1YJDL

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIQMNQSPSSLSASLGDTITITCHASQNIYVWLNWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
molecule keywords Fab fragment of 5.11A1 antibody light chain
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL01
4N1HB 1DBJL 1R5WB 2H6PA 5F1NA 1UZ6E 5DJ8B 5I1JL 4ONOA 1JPGA 4YNYA 3RIAF 2AJXH 5LAXA 4MJ2A 2N7BA 5BS0E 3VFGH 2X4QA 3NOIA 2DLEA 3PWNB 5K9QI 2XRAH 2Y06L 4QF1A 4MZ3A 3FB6B 4MMZC 1PYWA 2EDFA 5JTWA 2XKNB 5KSBB 1QVOB 1PY9A 5C0EB 2BJMH 5E6ZA 4IMKA 1FAKT 1X5XA 2BRRH 1YEKL 1MIMH 3STBA 2Y7QA 3SGKC 1S9KC 4NUGL 2RFXA 2NXZB 4PRIB 5J3HD 2ZCKH 3F58H 3AREB 3ARYA 4YEFA 4XXDA 2ICWB 4IDJL 2B4CL 1NCDH 4KV5E 5KSUA 2Q8BH 4JZOB 4DKDC 3F7VB 7FABH 2VUYA 4F58H 1FL6A 5DQJA 1U8QB 1EJOL 1LO3H 4F7MB 2ZUVA 2XZCH 2F5BL 3F5WB 4JPWL 3BPNB 3O6MH 2A9ML 3SO3C 5IT2H 5FGSA 1VACA 4N0UA 3WDIA 5IOPA 3THML 4AY0A 5I18L 1K4CB 4TRPL 4WUKL 1SMOA 2FZ3A 1A7NL 1UCBH 4ELMA 4F7PB 3C2SA 1T1ZB 4ELMF 2HVJA 3LKQB 4OZGA 1UB6B 2JJSC 4AL8H 3VGDA 3P9LA 5F1IB 3GRWL 1JGUL 4KFZC 1REIA 2IQ9L 1JI2A 2D03H 1T1WA 3W9DB 1TVBA 4N8CH 4ODUA 1DE4A 2VIRB 2VLKD 4ZSOB 1U8OA 1I7UA 2GCYA 2YD6A 4QOKE 3BEWB 4PJGF 1YEDA 1T6VN 4U1GC 2EZ0D 1PFCA 4PUBL 5IB5B 4L4JA 3ZO0A 1N6UA 3FN0L 3PXHA 5IIEB 1FFNB 2CUIA 3C08L 2JCCA 3PHSA 4LLWB 2BERA 2NZ9C 4LOUD 1U9KA 1H5BA 1M05A 4PJDB 5BV7B 1CE1H 4QHUA 3SDAD 2NY2C 2DQIH 2CO6B 5CILL 1OT1A 2F58H 5KZCB 3BWUC 4Y4FD 5AUMB 4G9FA 2G2RB 5D7KD 5FGBA 5HYJD 5C70A 1LWRA 2MKLC 4UOW0 4QTHA 3QPXL 3BD5A 2UUDK 1RJLA 1JWSB 3BP4B 4JDTH 3QUZD 5HYEA 2OP4H 5GSRA 1ACYL 4FQIH 1KACB 5I16B 1MVUA 1MHCA 2YA1A 1N5AA 1MJJA 3G04B 5HYJA 5I1GL 4Z7UF 1S7QA 2N56A 1BIHA 3IJYA 3AS0A 4A6YA 2WIMA 1WV7T 4NOBA 4Z95L 1LK3L 4AYFA 3KPOB 3PHQB 5E70A 3EJYD 2FATH 1EHNA 2CIKA 1J86A 4Q9RL 1G7MA 1A6TB 2ADJB 4QHLA 3QEUA 4Z0BL 3V5HB 3GJFA 3B5TA 4GSDH 5HGAA 5J11B 2L0DA 2W65B 3HPLB 4DGYH 2BOCA 1EO8H 1ZLSH 3B9KD 4U6VH 1QBMH 5J9PA 1M7DB 4X5LA 5F9OL 1UJ3A 3MRCA 4XB8A 5JW4Q 3O81A 3ECBB 5TF1L 3A0OA 2XKNA 1AXSA 4L4VE 1MQKH 3HAEB 2CDFB 5FK9B 4TNVF 4UT6H 1H5BB 1M05B 4PJDA 2DD8H 1RIHH 3IFLL 3C09C 5DJ0B 1EXUB 5D5MB 3P11H 4NQDB 4AIXA 4D0CB 3MX0A 3O2DL 3OWEA 4JKWA 4N0YH 2X9YA 3VFPB 4RWYH 5D2LF 4ZXBB 4RGNC 3SBWA 3EOBB 3D1MC 1CYGA 2LAAA 4NSKB 4R4BB 1OHQA 3N1MC 5DJ2A 5H2BA 4ZO9A 4YZFE 3CX2A 2QHLA 3VWKC 4H88L 4K9EC 1RD6A 3ULVC 1FH5H 5DSCB 4HKBA 3BKML 1E4WH 1IAMA 3LHPH 1J1OL 1U8JA 4NN7B 4KJYB 3LEVL 4JB9L 1MI5B 3ELAT 3OXSB 4M62H 3ZE2F 1X3DA 4OZGE 4P2RD 4E5XB 2FEDC 5J1SC 1GH7A 1X9QA 1OB1B 2JJVA 4ELMB 3REWB 2Q20A 2X7LB 5FV1L 1V7ML 4XMPL 1KELH 4R8WL 1UENA 4F57H 2C3GA 1JGVL 1YDPB 2EDDA 3UAJC 5C0RH 1HHKB 3OKKB 4C56D 1G9EA 2X4SB 4HD9A 3QUYA 3V8CA 5EOCJ 1MOEA 5E2WL 3ARBA 3LPGA 3SPVA 3KLHD 3BH9B 4L9LC 1FNEA 1X5IA 4OD3L 1AXTH 5LQBL 1JUFA 4GKNB 5C2BH 5KSUB 2EKSB 1AHWB 5LVEA 5EBMA 1HQ4B 4F15B 1BVLA 1IQWH 4HAFA 3WFEL 1XF3A 1NEZA 1A47A 4LSUH 2R2BB 4CW1A 3MJ9L 1D5BA 2L7UA 4R7NB 1R5WA 2H6PB 3BP7A 3TPUB 4CMMB 1T5WB 1RHHB 1OAKH 5IFHL 1IEAB 1FZKB 4QRSB 3I02A 1JPSL 1S7SB 2APFA 1BGXL 2GJJA 3TN0C 3OBAA 2OR7A 1JTPA 1DEEB 3U0WH 1C16A 1BMGA 4Y4KA 3DI2B 1RIUH 4LFHD 2VTFA 3S97C 1FZOA 3O45B 2MKWA 5FDWA 4X7TB 4LPXA 5TDPA 4JN1L 3H3BC 1HIMH 3HUJB 4DFIA 2DIAA 2DJ4A 3VD7A 4GBXD 5TDPB 4HS8H 1FZMA 3PNWB 5T5FL 3PG2A 5E4EB 3H7BB 5T1MA 4M02A 1K5NA 3T0DA 1KC5L 3KPSE 4FP8L 4HGKC 4M1CD 3I75A 4JO3L 2E27L 5GGVH 1HQRA 2CGRH 1XCQA 5FYKL 5HGHB 4DFHA 4TN9A 4PG9A 4K23H 4GT7A 1CDJA 4UTAL 2FX9H 2D4FA 1J10A 3ARGA 1I9EA 3IXAA 1JWMB 4GQ9H 4PRID 4OGZA 3QP3A 1KIRB 3S5LB 3MRLB 2HT3C 1TDQA 2UV3A 2VLJE 2RAMA 4D0BA 1HK6A 4JFPB 2NY6B 3LEYL 3GO1H 3D2UD 3HZKB 3O4OC 4RNRB 4FFVD 3EO1B 3O3EA 4WV1C 1BFVH 2P8MA 5F6HI 2QEJA 2VLJB 3DVGB 4MNGE 1AXSB 2ADIB 4CRPA 4R97C 4L8CA 5FIEA 4UNTA 5GRZA 4G8IA 1DLFH 2LVEA 5C07E 1YN6A 3NFNA 5AZEH 1OARH 1Q0YH 2GTWB 4XCCH 1EZVY 4FQLL 5BZDB 4FNLH 2PNDA 3QULA 1JGEB 4HWBL 4OM1H 4JHAL 2HJLA 1J9CT 5D2NB 5EOTB 4NP4H 3H2WA 4FABH 4CUCA 1I8MB 3BW9A 5HHOD 4NBZB 4NZDA 1U42A 4WWKC 3DX8A 4UDUB 3D85A 1BQUA 4RMSA 4DK6A 4U05A 3IDYC 2RGSA 3DSFH 1P5UA 5CJXC 4P9HH 1TJHL 5GS0D 3PJSB 5GISL 4EI5B 3DYPA 1LEIB 1WT5C 3TFKC 4Q74A 2HT2D 3PGDB 3VD3A 2AGJL 4OCYH 4Y2DB 4PJIE 4UAOC 4GXVL 2UWEA 3GSNH 1OSZA 5IB4A 3VFNA 2IANE 3IDGA 3MROB 1XGRA 2A83B 2QSVA 5C07A 4GG6F 4IIQC 2RCSL 2X05A 3SY0B 1GZPA 2P42B 4KROC 2RIKA 2RBLA 3PWJB 4DTGH 3G6JF 5CJBA 4Y2OA 3TO4B 1KIPA 3C2AH 1WBXA 1IZJA 2EDEA 2W0FB 2DJSA 4UV7H 2ARJB 3HS0A 5GGVY 3MC0A 1NAML 4NN5B 2C9AA 4GKSA 4KKCC 2Q87A 4F8TA 4PGDB 1UVQA 5IMKB 2R2EB 2QSTA 4KUZL 3HC4H 1FL3B 4V1DB 3STLB 5HHXH 3TA3B 3BKYL 3HE6D 3ARGB 5CGMA 1I7ZA 1L0YA 1X5YA 4CDHA 1G9ML 5C0AE 4XBPB 3ILPB 4K8RD 1EUUA 1D6VH 2F15A 1JN6B 2IG2H 4P2QE 4GW5B 4YXLH 3TZVA 5E8EA 3S88L 1DR9A 4LP4A 3OF6A 4RISL 4Y89A 2C7UB 5F44A 4MA7H 4HZAA 1YEDB 4ZOEA 2W60A 3L9RA 3DNKA 5T3ZH 4EDXA 1QPPA 3V52H 2X7LA 3OZ9L 2PO6D 2ZG2A 2VLRE 4ODUB 1KLFA 1MH5B 1YEFH 3CAFA 4E5XA 4OZIE 1E28B 3IXTB 5FO7A 2AS5M 3BJ91 5HHME 4OFYA 5KAQG 4HZLA 4ZFOL 3VXMD 2R1YA 4OZIF 2ED8A 2VSDA 3OKNB 3RHWK 5F6HJ 1WBZA 1CBVH 1WZ1H 3CFDA 1TZIB 2QR0B 3EOAA 3OV6A 5DMIH 