5IP4A

X-ray structure of the c-terminal domain of human doublecortin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'VQLQESGGGLVQAGGSLRLSCTASVNIIGGNHWAWYRQAPGQQRDLVASLSRYNANYADSVKGRFTISRDNAKNAAYLQMNSLKPEDTAIYFCALENYYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XA4551 NANOBODY AGAINST C-DCX
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Transferase
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ip4A00
3GJFH 4Z78A 1U3JA 3SDXE 2HKFH 3G6JB 3BGFB 4OTXH 1BJMA 4U6VH 1U3HC 2ADGB 4P9HH 3BRFA 3DX8B 2D7OA 5D6CA 2ATPB 3MJ9H 1CFNA 3ROLB 5C8JA 3CDCA 1AQDB 3AS0A 5DJCB 4QRRE 4OZIE 3G04B 3MROB 4ODTH 1LP9E 1A5FL 5HGDA 2YKLL 4OFYA 4YHPB 2P8PA 3HPJB 2E3VA 3U0PB 3S35H 1P53A 3LAFA 1QRKA 2DMBA 5ESAB 3QSKB 3HRZA 2FD6H 1EK3A 1MFBL 2I07A 4WU5B 2V5YA 3TBTB 2OK0L 2VLRA 3HE7B 2DQTL 1HIML 3MLXL 4Y4FC 5FHBL 4GRLD 3VXSA 5AZ2H 3IF1B 1URLA 4ZG1A 4PRIA 1I75A 3QDME 3KPOB 2D9CA 4G43B 3QPQC 3S3JA 1L9MA 2B1AL 4Y19D 1E6OH 5IR1A 2EIZB 2A2QT 3RVWC 3TESA 3SEPA 1CG9A 3MRCB 5DK2A 1J12A 1OY3B 2MKWA 1LE5B 2X4QB 5D7IA 1JPTH 1OAUL 5DFVC 2F58L 3TC9A 3NIGF 1TFHA 5IBLD 2DRUA 2BSSB 4V2CB 2GSIA 4IRSA 4JDZB 4LKXA 3ILPB 5IW1B 1SJEB 3D39E 1T80A 4NO3B 3BUYB 5D1XA 1U8OA 4Y88A 3GSXA 4PRDB 4NM8L 4PBVC 4BZYA 1U2HA 5K9OA 2Y5EA 1Z5LB 3QQ4B 3OHXB 3MRHB 3IU3B 3DURA 4O5LH 1DQLL 3MRDB 1NCCH 5E2VL 5TF1H 1S78D 3TCLB 4YDLC 4KI5E 3VI4E 5C0DB 1BX2B 3TT1L 3OJMB 3FAWA 2OZ4A 3TN0B 1DQTA 4ODSH 5LCVH 5JW4N 5BJTB 4JDVA 2Z8VC 4OD2B 2FZ3B 4EXKA 4JPIB 1RZGA 4I2XE 2YXFA 4PJ8B 3VWKC 2J4WH 2E5EA 5CLTA 1MSPA 1QQDA 1YQVH 2J2ZA 3BH9A 4Y0GA 4TNWK 1K4CA 4N8PA 5EU4B 4DWHA 5DVOA 1D5ZB 5FUCE 3PL6A 4JFFE 4J3VA 4L9LA 1JVKA 2OXHA 2AEPH 5A2KH 1HHJB 4QOKA 1MRCL 4E9LA 3ULUE 1V7ML 3T0EE 3LS5H 3BPLB 3QXAA 4Y4HB 5ISZB 3IDNB 3IDIA 3WN5C 4BFGA 4RMUA 1D6VL 5FDWB 5JW4Q 3BHBB 1MIML 2D0HA 1QLRB 1OSPL 3H9SD 2XIDA 5B38G 1WCQA 3PG2A 4NBXB 2JB6B 3ARFD 3QIWA 1K6QH 4RMRA 1P4LB 3ME0A 3UTQB 2WIIA 1Y18B 5DEFA 2ZSWB 2R0ZL 3PXJA 3HCVB 2MSPA 4DCQA 4R96A 1YUHB 3P30H 1EFXA 5EULV 5JOFB 4PLNC 4Y5VB 4R4ND 2LTQB 2GQHA 3SCMB 2AQ1A 2RFXA 2EDQA 2EYTA 3QUZC 1IGCL 3RGVC 1A7OH 5CFHA 5FEBA 2XI9A 5HI5D 4HPYH 1DTUA 4XNXH 1ES0A 2DLEA 5JQ6L 1DLFL 4D0DA 2AJYL 4PG2C 3SDCA 1NPUA 4MNHA 3EJZD 4C58B 2XPGB 5EOCJ 1WUNT 2X5PA 3BKCL 1VESA 3I50L 3OKLA 4O51B 2X4RB 2VITA 4NQCA 4GKOA 3DV6B 4OCXL 4MWFB 4HGKC 1CXEA 4Z78B 3CSGA 4JPWL 1KTRL 3EZ8A 5C08D 2P5EA 1VFOA 4KKBC 4OF5A 1QFPA 5I1GH 1KENH 5C8JB 1CFNB 2VDKH 4M7LH 5E7BA 5CKGA 1A3RH 3QJFA 4Y4KB 2ZOKB 3DIFA 1F4YH 2P8PB 4P46D 4XNZB 4HMCA 2BRRL 4KUCF 1T7YA 2BY1A 4HF5L 2R15A 