1YJDL

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIQMNQSPSSLSASLGDTITITCHASQNIYVWLNWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/signaling protein
molecule keywords Fab fragment of 5.11A1 antibody light chain
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL01
1EAPA 3K4ZA 5F97E 4KKBD 3I6LE 4XI5C 2GJ6A 3IDYC 4WFHD 1RSFA 4OZFG 5E03A 5JXEC 3BN3B 3OKMB 4JHWL 4PJAF 5FDWA 2Y06H 4G80A 3HAEH 4NZRH 4PRAB 3TO2A 4YE4H 3NCYP 4R3SA 2A74A 2NLJA 3HNTL 4TRPH 1N59B 1F00I 1JGEB 5CEZE 3DGGA 1T5WA 5H35A 1P4BH 2YSSA 4J12A 3RPIB 3OQ3B 3O6FA 2CJUL 5HHMB 3WUWB 1NKRA 4JCLA 2VXQL 1G9EA 1V7NH 4QOKB 5DFWH 2VIRB 4GBXC 4JFHE 3KPQA 1TPXB 4NQCA 3W39A 5D9SB 1CXFA 1V7MH 3VXQB 2EKSB 1TZHB 4O4YL 5DHXB 1U3YA 4LGRB 3KYNA 1HOCB 5EBMA 4MD0A 4IRJB 2ICES 3HMXH 4AEFA 3O3DA 5AG9A 1KC5L 5ERWB 4U6YA 4MD4A 3QULB 4R4BA 3F7YB 3BGMB 3PNWB 4BM7A 4W6WB 3WD5L 2P5WD 1KPUA 2W0FB 3ARSA 1YQVH 1CR9L 4P48A 1MCOH 1FO0L 1EHAA 3RGVC 3O11A 1AGCA 2ZCHH 2E9WA 5IKCA 4XRCB 3TBSB 3TT3H 2ADIA 1JNNH 1ZE3C 4NN5B 5JZ7D 2V7NA 4RMSA 1SJEA 4MDJA 1BLNA 4NNPL 3B6SB 5C9JB 1ZHKB 3BESR 4FQIL 1D9KD 2VZ3A 5IB3A 3DO3A 5JNYB 4ZUVB 2Z91B 3QQ9C 2NQCA 2VLMD 3ZDXF 5DJ8B 5E6IC 4WI3A 2XZQL 5FUCE 5IIEA 5H8DA 3UDWC 5IJVB 1H3GA 3CSPA 5KVFL 5C71A 3X13B 4Y8DC 2OTUB 2BMKB 4PJ8D 3STZA 5MENE 3UPRA 1IFHH 2R1WA 4TNWK 5D1ZC 3DVIA 5AZEH 5DRXB 4TPRH 3C09C 1T20B 4YDLB 3BZEB 7FABH 4K3JL 4X4ME 5DMJB 4HK3J 2W9DH 5TE7H 1YPZF 4F3FA 5HHOE 4U6VL 2PNDA 1BBDH 3LPWA 4HMCA 2DQJL 4HWZA 3TCXA 4ZS7L 3SDYH 4PGCA 3PV7A 4WEUD 4P3DA 4AK1A 4PJ7F 4MNQA 2Q20A 1WF5A 1XGQB 1BZ9A 1F4AA 3HRZA 2FEEI 1QPPA 1HIMH 3KPOB 4XC1L 1DQJA 1UH2A 4IRSA 4Y4FA 2BY1A 3RA7L 5MERB 4YGAB 3RAJH 2ESVD 4OZGE 5C86A 2VSCA 3MRQA 4HZAA 3GMNA 4IOIA 4EI5A 4Q0XH 4M5ZH 5CFHA 1OGAE 1DFBH 5FAAA 3WLWD 3CGTA 3FO2A 4HFWB 4ZOEA 4P46C 1IQDA 5E2UL 5GGSB 3L3KB 4Z0BH 5K59F 1FH5L 4P2RE 1OAQH 3VFVA 1FFPA 4UU9B 4L3EE 2X44D 2Z31B 1T1WA 4ZFZB 1OOAA 4F2MA 2Q8AL 1DLHA 2AJVL 2DI7A 1RUMH 1QBLH 1QFWM 1GCFA 1INEL 3HPLA 5HYJD 2CKBA 2JELL 3LEVH 2LTQB 3SGKC 3B9EA 4IOFC 3B9KB 2GUOB 3C60D 4MDIA 3S4SA 2A6DA 3H9HB 3QDGD 4Y5YA 4Z7VF 5KSVA 2I27N 5DGRA 4ZPTB 3ZHLA 4URTB 4Q9QH 3MA7B 3FCTA 3MRPA 1YY9D 4L9DA 4YFLF 2O93L 2P47B 5HI5D 1IL1B 3TEUA 5LVEA 1QRNA 4UUJA 3CVHB 3S36X 3RFZC 1AXTL 4OGYL 5HHPA 3TYFA 2H41A 1A1MB 3SJVA 2PCPB 3IDJA 1RZFH 5IOPB 2V7HA 4Z18A 3GI9H 3SKMA 5GS2D 1T0MB 5BVPL 4P2OB 5FF6B 2DLHA 3NCYS 5DEGB 2AQ2A 1CYGA 2NXYC 1MCPL 1FYTB 2AK4E 3QO0A 2Y07L 4J1UB 4M4PA 4XMPH 1ZLUH 1LP9B 1UB6A 1E6OL 1ORQB 3OAUL 4Y4HA 5FYLL 3O6KH 4L5FL 4GFTB 3O2DA 3ILPA 4LLVB 2OR8A 3KPRB 2ZNXA 2BSSA 4WU5B 3TN0D 3M1BB 4LCCC 4NIKB 3U4BH 4Y2DB 4N5UA 3I75A 5JMOC 5LGJA 4OKDA 1MCHA 4ZTOL 3U2SA 1JPSH 1U42A 4QRQB 5EUKB 3V0VB 4B53A 4K3EH 3CK0L 2MPAL 1HN1A 3WKML 2H32H 3O6LL 1MNUH 5EH1A 1RAMA 5I8OH 3VXSA 2X70B 4LGSB 3PIQB 4QXWA 3QEGH 3LQAC 1P1ZB 1RURL 4P5KA 4O51A 2IH3B 5F1SA 1ZEAL 4LNVA 4GRLB 4R2GB 1N26A 3EOAB 3OKNA 1QSZA 3TNNA 3VWKA 5IFHL 3MACH 2OS7A 4HKBA 2EIEA 1HQRB 4LAQL 3ULVE 1DUYA 2Z93B 2YRPA 4L4VE 3EJYD 2BXYA 4LLMB 5EO1B 4ZFOL 1JWUA 4QHUA 3I9GH 4Y4KD 3U7AA 4ONHA 2P1YA 5IVXA 1P7QB 3ZHDA 5DJ6A 5DMKA 5FOBA 1I1AA 2AAVA 3H3PH 3ZYOA 4RAVA 4NUJA 2WWMD 5E00B 3MV8A 3S96A 3HI6H 2CIKB 3KWWA 1EO7A 2CR6A 2H3NA 3WXWL 4KXZI 4P5TA 3MXVH 4HUVB 3PDOA 4NO2B 2HWZH 4O9HL 3VXOA 1QOKA 4W6XB 4G6KL 1HYSD 1MVUA 2B1AH 5D7SL 1YY8B 1U0QA 5DJXA 3JV0A 1P5UA 4F7EB 4RBPH 1JGUL 4PRNA 1IKFH 5IW6B 3T3PE 1UB5A 2DM7A 3X11A 2JCCA 3JWDC 3BKYL 2SEBA 2DIJA 4HUUA 1IGIH 1KLFA 4X9IA 4LKCB 4K55A 4OFKA 3UJIH 1IQWH 4OLUH 3KGRA 1OAYH 2NY0D 2ADGB 1UWEH 4JKPL 1Q9LA 1A6ZB 1I3VA 1P6AB 5DQJB 1MIEH 2QQKH 4RWYH 3F7PC 2PYEA 1UGNA 1I75A 3L6FA 5BW7A 1YC8A 3PJSB 4PJCA 4HT1H 4YK4B 5F7DB 3E6HA 4QRSB 1TPXC 4R9HA 1DSFL 4R6UA 5C6TH 3L5JA 1B0RB 2Y23A 5ENWA 2UVEA 1ZGLP 3SCMB 4I77H 4HQQL 5F7NC 4E5XA 32C2A 2DBLH 1BFOA 5BZWA 3DXAA 1EFXA 1MFBL 2FJFA 4UI2A 5FV1L 5FKAB 4IRJC 2WANA 4OKVA 2DDQL 2Q76B 1AP2B 4IMLA 1SVZA 2P42B 5KANI 1HH9B 5E2TL 1HCVA 4RAUA 1HHKB 5IK3A 3I50L 4NQVA 3MLUH 1LO5A 3WIFB 4DKEL 1N64H 2G2RA 4DVRL 5K9OB 3ZE0E 1UJ3B 3SKNA 3MA9H 4UB0H 4JN1L 1EFQA 2UZIL 4HKZB 1A7OL 1CQYA 3FO9A 3M17A 4IRZL 2KUTA 5D2NA 2OQJA 4PLNC 3O0RL 1NAML 1G9NH 2I60L 3PQYA 4NN5C 3L95A 5TJWK 3HUJA 2OL3H 3GSRB 4JFEE 1KG0B 1NFDE 3CMOH 1YEHL 5A2JH 1JWMB 2NY3B 1QR1B 5GSRB 1N6UA 2C1OA 4H1LA 4NQSB 2R56H 5T5FH 3RWCA 3CCHB 2OTWA 4E42B 1PJ9A 3BZDA 1WBYB 3TBTB 5HGHB 2DLEA 4MCYA 4PJIB 1IC4L 1ZWIB 3QIBA 4GKNA 2CLRA 2X1PA 3OPZH 1FYHB 3EJZD 1S7SA 3GMMA 5H94A 3VGEA 3W0WE 4OV5B 3MJ7B 4ORZC 4MAYB 4N0RA 1A6AA 3ARUA 4EN3B 5F3BA 4BKLA 3VI3F 4YDLC 5E5MB 5IG7B 2XA8L 3GMPA 1GC1H 1A1OB 2C4XA 1XF2A 1TLKA 1YMMD 3HNVH 4PRIE 5ALBL 5HHXH 4RMVA 1FBIL 5I66A 1I4FB 1AI1H 1BD2A 1NEUA 3RP1A 2JJUA 4JVPA 4KDWA 5FKPB 3OKLB 2BJMH 5F7LB 3W82A 3T3PF 2BFVH 2YPKB 1DANU 3FFCA 2NX5D 4RDQG 3UYPA 1L0YA 4FP8L 3LDBB 1AC6A 1CICB 1VB9A 2EC9U 1KPVB 1HWHB 1JHLH 3RJDA 4JFFD 3D1MC 4JB9L 5K9QG 4RAHA 5C0JA 1J8HB 3WHXA 1NBVH 3T0BA 1U8OA 4TVSa 1E4WL 3SKOB 5KVEH 4U6HA 3HE6B 2DQIL 4X7SH 4D9RD 3EDJA 4F8QA 4TULL 2UWEE 4JRWA 5DD5H 