1YJDL

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
b'DIQMNQSPSSLSASLGDTITITCHASQNIYVWLNWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of 5.11A1 antibody light chain
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdL01
5GGRY 1X4YA 3MRKA 4QRPD 2PXYD 4N1CA 1S9KC 4Y5XC 1RVFL 1F4YL 2BVQA 1TJGL 4ZUTA 1YMME 3BQUC 1CE1H 3EFFA 3MRCB 2DKMA 5F7HA 1H3GA 4HKXB 4YO0A 2CIIB 3O4LE 4M1CC 2NY3B 3ZYZA 4IRJD 4F7TA 3SEPA 4EDXA 4IRSD 1KGCE 5EO9A 3PDDA 2YPLE 4TVSa 2YS4A 4RGNB 5L2KA 1X5KA 3VFMB 2OLDA 3B8YA 3G6DH 3CPLA 1QSEB 3BPOC 2XN9D 3MA9H 4S2SA 4IDJH 1A6ZA 3DROA 4CVUA 2YA1A 3T1FB 4S1DD 3QDMB 4L9DA 5INCB 1EMTL 4BJLA 1RJYB 4HG4J 3WN5C 4BSVA 2F15A 3QUKA 3T0WA 4TULH 4X6DE 3QIUB 3FQTA 3PWJB 3VI3E 2JELH 2ZKHL 4GRLB 5EBWA 3KLDA 3UZVB 1TNNA 1NGPH 4HS6B 5I9QB 4M9PA 3VD7A 4D8PB 1Q9OA 2V2TB 2XNAB 4N90E 4PG2C 2A2QT 4NN7B 4OF3A 2B5IC 4UU9A 1L4IA 1QBLH 2ID5A 2W60B 3TFKC 4PRHB 3QDGB 4M62L 2DWDB 1CGWA 3OG4B 2ZOKA 4ZXBA 2OS7A 4TRPH 1M7DB 4ZAKC 2X70B 3FO1A 3MLWH 4NQXA 4J23A 5DHYA 3WXVH 4Z7QE 5MEPB 1NFIB 4JR9H 4PUBL 3BISA 1W0WB 2ITDA 1ZS8A 3MOBL 2WQ8A 1DN0B 3QIBB 1RJLA 1FV1B 3EKCA 1RV6X 4WY7L 3MLZL 3SE3A 5CSGA 3JTTB 3K46A 4MGXA 1RIVL 1ETZB 4E9LA 2GJZB 4FFVC 5HYEA 3CSYB 3H9HB 2VDQH 4P2RB 4G7VL 5DR5H 1UH4A 2JJTC 5EU6D 1HHGB 4DKFL 1PLGH 5KAQG 4R2GC 2NTFA 4TUJA 3IDXL 2FIKA 3U6RA 3V6FB 4NHUA 1SYVB 3QQ3B 2X4QA 4HKJB 5FUCC 4NYLA 4O58H 1KB9J 1NGZA 5I76A 4HT1L 4YLQT 4JN2B 5C0FA 4E0RA 2IANE 5K9QI 5IQ7H 2APFA 4PJ9C 1ADQA 2FWOA 3A67H 3MRRB 2R0LL 5C0RL 3IKKA 1I3RB 2DTML 3IFLH 3MV7D 1WIOA 4P4KA 3ULVE 2NY3D 3GMNB 5BZDA 4CMHC 3S34H 2AI0H 5EO0A 4WV1C 1VACA 1IAKB 3LKPB 2D31B 3HC4L 3V0VA 4M6OL 3VE0A 2QHRL 2HFFA 4RGND 2FSEA 4O9HL 4KI5D 1UB5B 5C92A 4GG6F 1QSED 4DZ8A 4U2ZA 3C5SA 3OGOE 3SGJA 1PZ5B 3MLVL 3QDMD 3WS6C 4RBPH 4ELKA 5HYSG 1H3WM 4XVSL 5HDOA 1T83A 2K7PA 1ZK9A 4IHOA 3L7EA 1CFQB 3K8KA 3DV6B 3HN3A 2Q7NA 3O2WH 1Y18A 2P48B 3QBTB 5EUKA 1KTDB 32C2B 4TTDD 2FYYA 1QNZL 3OJDB 3WS3B 2AXGB 4UILL 1BAFL 1NAMB 4U1JA 4XHQA 4MNGB 4XRCB 2DBJA 1FZJB 1AHWB 3V7AG 3MRIA 3QCTL 2EDJA 4OI7A 4H1LG 1IEAA 3ZKNC 1HINL 1NCCL 4YFEA 5J1TC 5L8LB 2ICWI 3BDYH 3O9WB 2W65A 3QCUH 2F53E 2M26A 1T0MB 5FYLL 1EFXB 2GJJA 1TQBC 4LKXB 1FNFA 3AXLB 4XBEL 3MRDB 3O3DA 2PW2B 2H6PB 4PV8B 5CILH 1AIFA 1KYOJ 2VLKB 1P7QB 2XFXA 2A83A 3EZ8A 1YQVL 4XPTL 4Z7NE 3O45B 1RQ5A 4G8FA 4D0DB 1CGSH 4Z8FH 1BQHB 5KSBA 3CFEA 5KSVB 2BRQA 3IB4A 3L3GB 3SDXB 3SE8L 4QT5A 5T3ZE 1XR9B 1I9EA 2L7JA 5FECB 1F13A 4X9IA 4U6HB 5DC4B 1TNMA 4YC2C 1HSBA 3D0LA 1AO7B 5KVGH 3U9PL 2MFNA 3MNVA 2BXZA 5GRUL 1QEWA 5DFWH 1K5NA 1IC4L 1BD2E 3NACH 3HAEH 3L3DA 4HPOL 4TOYH 4X6BA 1J8KA 1TZGL 4QCIA 5I8OL 3BP6A 1Y6NR 4HLZH 8CGTA 2FO4A 1JTOA 4D9RD 4AM0B 4YHOL 4KRMB 1OTUD 2IPKA 5K9OB 2A77L 5KS9F 3OKKB 2J5LC 2DI7A 1F97A 2YD7A 4A2LA 3HUJF 5FKPB 2MWCA 1LK3L 3DIFA 4C56A 3I3DA 1IGMH 1G9MC 5D72H 2IC2A 3GBNH 2O5XL 3RWDB 4WTWA 1MRCH 2EC9U 2VXUH 5TPWL 4PRAB 3FCTA 5GZNC 4FTVB 1G7PA 3RIAK 2NY2C 3LB6C 5F7LB 3MUHL 2BVYA 1NLDL 4E41E 4LNRA 5DUPL 2DYPB 1HSAB 2EO1A 1LO0H 4FFWD 1FIEA 4NO2B 4JKPH 3PGCA 5DK0A 2EH7H 3D2UB 1VGEL 5MEQB 5IK3B 5HVHC 1RD6A 2C3WA 3BIBX 5DMYA 1RHHA 3B2UD 5BO1L 3TWCL 3MBED 4G7YL 4HF5L 1IGCL 3WIIH 4K94H 3O9WD 4JFEA 3BD4A 1XF1A 3REWB 3T77A 1CTOA 4NSKA 2Y25A 1VEPA 3I02A 3VH8B 3U46A 2VIRA 1FYTE 1EFXD 3PABB 1NGWA 2AEPL 2YPVH 1S9WA 5JLZB 4AMKH 1CFBA 2EDBA 3ZE1E 3MRLB 4JAMA 1W8NA 3D69A 2EO9A 2VLKD 4ZFGH 3U7WH 2A9NL 3T08A 5MENA 2CRZA 4XCFH 2L4OA 5ANMB 1JZ4A 2OQJA 2XA8H 1AGFB 4RIRA 2IAMB 1CFVL 2AAVA 4B50A 4OZ4B 1U3HA 4JRYD 3LPFA 4M7ZB 5F96L 4R4FH 4M5YH 1RHFA 1UWEL 5IB4B 2F19L 4PRDA 1HHKA 1D6EB 3SGDI 1EO7A 4H25B 2A9MH 1AO7D 3NGBC 3G5YB 4JRXE 3UMTA 3GBML 3ARRA 4GO6B 2BFVL 4AEIH 5EIIB 2RBLA 4O51B 2R0ZH 5C2UB 4FA8A 3O6FD 2NY5H 1IT9L 4WI5A 5C09B 4M03A 5CBEB 2CDGA 1BM3L 5JO5A 5FHAH 1OQXA 2DLFL 5GZOC 1H3PH 1WICA 3V5DA 4LEXL 2Z31C 1R5VB 2B0SL 4I3SH 4OQTA 5GGRA 1T89A 3GGWB 4NBZB 1FDLL 3GMOA 1G0XA 1O5DT 2A6IA 1NGXB 4WCYH 5KSBF 3ARXA 3V0AC 1N2RA 5T1KA 5J12C 3LEXB 4ZPTA 4LLWB 1XCTA 5EZIH 4BA8A 3FHQA 2LAGB 3VFPA 2JK5B 3MSPA 5HI4C 1S8DB 2QEJA 2VXVH 1OCWL 3CFDB 2SEBA 1NH6A 1XMWA 1Z9LA 2DYPD 2QQLH 1PBYA 1PY4A 5HGHA 3UXFA 1F02I 4N0FA 4HWEL 3NFPA 1KIQA 5DD1H 2MKWA 3ALWA 3UJTH 4GH7B 1CIDA 4TNVF 5AD0B 3T8XB 1T2QL 3L1OH 3U30B 1EIBA 4M3KB 1FFOA 4IRZL 3PV6B 3GMPB 2AXFB 5J1AA 4OBRA 1CL7L 3ME0A 5FYJL 1U91B 3TZVC 1XGPB 3PIQA 2I25N 3SGEI 4KQ4H 4PB0H 1D9KB 1NBQA 2GKIA 2VYRE 2NY7H 1KJMB 1UGNA 3WHE1 2Z92A 1QTYT 3IJHA 1X9QA 4I3GA 2P49B 1I1FB 3PP4L 1QPXA 5E6YA 5IQ9A 4UTAH 4UV7L 2ADFH 3WO4C 1YDPA 4KQ3H 5D7IE 4F37K 1YEFL 1IKNC 5BJTA 1CDJA 2P5EA 2IH3A 1WLHA 2IAMD 1T03H 2ZPKL 1CD0A 2VMFA 1SEBB 5BRZD 5ID0A 1UCBL 3WNPA 4IIQA 2D7MA 3N50A 2ADJA 4BQ9A 4EQ2A 3WEXA 5TGBA 5IBLD 4GS7B 1HDMA 1LP9A 2DQFB 3EO0A 5L2KE 3NAAH 5DLMH 1B9ZA 4QHMB 4WWKB 4I13B 1OAQL 5IEKA 5DGRA 5D5MB 4JPIA 5IFJA 5HGAB 3KG5A 4MA8H 4BH8B 4AQOA 1RFDH 2R0WH 3ZL4H 1MCWW 3UC0L 4KJYB 3UPRA 1XGRB 5TDNA 1V7NL 2IPUK 5JXEC 4M6ML 2JJSC 4V2BA 1ZT4B 5DYOA 4LLUB 3TH4T 3HAEB 2ZCLH 3QUMH 5C09D 3JZ7A 3DV4A 2D7OA 3OF6D 