3C9NB 4UINH 1CVSC 3B2UC 4P2RB 2I9TA 1DSFL 2OTPA 2I07B 5T3XL 4TQEH 2N1KA 3PIQA 2WBJD 4NFDA 1HYSC 2H2PC 2QBWA 5GGVH 4L4JA 3VXSB 1KEMH 4GRMA 4ZOCA 1IM3B 1MHPL 2A1WL 5T5NF 3MACL 4PRIB 4WEBL 1RZJC 3EDJA 2OR9H 4XAKE 2VZOA 3HI5L 3GI8L 1RZFH 3IETA 5EC1A 1BEYL 2H26A 5GSVA 3O4LE 3IRZA 1BFSA 5DK2B 5CMAA 4QTHA 1QHPA 3WFHA 3R8QA 1FE8H 3OZ9L 4M5ZH 2GSIB 2W60B 1QG3A 4JG1H 1KPVA 2DKMA 1U8OB 2F53A 2DM3A 5DDHA 1T5XB 4ZDHA 4N8VG 3HAEH 1T5WB 5HHOD 5EZOH 1M7DB 4MJ6A 1P6FA 2BNUA 4FXGA 2R1WA 4BH8A 2EKJA 1A4JB 2ED9A 4MAYB 4HC1A 4R4BA 3BPNC 4YZFF 2ZG3A 5CILL 1EHAA 5FYLE 1OLZA 4PLKD 4HW6A 3WHE1 1RJLB 3INUH 1VPOH 4JDVB 4D3CH 2RQ8A 3ZDXF 3HNTH 4YGAB 2YSSA 4N5UA 3W9DA 3MRQA 4L3AA 5BRZD 3ELAT 1L6XA 2FGWH 5ITBL 1HHGA 2X1QA 3CXDL 1UM6H 3BH9B 4LHJB 4OIAA 2YC1B 2PO6C 5IFAL 2Y72A 4PJDF 4X4ZA 1HWGB 4F33B 4YAQA 4PRPD 1FZJA 5EOQH 1XF1A 3EOTH 2JJTA 1X5XA 3PL6B 1NMBL 2AV1B 1MFDH 3LKPB 1QRNE 1ROWA 2BXYA 1FNEA 3SO3B 4JM2A 4JN1H 4GKSA 3QXAB 3U36B 4YH6A 4JFHE 5C0JB 4Y2DA 4J3UA 4GAJL 4LCCA 3QEGH 1U8LA 2DN7A 2Y7QB 3GEWB 4PFEA 1D5XA 3ARTA 5I1KL 2QSCH 1X5LA 4AJ0A 1LK2B 3L3KA 4YR6A 5FECA 5DEFB 5JHDA 3ZDYE 4HWUA 5IGXH 4OLUL 2P42B 4HIIB 4F15C 4C56A 4R96B 1RY7B 4DCQB 1YMMD 2DTMH 3U9UA 4GH7B 2XG4A 2DKUA 4MLIA 3OJ2C 1D9KC 4M5YL 2EDTA 2IPUG 2ATKA 1QSFD 2VDOL 4G6ML 4BQ8A 1RUQL 4LEOB 4MVBD 2EYTB 1KN4L 4P2QB 2XTJB 1OWRM 4K07A 3ARQA 1Q38A 3QFDA 5ACZA 4EN3D 3O2VH 3SE4A 4DKDC 2AJVH 3U83A 3RZCD 3SDCB 2EE3A 4MNHB 3GIZH 4I5BA 4ALAL 3FO1A 1N26A 1UH4A 3MLSH 2FX9H 4GQ9H 2VQUA 5BV7L 3W82A 1IEAA 3O2DA 4LLVB 4NC0B 1JNJA 1N2RA 3V4PH 4LVOC 4S1QL 4KJPC 4NO2A 4HT1H 3VD5A 1NGQL 4XCFH 1G6RL 4G9FD 3C2AH 1ZS8A 5JHLL 4G8GD 1OP9A 5D5MA 5B22A 3CLFH 1KJ2H 4OQTA 7CGTA 1A1NB 4Z7UE 3E1F1 3QJFB 1CGYA 2JIXB 4G7VH 2B5IB 4U1NB 2EEAA 4JZOB 4WTZA 1HI6B 3ES6B 1AO7A 1OGTB 5T33H 1FVCB 1RZ8A 2VR5A 4IRJC 3PIQB 4C55A 2P5WE 3DMMB 2W9EH 4KDTA 5HYSG 4XCCH 1MCWM 1DBMH 4GRMB 4X7SL 3SDDA 5SX4H 1FFPA 4Z5RB 3PWUB 1JHKL 2PTTB 3LEVL 3IETB 3LB6D 3HUJF 5GSVB 3IDXL 3WIHA 3AAZA 5JW4M 4OLEA 4FQHA 5I16A 3EHBC 3LHPL 3WFHB 3HE7D 3P11H 2VLJA 1KCRL 1J0IA 1KPRA 1U58A 2EYRA 4R4NC 4K94H 3BPOB 5TE4L 1NCDL 3WE6A 1Z9SA 3LOWA 2F53B 3W2DL 4ZPVA 3TBWA 2Q8BH 2CKBB 3SGKA 4NUGL 4PRBA 5HHVL 4DK6A 1YEGH 4FXGB 3QAZC 5E70A 3RVUD 2WAHA 3ARZA 1HINL 3U4AA 4JFYB 1XCQA 1BD2D 1ZAGA 5KVFL 2ZKHL 4Z0BL 2J8UA 4KVCL 3QFJE 2EO1A 3PJSA 3STZA 3WSQL 4L8DA 4LRIC 2D7PA 4FG6D 4PRNA 2Q7YB 3HNSL 2NY2D 4MCYB 3WFCH 2E27H 2EKSA 3RIFK 1ZSDA 5GGQH 4P5TD 2YSSB 4HD9A 5JPNB 2AEQL 4L3ED 3W9DB 3WIFB 3IFNH 3TH2T 2AABL 4JO1L 3REWA 1FYTA 2DYPA 3EUUA 3QNZB 