4F37K 1ZGLA 2X4QB 2Z31C 4X98A 1OAUL 3RZCB 4F33A 5EO9B 4XPHH 4QRPE 5B8CA 2DQEL 2A9ML 3FN3A 2XA3A 4Y16D 3U46B 5JMRA 4LSQL 3MLSH 1XMWA 2LTQC 3KVQA 3RWEB 3B9KC 3VMOA 3BPCB 1AO7B 1JGVH 4YBQD 5DRNA 5EBWA 3FT3A 2IADB 3R0NA 4JGJA 2D2OA 2E27H 1I9JH 4M4RA 4KJYB 5DUPL 5F1NA 2CO7B 4JKWA 4RDQF 2B1HL 3K0WA 4MXWL 1FFRA 4PJ5D 3C9NB 2JLLA 1PLGL 4YUEL 5CGYD 1H5BB 1FLRL 3SPVB 4J3TA 2BNQD 1FP5A 4U1KB 1I1YB 5KS9E 1KJMB 1FFOA 1G7PB 3GSNA 2ZUYA 3H9YA 3P9LA 3QFJB 3VFNB 4XNQA 4PV9A 3HFMH 5CUSL 4YQXL 3QDJE 4P2OC 3IGAB 4YZFE 4WY7H 5IFAL 3SO5A 1GAFH 4D94A 4FQ2H 1IT9H 4QRRB 3IFLL 3HZMA 4RISH 1ZLWH 4JFOA 2EIDA 4W4OC 3CFIC 1P53A 4LSVH 3N9GL 5GPRA 4GO6B 5BRZB 1HKFA 1T3FA 4NUGL 1N8ZB 1B4JL 2G5RA 3QCUL 5DD6B 5E7FA 2QQQA 4V2CB 2CGRL 3D9AH 3VI4F 5EU4A 4WW1B 4Z7OF 5IR1B 4Y2DC 3HKFA 1TCRA 3OWEA 4NRZA 1NBYB 1YNKH 3L5WA 4GAJL 3NCEB 4MQXC 3IB4A 1QSFE 3OKEA 5DJAB 2EE2A 4PV8B 4MXVE 4X6CF 1UVQA 1RQ5A 3R1GH 3ARZA 2BY3A 3V5HB 4W68A 4ELMB 1TJHH 4JAMA 1YMHB 5F88A 3KPLA 2L7UA 1ZLSL 3MZTA 3IVKA 1AGFA 4OBSA 4G7VL 4GRLC 2HJFA 4R2GC 4GH7B 1G7IB 4J3UA 4PJEF 2ZP0T 3S37L 4C54A 3UROR 1JMZA 1KFAL 3LN4B 1RZKL 4PJDE 1PGRB 1QSED 5EN2A 3BGFB 3OG6B 4LLYB 4OM0H 4U3CA 4DKDC 1KTDB 5CZVL 1MLBA 3LS5L 4LDLB 4RCAA 1FZMA 3AM8A 4E41A 1TZIB 5DFVC 5IF0A 2VL5B 2YD5A 1LO4H 1AQDB 1EK3A 1HZHH 2YPLA 4YIQA 1L7IL 2NCMA 3MV9E 2LU4A 4YHYB 3QRFM 5FA3A 4LLWA 4XI5D 1WZLA 3B5HA 4K07A 3UTOA 5EZLA 3HG1D 3FB7B 3L3IA 3DVGB 4MHHG 2HMIC 1UWXK 3MLVH 3G6AB 2DQDH 4L4TE 1DTUA 4PLKC 1F3DJ 5I1DA 3BGAA 1S8DB 1MFEL 3OV6A 1XR8B 3LVEA 2O5YL 1DBBL 1VHPA 3V4PL 5FECA 4CMMA 4HX1A 5JLZB 3GMRA 4KQ4L 3WFCL 3MOAH 1JK8B 1KLGB 4LHUA 1KACB 5L0QB 5EB9A 2DJUA 3NIFF 5JHDB 4MLIA 2WIIA 1SYVA 4ERSL 1LGVA 1A6WH 4KJPC 2AXGB 1CU4L 5CJBA 5TDOB 4GBXD 5DK0B 2GTZA 3P0YL 3DBXA 5IB4B 4YZFF 4YHOH 4NQDD 1BFSA 5FO9A 1S7XA 1UM6H 4GAFB 3ZTNH 4YK4C 1XGRB 2UZXB 4N5EC 3UTTB 3S5LB 5HDQH 5DEZA 2W07A 3VWJA 4X7TB 3MV01 4MA3B 5B3NA 3SCMC 5BOPA 3LQMA 2ED8A 1J87A 4YNYA 1LEIA 3L1OH 5D7KD 5HYQA 4GSDH 1DZBA 4PRDB 1E28A 3RY6C 1MIMH 2APXA 4XX1E 4PTUB 2QQLH 4Q7DA 4CNIA 3V7MA 4XT1C 1X5ZA 1B6UA 1NC4D 1U8MA 1WTGT 3VD9A 3RGVD 3WO3B 5E5UB 5DUBA 3CLFL 3TP4A 4Y19E 1EZVY 3VXRE 3EDFA 3ARBD 1UJ3C 4NC1E 3IDNA 1HEZA 3CU1A 3WS3B 4HUXA 1OCWH 4K9EL 1BQHB 4RX4D 2J8UB 4HFUH 5HBBA 3KG5A 3MLYH 5SWSD 4PTTA 3VFUA 3W81A 4XXCA 3SE9H 1T21B 5E6ID 2XN9E 2AV7B 4HD9A 4Q6IA 4X0KA 1MJ8H 2DQTL 3EUUA 2XT1B 4QXUL 2WUBH 2VAAB 1RMFL 1YYLL 4H8WC 4BSJA 4K3HA 1N4XL 4PJIF 1OARH 5IHLB 4PJDF 4LU5L 2XXCB 3C5JA 1ERNA 5D1ZD 2GJ6E 4MLSA 4BJLA 2NY5H 4ODVH 4APQB 5FOJA 2Q3AA 3MRLA 1X5IA 4P3CL 5ID0B 4JLRA 4I48A 1UM5L 3RNQA 4L8CA 1DANT 5GS0D 5AD0A 4MAYC 4Z0XA 3NH7H 2R69H 4EN3C 5T3XL 3H0TA 2AGJL 4HIIA 1MF2H 3B9AA 4P59L 5CINH 4P57A 2EC9T 4YHMH 5I1LA 4YPGA 4DN3L 5MEPB 4WW2A 3UX9B 1J1OH 1KJ2H 5FCUH 4YDJA 1NCAH 1X44A 3DHMA 4MWFB 4OCYH 5DDHA 1AGBA 1U95B 1IZJA 3H9SA 1N5AB 3CFJB 2I9TB 3TZVA 1T04B 1HHHB 1D6EB 1JPTH 3A6CL 2VITB 3VDAA 1X6LA 3LDBC 3U0PB 5JW4M 2VXUL 1CICC 2E7HA 4X6EB 4NQCE 2DQHH 3LMJH 1ZLVK 3VD3A 1RK1B 2HT4C 4UQ3A 3V0AC 1Z9MA 3SOBH 5T5NG 1V3JA 3BZ4B 1UEYA 3QB7C 4MNGE 3B3IB 5T1LA 2BP3A 3W9DB 4PP2A 3HE6C 3PWUB 1HI6A 4Z7UE 2HTLD 3Q0HA 3RZCC 3S7GA 2ICWB 3UTSB 2K1MA 3Q6FB 5F8QC 1U8HA 2X1OA 2CJUH 2XKSA 1YEFL 5F9DC 4Y1AE 1BM3L 4Z78A 3IKKA 4JRYB 2RJMA 4H20L 1SYSA 1FNAA 2CRYA 2FECL 2FWOA 1EIBA 3HR5B 4O4YH 1F3JA 1QNZL 4J23A 3H7BA 3NABL 4S1SL 1H5BC 1T6WA 4QY8B 3QNZB 2F54D 1KC5H 5LBSL 4X9BA 1U8KA 4R97B 2D3VA 3I6GA 1NKOA 1JI1A 3JTTB 5T1KA 1UM4H 2VZUA 5TDPB 1R5VA 1MUJB 4NO3B 4GW4A 2YKLL 5DJDB 3DTXA 3VGBA 4PRPB 5KSAA 4JPKH 2WQRA 2P43B 3C5SA 1REIA 1J12A 2OMNA 3ULSB 1SM3H 4H5SB 2X4UA 2ZOLB 4MZ2A 4MQSB 3E0GA 4EUPA 2Y9RT 3QDAA 3P0VL 3VFWA 2EYTB 2VLRA 5LWYH 4NHUB 3U4EB 4FQIH 4YJZL 2GI7A 3AAZA 1YNTA 2VLKD 2X4SA 3HZVA 3V52H 5ESAB 4HIHB 1NGXB 1BX2A 1S5IH 4I0CC 4U3XA 2XZQH 3V2AR 4GRWB 2R4RL 5KVFH 1QYGL 5ITFB 1RJCA 2Z35B 2DMBA 3QIWB 4KKLC 1JYWA 2E5EA 1OTSD 2KKQA 4DW2L 1YYMH 1AHWB 1BFVH 4O2EB 4M03A 3VFTB 5KJRH 4BZYA 5GRVL 3MRKB 5GGSY 3D3VB 1NBZA 2UYLB 1JF5A 4UDTB 3DUUA 1FGNH 4QTIH 4XNYL 1XGUA 4KJWC 1T89C 3AREA 1IKNC 1HDMB 3EOBA 4U6VH 1Y0LA 4BH8B 2MCPL 5CHNA 2AJ3A 4F7TA 3S34L 1MCCA 4JY6A 1BIHA 3HAEA 1T66C 2HJKA 2JJTA 4OZ4A 3BGFC 3NTCH 4MSWB 1Q9WB 5C0GB 2D4FA 4BZ1L 4FTVD 5E8DL 4HKJA 5HGAA 4M5YL 3G5XA 2QHRH 4ZFFB 1DJSA 3CXDH 1HQ4A 3QXDB 2Z92B 2VABA 3PWPB 3K1DA 4OZFH 4M93B 3LN5A 1VEPA 4YHYC 1B0GB 5KSBE 3S5LG 1ACYL 5E2UH 2CDGA 1QO3B 2AXHA 1U2CA 1FH5H 3MFFA 3I3DA 5ACMA 2I9LB 1I7TB 3MV7A 4PJBB 5C0CD 4Y8AA 1QRNE 3GBML 5E9DD 4M1CC 4ZXBA 2AK1L 2GEEA 3PABB 5K33A 3SGJC 3CC5A 1BWMA 4X6FA 3VRIA 2AJVH 3OKOA 3DX8B 1FSKB 2AJYL 4GMTL 4NNYA 3SDDA 3T1FB 5L7XL 3GSQB 1KGCD 1QVOA 1AIFA 1O0VA 3ZTJG 3HMXA 3F12A 2V2TA 4OFYD 4WI9A 4RBPK 3FQXB 3SO3B 4DWHA 3EYFB 3VRJA 4OF7A 1QA9A 3RTQB 4PJXE 2BZDA 4N68A 4YWGL 2HKFL 1MAKA 1BQHG 5L0QC 5FYJU 3WNNA 4JO2L 5FM5M 1A7NL 4AENA 2VDNL 1F3RB 5AUMA 1N6VA 1D5IL 5DVKA 1AXTH 4OGYH 3V6ZA 4PBWD 3MGTB 1A9EA 2GQHA 5D71L 2DJSA 1W0VB 2IFFL 3BIAX 5EIIA 3HZYA 2ESVE 5CLWA 1OSPL 3D25B 4MD5B 4IRJD 2Y07H 5GHWL 3T0ED 