 4AL8H 4ORZC 2GJJA 5HHPA 3SE9H 2XA8H 1X7QA 2DQHH 1YNTB 2X09A 3PHQA 4LNRA 2UYLA 3PP3K 2JKXA 1S78D 2EE6A 3S36X 1T66C 3STZA 3RWFB 5DMKB 3OGCA 3L7FB 1T7YA 5IG7A 3WEXA 4P5MB 4P23A 1A2YB 4MCYB 3ULVH 1RIHL 2BDNL 1SJHB 3C5ZD 3KLHD 1BVLA 3E8UH 5IVXF 1JHKH 1P1ZA 1QVOB 1T1WB 4PS4L 2VDQL 4I18A 4WTWA 3LSOB 1JHLL 4KK5D 5CJOL 3MNWA 5KSBB 5ICZB 1A6WH 2B2XH 1CE1L 1FE8H 5IHZA 3WMSA 4LFHD 4OLWL 1BREA 5CJQH 2A6DA 5I0ZA 3AREA 1IQDB 4UOW0 2NCMA 4FZ8H 2WWKT 4PFEA 1NLDH 1X5HA 5AEAA 5C8JB 2FHCA 5FO8A 2GW5A 4O00A 4NZDA 4DTGH 3GO1L 1SMAA 2XT1B 4HS8L 4S1DD 1CFQB 3QO1A 4OCLC 4WNQA 1EEYA 5CGTA 5E8EA 3KS0H 3FQUB 4KAQH 3GMRA 3ZDYE 4L8BA 2A6IB 4M7JL 5FEBA 2FR4A 3FRPA 2IH3A 2A74A 3L6FB 4F7TB 3QUMH 5CGMA 1DVFA 3RI5K 3V6BR 1CXKA 4CN6A 2XZAH 4J4PA 1FZMA 4FNLL 1OTTC 4AEHH 2H32B 4OZFA 3SE4C 2DLHA 3X3FL 4P48A 5EULV 4I0PA 1YNTA 2O93L 3CFKA 1F13A 3FQTB 5EPMA 4R2GB 4PJGB 4WDIB 3E6HB 1T0NB 3BKYH 2XWBB 5DMKA 4JN1L 1F4XH 4KJPC 1E4JA 1PKQB 2F58H 2FEEL 3AU1B 3ARUA 3L7FA 4IMKC 1OM3H 4U1SB 2IF7A 4P5MA 3WIHL 1A2YA 4MCYA 5GRUL 3GKWH 1SJHA 3VRLF 1EHLL 3G9AB 1DLHB 4M6OL 2DQGH 1RUAH 1ZT4B 1AH1A 2QTEA 1QVOA 2IANB 1T1WA 2CKBH 3LSOA 2MPAH 5T5FH 3ZE0E 5E08L 3LKRA 1MVUB 3MCKB 5KSBA 4E41B 2B39A 1MCBA 1IC5H 5ICZA 4OZIA 3H6JA 4MXQD 2DJSA 4N0YH 4CBPA 3AVEA 5KSBE 2EDRA 1P7HL 4C59B 4OZIE 2R56H 1YQ2A 4I13B 4GW4B 3NCYS 5C8JA 15C8L 4HUMB 1MFDH 5D71L 4ODXB 1CFQA 1MFBH 4QHKI 4TSAH 2NW3B 3FQUA 1EFXD 5D1XA 4EI5A 5IEHB 1DQMH 4PRID 3H9HA 4MDIB 4LSPH 3LKQB 3HNTH 4QRPB 3EDEA 2NY5C 5E95B 4FS0A 2FATL 2H32A 3WXVL 1G6RL 1T89A 2PNDA 1KV3A 2OQJA 3FQTA 2WANA 4PJGA 4XBPA 4WDIA 4XAWH 3E6HA 1UC6A 1U58B 2XWBA 4ZPTA 1NCDL 5DUBA 5CHNB 1PKQA 3WHE0 3DTXA 4U1SA 5GXBB 2BSTA 1PG7W 1BM3L 4JN2B 5HVWA 4XC3H 3CUPA 1KNOB 1DLHA 1PKQE 3V5KA 4FFYH 1ZT4A 5DQJB 1U8QB 1KPVA 4ZTOH 5GRVK 3IJYA 5F70A 5HD8D 1F8TL 1E27A 1KJ3L 1MVUA 5HYJA 1WWWX 3GRWL 1YYLL 4E41A 5GGRY 1H8OA 1W0VB 1CDJA 1AI1L 5HYJE 3D69A 2G2RB 4ODUB 2YKLL 1CFSB 4Q9BA 4E41E 5F96L 4NM4L 5I2IA 3VDBA 2YR3A 1NGPL 4GW4A 4Y16B 4PLKC 5KVDL 3ARBB 3SOBL 4LSDA 1LK3H 4L9DA 2IH1A 3UO1H 4ODXA 4C4KO 2NW3A 3RVVC 1YMHA 2VZSA 4NOFA 2FX7H 4J2XA 2Z31D 4MDIA 1CR9H 3LKQA 1GGIH 2WUCL 1A6UH 1FV1B 1TQBC 2WLZA 5KSAB 2AJSH 1YECH 4ZFGL 1I7RA 2APTA 4FFZL 2A9MH 2R0LL 5DUPL 4IHOB 1KCSL 3P0VH 4NKMA 5D96C 3CH8A 5T3ZD 3O2DA 1U3HD 3H7LA 4WEBL 4PGDB 3W9EB 2XY2A 1M7XA 5E8DH 3DOSA 1JYWA 3L3OB 4OCRH 4JN2A 1Q1JH 3L3KB 2Z8VC 3SKNB 3TO4B 1KNOA 1ZLSH 5FGRA 3QPQD 5DQJA 1U8QA 3BIAX 4ZNCD 3BRFA 2XN9B 5FYJE 3CJJA 3IJSB 1TVHB 4LMQI 3R0MA 2EIEA 2BFVL 3BPNB 1K5NB 4YGVA 1MIEH 2CH8A 1W0VA 2RFXA 3ARDD 4NRYB 5JXEC 3NFNA 2W9EL 3Q6FB 4ODUA 4CMMB 1CFSA 3IKKA 2F5BL 3GI9H 3KPSD 4Y16A 3IU4L 1BJ1H 1QKZH 3ARBA 4EZMA 3MRHB 1B0GA 2RAMA 4ZFZB 5ID0B 1ZGLA 1UA6H 2WNGA 4RWYL 5IVZB 3TGXA 5JUEL 2HFGH 4LCCA 4Z78B 5F3BA 2F8XC 2ZG1A 4KQ3H 4TNVF 1MF2H 4LDLB 1IC1A 2DF3A 1INDH 5GGVL 4Y8AA 3HC4H 3D2UB 4HWBA 2IFGA 5C0RL 1C5BL 4NZTH 1EO8L 2ZUQC 1BQHG 3M8OL 2C1PA 2EC9T 2VXTL 3IS1X 4IHOA 3B3IA 1LEIB 4NO0B 4Y8DC 3OKDB 1CS6A 3SCMB 3EOTH 1KGCE 4PGDA 2FB4L 3B2VH 4Z7NE 2VMFA 3L3OA 1FDLL 3L1OL 4LU5L 3L3KA 3TO4A 5KVFL 4DN4L 5ALCL 5IWLC 4M7ZC 3BQUC 3LPFA 5DJXB 1PY9A 4CGTA 3T1WA 2XN9A 2SEBB 3IJSA 2X4OB 1DBBL 5ID1B 4R7DB 2JJVA 1NLBH 1Q0XL 3ZE1F 1K5NA 4DFIA 3NGBB 4XPGH 4IRSD 4HC1A 3NIDF 3L3IB 3UTTB 1C16B 1LE9B 2W9DL 4NRYA 2FEEI 3Q6FA 2VLJB 3MRKB 3DI3B 4CADB 2DWDA 5BOZG 1WJ3A 4PJBF 3QIWA 2NXYD 3R06B 3QIUA 2ZUUA 3MCG1 3MRHA 3WNLA 3R1GH 5ID0A 2CRYA 1MFCL 2VDMH 5LBSH 3TWCH 3WFDL 5IVZA 1I7ZB 4RIRB 4Z78A 4WTZG 3OHXA 4NQXB 3RPIA 5T1LB 3D2UA 3UYRL 