5IP4A

X-ray structure of the c-terminal domain of human doublecortin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'VQLQESGGGLVQAGGSLRLSCTASVNIIGGNHWAWYRQAPGQQRDLVASLSRYNANYADSVKGRFTISRDNAKNAAYLQMNSLKPEDTAIYFCALENYYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XA4551 NANOBODY AGAINST C-DCX
molecule tags Transferase
source organism Lama glama
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ip4A00
4L4VE 5C9JB 3TYFA 3VA2C 5TDOA 2YPLB 4UQ3B 3L3KB 5DRZA 3UTTB 4PG9B 2B2XL 3S36L 2NX5D 3NTCH 2IFFL 5C09E 3MJ7B 1KTDB 1GIGH 1GYAA 3EO0B 5JHDE 4KH2A 4RAUA 2D9QB 4XX1E 3SDXB 5EUKB 4PGZA 2KZWA 4NKDB 1X7QB 4K3HA 3SDCA 3TVMB 4OCYL 2ITCA 1GJIA 4JZNB 1A7BA 5IB5A 3VFTA 2P48B 4WCYL 4KKCD 5L8LB 2FO1A 1MLBA 4XC1H 5AWNL 3UROR 1S9WA 1OAUH 3ARBA 3KPLA 4DZ8A 1ORSA 4OFVA 2F9BT 4NUJB 2P5EB 4LLDB 4PP2A 2EDEA 5FOBB 2HN7A 3KJ6L 4ZUUB 3N9GL 2R0LL 3WLWD 4LLWA 4KVNH 2OI9B 1I8MA 1YNTA 3UTPD 2DQCH 1YPZA 2UVEA 2ARWA 1F00I 4JZJA 3IFNL 4JHAH 4EI5A 5F7KC 3WJJC 1BBJB 1C1EH 2W0FA 3AM8A 4FFWC 5D2NC 2X05A 1RJLB 3WFBH 2IPTL 5BXFB 2OL3A 3FRPA 4U1SA 2X4TA 1EEZA 3RAJH 1LK3H 4QRRB 2V5SA 1U91A 3QJHB 2FHCA 3MV9E 3WFCL 3KPRA 4YXKH 1MPAL 1U8KA 3LB6C 3GI9H 3OKLB 1OAQH 1CDCA 5I71B 5J8OA 2PYEB 1BVLB 4PD4J 5KVEH 1AIFB 4XMPH 3FB5B 2WWMD 4M1GL 4OZIE 4DGVH 2FL5B 3B8SA 4YDIL 5L7XL 3QUKA 1JBJA 1LNUA 4QXGH 4PJGE 3P4LA 1NFDF 3PNWA 4HHAA 1C5CH 4WI7A 1RU9H 4ODHL 1QVOA 4OFDA 2VLKE 5ETUB 2KUTA 4KI5D 1KBGL 4PTUA 4M7LL 5TF1H 1PLGL 4LEOB 1LO5A 3WXWH 3EFFA 4NDMB 1KIQA 5IQ9A 3D9AH 1WZLA 4ZQKB 3FT2A 3GSXB 1MVFA 4HEME 3VDBA 2F5BH 1Q72L 2YPLE 4OLXL 1CDBA 4BZ2L 2FYYA 3LN4B 4IOIA 3WIHH 1ZOXA 4HX1A 3HI1B 4JFHE 4XBPB 1C16A 5E8EB 3NIDE 5CEXA 5D1ZB 3TT1H 3CSYB 4QWWC 4OIIL 2I27N 1BWWA 2EH8L 2DTSA 3SDXE 5IQ9B 4XPGH 3DBXB 5D71L 4W6WB 3TJEL 4Y2DD 5B4MD 5DA0B 2XTLA 3HAEH 3HE6B 3QQ3A 3GM0A 1IVLA 4YLQT 1NC2B 1KLFA 3TEUA 4WHYG 3VI4E 1QQDA 3MGOB 4Y2DB 4LDOB 2LAAA 4UT7L 5INDB 3BD3A 1AR1D 3O3EB 3GSNA 1LO4L 1ZVSA 5HGDA 1H3UA 4ONGH 1LNUB 3RHWF 1MCKA 1QG3A 4WHYH 2CSPA 4DN3L 5D72H 2FL5A 3UTOA 1Z0MA 2X1QA 3LD8C 3IXTA 3HMXA 1GGTA 2FH8A 1JTOA 1KYOJ 2NNAB 4NZUL 4A2LA 3UZEA 1T7VA 2NXZC 1DBML 4C83A 3ZDYE 4F8TA 4XNUH 2Z35B 4MMXC 4I0PC 5HGHA 2E7CA 1U0QA 2OR9L 2H3NB 2YD8A 43C9B 4YGAB 5I8EB 1X5AA 2CIKA 5F7UA 2X4TB 4P5TC 1N26A 2EYTA 5DFVD 4WI9A 1JL8A 1H3WM 1DLFL 4EDWH 1REIA 1Y0LB 4TRPH 4Z78A 3RIAK 3BX7C 3TBVA 3MC0A 1P84J 2M8XA 1NMAH 2X7LA 1PVHA 4XMLH 4KU1A 2RCSH 3F65A 3UCRA 1J1XH 5H37G 3BH9B 4RGND 3SGDI 5IJVB 1CVRA 2IPUG 2D7TL 1F2QA 3U30B 1S7VA 1YEIL 2CIKB 1VEOA 2PYEE 1KCKA 5F1KC 4LMQI 5KS9E 2VQ1B 2G2RB 4PP2B 3QXAA 2NCMA 4NUGH 1UH2A 4X0KA 1ZGLB 4TUJA 1ORSB 3X11A 3OJMB 4WEMB 4PJGB 3QYCA 4YGVA 2AAVA 5H35B 3U6RB 3V4VL 4QXUL 1AY1L 3RVUD 1DANU 3OG4B 2X4UA 4Y4FC 3MRKB 4ODBD 5DK0B 5EUKA 4ZD3H 1TFHA 2K7QA 4F7PB 2DYPB 1SYVB 1UYWL 4YEFA 1INDH 4HJJL 5TH2A 3R0MA 2VXTH 3QCTH 1HXYB 4ZOAA 1LO2L 5LQBL 3ARGC 3RU8L 1QFPA 3L3KA 1A1OA 2D7MA 3DUSB 4LSPH 3T0EC 1RSFA 1H5BC 1DL7L 2MQ0A 1DEEB 4CVWA 4YHPA 1CE1L 1NGQH 4HBCL 2XI9A 3A6CL 4JFDB 1KIPA 1T3FB 5KVGL 5J9PB 3MLTB 5GRUL 5HGBB 5FECA 2LTQB 3LRSA 1PFCA 2BY1A 5KSAD 4V1DB 3Q6FB 2PKDA 5F9AC 3GMNA 2F5AH 3PWLB 3U9UA 3BGMA 1JIBA 1BJ1J 4XNYH 3PP4H 1T21B 1CZ8H 2EECA 4MZ2A 1CTNA 4CNIB 1CFNA 4Q9QH 4RWYH 3KPQB 4HWZA 1KCLA 4ZODA 4H25B 8FABA 3T8XA 1JNHA 5I1EL 5I71C 4NZRH 5EOCH 1UZ8B 4POZD 3GI8L 4LHUG 3QJFB 4KAQH 3Q0HA 3T0VA 3O2DH 2QQNH 5J1AA 1G6VK 1TQCB 3MV9D 1J5OH 1FVDB 2V5MA 2VIRA 4NWUH 2CLRB 5IIEA 3CDYA 3QBTB 2WWKT 2XA3A 1HQ4A 4IRZL 5C09B 3RY6A 1I3VA 5JW5A 3RA7L 4MHHG 1S7QB 2B0SH 3O4LB 3IB4A 3I6LE 1XGRB 3C09B 4NYLB 1KCUH 5IB4B 1P4IL 3B2VH 4ZUUA 1MFAL 2IGFH 1MCLA 5AYUL 4GBXA 4QHMA 4RMWA 1WIOA 5DD3L 2VYRE 1B0GA 4YHIA 4OGXL 2DLFL 3L95B 1CDHA 5JXEC 4M5YH 2XRAL 3MA7B 3DOSA 3FO1A 3NCJL 4GMSH 3L1OL 1EFXA 3BWAB 1F5WA 4PRNA 3CVHB 7FABL 1RUML 2CPCA 4XI5D 1MUJB 5JOFA 5FO7A 3LKOB 1CXLA 3EYVA 3TN0C 5EZJB 3S7GA 1U3HD 3K0WA 5KANI 4FRWA 2FEEI 2VWEC 1BAFL 2MTPA 4OZIB 1NBYB 2X4OB 3W39A 5BW7A 1MHHA 2RAMA 4IIQA 4MX7A 4EUPA 5HGGS 2WAHA 1D6VL 2XT1B 4O5LL 1G9NH 4JPVL 5DMKB 3OV6A 5C9JA 5IMMA 2MQ3A 3IDNA 1MF2H 4KKAC 3W9EA 3L95A 5I6XB 4TUJB 3O9WA 4JFFE 1MCPH 1FBIH 1MREL 4V1DE 2OJZL 1EZVX 1RUPL 3BP4A 4Z9KB 1N8ZB 4M7LT 1P4BL 2APBA 3UX9B 3BYYA 2ZUWA 1I8LA 2J8UF 2EDFA 1OB1A 4R3SB 2GJZB 1CGXA 1X5HA 3LEXB 4CU8A 3EDFA 1JZ3A 1RHHB 2YD4A 5GHWL 3MRNB 3GMPB 3UDWC 3KPOA 1JPTL 5JHDB 3HZVA 5EU5A 1W0WA 3D69B 2EDNA 4GW1B 2AK4A 4Y8DC 5B38A 1TXKA 2OSLA 4HT1L 3KLAB 5T3XH 1WBZB 5GS3A 1C1EL 4GAJL 4HFWB 4AK1A 1IKFL 5GGSA 2QQNL 4K3JH 3BI9X 2C3VB 1OP9A 5A2IH 1XIWD 1RUKL 3ARTA 5D9SA 5BS0B 4HFUH 4PJ5A 3RWDA 4NP4L 1NAKL 3IU4L 1S7TB 3HMWH 4FXGA 4GSDL 5F1NB 1GZQB 2GTWA 4PRHB 5DLML 2BNQA 3PE9A 5IB1A 3ROLA 1RK0B 1E4KC 1JMZA 1NLDL 3V8CA 5JQHC 2VL5A 2CGRL 1FYTA 1MFDL 5E0QA 3WHXB 3CU1A 4F7TB 2ESVB 2YSSB 1E4XL 4PJCB 2P5WE 3MMEA 2X89A 2YWZA 2DB8A 3TIDA 3QNZA 3ZTNL 5I1JL 5C0EB 1J12A 2EH7L 1DDHA 1R5WA 3QNXB 2CK0L 3LCYA 4UB0L 1QBML 5CBAB 1FVEB 5C07D 3WUWG 3MJ9L 1Q9WA 2VDPL 3AAZA 5E6ZA 2X9XA 3GSXA 3EAKA 1N6VA 2VDNH 5C7XH 2J5LC 5JDSA 4D8PA 4CW1B 