2HTKD 5DYOB 4NM4H 3RIAK 3MCG1 4U1LA 4CU6A 4HC1H 2Y36L 3MLVH 5DD3H 4JO4L 4P5MB 4B50A 4PJ8B 2OTPA 2NY7H 1TETH 2HKFH 4RMTA 3D3VD 5CJ5A 5DURB 1HYSD 1LHZA 3HNSL 4MD0B 4MSWA 5EUOB 4RAVA 5EIVA 1NANH 4G9FB 2V9TA 3VXRE 4KTEH 1DANT 5DJ0A 4HLJA 2ERJB 1GHFH 3QIBD 1A7OL 3FO9A 1VENA 4KY1L 1IM9B 5DQ9B 5KJRL 1JUFB 4HT1L 3R8BB 4ZO7A 2Z8SA 4EN3A 3CZFA 4PLKD 1Z9MA 4FQ1L 3L3IB 4AH2A 4HFWA 3VFVA 3MLRH 3O6FD 2AEPH 1BQHB 4OKDA 1N64L 4PV8B 4Y2DD 4MD4A 5E8NA 4XPAH 4HPOL 1MAMH 4M5YH 5C08D 3MOAL 4WCYH 4DGIL 1MF2H 2P49B 3QZWA 1PKQE 5ALCL 3GI8H 1F4XL 1NANI 2PXYB 3IGAA 1BD2E 1OAQL 1J0JA 2XA8H 4U7SA 4WHDA 3CC5B 2R8SL 4OGXL 1M1SA 1Q9OA 1P4LA 1MCDA 4F33A 3TLRA 4DOHB 1D7FA 2VDQL 1IARB 2O5ZL 3IXTA 4HBQA 2VWEE 2XWJB 3VFRA 4M9PA 3NABL 2FD6H 4ZPTA 2I27N 1CDGA 2NXYB 4PJXB 2B1HH 2FGZA 2Z8WC 3HZMA 5DUBB 3DUUA 4J4PD 5FYLH 3HE6C 4X80L 1KJ2H 3U4EB 5B8CC 4LGSB 5BRZE 1B90A 4NO2B 1SQ2N 3CVHH 4AM0A 3U7WL 4ONFH 5FO8B 4H25A 4WFED 5DD1H 5C3LD 4UQ2A 3JV4B 4MJ4A 4M93B 3UDWA 1CXLA 2FRGP 5FA4B 3FJTA 3X14B 5JOPD 4L9DA 3I6LD 4NNXB 1P7QB 2R29L 5CP3H 1U0QA 4AEFA 1VKXB 1RUQH 1CDIA 5A2JH 3W0WA 4Z5RA 2P5ED 3O11B 4PY8J 2IH1A 3IKKA 2WMPA 3QXDA 3ULSB 2OZ4H 4U4BA 1ND0A 1OAXL 5IBTL 1IILE 1UADC 1JZ6A 5E1AB 4XBPA 2GTZB 4HFWB 2X6MA 3O3DB 4ODTH 3QXVA 1K3ZA 1O7SA 4HS3B 5IVXB 5HHNA 2UY7A 1XGYL 2ZG3A 4QHLB 4HIXH 1MFCH 4IOFC 2ESVE 2K9UA 3V0VB 2HFFB 2CIIB 4YHMH 3HLAB 2BSED 3PDDA 4UBDC 5GZND 2DBLL 4KK5C 2C3WA 3QDJD 4JQIL 2CK0H 4RX4D 4C56E 1SJEB 2ENSA 4PGJA 4I3SH 4K94C 4FG6D 4K7PY 5D7SH 4MAYA 3U7YL 5E9DB 3IKCA 4MAUH 3U0TA 1IGTB 1RZGB 3H3KA 5EWIH 1CGSL 1KCRH 1FNLA 5DVMA 5DMYA 1CG9B 4OD1L 5ILTL 4ORGA 4LOUC 5EBWA 5JIKA 5JQ6H 4FZEH 1R3LA 5J6GA 2GW5A 4HJ0D 4PJAF 4MCZB 4LKXA 3STZA 1OGAB 1IM3B 3ULVD 1RK0B 3O0RH 1NBVH 1NGZA 3EYOB 4KU1A 3RQ3A 4O58H 1CI5A 1UM6L 2KZWA 4P49A 3UTTB 2PKDA 4WHTB 3O3EB 4HW6A 4HUVB 5EZOH 5IMKA 3QFDA 4PRDA 4HIIA 3MFFB 2WP3T 2V17H 3WBDA 3HZVB 3WJLA 3MOBL 4LLWA 1L0XA 4M7KL 2ARJA 4JVWA 5GRVK 5E6IC 1DQJB 1SEQL 4RMVA 1WFTA 4PJ9B 2CMRH 1XGUB 4P4RA 3FOLA 1A5FH 4N0FB 3UZEA 4ZO6A 2AJ3A 3HMXL 4BFGA 1AC0A 4K8RL 2YWZA 3JWDL 3D0LB 2JJTA 3CDGB 2XFXA 1XGTB 2C1OA 3TWCH 4FZ8L 3IXAB 5DHYB 1IC5L 1GGYA 4IS6A 1IL1A 2JF1A 2NY5H 5C0ND 1JWUB 2HN7B 5GS1A 4PYHA 2R23A 1FGNH 4EN3C 3OAUL 3MUGA 3D39A 3IDMA 2EEAA 3IB4A 3LIZL 2DLTA 2AKRB 4XP4L 4TOYH 2UYLA 5ACLA 1HI6B 1U3HB 1NMAL 5IJVA 3D39B 5GHWL 5EZIH 3GJFK 3CGTA 3SJVD 5F9JB 4TPRL 4YFDB 3FTGB 1PG7X 2V9RA 1KTDB 5CGYC 2I60H 3EUUA 4LHQB 4HPYH 2A77L 2H32H 3KS0H 1CLZL 1A2YA 1OGTA 4HUUA 3TT3H 4JY6B 3SGEI 4IEFB 5I8EA 2EYTB 1LP9E 4LCUB 2NW2A 4PGBB 3VD5A 4QHNA 1AKJA 4OFPA 4FMKA 3LN4A 2BY1A 1XGQA 3VRLE 1U3HD 5KOVC 5JHDD 3I9GL 3TBSA 4I4WB 2Q3AA 2GTZA 3NCJH 1CFTB 4M48L 4Q9QH 1LO0L 4ONGH 1RK1B 1XF5A 3IFPB 4B5EA 3IDNB 3OHXB 1V5JA 1WBYA 1MNUH 1AY1L 1XFPA 1YQVL 4JCMA 4MJ6B 4E41E 1MSPA 1T2QH 3QXUA 5IESH 2HLAB 4OLYH 4KI5F 2QQLH 3JTTA 5LWYH 2J2ZA 5MEQA 4MNQB 1UWEL 3C60D 2BNRB 1FIGH 4AT6A 1FE8H 3BFOA 4JGUA 3T1FA 2XXCB 4U6XA 4KI1A 1QNZL 2V5YA 1MFAL 3S37X 1J8HD 4ZFOB 1JGLH 5TQ2H 1R24B 2VL5B 3KPLA 1VPOH 2F5AL 3O6LL 4QTIL 4MXWH 1AGCA 1BX2A 3DURA 4XPTH 4XP6H 1A6WH 1F6AA 3DARA 1BOYA 3GBML 5JHDA 4JFZH 3TYGL 1DQTA 3ZTNH 3RUGB 3QUMB 3O6KH 4RQQA 4MCYA 1NC2B 3MV8B 5T1DH 4HLZH 1AKJD 5MERA 5C0IB 2AK4E 3S35L 5E6YA 1AGEA 3KHQA 4LFHG 4EEEA 2JKXA 1ZA3B 3D18B 4CN1A 4PJFE 3ZKND 2YKLL 3MJGX 3CSYB 1QRNE 2V5TA 2J1KA 3QPQC 4K71C 4FOMA 3KYAA 4BH8B 4OV5B 3S34L 1NFKA 1IKNC 2ZP0T 4JANB 1YNLL 4NSKA 4XC1H 5JA9A 3DRTB 4HEPG 3G5VA 4G7VH 1LGVA 5GGRB 3ZT6A 2F53A 5DJYB 1UKQA 2DQCL 5IFJB 4YHOH 5T33H 1LO2L 4WWKD 1EIBA 1RULH 1VFOA 1BVLB 4YXKL 2EYSA 4YDIL 1XAUA 3QAZC 4X5XA 2AAVA 3KPOA 1G7JB 1IAII 8CGTA 5KVGH 3U83A 4HIEB 3PV6A 5DJAB 4RFOH 3SGDI 1CGTA 1C1EH 4LBEA 2P24A 1QD0A 3QIUD 1Z9LA 4FQPA 2WBWB 1QEWB 4P23B 3C5ZA 4UOW1 4D0DB 1A1NA 3FQWB 1IEHA 1HHKA 4KROD 3WCYA 5DO2C 3P73A 2MPAL 5DRWA 3KPPB 3RY4A 3SDYH 1L0QA 2YOCA 4MDJB 1W8NA 4HG4K 3ULUL 1Q9WA 5KS9A 2I5YH 3H3PL 2WQ8A 2Q1EA 4HWZA 4MNHA 2A73B 5EO1B 1A0QH 5D5MA 4DQOH 4HWNA 3PF2A 1H8NA 1YA5A 3MREA 2JJTC 1V3KA 4PJXF 2Y6SD 1DJSA 4FQ2L 5K59F 4OI9A 4ENEC 3KDMB 5H2BB 5J1TC 3QZWB 4M1CC 5SWZD 4QHMB 4OBSA 2HH0H 1I8LA 3E0GA 3QJHB 2BSTB 5IBUB 4WUUD 4LSSL 3VGAC 5DI8B 2I07B 4ZQKA 4U2YA 5HHVH 5I30L 5ITBL 1N2RB 4U7KA 4M7LH 4H0GA 5TPWH 4OI8A 4L1HA 2FWOA 4UUJB 4M1DH 3UTSA 5D1QD 2R4SL 1I3RB 4LIQE 5DEGA 1P53A 2O5YH 3KR3L 2QQNH 3KG5A 3V95A 3OX8B 1KPUA 2UZIH 2FL5A 3HKFA 4O4YL 5I1KH 4HSQA 3CPLA 3AXLB 3ES6B 4XMLL 3RKDC 4L8SC 4QRPD 3QIWD 2WBJA 1BM3L 2X1XR 4OFKA 4Z78B 3RPIB 1JRHH 4XPFL 2D9QB 1JWSA 4UOJA 3LZFL 3WFBL 1EHLH 2JE8A 5SWSE 3QIBC 4A6YH 4HIHB 3TVMC 2FO1A 5JOFA 3H9ZA 4RGOL 4WHCA 1K85A 2E7MA 3BGFB 1OT2A 2R0WH 3W0WD 5K9JH 2Z93A 4J3TA 4Q7DA 5E2UH 2BP3A 4EBQH 3TN0A 1PW3A 4U1KB 3QDMA 4X6CF 2HLFD 3M1BA 4GAJH 4PJHE 1JRHI 5B38B 4RDQF 1FLRL 5SX5H 4XCFH 1DBKL 3VGBA 3D3VE 3MACH 5EBLB 2RJMA 1Y18A 3IJSA 1NMCB 5F3HA 3P0VL 3F5WA 5D7IE 4F7CB 4LCIH 4HKXB 5ID1B 1Q9KA 4WFGD 1NGPL 3PABA 1AD9A 3BGMA 1A6ZA 1S9XB 4CAGA 4ZAKC 4YDKL 2LU7A 3N1PC 1IGFH 4YUEL 1U2HA 1FYTD 4LIQL 4JVUA 4GKZA 