2FIKA 2H1PL 4BKLB 5JHDD 1AC0A 1S7UA 5D6DA 1AR2A 3UC0L 2V9QA 3WJJC 4KRMB 3V4PL 5EUOF 2HKHH 5KN5B 3J7HA 3SCMA 4RMUA 1AFVL 2VE6A 4Z7VB 1OP9A 1MCSA 4O2EA 5IR1B 1JI1A 2MCG1 1FCCA 3QNXA 2EH8H 4LRNH 3UJIH 3MNZA 2HLFD 5FYLD 3QCVH 4WI9A 4LFHG 1UJ3B 3VXUE 1BLNA 5DJXA 1OGAA 4IIQB 1MY7A 1YEIH 4HH9B 2X4OA 3O6KH 4YHLL 5ID1A 3BPOC 4G42B 1MFAH 1PAMA 3RTQD 3SDDB 1OGAE 1UXSB 3MV9D 3L3IA 4NIKB 1C16A 3O9WC 4Y2DC 3ZZ1A 3CIQA 2F5AL 5HGAA 1BIHA 5C0AD 4X9BA 3QXAB 3UTZB 1AY1L 4CADA 4ETQB 4O9HH 4ZS7H 5E4IA 1BAFL 3EKCA 5JIIA 3R06A 1WFUA 3BKML 4P4KD 4GG6B 2ZUYA 3O2WL 4HFWA 2VR4A 3HR5B 1JZ6A 5H35A 4CU6A 4JFOB 4NKQB 5E2UL 2EKJA 1OAXL 2W92A 2XTJD 4PRHB 3PWJA 3R8QA 4YHYC 1I7ZA 4YDJB 3VWJB 1WSST 3ZKXC 4PLNC 4KUZL 1XGUB 1C1EL 2DOCA 5T1LA 4LEOB 1I1RA 3ULVF 4L5FL 4BKLA 2P48B 4WY7H 3RKPA 2EIZB 2GT9B 5EFIB 1G7PB 5ANMB 2Q6WB 1U8JA 3PGFL 2LTQB 5FM5M 1IGJB 3EYVB 2KBGA 4LCIL 3MV8B 1RJYA 3WFCH 1R3LB 1A6AB 2IMMA 1UKTA 4WFEE 3V79C 1CICB 2BVOB 2CXKA 4Q6YA 5EO1B 3RL1B 4OT1H 1P84J 3PDGA 4ZO8A 1BWMA 5HYQB 4V1DD 1UJ3A 1BZ9B 5GSVB 4DN3L 2H9GA 4IIQA 4JGJA 5F6IB 5B8CB 2HJFB 1HILB 4MA7L 4P4RB 4KKBD 1GGTA 3SDDA 5JLZA 1UXSA 3I2CH 3OKLB 1KN4H 3K8KA 2HT2C 1ZANL 35C8L 2QJDA 2VDPL 2CKBA 2EO9A 2X05A 4AMKH 3UTZA 5JZ7D 1TXKA 3MXVH 1TDQA 5T3ZL 4Z7QE 2B1HH 4NJAH 4GG6A 5ERWB 4HZAA 5HVFB 8FABB 4NQVA 1EJOH 3HR5A 4Y4FB 5D1ZD 4JFOA 4YQXH 1RPQA 5EZIL 3MJ8A 4GG6E 1LO4H 1X5IA 4PRHA 4YDJA 3VWJA 5D7SH 4JRXB 3HE7C 2ILLA 3QRGL 4UZGA 5BXFB 4ZS6D 1XGUA 3HS0A 5CWSB 4HMCA 3S6CA 4LVNC 4PRHE 5E94B 4AT6B 1U8HB 1WIPA 3C5ZC 4U1IB 3NN8B 4XNYH 4ZQKB 2BNRB 2EIZA 2GT9A 2ERJB 4PJDE 5FIEA 5I75B 4Q0XH 5ANMA 2Q6WA 2EECA 1JFQH 4WUUA 1IGJA 1F4HA 3JXAA 2ZCLH 4LNVA 3VI4F 3MV8A 5BVJB 4KK5C 5ANME 3MGTB 2XKUA 3QIBD 5JA9A 1R3LA 1OOAA 1A6AA 5D6CB 2UUDK 1NMBH 3WNOA 3AROA 4EEEA 3Q6GH 4WUUE 3MV8E 5EO1A 1RZJH 3RL1A 1BZ9A 5GSVA 3FQWA 3RZCB 5DD3L 2Q7NA 2DBLL 3CC5B 4RCAA 5B8CA 4JHWH 3QI9D 2QADD 1HILA 1KB9J 3PQYA 4P4RA 3B9KB 4D9LH 2ADJB 4S1DC 1ZHBA 5GISH 3OKLA 3LS4H 1XIWC 5I8OH 3ZTJH 1J0KA 3M17A 3PQYE 3HUJF 3K1DA 3GBMH 1RHHA 4XBEL 4J3UA 5IJKA 1NCTA 3HC0B 1CTNA 3MLXL 1ZOXA 4GS7B 4DKEH 5ESVB 1S9YB 4P9ML 1Y6NR 3G5YB 5GGQH 4UTAH 3WLBA 8FABA 2D9QB 3GIZL 4Y4FA 4NQCE 1EGJH 1NQBA 5E2VH 1L0YA 5SX4I 2H2PD 3QISA 2VAJA 2UVFA 1GHFH 4JRXA 3GI8H 4TTDD 4WHYG 5BXFA 4MA3B 1FSKB 3EAKA 5CWSA 3SQBA 3CFIC 3DUSB 5E94A 1KPRA 4QGTA 4JRXE 4Y4KD 2WAHA 1YY9D 1U8HA 2XXMB 4AT6A 3DO3A 4LRIA 4U1IA 4ZQKA 2BNRA 4GXUM 3BJLA 5T3XE 1N0LA 3RWHA 5IV2B 3FJTA 5EU6A 2HWZH 2BNRE 5BVJA 4MS8D 3MGTA 4C57C 2QSQA 3RAJL 5EU6E 2DKMA 1A5FH 1E6OH 4K3DL 3EYOB 1JNHA 5ITBL 2BHUA 3QXDB 2ICWI 3RZCA 2E8ZA 3CC5A 2VR5A 4MA8L 5JHLH 4U0RC 4YPGB 5I6XC 2ADJA 1CGSH 3KNBB 3KJ6L 1P6FA 3RX7A 2NXZD 4X4ZA 1FNGB 1Z3GH 4I2XA 5C08B 5KAQG 3IDYC 4XCCH 3SE3C 4LK4A 4DZ8B 1N5AB 3O45B 5ESVA 1IKNC 3AS0A 1XGTB 4I2XE 1S9YA 4S1QH 1PG7L 1OHQA 3G5YA 2IAMB 2BY2A 3WDIA 5FYLL 1MSPA 2X41A 5DC0A 1VFMA 5D72L 5DD6B 3UBXB 1I1FA 4N0UB 1ZT7A 1UWGH 4KKAC 4MA3A 1CE6B 1N6QH 4RA3A 5EU4A 5D1QA 1NGXB 1WBZB 3KYMB 4XP4H 3MXWH 3U9PL 4AG4L 1D5MB 4XXCA 1MREL 1MCNA 5F9DC 4HAGA 4H1LH 2XOTA 5IV2A 5FAAA 4RFEA 4DVRH 2F19L 1FO0L 1S9WB 5ACZA 1G0DA 1OAZH 3K4DA 2YOCA 4S1SH 3LMJH 5EOTB 4FZEL 2VXVH 5FUOL 5FUZH 4UT7H 1I1YB 3T3ME 3S4SB 4NN5B 3QDJB 2ZSVB 3B2UD 5D2LB 4F15C 3QXDA 1JIBA 2VLKD 4APQD 4JG0L 5SV4A 3LN5B 3GNMH 5GGTH 3SGDI 4NKDB 5ETUA 1BD2B 4ZUVB 3B9DA 4U6VH 4YPGA 4YHZL 4HLZH 3IJHB 5D93B 1ZVHA 3P0YL 4HUNB 3SDAB 2E7HA 2ZCKH 1IGFH 3KNBA 4NKOB 4WTXA 5DEGA 2Y25A 2NY2B 1FNGA 4KTEH 3QAZB 4LVHC 5C08A 4O2CB 5JMOC 1AC6A 2HMID 4UI2A 