1F4WL 1FDLL 3CDGA 3DUUB 3QDGE 3D2UD 5HDBF 3X12B 2CRYA 4G9FA 4PBWD 4L4TA 3D3VD 1FPTL 1QVOB 1DE4A 3QB7C 1FFNA 5DK0A 2VLKB 2AJSH 1F58H 5DHVH 4MS8C 3OAYK 5L6YH 4HG4K 5H2BA 4UINL 5D7SH 1J1OL 3SQBA 3RAJL 2AI0H 2B1AL 3CXHK 4JM2A 4PJXE 2MSPA 2DBJA 2WBJB 4HGWA 1L6ZA 2P8LB 1TJGL 3MZTA 1A6AA 1NCBL 1WBZA 2DJUA 4K8RD 2AJUL 2ZUXA 1U58B 1G7LA 1QHPA 5I73B 4QRUB 4HS3B 4OB5H 1H3PL 3VD4A 4EQ3A 2J4WH 5IW1A 3NBNA 1OD9A 3S3JA 5T3XE 1YPZB 2ZWLT 3V5KA 1RZIA 4G8GE 4DN4H 4KUCF 4OCXH 4XBGB 3MNWA 4Y5YA 3FO9A 5L9DH 3V9FA 3E2HB 2O5YH 4J7RA 5CP3H 4DTGL 2CDFB 3BKCL 1DVFC 5JXED 4Z5RA 3DVGA 3KWWA 4K8RH 2JLLA 5CMAB 1CFVH 5MERB 3L3OA 1D9KB 1ZHNB 4WFGD 2E9JA 3GB7A 1ZK9A 3O3AA 1MHHB 3FB8B 1EO5A 4PR5B 5C92A 4YPGA 2NY1C 3DRQB 3ARQA 4MWFA 3PQYA 1NCWH 5CP3A 5C0DA 2P46B 5D1QB 1Q0XL 3TLRA 1AKJB 1C5BH 4HAFA 3DBXA 3OF6D 2Q76A 2GCYB 1GH7A 2FGZA 5JPNA 4EN3B 2J7LA 1T80A 1P1ZB 3T0XA 1T7XA 2DJ4A 3G5YA 5SWZA 2ZSVB 4RIRB 4M03A 1JNNL 3MCKB 4LK4A 2A6KA 5C08A 4YHIB 1BOGB 3MLXL 1J9CT 3CXHJ 5E24E 2F54A 4LCIH 4Z7VB 3UXFA 1QD0A 3B3IB 5CGYC 3UJTL 2D03L 5EIVA 3FFDB 4MXVE 1GGIH 3HG1E 3OGOE 4CDHA 3BISA 1R3KA 3C6LC 3QDME 3ELAT 2A6JA 2GT9B 2R2EB 3TH2T 3ORJA 3C5JA 2D2OA 2Q3ZA 4ZYKA 3KYOA 4LLYA 3O45B 2BERA 1QEWA 5T3XL 5KVDH 1NDGA 3T0ED 4KK9C 4M6OH 1JGDB 1H5BA 4TNWK 4W81A 3IJHB 1UT9A 2G75A 4Y19B 4CDGC 3N1MC 5D2LE 3C5ZB 2IQ9L 4GRWE 1KTLA 2KKQA 3O8XD 4X5WB 2OTUB 3CFIC 3O3DB 3UJJH 4NWTH 5BZWA 1QFWL 5CZVL 4NOBA 2XA8L 1NLBL 1IGTB 3EGSB 3HPJB 5F71A 4PJAB 5DD6B 5LWYL 2ZUVA 5IHUL 5T3ZE 2EEAA 4HIJB 3NIGF 2OBGA 2EDQA 5IVXA 1E6JH 5FCUH 3IAPA 4QF1B 1QR4A 4C4KT 2PF6A 3UTTD 2BVOB 1VPOL 5FO9A 2C1OB 4JFOB 3P2TA 4PV9A 2AKRA 3M1BB 4J3VA 1IM9B 5HY9A 3FN0L 4NZJA 4YHPB 1FNLA 4WUUB 1W8NA 4Z0BH 1K2DB 1U8MA 1QBMH 4KMTL 1KPVA 1L7IL 5F7EL 4NNYB 4HBQA 5ABDE 3FKUS 5ENWA 3QHFL 2HT2D 5GPRA 4NT6A 2FWOB 3WDHA 4LFHD 3KLHC 1CFSB 4U7MA 1OAKH 2GJ6D 1EO8H 3CJJA 3MZGB 4U1MA 1IBGH 4UU9A 3U7YL 1CG9A 1VADB 7FABH 5LGHH 1DBKL 1BVKB 2NQCA 5EORL 4JQVC 4XRCB 2F5AL 4JN1H 2Z31D 4TSBL 4JY5H 5ANMA 3ARYA 1KCVL 3KXFE 3P0VH 3U7WH 4LASH 2CRMA 1FYHB 3LRHA 5C0RL 4R96A 3EDDA 1DQLH 5DK3A 5F3BA 2HTKC 4OV6F 2NY1B 2X5PA 3EYQC 3T3PE 3QCVH 4MA1C 2XV6B 3A6BL 1KJ2A 3BP7B 3IDJA 4ZPVB 2DQFB 1ZSDA 5EC1A 2R2HA 2W65B 2YA2A 4LIQH 5I16A 1PY9A 4JJ5A 2QLVB 2GTZA 1A6TA 5D1XC 4I5BA 1FNFA 4PLJD 4WV1A 5EZLA 5KAQG 1VGEH 1SBSL 1I9IL 2NYYC 1KG0B 4PJDE 3ZT6A 1WWWX 2CD0A 4YDJA 4JFZH 2H3NA 2NR6C 3T0EE 1T04B 1DANT 5CJOH 4LHUB 4G6KL 4GAFB 3C6LA 3K3QA 1U3HA 4FTVE 4FQXD 5E08H 1A4KA 1LILA 1MFEL 5FDWB 1IEBB 3BDXA 4MDIA 2DWEB 1NAMB 3MNVB 3BAEH 5AAWA 4C58B 1BQLL 1A6UH 2J88L 3LV3B 1FAIL 5MHSD 2FIRT 3LQZA 4LRNH 4R4NC 4Y5VB 3LKNB 5T3ZD 4ZFGH 1KN2L 1ZT4A 4P46A 4M1DL 5D93C 2ZG1A 4NQSB 1VERA 5DMYA 3LEVL 3RVTD 1MQ8A 1BAFH 1KIRA 3MNZB 1D3CA 5D4QA 5FB8A 4J8RB 3FJTA 2UYLB 4QOKE 2VZ3A 4Z0XA 1MEXH 4KK9D 3VG9C 4AT6B 3MRGA 5MEQB 1HYRC 4JM2D 3MRDB 2BMKA 2ERJB 3ULUE 4AIXA 1MCCA 2EZ0D 3L3OB 3LB6D 4K3EH 4OD3L 3T3PF 1I1AD 3QNYB 5FUOL 4NDMA 1MIMH 2NY2B 3KWWB 4BJLA 4EI5C 5HYQB 3K80A 1R3HB 2ZNWA 3FT4B 5TGBB 5ETUA 1UM5L 3GMOB 3W11D 3C6LB 3HUJF 1RIVL 1CLCA 3QULB 5DMGC 4G9FD 4XBGA 5EBLA 3CVIL 1UKQA 2E9BA 2VR5A 4AQ1B 5SWQB 4XCCH 4N0YL 3KDMB 2H9GB 3VFVA 1UB6B 5DJ8A 2XN9D 1GHFH 4JRXD 1JNLL 3QPQC 1AIFA 1KEMH 1N4XL 4PRIA 1EVUA 25C8L 2XN9B 3RZCA 2W0KA 2D7QA 2R1XA 4P2OB 3R06B 3BKYH 3DSFH 3RUGB 3F7VA 4LVOB 4ORZC 5I1HL 3K46A 4ZTOL 2OL3B 3BPNB 4LASL 2A1WL 4QGYA 4U1SB 3F7VB 5GXBB 2AEPL 2COQA 2P24A 1BZ9B 1X3DA 1G1CA 1JVKA 1BM3H 1HZHH 1JRHI 4EVNB 1B88A 5ANMB 3RVUC 2ICES 1KT2A 3WXVL 5IJKC 1AD0A 4LLMB 1KEML 1VPOH 1XZ0A 4JY6A 4O5LH 1QSEB 3IF1A 3JV4B 1I1AB 1JNNH 4F33B 1YY9C 3SE8L 1NEZA 3N1QC 2N56A 3H0TA 1N6QL 5K33A 1XCTB 4DZ8B 4R7NB 3WD5H 2XFXB 4MCYB 2Y6SC 3HE7B 1CD0A 4GT7A 3BIAX 1I8IB 4UTBH 2FWOA 4J6RL 3ARGB 4OAWA 1QA9B 3TVMA 1YEKL 3S5LA 5I8KH 3PHQA 4MD4A 3IJYB 5EG6C 4LCWB 5IEKA 3MRGB 5JPMB 3ARFC 1AP2B 4OM0L 2GY7B 4NZDA 1LP9A 5HHQA 1C7SA 5D7JC 3O6ML 4RGNE 2BOCB 2V7HA 1T2QL 3QAZB 1UYWH 3VXSA 1ZHLA 1OF2B 4OI8A 5DRZB 3UTTA 3EOTL 2HKFL 1WFUA 5IW3A 4X7SL 4RFOL 5JR1L 4Y89A 5C8JA 1ZTXL 3G04A 4HWUA 4YHKL 3GJFB 3VFGH 1MCQA 4ZUVB 5I1LA 1PY4A 1KPUB 4LIQE 1MRCL 2BNQB 3IRPX 2Q8AH 4J4PC 4WHTB 1U8LB 3RBSA 2EEDA 2GFBA 4WUKL 5EO0A 2ZCKH 4JDTH 2CLZB 1IGYB 1URLA 3IKCA 5IVXE 2YRLA 4X6CB 3TWCH 4U2ZA 1TJHH 1AR1C 2G75B 4Y19A 1HE7A 1QFWI 3LN5A 2AJZA 3GFUA 4JO1L 1A8JH 1ADQA 4APQD 3B9KA 3SDAC 1FFQA 2FECL 2AQ3A 2WNGA 4NN5C 1QSED 4NFCA 4FN0A 4YDJB 2I9TA 4ZXBB 4JKMA 5HHMB 1IZKA 1J1XL 4Z7OF 4WW2A 1ZT1A 3GIZH 2FJFB 4QHLA 3DRTB 4MQ7B 1I75A 4Z7WF 3MJ6A 4ZUSB 4Q9QL 4M7LH 3QI9A 5IG7B 4D9LL 5L88L 2N4IA 2ZCHL 4LLVB 1F3DJ 3KJ4C 1ZLVK 3F58H 4BH7B 1K5NA 3S8WA 4KI1A 4KDVA 1PKQA 4P59L 3S96B 3V95A 4ENED 2DM2A 4ZS7L 2XZQL 3U1SL 1CBVH 3DARA 4RFNB 1MRFH 3VDAA 2YPLD 2FB4L 3G04B 1EXUA 2C26A 3QZWA 2JE8A 3QA3A 3QIBD 3SDXF 1N5YL 2YK1H 3HG1B 1OTUD 3TN0A 2B0SL 4UNTA 3QXUA 4QXUH 3TA3C 3VMNA 2JJWA 4HW6A 3OKMA 2DJSA 2V5TA 4PUBH 5E99L 4RGOH 4BFGA 2ZUYA 3MJGX 4MVBC 3KNBB 3L5IA 4K71B 4H26A 5HXMA 1F6LL 4IIQC 4BKLA 2YEZA 4P23A 2JCCB 5CIPH 1ES0B 5BVJB 4L9LB 4FQXA 5D6CB 