1ZMYA 5DI8A 3KAAA 5FXCH 2FBJL 3VMNA 3F12A 1TJIH 3ULUC 4ZTPH 1IAKA 3CUPA 4B7LA 3KXFA 1FORL 3GMQA 4HGMA 4P2RE 4FQQB 5SWSB 3JXAA 1DL7L 1SY6H 5C08A 2ZSWB 2X44D 1IFHH 1CLYH 3O6FA 3UAJD 5FKPA 1QEWA 4P23A 5TE7L 1CR9H 4UT7L 1YNTB 3RDTD 1S9VA 4KI5C 4HZLB 5CWSA 2D7TH 3V6OE 1S7XB 1A9EB 3LKNA 4KMQA 4OF7A 4UDTA 4K3EH 1L9NA 1N7ML 4UIMA 2XG4A 3D3VA 2I25N 3VW3H 4B7IA 2PW1A 1ZLUK 4JFOB 4XNQB 4OIIL 1XF5B 3IFPA 4MZ2A 1AJ7H 2OSLA 5SV3A 4G42B 4I8DA 1P7HL 1IEAA 2X9XA 2QQKH 1K8DB 1F3DJ 1I7ZB 3CFCH 3V5DA 1AD0A 4MQSB 5E9DE 4WHYG 4EJ1C 5C09D 3T1WA 2FYYA 4EUPB 2NX5D 25C8L 1IQDA 1ITCA 3RBGA 5AYUH 4LSQL 2UUDH 5I66A 1P4BL 1BECA 3WHE1 5IW1B 4Z8FL 3VRIA 4WI5A 3I50L 32C2A 2ZKHL 5DWUL 3OJDB 4U6TA 1IAIL 1RURL 5DJ8A 4HJGB 2PYFB 3EJJX 4ODVH 4GMTL 1OF2B 1F90H 2PO6A 1DN2A 3C8KB 5DJXA 5I1AB 3U36A 1AFVH 5L8JB 3U9PH 3O9WB 4J6RL 5F9JA 5C8JB 4CMHC 1YY9C 3QO0B 4CU7A 2FLRT 4ZXBC 4APQB 1UM5H 2VL5A 3KPLB 1JNJA 4HUWB 4YE4L 1RVFH 4KI5D 3EYSL 1AGEB 4GOSA 4ZD3L 2VL4A 1LMKA 5GRYA 5M95B 2AP2A 4OLVL 3TIDA 3MYZA 35C8H 3VXRB 1ZT1B 1D6EB 4Y4FB 3P4NB 4CVXA 1J8HB 4PY7A 5C0GB 4ALAL 4HKBB 3B9VA 2DQJL 1NFIA 4PRHD 3L7FB 2ATPB 2GSIB 3RZCB 3M45A 1MCBA 4QRSA 5L9DL 2XZZA 1TNMA 5HY9B 1EEQA 5J06A 2VXUL 1GPOL 5INCB 4WU7A 2OTUB 5DLML 3MNZA 1GGCH 1HNFA 1DVFD 4R0LC 1M7XA 3DSNA 4U1MB 4Z7WB 5I8OH 3ARDB 1TTGA 1OAUL 2G5BA 1KT2B 1WK0A 3TV3L 3P4LA 4LVNC 1OP9A 3MRLA 1G7LA 3EOTH 4LQ1A 1UWXK 2WAHA 5DT1H 1ZHLB 2ESVB 3ECBA 1MEXL 3STZB 4FQHB 4QT5B 4F2MB 1V05A 2A6KB 3KJ6L 2PETA 1T7ZA 4S1SL 1A6VH 2XQBL 4X4ZA 3QEQA 1GC1H 2XWBB 5FYKU 2UVEA 1QG3A 1WEJL 3FFCA 1S5HA 1JPFA 4WFEE 1S78D 4KDTA 3C9NA 4J8RB 1OAYH 4QRUA 3FAWA 1IM9D 3V6OC 1U3JA 3G6DL 3OB0K 3D2UA 3WSQH 3BAEH 5IEHA 4OLEA 3C6LA 4X9BA 5E08H 4YFLF 4EKXA 2Z8RA 3QULB 1IT9H 2AJ3B 4Y4HB 1MCPL 4MA8L 3U0PB 4P2YA 4I3RH 4TYUA 3TBTB 1L7TH 4GS7C 4OT1H 4Y5VC 1MFEH 2GEEA 1KFAL 4M6NH 3FB5A 1TZHB 1VESA 1MRCH 1XIWD 5FO9B 1RJLB 3BP4A 5GS0H 5I1HH 3UO1L 3LPFA 1GGBH 3V4UL 2DI8A 3MMEA 4NT6B 3QWRA 1U93B 4QRQA 3HZVA 5EULV 2JIXD 1VDGA 4GBXA 5IW1A 2Y5TB 3RWFA 4H8WL 4NPYB 2ORBH 3L6FB 3BGMB 3ULVF 1EBAA 3M07A 4NFBA 4XBGA 3WNNA 1KTLB 2ZUYA 1NCNA 5D1ZB 1ZGLP 5E00B 4Y4KD 1NBQA 2FIRT 5EN2A 3QDGD 3FO0H 4JHWL 1WFOA 5D6CB 4KZDH 3A6CL 2B1AL 2E6QA 4M6MH 1NGYA 2VDOL 1RZJL 2HKHH 5HHQA 2OI9B 1MHEA 3MSPA 1MPAH 3H9YA 1GYAA 3QNZA 3N50A 2XZQH 4JHZA 4NNXA 3JVGA 3UTTA 4BZYA 1RZIB 5HDQL 3S96B 3TIDB 5C09A 3QCVL 1NCCH 5FO8A 4M9OA 1CVSC 4MCZA 3MRBA 3ZHLA 1UYWL 2VLKB 3CLFL 1TTFA 1KJ3L 3L3KA 4XI5D 1UT9A 3C5JA 2AJUH 3NCMA 4IMKC 1P9MC 4ZMAT 5I75B 1KLUB 3P9MA 3T09A 4TVSa 1SM3L 1FG2B 1ZHKB 2AJSH 2QLVB 5C7XL 4OCSL 4K55A 1MCQA 4XCEB 4J7RA 4D0DA 4UIKL 2O61B 5H8DA 1W72B 4K7FB 2PYFA 4HJGA 4GAGH 3GHEL 2JK5A 2H1PL 3ZT5A 1NEZB 3GNMH 5E5UB 3L5IA 3VRIB 4J3UA 4LNRB 4XH2B 1UH4A 3MV9D 5FGBC 1Q9OB 4C4KO 3O2WL 2HFFA 2OL3H 4HBCL 2DQTL 2ICWJ 4ODSL 1RZFH 2FYYB 4NN5C 3LQMA 2AERT 1YMMB 3PQYE 3GSQA 5CAYB 1YQ2A 3WLWC 1A7BA 2Y7QB 4JRYB 3UCRA 3HI5L 5FUCE 3BP6B 1CZ8H 3MJ7A 4U1SA 5C0EA 4QO1A 2AJYL 5GRVL 3GJFB 3RA7H 3V9FA 2XZAH 2OQJB 5EUOF 1JNLL 1KLUA 2BFVH 2ZOKB 4G3YH 4JRXE 1A3QA 3FO9B 1KN4L 2EIEA 5DR5H 4WI8A 5C0CE 5GPRA 1S7XA 4HX1A 1OOAA 2R56H 3D0VB 3BQUB 4GRMA 4RFNC 1YNTA 3O8XC 3MR9B 5E7BA 3SE9H 4XXCC 2WP3O 3AM8C 3R1GL 4I48A 4YWGL 4NDMB 2FZ3B 3SOBH 1MVUB 1T7WA 4U0QB 4JY5H 3S3JA 3MA9H 2QADC 4JAMB 3SQOL 3FCTA 3O2VL 3OJMB 3UYRH 3B9KA 4ZXBA 1U8IB 4Z76B 2VC2L 4LGPB 4YPGB 4TQEL 2DI7A 4WHYH 3ZE0E 1E0OB 1PBYA 3KPSB 4ZS7L 4JPKL 1X5KA 3QO1A 4JFYB 4YC2C 1QSEB 4ZFFA 2FH8A 2NX5B 1OTUD 3FOMA 3DX7A 4R4FL 1E4KA 3FQRB 5ADOH 2BNRA 3DTXA 4AEHL 1PKQB 4JDZA 1L6ZA 4GXUN 3D6GA 1QSEE 4KWUA 4IJ3B 3MGTA 3LQAC 1BWWA 3AB0B 2RFXB 3NIGF 5I0DA 1TVDA 4YX2L 1A14H 1B0WA 2BVPB 3T0EB 3VWKA 5IIEA 4LCYA 1NBYA 3LDBC 3BE1H 3LEXA 3BXNB 1EDQA 1C12B 2VERN 5BV7L 3IETB 3MJ8A 2VDKL 4Q9CA 1YPZA 1J88A 4G5ZL 4LPYA 1DVFB 1INEL 5DTFB 3QCUL 1MRFL 1IC7H 3NH7L 3L3JB 2MWCA 1X6LA 5KSAB 2VLJD 4MB4A 5B4MC 4F7PA 1T03L 2VKXA 3E3QC 1HILA 1MHCB 5GZOD 1NLDH 2VH5L 2CR3A 5BMFL 4JR9H 4I18B 1ZS8A 3WHXB 3RP1A 3WD5L 1OSZB 3TNMB 2NXYC 4NQEB 1GRWA 3QI9A 1R5VB 3MUJA 4WY7L 5I76A 3MA7B 2B2XL 4XAKD 1WVZA 2DYPB 4XRCB 1EEYB 1Y6KR 5DZOA 3MRJB 5ESAB 3WUWB 3FMGH 1E4JA 4XI5C 1A4KA 1CFSA 2AJXL 4AT6B 1UG9A 1RFDH 1NUFA 2A6JB 2OJZH 1G7JA 5KZCD 2Y5TA 2HVKA 4NHCL 2XRAL 2Y06H 3KJ4C 1MI5E 3EJZC 6CGTA 3MMEB 3U9UB 3MFGB 3TZVB 4K7PL 2DMCA 3NZ8B 2V2TA 2AJZB 5DJYA 3QJHA 3N85H 2Z31A 1F58L 1KCSH 4S11A 3QIUA 2EC9T 4IMLB 5CP3A 1KTLA 3ZKSD 5EZLA 1GIGL 1QP1A 1VB9A 1LNUA 4LLAA 1OP3H 3NGBC 4R6UA 2B4CH 4P3DA 2QKIB 4LCUA 1WAAF 3WL9B 3GSUA 1ZA3A 1U8MA 3D18A 4F58L 5D71H 4HJ0C 1EJOH 5I74C 1S9WA 3QDHA 3QZWG 4RMUA 3LD8B 1BFOB 3DMMD 1B4RA 4Z7OF 2Y07H 4KVCL 4KKNA 3VDAA 3FB8A 2G60H 2DB8A 2WIIB 4JM2C 3UPCA 2LAGB 4OF3A 3QG7H 1F4YL 4WUKH 1ROWA 1QLEH 4OKVB 4XGZB 1XT5A 2NXZC 2R23B 1Q94A 4OQTH 3MYJA 3WNPA 5IW6A 1UKTA 3ZL4L 2J8UF 3ISWA 1YJDH 1QO3A 2DLGA 3BP7B 1JZ7A 2ADIA 3D85B 2FJHA 3HNVL 5C3TA 2AQ1A 5JIPA 2D9CA 3QHTC 2X4TB 2J6EH 4YK4C 4TSCH 1ONQB 2X4UA 1XR9B 5KN5B 1CXFA 1XF2A 2HLAA 4DCQA 2FSEA 1O7VA 1IGCH 3B9AA 3RRQA 5FYKD 