1V05A 3SKJH 2Z31C 2HRLA 2ENSA 4DZ8A 1N5AA 1HSAA 3O45A 3WIFA 5C08E 1ROWA 2MHAB 1FZJB 2IAMA 2J4WL 3H3KA 5F7NC 4R7NB 2Q7YB 1JPST 3VFMB 3SDCB 5DD6A 5E4EC 4A2LA 2AXGB 3UBXA 4KZDH 4HBCL 4N0UA 2PO6B 4BA8A 2V7NB 3EO0B 4PJ5B 5M95B 4U1GB 5C09D 3LZFH 1NGXA 1WBZA 1MRCH 3FHAA 4WFFD 1D5MA 3L5WB 5HDOA 3DI2B 3WDHA 5D70L 3TBSB 3QPQC 4BUHA 1T03H 1YN6B 3CDFA 3BKCH 3F6IA 4NKIH 5D7LA 5B38A 2AEQH 3W2DL 4XVJH 1MAML 4NZUH 4PJAF 2VZ3A 5D7LE 3MLRH 5GJSL 5E2WL 4F9LA 1I1YA 4FQQA 4X7CC 3S4SA 4ISVB 4YX2H 4OSUH 4QRRA 3E3QE 5HPOA 5E6YA 4E5XB 2YD7A 3FOMA 4I77L 3LN5A 5HHOB 1F58H 4YBLC 4NKDA 1BD2A 4ZUVA 4QRRE 1BIIA 3CZFB 3MRQA 2ZUXA 3D39D 3IDXL 3RWGB 3SDAA 4UTBH 4NKOA 1RUPH 3L9RA 5M94B 5L88L 3CLFL 2OZ4H 3JVGA 1W0WA 3TBVB 1A21A 3NTCH 5DURD 5HI3D 4O2CA 3OAUL 1IMHC 4LLUB 3GUTB 1NCBH 1FH5L 2CJUL 2MHAA 1FZJA 4XVSL 5E9DA 1A4KB 3OKYA 4NT6B 4R7NA 2Q7YA 1FNLA 3VFMA 1L7IH 2PW1B 2APXA 5E9DE 2ADFH 2AXGA 5I1JL 3DSFH 1A22B 5JNYB 2PO6A 2ZZUT 2V7NA 1N2RB 3EO0A 4PJ5A 2P49B 1MI5B 3K81A 5JXAL 3BESR 4F8TA 5FXCH 3U30C 3TBSA 4OFVA 3MX0A 5TE7L 2UV3A 4Y19D 2DL2A 1YN6A 4P2CG 1RZGB 1GGBH 1DBKH 2Z4QA 4G6AC 1TLKA 1QLEL 1CLZH 1J1XL 4TSBH 2VB5A 1F4WL 3P40A 1OWWA 2ARJB 4IRSC 5EZOH 2NY6D 1U91B 3EYFB 2ZG3A 4M9OA 3D9AH 1NFDF 1C7TA 4JM2F 1S3KH 4LSVH 4ISVA 4ZAKB 4YDLB 4KVNH 4O02L 4EN3C 2VXQH 4X7EC 2DQIH 2IPUK 2AVGA 5HHOA 4XX1E 4Y88A 2CSPA 5D5ME 3MCLL 2NXYC 2JCCE 2V2XB 2ZNWA 1KFAL 3PP4L 5GGVY 4OQTA 3H3PL 4PJ7A 3P9WB 1A8JH 5GS1C 5F6HJ 5HHOE 5C2BH 1FVDB 5BMFL 2AKRA 1YNKL 4PJCF 1RZFH 2AJYL 4I0CC 1BVKB 4PJ7E 2OL3B 4S1RL 1TNNA 2FWOB 4G43B 3GUTA 4HULB 2FO1A 1UH2A 5EUKB 1F2XK 1PLGL 2QHRH 3HC3H 1CYGA 2EDNA 4Y0GA 1A4KA 5ISZD 4MGXA 4NT6A 4UV4L 5IGXL 1BQSA 2MKWA 2PW1A 4N90E 5I30H 3W0WB 1NFKA 1N2RA 3OKNB 3LN4B 4G9FD 4KVCL 2AXFB 5D7KD 4ELMF 1KYOJ 4BFIB 4WWKB 4GXVL 4ORGB 3NMEA 4UILL 1RZGA 3BUYB 5FA4B 4XWOD 3QNZA 1ZLVK 4YWGH 1TJGL 2B8OT 2A9NH 4TUOB 1NH6A 1KTLB 3EYFA 3VGAC 2EYSB 3IF1B 5HTSA 2Q8AL 5DF0A 1ZKAA 5L9DL 3G08B 1HKLH 5INDB 5EBLA 4YXKH 2ZJSL 3U79A 1N0XL 3GSVB 2X2YA 2H2SD 1DQDL 4M62L 2VLME 4WW1A 4P4KC 2FECL 1RMFH 4WGWB 3PWLB 2NY5H 4RFOL 1KEMH 1JZ3A 1FVDA 3EYSL 3VD3A 1I9JL 1BVKA 4POZD 2OL3A 2XTJC 4GH7B 1T5WB 4G43A 4LKCB 4W81A 5EUKA 2WQ8A 4QTHB 4JO3H 3MFFB 4PGCA 4JCMA 2ZKHH 3RDTB 4E0RA 1DL7L 2FJGA 5DVKA 4H0IA 4YEEA 5KOMC 1XGPA 2WWMC 3LPWA 3V4VH 1V3KA 4M03A 1S7RB 5KW9L 3OF6D 4FTVB 1QNZL 5TDNB 4CUCA 2P47B 3A6BH 4IDJL 1PX3A 3SGKC 3OTTA 3LN4A 1Z0NA 3RNKB 1CBVL 4WCYL 2AXFA 4BFIA 4WWKA 2F53D 1T21B 4ORGA 3BE1H 5FYKH 1QOKA 4DKAA 4ERSL 4OLXL 4EQ2A 3BUYA 5FA4A 2P7TB 4M7LH 2OR8A 2FD6H 2OJEB 2UZXB 1JPFA 3RX5A 3VXRD 2BVQB 5AWNL 1DN0B 3ARFB 3LQZB 1KTLA 1T1YB 3JBG7 3QEQE 2EYSA 3IF1A 4HJGB 4Q9RH 1GJIA 3G08A 3V6ZB 2WV3A 4BUGA 1XCTB 5INDA 3O3AA 5JZ7C 4NNPL 3GSVA 4QLRA 3REWB 3T2OA 1G7IB 3PWLA 2H6PB 3BH9B 3NA9L 1TTGA 5IB2B 5TF1H 2KQMA 3WYRA 2KZ1B 1T5WA 5F7LB 4QOKB 2J8HA 4LKCA 4JFZH 4XPTH 4QTHA 4KJYB 4ZS6C 3MFFA 4RMTA 3RDTA 3U0WH 5F1OB 5CUSH 2DQFB 2WBJC 4KUCF 1ZVYA 2PYED 1ZXQA 4JHBA 4RBPH 4POUB 1S7RA 5JQ6L 5TDNA 2R0WH 1JUFB 1FGNL 5GJTL 5AYUL 2DQDL 3VXNB 3QIBC 1NCCL 2P24B 3RNKA 5F7YC 1BX2B 1RIHH 2BDNH 2YXFA 3ZKQD 1T21A 4NC1E 3DX9B 1UFUA 4OKVB 2AV1A 4KZEH 2DDQL 1P53A 3LKNB 2P7TA 3QI9C 4PS4H 2VDQH 2QADC 5EO9B 2YSSA 4J12A 4LP4A 1PQZB 1JHLH 4KRPC 5I8CB 5CJOH 1I9IL 3ARFA 4H1LA 4WI2A 1PD6A 2DQEL 4NBXB 5F44A 4HJGA 1CE1H 1NKOA 3RQ3A 3QDGD 3I85A 4OLWH 3B43A 3REWA 4OCYL 1G7IA 1ZS8B 3BH9A 4HS8H 2DQTL 2D03L 5IB2A 3GGWA 2X4TB 2J8OA 2G75B 2B4CL 1BZ7A 2H2PC 4B7LA 4A6YB 4P46A 4QOKA 3DXAD 2PTVA 2QQKL 4TTDC 1WZKA 1SM3L 4JGMA 2B0SL 