3MNWA 3FOMB 3GSOA 1G7MA 4TPRL 3P4OB 5C2BL 3U36B 3SKOA 5CEYB 2WM0A 3IVKA 4MVBD 1AY1L 1U95B 2VE6A 1BVKB 4XX1E 4GMSH 2CO7B 4Z18A 3C5JA 1P7KB 4WHTB 4XPAL 5HDBF 4W6WB 4CAGA 1VFAB 2Y5EA 3ARFB 1HI6A 5L6YL 3GSVB 4Z7OE 4UNUA 1E0OB 3VXNA 4DGIL 1BGXH 3ARSA 3RL1A 4XNUH 5DD6B 2GSGB 3QHZL 5JHLH 3LKRA 4W4NA 3VXOA 4YZFF 4PTTA 2YBRB 1FG9C 1GGCL 4Y19A 2GUOB 1KSRA 4OTXL 4XMLL 1GPOH 2X4OA 4PJGB 5ESQB 3VGHA 3VGEA 3L95A 3VGFA 3W39B 4NDMA 4F7CA 1PQZA 4NKIH 1FNGB 2VAJA 4I0PD 1WZ1H 3KPLB 5AG8A 1D9KD 1RZKH 4LLVA 5C07B 2YXFA 2G75A 3BZEB 4U1LB 3SBWA 2FJFB 5A40E 1KNOA 5DJDB 3TA3A 1KIRA 2FGZA 4R4BB 2E6JA 3BOVA 3VW3H 4KK5D 2HTLC 1ND0A 2J7LA 4LDEB 3ZTNH 4E42A 1NL0L 2YK1L 5E6IA 3KS0H 4PJIB 5I18L 1AGDB 1JL8A 1XGTB 5C1MB 3VFRB 4FQHA 4UTBH 2M8XA 2VZ1A 1U2CA 1XGQB 4PGZA 4DKDC 4DTGL 3GJFK 2X4UA 1RI8A 1YEDB 3TGXA 4UB0H 4QXWA 4PJ7B 3VDCA 5B8CC 5CKAA 5D93B 3V0WL 2ATKA 3QXWA 1CLZH 5GS0H 4A2MA 4WWKD 2COQA 3BT2H 5E2UH 3IDGB 4DGVH 4ZFFB 1Q9KA 3ULVC 1U8PB 1KCUL 1ODAA 4X6CA 2MJWA 1U3YA 1RK0B 2I9TB 4IDLA 4HIHA 1NC2B 3QA3B 1CDUA 4G9FB 2C1OB 1SBSL 3PDGA 2KDGA 4EQ3A 4JFFD 1RZ8B 1HZHL 5I1HL 5GHWL 2OR7A 2R1XB 5MERA 1T2JA 3HNSL 1JYXA 3OQ3B 5DJ0B 3F5WB 1BZ7B 3DVNA 3RUGF 4Y88A 3F7RA 3IAPA 3QIWC 4TUKL 1YEEL 5HYSA 5LWYL 1PYWA 4FABH 5IROA 5ESVB 3WFBL 3VXRA 4I48B 2AQ2A 3CC5A 4F9LC 3MRBA 5EUOB 2VDLL 4PRPA 3ARFD 4PJBA 2EIBA 4F57H 4RDQF 5IB1B 1NGYA 3PE9A 5SWZA 2J88L 4ZFOB 2GEEA 4P46B 1D5BB 1DLFL 5C0AD 3U9UA 1LE5B 3GJFB 3UTZB 3DMMB 3CSBA 3MRPA 1J0YA 5FYKU 3AS2A 3GHBH 2NY6C 1KTLB 2FJGA 2FL5B 4J4PD 3C5ZA 1WCBA 5F70A 2B8OT 2IADB 4K8RC 3INUL 1FJ1A 1A6AB 1IM9A 5HXMA 3MV9A 3HR5B 1CU4L 4NQVB 4JJHA 3RIFK 1NMBH 5C07D 5BXFA 3LKNB 4FQIH 4G6ML 1KCLA 5EZJA 4P5MA 4DEPC 4ZUSB 4Y4FA 3VWKD 3BGMB 4UDUA 3V5KA 2PW1B 5IMLB 3KPNB 2PYEA 1OP9A 2LAAA 3I6KA 3BZFB 5D7LB 3HC0A 2FZ3A 1F8TL 2ZZUT 5F7KC 4ZUWA 3IKCA 4LDLB 1ZT1B 5L9DH 3EOAB 2J12B 2DDQL 1DZBA 3SKUD 5HHNB 3V6BR 4K7FA 4IEFB 3ARWA 3GO1L 3H3PL 3MCLL 1N7ML 5IEHA 4KDTC 3O11A 3IF1A 1B0RA 3RNKB 1EPFA 1SM3H 3NA9L 4S1RH 3EYFB 3PQYB 4AG4H 1PEZA 4CGTA 4Y5VB 2ADGB 1RZFH 2CLZB 5H37H 2Z93B 3ZYJA 1SY6H 3MBXL 5IOPA 2MCPH 4C56E 5I1GH 4DGYL 2FX8L 1YNTB 4LVHC 3B3IB 2HFTA 2NW3B 1QRNA 4Y5YB 3ZTJG 1NKRA 3ARGC 5FGCB 1FLRH 1I1AC 4G43B 2V7HB 2BC4B 2VL5B 3JV6A 4C83A 3SDCD 1YY8A 2YPKB 4LAJH 1UYWH 4KZDL 1N5YH 5T33H 3C2AL 2V2XB 1DBBH 5JUEH 3CFCL 2A6JB 2IFFH 4F15C 3CZFA 4N8VG 2CQVA 4P5TD 5GGVY 5KAQF 3QFJB 1HH6B 1LEGB 3OAUH 1Z3GH 2X42A 2NXYD 3RKDC 1R3JB 5TJWK 3KWWB 1JFQL 3E1F1 2AJYL 5IW1A 2KZWA 4CU6A 5T1LB 4PRID 2V7NA 3E6HA 5E94A 5F9OL 3WNMA 1MFAH 3VXPA 4KXZH 5CJOH 1MCPL 4QRTB 3V6OC 3ARDC 4YDVB 1VFBA 2UWEA 5TDPA 3DBXB 4X6CF 2OL3L 3WHXB 4Y16B 2DF3A 3KNBB 3SKJL 4XBPA 1PW3A 3G5ZB 2VERN 1N3NB 5MENE 5I1LB 4L8BA 2R2HB 3JWDL 5IGXL 3HPLA 4YHML 3RZWA 3UTSA 2DQHL 1XF4B 5ACZA 1HIML 4G6FB 5DJXB 4M48H 2XQBH 3UDWC 5KVEL 4ODSL 3CCHA 4UIMB 4BFIA 1I75A 4UNTA 4XNQB 5D7LD 5JHDA 2C7UB 4NWTH 1F6AA 1J87A 1JGLL 2HRLA 1A4KA 1ZMYA 1GGBH 4JN1L 5JPMB 3OKNB 2HN7A 5D1XB 3QQ4B 4YZFE 3O3AA 4KTDL 4AIXA 4OSUH 3F12B 3CNKA 3ZE0F 5LXGH 4NQSB 1J0HA 4JZOB 5E56A 4X6FA 3IU3B 4L4TB 1K85A 3HE7C 2QSCH 4H8WC 4XBGA 1YJDC 3RWEB 1MJUH 1L7TL 1U58A 4IM8A 4X99B 4K7PY 4TTGA 3NZHL 4ODXB 2GW5A 3PQYD 1CLOL 3U7YL 2PCPB 3LKQB 3D18B 3RX5A 3VXUD 4CL7A 5GRJH 4GAFB 3DXAE 4GXVH 1RSFA 4UIKL 1ZVYA 3H9ZA 5FGSA 1JPSH 4GW1A 4PG9A 1T21B 1F3DJ 1E4WL 4LRIA 3H6JA 3TV3L 5CJQH 2CO6B 1FGNH 1T1YB 2E7BA 3FFCA 1MVUB 3TIEA 1NBZB 4HIXH 2OR8A 1CDCA 2ORBH 3MLUL 1TVHA 2XXMB 5JMOC 4GLRI 1OGTA 1DBML 3QFJD 3UJJL 1VFUA 3NCYS 3S37L 3DRTB 1RULL 3W5NA 1S7WA 4JO4L 4W6XB 3HE6C 1MFNA 4LBEB 1OT1A 5EPMA 2P5WB 3H9SD 5T1LD 1MCBA 3X3GH 3DOSA 5K9JL 4OZFA 4FQ2H 3ULUH 1HEZB 1OSPH 1TVBB 3GSQA 5BMFH 3DRQA 3GMRA 2CIKB 2Y6SD 3OTTA 5IVZA 3I6LD 3BESR 3DUUA 4Y16D 4NUJB 1FPTL 4TVPH 2C26A 5D1QC 4NC0B 3QAZC 3QZWB 2OR9H 1WIPA 2EDWA 3VXMB 2O61B 5TF0A 4HK3N 3JTSA 2P5EE 4XNMB 3L7FA 3OJVC 4XNYL 3TO4B 1T7WA 2HFGH 2NX5E 1CL7I 4U05A 3WFHA 4F80A 4XMKH 4G6FD 1U8MA 5IG7B 3CUPB 5IVXB 3BYYA 4HUWA 4PTUA 4APQA 5TQ2L 5KOVC 2YKLL 3S96B 1JPGB 1LP9E 2NNAB 2ZCHL 4LFHD 1DEDA 5CEZE 5D1XD 4BH7A 2ADIA 4GQ9H 4XVUC 3O0RL 3B9KA 5BS0A 2O5YH 2ZUQB 2OSLB 4L4TD 5F88A 2I24N 4FQJL 3X11A 4M5ZL 2R2BA 3WXWH 2BOCA 3QG6B 4MXWL 2WIIA 5E2VL 1MPAH 2N7AA 4QRPA 2PXYA 5MP6H 4FNLH 4WU7B 4DN3H 1INQB 25C8H 4RFNB 5D2NE 5L2JA 1ORQA 5GS0D 1IAIH 2GCYA 2DLIA 2VABB 4RGOL 1FNSL 2I60H 1KCVL 1TMCB 4IRSA 4PJXB 1R5WB 4XB8A 1KIUA 3DYMA 1T1WB 2VDML 5LAXB 3V6ZB 3GMLA 4PGCA 4X80L 1A7NL 2XN9A 2G9HA 4MQ7A 3AY4A 2OZ4L 3SDDB 3HG1B 1KPVA 1JMXA 5I74C 3KYNA 5HGDB 3EOTH 1FORL 3C8KA 4HIJB 4X8JA 4Y19E 4OD1L 3S37X 1H8NA 2VH5H 5FA3A 1BMGA 5FHBH 3H42H 1NCDH 1MRDL 4FQQB 1IM3B 1XGUB 2P5WD 1E27A 3Q6FB 4LLDB 1MJJA 4OM0L 1MFCL 1U3ZA 4YIQB 1XGYH 3MRFA 3I9GH 4LSPL 1J86A 2EEDA 1MCOL 1XR8A 2DLGA 3MXWL 3MLRH 2OTPA 3FO0H 2HT2D 4FQXD 3SE3C 4POYA 1X5IA 2X4NB 1N59B 3EJZC 1CICA 4CBPA 1ZHLA 4UDTA 3A6CH 3RTQA 1LDPH 3UYRH 1EVUA 3MX0A 5F6IB 1FGVH 3S4SG 4MNQB 3SCMB 2ATPB 5F7FA 4MYWB 1WFTA 1JTTA 2FATH 5DJ6B 5D7KD 4MQSB 5CUSH 4F58H 5INDA 1TCRA 1LE9A 