2HJFB 1JGEA 1PEWA 4AMKL 3U6RB 3LSOB 1IGYB 4NWTL 4PJAB 1A3RH 5ESVB 5T5NG 1OP5H 3FN0H 1K2DA 4CVWA 4XVTL 2ZPKH 3CH1B 4MQXD 1CU4H 1KCVH 1FL5B 3HE7D 5CSBA 5C0NC 4OLWH 3QUYB 4LVHB 3QEHA 4KTDL 2VDNL 3GJFH 3LN4B 4ONHB 5EU6B 3WIFA 2CH8A 4HULB 3QEQE 2XG5A 1K4DA 3X12A 4TSBH 5ACZA 5DD0H 1EMTL 1J1PL 5T1LA 1RMFH 1WT5A 5CINL 3C5ZC 1SJHA 4WU7B 3RIFK 1A7RH 3T4YB 5C0IA 5D70L 2CDEB 2ZJSL 4GJTB 3RTQB 4DVRH 1OVZA 3VXME 4XPHH 4Y4KB 1A7QH 4KAQH 5EU6D 4P5TC 3RUGF 1TQCC 1JV5A 5HYSB 4M6AA 2R1XA 1G7PA 2IPTH 1OTSD 1MWAH 5GGSB 1WTGT 4PJGA 5IMMA 4PJXE 5TE6H 3OAZK 1GZQA 2PO6B 1JHTA 1FJ1B 5FGCE 3GM0A 5T1LB 4XP9H 1BFSA 1R3JB 5BS0B 1LK3H 2FJGA 1RZKC 3MRQA 5F3BB 2P5WE 3WFCH 4G8GA 4OGAD 1LEKB 3TYFA 3WS3B 2BNRD 4S1QL 3RVUC 1ED3A 4ODHL 4U6YB 4OLZL 5KSAD 4GSDL 4PTUA 4M3KB 2IFFL 5GRWA 4Y4HD 5HHNB 1CFNB 4PJFB 3U46B 3BHBB 1U41A 3ROOB 3MQIA 3NTCH 4JJHA 2FO4B 1AO7D 2IAMA 1OF2A 1PSKL 4Z6AT 2F74B 1MFBH 4YBHA 4MWFA 4UT6L 4P4KA 1RJZB 5C9JA 3NCEB 1DP0A 1OY3B 3PQYD 5TH2B 3G6AA 5D96B 2HFGL 3RVXD 5IMLA 3X3GH 1Z0NA 4BQBA 2G75A 3DVNA 4LHJB 4MVBD 3JWDC 3MRMA 3PWUA 5JLZB 5CJQL 4OM0L 3CDFA 1CE6B 4WJ5A 2UZYB 3HUJE 3QR2A 4LCWE 5C6TH 1LE9A 4XT1C 4ZNEE 1E4XL 2R9HC 1PKOA 4RFEA 4KKBC 3SCMC 3TGXA 3TNMA 2XN9E 3SDCC 1TITA 3N0PB 4FXKA 3DYOA 4Y1AA 1G7MB 2ADJA 2NY1C 1J0HA 1Z0MA 3QXAB 4HDIB 3CVIH 4XP5L 2FGWL 3O4LA 5F1SA 1B2WH 5ISZE 1TVHA 4NZUH 4M8VA 2ZOLA 5KSBF 1ZVYA 1B4JH 1LILA 4ZS6D 1NUGA 4LLYB 5IMOA 3FL7A 1WWBX 3TBWB 3ROLA 5FM5O 2DTMH 1P4LB 43CAB 3BDXA 1KELL 2GJ6A 1OTTD 5IHUH 5C2UB 4F57L 3EFDH 1JGVH 2YRZA 4EDXB 5MENB 1MREH 4K8RC 3QDGB 4LSPH 3UPRB 1NBYB 3CFJB 3NAAL 3AXLA 3NACL 4NRXB 2F19H 2QHRH 1WWWX 1CQYA 4LPTA 4LARH 2DM4A 3JWNC 4F7EA 4Y8DC 4NKOA 1WJ3A 5CUSL 1AP2A 1T80A 3TJEL 3STLA 1FL3A 1A6TA 4V1DA 4PJDE 1AGFB 3B2VL 2Y6SC 1X44A 2AI0L 1BIIA 4WEBH 5JR1L 1U8LB 3G9VA 1X5ZA 3GMPB 4GRLD 5CMAA 4ZG1A 1RK0A 4HMDA 5FDYA 3L7EA 3Q6FB 2OK0L 2G9HA 4XRCA 1BHGA 1S5IL 2JJUA 1UH2A 4UV4L 5FOBA 5LGKA 5DO2D 1BGXH 1JPTL 3QI9B 1I8KA 3CFJA 1U8PB 5MP6H 2BC4A 4OIBA 5JO5B 5E95B 1G7QA 4TVPL 2VAJA 1UZ8A 1Q72L 3EBAA 3B8YA 2P5EA 4NN6B 4ZNCD 2EDQA 3VXUD 5IBUG 1Q0XL 2YSSB 3BSZH 1NL0H 4KK6C 2VDRH 5IMOB 2HFEB 3MRDA 4K94L 5F70A 2VXTH 1UA6L 5T5FH 1QSFE 3GKWL 3K81A 5DJCB 5DHVA 2JIXA 3ZKMD 1Q8MA 5CLTA 2IWGA 4Z78A 1MHEB 4N8VB 4JRYD 5FFLA 5JOPE 1FGVH 3ORJA 3ETBF 4I9WD 1RUMH 5JW4M 3PWLA 4X7EC 3BN3B 3EYFA 4NQED 3V5KA 5FUCC 2IEPA 3TT1H 3MRPB 4LLVA 2IGFH 2CRIA 3TA3A 3PDGA 5DK0A 4YHKH 5EC2A 1F5WA 3RU8H 4JZJB 3ZKXB 4MQ7A 2HT3D 4O9HH 4M1GL 1MCRA 4QHUB 3IU4H 4I9WE 4KZEL 5FECB 3L5XL 1X5HA 2BVTA 1DQML 3H9HB 5JIHA 4OF6A 5D7LB 2JCCB 2J88H 1IVLA 1QSFA 5H94A 3D87B 4G80A 2CKNA 4WFHE 5EORL 5EU3A 4GAFB 1BEYH 2BSTA 4NJ9H 4MNHB 3GI9H 4P2OA 4Y5YC 2O61A 1DLFL 4M61A 2R69H 1LK2A 1T89A 3MRRA 1JNNL 1IGIH 4LCWA 1K4CA 1HQRB 3D5OF 5L0QC 5DJZA 3DURB 3T0EE 1I9RH 4D9QD 3Q3GB 4PS4L 1LE9B 3RX7A 5F1KC 3IDIA 1RZKH 5IVXE 3FQXB 5E8OB 3CNKA 2X4OA 4YBQC 3FHAA 5I17A 4AEEA 3BIKB 3DSFL 3QIBB 1NLBL 1WC7A 5F1NB 4U0RC 2IBGA 4PJGB 3O4LB 4U1HA 1DQDL 3ULUF 2VISA 5JDJA 5HVWA 3VH8G 1AQKH 4BZ1H 1KPRB 4GXVH 2ERJC 3OKOA 4MWFB 2K7QA 4M5ZL 5IFJA 1U6AH 3MXWH 1F45A 1NBZA 3QHZL 1UQSA 4M7ZB 1WITA 1A6UH 5EOQH 5E8DL 5GJSL 4LHUD 4XTRC 1CL7L 1K2DB 2EDOA 2ADFH 2BY0A 3U46A 2QQQA 4XNUL 4FFZH 4JZOA 3L6FA 4HHAB 1MIEH 1RUKL 4XCNA 2R2EA 3GSRA 4S1RH 2D0GA 4EOWL 2N7AA 2NY3C 4U31A 3WIIL 3FQNA 5GS1C 5I71B 4JDVB 3BZDA 2Q6WB 3TP4A 4LCCA 5F21B 2VSCA 4UILH 3ARFC 3RUGA 1FO0L 4QGYA 4RIRB 3D9AH 3LS5L 2E6JA 4N0CD 1W0VA 1T7XA 3DGGB 1NFIB 4OZGF 3P0YH 3NIGE 4YQXL 3T3MF 2FBOJ 4FQJL 4U1GB 5DC9B 2X4QB 2YPLE 3REWA 1ONQA 1R3JA 2ZUQC 4MB5A 4IS6B 1XGPA 3CU1A 3C6LC 3LKSB 4PRAB 2IPUG 1U91B 5I17B 2GY7B 4HV8B 2QSQA 2D2OA 1F3RB 2NY1D 1CBVL 1WZ1L 1IRAY 4BSWB 3CXDH 5BW7A 4LHUA 1S8DB 4LPUA 4HCRH 3O6FB 4P9ML 5C0AB 4TNWF 2R0LH 5LGJA 3QEQB 2YUXA 5BVJA 3UBXA 4L1DA 1RV6X 2NY7L 1MIML 1C5DB 4OCLC 3C87A 4GBXC 3QT2A 4FFWD 2VAAA 1MY7A 2R2BA 3EDKA 3DYMA 4OSUH 4X6CA 4G6AD 4IDJH 3DUSA 1NCDL 4C54A 3SDDB 5LG1A 2V7NB 3GSRB 4PRDB 4HT1H 5EIQA 1LP9F 5FK9A 3MNZB 5JMRA 3EIFA 5DK0B 2AV1A 3UJIH 1JWMA 5GRJL 1CFQA 1FDLL 1ZK9A 5CS7A 4X99B 4XPAL 1EEYA 1TZHA 4I5BB 4P23D 1HXMA 4M5YL 3MOAH 3TCLA 4IRZH 4KMTL 4XVSH 5FCUH 2XTJE 4JPIA 1CICD 2FDBP 1FRGL 3BT2L 2WUCL 4HWUA 1PQZB 3BVNA 4APQC 2W0PA 1MCSA 1ORQB 2DQDL 1IL1B 1G1YA 5KVFL 5GZNC 1LE5A 3MRDB 3UPAA 1QA9B 1UJTA 2A1WH 4NJAL 4OCMC 1F11B 3CMOH 2D3VA 1ORSB 3G6JA 2YD9A 4KJYA 4WTZG 1FNSL 1T0MA 1QFUH 2DWDA 3Q5YA 1CD0A 6FABL 3UBXI 2MQ0A 4NQEA 3ULVE 4PJBA 4DZ8B 1CXKA 4P57A 4WI3A 4GRWB 4MX7B 3QDGE 1PG7H 2DMKA 4X7FC 5CKAA 2GT9A 1W72H 5ECJE 3S37L 3VD4A 1HWHB 3BISA 2BVPA 1S9WB 3EHBC 3CU7A 3U2SA 1KEML 4XXCA 2BY2A 3KYKH 2FX8L 3CFEA 1T3FA 2HT4D 4KK8D 3IU3B 3GMPA 4QEGA 3W0WB 4JFHE 4JFPA 4ZS6C 3ARBC 4NGHL 3GMRA 4GKNA 5EC2B 1H8SA 4TNWK 4XNZB 3P4OB 3LN9A 5HY9A 3DIFA 4X8JB 1KLGA 5SWZB 3WXWH 4BK4A 1EGJA 1CN4A 1AGDA 2GSIA 1MVFA 4Z76A 1R5VA 4Y16C 2GK0A 2VNCA 3FT2B 5I76B 1G6VK 4LLDB 2NTSP 4BFEA 3U30C 5BRZB 4QHMA 3EYQD 3CX5K 2VZUA 1VGEL 4Q2ZB 4JAMA 4LPWA 4PY7B 2Y1VA 1KBGH 2AV7A 5I1DB 1ZTXL 4JQIH 4QRRE 