4JZJC 3U6RB 2DQFA 1G6VK 4QOKE 4Y4KC 1YY9C 4FNLH 3X3FH 2A1WL 1U41A 4R0LC 1INQB 3THML 5IFHH 1JUFA 3O2VL 5K59F 4MS8C 4JN1H 1SMOA 2MFNA 4LHUB 3VXNA 3GSNL 2VRAA 2WBKA 3K8LA 1ZT1B 4CVUA 3WIHH 1HHJB 1BX2A 5EC1B 5GRUH 3RVTD 5I8EB 2D7OA 4CRPA 1WK0A 1EHLH 4M6OH 2AJVL 4NHCH 2X42A 3VFVB 1GOHA 2Y5EA 3O6FD 3IDJB 4UQ2A 1MFNA 4JVUA 1BFVL 3L7EA 4MJID 1ADQL 4LPYA 5EO9A 1PQZA 4PBWD 3ULSB 1FJ1B 5E08H 5DC4B 4LAQL 3FQXB 3PHOB 4M93C 4N5ED 1CT8A 4Y1AA 4U1JB 3IFOA 5GGSB 3TYGL 2NXZC 3L5HA 4KI5D 2KPNA 3KGRA 3S8WA 1A7RL 4I3RL 1WTGT 1MWAH 4Y1AE 2P5WB 4QF1B 4RMVA 4OGZA 2N56A 4Y4HA 1WCQA 1F3JA 3ZHLA 4OGAD 15C8H 4MJ5B 1WITA 3O6LL 1ZS8A 3KPLB 3NCYP 5D71H 1JMXA 1OPGL 1WIUA 5JW4R 2O5XL 2X4TA 2G75A 1KELL 4PGEB 1SVCP 2CD0A 3EJYD 3W9DB 4BSVA 5E1HB 1MRDH 4OZHB 5F71A 3U6RA 4NQSB 1EPFA 2OZ4A 1G7LB 4OLYL 1XGRA 4ONFL 4XMPL 2FATH 1G6RH 4OUUA 2ESVB 3T08A 3QQ3B 5MHSD 5IFJB 3U4AA 1U3JA 4GG8B 4X6EA 2J5LC 4K9EL 2FECI 3I50L 3BP6A 1I8MB 2B1AH 2MQ0A 3P4OB 3A0OA 4F7PB 2GY7B 4KRLB 4OV5A 2HVJB 3QQ9D 1ZT1A 1AKJD 5I1HL 2G5BB 1HHJA 1MHPL 1BM3H 1VFOA 1DN2A 5EC1A 2X10A 3C8KB 3NZ8B 3VFVA 3B2UC 3IDJA 2DYPD 4APQC 3T77B 4EOWL 3TV3L 4PJGF 1CGXA 3UYPA 4C56D 2YK1L 3A6OA 3T4AA 4RGNB 4ESKA 1A7NL 1F8TH 4M1DL 1FJ1A 3ULSA 5LQBL 3GRWH 3FFCB 3FQXA 3PHOA 2X7LA 3I6KB 5C86A 4H0HB 3DX8B 3ALXA 3SN6N 4XWGH 3SBWC 5GGSA 4EDWL 2HMIC 5FCUH 2YKLH 2QQLL 4NM4H 5F96H 2RJMA 4QF1A 4TYUA 2AK4D 1VFAB 1NC2B 5J12B 4N1EA 4MJ5A 1T1ZB 4YPJA 4UNVA 5KVDH 1XH3B 3SOBH 3KPLA 4W4OC 3VMOA 4DJMA 1JGUL 5EORL 3EGSB 3BXNB 4JJ5B 1BWWA 4L1DA 1DCLA 1U36A 4NO3B 4JFEB 4HCRA 4PGEA 2VLRB 4ZPVA 3IGAB 2JJWA 5JW4Q 2I5YL 2XQYK 5MEND 3QUZB 3W9DA 3SE4A 4EDXA 4OZHA 5H37G 1EVTC 4M5YL 4ZFOB 5C6TL 4NQSA 2WUCH 1G7LA 3N0PB 3WNNA 2GUOB 1E4XL 3MBXL 4ZFGH 2OLDA 3QQ3A 2E7LC 3T2NL 1UZ6E 4FFZH 5CD3B 1T80A 4IMKA 2R0LH 3ARRA 4PJ9D 32C2A 1KCSH 1OGTA 1I8MA 4NP4L 3SQOL 4WW2C 1MY5A 4NQED 2HVJA 2XRAH 3BP5B 4WEBH 3F6LA 2JIXD 4UOJA 4U1KA 3BH8B 4D9QD 2I60H 4FQXD 1I3RB 3C8KA 4YK4C 4YDIL 1J0ZA 3MLUL 4LL9A 5BRZD 5DK0B 4Z8FH 1W8NA 1ETZB 1IBGL 3IU3B 3OKMA 2BFVH 3FFCA 3ILQC 3I6KA 3OAZK 3DX8A 4IOSD 1WQVT 1CFTB 1MUJB 2EEAA 3BPLB 4M48L 4CL7A 3TBWB 3BYYA 3S3SA 5HI3C 3BZFB 3FFCE 4PJ8D 2W9EH 4RMSA 4Z95H 5HDLA 2F5BH 3EFFA 1VADB 1VFAA 3NPSC 3RNQA 3IU4H 1I8KB 1T1ZA 2ATKA 1XH3A 5E6IB 4RISL 5DK3A 4MD4B 1R5IB 3BXNA 4X6CB 5SWZD 2OK0L 4NO3A 4Z5RB 1I1AD 1MHHB 2VLRA 4RWYH 1CDHA 5I73C 3VGHA 5JUEH 4F9PC 1JYNA 4GMSL 2ZUVA 3VFUA 1P84K 3N1FC 5GGVH 4ZFOA 5E8NA 2VLRE 1UKQA 2NY4B 4ZTPL 5C0RH 2GUOA 1DQLL 3OAYH 1RUQL 4TNWK 1EO8H 5D96B 3KAAA 2B4CC 1VGEL 3M8OH 4K94L 1OAKL 2IADB 2VXTH 2VXUL 5CD3A 1AHWC 3NFSL 1OARL 3Q5YA 3S35L 3Q1SH 1Q0YL 1T1XA 1YC7A 1YPZE 3BP5A 5IEKB 4TVPL 2FB4H 2YD6A 3BH8A 5CEXB 1FDLH 3D5OF 1ULVA 3L1OH 4DN4H 5ALCH 3QEUB 4DGVL 1U8IA 4L3EB 1QLRA 1ETZA 1RI8A 5KG9A 3IU3A 1DBBH 1HWHB 5SX4H 3EDKA 1HDMA 1Q0XH 2VQ1B 4NJ9L 4LCYB 1CG9A 3QXUA 1CFTA 1MUJA 1SEQH 2VUYA 1BJ8A 2VUOA 4LLMB 4X7FC 3TBWA 2C3HA 3BZFA 5FYKE 5EN2B 1JTPA 5FO9A 3NIGF 2Z93B 4OQ1A 1N8ZB 1VADA 1I8KA 4PJEE 3U9UB 1RVFL 4MD4A 1R5IA 5IB5B 3VA2C 2K9UA 1MFCH 4Z5RA 5DA4A 1L9NA 5LAXA 3QWQB 1MHHA 5D4QA 1AR1C 1DBML 1QSEB 1MHCB 3QZWG 2VLLB 2V5SA 4XI5C 3KYNB 2ZUQB 5F9OL 4Y7MA 5CS7A 2VOTA 3UYRH 1ZEAH 2H1PH 3GMNB 4PR5A 4XNQB 1EA9C 3DGCR 4I0KA 4NQDE 1MNUH 2AI0L 3V4PH 2I9LB 1ZA6B 4XWOC 2BX5A 2VR9A 3BZ4B 1AQDA 5IEKA 5CJ8A 5DC9B 4Y5XC 3V2AR 1WGOA 5HGDA 4DKFL 5CEXA 4XP6L 4LMQE 4J23A 4L29A 5B4MD 4CDGC 3RX8A 1Z9OA 4K9EC 4U3XA 2OYPA 2N4IA 2H2SC 4YHLH 1OT2A 5SX5H 4JVWA 1IGCL 2G60L 4HGKC 5L7XH 2VQ1A 1U95A 1XAUA 4S10A 5JXEA 4LCYA 