1BVLA 3I84A 3TBWB 3P0VH 1FO0H 2DI8A 5DRXA 4PJEB 3UPCA 5FOBA 4ZODA 4QXTA 3BSZH 5EU6A 4OF5A 3RAJH 4L3CA 2B1HH 4GUPB 1M4KA 2WBWB 4R0LB 4U1KA 4U1IA 3U1SL 5CGMA 5GSRB 2OMBA 5KW9L 1EZVY 3IXAA 4NRYB 4P4KC 3PGDB 5BV7L 3U0WH 2R0KL 1J1PH 4RISL 5E8DL 3MMEB 3QUXB 3WFDL 4MA1C 2CGRL 5C6TH 3ECBB 1PKQB 3DX9B 4LCUB 3B9VA 2ICCA 2XOTA 1VGKB 1WZMA 3MRCA 1RURL 4LGRB 3FAWA 3TBTB 4HXBH 2IF7A 2V2WB 2IGFH 2Y9RT 5FF6B 4K3HA 4HKXA 3SGJC 2CIIA 2EECA 2NLJB 5F7WC 3NIDE 1I8MB 2R69H 2ZCKH 2OJZL 1T83C 1BJ1H 1VB9A 1QR1B 1KCRL 4KJPD 5ISZB 3WDHA 1F4HA 3B5HA 3HAEG 5DMKB 3P3YA 3VXRE 4O4YH 4D9LH 4PRPE 4PJBE 2XWBB 4HLZG 4XPFL 2P8PB 3BKJH 3VFMA 1S9XB 1UWXK 1QSEA 3LN4B 3ULVH 4OI8A 5SWZE 3ZE0E 3G5XB 5FUZH 3T1FA 3QDMA 4LSTH 5INCA 5J57B 4B7LA 1RJYA 1UM5H 3HG1D 1BEYL 5FO9B 1KFAH 1JF1B 3QIUA 4XP4L 3BGFC 3PWJA 4G5ZL 4Z78A 4GRLA 3V7AE 1IAOB 5DMGC 5IFHH 4XNXH 4YHKH 2GTWB 2V6HA 2J8UF 4HS6A 1IKFH 4C55A 3MV9E 3I2CL 2DTSA 5EOQL 4X7EC 2F8OA 2X4RB 5GISH 2L7UA 4EN3D 2V2TA 2XNAA 5CSBA 2ZUYA 3C60C 1GAFL 5IP4A 3O81A 2W60A 4PRHA 3QDGA 5FUOL 2DWDA 5DQ9B 2PYEE 1BFVH 3E8UL 3RVXD 3RJQB 4PLKD 3MLYL 4LU5L 1J8HD 1M7DA 4RWYL 1ZANH 5JIIA 5EU4B 2X70A 1AFVH 1FH5H 1KJ3H 5JW4Q 5MEPA 4CU7A 1NFIA 1OPGH 3H0TA 1IE5A 1W0WA 2BXYA 5JPNB 4MNQD 1OP5K 3SCMD 1DN0A 1DUZB 3QIBA 1FV1A 1S3KL 3K2UH 4WW2F 3JWOH 4NHCL 5DI8B 1JHKH 3JTTA 1CK0L 5F8RC 1ETZA 1FE8L 5CINH 4HZAA 2GJZA 3CSYA 3H9HA 4Y4KB 4P2RA 1PSKH 4KKCD 1HHGA 2CDEB 4OZIF 4UBDD 3V6FA 1H3VA 1SYVA 2YC1B 3QQ3A 1PGRB 4HKJA 3MV8E 3QUXD 2QSTA 3RDTD 3CVIH 3T3PF 3P9MA 3ARBB 3E0GA 4U7SA 4G42B 1C1EH 4JN2A 4I77L 5A2KH 5ALCL 3TJEL 2E7MA 3AREB 1BQSA 3MRRA 1QFPA 1I3RA 2BJML 4J3OC 2XTJC 3QXDB 1UZ6F 2QQNL 2FB4L 1WTLA 3GMNA 2QLVB 3ZE2E 3U82B 1L9MA 4WTZA 5BVPH 1IAKA 3LKPA 1DBJL 1KIPB 3QFDB 2D31A 4JFDD 5ISZD 1A6UL 1YPZF 4JPWH 5HGBB 2BZDA 4WHCA 4XGZB 1NAML 1ZLWK 1UB5A 4UQ2B 5TE4H 3CVHB 4MJ6B 3LQAL 1PZ5A 1YQ2A 4Y2DB 2ZOLB 1RIUL 3EGSB 5JDJA 5C0CB 3LY6A 2UY7A 5D70H 4J3XA 1CFQA 3TO2B 3DV6A 2R56L 2UWEE 1IBGL 3FMGL 5J13C 1MCKA 2Y23A 4KH2A 3QPQD 1KTDA 1RJCA 32C2A 3IAGC 1NCWH 3OXRB 3QI9B 3FQUB 3OJDA 3WS3A 2AXGA 2WP3O 1NAMA 4MNGA 4XRCA 1FZJA 1AHWA 1Q0XL 3HMXA 5IESH 5IBTL 4I9WE 3UTSE 3ULUD 2VZ3A 2UZIL 2QKIB 4DN4H 3O9WA 3PXHA 4KKNA 4NUGH 5JHDE 1MY7A 1NCBL 4GRWE 5DHVB 2F9BT 3DX6B 4KI5F 4BQCA 4TVPD 3DO7B 1T0MA 1EFXA 4LKXA 3T2PA 3AXLA 3QHFL 4NWUH 3MRDA 1LO5B 1U3HC 2H6PA 2PW2A 4HUMB 4PV8A 3WDIA 4EUPH 2DBLH 2VLKA 2WINB 2YD1A 4JFHD 1E4JA 5C0NC 1P7QA 1DR9A 3T2NH 4JY5L 1QP1A 1CE1L 1U3JA 1CDHA 3F8UB 3O45A 4D0DA 5E9DB 5HYQB 1BQHA 3FQXB 5KSVA 2D9QB 4M7JH 4O2EB 3L3GA 3SDXA 4ELMB 3OAZH 5GXBB 3AU1B 1XR9A 4L1DA 5DFVD 2Z8VC 1A6VH 4EI5B 2H32H 5FECA 4K7PX 4ZUVB 4U6HA 1EO5A 3ARBD 3G6DL 1M1SA 3MA9L 1PX4A 4IDJL 4GAGH 3DI3B 1D5IH 1AO7A 4HCRL 4WFHE 3ARED 2W0LA 2BVUA 3FFCE 3WUZA 1YJDH 2DQEH 4TULL 5GGTH 4PJAF 2JELL 5EU5B 4FZEH 4PLJC 4AM0A 4OZGF 5J06A 1NGPL 5EU7E 5K9OA 2WWMC 3QDJB 3OKKA 4KGJA 5B3JE 1A02N 5FKPA 4XCNB 3CFBB 3MRQB 4LSSH 1YMMD 5C0BE 1U8NB 3CD4A 3TCXA 2HVJB 3O4LD 5C0CD 4O5LH 3RWDA 2EXYD 4CMMB 3Q1SL 5DJCB 1CZ8H 3RVWD 4PRAA 1KGCD 4FTVA 1OGAE 2XACC 4TRPL 2YPLD 2BSED 2EYTB 3MLWL 1J10A 3WXVL 2ARJB 2DYPA 4HIEB 5IHZB 1HSAA 4JR9L 2LQRA 4NO2A 3QI9D 5L7XH 3D2UA 5MEQA 5IK3A 4LSRH 4QRSB 5SWSB 1JHTB 4Z7UF 4PD4J 2VDQL 4XP1H 5DR5L 3REWA 1J1OH 3VD5A 1PLGL 1K2DB 3SDAB 3VH8A 4YDLB 1P84J 5EFIB 2QADB 4JQXA 3PABA 1UH2A 4NZRH 4X4ZA 3TN0D 3SPVB 4U1GC 5BS0E 3BZ4B 5JLZA 4F8QA 4RGMB 3FB8B 4IIQC 3MRLA 3HKFA 4OUUB 5IQ7L 4R3SB 4PP1C 4NBXB 4M43H 3LN5B 3A67L 4LFHG 5ANMA 1AGFA 2IAMA 4TUOB 4WUKH 4WEBH 1OAKH 3UTTB 1B0WA 3S34L 3G6AB 2AI0L 4OZ4A 4MAYB 4DOHE 1N64L 4JGJA 1PD6A 4EI5D 1WF5A 3S98A 3NPSB 3P4LA 5IB4A 1PJ9A 1D6EA 4H25A 4PJHF 1I3GL 1Z5LB 1R5IB 3G5YA 1U8HB 4TN9A 3S35H 5HGGS 1KEGH 3RBGA 1WBZB 5EIIA 4J3VA 3X3FH 4F7MB 4O51A 3EYOB 4N8PA 1G6VK 3O2WL 2NY1B 5C09A 5CBEA 1VA9A 3MOAH 3GKZA 3OF6A 4HWBA 1X6LA 2V17H 2X1WL 2IAND 1R5VA 3BPNC 1L7IH 3QXAB 3GGWA 1NGXA 4YHYC 1BD2B 5FDYA 5F72S 3ULVD 1W72H 4TSCH 1I3UA 3SDXF 3LEXA 4LLWA 1KPUB 5KN5B 3QCUL 2JK5A 4V2CB 1H8OA 1S8DA 3CFDA 1FLTX 3VRIB 5IMMB 2NXZD 5TE7H 3HI5L 2OP4H 5CJBA 3PL6B 3WYRA 3MUY1 4YBQC 2GK0B 5CILL 3X12B 5AD0A 2OYPA 3T8XA 3SBWC 1HCVA 4R4ND 1PDKA 3PV6A 2OXHA 1QSFB 3GMPA 3TA3C 2AXFA 2G60H 1XAUA 5FM5M 2MTPA 2NR6D 1U91A 1XGPA 3QZWG 1CGSL 4Z8FL 4KKAD 4U7MA 2BERA 4E41B 1D9KA 4WO4B 4W4OC 1ZLUK 3SDAD 3W9EB 1Q9LB 1J0JA 1KJMA 1QBMH 4CDHA 1OARH 2V5RA 2HT4D 1AR1C 1I1FA 4KDVA 3LZFL 5I1IH 4XPGH 2X40A 4WW1B 4I0CC 4LQFH 2EKJA 3IDIB 5KVGL 1GZPB 3U0TB 1KJVB 4FQCL 1OF2B 4KU1A 5AZEH 3D9AH 2F53D 3NACL 4TOYL 2XYCA 5JIHA 1D7FA 1SEBA 4NC2B 1FYTB 3C08H 4FN0A 4KROC 3NZ8B 4MAYD 3O41B 1EZVX 1OTSC 4O2FB 3SO3C 1DE4B 2V5MA 2X1QA 2XICA 2DQFA 4X0KB 3MODH 1ADQH 4L9LB 4KK8C 2D4FA 4QHMA 4WWKA 1QSEE 5D5MA 5D72L 5HGAA 4Z0XB 3GBNL 4BH8A 3S8WA 5H37G 1MRCL 2VXUL 1HNGA 4KJYA 1XGRA 2CKBL 3ARVA 1ZT4A 3F65A 4KMLB 4LLUA 5IROC 4X6EB 3HAEA 1OD9A 3P11L 2X4PB 4ONHB 5FM5O 4JB9H 4OCYH 3FOMA 1LO0L 3MACH 3P4OA 3DGCR 3TNMB 4YXKL 3U36A 5CEYA 2EH7L 4P49A 2XY2A 1U95A 1BVKA 2PETA 1CGTA 1BD2D 5GS2H 1CR9H 1P7KA 