2C9AA 4UAOB 4OSUL 5DMIL 1KFAH 1UH3A 4PJ9C 3IDUA 1QFHA 3FO1B 3LQAC 3S4SG 1X5LA 2B1AH 3KPTA 3GGWB 4GRWH 1IGFH 4UOW1 2A9NH 1KJ2H 5EU6D 3S3PA 1XF3B 4OBSA 3H42L 3DJ9A 5FYKE 5FGRA 3HE7C 1AGEB 3HC0B 5KAQF 3TIEA 5KZCB 1T1WB 4MJ6B 1BWMA 1KELL 2CUIA 2VQTA 1RZGB 1VFAA 1A3LL 4R97C 4GOSA 3MYZA 4JRXE 2R2CA 3ULSB 4YBQD 1BJ8A 1IAII 3T0AA 1I9JH 4RZCB 5HI3C 4LPWA 4FQ1L 3CUPB 2M1KA 4M93C 4KJWD 4PJGF 2P8LA 2FCBA 2IQ9H 5CZKA 3KLDA 2OJEA 1JNHB 1NC4A 1GC1H 2A83A 2Q7YA 3QRGL 3KPQA 2EYRB 2FJGB 2C7UA 4JFYA 5I75B 4E42B 3N85H 5DR5L 4GG6F 5I8OH 2P4AB 1LE9A 3ILPA 5EH1A 1CICB 3MLRL 3O6LH 3NAAL 5DYOB 2W92A 4AEIH 1IC5H 3HMXL 1OOAA 3PV6B 3MV7E 4TNVK 3LRGA 2Q6WB 2NY5L 5DUPH 2JB5H 1YEFH 4AL8H 4LPUA 4MA8H 5GRXG 5HYQA 2MMXA 5GGUB 3P11H 1T66C 1M6OA 2X10A 4P2RD 5AEAA 5C3TA 3O4OC 4NP4H 3Q5TA 4DQOL 3MACH 4N0RA 5HHOE 4KUZL 3O2WL 2PW2B 4U6XA 1GZPB 4FNLL 4ZOBA 1AXTH 3QNXA 4XAWH 4GRLD 4KC3B 1T5XA 1V5JA 4MQXD 4M48H 5DHVB 4Z7QE 3DROB 3RPIA 1OF2A 3RGVA 1ZXQA 2GCYA 4RGMC 1JP5A 4N1EA 1S7UB 4X9IA 4XH2B 3V6ZA 4CU7A 4NHCH 1KUMA 4FZEL 1EMTL 1N5AA 4HJGA 3S34L 3WHXA 1S3KH 1FGVH 2NTFA 5CAYB 2VL5B 2EO1A 3IJYA 4NKMA 5GGVY 4RSVA 5KS9B 1RK0A 4FQQA 5TDNB 5CD3A 3JV6A 1X5KA 2NPLX 1I8IA 4M7ZC 4DVBB 4Z77B 4HWEH 4LLQB 5HYSA 5A3IC 4P23C 4WDIA 5FIEA 1MF2L 2DWDA 1I1AA 2G2RA 3SE3C 3QQ4B 1FBIL 2BSRA 3P3YA 3WO4B 3N9GH 1MQKH 3FO9B 2HFEB 3WXVH 4U1KA 5EOCJ 3BPCB 3JSSA 4KROD 1DUZA 4L9DA 3NIGE 3KPNA 4LKCA 3EW3B 2GUOB 4HD9A 4Y4KB 3S34H 1LE5A 3CNKA 1BX2A 5C71A 5GHWH 2GTZB 3VGGA 4WJ5B 2WBWB 5ACMA 4LPVA 4XXCA 4F7EA 5KG9B 2GJZA 1HHIB 3V5DA 2DM4A 2HKHH 3G5VB 4GKSA 4B5EA 4EQ2A 4DKAA 4S11A 3HS0A 4R96B 3SO5A 2XRAH 1HXMB 3CH1A 3CU7A 5EU6A 3ME0A 4MNGE 2BHUA 3L1OH 4OFPA 3OAUH 1UB6A 4Z7UF 2VZUA 3KGRA 1A6ZB 2XIDA 3P4MB 1GRWA 1I7RA 2HKFH 3HR5A 2XWBB 2UWEA 1P7KB 4RFOH 3NH7H 3L6FA 5F93C 1WCQA 4L9LC 1DLHB 4QGTA 1KXTB 5TGBA 1K6QH 4DOHE 2BNQE 4X6BB 3GKWH 3ZE1E 4FXKA 4WWKB 1MPAH 2K7PA 2F8VA 3CCHB 4G8FA 1TNNA 1ITCA 3VFMA 5DO2C 4HX1B 1TZIA 1ZANL 5TJWK 3LKPA 2MFNA 5IR1A 2AKRB 3MJ9H 3K81A 3K2UL 1H8NA 2PETA 4GBXB 4N68A 4P5TA 1R5IA 4QHMB 2PCPB 4YFEA 4Y16C 5BRZE 4U3XA 5IROC 3NPZB 5GGUA 4K9EL 2QEJA 5JZ7D 5CUSH 3H7BA 2Y4SA 3BD5A 1GGBH 3LZFL 1NGYA 3W5MA 2ENSA 4OCWH 1UCBL 1Y6NR 5F6HJ 2P5EE 2YS4A 2H1PL 2DD8H 3LQZB 4OTXH 5L2KA 4RMVA 1PQZA 1YEIH 4JQXC 4FABL 3CVHH 2J5LB 1S7TA 1NBQA 1XCQB 5GS1A 4P2YA 1A4KB 4JG0H 5K9OB 4Y8AA 5TFSH 1A14L 3RPKA 3NCFB 3RVWC 1Z6JT 2E3VA 1M4KA 3JVGA 4ZTOH 2QKIA 1DUYB 4LOUD 4WIQA 4LPCA 3GNML 1EIBA 1BD2A 3Q6GH 2QTEA 4ODVH 4Z7UE 3FB7A 1S78D 4KK6D 1RAMA 5EULV 1MQKL 1RI8A 1OVZA 1RUMH 4ODTL 3TC9A 3U4AA 4JR9L 1H3XA 1GOHA 3L5JA 4D3CH 1B0RB 3BJLA 3HZVB 3O6FB 5J6GA 5DJ0B 3KYNA 1I7ZB 1RHHA 3HC0A 3B9DA 3LKQB 1QSZA 5AG8A 4KTDL 1MHEA 2OL3H 5IJKA 2RGSA 3PL6A 4JFDA 5DRNA 3VWKC 1FAKT 2DMKA 4AEFA 5DRWB 4ZUWA 4JZOB 3ZKMD 1MH5B 1OAZL 5FYLL 2AJVL 3KPLB 4W4OC 4X4MA 3ZE2E 1HWHB 4JFFD 3FO0H 3HI5H 3SE4A 1RHFA 1RZJC 1EHXA 4IJ3C 1QFUH 3DXAD 1KJMA 4RQQB 4P3CH 3UTQA 4PRPB 1CI5A 5CWSA 2D7OA 4CKVX 1MWAH 4K2UH 2BRQA 1HOCB 4R26H 3PGFL 3S5LG 3EHBC 5I18H 4LP4A 1EJ6A 3BDBA 1NFIB 1FVCA 4Z7UA 4Y1AA 5TF1L 5EOQH 5GRJH 2BSSA 2J2ZA 5H35A 2IJ0C 4R4BA 3QA3B 4IS6B 5L2KD 1PYWB 25C8H 1MH5A 1A7OL 2QHRH 4DKEL 3VFRA 4O2EB 5EIQA 4HKXA 3NZHH 3VFPA 3LZFH 2AV7A 4M1CC 5LVEA 4Y4KC 5F9JB 4XNZC 1RZIB 3PDGA 3MXWH 3BH9A 3B83A 5DMJB 2VXUL 4F57L 4FQLH 5FM8A 4G6FD 1K85A 2HT3C 3C2AH 3IDIA 4XCEB 2P5WB 1KENL 4RCAA 3MGTB 4TVPE 1F4AA 3E2HC 1UG9A 1OSZB 2CQVA 2XYCA 5T33H 5BZWB 4UBDC 1M05B 2O5ZH 3TBWA 3BYTA 3EOBB 5HTSA 1GL4B 3Q6GL 3DXAB 2HVJB 4XAWL 3TBTB 5J6HB 2ZZUT 4X6EA 5F9OL 3AXLB 4NJAL 4B0MM 5JOPD 1B6DA 4WTWA 4O51A 3KYOB 2VR4A 4WHTA 4PYGA 3OAUL 3SQOL 4LRIC 2IQAB 1SQ2N 4U4BA 4X7TA 3FZUD 5JQ6L 4GRWB 5DGRA 2DQGH 3NN8B 3GMNB 1X5YA 1QQDB 3STZB 1KGCE 3HZYA 4Y4HD 2A9MH 5F7YC 3C5ZC 3EOYG 4WWKC 3NAAH 1Q9OA 1QNZL 5DHYB 3SO3B 3PXHA 4IM8A 4KK6C 3RNKB 1QSFD 4I0PB 5GGRY 3MA9H 1WEJL 1TETL 3IFPA 1PW3A 3ILQD 1BP3B 2SEBB 4DKDC 5FO8A 1L7IH 4TYUA 4NCDA 1DQMH 2MOVA 4PB9L 5MEND 5TE7H 1Q9OB 1KIQB 1WT5A 1LO5B 2ESVA 2EZ0C 2JJTC 3PQYD 3UAJD 1JWUA 2FATL 4JHWL 3M17B 1GAFH 2C3XA 2IALA 1HEZA 4PJXF 4K55A 1LO0L 3UPCA 1NCCH 1NGZB 2A6DA 4NN6C 3B9VA 5D2NA 1I7RB 4DN3H 1XIWB 5MI0B 5B3JE 5GZOD 3VRJB 2C5DC 4D0DA 1SVCP 1Q94B 3QEGH 3D3VA 1OAQL 4I8DA 1HQRA 1NKOA 4OI9A 4C56B 3NFPA 3MFFB 3KPRB 3RFZC 3AS2A 3EOAA 1C5DB 3OR6A 2EXYD 1S5IH 4XTRC 1PD6A 4NBZB 1SJHA 3VGHA 1PZ5A 3MJ8A 2R23A 5BCAA 4P2OA 2X4NB 3KPPB 2X4SB 3ALPA 4EI5B 3GMLA 5EN2A 4JQIL 4AEHH 4OD1H 1B0RA 4YC2C 1T0PB 1GIGL 4S10A 1M71A 4IDJL 1QR1B 4OGYH 3KPPA 5IKCB 4BH8B 1FNEB 2HLAA 3ROOA 4F58H 4KGLA 4TTGA 1U58A 5HD8D 3LKSB 4Z0BL 1A6AB 1UWXK 1AO7D 4RMQA 3QISA 2BK8A 2IAMB 1Q38A 4YFDB 4LLDA 4NUJA 3ZYOA 5IEHA 5AWNH 5C0AB 4NGHH 4WCYH 3ARBB 1JWSA 5IUSA 1U8QA 2BHZA 4D9RE 4P2QA 4EEEA 1Q1JH 2UZIL 1QHOA 4G6JL 2BMKB 5I2IB 3HC4H 4KI5E 1ITBB 4A6YH 1R3JB 1R3LB 3MRQA 1NBYA 4RMTA 1SVZA 1L6XA 5HYSG 1Y18B 1YY9D 4L4TB 4NQCE 3QIUB 2XY2A 2V5RA 2ARJQ 2FR4B 1YC8A 4RBPH 4U1NB 3RU8H 2P7TA 4NBYB 4OZ4A 3WNLA 3UTSD 3RIAF 1IM3A 1QP1A 1NEUA 1R5WB 3IFPB 5HDLA 3LN4A 4IOIB 4JM2F 4G42A 1ACZA 