5KS9B 4MXVF 1CL7L 1FFQA 1XF3A 3KXFA 1OP5H 1PSKH 3KVQA 4YIQA 4LLMA 1WVZA 2F5AH 4L3AA 3ZKND 5EN2A 2JJSC 1AY1H 3BPCB 3WUWG 1K3IA 2P8PA 5E99L 3KXFE 1N8ZA 4KPHH 3FO1B 4G8EB 4FQPA 3CDCA 2WIMA 2BERA 5IP4A 1XGQB 2NX5D 3BKMH 2ENYA 3IDMB 5EWIL 3U9UA 2HVKB 1V8HA 3O2WH 5IB5A 2DI7A 4XRCB 3VXMB 4OD2B 1IGIH 3O4OB 4ZOEA 3D3VB 5E2UH 1OAXH 4HXAL 2P5EB 3MUJA 1YEJL 1ACYL 3S35X 1QSEA 5DFVC 3LKOB 2DLFL 2VLLA 4KUZH 3FN0L 1C1EH 3KYNA 2AERT 4FXKA 4PJHB 3O41B 3SGDH 4L5FH 1J05B 3PDDA 1QSEE 3GMNA 1IC7L 4TULL 4OBSA 4XNQA 3HZMB 3PWPA 2PETA 3PNWA 1LILA 4YC2C 3PGFH 4RDQF 2I9LA 4WI6A 3NFPB 4BQ8A 1IAMA 4LCIH 3J8F7 4XVTL 3BZ4A 5DJ2B 3UPAA 3PWPE 4O58L 3N1MC 1AGFB 1JZ4A 1NJ9B 4I9WE 3UJTL 4OLVL 5IWLA 3MRIB 3BQUA 4GRLD 4P2QE 1DEEB 4N1HB 3UXFA 2D7QA 5FM4A 3BGFB 3HFMH 4WFHE 3HAEG 1R3IL 3VFOB 1P7QD 3MLYH 1BF2A 1YMMA 4DN3H 3TVMD 4U3HA 4FABL 2QHLA 5GRXG 4MA7H 4JM4L 1E4XI 1JN6B 4RWHA 1QBLH 4OGYL 2R39A 4Y2DB 1YMME 3B5GA 2H26B 5DJDA 4OLZL 5KS9A 4AEEA 4Z7VF 3LAFA 3QUYD 1XR9A 2VDPH 4Z7UA 2EZ0C 3LHPL 5KS9E 1FAIL 3BPCA 3DGGB 5T3ZH 2H3NB 4G8EA 3SPVB 3C8HA 1J0JA 3CPLA 4Z7UE 4LPUA 1XGQA 3WXWH 4D0DB 1BQLL 2EDWA 2HVKA 3SE9L 2X4NB 1I85C 2MCPL 4XRCA 3EJZC 3T2QA 4ALAL 3VXMA 4OD2A 3D3VA 2P5EA 3LD8B 4KHTH 2FX9L 2OP4L 3QRGH 3U36A 2EIDA 1FVEB 3LKOA 5K9JL 3GHBL 4P57B 3D3VE 4WU7A 2P5EE 5DUML 3S88L 3UTPE 3WJJA 3K80A 3DMMB 5IOPB 3HZMA 4U6TA 4LLQB 1QRNA 3PJSB 2EDHA 3NFPA 3S97C 4CU8A 3O4LD 1QFWL 1FG2B 3FL7A 5DJ2A 1G1YA 2M26A 1G6RA 1WISA 3RGVD 1QRNE 3MRIA 3RUGA 1DEEA 3MRMB 2X9YA 5JPMA 2YZ1A 3VFOA 4K94C 5CJQL 5DD3H 5KOVC 1FP5A 3RUGE 4BK4A 2DBLH 5DA0B 2RHEA 5CIPB 4TN9A 4GLRH 2OI9B 4PRPB 4Y2DA 1CLOL 1INEL 1FQ9C 1CDGA 3F7VA 3QJFA 3C60C 2ED7A 1YEGL 2DJ4A 5IW1B 4HF5L 2V7HB 3QUML 1L6XA 3MLXH 4YHML 3SPVA 4P9MH 5BS0B 4D0DA 3QEHA 2OBGA 4JFDD 1RJZB 3WO4C 4AEHL 1KG0B 5JW3L 4BZ1H 2X4NA 1TITA 3HE7B 5TH2A 3V0VB 2DAVA 4PJFB 5FDWB 4DCQA 4HUXB 2FJHA 4Z7OF 2EXWD 1VEPA 4LSRL 4LVNB 5I1KL 3ARPA 3JUZA 1FVEA 4ONHA 4XZUB 2F58L 1OM3L 4P57A 5L0QC 4N0CD 2ICCA 1CQKA 2R23B 3RVTC 2RCSH 4RFNB 1Z9SA 1HOCB 3CCHB 3DMMA 5IOPA 3CD4A 1EK3A 4U7MA 1RUAL 1FN4B 2FL5A 5LGKA 5JOFB 3PJSA 1X5XA 3G5VB 1RQ5A 1S7WB 4BK5A 4IDLA 1MFEL 3CMOH 2X5PA 4UIKL 1D9KD 2GIYA 2BNQA 3VWKC 3RAJH 3DNKA 1QHPA 1M4KA 4OCWH 1AO7D 3MRMA 2IJ0C 4U1MA 4K3DH 4JY4A 4LVOC 4XMKL 4HX1A 5ITBH 2BNQE 4OZGB 1D6EA 3AMKA 5EG6C 1J1PL 1MEXL 5IW3A 5KZCB 1XIWB 1OAYL 1FVCA 3QBTB 2H8PB 1HSBB 3KJ6H 1QQDB 1DTUA 3FONA 3H42L 5HSFA 4G6FD 3QQ4B 5ACMA 4IOFD 5IW1A 1OW0C 3C6LB 4HAFA 2V7HA 3B4NA 3AM8C 4HKBB 3VFTB 2YN3A 2P43B 3VRJA 2XG4A 2Q87A 2AP2A 5BS0A 1PG7H 3EDJA 1WAAF 1CIUA 1QSFB 1WBYB 1NUGA 1RJZA 5FYLH 4DAGL 3TLRA 3HE7A 1MCQA 3V0VA 1IGML 4WTZA 1A7PL 4PJFA 5D72H 4JM2D 4I4WB 4HUXA 4XCYB 2ID5A 1OTSC 1K2DA 4XZUA 1FHGA 1CL7I 1ES0B 1ORQB 3QQ9C 4PJFE 2AQ1A 4JQVA 5MI0C 3TF7C 2R23A 5KJRL 4HEPG 2V17H 1M7DB 3OKKA 4JFXB 3VGDA 1GSMA 1MREH 3CCHA 4F58L 3LKPB 1IM9B 1FN4A 3MV7D 2CQVA 4MQXD 1FPTL 5JOFA 1V3MA 3G5VA 2F19H 1FO0H 1T6VN 3VFGL 1S7WA 3LPGA 4HK0B 4L8DB 5GIRB 1EXUB 4ZODA 4FZEH 4LQFL 4NCC1 5FUOH 4PRAB 2FIRT 2LE9A 4C54A 5L2KD 4NO5A 5JIHA 4XAKE 4OZGA 1QLFB 5ESQB 1KLFA 2BCKB 3MRNB 1JZ5A 5MEPA 4QWWD 2EICA 2HAZA 1XIWA 4YHZH 4HWUA 1IQWH 1UVQA 4MCZB 4OZGE 2H8PA 1HSBA 2APFA 3S34H 1QQDA 3IDYB 2OTPA 2IFFH 4QHLB 3IVKB 3TBTB 5MEQB 4RQQB 1HCFX 3C6LA 4KDTC 2ICES 4Q97A 2V5TA 3ZT7A 5F7EL 4HKBA 3VFTA 1QO3B 4PJIB 5CD5D 4HIEB 4QHUA 4KMTL 2J4WH 1QSFA 4M4RA 4LLWB 1WICA 5EDXA 4I4WA 2LU4A 1QSFE 7CGTA 4XCYA 4HBCH 3ES6B 3TT3L 4U2YA 1ES0A 1ORQA 5DQ9B 5LWYL 3CZJA 4MJ4A 2EDQA 2DS4A 4FQXC 4JFXA 1M7DA 1F90L 