4K3HA 4W4OC 5KTEL 1VEPA 1HHGB 4NSKA 1A7PL 2NXZB 3NACH 1W0VA 3O8XB 5IMOB 1CDHA 3VD4A 2UWEF 5FA4B 2NX5A 3TA3D 5IMMB 5M7QA 3QEHA 3FQXA 4PTUA 2WP3T 4R9HA 5KVEL 4HLZH 3RWHB 4PJ8D 3TNMA 2OYPA 2FR4A 1MI5A 4QRPA 4JM2B 4GKSB 1WFUA 1U91A 1R3KA 3EYUL 4LCCB 4RFOH 1U8LB 4HSQA 4PGJA 3ARSA 5IESH 2Z9TA 3GMQA 2HVJA 5L88L 3ARGA 1D5XB 1ACZA 1QLEL 3LKRB 3HR6A 3RDTB 4OD3H 1CFTA 1ZHLA 3I85A 3T04D 2X4SA 1DBJH 3UO1H 1OGAA 2DLFL 4Y4HD 4HG4J 3U9UB 2CXKA 5BVJA 1A6AB 3PWJA 4XHJC 3VRIA 5ABDE 4HIXL 3CK0H 2PXYA 2WANA 4AEIL 43C9A 1DQML 4B53A 3NCMA 3QWRA 5C07A 5I15L 3PGCB 1I8MA 3GMPA 3QFDB 3LRHA 3DO3A 4XH2A 5ACZB 5LWYH 1NFDB 1CGSL 5CEZH 1IILE 25C8L 1EIBA 4X4YA 1RIUH 3LPGA 2ENYA 5I1CL 3CJJA 3DUHA 4HUVA 2YD3A 5B8CA 1QO3A 1N6QL 3WUWB 5E2WL 2RGSA 3C87A 1FL5A 4I5BB 4FQCL 2F54E 3EFFA 1HOCA 4YDKL 1A02N 3SCMD 5D7KD 4Q6YA 3HAEG 6FABL 3RX5A 4XNQA 3VXPA 4KC3B 1U3ZA 4PLKC 1NGZA 2CK0H 1XF4A 2XRAL 2IFFH 1N2RB 4MNGA 1B6DA 4OSUL 4NO2B 5D1QD 3IDMB 2I9LA 5F9OL 5D1ZC 1ZS8B 5MP6L 2OX5A 5D5MB 1DDHA 2P49B 4JO3L 3JWDC 4WUKH 2QHRL 2APBA 4FQXB 4GAGL 4EI6B 1BOGA 4KKCC 1KULA 2R29H 2VJXA 3C08L 1MLBB 4R7DB 5B39A 4LARH 3D0LA 5DUML 5A16B 4WHDA 4LQ1A 5CUSL 1B90A 43CAB 4XVSH 5FYJU 2FB4L 2VQTA 5E1AA 4YDJA 4NM4L 5HY9B 1T3FA 2H32A 3MV8A 4OAWA 1A3LH 1R3IH 3DI3B 3Q2CA 5CBEB 5EO1A 4ZSOE 2B1HL 4WHCA 5SWSA 1YNKH 4FQQA 1IL1A 4LLQA 3MODH 4OFYD 1PGRB 5F1OB 3ZE0F 3RZWA 1G9NL 1JYVA 3LEYL 3GMNB 2FO1A 3WKNA 4HCRL 4RQQA 5CJXC 3AAZB 1X3DA 2VLKE 2VLRD 1EEZA 3BQUA 1QA9A 2VLJB 4EI5A 1O7SA 2A6KB 4YHML 3VXSD 1KPRB 1IGMH 1S9YB 2EYRB 4XMKH 4PRID 4PUBL 3TEUA 1CLYH 3WE6B 3ZKXB 1WFOA 4U1MA 1ZHKA 3RP1A 1OTSC 1NMAH 4GLRH 2P1YA 4K3DH 4ZPVB 2XXMB 1KIUA 4KJQD 1I85C 3UZQA 3V7AE 4PRBB 2DIAA 1P4IH 3KYMB 2FSEB 4GW5B 3NCJL 4UB0L 4BZ2L 1ZHBA 1KIRA 1A22B 1SMOA 1UWXH 1XCQB 4IRSD 4YBHA 3E3QE 4XPGL 2J8UB 1FFOA 4TNVF 4L8DB 1SQ2N 4NKMA 5D1XD 4KMLB 5M94B 4PJGE 3N1QC 1C5CH 3WLBA 2O5ZL 3PWPA 3TO2A 3IS1X 3HC3L 1FYTB 1E4XL 2BVOA 1FV1A 3DECA 5HDOA 1WIPA 5SWZB 1WTGT 3GJEA 2QQQA 1YYLL 3FMGH 4NQDB 2NX5B 2AK4A 2N7BA 4DZBA 1IC4L 2CIKB 3QEHB 5EUKB 4C83B 3H3KA 5DZNA 4PTUB 1IT9H 3BGFC 4NO0A 1AQKL 5EA0H 4ETYA 1QPPA 5C1MB 2FR4B 1U8MA 1CDGA 5KJRH 3CH8A 5TPWL 1U91B 2Q8AL 2P45B 4XBGA 2DKSA 5D2LF 4PR5B 4D9RE 4NJAL 4ZTOH 3FTGB 1P7QB 2NTSP 5I17A 1EZVY 5BS0B 1FHGA 4OIIH 5INDB 4G6KH 3BSZH 3VXOA 1KCUH 3PL6D 3E2HB 3ZYJA 1CFTB 5CD5C 4QOKD 1ZHLB 2X4SB 3IDGB 2D4DA 5IB1A 1OGAB 2UZIL 1HKFA 2V6HA 4NJ9H 5DRXA 1S7SB 2F74A 5BVJB 1KTDB 1R5IA 1X5HA 2YK1L 4NQTA 4IIQB 2Q6WA 3O2WL 1EEUA 3QIWD 5CEZD 3NGBB 1IEBA 5J11B 1T0NA 2JCCA 3GMPB 3QDJE 