5J4MA 3VXSE 1CLOL 4M43L 3OAUH 1P7HL 3U36B 3ARGD 5FYLH 5I0ZA 1A4JB 3LEXA 5EC1A 1X5AA 2YHGA 4H25A 4YFLI 3VXMD 1MHPH 2R29H 4D0DA 3EDDA 3NFSH 2PXYA 4POUB 1RUAL 3NPSB 3MROB 3SY0B 3D85B 1WITA 2IBZY 5TDNB 4KVNL 1YEKL 3DURB 3F6IA 4AIZA 3KXFD 1WAAE 2NZIA 4ZTOH 2MKWA 2YD9A 5DTFA 2YS4A 5BO1L 3KLHC 1RI8A 3CK0H 4WI5A 1A5FL 5IVXE 5GGTA 3WKMH 4FFWD 3O6LH 4IIQB 3DMMA 5C09A 3QR2A 4XNMB 4WRLA 1KCUL 3AS2A 4AL8L 1BBJB 2AKRA 4JRXA 1W8OA 1G6RB 2CUMA 1EZVX 4YXHH 5T3ZD 3C6LD 5LJYH 2O5XL 3FT4B 5ADOL 4LPCA 4YXKH 3LHPH 4A2LA 5FGSA 4OAWB 4P2RB 3INUH 5IFHH 5C8JA 2G9HB 1NSNL 4P23A 1WISA 3O41B 4LAQH 2CMRL 4MX7B 1JHKL 4FG6C 3UZEA 2BVOB 1KXQE 4HMEA 4HAGA 2FZ3A 4APQC 5EA0H 2A77L 5IFJB 3MRRB 1UYWL 2IANA 2PUQT 3PWNA 4B5EA 3EYVA 3ZZ1A 2NR6C 3QHZH 4L29A 2R4SL 4JN2A 3NIDF 3F5WA 3DSFL 3WXWH 3PV6B 4HGKC 3QH3B 1X5LA 1J0KA 1I7RA 3W9EB 4ZOBA 1A9BB 5I8EB 3MJ8B 4G6KH 4NZJA 5DWUL 1QFPA 3SHSA 1YEIL 3MCKA 3VFRA 1JGUH 1G7QB 1FNGB 4P4KA 4Y5VA 2FSEA 4K8RC 4PJCE 2JF1A 3BKYH 4I0PD 4MB4A 5BQ7B 5T1MA 1CDCA 3QUMB 2XYCA 3FQTB 1HKLH 3WBDA 3QWQB 4DZ8A 2Z31D 4J8RB 3DXAE 3EYSL 1MCJA 4JG1L 4XBGA 5J3HD 1S9YA 2EYSB 2JK5A 2FRGP 2OP4L 4JKPH 3VE0A 3EFFB 3LRSA 5L6YL 3B9KD 1AH1A 4ZSOB 2XWBB 4YGVA 4KRNA 3MRDA 4MNHA 1KCRH 4P99A 3LIZL 2RR3A 3G04A 4G6FB 3LQAH 5ITBH 4JM4H 3RWGB 3MREB 5C7XL 1DSFH 1OQOA 4OD1L 1T2QH 5D2NE 3OGCA 1A2YA 4G8GA 3O9WA 5EZIL 1NJ9A 5DRZA 2AXFB 1LE5A 4UOW1 3B9DA 4KV5F 4HULB 4PP1C 5GZOD 5C0EB 2CPCA 3AS0A 2IAMD 3QUYA 1CDGA 5GRXG 3JV4B 5J06A 5JW4N 2H32A 4LLUA 1XCQB 2DDQH 1ND0B 1YN6B 3IF1A 1T1ZA 4P2QB 4X6DA 4AH2B 5LG1A 2BVEA 3BFOA 3BSZH 5FGCE 5E2TH 4DGYL 4Z7WB 2H8PA 4ISVA 4R97C 4NJAL 1FYTD 4HIEB 4PRHE 4DKEH 3O8XD 4L4VB 5TE6L 3PWLA 4N1CA 4QXGH 1A7OH 3GMLA 4IRZH 4HK0B 1G7JB 2I60H 3KPRD 4GW1B 4X7DC 2BCKA 3TPUA 3P73A 3ZT7A 1AJ7L 5FM4A 1S9VB 4JZNA 1YEHH 4J3OC 3MRCA 4WHYG 3GIVA 2F8VA 4MJIA 2Q1EA 4KUCF 1RJLA 2Z8SA 1PKQA 4DVBB 4GQPH 4L8SB 3SDCA 2E7MA 3DARA 3JWDH 1CGTA 3QIWC 1A6PA 1OAZL 3A6OA 3GHBL 1H3WM 2C7UB 3U9UB 2CDEA 3WFHB 1FG2A 1IC4H 1AHWC 3SDAA 4HEME 1E27A 4G7YL 5E94A 4G9FD 5FB8B 4YX2L 2JCCF 4MJ5B 2C3VA 1H0DB 3MNWA 4M7LH 3ZT6A 2I25N 4ZUSA 1M7IB 2BC4A 3HC3L 2ZJSH 4KMLB 3K2UH 5HI4C 1HWGB 3O2DL 4I3SH 4NQXA 1J7VR 3IYLW 1Y6NR 4K3DL 1WBZB 3NFNA 1FBIH 1NGYB 1KN4L 3F58L 4L8DB 1W8NA 5DZLA 2LQRA 1HCFX 3DOSA 1M7XA 5HHQA 2W65A 2EH8L 4PJCF 1MCLA 5L2KE 2DQFA 3S37X 3FTGB 1W0WA 2FIRT 4PJBF 4M93C 4PS4L 2XNAA 2X05A 1V3LA 3P0GB 3BHBA 2AJXH 2AJZA 5D2LE 5CJ5A 4LDEB 2HMID 4TSCL 2C3GA 4I5BA 5DZOA 3MLXL 5EPMB 1R5WB 2VLJD 5E8PB 2DQIH 1BEYL 3WN5A 2WWKT 4OLWH 5HGDB 1M71A 5L9DL 3HNSL 4UZGA 1FSKC 4DZBB 1ORSB 2A9MH 3IJSA 4KY1L 3JV6B 3KR3L 1YEDB 4P2CG 3BX7C 3SO3C 2APBA 3MRIA 3O3EA 4LPXA 1NDMB 4LHQB 4OQTL 3RTQC 5C08A 4KJPD 4KRPB 5DUPH 5IB2A 1X6NA 3HUJF 2B1HH 2VN4A 4QLRA 1U8LB 4JFEB 4RA0C 4Z76B 4QRUA 4H0GA 1NFDB 3E8UH 3KPPB 1X5XA 2RB8A 4TTDD 1YMME 3MBED 4YUEH 3TVMA 2NY1B 4ODHL 3P4NA 5A1AA 5IUSA 2J4WH 3LSOA 5GSVA 4ZNCD 1MH5B 3QQ3A 5GRUL 3KHQA 4YQXH 1K4CB 1IGTB 5HGGS 2OL3A 4XXDA 4JEGB 5ALCH 5IFAH 1JZ8A 5H2BB 3MRBA 3IFLH 4KH2A 4WI2A 3W5NA 5L8LB 5FHAH 1NCUA 2KH2B 4NFDA 2ZPKL 2EDKA 4HIXL 1KTLB 3W0WB 4MA8H 2LU7A 3N9GH 5TF1L 3QPXH 4M1DL 3M07A 1IAOB 3TBYB 1N0XL 1KIRB 3CH8A 1T1YA 3NPSC 1A6UL 2R1XA 5DURB 3LKSA 2HAZA 1R0AL 4Y5XB 5H37G 4H88H 5IMKA 2G75B 5F6HI 3CFDB 1PZ5B 3BD5A 4IIQC 3DVNB 1ITCA 1TDQA 3MO1A 2GAZA 5LGHH 5C07A 4E41E 3PGDB 2IBZX 4NZTL 4WDIB 1H8OA 5HJ3A 4PJ5E 1ZLSH 3WUZA 2YPLE 4JDZA 3RDTA 3ZO0A 2IPUG 4HPYL 3CPLA 3O2WL 4O00A 1DBAH 1XIWD 4OFVA 4WV1B 3BRFA 5D6DA 1XR9B 3FN0H 3F7RA 4O58L 3S37H 1UJTA 1A4KB 4BSVA 4RZCB 2UWEB 5TGBA 4OIBA 1GPOH 1KFAH 5IB1B 3P4OA 5F9JB 4QRPB 4MAYD 1QBBA 1IM9D 1PBYA 3LKQA 5F7KC 5KZCB 4LASL 1CDUA 2C3WA 5DS8A 1QBAA 1L7IH 3RVWC 1TJGL 5D7LB 1FIGL 4NYLA 1QLEH 1A14L 4M1GL 3VMPA 1JGLH 2I24N 5DVMA 5KS9B 2FO4B 5C0FA 3V95A 3WE6B 2ZG2A 1M7DB 2NY2B 5MI0B 3S9DB 3DGCR 4MAUL 2VO5A 3QDJB 3OF6D 1JV5B 2NYYC 1SEQL 1CXLA 1CVSC 1MFCL 1WSST 2LAGB 4PB0L 5CIPB 5GIRA 2Q87A 2F53D 4FQLL 5EU6A 4FABH 1XF4B 1DBBH 2XICA 3V4PH 1FGVL 2DB8A 3FL7A 2EXWC 4PG2A 4KQ4H 3FFDA 3WFCH 2ED9A 2OR9H 1MWAB 5EU5B 3IU4H 5I1KL 5E6ZA 4XNUL 1DQDL 4XGZB 2A83B 2AXJA 4OD2B 3WV0A 4JE4B 3RI5K 4WJ5A 5EU3A 3UTPD 1CU4H 1AO7D 4LIQH 4IHOA 2WWKO 3AY4C 2P8MA 1EHNA 5A16A 1E4XL 3IXAB 4NZUH 5SX5K 1M05A 1AGDA 3QG7L 5IQ7L 1QSFB 3ZT5A 5HPMB 4ZO9A 3WJLC 3BPLB 1MLCB 2VH5L 3ELAT 5D6CA 3AROA 4TVPD 3VFPA 1QR4A 1U58A 4M61A 4ZO8A 2HTKC 1MFDL 1IAKA 2HLAB 2VC2H 3CDCA 4Z7WF 3OAZH 3QFJD 3UP1A 2I26N 1T83C 1CD9B 3VA2C 5IW1A 1WTLA 5EUOA 4HG4J 2EDDA 4OUOA 1T1XB 1ITBB 1FJ1A 4QRRD 1OVZA 3CLFH 1C08A 2AJSL 3ULVC 3BKJH 3BMWA 4NKDB 5K9KB 4U1LA 2IPKB 3EYQC 3VG9B 4R7DB 1VEMA 4PJFA 3RWIA 2ORBL 2Q86A 3FJTA 3MNVA 4LCWB 3HLAB 4JFPA 4OLYL 4KI5E 3MRFB 4PD4J 5JOPE 4WTZA 4WWKB 2CO6B 1OP9A 3I85A 1CLZL 4HS6B 3NCJH 4NPYA 1TETH 2HKHL 1P4IL 2M2DA 3C87A 1RK0A 4XPTH 3MV9B 2DBJA 2DQTH 5MEOA 4XHJC 5EOQL 2APWA 2FX9L 4FFVD 3VFGH 3NN8B 3GB7B 1KSRA 1RMFH 1OTUC 1N4XH 1K4DB 3GSNL 3H9SE 3NA9H 4L8SC 4LU5H 4WI8A 2OR7A 5C0AE 4NO0D 5DT1L 1IGCL 5DJ2B 5CBEB 1WZMA 2A6KA 5CP7A 4L4TB 