3LKPA 1IM9A 4PV9B 2ATPB 3QWRD 2ICWA 3C5SB 3CLEH 3SKMA 6FABL 5A2JH 3W2DH 5I9QC 1MAMH 4HK0A 5INCB 2OJZL 1EXUA 1IJ9A 3E0GA 3UAJC 4JEGB 5GJSH 5E2WH 4RAHA 4PRAA 5AG9A 2EDEA 2GFBB 4HKJB 5DD5L 3GKZA 4YHNB 1YEHL 3QB7C 3F7PC 1S9VB 3V0WH 3I84A 3BGMB 5TE4L 2BCKA 3MRNA 1LK2B 4YHOL 5IW6B 4OZ4B 1FC2D 1EFXA 3FQRB 3KWWA 2VZOA 1QKZL 3IDXH 1TZGL 4MCZA 4LVHB 1KJ2L 1MJ8L 4QHLA 5L88H 2EE3A 3CLFH 1O7SA 3IVKA 1QFWI 1C5DB 4F7EB 4RQQA 3VG0L 1IKNA 3OAUH 2VL4A 4PRIE 3QDHA 5DJAB 5C0JB 2LVEA 1FH5H 1OQOA 2CJUH 4KQ3L 5D2LF 3VE0B 1QO3A 4MZ3A 1H5BC 5E4EB 1P69B 4LLWA 4TUKL 4NZTL 4GKOA 1KCRH 2XFXB 2AK1L 1PKOA 2LAAA 43C9A 5DJ6A 3MRJB 5K93A 2YD9A 3FN9A 4G8GD 3ZLQC 1HQRB 2EDLA 3EOTL 4P0DA 2QQNL 5DQ9A 3P73A 3B2VL 1HINL 4JKWA 5JXAH 2VWEC 2VAAB 1J8KA 4HDIA 4CVXB 5J13B 4MMXC 3RPKA 2XZQL 2ATPA 5J06A 3G04B 3C5SA 5CEZD 1QLEH 1J1XH 3BMWA 1NLBL 2W9LA 4PG2C 5INCA 4P2RD 4KC3B 3FO9A 1KJMB 4PJXF 4KUCD 2GFBA 4HKJA 1UWEL 2BP3A 1P5UA 1S9VA 1Q9WB 2R1YB 3BGMA 4Z7WE 4PTUB 5C3LD 5IW6A 3KLSA 2HTKD 1PEZA 3PP4H 1GL4B 1KFAH 3FQRA 3O0RL 3H3PH 4TUJB 3OXRB 3H9SB 4J3VA 3RL2B 3WS6C 3O3DA 3FOLA 5BMFH 1YNKH 2ITCB 3ZL4L 2AJYH 3ROLB 2VDML 2F54B 1C5DA 4F7EA 3ILPB 3TWCL 4JDTH 5C0JA 3QFJD 3VE0A 1YUHA 1PLGH 1B3JA 2I9TB 1O7VA 2IPKA 2OSLB 1ZAGA 2D7TL 4N0FA 4L9LC 4UV4H 3LRSB 5IGXH 4XMLL 3DIFB 4KK6D 4MX7A 3SKOA 3IRZA 4G9DB 1KIQB 4QRQA 1HQRA 5T3ZE 5HBBA 3U30B 3DSNA 4JQXC 2EE9A 4KVCH 3ZMRA 4P3DA 4GXVH 2VAAA 2D2OA 4UILH 3QCVL 4CVXA 5B4MC 1U8KB 3TNNB 3RIFF 4M1CC 4L4VB 3G04A 1K8IB 2A0LD 3KPRB 4KROD 2X4PB 3IDIB 3V5HB 2I27N 5DHVH 5I1CL 3ARED 4OD3L 3VXPB 5C07B 2GAZA 3MOQA 4EN3B 1KJMA 3GB7B 2Q8AH 3SY0B 1KT2B 3KPSA 5DLML 5L9DH 3TIEB 1H3UA 4R9HA 5IROA 1TCRA 1IE5A 4KV5E 1AQKL 1Q9WA 2R1YA 5HHXL 2HRPH 3KPSE 1N0XH 4O9HL 4PTUA 4Y5YC 1DQDH 4QNPF 4M62H 2J8UB 4PV8B 4TUJA 3OXRA 3RL2A 5B3JE 3HG1B 1J5OH 1Q8MA 4RFOH 1DVFD 3EYSH 3CDGB 5DGRA 2ITCA 1I9JH 2LVCA 3ROLA 1J7VR 2VIRB 1EDQA 2F54A 3EDFA 3JUYA 1NUNB 1ZA3B 4J4PD 3ILPA 3O8XB 3F7QA 1WC7B 2Q1EA 4O2FB 4MXWL 4MQ7B 5C0GA 3KPNB 1LMKA 5FK9B 4LLDB 1DL7H 2I9TA 7FABL 3SDXE 4PRDA 3LDBB 5DO2D 1ONQB 5EOCJ 1F4AA 2OSLA 3ESUF 2VL5B 5I74C 4ZXBB 3LRSA 5KW9H 4OCNC 1NFIB 4YDKL 3JWOL 1TJIL 4G9DA 3EO1B 4GW5B 2A73A 3S7GA 4N8CH 5C0IB 3DX6B 4RRPG 2IC2A 4KXZI 1WBXA 1CBVH 3Q0HA 4GRLC 4UV7L 4WCYH 1XGYL 5I71C 3U0TA 4MNGB 4D3CL 1P4LB 1KCKA 3BUTA 3TNNA 4ERSH 4L4VA 3TVMC 1K8IA 1A0QL 1SJEB 3CVHH 3T0BA 2X4PA 3IDIA 2YZ8A 1FIEA 5DK2B 5E03A 3VH8G 4OI8A 3HE6B 5C07A 4EN3A 1SY6L 3GB7A 3QUYC 4WI5A 1KN4L 2VISB 3P4LA 3SY0A 3C8DA 3TIEA 5KSVA 2Z92A 1BBJB 4NNPH 2OTUB 2WQRA 2NY7L 5GS1A 5DJZB 1X5ZA 2B1HL 1TZIA 1LDSA 2I26N 4NJAL 3X14B 4H8WL 2JB5L 3NA9H 3CDGA 3MMEB 3EBAA 5JDSB 1U8OB 1CTOA 2VIRA 5HGHB 2E7BA 2CDGB 1ZA3A 1RY7B 25C8L 1HH6B 1WC7A 1X6LA 2ZOKB 1I9RL 4MQ7A 5EU3A 2VABB 4R2GD 3DRQB 1RAMA 3KPNA 2X1WL 5FK9A 2DMBA 1IEHA 3RVUC 1A64A 1NAML 1NC4B 3ZDZE 1KPUB 1ONQA 4E42B 1MH5A 5KANG 4ZXBA 1CXIA 4Q0XL 4AZ8A 2L0DA 1J8HB 4OCSH 1NFIA 4NYLA 1CXHA 1NBYB 3EO1A 3MRGB 4GW5A 1X3DA 3ORJA 1FGNH 1E28A 5GJTH 1R3HB 3Q48A 5AYUH 2DQDH 5C0IA 3DX6A 3RGVC 4P9HL 2XWJA 4Z76A 4MD5B 1JRHL 2WIIA 2IAND 3Q6GL 4MNGA 1RZJL 2GJ6B 2NYYC 5FYLE 1P4LA 4E41D 4K8RL 3MV11 2DM7A 2YUWA 2DDQH 1SJEA 1QFWM 4MNGE 4AEFA 4RX4D 3ZE2F 1YEFH 2ZWLT 3KYOA 3DURA 3TO2B 1I9IH 4NC0B 1W8OA 1CDBA 2ZUSA 2DQEH 2XKNB 4H88L 3LS4L 2VISA 1NAKL 5I8OL 3QHFH 4KWUA 3FT4B 1BBJA 1CDYA 1FO0A 5L8LB 3GBML 4P4KA 1DSFL 5C0AE 2BVPB 2OTUA 4K07A 5A3ID 2GHWB 4GRMA 4JHZA 3UDWC 4OCYH 1D6VL 1HNGA 3C87A 1W72B 2D03H 5JDSA 1U8OA 4GMTL 4QRPD 4P5TB 2CDGA 2EXWC 4PB9L 3T0EB 2XTJE 3MBEB 