1BZ7B 2DOCA 4YBLC 3UTQB 5JW4N 1HOCB 5AWNL 4Z0XB 2P5EE 3BIAX 4DUVA 2L4OA 2VLMD 4F37K 2VKWA 1RUPH 5E0QA 1TJGH 2W38A 4EQ3A 4S2SB 3S3SA 1RSFA 2MOVA 2BMKA 3DV4B 2I26N 4PJ7F 1JGDB 4MS8D 3W9EA 1NCWL 4BUGA 3A6OA 1DLHB 1ZLSL 4U6VL 4UT9H 4A2LA 2JELH 3O3DA 1AR1C 1FSKB 4I0KA 3GHBH 1E4KC 3T0EA 3EJYC 3ULUE 3QJFA 3ULSA 4Q0XH 1QKZL 3WDHA 5J12B 4NQVA 3RUGE 1KOAA 1MCHA 5DTFA 3VFSA 4LHUG 4RCAA 3SDAB 3HI6H 3U79A 3IFLH 4CVUA 2QADD 4JZJA 5FA4A 1OSPH 3QB7C 3O4LD 3VFOA 4KXZI 4BFIA 3PP4H 4DJMA 5MEND 4ZFGH 4MSWB 5GGTH 2CMRL 2EDBA 1Y18B 1W72A 4K7FA 4ZOBA 4K9EL 4Y16D 4Z7UA 4KRPB 2BVQA 1RIVH 3IYLW 4P59H 2L7JA 3HC3L 2QTEA 3L1OH 4ZUVB 3RWCB 1ZHKA 4I77L 1MJ8H 1A4JB 4GKOA 5HGBB 3WFDL 1DDHB 4QHKJ 3MV7E 1J0YA 3GMOB 4Z5RB 1CDHA 3H0TA 3IF1A 2Q7YA 3H6JA 3HUJF 4NRZA 3BKCH 1CD1B 4NWUH 3JWDH 4J3WA 3GB7A 4M8QA 4N8PA 1QSEA 2P5WD 3ARZA 3B2UC 4WDIA 4FZ8H 5F89B 4AEIH 3DGCR 5D1QC 1I3GH 1T1ZA 4LCCC 4RAUB 4UB0L 1FGNL 3WNKA 4RQQB 5I1DA 2YD5A 4OZFA 1R3IL 4PR5A 1JNHA 2ZSWA 4WWKA 3T77B 5CEYB 4H0IA 4DKEH 3W9EB 2H26A 5JXAL 2Q86A 4U1SB 4ZDHB 1HKLH 4KQ4H 4PJ7B 2A77H 2FL5B 1CLZH 3MRBB 5E00A 5E2VL 5LQBH 3GUTA 1FFPB 3QCTL 4G8GD 1RZIA 3GIVB 1JF1A 1V7NH 1FCGA 5CEZL 2C3HA 4OIAA 5ICZB 1P2CA 1U8KA 3JTSA 4L4VD 3ZMRA 3JZ7A 5C09E 3SHSA 5F7LB 4ZUUB 3CFEB 2F8OA 4QKXB 1UM4H 5KVEL 2I07A 1RZ8A 3NZHH 4S1DC 4F9LC 3I9GH 1M7DA 1L7IH 4JQVA 1OAKL 5J9PB 5K59E 2VQTA 5I15L 3NPSB 4M48H 3VFMB 4ONGL 5EIIB 1DUYA 1T20A 4CU8A 4WFFD 5EO0A 4UTBH 4JZNA 3KYMB 2ITDB 4M43L 3WJJC 1WQVT 3VFTB 3GSOB 4N8VA 3U0WL 3BKJL 4JFDB 1NEZG 1RIUL 1S7UB 4Y19D 1T2QL 1HHHA 4R26L 1X5GA 4NRYB 5IB3A 1UB5A 5KN5A 1XR9A 2M2DA 5IFAH 5D7LD 1UWGH 1EEZA 1CXHA 2DAVA 1IAIM 1J0IA 3B3IB 1Y6MR 3FB5B 3RBSA 2PYED 4DN4H 1KC5H 1JV5B 2F5AH 5DHXB 5HYSA 1MAKA 1X4YA 3NFSL 3SJVE 5GGVL 4P46A 4G6KL 1M71A 1HZHH 3U0PA 1K8IB 3LY6A 1JZ2A 4XZUB 1KJ2A 2VLKA 2CXGA 1P7KB 5DC4B 2CJUH 3Q6FA 1A7PH 1WF5A 1KB9J 2VE6B 1XCTB 3RL1A 5ANME 2DS4A 3BJLA 5E4IA 3JTTB 2F8VA 2DMBA 3WKML 3GO1L 3BD4A 5INDB 1ZT7A 2HJLB 1KB5B 1RJZA 5C9JB 3RWEB 1FN4A 5EA0H 1YNLH 5BZDA 4IJ3C 4JKLA 3QWOA 3VG0L 4PJBE 5BO1H 3SJVA 1EERB 1OARL 1ZKAA 4Z7QE 4G6FB 5ICXA 5GZOC 2FH6A 4FNLL 5B4MD 3IFOB 2J5LB 2ATPA 2P47B 4PBVC 1DFBL 4W68A 3AC0A 5DVKA 1G6RL 4OM1L 3QBTB 3V8OA 3PGFL 5J0BA 5LGJB 5J3HC 1KJVB 5CZKA 5C0GA 1RZ7L 2MQCA 5EB9A 1JE6A 1DBBH 4EI5A 4G8GB 3WS3A 3MBXH 3KPRD 3MODL 4J3SA 4NO0A 1G7HB 3BH8B 4WTZA 3RAJL 2MCPL 1FAIH 3RY6A 3GBNH 1I7TA 2VE6A 2B4CC 5GISH 1A1OA 4I0PA 2NW3B 4PJCB 3SKUD 3PP3K 3KLAB 1JYNA 3E2HC 5EPMA 2C26A 4MX7A 1NCTA 4H5SB 1MJUH 2IPKA 1VGKB 5GSVB 1DEEA 3AY4A 3OQ3B 4P46B 3ALWA 5A2FA 1N0XH 5C8JA 2I5YL 4G8IB 2VRAA 1S7WB 3HFML 3MLWL 4PG2A 3U36B 2J4WH 1ZHLA 2ESVA 2B5IC 1Z9OA 3QDME 4OLXL 3OB0H 4I1NB 1KB9K 2NLJA 1U8MB 3DXAE 5MEPB 1H15B 2OL3A 2ICWA 1LO4H 2X4PA 3MBEC 1ZHNA 4LF3B 3LB6D 3KLHC 4FQ2H 3MJ8B 2W9EH 3REVA 1GCFA 1I1FA 5F9AC 4PRPA 4U33A 2EIDA 5C9KA 3PGCA 5F6IC 3RVWD 2SEBB 4JPIB 3ZSSA 3QI9D 2VZSA 1AD0B 3H9SA 3QA3B 4YHLH 2NY0C 5ADPL 4FTVB 4JFFD 4G42A 4P3CL 1L4IA 1NGWA 5HHVL 5ESVA 3VI4F 4KDTC 1N8ZB 4MA7L 4EDWL 3S35X 4OLUL 2H45A 1UWXH 3OJDA 3OJ2C 2VZOA 5DZLA 3V52L 4R90H 1BBDL 3OZ9H 3FRPG 3HZKA 4LEOA 1YN7B 5L88L 4YO0A 2FECL 4KC3B 1TZGL 4RRPG 1JPGB 4YNYB 5BXFA 5CIPA 4HWBA 4Y88A 4DZBB 5I9QC 1KN2L 1MCOH 3GMLA 2M8XA 4Z7VE 3ALPA 3P30H 5E8OA 2EICA 4ZUWB 3SDXB 4PJ7A 3N1GC 2XY1A 1D9KB 3VH8B 3VI3F 3OKKA 4RGND 1BM3H 4JQVC 2MFNA 5FAAA 1VGKA 4JM2B 4X0KB 3FB8B 5HXMA 4L8BB 3H7BA 2PR4L 4OZFB 3KYNB 3B3IA 2HN7A 4XAWH 3LPWA 1NAKL 3EO9H 2XWTB 3BZEB 3HNSH 5A40E 1JFQL 1WC7B 2WUBL 4BELD 3K74B 5J13C 4ZTOL 4P2QA 5L2KD 4NKMB 1YNKL 4PRPE 2P5WB 4BA8A 3VCLB 2H8PB 3VJ6B 3OGCB 3Q48A 4NCDA 3CC5A 4MQ7B 1EEUA 1WUNT 2CXKA 4JO2H 3Q5TA 3VWJC 4MXQD 4X4ME 4YXHL 3I6GB 1Q1JL 5FF6A 1NCAH 4NZTL 4QY8B 1HDMB 2CPCA 2IALB 4WCYL 3WJLC 4P2OB 3VXPA 4P48A 3P9WB 1YY8B 2VXSH 5KSVB 1D5IL 1FN4B 2P45B 3O9WC 3BD3A 1HSAB 4BM7A 3SCMD 4OI7A 5CBAB 3OKMB 2R8SH 1VHPA 1YEHL 1J5OH 1IGFL 2PYEE 1MHHB 1PZ5B 2CUMA 2DIJA 3DJ9A 4JFQB 2BNQD 1ZXQA 2AK4D 2Z93B 2B20A 2O5ZH 4A6YB 5EUOA 1MI5A 2YSSA 2X4OB 4ZPVB 4GG8B 3UTOA 4WI7A 3QFJB 3Q3GA 4KJWD 4TVPE 1V3MA 2H26B 4QYOA 1R3HA 5HVGB 1KJ2L 4BJLA 4RZCB 2V7HB 3KLAA 1TIUA 4W6XB 5I1IL 1WBZB 1INDL 1VEPA 1DSFH 5DEFB 2R1WB 3WMSA 1XF4B 4ZSOE 2D7TL 3BQUA 4EN3D 5EOCL 5K9KB 2LV4A 3AM8A 4KVNH 1ZV5A 1YECH 1MWAB 3WXVH 2B39A 3VRLF 2PN5A 1QPXA 4PJIB 2CIIA 5HGDA 4Q9BA 3ARDC 3GRWA 4G6AC 2PYEB 4ZUVA 3RWCA 3HE7C 1E27B 4JZNB 5L6YH 5EO0B 3GMQB 1JZ4A 1UACH 2XTJD 3VFPA 2Z31B 2EDYA 5KOMC 4PJ5A 3F7YB 2ARJQ 2NCMA 4J4PC 3VE0A 1Q38A 4EN3B 3E6HB 1U3YA 2GAZA 4ELME 1QLFB 3E8UH 3M1BB 1QOKA 4XBEL 4XWGL 5FA3A 3O8XA 2CK0L 2W59A 1S9XA 1AE6H 2ZKHH 5DWUH 4ERSH 4Y7MA 1IAIH 3DX7B 3BDYH 5IK3A 3X11A 3PE9A 9CGTA 4ZQKB 2UY6A 1QLRB 3MBEA 5F3HB 3UTSE 5HI5D 5ERWA 1TFHA 3NA9H 4IHOB 1Z3GL 4KJPC 4PJ5D 1H3PL 3LH2L 1F4WH 3QDGA 4G8EA 2H32A 4N0RA 4CNIA 5L2KE 3LAFA 4OD1H 4BH7A 1HINL 3RHWF 4LL9A 1RVFL 2DWDB 5DURD 4D9QE 4JFXB 1EHXA 2VWEC 1NDGA 3V79C 3INUL 4U1IA 3I3EA 4QOKD 5DJ6B 3RDTC 4N1CA 5EO1A 1J0KA 3AROA 4NQXB 5J89A 4QRRB 5JOFB 1V3LA 2MHAA 4GAYA 