3WS6A 5J7CC 3NZ8B 5ANME 1CGVA 2J7LA 1S7UA 4P3CH 1XF1A 4HG4K 1WCBA 3C6SA 3V5DB 2ZUTA 1OM3L 2NY7L 5T3XH 4NM8L 2AGJH 2FECI 3HC0A 6CGTA 4TUOA 3P77B 1DQML 2CSPA 2HRPL 3W2DL 1RZGB 3ZYJA 3UAJC 3OB0H 4OI8A 4XP6L 5DHYB 1A1NB 4HIJA 3I6KB 1NEZA 3QHFL 4PD4K 4XWGL 4ZTPL 4JDTH 1KLUB 1BOYA 3VXTA 4PLOB 1SBBA 2YN5A 5LCVL 4ZO7A 1I8LC 3D2UA 4UIKH 4JM2B 3ES6B 3REVA 4CW1B 4XP5H 2VXUH 2BXZA 3CDGB 2V2WB 4M1CD 5C6WH 1D5MB 1I8MA 4TSAL 3FT2B 5J6HA 1DCLA 2EYRA 4YHLL 3PGCB 5F7HA 1RIVH 1FG9C 1OWRM 1H3TA 3UPCA 4GG8A 4LK4A 2Z0BA 2QADD 1RZ7H 2RHEA 5I1CL 1MCKA 1MHHB 1HSBA 1YEFH 4IJ3B 4L3CA 1I85A 3ZDYF 4HJ0D 2BY0A 1C5CL 4M8QA 4G8FB 4JCMA 4M7JL 2NXZB 1D5BB 3BEWB 5J1AB 1F4YH 1F2XK 3LKNB 4KRPC 5LAXB 4H20H 4H8WH 2FIKA 1E4KA 5I30L 3OB8A 1U3HD 2ICEB 1W2KT 5FO7A 2VLRE 43C9B 2NY1C 1EUUA 3G6JA 2EEAA 5LBSH 4KJQD 3TV3H 1B4RA 2EDLA 4LCIH 4NKOB 3SGEI 4K23L 4ETQB 1MOEA 2YKLH 3HE7B 2BVQB 1OL0A 1GRWA 2XFXA 5FYJL 3HPJA 2AI0H 2X4PA 5ILTH 1I1RA 4CUCA 1KIQB 5TH2B 5FK9B 4UBDC 1JHTB 1Q1JL 3L3GA 4UQ2B 3E6FA 4CADB 3QUZA 4G6ML 3QDMD 3U6RA 1I3GH 3QEUB 2R0KH 5JXAL 1T7XA 2R2BB 4KGJA 4YFEA 3QJFA 3QZWA 3HHRB 4FZEL 4PJHE 1WWCA 4Y5XC 1T5WB 1MI5D 3PHOA 5HD8C 1OTTC 2R23A 1ZT7A 2EZ0C 2ENSA 3IAQA 5HYSB 2ZSWB 1PX4A 1AD9A 4I4WB 1KJ2A 3DX7A 2BNQA 5HYEA 1Q94B 2VDQL 3HS0A 2VQ1A 4XVUC 5E2VH 1KPRB 3GNML 3QIUD 5F7FA 3A0OA 1VKXA 4KC3B 1H15B 2HN7B 4OUUA 2XTLA 4WV1C 3TWCH 2V17H 1EERB 4MNGB 3QQ4B 3THML 2ID5A 1INQA 3BZFA 2IALB 2IG2L 3MV7E 4P49A 4Z7UB 1CK0L 3VA6A 1GGIL 3JVGC 2FEDC 2E7LC 4M62L 3SGEH 1FNSH 1AY1H 1A7RH 4M5YH 2Q6WB 2YXMA 3FB8A 3B2VL 3BQUB 1I8KB 1EEQA 3T65A 4JG0L 5CJ8A 1OB1B 4Y1AB 3RKDD 3CH1B 3O6ML 2JB6A 3UXFA 4MDJB 2FLRT 1EEZB 4BUHA 2VYRE 1ACYH 4WHTB 3PP4L 4ODWB 4F8TA 3ARDD 4F7MA 4KK6C 2O61B 4TUKH 3OXRA 3FO0L 1JRHL 1TZGH 3D18A 1LNUB 3LQZB 5EFIB 2AK1H 3T04D 4FQPA 2YZ1A 1J05A 2NY2C 2FJGA 5MI0C 2NW3A 2Q8BH 4GMTH 3V0WH 3G6DL 1XGPA 5DK3A 1EA9C 5D1XB 4K7FB 4A6YB 3VXUA 4YHNB 2DTML 1K8DA 2C9AA 2OBGA 1F90H 3SE4C 4YWGH 1UCBL 3VGDA 2HKFH 4QWWD 2QSQA 4Z77B 5JW5A 4JO2H 2ZNWA 1A7NH 3ZE2E 3MMEB 5DJYA 2GY7B 2DIBA 1D5IH 4C56D 1NMAL 3DVFA 1G7HB 1DP0A 3VH8A 4PGCB 3GDBA 1JNHA 1T0NB 1FAIL 4FTVE 5F7EL 5K93A 4CVZB 4JRYD 4N0YH 4CU8A 3VW3H 1KB5B 4U1IB 2CK0L 1JPST 3K1KC 3BPLC 4PP1D 2H1PL 3A67H 1DQJB 3IRPX 5DZNA 3T08A 3EAKA 3EGSB 1J0IA 5C09E 3QHTC 1SBSL 4FQXD 2YMXL 5GHWH 2PO6D 1RZJC 3CUPB 5JXEA 1CLOH 4QXTA 2B0SH 3BAEH 5DMGC 1MCNA 4RRPA 5I2IA 2ARJB 4EI5B 15C8L 3OZ9L 1XF3B 4HDIA 5C2BL 1BOGB 2KDGA 4QF1B 1UWGL 1CFSB 4PJAA 1L7TL 4F80A 4M7ZB 2P5WB 4EI6A 1YEKH 1ADQH 3HTLX 2FATH 3RL1B 2CIIA 2R1YB 3V5KB 3VG9C 3F7QA 5BO1H 4LSPL 4Y88A 2GKIA 4OLVL 1Z5LA 4U4BA 1HSAB 1QLFB 2IANE 4WWKC 1YUHA 1P7KB 1WBXB 5F9OL 1KCUH 1WZKA 1BZ7A 4AL8H 4GBXA 5KSVB 3L3DA 3ZKNC 5EWIL 2BRRH 2VDPL 3DRQB 3UJTL 4P4RB 1D9KB 5KSBB 3I6LD 2O5XH 4WUKL 1MREL 1GXEA 3LEYH 4PG9A 4DOHB 4OF0A 2H6PB 4Z5RA 5J12B 2EDJA 5DO2C 2CMRH 4OZFA 3NACL 4PJ8B 2V7HB 2ATPA 4RFOL 1FVCA 2A77H 3T0EE 4UT7L 3DI3B 1MWAL 4PJ9A 4OGZA 4FQQB 4AMKL 5I1GL 1B2WL 3RGVA 5CEZD 4PJXB 4Z9KB 5J6GB 3OKKA 4G6AD 3PWJA 1EEUA 2AEWA 3P4LA 1UEMA 2EIZA 4JPVH 4LEXL 4OZHB 3CFCH 3KXFE 4JM2F 4RSVA 4JFHD 1YEIH 5I18L 1BIIA 3MV11 4X4YA 2N1KA 2MHAA 2EDRA 2AW2A 3HC4H 3ULUC 3BO8B 4JM2C 1UFUA 2ITDB 3IT8D 1JE6A 1XGYL 3UDWA 3CLEL 1KBGL 2ESVB 2WINA 2ZUXA 2NTFB 5F93C 3TIDA 3WFBH 1QHPA 2IMMA 5D7IE 3VXSB 2ZOKB 3WXVL 4G8GE 2PN5A 1MQKH 1JJUA 1YQ2A 2EO9A 2FR4B 1MCWM 2BERA 3ZTJH 5K9JL 1JYXA 5BS0A 4JG1H 2X4RB 3QI9D 3TC9A 1CL7L 1NC2D 3DSNA 1WFOA 3VCLB 2GSGA 5SWQB 4HGWA 5E1AA 3QPQC 3DROA 4JZOA 4NZRL 2BOCA 4JJHA 5HYJB 4YE4L 4NC1C 2VLLB 3HB3C 5CEXB 4IJ3C 1A7PH 4PY7A 4ZAKD 5C7XH 3QDGB 2NXZC 1QFWH 5F9WB 2X5PA 3KYOB 1P4BL 1KJVA 2A0LC 4LLDA 3DV6B 4PJ7A 5HYSG 1R3JA 1F2QA 1SJXA 2GK2A 3MFGB 1I7ZB 4NKIH 3RZWA 1IEAA 1WJ3A 3MYJA 1IE5A 2DWEB 1F58L 2R8SH 4P46A 2R9HC 4DGYH 5MEND 1HHGB 2P5ED 4HEPG 4ZDHB 4U0QB 2EDWA 3Q3GB 4NT6B 2P44B 3EO1B 3QXWA 2KL6A 4WUUD 3N06B 3HE7C 5IHUH 5TE6H 1OF2B 2GJZB 4YHIA 3FOMA 2VERN 3HMXL 1DBML 4J6RH 1FN4A 3FRPG 5HHOD 2GK0B 4N0FA 4Q9CA 2X42A 1UA6H 1UXSB 2BRQA 1T4KA 5T33H 4KRLB 4ELKA 4O2FA 3LB6D 4Z7QF 4U05A 4LGPB 1QKZL 2VR9A 3TN0B 4QTHB 4X5LA 1GHFH 1IAIL 1U8PB 2FGZA 1V3MA 3TT3L 1S7TB 5DYOA 1JNNL 4Z7VA 3MRHB 5DD1H 4K8RH 3IFPB 3O2VH 4HS3A 2XKNB 1X5FA 3BIKB 1OAZH 3GHBH 4UV4H 1UZ8B 1ZA6B 1OGAD 2YK1L 1VADA 2P45B 1FIEA 1SY6H 5E8OA 4YX2H 5ADPH 3UBXB 3RUGB 5F9AC 4X9FA 4OD3H 1G0XA 1NLDL 2YD3A 4G8EA 4L3ED 1U8NB 4DCQA 1EFXB 4FOMA 4K94L 2XTJE 4K3DH 5F6HJ 2ILLA 2E9IA 3D0LA 5AZEL 4TPRL 5IK3B 43CAB 4Y4KB 5I8CB 5FV2A 4NQVB 4OQ1A 2E8ZA 4LCCA 5DK2A 1C12B 4RNRB 2W9DL 3D39A 4ZUTB 5TE7L 3D0VB 2HFEB 5GGTL 3BQUC 4LCYB 5ECJE 3L3HB 3MPCA 4ZOAA 1CFNA 1FVDB 4U1NA 1K8IB 3EHBD 3DUSB 5C08E 4JHAL 4U1MA 2NW2A 3D69A 3QEQE 3QJHB 4NOFA 1HIML 5F3HB 1A3LL 3JTSA 2L7JA 4YHZH 4LQFH 5GXBB 3DX6A 4X6DF 1AXSA 1AXIB 3RWCB 5FGCB 1II4E 1I1FA 2AK4D 5E8NA 2IWGA 3HN3A 4PRHB 4HPOL 2CUHA 5L9DH 3BUYA 4Q0XL 4M5ZL 3KPMA 1S7WB 3MQIA 3MUGA 5JORB 4JGUA 4U7KA 3EO9L 4ORGA 4G9FE 1ULVA 5D1XC 1JZ6A 4FFYH 1YN7B 4HJGA 1OAQL 3QIBB 2DI9A 3GMMB 3BP6B 3V4VH 4OQTH 