1TMCB 1MRDL 3RI5K 3G5ZA 5E7FA 1KACB 1MIEH 2V2TA 3PL6B 3D87B 2BXZA 4UIKH 3F6IA 4I18A 4Q9RL 3I6KB 1CFTA 1NL0L 3QUMB 1FYTD 3CFJB 5LBSL 3U9PL 4U7SA 2H2PC 3HTLX 2A74B 5E56A 3NN8A 2XN9E 5IV2B 4P5MB 5C0FA 1C5CL 3OSKA 3QRFM 4ODHH 5SX5H 2LVEA 4NHUB 1QSVA 3VCLB 5ACLA 3QXTA 3JWOC 3FMGH 3O6LL 1B2WH 3AXLA 2V2XB 3HAEB 2WM0A 3ILQC 4LSRH 4YX2H 2QSCL 3OKDA 3FO0L 2XQYG 2GSIB 1D5ZA 2DF3A 3MOAL 3MFGB 3RWFB 3WEXA 4KPHL 3ZT7A 4Z7QF 3SBWC 1X4XA 2UY7A 3ARPA 1ZLSH 2NY5C 5T1KD 1D6EA 3MRLA 4PJBF 2G5RA 1R6VA 5FKAA 4NHCL 5FYJE 3MRNA 4EN3D 3QEQB 3IFNH 4X5XB 1A7PL 2VZTA 4WY7H 1I8MB 4H0IA 1WV7T 4L8SC 2AV7B 1B3JA 3D0VB 4XNMB 4JFEB 4PG2C 2P5EA 3WNPA 3QI9D 1IGCH 1T1ZA 1EHLL 3SKNB 3RJDA 4JGUA 1EX0A 2GITB 3J8F7 3L5XH 4XVUC 3RVXC 3TNMB 2ICWI 1IE5A 2OTPA 1G9MH 1FO0A 1IT9L 4PJCE 4YC2B 3BP6B 3PHSA 4LNRA 1INQA 5DUML 4XP5H 4APQA 3VXOB 4JFXB 4DWHA 2E9WA 4P3CL 5J4MA 4F15C 5IMOB 5E1AA 2BVPA 3T0EB 3VFWA 5CJXA 3P4MA 3PUCA 1MFDH 3TN0B 3MBEA 3CVHA 3QUYB 1XMWA 5E08L 5TDOB 3RKDC 1WZ1H 1FE8L 5ILTH 2ID5A 4JANB 1HI6A 1JN6B 3O3BA 4NO0D 3BPOC 3TYGH 2HH0L 3N0PB 3F8UB 2AK1L 2YXFA 4G3YL 1VCAA 1QLFB 4NFBA 1D5BB 5IB4A 4IRZH 1MSPA 3C5ZA 1C12B 5D1ZD 5DD0L 1I7ZA 4XWGH 3H42H 4WJ5A 2F53B 5IQ7L 1I3UA 1L4IA 4NWUL 4D0CA 4XP9H 3U0PB 4YZFE 3NMEA 1I8KB 3EDKA 5CJ8A 5MENE 3UPAA 4LHUD 4QNPF 1NGWA 4ZXBA 4S1SH 4MD0B 4UDUA 1U93B 4M6MH 1ZLVH 3SE8H 4XNQB 4MJIE 5J0BA 3BKMH 2Y06L 1TQCC 5HHME 2H2SC 1CU4L 3GMRA 3AREC 1CD8A 3B3IA 2CLZA 4M62L 2DKSA 3KLHD 4Q0XH 4XPAL 4UTAL 5I1CL 3Q3GA 1HHGA 2D4DA 2VDRH 1UQSB 3K7UA 4PUBL 3CVIH 3U4EB 5INDA 1NUFA 4M3JA 1O0VA 4L3EB 5C0GA 5IMKA 4YXHL 2XQBL 1WCBA 2DOCA 1ZA6A 4X5LA 3EOTH 3MROB 2Q1EA 2PTTA 3M07A 3O0RL 1UM4H 3JWOL 2AEQH 4AEEA 1CICC 4PR5A 1OGTB 3OBAA 3RVWD 1ED3A 3DO7B 4PJ8B 4ETQB 2AXGB 2EIDA 2OXGA 1KLGA 1A1OB 2MKLC 3BSZL 5E2WL 2A73B 5C7XL 3VRLE 3DX7A 3NFSL 5ECJE 1ADQH 3IDYC 2MCG1 2E7HA 3S97C 2BFVH 1EEQA 3BO8A 2ZKHL 5J13B 4WI5A 4P49A 3DUHA 2BNRB 2VDLL 5DWUH 4JRXB 1TCRA 2ARJA 2AXFA 2H8PA 2VXUH 4J3XA 3TO4D 4X4ME 4F57H 1M7IA 4TSBH 5JUEL 1CXIA 5JZ7C 5D70H 4NQDD 1WFTA 5SX4H 4NQVB 4RX4A 3V5KB 1PG7W 3PP3H 1UXWA 1G7QB 5DJXB 43CAB 3RRQA 5JDJA 2MWCA 3VD7A 3I02B 1X9QA 4TQEH 3LDBC 2ZUQB 4MZ3A 2ZP0T 4OLZL 5I8CA 1DBAL 1PKQB 1EEUA 1RJCA 3LKSA 5D2LF 3VXTA 1T1XB 2O5XH 1OAKL 5SWZE 3SGKC 3JWDH 3HNSH 5I15H 4F15B 5E2VL 3CX2A 3MYJA 1T2QH 3FZUC 4X9HA 4OLWH 2RJMA 1CZ8L 3SDAA 5GGTH 1RU9L 4F9PC 2Q7NA 4KDWA 3MLWH 4JCMA 4PBVC 1UCBH 2GY5A 3H9SE 3MLRH 3TV3H 1Q0YL 2FBOJ 2HN7B 4ACPA 1EO7A 4N8PA 2Z35A 3BO8B 1UJ3A 4CADA 1T66D 1YQ2A 5HHOD 1A22B 3P0YL 3DUUA 1CD1A 3H7LA 4HJ0C 3WD5L 1X5XA 4D0DB 3ZHLA 4LP5A 3NA4A 4P9HC 3IDGB 5AUMA 4NKDA 1IC7L 2LVCA 3FFCA 1CLOH 3ZYIA 3NCMA 4H0HB 4HS8H 4GG8A 5KN5A 3QQ3B 3V6ZB 3CFBA 3MNZA 2YSSA 1JZ2A 3O4LD 1YY8A 5IMKB 3I6LD 5DHVA 1A6WL 3HI6H 5I0DA 4XBPA 4P57A 1D5XA 1MFCH 3SPVB 3N1GC 2FLBT 3UTSA 3ECBB 3RNKA 4PJXA 4LCIL 1YA5A 4JAMA 4ZFGL 3RJQB 4DZBB 1F11B 3C5SA 2JCCF 5ACZA 4M5YL 1LDPH 4UV7H 1KC5L 5EU4A 1HHJA 2DYPD 5DYOA 5F72S 4M9PA 3SKOB 4I2XA 1JZ7A 4FQHA 4WI6A 2FIKB 2PYFB 1YYLL 1ZWIB 2C7UB 4Z7VF 2I9TB 3LOWA 1OQOA 2NXYB 3U36A 3FOMB 3MREA 4PLNC 5A2KH 2QADD 1ZT7A 4EBQL 2XWTA 3VXQB 3P30H 5I1DB 1KB5L 1T4KA 1IILE 4LSPL 4MJ4A 4DCQA 3DYOA 2V2WA 5I74C 1NCNA 3RGVD 4IJ3B 4YX2L 5C07A 3ULSA 1E27A 1AJ7L 1CFQA 1BBJA 4MDJB 3RWHA 3DGGB 1E4WL 1AY1H 1U8NA 3DIFA 5D7JA 1FPTH 4H88L 2VE6B 3P9WB 1YC7A 3GJFH 4LSDA 5F6IB 4TN9A 4JKKA 1F3DH 3FFCD 2XZCH 4PJDA 1IL1A 4ELMF 5HPMB 2J1KA 3T1FB 3VFRB 4JFXA 1UA6H 3ULVD 4J3SA 1MCNA 5C0JA 3GMOA 2ADIB 1LVEA 1R3HA 3EYVB 2B39A 5BRZB 1KLGB 3ZO0A 3SCMA 3IFOB 4P2QD 5IK3A 3HE7A 3WIHL 5GRVL 4ZXBD 4HS8L 1T0MA 1K2DA 1VB9A 4K94H 5AZ2L 4QXWA 1CGTA 1NEZB 1IEAA 1Z5LA 3T4AA 5ID0B 2XOTA 3KNBA 2NXYD 4PLKD 5JTWA 1XZ0B 2NW2A 2VLRA 3RGVC 3HZKB 5JW4R 1FRGH 2VXTL 3SJVD 2YPLA 3D85B 4I48A 4UQ3A 4W6XB 4Y7MA 2B1HH 4JG1H 3VXRE 1K9TA 4EUPH 1R5VA 5K9QG 1EXUB 4WRLA 1X44A 3OJVC 3DGGA 1EJOH 3ZSTA 2P24B 1XF4B 1KYOK 1UACH 2NY3B 3Q3GB 1CE1H 1NGQL 1OTTD 4HS6B 3MNVA 2B7DT 3GBNL 4YHML 4A6YB 2NY3C 4PRDA 2HT2C 3LIZH 3T08A 1W8OA 4BQBA 1WTLA 3NIFE 3PJSA 3VXMA 1XGTA 2EE6A 1KCRH 2P8MB 1MI5E 3EYSL 3ZDZF 4BQ6A 3G08A 3GIZL 2XKNA 4WW2B 1CCZA 4GKNB 3G6JF 2AS5M 2BNRE 1J88A 2VUYA 1VKXB 3HAEG 1OAYH 3V4PH 4OV5A 4PS4H 5DJZB 4PJBA 5ESQB 4R6UA 4HCRH 4TUKL 5EC1B 1JYNA 1MRCH 5F7EH 1W72A 3ESVF 4YUEH 4XMKH 4M9OA 4OLXH 4TPRL 1MJ8H 5FECB 3VXMD 1XCQA 1D5BA 4TUOA 4GH7B 1YEFL 1U36A 2WP3O 3WV0A 1EFXD 3VGAB 5SV4A 3G5ZB 1K4DA 3GIVB 4NO2B 4XC1L 4I0PD 4OQTA 3ARDC 3D85D 1HHHB 5C0CE 5DD1L 1GC1C 2IBZX 4EDXA 2AJUH 3EZ8A 3NFSH 3ESUF 3I75A 1T0NA 1YN7A 4P46D 4P5TB 2X44D 5DZLA 1AKJA 1I85C 3MODH 3Q1SH 4D9LH 3VD9A 2YD3A 3FRUB 4ZFFB 5M94B 4NQSA 3PQYB 4KZEH 1UJTA 4KZDH 2W38A 3DRQA 2XQYK 2FO4B 3MPCA 1VDGA 5IEKB 1WAAA 2APWA 2J6EA 4NNPH 3QPXH 4LCYB 3EFDH 1TETH 1G9EA 4P3DA 4Y2DC 2LV4A 3SDCD 5ID1B 4I3SL 3CDFA 3QXWA 1UB5A 1A14H 1CD1B 2QQLL 5BS0E 1CGSL 5E2TL 4F9PA 4PG2A 4PJGA 3RL2B 2P44B 5DTFA 2NY7L 3CPLA 5CS7A 4F33A 1K8IB 1DQDL 1KEGL 3ZDZE 1S78C 1UJ3C 1OPGL 5IB2A 2VISA 4X99B 4HUKB 3G6JE 1PLGH 3VFSB 3EZJB 1QR1A 4LOUC 3QIWA 1QKZH 1A6TB 2Z92A 