8FABA 4HX1B 4NN7C 3BQUD 5E5MA 1IC4L 1YEEH 4PP2A 3MOBH 5E1HB 3ZE0F 4K3DL 4ENED 4UINH 3UBXG 4BQCA 4Y1AB 1C12A 4Q2ZA 2VDPH 1UXWA 4KKCD 4BSJA 2VXQH 1KTKE 4RFEB 3ZDYE 3VI4E 5I19L 4LU5L 2GHWB 5I73C 1ACZA 2F53B 4IOFD 3AY4C 3KYOB 4L5FL 4N5EC 4QY8A 5C07D 3P77B 3UPRA 3A67L 3QUZC 2IH1B 3MLUL 4EXKA 5IEKB 1MI5D 1YMMA 5CLWA 1HKFA 4QRRD 1IM9A 3LS4L 3ZYZA 2AK4A 4PJCF 1CICC 4JFFE 5T3XE 4EQ2A 3KHOA 1FVDA 4F3FA 1Z5LA 1HHIB 1UEMA 4FXGA 3VI3E 3VE0B 1RJYA 3ZDZE 2F74A 3KPSA 4NKQB 4YDJA 4MHHG 3MV11 4ZUTA 3IDXH 3ZT7A 4S1SH 2R0ZH 5JHDB 3KPPA 3GMMB 5IF0A 1ZSDA 2O5XH 4FA8A 4KDWA 4NM8L 3FQWA 2EZ0C 3OGCA 2CRYA 3TVMD 3C6SA 5B39B 3MV7B 4HPYL 1KGCD 4FQXB 1OAYL 1ORSA 3G6JB 4URTB 3IFNH 3D2UB 3K46A 1TCRB 2DDQH 3S3PA 1W0WB 5I1LB 4X6DE 5IQ9A 5D8JL 3HAEG 3Q2CA 5IM7A 4LSRH 3S5LG 1YMMD 5JMOC 5E08L 3VD9A 3RWGA 2IH3A 3BUYB 4G6ML 5LCVL 1DTUA 4OGYL 1MCPH 1HSBB 5CCKL 1VACB 3N9GL 1KEGL 2Q7NA 4GW5A 2YXFA 1ODAA 3IDNA 3LRHA 1K6QL 4PRHA 5HI3D 1HDMA 2IALA 4Z7VF 5LGHH 3NCJL 4RIRA 2CRZA 4JM2D 4Q9QL 4ZFOA 2P46B 1EGJH 1BJ1H 5ISZA 2ZNXA 1FP5A 1HHGB 5DD5L 3QG6A 5BVPL 1B0RB 2QQLL 3UZVB 4BK5A 5I6XC 3CVHA 1TPXB 3R06A 1EAPA 5TE4H 3O3AB 1FE8L 1MJ7H 3U1SL 4FHBD 1NSNL 4TUKL 3CZJA 4NBYB 5HHMD 1MFAH 2EKJA 3O4OB 3BO8A 1OM3L 3QRGL 4QNPF 3RWJA 1RI8A 3FTGA 3UDWC 3RPKA 1VPOL 3O6LH 1DLHA 3A6CH 4MXWL 4X0KA 2C5DC 5DMJB 4XPTL 1A6WL 3MLYL 5IB4B 4NZJA 1P84K 5EZJB 2XI9A 4JFZL 3HG1D 1A64A 3TYGH 1YEIL 4NZRH 3O6KL 2GY5A 1WFNA 5F8RC 1L9MA 3S35H 3BEVA 3CLEH 5JW5A 1UYWH 5KTEL 1F8TL 4K3GA 1CFVH 1N5YH 1WIOA 1S5HB 4XGZA 3QXWA 2GK2A 3BZ4B 4WTXA 3S34H 2AJVL 4XWOC 3OHXA 4OAWB 3VU2A 3FT2A 2GK0B 2EH8H 5C7XH 4N68A 1HXMB 3QUYD 3L5HA 4G43B 1KIUA 4NIKB 4C56A 4XNMA 3QXTA 1OQXA 4OQ1A 4GAGL 5FUOL 4I3GA 4LKCB 2FR4A 4PGCB 4XP1L 5L8KB 5BXFB 2BX5A 4YDLB 1TQBB 1P84J 2NW2B 5D7IF 1UKSA 5C08E 3RDTA 4ODSH 4EI5D 4Z7WA 3AMKA 1UGNA 5C0CB 4J3XA 4S0TD 2VUOA 4YEEA 4QCIB 5INCA 3OPZL 5SWQB 3P3YA 3T2OA 3RL2A 2CDGA 2ZCHL 1CG9A 3N1FC 1G7IB 2UYLB 4LK4A 1BAFL 4PJBB 4PRPB 4TTDD 3V5HA 1OLZA 3BZ4A 2HJFA 4G3YL 1RZGA 3CMGA 3ULUH 2APTA 4PP2B 2GJZB 4MA3B 1OB1A 2NX5E 2JIXB 3FT3A 5EU6E 2DM7A 1HCFX 4EIGB 4YIQB 5DHYA 4JY6A 3EDJA 1EEZB 4L8DB 3LV3A 1NEUA 4KKBD 1CDCA 1LEGB 2ZUQB 1HEZA 3FT3B 2NY4C 5EBGA 1KENL 3SCMA 1NDGB 3C6SB 5B39A 5HYFA 1JPFB 2HFTA 3MRHA 1OAZH 2GKIA 1T4KA 3PXJA 2HH0L 4P4RB 2DKMA 3GSNA 2ITDA 2DTSA 4TULL 4LSVH 5ICYB 3AMLA 2JTDA 2NR6D 5IB1B 5ERWB 4QTHB 1RJYB 4LSTL 3C60C 4J1UA 3T0AA 5D7LA 5ADOL 3D0LA 1CK0H 1HXYA 2Y4SA 4IRSB 1F13A 5JW3L 1Y0LB 2C4FU 1ZT7B 5K33A 3EDEA 1I7RA 4P2QD 5L2KA 1BREA 3EW3B 3HLAA 3S36L 3WN5A 1G84A 5B8CB 1FZJA 3U48A 5GXBB 2R4RL 3V4VL 4UQ2B 5FM4A 3RZWA 4HK0A 4FQCH 1XIWC 1FVEB 4O4YH 1J1XL 4WTWA 2WBJD 4PB9H 1C5BL 1OD9A 3SE8H 5D5MF 5EBWB 5BVJB 2NTFB 4XMLH 5AZ2H 3SBWC 3BE1L 1OCWL 1I1CA 1EV2E 4XB7A 3BWAA 4LEXL 3HZMB 4X6DF 5DUBA 5E8PA 3T77A 5FHAH 2VDKH 3DECA 2Q76B 3MLXH 3DV6A 4L4VA 1NGXA 1FZMB 3ULUD 1ADQL 3B4NA 2BNRE 4LQFH 1FFQA 4RGOH 5E5MB 5T3XH 8FABB 4XHQA 1E6OL 5JUEL 5IHLB 2V5MA 4G9FD 5E2UL 1FPTL 1A3LL 1R6VA 4JM4L 5C92A 3G6JE 4WUUA 5BMFH 1G0XA 5CZVH 4JFEA 3T0EC 1IBGH 4JKPH 4HWEH 2YN5A 4WY7H 4N0UB 4L8SB 1GSMA 4UQ3A 4Z77B 4RGNE 3H9SD 3MACL 3UJTH 2NZ9D 2F9BT 5F7EL 4Z7UB 1LO5A 3P0VH 1IAKB 3BPCA 3OTTA 5HD8C 5CHNA 2G9HB 1BJ8A 4CW1B 3LQZB 4MXQC 3SEPA 4WDIB 1PG7W 4DGVH 4D9LL 1Q9LA 3VDBA 4NO3B 3MLPA 1SEBB 43C9B 1I1AA 4W81A 3TIEB 1BQLH 1P4IH 3P40A 2GUOA 3EFFB 1MCEA 4PJHF 4WEMB 4LVOB 1OGAE 3X13A 3HPLA 1MFDL 1KXTB 1KXQE 4GG6E 1YEKH 2BNQE 3WIHH 4V2BA 5MENA 4NFCA 5DQ9A 3K1KC 2X5PA 2Q8AH 4O00A 1VKXA 1X5LA 3DRQA 1EVUA 4GRWE 4UT7H 1ULVA 2A0LD 3JV0A 4LAQH 4OJFL 5JORB 3CIQA 5JNYB 3VFSB 1FFPA 2KL6A 1T89C 4JN2A 4AK1A 4Y2DC 2DQGL 5SX4H 4N0UE 5I8KL 3UTQA 1D5ZB 2ITCA 5IGXH 2PW2A 3T0ED 2CKBL 2G60L 4ODBD 3QXAA 3NIDF 2BXYA 5IOPB 3PDOB 3QDJE 4OIIH 4R7DB 4R4BA 1AJ7L 3DV4A 4LLDA 1ZHBA 1C5CH 4NBXB 2YR3A 1A7NH 4YDJB 1UCBL 4Z7WF 4K07A 2EH7H 3CFCL 4PIRF 3O2DA 4XNYL 4YZFF 25C8H 1FVDB 5T3XD 2YZ1A 5SX4I 4MNQD 3J8F7 1P4BH 5J12C 4OZHF 4NPYA 2HWZH 4DAGH 1IGCL 5ALBH 4N8CL 3ZYJA 1H3GA 2AABH 2YPVH 3OKDA 1HSAA 2NY2B 2WSKA 4R96B 3Q1SH 2DLFH 5E8EB 2N1KA 3VGAB 1AFVL 2ZPKL 4O51B 4QXUH 5DEZA 5EBLA 5I1EL 3GSWB 4DEPB 1FFNA 3SKOA 1KULA 3ABZA 3MLSL 3T65A 2HJKB 1CIUA 1J8KA 5F8QC 5LBSL 1IKFH 2W9LA 2UZXB 5FYJD 3VFNB 3TO4D 1A6AA 4PJIA 4YR6A 3RY6C 5D72H 4GKSB 3C60A 4TUOA 1J1PH 4HKZA 4ZD3H 2OL3B 5JHLH 4NKMA 4HGWB 4OCXH 2X4TA 1WLHA 3KXFE 1D5XA 5MERB 2ZJSH 35C8L 4JG1H 3VA6A 5CJXA 3R0NA 5DGRA 1MJJB 2NPLX 1GZPB 3DV6B 4L4VB 1JVKA 3VGHA 1FNHA 4ALAH 4NYLA 3MRIB 2DQJH 4XAKE 3MUY1 4JREC 5F7DA 3BPOB 2P48B 2A38A 2ICEA 2QSCL 1MWAL 3MUGB 3RI5K 1BOGA 4RGMC 5D1ZA 1BFOA 5IK3B 3X11B 5I1JH 1AI1H 3HMWL 1E28A 2YC1A 5FO7B 4WFFE 4ZFZA 1I3RA 5DEGB 3VFGL 2BXZA 4GW4B 5C0CA 5ACZB 1SBSL 4Y5YA 1B6UA 1OQOA 4L3CB 4OLZH 2IFFH 4I0CC 4E9LA 2OBGA 3VXPB 1S7TB 4W4OA 3I2CH 2BJML 1QFWH 3PWJA 2PXYC 1EO8L 1KLGB 3NTCL 1QBML 4POZC 4XNXH 4JLRA 5F9OH 4EI5C 5DUPH 4YHZL 1S7TA 4NUGH 1KYOJ 2CRMA 3WYRA 2Q3ZA 4YBQD 2P7TB 4OV5A 1EJ6A 2YA0A 3WO4C 3IVKB 1MQKL 4QXGL 3EO1A 4PGDA 4XPBL 3EYUH 5D1XD 4WW2B 2X4PB 