4XH2B 1BWMA 5FM5M 4R97B 3N1MC 1ZT1A 3HI6L 4OZFA 5F7HA 9CGTA 3FCTB 3TWCH 2DQJL 3RNQB 1EFXD 2J6EL 4PJBE 4OLVL 1K9TA 1M4KA 1QO3B 4IRZL 2LQRA 2V17H 1FL5B 3X12B 4U6TA 5EZLA 1PLGH 2BVQA 3HFMH 3KLDA 3QEQE 1IC5L 2BSTA 3I3DA 3DUSA 4XNQB 3VXPB 3HNVH 2XTJD 3STLB 4L4VE 5D70H 4W68A 2HFGH 4YHZH 4MNGB 1A6WH 3JBG7 2NY1D 2QR0A 4NP4H 4OZGB 5JPMB 4OZHB 2I9LB 3SDCD 1EUUA 1JHTB 3HN3A 3CVIL 4Y8DC 3RFZC 3B9KA 4I3GA 4NQCD 5I9QB 2NY6B 4JY6B 3TN0C 1HNGA 2H8PB 3TJHD 5MEOA 1KC5H 2GCYA 3KYKL 1HQRA 1F3JB 3BEVB 4JFDB 3UJJL 4OCRH 3D0LB 5TE7L 2DBLH 3O9WA 2P5ED 3O2DH 3DYPA 4JZNA 5E56A 2HMIC 2IALB 3ILQC 4LMQI 1XGYH 5MERA 4HAFA 1JZ2A 4YDJB 2H32B 4M1DL 2YUZA 4HUXB 3BMWA 3NIGE 2DLTA 4LP5A 3C5SA 3S8WA 4QRRA 4OZIA 5EO1B 3W81A 3TT3H 1FVEA 1IL1B 1QFWL 3O6KH 4K9EL 5T1MA 4ELMA 1YEKH 3ULVD 2QSTA 4Z95L 4PJ7F 5KAQF 4LMQE 4P57A 4KXZH 2JK5A 4RQQB 1CDBA 5AZEL 3Q6FA 4Y4HC 1RQ5A 1QA9B 1BPVA 1XEDA 4YJZL 2EXWC 3NBNA 2BOBB 4S10A 1NBVL 3S37H 5IVXF 5CJQH 3QHZL 3R06A 2YZ1A 5F72S 3WD5L 4LHUA 4J3TA 1B3JA 3MLWH 3NPZB 1E4WL 3L5IA 3DGGA 4U1MB 1XCTA 1JTPA 2KPNA 1MREL 1S9XA 4R8WL 5E8DH 2AEWA 3PNWB 4LDLB 5DUBA 5F7EH 5C6PB 5LXGH 5ERWB 2NZIA 2ARJQ 4PB0L 5GRXG 3WIHH 2N56A 5GISL 1RURL 1MJ7L 3U9PH 2LTQC 1FFOB 4N0UE 4NKMB 2IGFH 2F53D 2J88L 4N0CC 4MD5A 2E7MA 1Q9OB 5BW7C 2R4SH 4Z77A 4O02L 5DEZA 3O41B 3IGAB 4UV4L 3WLBB 3RNKA 2ADFL 3TO2B 4OLZH 2R69H 2BC4B 5EFIA 2BVOB 2BVEA 3OPZL 1FV1B 4TSBH 4UILH 3ZHKA 4TUOB 5F9WB 1BQHA 1IGIH 5IBTH 2ID5A 2AK4B 1UM5L 2EH7L 4DZBB 1PAMA 4Z7OF 1UB6B 1R3JA 3S36X 5F1IA 3T4YA 4QRQA 3MGAA 5HPOA 1H0DB 3LEXB 5I66A 1U8MB 2OXGA 3BKJL 2XICA 2NCMA 1A6TA 5JLZA 1U95B 3MRBB 1I8KB 5FM8A 1TCRA 4F7PA 5J56B 4XI5D 4Y4KC 1BZ9A 2W65A 5JDSA 1T1WA 2YA1A 3QWQB 5I17B 1VDGA 1CGTA 4XNZC 4NRXA 4JFFA 4YGVA 3KAAA 4NKDA 4O4YL 4FZEH 4UMGA 4KROB 5IB1B 4JM2D 4LSQH 3A6CH 4JB9L 5DRXB 4Y2DD 2OP4L 2HJLA 1R5IB 3BKMH 3DETD 1FIEA 3ARYA 1FCCA 1JWSA 3M17A 4JLRB 1A7NL 4DUVA 4PRHB 4NZRL 5CINL 1OSZB 4J4PA 1IEBB 5LQBH 1CT8B 1P9MC 4P2OA 5JHDD 2JCCB 3S36L 2WSKA 2HT2D 4M6OL 4C56D 1CLZL 2YKLH 4PP1D 4NKIL 2R23A 2WWMD 3L7EA 3BGMB 4NCDA 4UNTA 5IW3A 5JO5A 5EZLB 2BVQB 4HGMA 1MFBH 3ZL4L 3DUSB 3K1KC 5C9KA 2HWZH 3OJVC 4QRUB 1INQB 3GKWH 1HIMH 3MLXH 1ZLSL 3HG1A 1P69B 1PG7H 1QNZL 2CO7B 4UZGA 3S9DB 2QR0B 4FXKA 4XBEH 3PP3K 4V1DE 2YXMA 1J0HA 1A7RL 4PJXB 3SJVE 4TRPL 2B1AH 1CK0L 4MAYC 4H0GA 2FIKA 1C12B 1W8OA 3GMOA 4W6WB 3EYQD 2F58H 5MEOB 2ICWJ 3SDXB 2GCYB 1HQRB 1RUPL 5HHMB 3O3DA 3O81A 2GJ6A 2ICWB 3O9WB 4ZFGL 4ZFOB 2F5BH 3SE9H 4U1IB 3WDIA 5C0IA 5MERB 4XZUA 3MLZL 4H1LB 4FHBD 4MQXD 4FFZL 3T1FA 3C5SB 2CUMA 4QRRB 