3K8LA 3QA3B 3R8BB 2P49B 3GJFK 1JN6A 1RUML 1QBLL 4KMQA 4WO4D 3PDDA 3LEVL 4GRWH 1NCCH 4B7LA 4ODHH 1S9WA 2EKJA 3KDMA 5IQ9A 3K2MC 3MRMA 1FV1A 3CFKA 2BNUB 1FFNA 4Q9QL 1Q9KA 1VEOA 2BNRA 4JREB 1HILB 3QAZB 3MCLH 2E7BA 4JFXB 4P9HL 5C07E 2ZPKH 3OKMA 1S78C 4C83A 3IFNH 1CGSL 4EI5C 5TF1H 3S3PA 1RZFL 3GI9L 1KTKE 3ULVD 1FVEB 1N0XH 4L4VD 4PRAA 2VLJE 3EYQD 2WBKA 3ALPA 3CNKA 1A6UH 4M7ZC 1TFHA 3OAZK 1R0AH 5GJSH 3NZHL 4FNLL 2XY1A 3ABZA 4KROD 3ARFB 1N59A 1JGEA 4WHYH 3O6KL 3JSSA 4Q74A 4U49A 1ZVSB 5SWZD 3RPIA 5BVJB 1ZT1B 5L2KB 5MHSE 2QL1A 4QOKA 4NZTH 3IXTB 5ETUB 4XP9H 4U1HB 5FYKH 5D9SA 1D9KC 2IPTH 1JPSL 5D2LB 2OK0H 2HRLA 2FYYB 3O2WH 4M6NL 4NCDA 3OR6B 3VXQA 2EKSA 4A2MA 1TZHA 3U48A 4LSRH 1IM3B 1MNUL 5J12C 1HOCA 4F7CB 3QEGL 4IRJA 5ERWA 5HGBB 4PJ8C 3BVNB 1E4XI 3F7YA 3QULA 4MA7H 1JZ3A 3BGMA 3PNWA 2DQGH 1MEXH 4FQCL 1L0QA 4QYOB 1SVCP 1RY7B 2W0FA 5CZXD 4XPGH 3UAJD 3CDYA 4ZMAT 4MMXC 5EU6E 4XRCA 3TBSA 4V1DA 3TA3D 1TJGH 4AY0A 1X7QB 3FAWA 5GGUB 5GGRB 4NC2B 1FCCA 1YMMB 1O7SA 4JKLA 5D1QD 5L88H 1WGOA 4M1GH 3B6SA 5C9JA 1ZHKA 3B4NA 3H3PL 2BX5A 2Y36L 3MNZB 2EDNA 5JNYA 4ZUVA 2Z91A 2VDKL 3OSKA 3HI6L 2NX5B 5DJ8A 5L8KB 2X4NB 1Q8MA 5CKGA 4EQ2A 2VXSH 5IJVA 1SMOA 2HWZL 1AR2A 4X7FC 3X13A 4LLQA 1Y6KR 1Z3GH 2OTUA 2B1AL 4JFFB 2BMKA 4PB0H 1ZKAA 2EECA 1HHJB 3WLWC 4F7PB 1IKFL 2OI9B 1CXEA 5EO0B 5DRXA 3IDUA 5I1KH 3O3BB 3LKRB 1T20A 1AFVL 4XNUH 1MHCB 3S36L 3BZEA 4PYHA 1KXTB 5CWSB 1D5ZB 1KCKA 3JWNC 1IGIL 4Y16B 3V9FA 4MXQC 1E4XH 4ODTH 3QWOB 4PJFE 4OLUL 4BA8A 3QG7H 3B5TA 5I73B 1G6RH 2KZWA 5D5MB 2DYPD 1UWEL 5KAQG 4BZ2L 5F9WC 1KT2B 1PVHA 3KPOA 2LVEA 3ARYA 3QCTH 1MIEL 1MFDH 1YY9C 4PJ5B 1G9MC 5HI5C 3TBVB 3QCVH 4WFGD 1GGYA 2YPLB 2WV3A 1DLFH 1TVDA 2HVJB 2OZ4A 5FA3B 3UBXG 4HT1L 5I71B 4GW5B 4HFWA 5GGSA 1YNLH 2F5BH 4I77L 4UU9A 3MOBH 1G84A 4JPIB 2ORBH 2Z31A 4ZFZA 4BSWB 1OP3H 2F53E 5H37H 4KKCC 5IM7B 1SJHB 5AAWA 4XVSL 1FZJB 1CLZH 3G08B 4MQTB 3DYOA 3B9KA 2GCYB 1P4IH 3MLUL 2GUOA 4PRID 1N64L 4BQ8A 4CMMB 4HX1B 4ACPA 5KAQF 3MA9L 5HD8D 4UB0L 4ZPTA 5DUML 3TN0C 3PP3K 1Z2KA 1NGWB 3UTPE 3GEWB 3MA7A 2MQ0A 1GSMA 3VJ6B 2AEQL 1G9NL 1IL1A 3GSNH 4XCNB 3V6BR 3CVHA 5I6XB 1C5BH 1ONQB 4U31A 3RUGF 1A1MA 3QUMH 3WO4B 1OD7A 4CVXB 4TVPE 5FO9B 1S7XB 2PCPA 5IOPA 2R56L 4G9DB 4TNWF 1T0MA 4JQIL 4F9LC 4P2OA 1R3KA 5DEGA 2Q3ZA 4DEPB 2YUZA 5IV2B 1JF1B 3QWRD 4NNXB 1OM3H 1FYTA 4NM8H 1EEYB 4H0IA 4J1UA 1LP9A 4NWUH 1QQDB 5GRVK 2HRPH 3REWB 4XP6H 3OPZL 3TO4D 1GGBH 2J6EA 4WTWA 3EJYC 4LLVA 3QHFH 4ZTPH 4XWGH 1QSEB 5KTEL 4WTZG 4Y4KC 4WU5A 4GQ9L 4K71B 4O2CB 3M1BA 5T1DL 5LCVH 4Y2DA 4XCEB 1GC1L 3CDFA 5CGTA 1C16B 1XEDA 4ZG1A 3QXTA 2FL5A 4QRQA 3LRGA 5EUKA 3V0VA 1G1YA 3CFEB 5HVHB 4KK6D 5HHXL 5GGQL 1FDLL 5EBLB 1TVHB 5EOCJ 4LVEA 3VFUB 2QBWA 3KPTA 1LEGB 2X70A 3EOYG 3PIQA 3Q5TA 3ROLB 2BFVL 1P1ZA 1HYSC 3U0TB 5HSFA 2YD7A 3HG1B 3T4AB 1CGUA 1XCTB 1BP3B 3EBAA 3GFUA 2HT2C 5EUOF 2IH3A 4GRLA 3GUTB 2V5RA 3EOAA 1MFNA 2B4CL 3WJJC 4HAFA 3WFEH 2DN7A 2HG5B 2CH8A 3C5JB 2FDBP 1NBVL 4KTDL 1HQRA 4C57C 4O02H 3F7VB 5ICZA 2ATKB 3RVTD 1C5CH 3QIBC 3TESA 5EO1A 4X7SL 4NCC2 4M7JH 5DD5L 4TNVF 4FZ8L 1P7QA 2MSPA 2VDMH 1WEJH 4XPHL 1NEZG 5I30H 4R0LB 1DE4B 1QP1A 3MLSL 2V5YA 3BI9X 2CIKA 2JJWA 1QSFD 1JGVL 4HUVA 4C4KT 4NO2A 3MCG1 3V7AG 2E27L 1I9JL 5C0AB 4NQDB 1KJ3L 2XV6B 4K23H 1YY8A 4JREC 1OAXL 4F7EA 1D5XB 2V6HA 3QAZC 5FYJH 5ANMB 3QUXD 1IC7H 4JFYB 3G5ZB 5IW6A 3NIGF 3HFML 1Q1JH 4LSTH 1BJ8A 4G6MH 1AKJD 1J1XH 4LKCA 1NC4B 5T1LB 1IT9L 3DIFB 2XPGB 1JRHI 4RISL 5JXAH 4FZEH 3ARBB 3ARFC 4WWKD 4GUPB 2X10A 2ADGA 1A6ZA 1T6VN 5DQJA 5B8CC 1NLBL 5BV7B 3MODL 3MV9D 3D9AL 4ZD3H 4XPBH 3GGWB 5SWSB 2Q7YB 1A0QH 1F4XL 3PJSA 2PYFB 3OHXB 5F7DA 1BPVA 4QRSA 1YNKL 2VDQH 1B0RA 1ZHLB 1HH6B 1EXUB 3X14B 3SCMA 5TE4H 4PUBL 3VFSB 3RY6A 5D7JD 3R1GL 1CK0H 4LDOB 1GGIH 1IEBB 1U8KB 2Q76A 1AP2A 4M62H 1HH9A 2EDFA 3C8KB 1KIPB 4WGVB 5C0BD 5LKNA 4S1QH 2X1WL 1HHKA 3EJZC 3WIFA 5K9OA 1HYRC 3B2VH 1UJ3A 1MY7A 3VXUE 3AFLA 5KSAB 4DFIA 1WIPA 3O6MH 4FQJL 4QGYA 1T5XB 3QDME 3G5VB 3AS3A 5DMYA 4OM0L 3PP4H 3P3YA 2ADFH 5JPMB 2A2QT 3G6JF 3FO0H 3GSRA 4OFPA 4ZQKB 1JRHH 1GGCH 4EXKA 2Y7QB 1KG0A 5LQBH 2A9NH 1JWMA 1QR1A 5GSRA 1LO4L 4HC1L 4NQSA 2BSED 1BJMA 3QYCA 4OB5H 4G43B 1EMTH 3CCHA 1MFAH 2NNAA 4E42A 2L4OA 4LPVA 1HXYB 5INDB 2R2HB 2JKXA 1VFBB 1M1SA 4YDKL 1OHQA 3FQUB 3U0WL 1WBYA 3TBTA 5HGHA 1MCIA 3CFBB 2FNBA 4PJIA 3WFDH 1B3JA 1ZWIA 3TJEH 1UCBH 1LHZA 4P0DA 3MLVL 4N9GA 2DQDL 5KSUB 2OI9C 4H26B 4OV5A 5KOVC 3MJ7A 4Y19D 4MAYA 4RGMB 3VXRD 4EN3A 5LXGH 3HB3D 5E5MA 1MCQA 4QHNB 4PJAE 1G7LB 5IG7A 4X9GA 1A1OA 4LEOB 4F7TB 1UENA 3NCFB 2ZUVA 4PJHB 5D5MF 2BVYA 4Y16C 1MCBA 1FAKT 1FAIH 5I19H 3MOAL 2A0LD 3UEZA 4MQ7B 1I4FA 5FKPA 5I73C 2HYMA 2CK0H 4YBQC 2XN9D 4DK6A 3OKLA 2H1PH 5DD0L 1QFUL 2E8YA 4HWUA 5FXCH 4Q9RH 1A6WL 2YPKA 4PGZA 5J0BA 1BVZA 1MJ7L 4M7KH 1CICA 1UQSB 5CGYC 4M8VA 4NRYB 1KPVA 4YHOL 1UM6L 2F54B 3ZTNL 5C2BH 2GJ6D 3RVVD 5I71C 4UNVA 3ETBF 1J8HA 5HDQL 5EOTB 2ERJB 1K6QL 3SKOA 2XG5A 4AM0B 3HE6A 2A6IB 3S35X 1Z9SA 1NGZB 3VRIB 2PTUA 2X4QA 1MIML 3VFOB 4LSPH 5IMLB 3RZCA 1FL6B 5EO9A 4OLVH 2D4DA 4I18B 4G8IB 1BVLB 3U46A 3RWEA 1NH6A 1LVEA 3BPCA 