4WHTA 1VFAA 3ARGD 3WIIL 4K94L 3GJEB 1N0XH 4OCMC 4PRHE 1FP5A 3ARFA 3QDGE 3LMJH 2YRLA 3RZCD 3GSVA 3MYJB 4ALAL 5MI0C 1K3ZA 5KTEH 4ZNEA 1VPOH 4BZ1H 4J6RH 5DD6A 2GSGA 5C0AA 3DSNA 3PL6D 4XTRD 1GOHA 2YBRA 2YPVL 4AMKL 4P59H 4NCC1 4Y4FC 2GUOA 4J4PA 4ZFGL 2D7NA 3U7WL 2IBGA 6FABH 5ESQA 2BY1A 4XCFL 2XQYG 3X14B 3W39A 2XA8L 2UUDK 3TESA 1FNGA 2XV6B 3KPLA 3KPSB 5KSAC 3RI5K 4E41D 1W8OA 2NZ9C 4P2RE 4DVRH 2CR6A 2D7TH 3IDYB 5C07A 3VD9A 3OKOB 3BZEA 4U1LA 1QFWH 2FJFA 4R4FL 1BWWA 4XMPH 4M5YL 5DJDA 2R9HD 4R4BA 3ARDD 5L0QB 1MAJA 3RVTD 2A9ML 2OTWB 1GXEA 1Q0YH 4XPHH 2EE9A 4OFDA 4AEIL 4BM7A 4KDWA 2FX9L 4HWZB 4PJIA 1AGDA 1XGTA 5LGKA 4RFEB 3VFRA 2R0ZL 4Q2ZB 1FYTD 3LS5H 4NRZB 2Q3ZA 4RZCB 1XGQA 5EWIH 2NY5L 2J2ZA 3VGAB 3MJ8B 1YEDA 5FHAL 1EO8L 5DC0A 4PJ7A 1QRKA 4HFWB 1H3PL 3O8XD 4I3SL 4BFGA 5F1IB 2AK1H 3OKLB 5C8JB 1MRFH 3IDGA 1FZOB 1RUQH 4WCYL 3JVGA 3QO1B 4U33A 4X5WB 4ZFFA 3TEUA 1V3KA 3CDFA 1U8PA 2E7LA 5BOPA 4POZD 1RK0A 2I9TA 5EZIL 4YXLH 1NC2A 1XIWC 3QA3A 3VI4F 3BEWB 1N0LA 2C3HA 2VXVL 3GM0A 4G9FA 2C1OA 4KVNH 1UXSB 1RZ8A 3OMZA 1PG7X 2QQLL 1M05B 1QSVA 2VQ1B 4PR5B 4KZEH 2ILLA 4NO0B 2R1XA 5DD1L 4JRXD 1ZHNB 3UJTL 1QZ1A 5D1ZB 1IL1B 5DJ0A 3F5WA 1BZ7A 3L1OL 4MNGE 2YA2A 2PO6D 5DSCB 5ESVA 3KJ6H 4I48A 5EUOA 5HSFA 4J2XA 1W72B 4KQ4L 5J6HB 4OJFH 4PB0L 5IB1A 4POUB 4X98B 4IBLT 4ZFOA 5FYKE 2NY7L 3VD3A 3UTPE 1KJ2H 4P46A 1D5BA 1LE5A 3GJFA 3UTZA 3DMMA 4Q9RH 3KS0J 3QYCA 1UEMA 1KTLA 5KOMC 2FL5A 3T04D 4UTAL 2ADFL 3W2DH 2IADA 2HP4A 2YUZA 1A6AA 5IBUG 2A74B 3HR5A 1DQLH 3KPSD 4CKVX 4NQVA 3QNZB 3TCLB 1KT2B 1WAAE 3HC3L 5T5NG 3LKNA 2E8YA 1EEQA 1SJEA 1DQMH 2Z8SA 4ZUSA 3BGMA 3SDXE 2EIEA 4YR6B 2PW1A 5IMLA 1URLA 3CZJA 3ZO0A 3KPNA 3BZFA 3ZDXF 5D7LA 1B90A 3FT2B 3NAAL 5DLML 4GKZB 5D8JH 3JWDC 5F9WC 3E2HC 3T4YB 1ZT1A 1JGVH 3EOAA 3WFEH 1AO7E 5HHNA 3JUYA 4MA8L 4JFXB 3G08B 4QF1B 1QPPA 1RFDL 2R0WL 3ZL4L 1QOKA 3B2VH 2NW2B 3HZVB 2E5EA 3IDMB 3TH3T 3RNKA 4CNIB 3UTQB 3DUSB 2ZCLL 3QUML 3LH2H 5DK3A 1D5ZB 3JV4B 5DO2D 3EYFA 3PQYA 3PWVB 3EAKA 4JO1H 1A3LH 5IFAH 4Y5VA 2BNUB 2ADGA 2CLZA 2Z93A 4XXDB 4Y4HB 4H26B 3CX5J 4GMSL 4ACPA 1YNTA 2RGSA 3B3IA 2NW3A 1EVTC 4NQDE 4MS8D 5E2WH 1T1XB 2NY0C 3ULSB 4G43A 3THMH 3VDAA 2ZG3A 2V7HA 2BC4A 2VL5A 1WWWX 4M61B 4DKEH 1MIMH 4YHPB 4FTVE 1MH5B 1C5DB 1INDH 2YPKA 1BGXL 2AABH 4OQTH 1NANH 5J7CC 1AE6H 4XNUL 5J56B 5JHLL 2V2XA 3MRJB 1BFOB 4P3WA 2A6JA 5D1ZD 3NTCH 5FO7B 3L3HB 4PJIF 1BREA 4K07A 5AAMA 1DQQB 3BQUB 5SWQB 5JR1L 1GPOL 4CJ0A 3QFJA 1S78C 5SX4H 1HH6A 1I7TB 1LEGA 4NKIL 2CK0H 1R3JA 1UKSA 1WZ1L 3KWWA 2H3NB 1RZKL 2CXKA 4PJ7F 4LCIH 3P2TA 5T1LA 3I50H 3FQWB 1Q72H 4JZNB 4P0DA 3VWJB 3FT3B 7FABH 5DHXB 5E5UB 2VDKH 2DM3A 4C57C 3VW3L 4QRTA 2DQDH 4YDVA 3UZEA 4MD5B 4OLWH 3DBXA 3WHXA 4Y16A 3KNBA 3ZTNL 1FVDB 3G5ZA 1N3NA 5I1JH 3MRMB 1LD9B 4ZXBD 5I1LA 4GW4B 5ANME 4UTBL 1GHFH 2R2HA 3QDAA 1MCSA 2IQ9H 3W0WB 4WFGE 5HI3D 1NCAH 4XNZC 3VFTB 2F5AH 3B9KC 2DM4A 3UCRA 4UB0L 1NBVL 2YWZA 1H8SA 1XF4A 5FGBC 5DJXA 1B2WH 4UIMA 4XNQA 2C7UA 5FK9B 2PXYC 3IXTB 4LVOC 5EUOF 1EEYB 5GRZA 5JPMA 1MHHB 3BT2L 3OKNA 5E2UL 4LARH 5D1XA 3QQ4A 3BWAB 1JWSB 3F12A 3EZJB 4NQSA 4JZOA 3DSFH 3IU3A 1V3LA 4L4TA 3B8SA 5HDLA 4LCYB 3CSPA 3RWEA 4IRJC 5KANG 4X99A 3MLTB 4IRSC 1D5MB 3W82A 1LHZA 4ODXA 5CEZH 1FVEB 4Y89A 2AK4B 5A16B 4I8DA 5I0DA 2PCPA 3U4BH 3LKQA 3BIAX 3D18A 1KV3A 2PR4H 2F54B 5E99H 5SX5K 2AJUL 4S1DC 4FABL 3B9DA 4WW2C 1T21A 3W9DB 3KHOA 4NO3B 3VMPA 4X9FA 3LIZH 43C9B 4F57L 4R2GB 1T80A 4JVWA 1UZ8B 2JE8A 4UT9H 1K4CB 3CSGA 1T1YA 4UMGA 1UEYA 1MVUA 1ES0B 1YEJH 2EZ0D 5I1EH 1NBZA 1N8ZB 2XPGB 3GHBL 1RU9H 2F5BH 4XVTH 1SMOA 3VA2C 3BP7B 3O6KH 4BQ8A 1FAIH 1LO2H 1DEEB 2VZVA 3DRTA 4U6XB 1H3UA 3MO1B 4ZTPH 5GS2D 4LBEA 2GFBB 1NMBL 2P5WA 5ENWB 4FQIL 2DRUA 3VWJD 1CICC 1J12A 4L4VE 2Z4QB 2GJ6B 4GXUM 1HEZA 1TVBA 1YY9D 2CIKA 1KJ2B 4KKLD 4MD0B 5TFSH 2MNUA 3ZKSD 1A14H 3M8OH 1BFTA 1NDGB 1NPUA 3FONB 4NUJA 5L9DL 3T0VA 2YMXH 5IHUL 3QZWA 3C8HA 2DIBA 3L6FB 3VXMA 2O61A 4LOUD 4XNMA 3O6LH 4L4JA 3TO4A 1SM3L 4S1RL 1EV2E 2EC9T 4WWID 5T3XE 4G3YH 2GIYA 4AG4L 3CUPA 5IG7A 1G0DA 5IVXA 3JV5A 3MCKB 3WJLA 2XI9A 4NFDA 1RZFL 4X5XB 3S96A 3QUYB 1JPGA 1IQWH 2MCPL 5I1GL 2NNAA 5I6XC 5D5ME 3QWRD 2OSLA 4AEEA 1FLRL 2NY3C 1UB6B 4AT6B 4M93B 1GVIA 3QG6A 3VGDA 1TQBB 4G9DB 1DVFB 5GRVK 4NQEB 4WU7A 1UYWL 1N5YL 5T33L 1DBBL 2F74B 1INQA 4RGNC 5JUEL 2MKLC 2F54D 3LD8C 4KI5C 4LLYB 2IFFL 4KY1L 1DLHA 1VSCA 5BV7C 2RCSH 3UBXB 1JI2A 4KWUA 3OAYK 4LEOB 5GJTH 1FN4B 2VABA 3WJJA 1SY6A 3OAUL 4QKXB 1CLCA 4PJXA 1R5WA 4LVEA 3ZDXE 3MV01 2XZAH 3GHEH 5L8KB 1T1WA 2ENSA 5LAXA 3V6ZA 5DZLA 5CEXB 1JF5A 3SGKA 4TTDC 2P4AB 1MFAL 4XI5D 3UO1H 4ZNEE 3DXAB 3SDDA 3HG1A 2YUXA 2EE2A 1RZGB 4OM1H 3FO9B 4GT7A 3WLWD 2FCBA 5EC1B 2Q20A 2RFXB 3DX7B 4NN7C 5HGDA 4HIJA 2Y06H 4PJGE 1FYHB 4OV6F 4FQQA 5ECJE 1IM3A 1XGUA 1A3RH 1ZLSL 3Q6FA 3PF2A 4LLDA 1DANT 4W81A 5BQ7B 4HC1H 4YIQA 1Q1JH 2GJ6D 4M48L 2XQBL 1CD1B 3VRLF 3WFCH 4NWTL 1WITA 1GGBL 5H2BB 1GOGA 1KENH 3WO3B 2ED7A 2X4NA 1N59A 4OSUL 4XVJH 1NSNH 5LXGL 2DQUH 2VLRB 5CHNB 2VLLB 4F7PB 4PLNC 3F7PC 4OD3H 2QSCL 1OLZA 3GSNL 1MJUL 1EHAA 3LEYL 4MNQA 5CZXD 3SCMA 1R3LB 2ATPA 