4Q6IA 4X9GA 4X7SH 1F13A 1Y0LA 1YNLH 4WU7B 2VAJA 3DSFL 2DQDH 4JRYA 4HUWB 1SY6L 5C07B 3EYFA 3BP7A 1G7LB 5KSAC 5DS8A 2VDQL 5F3BB 4CN6A 1IEHA 3E8UL 3ZKND 1IM9D 4HIHB 4MAYD 1H5BB 4BFEA 4YDVB 2NZ9D 1X4ZA 4RDQF 3BAEL 1HQRB 3MREB 4PRIB 4NQDE 4LPYA 2VLME 3FRPG 3C87A 4KQ4H 3WFEL 1YNKL 1BEYL 4NKOB 4NQEB 4Y1AD 3SKJL 3K2UH 4ALAL 4V2CB 4YBLC 4I4WB 3VXUA 1RZFH 1AHWB 1UC6A 4NN7C 3OJDB 4JVWA 4LAJH 5I1KH 3LS4L 4FQJH 4LLQA 3OKYA 1U6AH 3KG5A 5MHSE 4UT9H 4YHNA 1RVFL 3DX7B 4NGHL 3AU1A 4EOWH 5TE4L 2NX5A 2AXGA 1KPVB 2VUOA 4JVUA 3AROA 5D1ZA 4KROB 4IMKC 3ZYZA 3MRDA 1AI1H 4OLUH 1MFBH 5ERWB 1IM9A 5HY9B 4S1DC 5C08D 2BY2A 2EDRA 3H9SD 4PLJC 3WSQL 4Z6AT 5D1XD 1S7UA 2AK4E 1FNSH 4KK8D 5GS2H 1E4XH 4L1DA 4OGZA 2G60H 3MRFB 1TENA 3HZYB 1QBLL 1WIUA 1XH3A 2F19L 3VI3E 4FG6D 3DURA 1ND0B 5HYJD 5EU3B 2HKHL 2DWEA 1JF5A 1FJ1A 4J1UA 3MLYL 4HXBH 1FNGA 4NQED 2NW3A 3CDCA 4WO4B 2IAMA 1WAAF 1Q9LA 3QJHA 5D7LD 4M7KH 5IESL 4CMHB 4PRPE 2R1WA 3U82B 4QRRA 4FHBD 1OTUC 1IFHL 3RTQD 3QO0B 3LAFA 1V3LA 4XBEL 5GZNC 2R4SH 2HJLA 4QO1A 1WIPA 2E6QA 3L3GA 1MI5D 2C3HA 5CHNB 2DIBA 3RDTD 3SN6N 1G7JA 1S9YB 3HE6C 4ZD3L 2X4SA 5I1GL 5IHZA 1CK0L 4RNRB 1B4JL 4DGIL 5DJCA 5BQ7A 4AY0A 1DQLL 2IANA 1WEJH 1N6QH 4HKXB 3LKRB 2GSGA 1IMHC 3BZEA 3QDMA 4N1CA 1WICA 2VTFA 1O5DT 3CLEL 1CGWA 3K4DA 1QSEE 1PSKL 2A6KB 3WIFA 2CKBH 4F37F 4R4BB 3KYMA 4L4TE 4NQCB 3RDTA 3V2AR 4L5FL 3W2DL 4G7YL 1DBJH 3QUXC 4AIZA 2NYYD 1X7QA 2LABA 2ARJB 4QT5A 1UH4A 5GRUH 3S37H 1HEZB 1KJVA 4GRLC 4MQXC 3VFGL 4KI5C 2ADGA 2GJ6B 1QLEL 1RZKH 3QDJB 1PZUB 1N2RB 3GGWA 2DL9A 5JNYA 4PRPA 3BEWB 3VRLF 5K93A 2YUXA 1CFSA 4NNPL 4LNRB 4NZRL 4RBPK 5GZOC 3SCMB 4WO4D 4LAQH 3T65A 5CMAA 2NY4C 1HHKB 3BIKB 4OKVB 3D18A 5GS0D 3G9AB 3L5WB 4PJ8A 4H20H 5FA3A 3BESR 1RVFH 3ALWA 3P73B 4TQEL 2RBLA 1MJUL 5A16A 2VC2L 2H45A 4PV9B 4JFEA 4UUJB 4N90E 2E8ZA 2ZJSL 1JPTH 1Z9OA 2I24N 4GXVH 5L2JB 5IVXB 4KKBC 1U41A 1JTTA 3S88L 5DJ0A 1YDPB 4LSSH 4TULL 3PHOB 1HQ4B 4YNYA 1CFQB 1IAMA 4S0SD 1V8HA 3SJVA 4GW5A 4OFYD 1FGVL 1UXSB 4CVXA 2FJHB 3PL6C 2JELL 4WUUE 3BN3B 2Y6SD 1ZHBA 1I3RB 1BZ7B 3WLWC 3FMGL 4DCQB 2EDLA 4LLVA 15C8L 2XWTB 3EO9L 4LU5L 1JGDA 5DDHB 3ZZ1A 3MBEC 2CDEB 4HFWA 1KPRB 1F2XK 4WFHE 3MUHL 4FP8H 3ARGD 1LP9F 2EICA 3VH8B 1PQZB 1AC0A 4AMKH 3WLBB 2AABL 4YPJA 1NC4D 2VDKL 4PP1D 1VFUA 4OUUB 1MOEA 3WL9A 5E00B 4XNYL 3KPSD 3RY5A 1NGXB 3MV8D 4QLRA 3F5WA 4XP6L 3ZDXE 5HHVH 2GFBB 4X7EC 4KKNA 2F54B 1CGSH 5E2TH 2V2TB 3UBXG 4O2EA 4LSVL 3UZVB 2NY7H 4GAYA 4ELMA 3QUZB 1BOYA 2HMIC 3VWJD 1RUAL 1U42A 3EFDL 3DV4B 4XC3L 1OSPH 4MB3A 1UWEL 3MBED 3D18B 5CEZL 3PWNB 2QSQA 5E5RB 2H32B 4DOHB 3OHXA 3MLVL 3CK0L 4PRIE 3BFOA 1FC1A 3C08H 4FFZL 2VLLB 1LWRA 3V6FB 4BYHA 1MVUB 5B22A 5JHLL 4NM8L 5CZXC 5E6IC 4MD4B 3PWVB 4D9QE 3BP6A 4X8JB 1B2WL 2HH0H 3L3JB 2LQRA 3KPMB 4CVUA 4G3YH 5T1LD 1P53A 3E6FA 2GITA 5JIIA 4HKBB 5D9SB 2DQEL 1TCMA 4JZOA 5DFTA 5IFJA 4JGMA 2EKJA 3B43A 4QYOA 1S7WB 4EIGB 4JY6B 1KXVC 3MNWB 3SY0B 4HK0A 1OAUL 1AD0B 4PJ8C 1HHIA 2NY4D 1IAIH 4UT6H 3HNVH 5IHZB 4LEXL 4NM8H 5I9QB 4K9EH 3S36X 2J6EL 5T1MB 2JTDA 1XGUB 5DFWH 3VWJB 4FFYH 1KN4H 5JXAL 2XZCL 3BKJL 4PJ9A 1RIUH 4WFED 4O4YL 2LE9A 1NQBA 3NPSC 3L5XL 5MENB 3W0WA 1CD9B 5CD5D 1A7RL 1MCHA 4OQTL 2Z91B 1EGJL 3RZWA 2MPAH 3CGTA 3INUH 4XNUL 5D7IE 4YDLC 4H25A 2Q3AA 3QWRA 5ISZD 3VCLA 5EZOH 3BUYB 4FTVA 3R0NA 1NEZG 4LSUH 4HLZH 4WGWB 4L4TD 1OAXH 3QCUL 5DRXB 3MLWL 2F54E 3DETC 3TCXA 2X4OA 4MLSA 2ZCHH 5B39B 3GMQB 5M7QA 4FZEH 1AGBA 1R0AH 4U1IA 2BCKA 1CL7L 3VG0L 4PRNB 3RWCA 3X3GL 3VXSE 5C0IB 3VFMB 2X6MA 4N8VB 2HLFC 5HPOA 3RWCB 32C2B 2GYSA 2NX5B 5FM5M 1FLTX 3SDDB 3KXFB 1NCBH 3U48A 5DC4B 3TFKC 1NLDH 2CDGB 5B21A 2UUDH 4XXDB 3VXRA 4NYLA 1KB5B 1KSRA 1NL0H 3SQOH 4C54A 5I1AA 3S88H 2WSKA 1I8LC 3HCVB 3HMXH 3QH3B 4AEIL 4KQ3L 3OKNA 3GO1H 4OQ1A 4P4RA 4S1DD 4XPTH 1CQKA 1EPFA 4WY7L 4UDTB 5DQJA 2O26U 5CLWA 3VFOB 4N8CL 1CK0H 1MIML 3H9HA 4NM4L 4DGIH 4M00A 1ZGLA 4FOMA 5D72L 3PP3K 2QHLA 3RNQA 3S4SA 2QQKL 3TZVC 3ES6A 4L1HA 8FABB 3WFCH 4UV4L 5DJYA 2K9UA 5BW7C 3CZJA 4NRZB 5AZ2H 2VOTA 5KOMC 5E94B 3Q1SL 1NBZB 5JOPE 3F6LA 3LS5L 3K74B 4Z78B 4MXQD 1SMOA 4M7JH 4XPFH 3OJ2C 4LQFH 3LEXA 3VFSA 2R8SL 2YD9A 3O8XC 4LEXH 2EDBA 3Q2CA 1C12A 2YRPA 5F9DC 2BVYA 4XP6H 3MUY1 1C5DA 1NSNL 3CFCL 1UFUA 1GXEA 2DWDB 1NPUA 3G9VA 3V7AG 4OT1H 1DEEA 1FFPB 3FQTA 2H6PB 2X41A 3CIQA 4BK4A 5CJXC 3JV6B 4GRMA 4P5KA 3NABL 4WEUD 4QCIB 3CLFH 5E70A 4EUPB 1FVCB 3QXDB 2BSED 4HFUL 5ICZA 2F74B 5E1AB 3T0EA 2RIKA 3T04D 4IDJH 4E0RB 2NTFB 1LEKA 4PGDA 4XGZA 3UO1H 3WDIA 4FFWD 3O4LE 4XPHH 1A6VL 2FLRT 4BSVA 1H0DA 1WBXB 1P6FA 2H32A 1OP3K 1TZHB 4FQXC 5FKPA 1YEKH 5I8KL 2YD6A 1WQVT 1XGPA 4XVSL 4ELMB 2NR6D 4L3AA 2KDGA 1VESA 1CLZL 4X6DF 1YNKH 5I30L 3EUUA 1MHEB 4JREB 4ONHB 1E4JA 3MRCA 1GSMA 4HPYL 5GRZA 5CLTA 3LKQA 3PDOB 2G5BA 5JOEA 1WTGT 4OV5B 5JW5B 5E8OA 2YPVH 2R4SL 3MV9A 3FQNA 2NY6B 3C60D 4NN5B 1ZT1B 3MQIA 1DBBH 1NMCB 2AJYH 3RTQA 43C9A 1KLUB 4O2FB 1CT8B 3ETBF 4HH8A 4D0BB 4HIEB 4HQQL 4OLVL 3OB0K 4NC2B 2CDEA 3QHFH 1DUYA 4L29B 4ZTPH 1Z3GH 2X4RB 5FYKU 3BKYL 1S8DA 4C83B 3BDYH 3MRMB 2XZAH 3QXVA 4CJ1A 4RWYL 3I2CH 5TE4H 1M05A 3V5HA 4I9WD 2A6JB 2ZUTA 4Z76B 5EO1B 