1AO7A 1UCTA 4MVBD 4J3SA 2WIMA 2VDPH 3MGAA 3UJTH 3L9RB 5TQ0L 2IADA 1FLTX 2VLKB 4WUKH 1T2XA 4NSKB 4KJYA 1CL7I 3HZKB 3KS0H 3I84A 4HFUL 5DFTA 3O6FD 3CU7A 1VACB 5BOZG 3MLYL 3C9NA 3P4MB 3RVUD 4HHAB 4WI7A 1H5BA 1UACL 3SPVA 5I6XC 4NQCD 4U1KA 1I1YA 3WLBB 1KUMA 5F8RC 4ESKA 5CIPH 1KJMA 3MRGB 3T2OA 4BK4A 3OXSA 1G7PA 3WO4C 1FZOB 3VFNA 5JW4Q 3DECA 5DRWB 2WUBL 4UT7H 1MWAH 3IGAA 4YHKL 4DEPC 4AMKH 4XH2B 3ZDXE 2ARWA 1GZQB 3DLQR 1KEGH 4UOJA 1GOFA 2M1KA 3PE9A 1CG9B 5BRZA 4YAQB 5E2WL 1N8ZA 5DD6A 2VISA 3K3QA 5I18H 1BREA 3N1FC 3NH7L 4K71C 4WW1A 4FTVB 3T2NH 5IR1A 1MF2L 2DLIA 5FYLE 5BZDB 3STLB 1X3DA 5CINL 1NBYA 2UVFA 1RZJH 2VDOL 1XGYH 4XCYA 3MGOB 1J1OL 1KBGH 4HH9B 1KJ2L 1KCLA 1H3XA 1NCAL 5HVHC 5FO8B 5DJAA 3RIFF 4LSSH 4PV8A 1HINH 4PJ7E 5K9JH 3V5HA 4ELMA 4RMUA 1H8NA 1YMHA 5C0CB 1JPTL 5E9DB 4OI7A 4IDJL 2AV1B 1IAII 1CL7H 3OAYH 4P5MA 2A73B 5D1XD 1T89A 1G7IA 2DQHL 2HFGH 3QO1B 3LMJL 1IKNA 3EZJB 1CTOA 5HYIA 4EDXB 3SOBL 5IVZB 4L8BB 4TOYH 1Q72H 3S88H 3LN4A 1EO8H 4AIXA 3IJHB 5K59E 4JY4A 1MJUH 1FHGA 3SQOL 1ZA3B 3O3AB 1XF5B 1ADQA 3S35H 1TZIA 5DC9B 3HA0A 2VL5A 4R0LC 1PY4A 3O4LE 5IEKB 1AQDA 4J3VA 4W81A 2C5DC 2W59A 2FJHB 1A3RL 1WWWX 4U6XB 5FFLA 4XWOC 4I2XB 5JQ6L 1F58H 2X9XA 4IRSD 4Z7VE 4Y4FD 4TSBH 1IGYB 1EJOL 2AP2A 4M9PA 3MLRL 3FB7A 1S78D 2WK2A 4RMTA 4EI5D 2YA1A 3VDCA 3SGJA 2J8OA 1MRDH 1NMBH 3G6AA 3T0EB 3R06B 1DBMH 4WHDA 3ARGB 1U2HA 1VGEH 1S8DA 5E08H 3VXMB 1CD1B 4CJ0A 1XR8A 4S0SD 1UM4L 4M7LT 4MCZB 1ZT4B 1QKZH 5JLZA 2EDXA 4U1JB 3K7UA 1IAIH 4JPKL 1JK8A 2VRAA 1KLGA 3K81A 1I8IB 3ULUH 3KXFB 4XPFH 3ARBC 1IGMH 5DJ0B 1SM3L 5JHDA 2IH1B 4ZYKB 2VWEE 3DX9B 2AXGA 5TDOA 5DK0A 5BV7C 5LWYL 1IEHA 2YK1H 5FIEA 5IB4A 4PPTA 3V52L 1XGRA 5D7IB 1S5IL 4WFEE 3TT1H 3UTTA 1QRND 1WLHA 3S5LA 1BVKB 4KK8C 3C6LB 3S8WA 1NLDH 1U8IB 4CMHB 4X7TA 4MA3A 3RWJB 4ODBD 1YYML 4K94H 1BFVL 4R7NB 2P5EE 5KJRL 4PRDA 5J1SC 3IF1B 4PTUA 1A22B 3CAFA 3I02B 4WUUE 1VESA 1FGNL 4X8JB 3EYUH 5EZJB 4QTIL 4S2SB 5MEQB 3C5ZB 4Y4HD 3IFOB 1F97A 5GGTH 5CSZB 5KSAC 1BMGA 5GS0C 4XTRD 4PGJA 4R26L 8FABB 3WS3A 3JV5A 1W72B 1BQHA 2J8UA 3O45B 1LE9B 2F58H 4JHAH 1CDJA 3NTCL 2R0ZH 5DVLA 3FOLB 1D6VH 2OSLB 1A3LH 1T21A 2QHRL 2AV7A 2MJWA 3CXDL 1S7QB 5FGBC 2R2EB 3L7EB 3K4DA 2VAAA 1PFCA 3FO1B 4HPOH 4F9PC 3VXSD 3BD3A 2AS5M 1FQ9C 3EO9H 4RMWA 4GKZB 2DKMA 2P7TB 3MC0A 3VDBA 1FG2B 4I0PB 1H9VA 1PYWB 2LE9A 4OZIB 1DQQB 4APQA 1CXIA 4GMSL 1FL5B 3VWKD 5ID0A 1WWAX 1ZS8B 3RY5A 4OCRH 2VZTA 1IVLA 3WEXB 4RGMC 3SBWA 1R3LB 4MXQD 3GI8L 5A40E 5CMAB 2HTLC 1MSPA 5MEPA 5ISZA 4LBEB 1I1AD 2JJSC 2JJTC 4MWFA 1WZ1H 1U95A 1ETZA 3L3OB 3MV8D 2AEPH 1DBJH 1N5AA 2YBRB 3CFJA 3LPFA 2XACC 4OM1L 2I9TA 1T04A 1HHHA 3RGHA 4BFBD 1D6EA 3LD8B 4P9HH 2VITA 3ROOB 3BXNB 4QOKE 3U0PA 1W0WB 1CGSH 4ENED 2IAMB 4KUCD 4X6EA 3JWOC 2E9JA 4AT6B 1RK1A 4U2ZA 3LKPB 4KKAD 3BZ4A 1SY6A 4Z7NF 2ERJC 3U7WL 4DGVH 3B3IA 3NZHH 3O8XB 4FNLH 3W9DA 4KKCD 3PWUA 1F8TL 2CDFB 4LVOB 2MFNA 4N0UE 1MJJB 2N56A 5C0IB 1MHPL 2R29L 3LAFA 3NFSL 1WICA 2ICWA 4I18C 3UTSA 3O4OB 3Q6FA 5IEHB 2JIXB 4O5LL 5GGRY 4EJ1C 3ZLQC 1RV6X 1J0YA 2DQCH 5E99L 1OLZA 1OP3K 4V1DE 1U36A 5DLMH 3QEQB 4M6NH 5KVGH 1DN2A 1RFDL 5JHLH 3HR5A 5I74B 4PR5B 1P2CB 4A6YH 4QY8A 2FX7H 3QNZA 4PGEB 1H8SA 1OTSC 2W0LA 4YXHL 2OL3B 4G9FB 4FQCH 4YXKL 3LHPL 1UKTA 3JTTA 5TDPA 3DXAD 1MUJA 1EFXD 4NO3A 3BKMH 3TCLB 3INUL 5DJDA 5E24E 2X1XR 2HFFB 3GM8A 2DI8A 3TH3T 5HHNB 4HUWB 2DD8H 3KJ4B 4PRPA 2FGWH 4GAGH 2A38A 3BP5B 4KHTL 4NQEA 3K74B 1CFQB 4J3XA 3ULSA 1TJIL 4YXLL 1LEKB 4H5SA 3ZMRA 1J10A 1BHGA 2ZOLA 5EA0L 3BPOB 3U4AA 4JKKA 5FCSH 5ESQB 1KB5H 2EYTA 2Y36H 4NHUA 3BH8B 3QHZL 3L7FB 4KK5D 4OQTA 5IWLC 2VDKH 3WUWG 3PQYD 3VI3E 5DI8B 5ESAA 5SWZE 4HIHA 1NGXA 4ZNEA 4FRWA 4G3YH 1NGPH 4OJFH 3C8DA 5ITFA 2Z35A 3QIWA 2AVGA 2HT2D 1AHWA 4O2EA 3MRKA 1JGDB 3D3VA 2UYLA 4PJGB 4PRHD 4UDTA 2I5YH 4YLQT 2VLJB 1AFVH 1FNLA 3S36H 2UUDK 1FFQA 3WNOA 2VB5A 4NM4L 4ZS6D 2ITCB 1HDMA 3UZVB 3QIBD 4BH8A 5DC4B 1HKLL 1N2RB 3GHEL 4P9MH 4UNTA 3DO7B 1K3IA 4MSWA 1Q9WA 1S7RA 4BZ2H 1HNGA 2XY2A 1DR9A 4ZFFA 3TM6A 1KCRL 2AJUH 3ZSTA 3QXDA 2Z92A 3MBEB 1VA9A 3PWPA 2WNGA 5J9PB 3LQAL 5ITBL 4JM4L 5EBGA 3MRNB 1B0GA 1T2QL 1N0LA 1QO3A 3FFCD 4N8CH 4OIAA 1CS6A 3AMKA 4NBYB 2I9LA 1I7TA 2ZZUT 4PJBA 2PTVA 4GKSB 1A7QH 2QV2A 1OW0C 3PABA 1GYAA 2VMFA 4YDIL 3T0EC 1EGJH 3DX8A 3T1FA 5INCB 3GSQA 3BSZL 4XVSH 3ARGC 3AU1B 1LO0L 1NQBA 3JZ7A 1BF2A 2FBJL 3FQXA 3P9MB 3EYFA 5I76B 5GS1A 4PREB 3ARFD 4IS6B 4LPYA 1MCEA 3RTQA 5DUMH 4NDMB 4QXGL 4QEGA 4JZJB 2AEQH 2ARJQ 1KCVL 1AGEB 3BRDA 5L2KD 3NVQA 4FFWC 5HDBF 3MGTA 3WNKA 1V5JA 2BHYA 3VI4E 1W0VA 2X4TB 4JQIH 3KHOA 2VXVH 5D6CB 3OX8B 3IDIB 4Z7OE 1KN2H 4WFGE 5HY9B 1PKOA 1QLRB 3C6LC 3D25A 4MD5A 1XIWB 4CMHC 3JWDL 4EVNB 2XWTB 3U36A 1A4JA 3PG2A 2LU3A 4NKQB 1JIBA 3JUZA 9CGTA 3GSWB 4X6CE 3K46A 3RBSA 4LPTA 5KTEH 4M7LL 3MROA 4GQ9H 3D85A 3SY0A 3UBXI 4D8PB 5TDNA 2ZJSL 5T1DH 1IM9B 4YO0A 3C5ZC 1O5DT 3K2UL 2GY5A 5IHZB 1G9MH 3AC0A 4I3SL 2BSRB 4PJEE 3KNBB 1GZPA 2R39A 1JZ4A 1H3UA 2VE6B 3KYKL 3T3ME 2CXGA 2JB5L 5GGQH 1FDLH 2CLVB 4IIQA 1TTFA 3BW9A 3V6OE 4HWNA 1FNHA 4XNMA 2W9EH 4NWTH 2I07B 3T4YB 1BBJA 1Y6MR 5GS2H 1A6TB 