4S1SL 4OZIB 1J18A 5FM4A 3VFTA 1DQLH 1LP9B 2AGJH 4QRTA 3WO4B 1T83C 3NOIA 5J3HD 3HC4L 4OBRA 3PL6C 3FT3A 1AO7D 1P1ZA 4MGXA 3TT1H 2JK5B 2AJUL 3CCHA 5H8DA 4CVXA 3SO3C 5DTFB 5MEPA 5EUOF 2GFBB 4HXAL 3W11D 2D03H 3E6FA 4YZFE 1PFCA 3QDMB 3SDDD 2B8OT 3I6LE 4LHUB 3HC0B 2P48B 4PV8A 3WLWC 1XCTB 4R2GD 4ETQA 4YXLL 1S9XB 3ZDXE 4JFXA 2D31B 3DX7A 5DUBB 4M9OA 5DVNA 3O3UN 2J7LA 1LDPL 2VLJD 5DQJA 1N4XL 2XWTA 1WSST 1V7MH 1CFSB 4DEPB 3MLPA 2NR6D 1KCLA 4OLYL 1D6VH 2XTJC 3QNYB 2CLRA 4Z77B 4QT5A 1OSPH 4CU7A 3HE6C 2APVA 3FN9A 15C8H 4RWHA 4X7DC 3L1OH 1BF2A 4YDIL 3VI3F 4U1GB 2I5YL 3O3AA 4D0CA 3EO0A 4CMHB 1WEJL 1EBAA 2ZWLT 1EAJA 3TJHC 4X6DA 4RX4A 4U6XA 5ID0A 1RV6X 5F1IB 2F15A 5D72L 4QRQB 1SJXA 3WL9A 4I2XB 3U82B 1MCIA 4NPYA 2FEDD 4NO5B 1OOAA 3T65B 1FYTD 2DYPD 5HVHB 1NANH 1A6TB 5JLZB 3BZ4A 1W72L 1A0QL 1D5MB 1A6ZA 5C0BA 4F7PB 4Z7NF 4ZUSA 2JJVA 2NX5D 4ONGH 1BZ9B 2W65B 5JQ6H 1DLFH 3FQNB 1D7FA 2W0FA 1KB5A 4NRXB 3BKCH 4JFFB 4F9LC 4YUEH 3TYGL 4NKDB 4C59B 3T0EB 1LQSR 3MPCA 1MI5D 4QRPD 4RA0C 2VXTL 4OCXH 4Y5XA 4YQXL 3NCYS 1U8KA 2GTZA 3DMMC 3WJJA 1GGIL 3M17B 1NDMA 4PGBA 12E8L 1KPUB 3ARGD 3LY6A 2XQYK 1Z3GH 4TVPE 1VEOA 4P2OB 1G1YA 4OJFH 2M26A 1UQSA 4OGAC 1OGAD 2KBGA 3DRQB 3LRSA 3MRJA 3LQMA 4F7EA 5CD3A 1SVCP 5D93C 1QYGH 3L6FA 2BRRH 4HF5H 4JAMA 5JO5B 4OFPA 4BSWA 3BPOC 4CBPA 2PXYD 1LE9A 1KELL 4F7TA 4OUUA 5HPMB 5JIPA 3CVHL 3QWRD 5C07D 4YX2L 2O61A 3HG1B 3D1MC 1GH7A 1MHPH 4FXKB 3MACH 3HMXH 2AEIT 4P99A 2AXHA 5HGBB 3O6LL 3TNNA 3HI5H 3GI8H 4OZFH 1BEYH 5GGSA 2FIRT 1QEWA 1NUDA 1FC1A 2X4OA 3MLUL 1VGKA 3MO1A 5FYJE 3DSFL 1MF2L 2BP3A 3S5LA 4HAGA 4U1KB 3O3DB 3OZ9H 2GJ6B 1HWHB 4LPYA 3HUJE 3HZYB 2NY5L 5C0IB 5CGMA 3L9RA 1Q72L 4Y1AE 4S1DD 5GGSY 2V7NA 1GGCL 2FHCA 4UNUA 2IPTL 2MHAB 2NXZC 5B4MD 3O8XC 3DVNA 4XI5C 1T1XB 2CLVA 3RTQC 5D7IF 2KKQA 1NC2A 4GKZA 4QRTB 1G7MA 4N90E 2OM5A 5JW4R 3C6SB 5TH2A 4YC2C 2JJTC 4LLDB 3FT3B 5EPMA 1P1ZB 1F5WA 4QHUB 5CILH 5F3HA 2OJEA 4KMTL 4LSVH 5BXFA 2VRAA 5DK3A 1ZHNA 3T1WA 1CD9B 1R5VA 3MV8D 2OL3L 4O9HH 2BJML 5HYJE 4O2EB 4LCCC 2BY0A 5F9JB 1GZQA 3E6FB 5SWSD 3WNLA 3RUGA 4KHTL 3K8LA 1TTFA 3MOAH 4XMPH 2CMRL 4WUUA 4PJ5A 1UKSA 3RDTC 5IROA 3AS1A 3CXDH 1JZ3A 5TQ2L 4ETQB 4U7SA 2HT2C 2DF3A 3UC0H 5LGJA 3BQUD 4OB5L 1LILA 4EI5D 5F7YC 1HHIA 5J13B 1X4ZA 2F5AL 3GIVA 3L95A 2XWTB 3PHSA 4R4FL 3W0WE 4M6ML 2UWEE 4DKAA 1T6WA 4J7RA 2AV7B 4K8RC 5MENE 3QB7C 4GAJH 3DVIA 5FF6A 3KPLA 2AJXL 4PGCB 3MCKA 4NZDA 4QT5B 5D9SA 4RDQF 5GZND 1CE1H 4YXKL 3SE4C 4F7CB 4NZUL 1MIEL 3RWJA 4AEHL 4WU7A 4D9LL 1YPZA 2EIEA 3VMNA 2J6EA 4D0CB 5IJKC 1Z0NA 3IJSA 2H6PA 1I9IH 4JPKL 4LCYB 