1SHMA 3HI5L 3PHOA 2B8OT 1LO3H 2FHFA 3JV0A 4ZSOB 3T2NH 3FQRA 5F9JA 1S9VA 2VDLH 1RZ7H 4GW4B 5DWUL 1N3NA 2VWEE 1JGEA 4ERSH 5ID0A 1LP9B 4G6MH 4JM4L 1J8KA 3WO3B 4RGNB 3CFKB 5FUOH 1MHCB 5FA3B 1BF2A 4P2OC 3DMMB 1QA9A 2VDQH 4OKVA 3T65B 4LSRL 3W5NA 3MRRB 2OR7A 3A6BH 3SGEH 4Z7WA 1HOCA 3CLFL 4IRSA 1FCGA 1CDJA 1R3LA 1R3JA 1QSEA 3IF1B 3WS6C 1RPQA 5HPMA 4X6CE 1QFWM 1BREA 5ALCL 2FX8L 2QJDA 4QCIA 4X98A 1ETZA 2JB5L 4LSTH 4Z5RB 4OI7A 4NUGL 4LPTA 4MVBD 3GBML 4JFDD 4HSQA 4P9HL 1OP3H 1FQ9C 3I84A 3QUYC 5DK2B 5GS0C 1MFEH 5GGSY 2YUVA 2V6HA 5LJYH 4B7IA 4FQ2H 3CLEH 3P40A 4YE4L 4NJAH 3QIBC 3QIUC 1XR8B 1XR9B 4OF0A 5B4MC 5JIHA 4M5ZL 3FOMA 5F3HB 5BJTA 2D03H 4PGEB 3HZMA 1MCBA 2DTML 3P77B 4E41D 5JW3H 1AGFA 4OCRL 5E2UH 1CGVA 3CD4A 2YPVL 1SJHB 4HAGA 5DJYB 1ZLUH 5SX4I 3WE6A 3HFMH 2XACC 5TE6L 1F90L 5CEYB 1KELH 1OLZA 4J2XA 1IC1A 2OP4L 1AGCB 3H9HB 3MLUL 4KMLB 2OZ4A 2ATPA 1XIWA 1QPPA 3TO4B 1KGCD 4JFQB 4Y2DA 3MO1B 1NC2A 4Z0XB 3CXDL 1ZHLB 1O7SA 2IMMA 1QYGH 2HVKB 1CTOA 3SKMB 3QQ9D 2YR3A 1L9MA 5E8DL 5E9DB 1UM4L 5C0CB 4CN4A 5IR1B 1JHTA 2Y5TA 4X80L 2YA1A 1AP2A 3T2QA 4N8VA 4DQOH 5FF6A 2F5BL 1TJGH 4H8WC 4M6ML 2UWEE 4OLZH 4YHMH 3PQYE 4YWGL 3P0GB 4FXKB 1MFBL 3LIZL 5DJ6B 1BQLH 4M6NL 5FDWA 3GMQA 4UQ2A 1OW0A 1XCTA 4ODXB 2EKSA 1ZV5A 2M2DA 4BFBD 3STZA 3PV6A 1T7YA 3L3DB 3OXRB 4MCZB 4YHZH 3U30C 1A5FL 5EFIB 4WHCA 1F02I 4ZOEA 2JJSC 4GKNA 5IFHH 4OCLC 1BFTA 1P4IH 4YAQA 4S0TD 5CJQH 1UWXH 3FB5A 4Q6YA 4WNQB 5F3HA 2A83B 5ADOH 4JJ5B 2Z91A 4X6EB 2VERN 4F58L 4Y16A 1JWMB 3JUYA 4K3EL 3WFBL 3FQUA 4F9LC 3HS0B 2ZUUA 1CFVL 4GBXD 2NX5E 4N8CH 2E7LA 3FHAA 5DUBA 4LF3B 4GW1A 2X4QA 5I8CB 4GW5B 2W0FB 4FMFA 5IHBA 5JHDD 1RZ8B 3QDMD 2W9EL 1K8DA 2P5WA 2DN7A 4PJ7F 1R5VB 2VRAA 4EI6A 4Y4KA 4Q6IC 3GHEL 1HKLH 5FGSA 4E9LA 2BVQA 3KYKH 1OM3L 4NKQB 2CGRH 12E8H 1PG7H 3KR3L 1VFMA 3SCMC 4MSWA 2NW2B 4U3HA 4POZC 5CKGA 5F1IA 5FOBA 3W9DA 2IFGA 1MWAA 4AJ0A 3HR6A 1T0MB 1FNAA 4H1LG 4DVBA 4Z77A 4WFGE 3HLAA 1UB5B 3RP1A 2VB5A 2H26B 2C1PA 2VH5H 2QQLH 5I30H 2AEIT 3WNKA 3BE1H 3V6OA 4GQ9H 4QRPD 2OQJA 4XP4H 4EUPG 5HYIA 3O9WC 3ULUD 1ES0A 4MMZC 2JCCA 1RZJH 2ADIA 4JDVB 2VNCA 1I1AC 1YN7B 4PGJA 3U4BL 4KRPC 5JOFB 2OZ4H 1AD9A 1INEL 4JM2C 4ZSOA 3BP5B 5T5NG 3AB0C 1X6LA 2KPNA 2BRRH 1AQKL 4XPBH 4K3JL 2PXYC 1BFOA 2P1YA 2XY1A 3U1SH 5GIRA 3QG6A 3M45A 3DYPA 1JYXA 1EGJH 4U2YA 4QTHB 1HHGB 4PV8B 1FYTE 1HH6A 4Z8FH 3WS3A 1DQML 1YMHA 4PJHB 5E5MA 2OYPA 3UBXB 1IAKA 1NLBH 4U6VH 1NUNB 4U0RC 1S8DB 1V3JA 4G8IB 3E1F1 1FIEA 1T22A 4O02L 5E00A 4E5XB 3OL2A 1F3JB 4MHHI 4S2SA 2J4WL 1BD2D 2I60L 1NCDL 4ZNCD 4X7DC 2GT9A 2R2EA 5AZEL 1NCTA 2FJGA 3SKOA 5DMIH 5ICXB 1BD2B 1NC4B 2VDOL 5E8OB 3HUJB 4NRYA 4CVZA 4G6AD 3QUMH 3RWEA 4Y5VC 1U3YA 3NFNB 3B8YA 5A2JH 3ARED 3WKML 4WW2F 4CNIA 1JUFA 1VACB 3OZ9L 1XF4A 3TBSB 3BN9C 2WBJC 4U33A 1YJDL 2X1XR 3FQWA 5KANG 2OS7A 3LY6A 3TIEB 1TZHA 3EKCA 3RIFF 4P5TD 1PAMA 4V1DA 8CGTA 3MBEB 1WBXA 1YMMB 3RA7H 2YN5A 5DVOA 4Z7NF 5ICYB 4OLWL 2ICEA 1KIUA 4NQXB 1KIPB 1RD6A 1BVKA 1RK1A 4JG1L 5GS2D 3QR2A 2IFFH 4J6RH 3DX8A 3B5HA 4XNXH 1KULA 1FZJB 1RIUL 2Q86B 4XB7A 3CCHA 4YO0A 2GJ6E 2BVEA 2QSCH 2H26A 1I9RH 5K9JL 3AMLA 3MLYH 4HXBL 4YHNB 3FQTB 4HUUB 3VJ6B 3WFZA 5TH2B 2R4RL 1IQDA 3OQ3B 2DQIH 3TA3B 3BE1L 5C0JB 3DVFA 4F7PA 4WHDA 4M7ZB 4NQEE 4KGJA 5AAMA 4JFOA 5JQ6H 5F1SA 1YMMA 5E99H 3QFDA 3C9NB 3EDEA 4OFIA 4YHKH 1KBGH 4JKPH 4OZFB 1LP9E 3B6SA 3EGSA 3HPJA 4Z8FL 4Y2OA 4R26L 5HHXH 3VXUE 5JR1H 2X4QB 3VFNB 2GSGB 3QFJA 5CKAA 5L8KB 1MFNA 3SGJA 3VXTB 2FDBP 2Z93B 4KUCD 3WUWA 1ONQA 1JWMA 3SGKA 3QI9B 6FABH 4JLRB 4JY4A 1B9ZA 5CGMA 1MCWM 1OQXA 3BIBX 5GGQH 1BFSA 2HA1A 5CHNA 4F7CA 4DEPB 4UDTA 5DQJB 4ZNEE 4X6DA 4X4XB 4NHUA 2DS4A 3W81A 2PYFA 2YD7A 1A4JA 3MV8E 4U1HB 4JB9L 3MXWL 2GJJA 1MFAH 3HCVA 3QULA 4PRAB 3IKKA 2X1PA 5T3ZH 1Q9LB 3QQ4A 5JLZA 2EYSA 5ACZB 3TA3A 1FE8H 5ILTL 3K8MA 3UYOD 4X6CA 3KPRD 2ADFL 4XXDA 1SYSA 3MOBH 4WV1C 2NNAA 2DIJA 2WUBH 2B4CH 3TGXA 1CLYL 2CUHA 5D1QD 5FF6B 5C8JB 5FYKL 3IFLL 1P1ZA 4XT1C 5JW4N 4YWGH 5C2BL 2BCKB 1HH9B 2P7TB 1NMAL 4XMLL 3I75B 4N90D 4TOYL 1KIRB 1J05A 4F80A 1JPGB 2AJYL 2NLJA 4PYHA 4U1JB 3V6BR 2WP3T 5A43C 5IGXL 5DRXA 2V17H 3FQWB 3HI1A 1A0QL 3O3AB 3QDGB 1FG2A 3AREA 3ARBD 3S5LB 2BY0A 1OP5K 3SDYH 1EDQA 1GVIA 5F96H 3ZKXC 1CFBA 2A0LC 4XCYB 3HLAB 3DVGB 4WUUD 2R0KH 3TVMD 1CXKA 5FUZH 1MWAB 3SE9L 5HVHB 2EYSB 4W4OA 3C09C 1VFBB 1MCOL 1SEBB 4U1LA 1DQQA 4MSWB 1NGWB 4LIQL 1BQHA 1W0YT 4M8QB 4P0DA 1KT2B 4GG6B 1FC2D 1VEPA 2E7BA 2BNUB 3BXNA 3P77A 1RFDL 4RGMB 5IKCA 1YEEH 1M71B 2OLDA 4OCRH 1JYVA 1EEYA 4FXLA 2IF7A 4L3ED 3KPOB 1GOFA 3PJSB 2R9HD 1UADC 2X2YA 2R23B 4H20L 3QQ9C 3JWOH 5FXCH 4NQUA 4HG4J 2P47B 2ZPKL 2ICWA 2WLYA 4BQ8A 4HS6A 3T1WA 2KQNA 5HHXL 4LCCB 1MJJA 3H9SB 3N1FC 4JFED 1JK8B 4GRLA 3BT2L 3VXME 1IQWL 3V6OC 1EERB 3X14A 3B6SB 2K1MA 4ZO9A 1DBKH 1Q94A 3U0TA 3AMKA 4KK8C 2Z9TA 4NQVA 3O6KH 2DM7A 1U95A 4WI8A 4X99A 4V2BA 5SWQA 4PRBB 5IVNA 2FX8H 1KEGH 2VXSH 2VXVH 3FCTB 1Q9KB 1UKSA 4ZNEA 1OGAA 3MOBL 3BKML 5I8OL 1SMAA 4LFHG 3PGCB 3BZ4A 4OZIA 3CPLB 4G9FB 1BD2E 3LKOA 5AYQA 4QOKA 4MXWH 3K1DA 1R0AL 3QUXA 1AO7E 4YXKL 3VDCA 3UYPA 4FQXB 5D6CA 4HKJA 3MA7A 2VLJD 4GMSL 4NRXB 