5SV3A 1G6RA 4BQ9A 3TH4T 1F6LL 3Q6GH 4XCFL 2WQ8A 3FT4A 1U3JA 4YPJA 3V6FB 3T77B 4OAWA 4P2RA 2B4CH 4IOSD 5CJOH 4QT5B 3MJ9L 5DJCB 2C26A 2G9HA 2AJXL 2XXMB 2VTFA 4KTDH 3O41A 3RU8H 5DA0B 4MX7A 2GFBA 5DF0A 4I0PC 1NCNA 1KV3A 2F53B 2BVOA 1DQLH 1TIUA 5IFJA 2IQAB 3H42H 3MRRA 4FZ8H 4RQQB 4OLWL 1BQSA 1KELH 5J3HC 3GSOB 3V4UL 1MHEB 1U8QB 5E7BA 3PV6A 3QH3A 1M6OB 5IMOB 2FBOJ 2DAVA 3W9EA 4ZPVB 3PWVB 1FNEB 1A9BA 5I8EA 3MJ8A 3GIZL 5F1IB 4E41D 5T3XE 1KJ3H 3QQNA 2QSVA 4U7MA 1C1EH 2F74B 2X7LB 1OAXH 3MLTA 3E8UL 2VXTL 2YPLD 4NZDA 5IBLC 1G7QA 1FNGA 1HXMB 3NIFE 4DTGL 3WFZA 2Q7NA 2J4WL 3LD8C 1AR1D 3LN9A 1YDPB 5GZOC 1G0YR 5C0RH 2IAMC 3BKCH 2FD6H 3LV3B 3PUCA 5E2JA 4UV7L 5JPNB 5BQ7A 1LP9F 3QUMA 4N90E 5ALCL 3FQTA 1KEMH 4HH8A 4JFQB 4KQ3H 2EYRB 4J8RA 4OF8A 5JTWA 2CLZB 5FHAL 2Y6SC 2J3SA 3O8XC 5DXWA 5FYJD 1C5DB 2EYSA 2OM5A 3LRHA 4MA8L 4LVOC 4KAQL 2A1WH 3QPXL 1S9XB 3EFFA 4S0TD 4ZSOA 1NLBH 4OBRA 2XWBA 1HSBB 2GIYA 3IU3B 3MODH 5IT2L 3AY4A 3MBXL 3O4OC 5E56A 5JUEH 1T7ZA 5L2JB 2X89A 5KOMC 4LHUD 1OP5K 4M8QB 1DDHB 2VUYA 1MRFH 1F4XH 5FGRA 5ICXB 1SMAA 3RWGA 3MREA 3WJLA 2K7QA 4H88L 2CRIA 1TENA 1NL0L 1QEWB 3RNKB 4OGAC 4JDVB 3SDXB 3UC0L 4CN4A 2AXFA 1MCRA 2OZ4L 4NN7B 2RBLA 5E4EB 4PUBH 5C0EA 5I74C 1T83A 5LGHL 4MMZC 4KPHH 3JV4A 1QUNA 4UOW0 4NO0B 4N1HB 1P84J 1XCQA 4P2QA 1ND0A 1YN6A 4AH2A 3VWJD 4Z7WA 3NGBB 4HIEA 1ZHBB 1DBAL 1YEGH 4HGMA 4L4VA 3RWFB 1FRGH 2EE3A 3FN0L 3T3MF 2LVCA 3KJ4C 1GPOL 4PJIE 1ZANL 4FQJH 4HK0A 2W92A 1G7JA 2WLYA 1UZ6F 3L3GB 2P8LB 1ZXQA 3BPOC 5DQ9A 2G60H 4IEFB 1B6DA 1S9VA 1U8JB 4N0CD 4PB9L 4BFEA 3QZWB 4HC1H 2J2ZA 2NTSP 3CVHL 2DQUL 5CEYB 5DQDL 1CFTB 3WL9B 4DVBA 4L8SA 2EDOA 1QLEL 4YDKH 4PJGF 2XQBL 2VUOA 3BIBX 3U0WH 1U93B 1JGLL 2C7UA 3U9UA 3WFHA 4OIIH 5D4QA 1ZK9A 5FB8A 4MJ5A 1P84K 1DUZB 3FQWB 5HI3D 5CD3B 4JJ5B 2QSCH 1H0DA 1M7IA 2P48B 1J8HE 2MNUA 1RUQL 2J6EL 3CSYB 1K2DB 2X4OB 4FABL 2QADB 4KI5D 5C0BE 5JOPD 3N85H 5CD5D 1WBZA 1E6JL 1NGYA 2OR9L 5TPWH 3IU4L 1IGFH 5BXFB 4L8DA 4BFIB 1LQSR 5DD0H 1FL3B 3DRTB 4N8VB 1QFUH 3WKNA 4LF3B 5I17B 3UTQB 4XWOD 1MJ7H 4LIQL 1OGTB 2DMKA 3GMOB 5IROC 1U3HB 4TTDC 5F1KC 1RUPH 3MBEC 4MZ3A 4NZUL 3H9SD 5C0AD 3FTGA 3IDGB 2XZAL 5KVDH 3NPZB 4M48L 3IJYB 1K6QH 5EPMA 1NCDH 1R5WA 4W70A 5E8PA 2VC2L 1FC2D 2YUXA 3BN9D 5FUZH 5HGDA 4QO1A 3OR7B 4GG6B 4FFZL 5BMFH 4DZBA 1ORSA 1UKSA 1WFUA 5T1LD 5FYKU 3JV6A 1YEDA 1NANH 3BKJL 5GISL 2WBJA 2F15A 3QDMB 3L3JB 1NDMA 1OY3B 4KUZL 5TQ0H 1BJ1H 4F15B 5JW5B 4RMQA 2H26B 1R3IL 4JZJC 1FO0B 2HH0H 1U8LA 4JFEA 4Z76A 1MI5B 3KPPA 3W11D 1MCFA 3NCJL 3NOIA 1TETL 5IMMB 1UACH 2QKIB 5D96B 1JUFB 1JFQH 1JNHB 6FABL 4XPTL 5IB5B 1QRKA 1MH5A 4KK8D 2CK2A 2CXKA 3VFGL 1SHMA 1RULL 4YHKH 2ZSVB 2ICCA 3VGFA 2HJLB 3QIUB 2APVA 5FUOL 1IC1A 1A7BA 5H2BA 3NA9L 1X4YA 1XIWC 3EFDH 3QG6B 3ZE1F 4ELME 1KTLA 3W0WA 2WAHA 1E0OB 2KQMA 5T1KD 4LOUD 4R4FL 2WMPA 3U9PL 5E2WH 4RGOH 1NAKL 1OPGL 1IAOA 1TQCB 3TBYA 3P2TA 1KIRA 4ODXB 1AE6L 4WTXA 1EUTA 5KSAD 3RHWF 2Z8WC 5JOFB 4LRIC 5KG9B 3ECBB 4Y5XA 2VDOH 3VFMB 3VU2A 5C0DB 2G75A 1YUHB 2VLRD 3CFDA 1PZ5A 2N7BA 2VR5A 4JDTL 3DVNA 4U1SB 4EOWL 4HCRA 4OGXH 1IILE 3ARDB 1CT8B 3PGDA 4WDIA 4UIKL 3MUZ1 4IDJH 4YHPB 4X5WB 5KW9H 4WV1A 4XP5L 4AJ0A 1XR9A 2H2SD 3IS0X 1TNMA 1A4KA 4RZCA 2UWEA 1I3UA 4BQBA 4NQTA 4MB5A 5IB1A 3JVGA 1ZHNB 1RU9H 1FVCB 2DS4A 1RIVL 5F9JA 4QRPA 2GITB 4JKMA 5CP3H 3AXLB 4S1DD 3ARED 4PJ9B 4QHLB 3SQOH 1JPFB 4Y0GA 5CSGA 3EZ8A 1J9CT 5A2LH 4JO3L 4QNPE 1RZ7L 5ICYB 1YJDC 3PL6B 2YEZB 4C56B 1A3RH 5D7LA 1LD9B 5JQ6H 5ID1B 1JWSB 3FMGH 1F4YL 1DL7H 3GSUB 4X6BB 1EJOH 5JIHA 4H8WL 1DVFB 3MLRH 3WE6A 4R96B 1X4XA 5DEFB 3CVIH 2IQ9L 4FQXB 2D7TH 2PO6B 1GH7A 3QDJA 4HV8B 1JV5A 4UDUB 3BDBA 3NFPB 4HF5L 5T5NF 2FHBA 2UY6A 2QQNL 3TV3L 3MV7D 4LCIL 5M94B 1I9IL 4ZXBD 1K5NB 5CIPA 3BH9B 4GAYA 5FHBL 4EBQH 1XF4A 3O3UN 1PDKA 3SE4A 4W6YB 4ZUUB 4OCXH 2AI0L 3SDDD 4GLRI 1MWAA 1KIUA 4R8WH 5EU5A 5ILTL 3NMEA 4M6MH 4XGZA 2A83A 2KPNA 2VQTA 4JANB 4OD2A 3TLRA 1OQXA 5I16B 2PW1B 1RHHB 5J11B 1I3RB 1OSZB 2D03H 2F19H 1I3GL 4HWEH 3DWTA 2X41A 4OF6A 2W60B 1LK3H 1TVBB 1YPZB 1ZLUK 3IXAA 2R0KL 1JTTA 2QR0B 5EORH 3SDXF 1QSFA 4B0MM 1NUFA 5HPMA 5DHVB 1MLCA 2P46B 4JO4L 4MJ6B 4MNQE 2O26U 2ZCLL 4ELMF 2EDHA 4FFVC 3S3SA 4LNRB 5IGXH 4NN7C 2HLAA 5E4EC 1GJIA 1NDGB 2YD8A 4JFDA 4ODUB 5E2VL 1T1XA 4WCYL 3W5MA 3NGBC 3TWCL 2V17L 2HT3D 4NKDA 5K9KA 2IPKA 1XGTB 4R7DA 1QACA 4X4XB 4R26H 4LCWA 3HLAA 4R4NC 3B2UD 4OLXH 1E4JA 4FXGB 3MRFA 4WWKA 4D0CB 1FNSL 2D9CA 2J5LB 1MCSA 3QXUA 1AY1L 4HS6A 1A7RL 5I1IH 2MTPA 4N8VG 3O4LB 4ZFOB 5D93B 1CQKA 3BD4A 4XZUB 4PY8I 4GLRH 3I3BA 5C70A 4JPWH 1F6AB 3NBNA 4FN0A 3IDMA 3BEVB 4KMTH 5CBAB 3DMMD 3NN8A 2FH8A 5ISZE 3GB7A 5C09D 5HTSA 2AABH 4HZLB 4X5XB 1K4DA 3NIDE 3T2QA 3AUVA 4XP4L 3MLWH 3TBWB 5ACZB 4TUKL 5DJ2A 5CBEA 4GXVH 1T7WA 4JVUA 1TZGL 4OCLC 4L4TA 3NZ8A 1KOAA 5GGVH 1BQLL 4GMSH 4QNPF 1F11B 1T03L 3UTZB 3KLAB 3SJVE 3B8YA 3OGOE 3QI9B 2Q8BL 4P23D 4G8EB 3V0WL 3E3QC 3WHE0 3V5DA 3KPSA 1NC2B 2Y25A 3GI8H 1NGQL 3P77A 1DEEB 1R6VA 4YDVB 1RZGA 5BV7H 2XWJB 2QADC 2IAND 1F90L 2Y5EA 4AEHL 5DHYA 1A1NA 3I6KA 4HJ0C 1KLUA 4ZAKB 5JW3L 1FZKB 3MRJB 4OM1H 1TTUA 4X8XA 1RZIB 3UTSE 