2I9TA 4HQQL 3RJDA 1QSED 2P5WA 2MTPA 3X3GL 3DXAA 1PD6A 5CJOH 1EA9C 3KPQA 5ELIA 2JLLA 1OLLA 2XZCL 4Z7NE 3O2DH 5DEFA 4JPWH 4R3SA 4W6WB 1UCTA 4NNPH 1E4XH 7CGTA 2ZNWA 1NPUA 4ORGB 3THMH 5I1CH 5I18H 4APQA 3F7PC 2GSGB 4CJ0A 2FGWH 1W0VB 4YHNA 3TCLB 5M7QA 4EVNB 1BQSA 3BOVA 3BKMH 1HILB 1U3HC 3VFWB 3RWJB 1B4JL 3HPJB 3MV7D 3I6KA 3OAYK 4JRXA 3ARUA 2YBRA 1IGJB 1N4XL 2IQ9H 4K2UH 4X7SH 1GAFH 3QEGL 3SKNB 2D03L 2DTML 3E1F1 5D93C 1ZANH 4LRIA 1I8LC 5IMLB 1ORQA 3C09B 1I75A 1MHPL 4H8WH 5EBMB 1V7MH 4XMPH 2D31B 1VCAA 4I2XE 4MDIA 1A9BB 3LKRB 5FKAA 3OB8A 1IKNA 3W39B 3O9WA 4LCYB 4JHWH 5EU5B 1TLKA 2QL1A 3TF7C 2YWYA 3SE3A 3C5SA 2B1AH 2DQEL 2WBKA 3HRPA 5J1AA 4H20H 5KS9E 1G7LB 3WUWG 3U9UA 5KW9L 3FB6A 4JEGB 3ARVA 3H42L 3U6RA 1ED3B 5EU7E 2YPKA 1CE1L 2AI0H 1QBAA 3BPLC 5C2BL 2H8PA 3QPQD 3EGSA 3MV8D 3V6FB 4TSAH 3T8XA 3CDCA 2FR4B 2AEIT 3JV4A 2EO9A 1IM3A 3LRGA 5DRZA 3OAZH 1P7KA 5IKCA 1S9VB 2NQCA 4R4ND 4UV4H 1FZOB 5HI5C 1Q94B 3LKOA 4PJHB 2MQ3A 1NCBH 4C83B 3TH3T 3B9KB 1I1RA 4Y1AE 5F7DB 5DJZB 4NQCA 5HHOE 5ESQB 4D3CL 3UTZA 4UIMB 3P4NA 3IAQA 4PLJD 4U1HB 4V1DE 3I84A 3LCYA 3VGEA 1AO7B 2VB5A 4OUUA 4MXVE 1H9VA 4OQTA 5I1GH 1A1OB 3GHEH 4UNUA 3FQUB 3B83A 4POYA 3BX7C 1QRNB 1U8HA 2E8YA 2VITB 4NO0B 32C2B 3GKWH 2DQFB 2FATL 3F8UB 4HBCH 1AGBA 2DQTH 4U6HA 2VDLH 2LU4A 5AD0A 2R2HB 4KPHL 2NY4D 1FGVL 4JO3H 3ULVL 2VMFA 4K7PX 5D4QA 3NCYS 4ZAKA 5B3JE 3T65B 1RHHA 3GM8A 3L3HB 2HTKC 4FFVC 4R4NC 2F8XC 3G08B 3V7MA 3HN3A 4MS8C 1BP3B 5A1AA 3MZGB 2BOCB 1OP5K 2V2TB 2X89A 2XZAL 3I3DA 4ELKB 3VXUB 1DQLH 4F3FB 2DJUA 5ETUA 2XTLA 1DEDA 3GGWA 4OCRH 4U1KA 2XT1B 3U4AA 3QUMH 4EZMA 4RMQA 3BIKA 4OFIA 1NGZB 3EYOA 5CWSB 5DJ6A 3TA3D 3LQZA 1UJ3B 1YYMH 3MRJA 3WUWA 3GK8L 3QJFB 3W81A 5H35A 3RX5A 5IQ7H 1U8IA 3RWIB 1RJCA 3BESR 3MLZL 1Q0YL 3WFHB 4JGMA 1YEGH 2YUVA 4K3JL 1I9RL 3UYRL 4HWBH 3E3QE 4I0PB 4NP4L 4PJCA 3LEVH 4JB9H 5IQ9B 3U4BL 1QFWI 3QIBA 4AENB 5F71A 3MRFB 3RIFF 4R4FH 1NLBH 1EX0A 3WLBB 3TO4C 5CBEB 1I9IH 1HHIA 1Z5LB 1ZE3C 4IRJB 4KH2A 5CZXD 4F33B 1JL8A 3L5JA 3HB3D 5CEZD 4NRYA 2F54D 3O8XB 1NGXB 1N5AB 4HJJL 3VG9C 1I8IA 3GMOA 4R97B 3MXWL 3LEXB 5IV2A 3QSKB 1NC4A 5E6IA 4PREB 4NQCD 4O5LL 4OCWH 5GJSH 3KWWA 2VLME 5E2WH 1EO7A 4O51A 4PREA 1AXTL 1MCCA 4MJIA 4KRLB 5CP7B 3VXMA 3UYPA 1EXUA 1RUAH 2YPLB 3UC0H 4HIIB 3QDMB 2AW2A 5HGDB 1IQWL 4NHUA 4DW2H 5FM8A 4HF5H 3PL6A 2EECA 1QHOA 2XYCA 3HC0B 2E7BA 3HRZB 3QWQB 4KUZH 4ZFFB 3MRCB 3BKYH 1BOGB 4LDLB 5TFSL 1JIBA 4HK3J 4WI4A 1DN0B 1T03H 1DBML 4RBPK 1D6VL 3RGVC 1M6OA 3L95A 4WI6A 3HE6A 4FQJH 4IM8A 5E2TL 3IS1X 3PHQA 3OKNA 3SKJH 1T0MB 3VFRB 5H35B 4JN1H 2X42A 2NNAB 3VXOA 2W9DH 1P6FA 2EEDA 1T04A 1T5XB 2IMMA 1X5AA 4ZPVA 1HEZB 3UJJL 3IJYB 2VN7A 2VQ1A 3PL6D 4HFUH 3GB7B 1J05A 4M8QB 1G9NC 2BNQB 1TVHB 1WWCA 2P4AB 2P5EB 2EIZA 3FHQA 3ARFB 1OTSC 2R0LL 2LABA 4MJID 5KVDL 5IB2B 3WEXA 3QH3A 3N85L 1J87A 3JWOH 3ILPA 3MNVB 5DK3A 4UTAH 4Y5XC 5EFIA 4FQHA 1MQ8A 1LD9B 5SWQA 5LKNA 3MRMB 3PWUB 5JLZA 4PJIF 4JVPA 5E7FA 4U1JA 3VFOB 2OTWA 1CVRA 3F7VA 15C8H 4NKIH 4KTEL 5A3ID 3ARSA 3DROA 3QDJB 3V0AC 4QRTA 5DQDL 4YGVB 3WS6C 3I3BA 1QYGL 1QLFA 4G8GE 5AEAA 1H0DB 5IHZA 7FABL 1CT8A 2OS7A 5BQ7A 2ZCLL 4ELKA 5D1XA 2OTUA 2EXYC 1YY8A 3VGGA 4YHPB 2KH2B 4LAJH 2PO6C 1N6QL 1DUZB 2F5BH 3JV6B 2ZOLB 3TJHD 2NXYD 1AO7A 3BUTA 1JHLH 3KNBA 4MCYB 3O6ML 4BKLB 3GJEB 3KYNA 1E27A 1QFWM 4JPVH 4IIQB 4LCWD 1XZ0B 1FRGH 4ZO8A 3UBXB 2FHBA 1DZBA 1VFMA 2VZ3A 1F4XH 4Y4HA 4TRPH 4I48B 4P2OD 4H1LB 3KVQA 3QQNA 4FABL 1XR8B 1ZA6A 3VCLA 4GG8A 2FJGB 5MI0B 4N5ED 1S7RA 3SDDC 2VITA 4TTGA 3LMJL 5KS9F 3MRFA 1CQKA 4I13B 3PV6B 4KGLA 5C0CD 4PB0L 5IWLC 5IVZA 4OUUB 2AQ3A 1B3JA 2FJFB 1B6DA 5FM5M 2D7OA 4OCYL 1J7VR 1U36A 2FD6L 2CLRB 1T66D 1BJ1J 3P73B 3V6BR 5ID0A 3IDUA 1G7IA 5EU6A 2J8HA 2IAMB 1W72L 4F2MA 4FTVD 2V2WB 3C2AL 1T1XA 2KQNA 3BHBA 1FVEA 3CSPA 2KUTA 4BFIB 5B3JF 4X6CE 3WNMA 1YY9D 1YMHB 1NAMH 3V6FA 4QHNB 1NAMB 2FX7H 1G9NH 3NMEA 1HQ4A 4KQ3L 4WWID 3X3FH 4P4KB 3HCVB 1CLCA 1RUQL 4CDGC 1A7RL 1SYSB 5F96H 3K8LA 1EZVX 1GZQB 5DRNA 4LRNL 3WXWL 3QPXH 4Q6IB 5IBTH 4YHYB 1U92A 2R1XB 3PWPB 4KAQL 2IG2L 4BUHA 4ODTL 5CD3A 3L7FA 4Z7VA 4U6YA 1ACYH 2Y72A 4HXAH 1T21B 2DYPD 2EO1A 4XX1E 3HHRB 4N9GB 4KKLD 3QUXD 1NMBH 3LKNB 1QACA 1NKRA 4PJ7E 4XP9L 3V4PH 2ID5A 2OMBA 4MNQA 2X4NA 1G7HA 4HUXB 5D7SL 4Z95H 4YO0B 4MNGA 4JFEE 3O45A 5IW6B 4S1QH 3U7YH 5D2NA 5DMIL 3OJVC 1JJUA 1NCWH 1PX3A 1EFQA 1NGYB 5FCSH 4HC1L 2YK1H 5DD3L 3X17A 4JY4A 1KCRL 3DETC 3GHBL 5ILTH 3RTQA 5JQ6L 3BN9D 1XGUA 4D8PA 1SBBA 1PSKH 5K9QG 5LJYH 5BOZG 5DRXA 5JPMB 4L4TE 3DBXB 2AJZA 5EU3B 1IGYA 4JDVA 2Q6WA 4OF8A 3F58L 1NBVL 4WO4D 3RWEA 1PVHA 1WIUA 4RWHA 3GSUB 3HI6L 4DCQB 3H7LA 2A9NH 2EYTA 1M7IA 3QG6B 3WIFB 1FBIL 3S5LA 1NUDA 2E9BA 2ENYA 4HG4J 3IFOA 3K4AA 4Y1AD 1PLGL 2A9MH 5DD6A 3FB7A 2MMXA 4RWYL 3HC3H 1KTRL 2AXFA 2VYRE 4DGIH 3H9SB 4PG2C 4L9LA 2X41A 2XTJB 1ES0B 4YDVA 5DXWA 2XA8L 3QEUB 4I18A 1VFUA 1IGTA 2CUHA 4M7LT 1E4WL 5LXGH 1SVZA 1I1AD 3DX8B 2VQ1B 3GRWH 1EO5A 1A2YB 1SMAA 4L3EB 3WO3B 3R4DA 2YEZB 5EUKA 1HNGA 4PJCE 4X7TA 3FQXA 3MCLH 3O3UN 2NNAA 3VXOB 4GUPB 1XR8A 1ZA6B 5IHUL 1EAJA 1MREL 1WZKA 3OAUH 3MCKA 4L4TB 3V0WL 