1F02I 5CEZL 1A9BB 2YPLB 3RHWF 2ZOKA 5KVMC 3GJFH 2WBJB 4O51B 2DICA 2QQKH 2VABA 3DRQA 1KTKE 1B0RB 4N0CC 3D25A 1SM3H 4X83A 2B0SH 1PZUB 3OB0K 3ARGB 4GUPB 3GMQA 3TESA 1KPUA 1C5CH 3VI3E 2A1WH 3C2SA 3THMH 3SGKA 3CXDL 3MRGA 3O2VH 4EJ1C 4R4FL 5H8DA 2DIBA 3QHTC 1FGVL 3GSNH 1D9KC 3LKSB 1CWVA 4FFVD 4RBPK 3X17A 1P9MA 1NCNA 2GJ6A 3NOIA 4KRPB 3NPZB 1BFVH 3P9MA 4YXHH 5JHLL 2FHBA 1OAUH 1NBZB 1XF2A 3P30L 2VN7A 4Y16D 3TYGH 3UPCA 2EIBA 1T5XB 2IQAA 4IOFC 1C7SA 2CR6A 3B9AA 4V2BA 3ARBD 3JWNC 2GCYB 1A7RH 4ZUUB 4I3RH 1F97A 2BVPA 2X1PA 4ODBD 4QRTB 3KPOA 4DFHA 5H37H 3DECA 5DR5L 3DRTB 3O6LH 1QR1A 3MV01 1CZ8H 2O5XH 5ABDE 1EHXA 1KELH 3LOWA 4JM2C 4K2UL 4L4TB 5KSAD 3DYPA 4ODTL 3MBEA 4X5XB 3U0PB 2YPLA 3K2MC 4OB5L 2WBJA 5MP6L 4GRWB 1UWGL 3TIDB 4H25B 1OWRM 1KGCD 4JKLA 3ARTA 1B0RA 5HVHC 2LU7A 1S7QA 4GUPA 5E7BA 2YPLE 5TPWL 4ONFH 3L5IA 4XMPH 4XP4L 3UPRB 1ZHLB 3MXWL 2CR3A 1FNAA 5J8OA 5E2TL 3ARZA 3QIBA 2W0FA 4K9EH 3I50H 4R4BB 2OR7A 3TO4D 3T2PA 1UCBH 3R0NA 3LMJL 3ETBF 2XN9D 2VXVL 3UZEA 4YFEA 2KKQA 5T1KB 3TN0C 2DTML 3W81A 3QI9A 1H3PL 4X4YB 4IS6B 5IFAL 5CZVH 1AD9B 1GGYA 3BN9D 5GS3A 3QJHB 4EOWH 3JWOC 1GZPA 4HQQL 2YK1H 1A7NH 4M1DH 5LQBH 1KXVC 1J12A 4DVBA 1IGFL 1YN7B 2Y07L 4HUWA 3MA7B 3VXOB 4EDWH 1T5XA 2FBOJ 1YDPB 3PV7A 2GCYA 4ZUUA 1QFPA 2QQLH 3BO8B 2X89A 2PTTA 2UWEF 4UNUA 1X5FA 5CD5C 1KTRL 3DRTA 3FFDB 3RVWD 3UROR 4HG4J 1G1CA 1JGUH 5EORH 1WFOA 4JKPL 5LG1A 3D2UD 4L4TA 2D7NA 4X5XA 4JZJA 2I5YH 4UT6L 4Y4KA 3TIDA 2G5RA 5IMKB 3QUKB 4L4TE 4M5YH 5C6TH 4GBXC 1DBJH 3BAEH 4W6YB 1HEZB 4LLVB 4NO0D 3K2UL 3JTSB 4H8WC 4UUJB 3NIFF 3SCMD 1E4XH 3MBXH 3P4MA 3GSQB 4MNQB 4F33B 4EUPG 4IJ3B 2I07B 3T2NH 1T03L 3BKCL 1CU4L 4NKIL 4R4BA 2W0PA 1QBAA 4NP4H 4NUGH 3SQOH 4ODWB 2WSKA 1UJTA 3CMGA 1N59B 1II4E 1LO5A 1GOFA 4OZHF 4APQB 4QHMB 3QWOA 4YDIH 4OF5A 3VXSB 4IS6A 4X4YA 3MLUH 1EZVY 1AD9A 1UB6B 3UTTD 5IB1B 4PY7B 3WS3A 3LQAL 5JOEA 2UVEA 2JK5B 2VLJD 2XKSA 4P9HC 4W70A 2F8VA 3VCLB 1UCTA 3MA7A 3MRDA 4M48H 1KIRB 1RZJC 5H94B 4KMLB 3NTCL 4K8RC 1E4KC 4OLUL 2M1KA 4NBZB 1JRHI 3QUXC 2DI9A 1TIUA 5FECA 3FFDA 4B0MM 4PG9B 4YNYB 3PV6B 4PP1D 4RISH 3KJ4B 2OK0H 2CDFB 5EOQL 3S98A 4UIMB 1EBPA 5T1LD 5BZWB 2OMBA 4J7RA 5DMGC 1D7FA 5DT1L 5IMKA 4GMSH 3VA6A 4JDZB 5SWQB 1KCUL 5CBAB 4WFED 3HB3D 3SGJC 5J0BA 4LPVA 1HEZA 2CLZB 4LLVA 4UUJA 4EXKA 4ZTPH 1DQLH 3QYCA 4FQ2L 3GSQA 4F33A 1HK6A 2I07A 3LV3B 2GJZB 1VGEH 4HWEL 4WW2B 5DJYB 4NQTA 3G6AB 1OAKH 4ZUWB 3VD4A 3IFNH 2KH2B 3FB8B 3NFSH 1OARH 1DBKL 3IAQA 4ODWA 1Q0YH 3BD4A 1XFPA 3I6GB 4TVPH 4JAMB 5J89A 3ULUF 2KUTA 1N59A 2NLJB 5HYEA 4JFFB 4APQA 3D9AL 3NVQA 2UZIL 4HJJL 4QHMA 4LSVL 3HNSH 5D8JL 3VXSA 1D5XB 3SDDD 1UB6A 2OXHA 4DGVH 3TNMA 3LRGA 5EA0L 1F6AB 5IB1A 4JREC 4PY7A 3T3PF 3NCBB 2JK5A 4HT1L 1IILE 4NJ9H 2R4SL 1MOEA 1KIRA 1QSZA 1F4YH 1TJHH 5H94A 1WEJH 4ZYKB 1D5IL 3MOBH 2VO5A 3DVIA 5IMMB 5J4MA 4HJ0D 4MVBC 4PRHD 4PG9A 4YNYA 2NPLX 3PV6A 3L95B 1RVFH 5K9QI 1VGKA 2CDFA 5CJBA 4Z9KB 3IXTB 5I17B 3WBDA 4UIMA 3L3JB 5D7IB 3QP3A 4KK6C 5BZWA 3T09A 2DQUL 1L9MA 1DBMH 4GAFB 5SWQA 4M61A 1S7SA 5JW4N 5F9OH 1ODAA 1ZVSB 3KYKL 3O11B 1XT5A 2CLZA 3VFRA 3MV8D 1NMCC 3VGFA 3HPJA 3HAEH 3UTQB 3LV3A 4WW2A 3Q3GA 4X6CF 4ZUWA 1CICD 2A0LC 3L3DB 2AI0H 2YA2A 5HJ3B 3VRIB 2R1WB 2ZSWB 5GRJL 1A3LL 5CP3H 3OAYK 2A77L 2AABL 1WV7T 4JFFA 4DKFH 1C08B 5HI4D 4XP6H 2VDOL 4HGMA 1D5XA 3G6JF 3VW3L 2CUMA 2UY6A 2EDDA 1Q9LB 1IGCH 2G60H 5JIKA 3ZDXF 4WVRA 1GYAA 2QR0A 4IRJB 1DVFC 3ELAT 2V9RA 4JO4L 4Y5VC 3U83A 3ZHDA 1CL7H 4YZFF 1JYXA 4JZNB 4YBHA 4J4PC 4PBVC 4ZYKA 2D0GA 4TRPL 5AYQA 4YR6A 2L7UA 5IMMA 1DZBA 4F37K 5E99H 2F74B 4Y4FD 2X70B 5KVEL 