3SEPA 4XMKL 4GOSA 4HMDA 4JM2A 4CN6A 2L0DA 1A64A 1IC5L 2UZYB 3ES6A 4R90L 4CW1A 5I1EH 1U3HC 1HHIB 1Q0XL 5CILH 3CDGA 4N0YL 1NUDA 5DVNA 2V2WA 5ACLA 4ZFGL 3VW3L 4P4KD 1D5MA 3A67L 3GMQB 5MENB 4KJQC 2P5EB 1IBGH 2V2XB 3FT2A 4EIZC 3U7WH 3MXWH 5IBTH 2ZUQB 3PGCA 4GG6F 3RX5A 4WUUB 3P40A 1F8TH 5GS0H 2B0SL 3BAEL 4WFFD 4KV5E 2BSTB 5E1HB 5GQBA 3UCRA 3BE1H 1T22B 5HHOB 1WUNT 1KF9B 1MHHA 3CZJA 2ADJB 3OKYA 3ZDZE 4NGHH 4O5LH 4QCIB 1ADQL 2FATL 4G8FA 1J1PL 2J8UF 4PRPE 5E99H 4NQEE 1D5BA 3BEWA 5FA4B 5J1AA 5HPOA 4F15C 4RA3A 4YR6B 3LKNA 5LAXA 1RFDH 3WNPA 4D0BB 3GSVA 2OJZL 2ICEA 1L0XA 4LKXB 1NPUA 5F6IB 1NAMB 4OZGB 3B8SA 43C9A 4HLZG 5D96C 1CIDA 2QLVB 4PGBB 3MV8E 1U92B 2RAMA 2BRRL 4G8GD 1OGAB 3O9WD 4DUXA 4IM8A 4NKOA 3LEYL 4UTBL 4GRWE 4ETQA 2X2YA 3HE7A 3QUYD 4NKMB 2BVQA 3EO0B 3QIUC 3MSPA 2DJ4A 1MCDA 2Z4QB 4AG4H 3IS1X 4L3EB 1INDL 1QFOA 4KHTH 1KIQA 4C83B 5TH2A 4QKXB 5FK9A 3VXNB 3D3VE 3KPNA 1TJIH 4YXLH 1S3KL 1JHTA 3F62A 3IETB 5C6PB 4UQ2A 3C5ZD 4CADA 2PTTA 1TQCC 5IVNA 2JCCE 3QEUA 5IESH 4NJ9L 4DAGL 2R2BA 4KTEH 4NOBA 1L9NA 2OJEB 4PGDB 1NFIA 2MQ3A 3FQRB 3GKWH 4JPVL 3RKDC 3JWOH 1LO2H 3CFCL 5HYSA 1Z9LA 1DN0B 2ZSWA 2APTA 3WDJA 4I4WA 4MJID 3TPKA 4KWUA 2PYEE 3ARDC 3HC4L 4LMQI 1Q94A 2B5IB 3PWPE 1KB9J 3SDCD 1KPRA 4POZD 1F3DH 1H15A 2HN7A 3CX5K 2AK4B 4NM4H 3WFBL 1AD0B 4G42B 4JQXC 4MNGA 5JR1H 3QQ4A 3QNYB 3SDAD 2IALA 2GSIB 3U82B 1MQKL 3UZQA 2P8PB 4PJBE 5C0ND 3CJJA 1WC7B 5FYKE 4N0UB 5KN5B 4Z7UA 2Y5TB 5F89B 2VNCA 3GHEH 1T7YA 5E4IA 3FRPA 1R24B 3X12B 3VRLF 3OL2A 5JQHC 4PJ9C 4BH7B 2Q6WA 1CZ8H 4QWWC 3BP4B 1WV7T 3BP7B 3BQUA 2YD2A 3RWHB 1I8KA 1XZ0B 5B3JF 4LSDA 1PEWA 4WO4B 1OB1A 4Y1AA 4V1DB 3CH1A 3PL6C 2JTDA 1ED3B 1A7PL 4IBLT 2BDNH 1PAMA 5I1AB 2D31B 1L6ZA 1EEZA 1I9RL 3JXAA 4WHTA 1QFWL 3H8NA 4ODWA 5IBLD 3DETD 3PQYE 3TYGH 3VXPB 2O61A 4UIMB 4CU7A 1D3CA 1DVFC 3OTTA 1LNUA 4WNQB 3LQZA 5EFIA 3HUJE 2G5BB 4NKIL 4TUJB 5JDSB 4YDIH 2A6JB 4XMLL 4FQXC 4EIGB 2PO6C 5DSCB 3ZDZF 2B2XL 1KB9K 2R8SL 3KLSA 4LLQB 2C1PB 1TQBB 3GJEB 1XAUA 1LO0H 2HLFD 4K7FA 5D1XA 4A6YA 2XTJD 4YHNA 3P11L 2FBJH 2Y6SD 3I2CL 2D7OA 4GXUM 4RFEB 5IHUL 4M02A 4ONGH 1YEEL 4J6RL 4Z77A 2OCFD 4K2UH 4KROB 3WIIL 1QZ1A 4RIRB 3WNMA 1EVUA 1KCVH 4KDTC 1H3PL 1UA6L 4RMRA 3MMEA 5T33L 2JIXD 3FB6B 5J11C 5SWZB 1G7HA 1RZ8B 2RFXB 1ZLWK 5C08D 1T0NA 4GRWF 3ZSSA 4U0RB 4L4JA 1GHFL 4OGAD 3QEQD 4CVZA 3GM0A 1ZLVH 3A6BH 4M9OA 1KB5A 4U1IA 4NBXB 3VGGA 4OCWL 3TVMD 3HI1B 4K8RL 5DD1L 3OG4B 3O2VL 3WCYA 1BD2E 3EGSA 4YEEA 4RFNB 3CUPA 2VZVA 4UV4L 2ARJA 3FFCE 1V8HA 1Q9OB 2F5AH 1SY6L 1XF3A 5ADPL 1BOGA 4GRMB 4QF1A 4XVJH 1CFSA 2W38A 2FLBT 4OD3L 1NCTA 2P5WA 5F72S 2FO1A 35C8H 1KNOB 3RIAF 2DTSA 3RL1A 2R1YA 1S9KC 3V5KA 4WENB 3T0XA 3DV4B 3FHQA 1P9MC 1R5IB 3GO1H 4UILH 3ILQD 3KYKH 2JB5H 3QUKB 4G6AC 4J7RA 4M6OH 3TA3B 1HSAA 1QLFA 1P7KA 1WBXA 2J5LC 3LZFH 3FRUB 1U91B 5D1QB 5D93C 1M4KA 4RGNE 4TNVK 3DRQA 4P4RA 1D9KA 5KSBA 5GJTL 4XCFH 1IARB 2H6PA 4OFDA 1T80A 1VDGA 5C07D 3MJ9H 1PG7X 2XRAH 3BT2H 5A3ID 4PJ8A 1XH3B 4LQFL 3RDTD 4YHZL 1ES0B 1S7VB 1R3KB 3X3FL 4Z6AT 4JO1L 5ESVB 3QI9C 4FQQA 3G5YB 4UNUA 2EDYA 2HVKB 4XVTH 4ZUWA 3V4UH 4PJXA 4D2NA 2KZ1B 3CMGA 4FFYL 1EGJA 3GJFB 4ODSH 5J6GA 4KVCL 2LABA 5B39B 3K80A 1JBJA 2DM2A 3NAAL 3V4VL 2EE6A 3GIZH 4OZHA 2VWEC 2VR4A 5MHSD 4ZAKC 2DYPB 4ZSOE 2VXTH 5T3ZH 4YBHA 1NCCL 1R3HB 4DTGH 3QXAB 2RCSL 1BJ1J 1TCMA 3BO8A 1G1CA 1U3ZA 2FL5B 2ITDA 5J8OA 2ESVA 5FUCC 2NTFA 3MR9B 4WU7B 4UV7H 3VD5A 2ZOKA 4QHMB 5IJKC 3MCLL 2FR4A 5DJZB 4S1RL 4CDHA 5JDJA 3SGDI 2X4RA 2ZUQC 4X6CB 3L5HA 3FB5B 4KRMB 1ZTXH 2BVPB 3IFNL 3VCLA 2RQ8A 4P2QE 5SWQA 4KAQH 3MUY1 5CEZL 5GZND 5EU6D 1W72H 4Z7WE 4CN1A 1ZSDB 1WAAA 3T8XB 2NZ9D 5IT2H 3MBXH 2VDLL 3WDIA 5HYJA 5ICZB 4MS8C 2VLLA 4PJEB 5CEXA 5K9QI 4ONFH 4PRIB 3C60A 5GJSL 3GBLA 2EICA 3LB6C 3QDGA 1RJYB 1TMCB 1RUKH 1NL0H 3VGHA 2C3XA 4OZGF 3KYOA 3Q2CA 3UC0H 3DV6A 2OZ4H 4HLJA 4N1EA 1I7UB 1I7ZA 4OSUH 2ZCKH 5F6IC 1CBVH 3QRGH 1CVRA 4XP9L 4FQ1H 2DWEA 5FYKL 5EC2B 2IPTL 1HHGA 4ZDHA 2OK0L 3WMSA 1CFVL 3Q3GA 3ARTA 3PDGA 4NT6A 3EO1A 4XAWL 1J0ZA 4NRXB 4LSRL 1OF2A 2GJZA 3I3EA 3TIEB 2H9GA 1RIUL 1PG7H 1ZANH 4I3RL 2YXFA 3TNMB 5HDOA 3U7YL 3QFDB 4K7PL 4MA7L 2GK0A 1UXSA 2DQGL 1MEXL 3L5XH 3QNXB 3TO4B 4FXKA 4NFBA 2GTWB 3CD4A 5FYJE 1JPGB 1JP5A 2X09A 3HCVB 4OT1H 4QRTB 5F70A 5BCAA 4XPGL 3SGDH 2PW2B 3TN0A 4QTHA 4PB9H 4LP5A 1U8PA 3CVHH 1SEBB 2DQUH 1YECH 5DQDH 1S7TA 4U1GB 3MRHA 3IFPA 2IBGA 1JMXA 2FB4H 2XKNA 3BIKA 4L9LB 3BDXA 3IDXH 5L88L 3EHBC 2XQBH 2EO1A 1UZ8A 1ZA6A 4KZEL 3LS4H 3DPBA 5HVWA 4F9LA 1F4WH 3UBXA 4E0RB 3RUGA 2B5IC 1J5OH 5I1HH 2VXSL 1A6VH 2XKUA 2VL4A 4JFZL 1U8NA 1Z3GL 4KXZH 1RUQH 2J6EH 1GIGH 4ZOCA 3IKCB 1VFOA 2BOBB 1UT9A 5JO5B 1E6JH 3Q1SH 3FN9A 4IMKC 1BAFL 4X7EC 3F65A 43CAA 4Y4KA 5I8CA 1C12A 4X99B 4RNRA 4ZUTA 3D0VA 2HFEA 3RWDB 3ESUF 2XQYG 4LCYA 3L3HA 2H45A 5FDYA 1LDPH 4WO4C 4HJJL 1FVDA 5F96L 4ODTL 2OLDA 1K8IA 3DUSA 1IAMA 4F57H 2F8XC 2XZAH 3TGXA 1G6RL 3GSXB 2EXYD 3ZDYE 3RL2B 4I13B 3D2UD 3QJHA 5D72H 4M48H 5F3HA 3QCTL 1WVZA 1VCAA 5TFSL 3WSQL 3QCVL 2NNAB 3QUXB 1DLFL 4PRHA 3ULVF 3N1PC 4HKXB 3WJJA 4FFZH 3GRWH 1S7WA 1P4LB 5JORA 3HI5L 5AZ2H 1YNLL