1M71B 4DKEL 4PGZA 5C08B 2OM5A 3MO1A 1BVZA 3NAAH 3D69A 1BQHG 4J2XA 4MD5A 2CDGB 5GRUH 1JHKH 2F19L 2LVCA 1HKLL 3BQUC 3VFMA 5EZIL 2JB6B 1KCUL 3VWKB 5E2VH 1LP9A 3RVVC 2YRPA 3HR6A 4GKZB 3TJEH 5GIRB 5E2JA 4NQDA 3BZFA 2R29H 3F62A 4WEBL 4YGVA 3SDDA 5HHOB 5B38G 1YPZB 4PFEA 1F00I 2DLHA 5FHBH 3VXTB 1SJVA 2OTWB 1QBBA 4XVJH 4BFBD 1S5IH 4L29B 3EYVB 1CDBA 2OZ4L 5HJ3B 1OAXH 1X5FA 3KGRA 3FRUA 4JDTL 4L3EE 5J4MA 3VWKD 5EC1A 1W2KT 1JPSH 4HIXL 1K8IA 1MFCL 4ETQB 4FQIL 3MGTB 4Y8AA 1MNUL 3ARFA 1JNHB 3QUXC 4BSWA 4WNQB 4UDTB 2GJ6B 2UVFA 5DJCA 2F54E 1J05B 3BPNC 3BYTA 5IFAL 1VFAA 3BSZL 4CBPA 1JTOA 4I3SL 2M26A 4K94H 5B39G 4KI5E 4NKDA 1T04B 3DPBA 3PHOA 2HVJB 5IW3A 4Q9RH 1ETZA 2NY4B 4MDJA 2VZVA 4Z0BH 3OXRA 4OB5L 4FP8H 1QFPA 1NFDB 2EDHA 4Z9KB 1URLA 4PRNB 4RSVA 5EIIA 1UZ6F 1CGVA 4HUNB 3TT1L 4KRPD 5DUMH 4MAYB 5KSAC 1NKOA 4X5WB 3LN5B 3BMWA 5TF1H 1QLRA 4GRMB 1A8JH 4FXGB 4MA1C 4HGWA 2H2SC 3K4DA 5EZOL 1T22B 1KJMA 2JCCE 4PV9B 4KZEH 1C7TA 4C59B 1RIHL 1A6AB 2XN9A 3QIUC 3LEYH 2YKLH 3G5YB 3V6ZA 4C55A 3GIVA 3H8NA 1YMME 3EO0B 1RY7B 1TCMA 3VDCA 4KJWC 4RAVB 1BEYL 2D0HA 4NQVB 2HAZA 3BPCB 2X4SA 5E8NB 1RZ8B 5IJKA 5AZEL 1J12A 4JGJA 2EE6A 3W2DH 3CZFB 4H88H 5F9WC 3O11A 1JI1A 1I9JH 3S36X 2BSRB 2EDWA 5JPNA 1RULL 2XNAA 3FT4B 3LHPL 5JXEC 5AD0B 3CFDB 4S2SA 5I2IB 2Y5EA 4KHTL 1MCJA 1T22A 2MCPH 3MV9A 5F3BA 3V7AG 3O4LE 1MRDH 3GEWB 3S96A 2DKSA 3LKQA 4OZGB 4U3CA 5HI4D 2DQHL 4K71B 4NRZB 2V7HA 4WNQA 3LIZH 1U6AL 4JQXC 4DUWA 3NCFB 4JFEB 5L7XH 2J5LC 1TZIA 3WHE0 1A6UL 4M61B 5EOQL 2V9QA 2WLYA 2DI9A 4WI9A 4EXPX 4OD3H 5BJTB 2WANA 3OSKA 3T1FB 1XF1A 4FFZL 3KPNB 1MIEL 4XBGB 4MVBC 1NMCC 2EC9U 2BSRA 5JPNB 4XXDB 1KJMB 4PV9A 2PXYA 5JIIA 2KPNA 5GIRA 3UZQA 2EYRA 1CDUA 4F7EB 1AGDB 4H1LH 1NGWB 5E99L 1INQB 1WZLA 1T7YA 4DWHA 3L3OB 5T5NF 4EDWH 3TBVA 1QQDA 2X4RA 5F88A 2W0KA 3P0YL 3TBTA 5IVXF 1AY1H 5FV2A 2RB8A 2UWEB 5DVLA 2QR0A 1AKJB 3EOAB 3MRNA 3CSYA 2E9WA 5IESL 2A6IB 3PWNA 2FSEB 3E6FB 3R8QA 4Z7QF 1T1WB 1SEBA 3RZCC 4WGVB 4X6FA 2CK2A 1HIML 4X4YB 5EUKB 1DVFC 2O5YL 1KN2H 2FJHB 3KR3H 1JHTB 1FJ1A 4FMFA 4HS8L 5J56B 3OAYH 2QQNL 1BZ7A 5TQ2L 2JB6A 5DZNA 2Q76A 4X6DA 3PUCA 2YZ8A 5K9OA 1UZ8B 4JM2A 4O2CA 3DX6A 2WBJB 4XP6L 5BV7C 5C0BA 2D4DA 5HYQA 1F02I 5E56A 4KK5D 2APWA 3ZTNL 4JO4H 4R2GB 3RL2B 1BD2D 1LEIA 2X1QA 3WFBH 5J6HA 1TETL 4U6XB 1EHLL 5L8LB 1OWWA 1PAMA 5DVNA 2NW3A 2QV2A 4QCIA 2XY2A 3V7AE 1S78C 1YNKH 1U8LA 2EDTA 4RA0C 5C71A 5GGRY 2GJZA 4MA3A 3SN6N 5TH2A 1GHFL 1AR1D 2QBWA 1PQZA 1A7OH 3KLSA 1BFVL 5DFWH 3TJHC 2ADGA 1N2RA 5KJRH 1JCKA 5HHPB 3UJIL 3FFCD 1YJDC 3VMPA 1KIRA 1JN6A 1Q1JH 4XC1L 4L9LB 4ZXBD 3VWJD 1MCWW 3MRKB 2ZUSA 4C56B 1VSCA 2OR9L 4KMTH 1N64H 2YHGA 4LLUA 5HI4C 5FCUL 4JZJC 4FQLH 1PDKA 4F15C 5ALCH 3GI8L 1NGPH 4LNVA 4HH8A 4YDIH 2ILLA 5GGQH 1OAQH 1YEHH 4PJAE 1AIFA 5J11C 2EDXA 4P2QB 3I6LE 4UDUA 1SYVA 2BCKA 1WAAE 2FBJH 3VXNA 3TA3C 4XNMB 1BF2A 5C0BE 1QFUL 1DCLA 4PY8I 5FB8A 1WFUA 3D69B 3BRFA 1KG0B 3FFCB 1H3VA 3HMXA 2AKRA 2OJEA 3ARTA 2GIYA 5FYLL 4PTTA 3GIZH 4P5TA 3MRIA 2VXVL 1K5NB 1T7VA 5I1IH 1JMXA 4MLIA 1F97A 4WIQA 1JYVA 2HG5B 4UV7L 4LGRB 2G75B 3DVNB 4KVNL 4GMSL 4E0RB 2HP4A 1YECL 3C9NB 3WXVL 1XF3B 2UWEE 3VGFA 4QOKA 3QNYA 3B9DA 2NY1B 4J23A 3SE3C 3RWHB 3ZYIA 1OW0A 5ISZB 1NUNB 4HS3A 5IVXA 1DUYB 1T20B 3SJVB 4I4WA 1INQA 4PD4K 3S88H 4R7NA 2QQKL 3UYOD 4PTUB 4RISH 4MDIB 1XGYH 3DWTA 5KSBE 5TPWL 5JQHC 3MBED 4L3CA 4PJBF 3RWDA 4HUKB 1YUHB 4U1MA 2KQMA 5GJTL 1R5IB 3BDYL 5AWNH 1HCVA 2F54B 3O8XD 4LPVA 3DBXA 2NX5A 1RURH 2UZIL 3BH9A 4GMTH 4H25B 3NA9L 5HHMB 1MCFA 4B53A 5I1KL 4LSDA 4MJIE 3ZKQD 4HH9B 3HE7B 3HG1A 1S3KH 3U9PL 3LH2H 4MAUL 1JK8A 4NM4L 4NNYA 2W1NA 1HI6A 3NCBB 2CQVA 1FFRA 2DQUH 3SGEH 4MXVF 3MLVL 4XPFH 1KPRA 1TNNA 1UM5L 4WWKB 5C6WH 4A6YL 2CDEA 4CADA 2UWEF 3SGDH 4O2EA 5CGTA 1IC4H 4O58L 4L3ED 1YEEL 2LTQB 2I24N 3ZDYF 1C16B 4UINL 4HHAA 4JFDA 1NFDF 3PP4L 2OLDA 4ZFGL 3BXNA 3T4AA 2AEPL 4IIQA 4L5FH 1U2CA 4HPOH 1GGIL 1VERA 5F72S 2BHUA 1C08B 1HH6A 1MF2L 3KXFD 3MLUH 5F7FA 3WFDH 2VXUH 5ACMA 2VZTA 5HGAB 5J8OA 5A43C 3PL6C 2I9LA 1I1AC 3C6LD 3CH8A 3O41B 5EU4A 3BKCL 3HMXH 1J11A 1OPGH 1U58A 1EVTC 3GSVA 2BNQA 2OI9C 5IVZB 2HT2C 4LNRA 1SY6A 3FOMB 4GAYB 1EHAA 2VDQH 4NO3A 1Q9LB 2WLZA 1FNEB 1CFSB 5FUZL 4NFDA 1GGTA 5IROA 2XQYG 1OGAA 3HPJA 4F7CA 1IZKA 1H3WM 3V5KB 2NY5L 3ESVF 5EUOE 2R0ZL 1ZSDB 1SY6L 4X83A 3B43A 5I16A 12E8H 4X80H 3P2TA 2DL9A 3SDCB 3VXQA 3QI9C 3VWJA 3EOBA 5GHWH 5C86A 2CLZA 3CVHL 1II4E 2PTTA 3MR9A 4M4RA 4ONFL 3Q6GH 3WNOA 3QRFM 3FQTA 2OR8A 1H0DA 5IHZB 1A1MA 1DVFA 4P3DB 1CD1A 3QIWC 3ARWA 2XNAB 4G6MH 5LCVH 3RKDD 1BBJA 1FNGA 4PJ8C 1A4JA 5HGBA 3FOLB 1XZ0A 5F93C 3NZHL 3VFTA 3G5ZB 3SDXF 4GO6B 4HKXA 5E24E 3CFKA 4QRPA 5I0ZA 5LGHL 3O3BB 1F42A 1UH3A 3HNTH 5HVHB 5E1AA 4M6NL 1DUZA 1MRCL 2C1PA 1CFBA 1EGJL 3AREC 5C0JB 4QRPB 4J3OC 1LO0H 4XPGL 5FYJL 3UO1H 2OXGA 2W0LA 3SDCD 1YEJL 4H1LG 4YHML 2GQHA 3W0WE 4R26H 3SQBA 2DBLH 5HDOA 3QFDB 4HLZG 3UTSD 4HXBL 1G0YR 5D2LE 1MJ7L 2CDFA 5LWYL 3U1SH 3ZTJG 4ODVL 1FIGL 1UWGL 1AHWC 5ID1A 3P9LB 1MCIA 4XCYA 1ZLWH 3NFSH 5MEOB 2YS4A 4HDIA 3MPCA 2DM2A 5EWIL 1YYLL 5AG9A 5IB2A 4QTIH 5C1MB 3P9MB 1R3HB 3BEWA