5CJ8A 5GRWA 2JJWA 5IUSA 2P24B 1KBGH 5DJ6A 2FNBA 3PJSB 3EYQD 3OGCB 5GRJL 3TBWA 4EUPG 3QUYD 5EB9A 4PJEA 5DQJB 4GXVL 4P3CH 4ZOEA 4Z95H 1JPSL 4NKDB 3H9YA 4GUPA 4JE4B 4R0LA 5GSRA 2NX5B 5CJQL 3FB7B 4NRYA 3PGDA 2LFGA 3MMEA 3QUXA 1RZJH 1Q9WB 1CXHA 1DVFD 1NMCC 2WAHA 3K1KC 5C0JB 3ECBA 1PKQA 3DX9A 1OTUC 4LCUA 4G9FE 1VKXB 1VGKA 4HIXL 3ALPA 3TBTA 3AM8A 2V2WA 5FF6A 4S1QL 2VQTA 3DJ9A 2NLJA 1MI5B 1V3MA 3W11D 4P4RB 1QR1A 5ISZA 3F58H 5DMKA 4HAGA 4ONOA 5EUOE 1GJIA 3VFWB 2XWBA 2P8PA 3MA7B 1S9XA 5IVXF 3X3GL 3WMSA 3LN4A 4FQ2L 1NGQL 3UYPA 3SDYH 3ULUL 3G5XA 2X44D 4FFWC 1OSPL 2OBGA 1I3VA 3DXAD 4LGSB 4XWOC 5D2NB 4YH6A 5BMFL 1UACH 3EYVB 4N1EA 5FO9A 3TLRA 4PY8J 4CN1A 1JF1A 4P99A 1JGDB 2O5ZL 5T1KD 3LQAC 3B2UC 5J6GB 2OR9L 1IAOA 3MBEC 2BNQB 2GTWA 3O9WC 3ZMRA 5C71A 1R0AH 3KDMB 3RL2B 3OR6B 5KVDH 2ESVE 1A6WH 3X13B 2LVCA 2HFGL 2X4RA 5HHPB 2MPAH 1AR2A 4D9QD 1RPQA 2DQGH 4XMKL 2Z31B 4LHUB 5IB3B 5DQ9A 2ZUVA 1QYGH 5KZCB 4PJXF 4IMKA 5D7LE 3NFNB 4YFDB 3B9AA 4GQ9L 5J12B 1RAMA 5EU4A 3MQIA 1Z9OA 3LHPH 4K3GA 2O5YL 4WUUE 3WXWL 5JPNA 1DUZA 5ITFB 1EGJA 1MPAL 5MP6L 5E95B 4FNLL 5DI8A 4DN3L 4GRWH 4UQ3B 1HYSD 2BY3A 4QRUB 1BJ1J 3PQYE 25C8L 5K93A 5JZ7D 4Y4KA 1JMZA 4Q7DA 3QH3B 2P7TB 2CLVB 2F8VA 4EZMA 1IAIL 2CDEA 3P30H 2I60L 2R8SL 4X7DC 2YC1A 1ZE3C 2NX5D 4LIQH 4JANB 5IF0B 5FGCE 1QHPA 3GMQB 3ARBA 1CVRA 1CGVA 3EYSH 3IDJB 4G42A 4IS6B 5CCKH 2H9GB 5DMIH 2VSCA 3AREA 5CEZD 1EHNA 3QXDA 4YAQB 3WO4B 2VQUA 2ZJSH 3VFUB 3EOTL 5F9JB 3G5VB 4QRQB 1KIPA 3QFDA 4Z7WB 3QFJE 3NIGE 3H42L 1NCDL 1KXVC 4H0IA 5FHBL 5HGBA 2YD4A 4EBQH 4UQ2A 4PJFF 3MREB 3CVHA 4MJ6A 3VG9B 5LGHH 5I17B 1XGYL 5J11B 4AIOA 3ARTA 3I9GL 4PJEF 4QHLB 4Y2DA 1OAXH 2ZOLA 2D0GA 3EGSA 3MLRL 1T22B 5C0CA 1XT5A 3FO0L 1TLKA 1A7PH 1QUNA 4LPVA 2R1YB 4OLUH 1DSFH 4YK4B 3TO2A 3ZKXC 1X44A 1NUGA 1EUTA 2QSQA 1WC7B 4KKBD 4NJ9H 1BJ8A 5E8NA 4ERSH 4QTIH 5B38B 4OZFH 3EHBD 3UYRL 1LDPL 2EE3A 1U8KB 3OXRA 5F7YC 1FNAA 3QI9A 1FGVL 3FQUA 3JV0A 4KRPD 3BVNB 4XX1G 4I18B 3GRWL 2FATL 4JQXC 5D2LF 5BVJB 1A47A 4F58L 2MQ3A 3BMWA 4LHUD 4PYGA 1Y6KR 3P0VL 1HILB 1FO0L 3AFLA 4Y19D 4GKNB 2QKIA 5KZCD 2LTQB 3QEHB 3VMNA 2Y72A 5JW4N 1RY7B 1E28B 3BSZL 2WUBH 3RAJL 3IFNH 5DHVA 3DX6A 5DZOA 2APTA 2IAMC 3DO7A 5LG1A 3U0WL 1J1PL 4UAOC 5LGJB 2X9WA 4HIIB 3WIHA 1LO5A 3R06B 3K3QA 5C6TL 4JFOB 2OI9C 4YFLF 3MJ7B 2WINA 3RVUD 1EJ6A 2HJFB 3N1QC 5IBLC 4XP5L 1J11A 4TNWK 1BIIB 1E4XH 2FHFA 4HXBL 5E9DA 3ARQA 5HYQA 2IGFL 1UFUA 1G6RB 3FQXA 4LPUA 5E6ID 2YUVA 4O2EA 1S7UB 2R69L 4ELMA 4HMEA 1P1ZB 3AU1A 2HT3D 3FQRB 4O4YL 4RWHA 4D9LL 1F45A 4EI5A 3OZ9H 4ZUVA 3BKJL 4N0CD 4JKKA 5FKAB 1YEKH 3ULVL 1FFRA 3ULUF 5FUZL 3FRPA 4MQXD 4LSTL 1J0ZA 4L29B 4EVNB 3VD4A 1CBVH 1KFAL 2ZUXA 4MVBC 4NRXB 2BVTA 2XY1A 3S3JA 3D5OF 1IGFH 5EU5A 4I5BB 2KQNA 3PWUB 2HAZA 3MV8B 2I5YH 4R7NB 3SO5A 4XNXL 4Z7VB 1IKFL 3QDJA 4S0TD 5F3BB 3I6GB 5CJXC 3UAJD 4XCNA 3CFBA 5ICYB 3MRQA 3CMOL 2P5WE 1MFBH 5B8CB 1U8NA 5M95B 4Q0XL 2HVJA 4RNRA 4NO5B 4CMMA 4UOW0 5DJCA 4LPCA 3F7VB 1F2XK 4MLIA 3VXRD 2Q6WB 1JP5A 4QNPF 1ZANL 2EYTA 4PRPD 5IMOB 1TETH 1AFVL 1FH5L 2ARJA 1KJ3L 4HIEA 3WIFB 5IHZA 4OZHF 4I0PC 2VISB 3VXME 3D25B 5SWZD 2VAAB 1D9KC 5B21A 2FD6H 3K7UA 1DDHB 1MJ8H 1JHKL 4QRSA 5SWSA 1JHTA 3NCEB 2VWEC 2WANA 3HI6H 5C0EB 5CINL 5AG9A 3C5ZD 3GNMH 3QIWB 4KK5C 1T5WB 1PSKL 4QOKB 3MR9B 1B0GB 1X5JA 1K2DA 2NY4B 3MV9D 3SDAA 4O2CB 4OV5B 1I7ZA 5EFIA 2A0LD 3SPVA 3STZB 3BZ4A 4GFTB 3CVIL 3FB8A 2D4DA 4D0CB 1C5BL 1C1EL 4OUUA 2PYED 2NY6B 4R3SA 1MCHA 4IJ3B 4GS7C 5H94B 3LN5A 4EDWH 1Z0MA 4RA0C 4M1GH 5T3ZL 2RAMA 1MVFA 5C86A 1LQSR 4TUOA 4WWKC 3QQ9D 3DURB 5DUBB 5JXAH 2ICWB 3UTTA 2C1PB 3G6AA 5BVPL 1CIUA 4MAYA 5GGSB 4NN6B 2GT9B 5E08H 3RA7H 4JPWL 5C70A 4PJXE 3MC0A 5TE4L 4L3EB 4N8CH 1T66D 4X6DF 1Z5LA 5KVMC 3VI3F 1R5IA 1CXFA 1MCRA 1U8HA 3E6FB 3T3ME 4RX4A 3OB0K 5D4QA 1WBZA 3GK8H 4G8GB 4L8DB 1T5XB 4F7MA 3HG1E 2GTZB 3L9RB 3LEVH 3EYOA 4YDKH 3HMWH 4HUXB 3P4NB 1BWMA 3MV8D 4HFUH 2EDKA 3KXFB 3ARFC 1NCWL 4J3UA 4YX2H 5TQ0H 2FECL 4I2XB 4NNPH 3KYAA 1SEQH 3S3PA 3N1PC 5IESL 1BD2A 3EO1A 4Z7QF 3OL2A 2BSSB 3CIQA 2R23B 4DN4L 1KACB 4J4PC 1TJGH 1KPUA 4NUGL 4WFEE 5KN5A 1S7RB 2AEQH 1YECH 2E9JA 2H41A 4OBSA 5IKCB 4KXZI 1OT2A 2DQCH 4LMQI 3VRIA 4Q74A 3PP3K 1SVCP 1JPFB 3PL6A 1FFQA 1MREH 1AP2B 4K94C 3X12A 1WQVT 1WV7T 4MXVE 2DBLL 4MNQE 3VWKC 3WKNA 4W68A 1QSFA 1XZ0B 3T2NL 4F15B 1TITA 1FAKT 1WZKA 5GGVH 5C0GB 1OGAB 5DD5H 1SVZA 2DN7A 4E41A 2NY4D 4WO4A 3W9EA 3R1GH 1Q9LA 4ZO6A 5D6DC 4ETQB 1A6VL 5KSUB 1H5BC 4OFVA 4WW1A 2MOVA 3ULVF 3UTSD 4GAGL 1D5IL 3IDIA 5I73B 1GZPA 2HKHH 1PFCA 3U0TA 1KJVA 5D93C 1OF2A 1PKQE 1DQJB 1ZEAH 1YJDL 3PNWB 4ODTH 5JHDD 1G84A 2DQEL 3MGOB 5GGTL 4X4XB 3ORJA 1FYTA 3JVGC 4FZEL 3NZ8A 4YHZH 1PAMA 3O41A 2R4RH 4O2FA 4O02H 2E7LC 5J0BA 1ZTXH 2YD6A 3KPTA 5ISZE 1FL6B 1MCLA 3R0MA 4X0KA 43CAB 4L9LA 4RMUA 4LSSL 4YBLB 3SDCC 4OFPA 2A6DB 1SHMA 3WV0A 3UBXG 2NY5C 5JTWA 4Z0XA 4O5LL 1IGYB 3ZHDA 4R90H 4G8GD 3B4NA 1CZ8L 2P47B 3LDBC 5ID1B 3OBAA 3N1FC 4YFLI 5LQBH 4P5TC 5MHSD 4X6EA 4H20H 1LILA 3HE7B 4JQVA 2X4PA 3KXFD 2NXYC 1NFDE 4ONHA 4ZTOH 4K7PH 3TNMA 9CGTA 4U1SB 4WFHD 2I07B 3QP3A 3QNYB 5L7XL 4ZS7H 