4OLUH 1T1ZA 2HN7B 1BIHA 3EYQC 4HIHA 1V7NL 4X6DB 3T0WA 5ID0B 2QKIA 2XA3A 4JGUA 4M5YH 1XF3A 1MRFL 1UA6L 2YEZB 4U1LA 3LQAC 2NY4B 3WL9B 5DGRA 1UENA 4KTEH 4NPYB 3SKUD 4H26B 3PWPD 2VDOH 4TSCL 1RUQH 1XIWA 1QR1B 5FCSH 3ARBC 4ENEC 2VAJA 1KN4H 1ZVSA 2XOTA 4G5ZL 3SOBL 1KLGA 3S3SA 3IDJA 1ND0B 1A6ZB 3MJGX 2OS7A 4FQXC 4KJWC 4X9BA 1SMAA 1NEZB 1UJ3C 2AK4D 2EDRA 2W0FB 4HJGA 1JPGA 1WC7A 4NBZB 5C2BL 1KB5B 4IJ3C 4X83A 4M61B 4NO0D 4GKNB 2BXZA 2QQNL 1QRNB 4UT7H 4N9OB 3GB7B 2J8HA 5BV7H 1BJ8A 4BFBD 4Y5XB 2HFTA 1U8KB 4H5SA 3U4EB 4OI8A 2GTZB 4UDUA 2EYSA 3V5HB 2IH3A 1NDMB 4S1QH 5FUZL 2XFXA 3ROOB 2XV6B 3CIQA 4QY8B 2NY0D 1G6RH 2R2HB 5F6HJ 1U8PB 5JHLH 2ZUXA 1IRAY 1YN7A 1WCBA 3JVGC 5MHSD 4MB3A 4OZ4A 2IQAB 2DB8A 4KROD 1S9VA 3JWOC 4PJ9A 5CD3B 4F7EB 2RCSL 5H94B 3C8KB 5T3XD 5E94B 5E6IC 1RK0A 1OHQA 3UP1A 5ADOH 2DL9A 3MCLL 5C9JB 3BE1L 5CEYB 4PJCA 4P5KA 1AGDB 3GBMH 1RULL 2HA1A 4XP4L 4F7TB 4LIQL 2IH1A 2FCBA 3QHFL 2E7BA 2NR6C 1TVBA 1OB1A 4MJ4A 2O61B 5DQ9A 1NLDH 3K46A 4EVNA 3Q5YA 1NBYB 4X7SH 3V6OE 2A73B 3MRPB 1WWAX 4QXTB 3ULVF 5GHWH 7FABL 1E27B 3WHE0 3LEVH 4M3JA 5T3ZD 5GGSB 2BERA 3IDXH 4QF1A 1QEWB 4KMQA 3HZMA 4AG4L 5E03A 3Q6GL 3LHPH 1WWCA 3ZE0E 1A9BA 1QSEA 1UGNA 1QBLL 3TZVB 4HV8A 3L9RB 3V95A 4AMKH 2Y07H 4QXGL 5DK0B 1T89C 2BVUA 4WWKB 4NHUB 3W2DH 3B9KD 1RZ7L 4Z7UB 3BIAX 1U6AL 1RIHL 5JMRA 1RUKL 4IM8A 3ZZ1A 1A47A 1NC2B 4NUGH 1WBZA 4GKZB 1G7MB 5HHVH 4ERSH 5TH2B 3RKDD 3U0TA 5HHMD 1HINH 1YEIL 1RJZB 3G5XB 3LIZL 4ZS6D 3O9WD 4LSUL 1JWUA 4Z0BH 4KVCH 5JA9A 2G2RA 1YDPA 5E0QA 5F3HB 3WSQH 4OF7A 1R5VB 2P5WB 4KKLD 4QRRD 2Y25A 5GS1A 3QH3A 1G7QB 3JUYA 1VADB 1XZ0A 3CZFA 4ZUUB 3RUGB 5C2UB 1NGYA 4LF3B 4LU5H 2AABH 5KTEH 3CAFA 3E2HC 3H9SE 4NNYA 3N9GL 1NL0L 4M7LT 3U7WH 1SM3L 3VFOA 1J7VR 4M3KB 3U46A 5DHYB 5KVEH 3EYFA 3FRPG 4X6EB 8CGTA 4IIQC 3AU1A 1Z2KA 5FHAH 5IB5A 4F3FB 2AJ3A 4OM0H 4LHUD 4DN3H 3NGBC 4KDWA 3EYUH 3UX9B 5J11C 4ODWB 5J1TC 2WUBL 2DWEB 3QPXL 5D9SB 5CZVL 5CSBA 4R97C 5CIPA 2VLLA 3RHWF 5L88H 4H25A 3RWJB 4BFEA 3CD4A 3C5ZB 1JPSL 2NW2A 1D6EA 1YPZB 4IS6B 4A6YA 2XZQL 5D7SH 3QFJB 3RY6A 3KDMB 5D2LE 2H6PB 4JM2F 3D2UA 3ZT5A 1XF3B 5IHUL 4U1LB 3V6ZA 4HIXH 1EXUA 5A3IC 1ZLWK 3K74B 3WCYA 4JE4B 1XIWB 4QHLA 4S1DC 1X6NA 3G5ZA 4P3DB 1DQMH 1KLGB 3IDJB 5C08E 1SYSA 2VWEC 5I9QC 25C8H 2NY6C 1KNOB 5I1CH 5IOPA 1RHHA 1Q0YL 5DJ0A 5E2WH 4FQCH 1R6VA 3OR7A 4YDKH 1DE4B 3PGDA 6FABH 1GPOL 3ARVA 1K2DB 4H5SB 4XPFL 4RSVA 2XRAH 3P0GB 2WLZA 5GJSH 4OSUH 2XFXB 2VXVH 3TP4A 5FO7A 5CKAA 1MY5A 2JF1A 3MBEB 4EIGB 4R0LB 1R3HB 3QBTB 4JFFD 2XNAB 4JO3H 5EB9A 1MCEA 1UZ8A 4GAGH 5HTSA 4PJ9B 5HYIA 5ESVB 