2FO4A 1DVFB 3QUZA 1E6JL 2P5ED 1AQDA 3VD5A 4PJCA 3PIQB 5GSRA 1RIVH 3GO1L 4OZHB 4J4PD 2B1HL 1TPXB 4F7MB 1QPXA 4UT7H 3THMH 2VE6A 2YXMA 4G7VH 4KRLB 3IVKA 3SKJH 2XXCB 1CIDA 4MDJA 2NY6C 3HPLA 4PREA 2R0KL 5D7KD 4X5WA 2GTWB 3MLSL 2EDOA 1PDKA 1A0QH 3CC5B 3U7AA 1BFVL 4Z95H 5BS0A 3C6LD 3BZDA 3QJFA 4KTEL 3U7YH 5DVMA 4Y16B 4HLZG 5CZXD 3QEUB 2CKBL 4O00A 4ZUSA 4OZGE 2DQCL 4FG6C 3CMOL 1PEWA 3CX5K 4XAKD 1DLFH 5C0AE 3GSWA 3S3SA 3S37L 5CIPA 4ZS6C 5I16B 4MCZA 2G5BB 1HILA 4Y4HC 2A2QT 4NFDA 4AENB 4JFHD 4PJ7A 3MRCB 3IKCB 3MV11 4JAMB 1YQVH 4PY8I 4EIZC 1F4XL 2QADC 4IRJA 2R56H 1BOGA 3LQAL 4I18C 4ODUB 4M1GH 4HKZB 3P73A 3F58L 5IMMB 3IVKB 3UP1A 1QFWH 5CZVH 3D0LA 5IVOA 3A6CH 1JHTB 1VGEL 2Y5TB 4U0QB 1F4WH 1FDLH 3IDXL 3ULVL 3TF7C 3S36H 2F53E 3EJZD 4H1LA 1EZVY 1Y18A 1N64H 1SYVA 5C08E 3T4AB 3IAGC 5JXAH 4APQB 2ADGB 2GJ6A 1KCSH 4NRXA 3GKWL 3UO1L 1RUQL 4KY1L 4E0RA 3T77A 3QCTL 5EU7C 3MRRA 5FCSH 3DVNA 4ELKB 4KI5F 1BJ1H 1U2HA 5HYFA 4ESKA 1R3IH 5LKNA 4NZTL 3B4NA 3MRPB 1AGDA 2ILLA 3NZ8B 3OKKB 2ZOLB 4CADB 1Q72H 4WUUA 1OTSC 4OLEA 3PGCA 4H0GA 4OZGF 3JV4A 3UTPE 3W11C 3D0VA 4Y5YB 1A6UL 2J88H 3EHBD 3PWJB 3BPNC 4OB5L 2IWGA 5EU6E 4L8SA 4LSQH 4LSUL 3HZMB 3STLA 3O4LA 2CKNA 2ZUQC 5D7JB 1NGPL 3O6FA 5J6GB 5DD6A 2Q8BH 2YPKB 5CCKL 2E7LC 4OM1L 4OUOA 4N5ED 4QRUA 1MJJB 4E41B 4JB9H 3MJ8B 3V52H 4LF3A 1RULH 2VABB 2X4PA 3C2SA 4OFKA 1QACA 1J10A 3E3QC 4BSJA 5IW6A 3RZCB 1RUAH 2XN9A 3MA9L 5D1QC 4O9HL 2OTWA 4WTZG 5JW4M 2BNRD 4LLYB 3HC4L 1CFNB 2QR0A 3D25A 4IBLT 2UVFA 4GQ9L 5F7HA 2W59A 3JV5A 2VC2H 5CSZA 1NUDA 2VXSL 1TCRB 3MV9B 3DURB 1UM6L 5DC9B 4JJHA 5ITFA 4M61A 2CO7B 4DZBA 2NY2C 3WN5A 3QNYA 1M7DA 3OAZK 2R29L 3HC3H 1BJMA 1YEJH 1XGPB 3DO7A 1DQDH 3MCLH 3D48R 4GUPB 1QRNE 4FP8L 3QDJE 2LU3A 3KXFD 3QEHA 1IBGL 3EDJA 5D93B 5C0EA 3NOIA 4I0PA 4J4PA 1BGXH 4EN3A 4R90L 1JGEB 15C8H 3EO9H 3JTTB 3RL1A 3WN5B 4X6BA 3BWUC 1TVBB 4U6YA 4TTDC 4L5FH 3W2DH 1KCSL 1YEEL 2XNAA 5DI8A 3WBDA 3G6JA 1NMCC 4XGZB 4H8WL 1Q0XH 2CKBA 4O02H 2DDQH 4HPOH 2M26A 4G7VL 3PNWB 4GLRI 4HHAB 1IAOA 5DQ9A 4N0FA 3S35H 3MSPA 2OK0L 3KR3H 5AUMB 3QXDA 3ROLB 5T1LA 4QOKD 2QR0B 3D25B 1A3LH 4PJBE 3RUGF 3NA9L 1JPFA 4FXGB 4YGVB 3X11B 3AS1A 1UJ3B 4LCWD 5EU6B 4OQTH 5HHMD 5B8CA 5CEYA 1G9NC 4UIMA 3LDBB 5EIIB 3BHBB 3UJJL 3C08L 4JHZA 4U1HA 1IFHH 3OZ9H 3TBWB 5JW3L 3O41A 1NCWL 1RJYA 3A6OA 5BXFA 1XF1A 4OZFH 2IEPA 4EKXA 5BJTB 1W0WB 1E6OL 3OX8B 5T1MA 4X7FC 5HJ3B 5I66B 2QBWA 3PDOA 3O3UN 4UI2A 3VW3L 5FK9B 3SJVE 3KPNB 4LKCB 4JPWH 3RI5F 4U1KB 1DBAH 2X09A 5DEZA 1N8ZA 1NDMA 2BSRB 2DMBA 1U3ZA 1BMGA 1JGUH 3O9WB 4FQCH 4L4JA 2ZOLA 3D9AL 2R69L 2VLRE 4IEFB 5TQ2L 2AEPH 1G7IB 4OZFA 1XF5A 1FIGL 5B39G 3SOBH 2A9NL 1I7TA 5DJXA 2EIZA 3ARRA 4LKXA 3C9NA 2UV3A 4FQQB 5E9DE 1OAXL 3QCUH 1IKNC 5D2NB 1XEDA 3N06B 3P9LB 2DBLL 4KXZI 1CF8L 4UNVA 4M43L 4LHJB 5DZNA 4DKFH 3EYUH 4KRPB 5LQBH 1GCFA 3JTTA 3RL1B 4LL9A 5F97E 2HJFA 4GJTB 1Q9WB 3AAZB 2V9RA 1KB5H 2AERT 3RX7A 2IGFL 3GDBA 5CBAA 2E6JA 5C0IA 3IU3B 3ARFB 3PWUA 4ODUA 5DRNB 2D0HA 3Q5OA 4XVSH 1CR9L 2E7MA 3ARBC 4YE4H 5C0BA 2UZYB 4FQ2L 5K59E 1GOGA 3DV6A 5J57B 1JI1A 3HB3C 2X89D 5T5FH 4X5XA 5CEZE 1S7QA 3LHPH 4JGJA 2W9DL 4OUUA 4PJAA 3SDDC 1NBZA 2NY0C 4NCC1 4OIBA 1CDIA 5LGJB 2ZSWB 1B6UA 1JF1B 3MLZH 1L0QA 5IHLB 3RWJB 5FA4A 2GSIA 5J1AB 3GSUA 4N5UA 4BQ9A 1LMKA 3RWGA 1LGVA 3WN5C 4NO3B 4WI3A 1FNHA 2YZ1A 1K3ZA 2W9EH 5FYJD 1LEGA 1NDGB 3WJLA 4OCSL 3GHBL 3ULUC 3VFOA 5BS0D 1ZHBB 4MD0A 4UDUB 4ZYKB 2VDML 4RZCA 4JO1H 4MYWB 1JF1A 1OPGH 3JBG7 2FJHA 2WWMC 3RVVC 1F3JA 4S2SB 4TVPD 3WO4C 1DN0B 1J8HA 4GXUN 5I1AB 5CINL 3IDXH 3C2AL 3T4YA 3D85A 4I48B 1JGLL 5C86A 3TNNB 2PW1A 3KJ4B 3PWJA 4O58H 5F7LB 3HNTL 5IBLD 3TJHC 2YWYA 2PCPA 1P7QB 4BZ1L 1AQDB 1NAKH 1G84A 4JANA 1LO2H 4PP1C 4DKEH 2YBRA 3REVB 3A67H 5HI3D 1NFDE 2VKXA 4X6CF 5IB5B 4M6NH 2FEEL 1YJDC 5BRZA 5HDOA 1ZGLP 1HXYA 3SDCB 2H41A 1BIIB 3RBGA 2C3WA 4ZO6A 5IESH 1G7MB 3C60B 4KV5E 5C6TH 4BKLB 3FTGB 1LEKB 1KJVB 2MCPL 3MJ7A 1GGCH 3CZFA 3EO1B 3FCTA 3ZTNH 4YFLF 5I1JH 1D9KA 3ARZA 3BRGC 3O2VL 2HTLC 5I6XC 3LVEA 4NNXB 1G7PA 2HWZH 4AG4H 4YUEL 2NY5H 5BV7H 4XXCC 1IJ9A 3GEWB 3MRHB 3RWHB 2DAVA 2JELH 4FQJL 4X0KB 5GQBA 1WF5A 5I0ZA 2WUBL 4Y4FB 3VMOA 4DJMA 5FM5O 1JYWA 1K5NB 2YD5A 3S35X 4PJ7B 5C6TL 1FNEA 3VXQA 3UJIH 1CR9H 5KS9F 1U92B 5DXWA 2MCPH 1H3TA 1AH1A 5T1DL 4MJID 4MAYB 4EDWL 4JFFB 3VGEA 2PR4H 4GRWF 3OR7B 1MCJA 3TV3L 2X4NA 4NPYB 5IIEB 5LXGH 3QO0A 3LPFA 1EMTH 1A9BA 4HK0B 3RWIB 2HFEA 3JZ7A 3OR6B 4MXVF 2YC1A 2F15A 1BHGA 2QKIB 1QRNB 3LN5B 1NBVL 5FEBA 3RWGB 4C56A 3H3BC 4UTBL 5HYSB 2Z8VC 1F97A 3ZHKA 1VSCA 4ZUTA 1EAJA 3FO2A 4GAGH 4MNQD 3L3JA 4XVJH 4G6AC 1SJEB 3KJ6H 4Q58C 1FAIH 2VQUA 4MNQB 3V6FA 4Q9CA 4ODXA 5CD5C 3LRSB 4OTXL 4R0LC 4HK3J 2D7TH 1IC5L 2NTSP 5D70L 3SDDA 4BZ2H 2I07A 3RY6C 3AUVA 3VXPA 2Y06H 2DLHA 1I9RL 3GSNH 4CUCA 2R15A 5C07E 1SY6H 5C0BD 1T5XB 1XAUA 3T2PA 5I1HH 1J0JA 1L0XA 1S5IL 4PRID 2WIIA 3RTQC 2ESVE 2HJFB 4WWKA 1J7VR 2R0ZL 3IFLH 2DQEH 4U1NA 1ORQA 2BOBA 4U6VL 1NMBH 4RISH 1DSFH 1JGVH 1A1MB 3QIUA 1UEMA 2N7AA 3UAJC 5FUCE 2EDKA 4MNQA 2CMRL 2JK5B 3VRIA 3V79C 5EUOA 3MCG1 3VXUB 1SJEA 4YHZL 1RZFL 2Z31C 1EK3A 4DUWA 2FATH 4JHWH 2OL3L 