1MCIA 4G6ML 5EWIH 1FFPA 4R3SB 4BM7A 2YMXL 1X7QB 3QNYB 5I17A 5T3XD 3PHQB 3L3JA 5D7IA 3V4VL 2UYLB 2YRLA 4HC1L 4J3SA 2EYTA 4HXAH 1YEJH 4Q58C 2L7JA 3N85L 4Q74A 2BNRD 1SYSA 2DLFH 5D7IE 4ZMAT 3FN0H 3OGCB 1KB5L 4P23B 4GT7A 5DD1H 3QULA 1D3CA 4OGXL 1IC7H 3EHBD 3UTQA 2DI8A 1KEGL 1BVLB 4WV1B 1EO7A 1IM3B 1Z5LA 3L3DA 4JPWH 5HJ3A 1OP3H 4Y5XB 2R1WA 1FZKB 3L3HA 5BV7H 3NABL 4M7LL 2GTWB 4R90L 4XVTH 4O58H 3MNWB 3RZCD 2CRMA 3UJTH 4OLVH 1EIBA 1C08A 1CDIA 1HYSD 1G9ML 3PXJA 5IHZB 3B9KD 3G6DL 1R3IH 4RMWA 1F2QA 4HPOL 4XCFL 4KJQD 3P4NB 3ISWA 1LO0L 4FABH 5CGYD 2GK0A 4JM4H 3HI1A 5IESH 4OGYH 5JTWA 1EUTA 4OLZH 3JWDL 3QO1B 4WNQB 5E8EB 5IVXA 1ADQA 4JZNA 4JZOA 2FR4B 5SX5K 3LHPH 4I5BA 4L8SB 1NL0L 5IQ9B 2A74B 5IVXE 2F74A 2X70A 4R2GC 5ISZA 5JR1L 4FFWD 3LS5L 3TBYA 1OP5K 3LQAC 3U0WL 3MACL 4D9RE 1RJCA 2HP4A 1CN4A 1BQLH 2YA1A 1FZMB 4R3SA 5HYSG 5ISZE 4OZFB 5DJ8B 3QNYA 4I0PB 2MCPH 4ALAH 3SO5A 3CFKB 5EPMB 4HZLB 5JQHC 3OXSA 2ORBL 2R0WL 3BGAA 2FX9H 2OP4H 1NMAL 5C0FB 5K9JH 3B5TA 3GHBH 3S37H 5A43C 4LF3B 2X1XR 5DUMH 3U7WL 4QRUB 3S88H 1YQVL 5D7KE 4HHAB 1KSRA 4WV1A 1IM3A 4Q2ZB 4KZEL 4M6NH 4Y5XA 4D0BB 1FZKA 1QFWH 2GTWA 3LKRB 1S9KC 2DB8A 1M7IA 1KUMA 3EDDA 1CK0H 2FHFA 2A6KB 4PJHF 2W60A 4OZIB 1H15B 4MAYC 3C08L 1YZZA 2BJMH 5A3IC 2W65A 3P4NA 3GEWB 3DARA 1DR9A 1NEZB 4LOUD 5C08D 1CLOH 1INEH 2J88L 3MJ9A 4CNIB 5DS8B 3A6CH 5F7HA 5AZ2H 4XP1H 5D1XB 2Z91B 1YEGH 3VRLE 1J9CT 4EI5B 2IAMD 4L8SA 4HF5H 3H9HB 4DEPB 5A1AA 5IQ9A 4YHMH 3REVB 3U48A 1CVRA 3WLWD 3ZYOA 3O6ML 5DJ8A 5JW3H 4EI6B 1Q9OA 2OQJB 2VITB 3AXLA 4HZLA 5IFHL 1FIGL 4XBPB 2J12B 4LKXB 3KPPB 4LSRH 5I1KH 4ZPTB 1IEBA 1P7KA 5C0FA 2NQCA 2F53A 4LF3A 3DTXB 2BSTB 4QRUA 4KRNA 5J11B 5HY9A 3ZHKA 2ZNXA 3CUPB 4BZ2L 2F53E 4HHAA 4YXLL 2Z8RA 2VXSL 3GM0A 3V5KB 5DQDL 4NHCL 5DYOA 2OR9L 4LARH 2CLRA 4Q2ZA 1KPVB 4I3GA 4D0BA 4CN1A 3QDJD 4W6WB 3IJYB 1RSFA 1E27B 1MFEH 5HYJB 3VXRE 4UIKH 1U6AH 2E7MA 1J87A 1PFCA 2MMXA 3QCUL 1BD2D 4Y16C 2A6KA 3E2HB 1H15A 3D69B 4XMKH 3SDAD 1DFBL 1MWAL 3WHXB 5I2IB 1H3XA 1J1PH 1MELA 1MEXH 2NY2D 1NEZA 4RDQG 4DW2L 1SHMA 1OAYH 3C60B 4O4YL 4CNIA 2IH1B 5DS8A 5FHAL 5DWUL 2E6JA 1JJUA 3H42H 2NZIA 1F3DJ 1YMHB 1G84A 2Z91A 5KSAC 2AXHA 4RMRA 1PYWB 4QT5B 3TH2T 5GZOC 5I1DB 4K7PL 3AS1A 4AIZB 1C8PA 3REVA 3WO4B 1MRDL 1I85A 3SDCD 1AGCA 2PO6D 2Z0BA 1U93A 4DAGH 1LGVA 2PYEE 5J9PB 4EI6A 4PJ5D 5DGQA 2YN5A 1I7RB 1IGMH 1A7PH 2VITA 2AEIT 3QZWA 5EBWB 2J6EL 1SJXA 4LKXA 3KPPA 2CRIA 5C6PB 4NKMB 2ZP0T 3G5XB 4C55A 2B1AL 1AD0B 1NBVL 2VERN 1Z9LA 5FUCC 5KJRH 1RK1B 4JQIH 1KCLA 4NGHL 2V2TA 4F58H 4KK9D 5C0ND 1FBIH 2XI9A 1FPTH 3OZ9H 1AGBB 5T1DH 1QYGL 3VWKB 5DMJB 3VFGH 5JOPD 3EW3B 4UT9H 4GAJL 4LVOB 2XTLA 4WO4C 4LQFH 4YGVB 5HHOD 3ZSTA 1R0AL 4XWGL 5BVPL 3UX9B 1OSPL 2RFXB 4RNRA 4TTGA 5IBUG 3QDGE 3QFDB 2IWGA 5FCUL 3NFNB 4R8WL 2PXYD 3WHXA 2QV2A 2FNBA 1KACB 2CGRL 2HFFA 3C60A 3GBNL 3RVWC 1MJUL 4TVPE 1B0GB 4K3EL 4PD4J 3GSXA 3WUWA 4JPVL 4KXZH 1PW3A 1G9MC 2OS7A 1ZGLB 2W0LA 4KTDL 1PYWA 1V5JA 4QT5A 5J57B 5I1DA 1Z9MA 4LCCB 5F3BB 3EO9L 4AIZA 2X1OA 3DXAE 5F9WB 5F7EH 3RWDB 3RWEB 2VQUA 3R4DA 4KMTH 3JWDC 1RZ8B 5J9PA 1MI5D 2C1PB 3NAAL 5EBWA 5HDBF 5LCVL 4AYFA 3BZDA 2I25N 3RKDD 4G3YH 3B3IB 4R97B 3TT3H 1UYWL 3G5XA 1AD0A 5HI5C 1KIUA 2XRAL 3IXAA 5LWYH 3D87B 2L4OA 1UADC 1RK1A 3MOAL 1F90H 4MJIA 3F7YA 2I60L 2R2HB 3NGBC 5M7QA 4MJIE 4JB9H 4Z8FL 4LBEB 1PBYA 1AGBA 6FABH 4ZAKD 3VWKA 1F00I 1SQ2N 2VLMD 2OJZH 4ZDHB 3HAEA 4LHQB 5I66B 1HZHL 1OL0A 3W5MA 3MLWL 5DD5H 4P59H 3TPUB 4UQ3A 5EUOB 1YEHH 3QFDA 4XPFL 2OXGA 4Z95L 1I7UA 5CP3A 5TE4H 5EBMB 4JY5L 4OFDA 2DWDB 4YHOH 4L8CA 1VFUA 3QDAA 3QIWB