4PFEA 5D71H 1ZAGA 2DAVA 4LSRL 5DA0B 4U1NB 3QRGL 4HJ0D 1ACZA 4LAQH 1GGTA 3F7YB 2XRAH 4XP1L 5DWUH 1J1OL 4L8CB 3MTRA 3MYJA 1D6VH 4N5UA 2FLBT 1ZA6B 3VU2A 2BNRE 4NZRL 1J05B 5C0BD 2YN5A 3B6SB 3HMXH 3QXUA 4TVPE 4S10A 4Z7NF 4M7KH 4ZDHB 2D0FA 3ARYA 4M43L 1NJ9B 5FYKH 3X14A 2IWGA 5IV2B 1OGAD 3MLVH 4WUKL 3O3UN 4WEBL 3CAFA 3KPSA 1OAKL 1GGYA 1TPXB 4ZSOB 3HE6B 3OKOA 5C6WH 4OLYH 1F90H 5ESAB 2EDQA 2FHCA 3OKEB 4WI7A 4Z0BH 2YRPA 5B39B 3RPIB 2OTWA 2KKQA 4NOFA 3S35L 4APQD 2WWKT 1KEGL 2QL1A 4HWZA 4PJ8B 4PJDB 3NBNA 3X3FL 2B1AH 4RFEA 1UADC 4ZO9A 1BBJB 4Q2ZA 2LU3A 3QAZB 2LU7A 4NRZA 4DJMA 4RZCA 2VOTA 5BS0D 3MJ8A 4MMZC 3RNQB 3V79C 5EO1B 4HFWA 2V17L 3BZDA 1IAII 3CDCA 3MPCA 2V9TA 1L7IL 1A6PA 2OCFD 5D7IA 5F1IA 3KPRB 1CF8L 12E8H 3OKLA 5C8JA 1FFNB 5D96C 1FZOA 5F7DB 3QO1A 4X5WA 4Y2OA 4TSCL 1UWGH 5C0CE 2BVQB 4PLOB 3BEWA 3K8LA 1E4KA 1OQOA 2HA1A 1T0NB 4LASL 3GEWB 1UXSA 3H3BC 1M05A 5TE7L 4PR5A 4NKOB 4NO0A 4OAWB 5DJAB 1T1ZB 1ZHNA 2J6EH 2NYYD 4RA3A 3NCJH 5D1ZA 1IL1A 5CD5D 1TENA 5HHVL 2G60L 4ORZC 5DSCA 2MCG1 2Y6SC 4KMQA 2BDNH 3GI9L 2UY6A 3IYLW 4HDIB 1W72A 4Y16C 5J6HA 4X7SH 4X98A 3ZE1F 4F9PA 1TZHB 1QBML 1OARL 5I8OH 1H15B 2JB6B 4EIGB 5I1IL 3N9GL 4XPGL 1CXLA 4LHUG 2A77H 4LQFL 2DQIH 5DK2A 2DJ4A 5JORB 1RZKC 4PY8I 5I19H 1PG7W 1DTUA 2YZ8A 3HHRB 5AZEL 4YNYB 2A74A 3GSRA 1QLRB 3QNZA 4QXUH 1KC5H 1HWHB 5E9DE 3TCLA 3C08L 1I8LA 1KT2A 5D1XC 5DQDH 1CICD 5TPWH 4HX1B 3RTQD 2NCMA 2HTKD 3PDOB 4ELME 4YR6A 3Q3GB 4F8TA 1MCDA 3RU8H 4J12A 3DO3A 3MODL 3MRHB 1ADQL 3FT2A 4JQIH 4GKZA 2EDTA 3T4YA 3S3SA 3F6LA 3S35X 2DD8H 5KS9B 4JFXA 3G08A 1V8HA 4PJ8D 4HGKC 4QF1A 4WJ5B 1LK2B 4WVRA 3HUJB 3PHOB 5EORH 2NW2A 3HZVA 3WNOA 5BO1H 4CVXB 4NQUA 2KPNA 3IDMA 5GS0C 4CNIA 3UTQA 3CX2A 3DUSA 4GOSA 4QO1A 1D5ZA 3JV4A 3CLFL 4JB9L 4OCYL 3PWVA 3MACL 1FC2D 1A7QH 3QDJE 2BNUA 3KPRD 4XXDA 5T1DH 4Y4HA 1QFUH 4H26A 1S7TB 4JM4H 1Q94B 4F33B 4OCXH 3EOBB 3TPKA 1CR9L 3L5HA 2VDPL 4LKCA 4NJAH 3QSKB 1EK3A 4E0RB 3DHMA 1N0XL 4ZO7A 1T1XA 1A4JB 3LMJL 3ULSA 5HBBA 4HWBH 4M61A 4HAFA 4YHPA 3V4VH 3UEZA 4JPVH 1MH5A 5KTEL 1C5DA 3PWLB 1VPOL 1JE6A 4ETYA 4BZ1L 4J6RL 2BVPB 1VACB 2YA0A 4MA1B 3MRJA 1BFOA 4ONFH 5F7NC 4N9GB 4HG4K 4NNXB 4P2QB 4P59L 4ZPVB 3C87A 3WLBB 5FO7A 3L3HA 2F19H 1DQQA 3BQUA 5SWQA 2AJ3B 5E1HB 1HQ4B 1KULA 1I7TA 5SWSE 2OTUB 3T2OA 3QIUD 2BFVH 2HT2C 4FQXC 4GRLD 4IMLB 3CXHJ 5B38G 2H3NA 2D7TL 3BWUC 3OHXB 4ZOAA 4Q6IC 1AH1A 1LMKA 3FQWA 3DGGB 3VWJA 4JZNA 4PBWD 1QFWL 3TBSB 3FT3A 5D7IF 1XEDA 1T20B 3MLPA 3H8NA 1FRGH 1Q0YL 4MD5A 3QG7H 4XPHL 4PRHD 3QDGD 4XWGH 1FVDA 1FDLH 3E3QC 2VZTA 3MRMA 1LD9A 4TNVK 1GYAA 2UVFA 4GW4A 2DL2A 3LS5L 4Y1AB 4Y0GA 5EWIL 3W0WA 1QFHA 5DD3L 3UTTE 3VFTA 4XCEB 2YD9A 2ZP0T 1JRHH 2AP2A 3MYZA 2H2SD 4PJ5B 1JK8B 2UYLB 1GRWA 3QIBD 4QRRE 5KJRH 4FQPA 1U9KA 5FK9A 2AK1L 3C60B 4HWEH 3IXTA 1EEYA 1MHHA 1MRFL 1RUQL 2P8MB 1QVOB 3BWAA 1MWAH 1JWSA 2CDFB 5T3XH 4P2RD 3QWRA 4RFNC 4X4MA 5C7XH 4OLZL 4YXLL 1CL7H 3FZUD 4LCYA 3U4EB 3WJJC 1EH9A 1KB9K 4KVNL 3MLTA 4LCWE 1D5MA 4GKSB 4KJPC 1I9RL 1FVEA 4LRNL 1EXUB 2AK4A 5A16A 4KZEL 1CGXA 4P9MH 2VR4A 2F54A 2J4WL 5CGYD 1CXEA 3SGKC 2E7CA 5D7JB 4Z7OF 3ETBF 5SV3A 3KJ6L 3W9DA 4UV7H 3O6MH 4NO3A 2JJTA 3I75B 2AV1B 43C9A 1C7TA 1BF8A 1YEFH 1UZ8A 4OJFL 1K4CA 1UM6L 2G5BB 4BUHA 5IIEB 1KJ2L 5I1CH 1ES0A 1ZKAA 2JLLA 4Q9RL 1N8ZA 2XPGA 2D7QA 3KLHD 5K9QG 3HPJB 4LCCB 4EN3C 3BP7A 3SQBA 2BRRH 2Q8BH 4NQDB 4QXGH 1NBYB 5FV2A 2XTJB 1DEEA 2NMSA 2FECI 4EXKA 4JREC 4F2MB 1QSFE 4U6XA 3MO1A 1DQLL 1XF5B 1IGJB 4U6YB 3RVXC 2GFBA 3S36X 4PLKC 5ENWA 4S1SH 3TNNB 3C09B 1PG7H 1DQML 4K3JH 2Z4QA 4K9EH 1AKJB 4XWOD 4YUEH 2GJ6A 2P42B 1Z9MA 5GRXG 4P57B 4P5KB 2G2RB 2K9UA 4BYHA 1I1CA 3VXSB 3SCMC 1KJ2A 4NQCE 1J1XH 2WLYA 1WIUA 5D8JL 1T3FB 1YEGH 4PGDB 1IEHA 1NDGA 1CXIA 1JGVL 3FONA 3KLAB 5C2BH 3WFEL 1A22B 1AY1H 4LDOB 1EHXA 3L6FA 1BFSA 4XPAH 1PX3A 4KKCC 5FYKD 3WSQH 5J13B 3UTPD 4Y1AD 3LN9A 1GL4B 2DQJL 3LH2L 2X05A 4UBDC 2VXTH 4J3TA 1KYOK 3MNZB 4JO1L 4PJ5D 3ABZA 4JM2B 4PGJA 3MCKA 3QUXC 4KGLA 3RDTC 4AEFA 4DGIH 5IFAL 4ZFZB 4X5XA 3QUYA 1CWVA 1P7QD 1CI5A 4L8SB 1MCFA 3QISA 4HEME 4KJQD 1WZLA 4PV9A 4KK9D 3RP1A 3AM8C 1EHLH 1OTTD 5E2WL 2H8PB 1DQTA 3ARUA 3THML 4NP4H 1UB6A 4B0MM 4AT6A 4DKEL 1MIML 4G9DA 1DVFA 1INDL 5HVGB 4OQTL 4NQEA 3L3KB 2DLEA 2F74A 3RHWF 3CMGA 4LLYA 3IFOB 1YZZA 3NTCL 1HWGB 2C4XA 5D7JD 4HUVB 1P6AB 2CUIA 1VEMA 3UBXA 1NEUA 1DANU 4LEOA 1FN4A 3S9DB 4KVCH 1M7XA 4D2NA 2CK0L 4P23B 1HHJA 4UT7H 4LCIL 1YEIH 3I50L 5EIVA 5CEXA 1P5VA 1Q72L 4LF3B 3V52H 5GS1B 3QPQC 7FABL 5DT1L 3D1MC 3DXAA 3MZGB 1OLLA 2HFEB 2VDKL 2AEIT 5DD0H 2DQDL 3L3OB 1RZGA 3FO9A 5EC1A 1OWWA 4OLWL 4NQDD 2RFXA 3DX7A 4OGAD 1S7VB 3ULUC 5I1JL 4FTVD 3WKMH 3WUWB 4HLJA 1A1MB 4IMKC 1TCMA 1GHFL 3GJFH 2EKSB 2IQ9L 3ZKQD 3KPSE 2APBA 2EDYA 1NCAL 1YNLH 5BQ7A 2F5AL 2YD2A 4OZFG 5IHLB 1WFNA 2G5RA 1B2WL 5H35B 1JYWA 3D2UD 1CD1A 1JCKA 4RFOH 3NCFB 1EUUA 1A9EB 4LGPB 5H2BA 4LARL 4NKMA 5GGSY 3VFVB 1I4FB 4DUWA 1YEEH 2VLRA 3DSFL 4WHDA 5CHNA 5IMKB 2VLLA 4F7PA 5EA0L 5J1AB 3IS0X 4L4VB 3NIFE 1FG2A 4M6NH 2DI9A 3VFGH 1R3LA 3FQNB 5DDHB 5J9PB 4G8EB 4OCSH 2P24A 4F7EB 4UOJA 5CEZL 4JM2D 5DFVC 3PJSA 