1RK0B 5I19L 2VSCA 3FB7A 5CUSH 5DD5L 4J4PD 1D5BA 4WV1B 5IMKA 3WNKA 4UTBL 2IH1B 3G9VA 4XMLH 4P2OD 5EWIL 2XYCA 1TVBB 2CUIA 1J0JA 1I1AA 5F96L 4EVNB 1DQDH 5C0CA 4OCSL 1V3MA 4XXCC 4B7LA 1IMHC 4ZNEE 2CUHA 1RZIB 4YWGH 1NSNL 1G9NH 4UQ3A 3TPUA 1H3UA 5HHOE 4HCRH 2OTWB 3QEQA 5HI4C 4RBPK 4IBLT 4UAOC 1PQZB 4DGVH 4AZ8A 2ZG2A 2VZ3A 3RWCA 1EGJL 4JQVA 4PJ7E 4JHWL 5FA3A 3RRQA 4LSRL 4YHMH 3HG1D 1A9BB 1QSEB 5DD6B 4FQ2H 4X9IA 2A0LC 3TBYA 4HV8B 4PUBH 1G0YR 2BHYA 3MUY1 2XQBL 1JF5A 1ZA3A 4OFKA 3T4AA 1L0QA 2GT9A 5KSAA 1LO3L 2IC2A 5F9WC 3TH3T 4LK4A 3QEUA 5KSBA 1F11A 5IVXE 3Q1SH 5A2JH 2VZVA 5T1KB 4OIBA 3EW3B 5BRZE 3AREA 4UB0H 2MQ0A 3Q48A 3U0TB 3UAJC 2GJ6D 1KTLA 4XPGH 1G6VK 4WTXA 3FO9A 2B2XL 4XP1H 1H3GA 4Z7WF 2F8VA 4PRPE 3FHQA 1GZPB 4ZSOB 3WFDL 1XZ0B 3Q3GA 4P59H 5JORA 3CZFB 2NY3B 3UJIH 4QHMA 1W72A 1NGYB 2O5ZH 3VJ6A 2K1MA 1OTUD 5AYQA 3TV3H 5DSCB 3TFKD 1XAUA 3HC3H 2XA8H 3IJYA 1C5DB 1E4XH 4X80H 5HD8D 1IQDB 1JIBA 2CIIA 2Q76A 3PV7A 1C7TA 1YYLH 2BHZA 2BCKB 1FLTX 3M1BA 1JGDB 3VFOB 3BYTA 2IBBA 3EYFB 3AU1B 1QFUH 2AJ3B 3EDDA 1OAQH 5TPWH 1I1RA 1DEDA 4Z7OE 3X11B 4NJAH 1QSFE 4H25B 3S4SB 2WQ8A 2NW2B 4A6YB 2NXYB 2C4XA 5GGRA 1RZKL 2UZIH 1EJ6A 3D2UB 5IFJA 2FBJL 2J3SA 2ESVA 2EIDA 2X44D 1HQ4B 4LOUC 4PJGB 2DQDH 3CVHA 4QHLB 1HHHA 4HZLB 3G5ZB 4I77L 4LLWA 2EDBA 2JKXA 5DUPL 3FT2A 2CQVA 1QHOA 1SYSB 4XWGL 5GQBA 3S6CA 4HUUA 4AIZA 2V7HA 2VABA 3GSOA 4G9FE 4RX4D 4OLVH 5DFTA 1RHHB 4G8GE 3NFSL 3OR7B 3O9WC 1ZKAA 2P47B 1JF1B 4UIMB 3MV7A 5C71A 3PGDB 2CO6B 3GRWL 2V2WB 1F58L 1TETL 4KKLC 1G0DA 5C0BD 5CSGA 4TNVK 4BSVA 4YHOH 4LEXH 3MR9A 2GHWB 5HI3C 4HH9A 5LAXA 4B5EA 1R24B 5FO9A 2ZUTA 4MYWB 3CVIH 4GBXA 3HS0B 3KJ6L 4RZCA 4XPAL 5J1AA 1K4DA 3L3DA 2FX8L 3KYKH 3C8DA 3UJJH 2OL3A 4HWEL 1JNHB 5J57B 3WKML 1YECL 2F9BT 5IMKB 1UC6A 2ZUQB 4M1DH 3U79A 4U0RB 3REVA 3QDJB 1FL3A 4NCC2 1VA9A 2VQ1A 5DQDL 1QFWH 4K9EH 2B7DT 5EIIA 4Z95H 2CKBH 4E42B 4R90L 4NN5B 3QEQB 5IIEA 4ZUVA 5AZEH 4XPHL 1BBDH 1KJVA 4M03A 3RWCB 4DEPC 3GJFK 1EBPA 5FA3B 5GSRA 4L4VB 1BD2E 1NBVH 3F8UB 2JJSA 5IEKA 3TBYB 2PR4H 3OKDA 2V5MA 4KI5C 5I8OL 5IM7A 1E4WH 4M48L 1I1YA 5EUOE 2XWJB 5HGHA 1IGYA 4YHNA 5I1JH 2C1OB 4M7ZB 2GT9B 1MREH 4ODTL 4R8WH 1ZK9A 4ZS7H 4CMHC 4KKAD 2HTKC 3NAAL 4L3EE 5EU6E 3O6FB 1Q94A 1RURH 2FDBP 1RJYB 5CLWA 1KTLB 1N3NA 4WNQA 2FD6L 4MNQA 1CL7I 1J05A 1IAOB 4P49A 3RY4A 5HVHC 1QFWM 1QKZL 3MLYL 3KS0J 2PN5A 1WZLA 3J8F7 5DURB 5AZ2L 5JW3H 4O02H 1TJIH 2PETA 4IDJL 1MWAB 4JVPA 3RVXD 4QHMB 4UV4H 5CS7A 1NC2D 4JANA 3VJ6B 2ADFH 3SDYH 5FUCC 2WWKO 1U36A 2XZAL 3ULUC 1U8IA 5F93C 5I75C 3T0EC 3M1BB 4FFVD 1UM5H 1S5IL 1BHGA 4KQ3H 