3G5XA 5F7NC 2H32H 4PJCF 3OWEA 1TNMA 3W82A 3B9AA 2Y07H 4KZEL 3BQUC 5F1OB 1IKNA 2OJEB 3BKJH 2WIMA 1A9EB 3WJJA 2AQ2A 3W0WB 3DXAA 1HXMA 3CH1B 3WKMH 1WZ1L 1IC4H 1OSPL 1JZ6A 4UOW0 4XC3H 2VABA 3TVMC 5DS8B 4L4VB 1T89C 3QFJB 5E8PA 4HMDA 3UDWA 5INCA 4N9OB 4OF3A 2L4OA 1G7JB 3FL7A 2H2PD 43CAA 2RQ8A 3REWB 1T20A 1GGIL 1U8PA 4I9WE 1AXSA 2KH2B 4PGCA 3KYKL 2Y07L 3VFPB 1N59B 2AXFB 2H8PB 1VFBA 1MHPH 2P49B 4GKZA 4W4NA 2B4CL 1A6WH 3HI6L 3MRHA 3T2OA 3FT4A 5BO1H 2XTJD 4U05A 1YPZE 4NN7B 5IMLA 5CP7A 1MIEL 4MA7L 2EC9T 1NBVH 1CU4H 2A73A 5CD3B 1BLNA 4ETQA 1ED3B 5BVJA 2HT3D 4WFHD 3CZFB 3EO1A 3MUJA 3V0VB 3ULUF 4HUXB 3RVVD 2VLJB 4FZ8H 4M3KB 5IVZB 2IPUK 3CFEB 4MA1B 4CGTA 4NJ9L 5DEGA 4H1LB 4EN3C 4Y5XC 4JFPB 1C5BL 4PJFE 1WWCA 4JDZB 2UY6A 3QT2A 4RQQA 3DTXA 1RULL 3PWNA 1I85A 3CSYA 3NPSB 3JWDC 4LSVH 1K6QL 3RPIB 1KN4L 2DL2A 5KVMC 1NGPH 4L4VD 2AJSL 5CEXB 5IB3A 5CJBA 4U6XB 2XKUA 3AVEA 4JN2B 3GUTB 2YKLL 1UQSA 2PNDA 3FHQA 4MA7H 4IRJB 3QDMB 4LDLB 3S96A 1BZQK 1JHLH 1V7NH 4BH7A 2FZ3A 1P9MA 5DT1L 5HHPA 4JPKH 3K4AA 2CK2A 3PABB 2EO9A 3T4YB 1KJ2L 3HKFA 3ARDB 4PRAA 5ISZB 1H15B 5ALBL 5CSZB 4QRTA 1CICA 2HJLB 3RVTC 5LGHL 1S9KC 2GHWB 3FB7B 4JREC 1FZKB 4HCRL 4E42A 4DK3A 1K4CA 4X6DB 5B3JF 2XKNB 4WV1B 2BSTA 3L7FA 5EZLB 3CXDH 2A38A 4D0CB 3B9KB 4R0LA 4HT1H 1YEJL 5KSVB 3MLSH 1DN2A 2VITB 2YKLH 3VG0H 1YEDA 5GS1C 2BDNH 5F21B 3RY4A 1BFVH 4Z95L 1SEQL 1NFDB 4P46C 5F7MC 2YMXL 1DEDA 1M7XA 4N0UB 1C8PA 3H9YA 3VFNA 3HMWL 3SGJC 1P5VA 2YPKA 4LVHC 4W68A 2IBGA 4ZUVA 3BGMB 2LU4A 3NZHL 4G8GA 3QIWB 1AD9B 3CH8A 2I25N 5C2UB 1SY6A 4CL7A 4IHOA 4LLUA 2DQHH 5C1MB 3VFWB 3BMWA 1X5FA 5HYEA 3QUZC 2G9HA 1W72L 4G9DB 4OZFG 1DCLA 4MXQC 5CSGA 2IPKA 4YHLL 4JE4B 4P4KB 3VFUB 2Y36L 3OKKA 1J18A 1IGJA 5FKPB 2JIXD 1YECL 4R8WH 3BRDA 2CK0H 2A1WH 4P4KD 1I1CA 1S9XB 3QWQB 4IDLA 1S9XA 5EOCL 2ITCB 5IF0B 2DICA 4P9MH 5M95B 5C0AD 2UZXB 2VL4A 3PG2A 1WK0A 4M48L 4XCNA 3UMTA 4P4KA 2DYPA 3VFUA 3BGFC 4XNMA 1I9EA 4QT5B 1KCRL 4I4WA 3N50A 3OMZA 5IVXF 4G7YH 1HDMA 5ALCH 3LHPL 4MNQE 2APTA 2VSCA 1F6AB 4JPVH 2L7JA 4XP1L 5DQDL 1UA6L 2P43B 4U7KA 3U6RA 2WANA 1ZTXH 1XF2A 1HKLL 4CBPA 3OB0H 3THML 3T3MF 1J11A 3WIFB 2KQMA 5T3ZL 1JK8A 4Z7OE 5EBGA 2X40A 3PV7A 4ZAKD 3D6GA 2XICA 2ZG3A 4FQPA 1UCTA 1UM5H 1S5HB 3V7AE 3BSZH 5TDPB 3G5VA 4GKSB 1D5ZB 1FFOB 5HVFB 1ULVA 3RUGA 2DI8A 5FK9A 3TBYA 4OF7A 5TPWH 5ITBH 4WU7A 1ZT7B 5FYLE 4ZFZB 2VITA 4Q74A 4D3CL 4MNGA 5ESAB 2X1OA 2ZOKB 1JNLH 1EEYB 1YZZA 3FT3A 5TE7L 1VKXA 3V0AC 4ISVA 1YN6A 4QHLB 1T1YB 3KDMA 1CL7I 4NRZA 2IAMD 4K9EC 4AQOA 2JIXB 3L7EB 1S7XA 2XZZA 1KCUL 3NH7L 1DQQB 5GGRA 4UIMB 3QWRD 5ISZA 1IRAY 3HNTH 1CYGA 1YYLH 3QDAA 3LPWA 5EWIH 4ZSOE 4DGYH 5J56B 5DTFB 1EHAA 4KJPC 1Y6MR 1TTFA 2JJTA 3R1GL 2V17L 3GRWA 1MCIA 3HRPA 4PY7A 3W0WE 7CGTA 1U2CA 5KTEH 2WUCH 3MUGA 4Z7WE 1ND0A 1G1YA 3L3HB 4L8BA 4M62H 4NO0B 2DQIL 3G6AA 4WW2C 2AXHA 2DM3A 1YY8B 3MRJA 4LQFL 3H7BB 4OZHA 4XH2A 2IH1B 2IADB 5I18L 5A40E 2R2BB 2P45B 5E8DH 4WFEE 5ELIA 4TVPL 3FQXA 4X80H 4R7DB 5C0DB 3DROA 3BGAA 4KHTH 1WAAE 1MJ7L 2CJUL 3QHZL 3RGHA 3G6AB 1QO3B 5I2IA 2ITDA 2ZCLH 2DQJL 4QRRD 4QOKB 2B4CC 5B39A 2ORBL 5C3LD 3VGDA 1J0IA 2E8YA 4UBDD 3ET9F 5DLMH 5JXEA 5HHOA 2XA8H 1LQSR 1LO3L 1IGMH 2BC4B 4GXVL 1WJ3A 4BELD 4KKCC 4ODTH 2HLAB 1OTSD 3SDCC 4EVNA 2VAAB 3O6KL 3G08B 3QHZH 1CF8H 3VU2A 2PYEA 4XHQA 5EA0L 1G9NL 5MEOA 2F58L 1MELA 4DKFL 3MYJB 2R2HB 1A6VH 4NN6B 3BW9A 2Y9RT 5KSAA 4WWID 3KAAA 4YIQA 2NY1D 1FSKC 5TFSL 1G9ML 1MAJA 5FV2A 4Y5XA 4KMTH 3EYFB 5J12C 2Y72A 4YIQB 4HIIB 5J3HD 3NFPB 1TJHL 1QYGL 4U3CA 4KV5F 1FO0H 4MNHB 3G5XB 4LRNL 1ETZB 5DEFA 5KJRL 2CR6A 5CFHA 2DQHL 2FIKA 4XRCA 5I75C 2F53D 1UWGH 1V3MA 3TPUA 4AG4L 3TZVA 1W0VA 3L3DA 3OXRA 2G60L 3M17A 3HRZB 2ADFH 3BN9D 1JRHL 2EKSB 2W0LA 4U1MB 4UU9B 1AGDB 4K3DH 2GQHA 4ZMAT 4J3WA 3VJ6A 1LO4H 2EE2A 3INUL 1YUHA 2MPAL 1ORQB 2BOBB 2EIEA 5AYUH 4KJYB 3AB0B 2R1YB 4NNYA 3QFJE 4NWTL 2WIIB 4ELKA 4ZS6D 1I3GH 1DBMH 4MJIA 3VXRD 4MS8D 4HJGB 4XHJC 1BGXL 1IAIM 4JR9H 5KSBE 4G8EA 4OFYA 2G9HB 3H6JA 1N3NB 1YEHH 4M43H 1JPSL 3CFBB 2HVKA 4UNUA 1ZA6B 2LFGA 5DD1H 5E95B 4FQLL 4IHOB 4LLUB 3UJIL 4EDXB 4QHNA 3PGFH 5D96B 1B0WA 1F8TH 3OKEA 2R0WH 3P9MA 1EA9C 3L3HA 3LKNA 2FX9H 4Z76A 5L9DL 5EZIH 4F37K 1UGNA 2NY6D 3HHRB 2PYED 3TO4C 5ADPL 4P3WA 5SV3A 4QXTB 4XZUA 1T4KB 3DX6A 1I1YA 1NGXA 4PRHE 3GMRB 4N0CD 4XVTL 4C57C 2HVJA 1QLRA 3TBTA 5JLZB 4PJBB 1PSKH 1J5OL 3KHOA 1H3PH 4MA3A 3ZDXF 3WSQH 5D7IA 1E28B 1FGNH 1BQHG 4K2UL 1FNSL 4M7JL 3SDAB 4D9RD 4B41A 5DHXB 5D6DC 4KKLD 5D7IB 3VI3F 5MP6L 4I5BB 2FH6A 1CICD 2EDYA 2HRPL 3GMPA 1QLRB 1ZA3A 4RAVB 1MY7A 3GSRA 4WI4A 3GMMB 4PRDB 5C6WH 2ED9A 5F7FA 4HC1H 3GSOA 4Z7VA 3UYRL 1E4KA 5FV1L 4OGXH 4K8RL 2RFXA 3HPLB 4PREB 5KVEL 5LWYH 2X70A 4R9HA 3QG6B 5AD0B 3IDNB 1PYWA 3P9MB 2DBLH 3LSOA 4HIXL 5TQ0H 4LGSB 3TM6A 3DMMD 4X98B 3PF2A 4MX7B 1FZMB 4K71C 5GSRB 3WMSA 3TESA 2VLRB 1C08B 5I73C 3UPRA 4H8WH 1OCWL 1MI5A 2PO6A 1U8OB 4UAOC 3CFEA 3HE6D 4E41E 1OAYL 4PGDB 4UZGA 5SWSA 5GJTH 4HUVA 1IQDB 1MJ7H 5JA9A 4LCWA 5CWSB 4TUKH 2Z4QA 4OD2A 4RMRA 2F74A 4IOFD 1KFAL 5ESVA 5MERA 3GJFK 4YO0B 1HCVA 5KSBB 5CP7B 1F3RB 1G0DA 3H9ZA 2R0LH 4KWUA 2W91A 5SWSB 3UJTH