1NCTA 3U4BL 3OGCA 2PR4L 3ARBC 3S5LB 3ZT5A 5DQJA 5E99L 1BQLH 5GSVB 4OGYH 1JYNA 5DRWB 5J3HD 3CDGA 3AREC 4NKDA 1J5OH 1LEIB 3LIZL 4ZUUB 4WFGD 2NX5A 4WU5B 3FB7A 4JEGB 1MWAB 3WL9B 4M4RA 3RUGB 4UT9L 1Q9WA 1G1CA 5C0JA 4PYHA 2H2PD 4NN5B 1YEJL 5EBGA 5I1EL 1VKXA 1RU9L 2PF6A 2F5BL 4XVTL 3VFSB 3Q0HA 3KYOB 1A6TB 4P2OB 1MI5A 1MF2H 1FAIL 4P4RA 4KRLB 2EXYC 4P23D 4ZTPL 4DWHA 3RVWC 5IWLA 3JWNC 3VFWA 1MLCB 3BYTA 3MA7A 1N7MH 1DL7H 5JOPE 4UINH 1TJIH 3QJFB 5D2NA 5I2IB 3D48R 3QI9C 3EYVA 4X7TB 3D0VB 5TFSL 4B53A 1A14L 3M8OL 1JGDA 2YMXL 1F4WH 5J6GA 3C2SA 3F62A 1BHGA 2BNQA 4DGYH 4LP4A 4HULB 3KDMA 3RL2A 3OR6A 5IM7A 3X13A 2ZSVB 1ULVA 5HHPA 4PS4H 2BX5A 1IQDB 1NQBA 3FL7A 3TN0C 2Z31A 4G3YL 3BPNB 2ARWA 4LHUA 5IB3A 2FR4B 3VG0H 1WWAX 2XKSA 3GIZH 3NFNA 3QDHA 4JGUA 3MJ9H 4KHTH 3ROOB 3SQOH 3LKSB 5HHXH 4IOFD 4L4VD 1KOAA 1PQZB 5ITFA 4P2YA 3IDNB 4S0SD 1MCEA 4UQ3A 1QBAA 1WVZA 4EI5C 1S5IH 4QRUA 5BW7A 1U8LB 4GBXB 5F9OH 5FDWB 2IPTH 3QH3A 2P7TA 3D39B 2CLVA 4XCCH 5F1SA 1E6OH 5GJTL 3RX7A 3A6BH 5F1NB 1NUNB 1CFTB 2XKNB 3SY0B 2Q3AA 2XZAL 3GHEL 1UH3A 2HJKB 4JANA 5IF0A 3QPXH 5T3XD 3P0GB 3GMQA 4PREB 3D87B 1EFQA 4IS6A 4KV5E 4WRLA 2H9GA 4ZQKB 1DBKH 1X5AA 4O00A 3V2AR 3WNKA 4OM1L 4YAQA 4RAUB 4P2OD 3VFUA 5F7EL 4MWFB 4KPHH 3VFNB 4M8QB 5CWSB 1MNUH 2Y06L 5F9JA 3QEQB 2Y1VA 3G5VA 4QRQA 4Z7WA 4JN1H 5DXWA 3PGFH 1A3RL 5CZVH 4JGMA 3MREA 4MDJB 3SO3B 5BOZG 4HC1L 5I8CB 2EDHA 2Q8AH 3VJ6B 1Q1JL 2AGJH 4QHLA 2NXZC 3S88H 4KHXH 3BRGC 1T22A 2R1YA 4LPYA 4R4NC 3C6SB 4PB9H 1CXKA 1KENL 3ZHKA 4WHYG 1WC7A 2Z9TA 4UIKH 2VLJB 1ZLVH 4XVJL 1NSNL 2NR6C 3FJTA 2DQUL 5B38A 4L1HA 2HMID 2FX7H 4KKAC 4OD3L 1U8KA 2YHGA 3OJMB 2J1KA 1LP9F 3SDAC 1SYSB 4JHWH 3BVNA 4I18A 3W0WE 4OKVB 5BVJA 3N85H 5GS3A 4LPXA 5ACMA 2HT4C 4HC1A 2FGWH 4N0RA 1HILA 4RGMC 4R8WL 2L0DA 4GKNA 4H5SB 4P3CL 3QEHA 4DW2H 1SJVA 1QFWI 1E28A 4Z95L 2D7PA 3KPOB 4DAGH 4JLRB 1G1YA 3JWOC 1CLYH 2BMKB 3BKYH 1QR4A 2AV7B 1L6ZA 2ESVB 3KJ4B 4H1LB 5MI0B 3SKMB 4ISVB 5LGJA 1K9TA 4X4ME 1RZJL 4HIIA 5LBSH 2IQAB 3R06A 4MAYC 3UJIL 3BD3A 4JFOA 3MJ7A 2QTEA 4KK6D 2HJFA 4QWWD 3NPSC 2P8LB 5K9JH 4MMXC 2KL6A 4GBXD 2AK4E 4UDUB 4FZ8H 1BIIA 1V3JA 3D39D 2F54E 1G6RA 2Z35B 1P9MC 1TXKA 4WUUB 1S7UA 3TIDB 1P1ZA 1QO3B 2DKUA 5KSAB 3NMEA 2ZNWA 4NGHL 3F58L 5IVNA 3BH9B 3FQRA 5LVEA 1HE7A 1EA9C 5FKAA 3SDYL 3K74B 4X9HA 5I1AB 3K80A 5FUCE 4L29A 1MCIA 4XHJD 4EVNA 4WI9A 4X5LA 4Z77B 1ZHBB 1JNNH 5FO8B 1A5FL 4NRXA 3GSUB 1ZV5A 1KN4H 1BIHA 3QEQD 4I5BA 3BX7C 4WTZG 4WIQA 3PWUA 4R7NA 3MV8A 2X1PA 4Z7VA 1NC2D 5F3BA 4XH2B 1R0AL 3LRGA 3RZCC 5KVDL 4G9FD 2Z91B 1A6WL 4ZMAT 5ICYA 1FL3B 3CK0H 3LKOB 3U2SB 2MPAL 3VGBA 5B8CA 1F11B 1TQCC 2DQGL 3P4MB 3RVVD 5ABDE 1JPTH 3G04B 2GJ6E 3PL6C 3K81A 4XTRC 3VFOB 3BUYB 1F5WA 5JW5A 4NO5A 5IJKC 2ED9A 3F7VA 4MDIB 4NT6B 2Q6WA 3IDUA 2X9YA 5IMOA 2UV3A 3LHPL 5E6ZA 4YQXH 1XIWB 3WIFA 2VXQH 4CADB 2VISA 4RGOH 4XP9H 3D25A 2QV2A 1C12B 3HNVL 2VAAA 5DS8B 4P46D 4MCYA 3DMMD 2VDMH 1DDHA 1ITBB 4JPKH 5EBMB 3T09A 5ADPH 4BFEA 1ZHKB 2R9HC 5C0EA 4MQTB 5EZOL 3JSSA 3QIWA 3ZZ1A 3RVTC 3KGRA 3S6CA 4Z7WF 4ODBD 3MR9A 4QOKA 1B0GA 5IVOA 1JV5B 2YSSB 3P30L 1CGUA 4O2CA 2LE9A 4OV5A 3OKYA 1OAYH 2ESVD 1Q38A 3HZMB 1I7UA 3QEUB 3STZA 4Q6YA 1Z0NA 2VN4A 4NQTA 4D0CA 1MRDH 1UKTA 2BOBB 5I30H 3NIDF 4R26H 2OMNA 5CCKL 3AS0A 5H94A 4NQEE 5DMIL 5JIKA 3O8XC 2R15A 4LSPH 4CDGC 3QUZB 3RX8A 1MCOH 3DURA 2E9BA 2ZJSL 4PJBF 2EIZB 1BQHG 2ICWA 2RQ8A 3MXWH 2C1PA 4WUUD 1RIHH 5EULV 5E2TH 5GGSA 2GT9A 3RWFB 1ZLVK 4BKLB 1SMAA 2VDOL 3O2DA 4POZC 3V9FA 4EBQL 1NLBH 2OL3B 4L3EA 3FAXA 5LGHL 4JQVC 3E6FA 1OAXL 3EDFA 1X4ZA 2XG4A 5E1AB 1WT5A 1FIGH 3EO9H 2R39A 3DNKA 3CFJB 4G8GA 4L8DA 1T5XA 1A1NB 2C4FU 4HS8L 1NANI 2GTZA 3L9RA 1DSFL 4OLUL 3P4NA 2BVOB 2PO6C 1A2YB 4RRPG 5C08E 5I15L 4KDTA 3AS3A 4QTIL 3KXFA 1VERA 3W81A 1R3IH 5I8KL 4I2XA 3CJJA 4K55A 4KI1A 5SX4I 1OAZH 5IW3A 2R0KH 5BZWB 3WFDH 4PBXA 4V1DB 4HJGA 4D9QE 3TYGH 2BSSA 1P4LB 2C9AA 2R23A 1X5ZA 1JNHB 3DLQR 4MB4A 1S7RA 1S9VB 4B5EA 2VKXA 5F8QC 5C0BA 5KVFH 1JPFA 3MUJA 1ZGLB 2VLRE 4KAQH 1AP2A 4JZJB 4PP2B 2HYMA 1KCKA 2VN7A 3AC0A 5E7BA 4XPFH 4OGZA 5JW3H 1XZ0A 1OVZA 3OR7B 4HKZB 5DURB 3NOIA 5L0QC 5C0GA 1E4XL 1OGAA 2FEDD 4RMVA 2IJ0C 5D9SB 4XAKD 1SJHB 3DRQB 5JQ6L 3GSXB 4KTEH 1G9NH 4OLVH 2JCCE 3VH8G 4XP4H 1EGJH 5C6PB 4ETQA 1UWXH 3T2QA 1JF6A 5F1KC 5KSUA 1YEKL 1PY9A 4AJ0A 5DEZA 3ZE2F 5DO2C 2WV3A 1K6QH 1DQJA 3PNWA 1HQRB 4C58B 3ZT7A 3QUZD 1CBVL 3MGOA 4M1DH 1GAFH 2RB8A 4MJIE 1GGIH 1UJ3B 1T04B 3O3BB 4X4XA 5FYJU 5HHOB 3GUTB 1INEH 5FUOH 5A1AA 3E8UH 1MI5E 4FXGB 5CD3B 2I5YL 4E5XB 5TH2B 1IGIH 4MS8C 4RQQB 2FLRT 1FL6A 1EBAA 5C0IB 4XNZB 2VXSH 3KPQB 1E4KC 43CAA 1CGYA 1BZ9B 1MFBL 3UDWA 1U92B 5EH1A 2UWEF 2A6DA 4MJ4A 4CN4A 1DUYB 1PVHA 1S3KH 2J8UB 1IGYA 1BF2A 1VADB 5D1ZC 5ID1A 2JJVA 1TJHL 2X7LB 2VO5A 1TETL 3HE7A 3CVHH 4BELD 2VZSA 4ZG1A 1OP5H 4IRJB 1K8IB 2BNQE 1UA6H 2NTSP 4U1SA 3BI9X 2I07A 3QNYA 2YXMA 3IJYB 2FD6L 1MJ8L 4GRWF 1BECA 2A73B 3IETB 3IFPB 4U1NA 5ILTH 1KLUB 1KTRL 3SN6N 2Y5TB 3F7YA 3TJEH 1HOCB 1D3CA 4WW2B 3EIFA 4L8CA 3WUWG 4HGWB 2IG2H 1ZA6A 4MX7B 4KFZC 3QXVA 1J05A 4JKLA 4ZXBC 2Y07H 1H0DB 1NDMB 3B6SA 5ETUB 1I8LC 1KUMA 4ZDHA 2J3SA 3FB6B 5HI3C 4OZIB 1V05A 1AJ7H 3L5IA 4LSUH 1NJ9A 5DURD 4EDWL 3OJ2C 4M1GL 5IV2A 2PTTB 5DHVH 4YE4H 1MAKA 5HPOA 4ODHH 3P73B 4ZSOA 3VXMD 3HE6A 3WIHH 1IEBB 3WD5H 4HGMA 5E08L 5ESAA 3RA7L 3BRDA 3OKEA 1IBGH 1ZLWH 3TO4D 5FCUH 5B39A 4YWGH 4N8CL 3RPIA 4QHUB 1YA5A 4NFBA 1GOFA 1YPZB 4GRMB 2AW2A 4PJ8A 4PJDA 3GK8L 3KR3H 5B3JF 1BBJA 2WK2A 3LEVL 2A1WH 4YDKL 4G6AD 3HMWL 2UZIH 3O3EB 4M3JA 1S7SB 4HFUL 3RNQA 2YD3A 3CFKB 2V9RA 5H8DA 4Z7WE 5D6CB 5TQ0L 4NNPL 3TC9A 5GIRB 2VNCA 4Q9QH 4X83A 4C54A 1BLNB 4ZOCA 1SEQL 3KPRA 5HYJE 1F6LL 3QHFH 4GMTH 1FFNA 2EZ0C 5F7DA 2NQCA 3MV11 4FMFA 7CGTA 1WJ3A 5EZLB 1YC7A 1SQ2N 1OAUL 2XZCL 1BX2B 4JY5H 3MFGB 3EDJA 2AEQL 1YECL 5I6XB 4OD2B 3MV7B 3R8QA 1T0NA 2DQCL 1BBDH 4R7DB 4NKOA 4M02A 4OAWA 2HRPH 5DJAA 1T1ZA 1MREL 5CLTA 5FB8B 4XT1C 3VXQB 1FSKB 3VWJC 1CD8A 2QQKL 2P46B 4CJ1A 3LD8B 5KBNC 4OF6A 3SDDD 3BMVA 5CP3A 1ED3B 5K59E 1YY9C 5BV7B 5GGVL 5HPMB 1P4IH 5IT2L 4KKLC 4HCRH 5DD5L 2ICEB 4HDIA 2XKUA 2WBKA 2CH8A 1NFDB 1TZHA 3R1GL 2R4SH 5CZKA 1A0QH 2FEEL 1IC5H 3H7LA 4LOUC 4Z78B 1H15A 2JB6A 2IEPA 4D8PA 4BK4A 3FKUS 1U6AH 3TJHD 4KJWD 3FTGB 1OD7A 5E00B 1X3DA 5JORA 1HXYB 2HKHL 2W59A 4LSDA 3KAAA 1ZEAL 4ODTL 1QFOA 4WFED 3OG6B 4YNYA 3U7AA 4OFKA 1I9IH 1HKLH 1QLRA 1LO3H 2BNRB 2AJSH 4HH9B 5MEOB 3HNTH 4H0HB 3WHE0 4YHZL 1S5HB 3Q1SH 2R4RL 2IPUG 5E8EB 3FFDB 4HX1A 2HLFD 5ICZB 1WK0A 4O02L 3PDOA 1ZTXL 3Q3GA 1ZWIB 3T65B 3BJLA 1Z9SA 4PJAB 3MRHA 3ZLQC 3H0TB 1YUHB 5DJ2B 3U0PB 4OZGB 3MGTB 5KS9A 4WJ5A 4R90L 4J1UB 4LSQH 1LK2A 3CLEL 3HUJA 3PHOA 4CVXA 5LQBL 1AXIB 4HS3B 4GAJH 4H20L 3TT1L 5F89B 1I9JH 4I3RH 3R8BB 4ZTOL 3DYPA 4K7PL 1ZT7B 2D3VA 4Z7VE 5HHME 4ZS7L 4P9HH 1S7TA 1Q94A 5D71L 4F33A 3EOBA 4BSWB 3P9MB 4XI5C 2XZQH 4MZ2A 4LAQL 3PHSA 2XRAL 3WLWC 1A4JA 2B4CH 1MFDH 2H1PH 5DWUL 2CLRB 1D6VL 1B88A 3PWLA 4Z7UB 4AH2B 5ERWB 4ZYKB 2BVPA 3HMXL 2YRZA 2UZYB 1NMCB 4N9GA 4M7KL 4N1HB 1N64H 1JHLH 4NNXA 4P2QA 4ZPVA 5HJ3B 3WLBA 2GI7A 4PJDF 5AAWA 2JIXB 2AJ3A 3GB7B 1HQ4A 1I3GH 3TH2T 5FYKL 2OTUA 1LO4H 2P43B 5I66B 4IMLA 4BK5A 4EXPX 1F6FB 4N8VB 5K9KB 4QOKE 3OHXA 4HUNB 1RMFH 4R6UA 3DGGA 4OLYL 3MLXH 4JVUA 3TBSA 1F90L 3WCYA 3MJGX 1UKQA 5AWNH 1T20A 4Z0BL 5CZXC 1KLGB 1UT9A 3KVQA 2B2XL 3EYQC 3MROB 1MCCA 3STLB 1ZVHA 3QUYC 2EH8H 3KYKH 4JCMA 3MZTA 2B1AL 4HZLB 1EDQA 2W0PA 3ILQD 3K4DA 4PJHB 2BNRD 4NOBA 4UUJB 2WZPD 4Y1AA 3MBEB 3HB3D 3TVMB 1F4XL 5HI5C 4XP6H 1JIBA 1YEHH 4XCEA 4AZ8A 3P0YL 3PWPE 4MHHG 4PJ5A 1JK8A 2UYLA 4M93C 3MRNB 5LCVH 5CIPH 2Y36H 5JA9A 3ZDYE 1DVFC 4RSVA 3C60A 5A2LH 3HI5H 2NPLX 12E8L 4YXHH 4L3EE 4LIQE 4OT1H 2WWKO 1ERNA 5F21B 2P8MA 1QVOA 3QCVH 2CDFA 4Y4KD 5C9JB 4N0UB 1WAAA 1UWGL 2X4SB 1JJUA 4G8GE 3U4EA 4D0BB 4LQ1A 3QXTA 4PGBB 4GJTB 3W11C 3NCBB 3IU4H 5MHSE 4GKSA 4U2YA 1EXUA 1P6FA 3AROA 4JRYB 3KXFE 1L0YA 2J6EL 4BZYA 5IW6B 3NCJL 4I2XE 1QACA 3JXAA 5D7JA 4I1NB 5E24E 2VZUA 3B5TA 3LZFH 1KB5H 4UNVA 1T89C 1ZA3B 3I75A 2AV1A 2BDNL 5CSZB 3L3JB 4FQCH 1ZLUH 3AS1A 4HXAH 4U3HA 3BFOA 4RRPA 4X7SL 4TQEH 3DYOA 4OCRH 4AL8H 1MJ7H 2G5BA 5ICXB 5IIEA 5AZ2H 1C16B 3KHQA 3O6FB 1JI1A 4QGTA 3BP4B 1RZIB 2XTLA 3HPJA 4LCCA 2DQIL 4UT6H 4K2UH 4Y2DD 4NQDA 2JIXD 2J6EA 5I19L 1NBYA 1QBLL 2AQ3A 4R9HA 4AEHH 4F2MA 1BZQK 3GI8H 1QG3A 5HDQH 2W9EH 4UZGA 1XF5A 1IGJA 4U6YA 3SE9H 4BQ6A 1N6QH 4QXUL 1KC5L 5DQDL 1Y6MR 1WBYB 3TNNA 2CKBH 3TPUB 3MUZ1 1AKJA 1M6OB 3V5HB 4LHQB 5DJZB 4P57A 4P5KA 2G2RA 4XCYB 2X89A 3RU8L 3VXSA 3P11H 1K4DB 4JQIL 4HUUB 1T3FA 4PGDA 1EAPB 3M17B 3VXTB 3KLAA 4OFYA 4YXKH 2GK2A 2DD8L 1HYSC 4QTHB 4MXQD 3AGVA 4JO2H 5JZ7C 3V6OE 1U42A 3ZKXB 3C6LB 1NUFA 3D3VE 3DECA 4RMSA 5EORL 1MFEH 2N56A 3TVMD 1E4XI 3MNZA 4ALAH 4JM2A 3EYUH 1A7QL 4O58L 4JKWA 1RUAH 4ODWB 4ZFZA 2EYRB 5T1DL 4I0KA 1QFUL 4JM4L 2D2OA 4OCXL 4L8SA 1HHHB 5E4EB 4K3DH 1N4XH 15C8H 3MUGB 3IFLL 5E9DD 4NJAL 3QEGH 1JNJA 2YZ1A 2H8PA 4RBPK 3U48A 3ELAT 2BCKB 2RJMA 4HWBL 3RWCB 4LSVH 3V4VL 4JPVL 5C9KA 1W2KT 5FM8A 1WCQA 4QRRB 4WFFE 4UAOB 4U1HB 5BRZB 3KPMB 1GC1H 1HYRC 1IFHH 4JDVB 1JN6B 5HY9B 3L3KA 5IWLC 2OJEB 4ONFL 5D7SH 3O4OB 2DMCA 3NVQA 3IFOA 1A7RH 2OI9B 5GJSH 3S7GA 4HUVA 1NMAH 4NZTH 1ZVSB 1S9YB 5D2NC 2UUDH 3A6OA 3SJVE 4P23A 2VC2H 5EOCH 4LCWB 2FX9H 3MRGB 1U8IB 4ODUB 5ITBH 5GGQH 4LLQB 5E5MB 4KKBC 3QDJD 4HWNA 4QHNB 4LF3A 5GS1A 3BPLC 3EHBC 4JFZH 2HFEA 4BZ2H 3RY5A 1EO8H 3L3OA 2CUHA 4KRPC 1FRGL 1ZGLM 2MSPA 2K7QA 1AGBB 3GZKA 1WAAF 3QG7L 1H3TA 4XWGL 1S7VA 3NH7H 5A3ID 1KPRB 3BDYL 1S7XB 2ERJB 3WUWA 1A1MA 1R3KB 2ZSWB 2EKSA 2FH6A 4EOWH 4ZSOE 1JRHL 3HTLX 5KJRL 5H35A 3TBYB 4PD4K 1A9EA 1ONQB 5SWSD 4AK1A 5DVNA 3RVUC 2AJVH 2LVEA 4DZBB 1EJOH 5BW7C 5DGQA 3VFVA 1I4FA 4XAWH 5DC9B 1MWAL 3AB0C 5T3XL 3CXDH 2EXWD 1P84K 3C6LD 5IMKA 1FZKB 4QLRA 3WE6B 1FNLA 2VR5A 5C7XL 4PJDE 3KYMB 4L4VA 5EOTB 4GG6E 5E6IC 4WGWB 1MHPH 2QADD 4HJJH 3FQNA 5DDHA 4I0PB 5J9PA 4G8EA 3HR6A 4F7EA 2Q76B 1G7HB 2DOCA 4JG1H 2HT3C 4NQCB 5F9DC 4P9ML 4H88H 1P4BH 1IC7H 2XIDA 3S5LA 4N0CC 4F3FB 3S4SB 5GSVA 5DRWA 4MQXC 3KPRE 4EJ1C 3GKWH 5CIPB 1MIEH 1L0QA 3O6ML 1LEIA 2ARJQ 4ZUUA 1JZ2A 1AI1H 4WU5A 3UTTD 4HK3J 1MWAA 3QT2A 3WL9A 3RUGA 1AD9B 4QRRD 1K8DB 4XZUB 1JZ6A 5I1CL 5EU3B 3HC3H 4QYOB