4KK9D 3VI3E 1U9KA 5CBAB 1G7HA 1ZWIB 2WMPA 1I3RB 2R2CA 3ZKSD 4J4PC 3BKJH 2FEEL 4WUUD 2GJZB 3AVEA 4PJ5D 2X70A 5HHNA 3H0TB 1S7VA 1YYML 1INDH 5DI8B 1G7JA 3PXHA 4FQ1H 4K2UL 1YZZA 4MJ2A 5IJVB 2YPKB 1WGOA 3MRIA 4O4YH 4Z7NE 1EAPA 4N0UB 4UT6L 4XP6L 4YNYB 2HLAA 4PJDA 5CEXA 2XN9A 3F7YA 5B3JF 2OP4H 1A2YB 2ESVB 5C6WH 4NNXA 1A7NH 2R1YA 3T2QA 1AGFB 4UU9A 5D7KE 3LQAH 3E8UL 4GQPH 4X7TA 2J4WL 3GM8A 4LLWB 1YQVL 4XP9L 1F02I 5CIPH 4UBDD 1M7IA 2HT3D 2Z93A 3S36H 4P23C 1RMFH 2IANA 5HGGS 1QOKA 1CLZH 2Y6SD 4AIZB 2V7HB 4P3WA 1QFOA 3GSOB 3KPMA 4H88L 2AEPL 1BJ1H 3X14B 1NFKA 3V0AC 1XGUA 3LS5L 2HJFB 3MV7B 5SX4I 1XIWD 4HIJB 4UT9L 4JJHA 2JCCF 4M7KL 1QNZH 1UT9A 4BSVB 4XCYB 1TPXB 3MV01 1A7RH 1FGNH 1VSCA 3M07A 4TRPH 4P2CG 1JMXA 5K93A 5FO9B 4GBXB 3EFDH 5EN2B 2IAMC 4RGOH 4RGND 1CCZA 1BQLH 5J1AB 2R0WL 5EZJA 3WMSA 3L3DB 5ANME 3ARWA 4KI1A 4LP4A 4H20L 3UXFA 1BOYA 4QEGA 1XGQA 3ZMRA 3MSPA 5GRVK 1LEKA 1KGCD 3W9EB 4G80A 2VH5L 2VLRE 4FFZH 3ARDB 2XXCB 4S1SH 4G42A 3REVB 3VXSE 1FL3B 1U42A 3OKNB 5ICYA 4WJ5B 2A83A 4PJ9D 5L2KA 1MFEL 4PRIE 5EIIB 3LN9A 1T66D 3HC4H 2FGZA 2QL1A 2Y4SA 1WAAA 5IIEB 2AJUH 4JO4L 2VE6A 1F4XH 5GJTL 3ABZA 4PJEA 1X5ZA 5D7IE 4HXAH 5INCB 1BREA 5GSRB 1TENA 5HHQA 2GIYA 4U31A 5ESQB 1QBML 5JUEL 5IEKB 4V1DB 3DWTA 3OKDB 4XHQA 4ELMF 5I1GL 2M2DA 5AD0B 2D7NA 5CHNB 3RI5F 1QVOB 3G08B 5HGHB 4POZD 4JM4L 4YXLH 4PD4K 1A1MA 2A6DB 5DVKA 4G9DA 3U7YH 3H3BC 1OAYL 1F4YL 3DARA 4FFWC 1LDPH 2WK2A 1BF8A 1ZLUH 2DWDB 3VXNA 5EU5B 1SBSH 1N4XH 4G6AD 1QSED 2NY4C 3EGSB 4WNQB 1N3NB 1J05B 1JTTA 1OAKH 5E4EB 3L5JA 1TZHA 1NGXB 4BFIA 3W5NA 5DT1L 1A1OA 2NLJB 1KEML 3BOVA 4NWUL 4D8PB 5GRYA 2OR9L 4BQBA 2AK1H 1FORL 1YY9D 2VDLL 1RZFL 2ICEA 2I5YH 1UEYA 1BBJB 2YS4A 2ADIA 4OUOA 2YN3A 1RPQA 1WEJH 4Y5XC 1L7TL 3LKSA 1TVDA 3UCRA 3OX8A 3VGEA 4M5ZL 5D72H 1GHFL 1MCNA 4JG1L 1G7HB 4QOKE 4HLJA 2NY3D 1I4FB 5IB3A 3ECBB 2VZTA 3BZEB 4Q7DA 1YJDC 2EZ0C 4MS8C 1KTKE 5SX5K 1KT2B 3BIBX 3F7PC 1AH1A 1W72H 1A0QH 1IBGH 1RSFA 1EEYA 2X70B 4PY8J 1EJOL 4DN4L 1IFHH 2XKSA 3IB4A 3MUZ1 3PHQB 2BMKA 4J3OC 5CEZE 4OQ1A 1CE6A 3TO4B 4O2FA 4WW2A 3IDUA 3MNZB 3TYGH 5LJYH 1J87A 1PYWA 1RVFH 3MRIB 4HJJL 3TVMB 1EAPB 3CX5K 5CEXB 4RAUA 4PJDB 2VXTH 1S7WA 4YQXH 4E5XA 2XKNA 4PGEA 1VPOL 3GSVA 1GGIH 4WENB 3FB8B 4HEPG 5FKAA 3HNTL 4X6CA 4QWWD 12E8H 1MVUB 2UYLA 3OKKA 2R1YB 3TM6A 4NKOA 4PGZA 1FNGA 3D18B 4DOHE 1OCWL 4X7TB 3QIUC 1ZGLA 3SKJH 1OTTD 2X9WA 1UM6L 1IGJB 1EO8H 2NXYD 5KS9F 4AK1A 2IANB 3D2UD 4KKAC 5IK3B 1EVUA 4JFEA 5EOQL 4MQ7B 5TFSH 3MJ6A 2VDNL 3EYOB 1N5AB 1DL7H 1EGJA 3IRPX 4NQCE 3TZVC 5HHPB 4X98B 3WHXB 1KELH 4WWKC 3KLAA 2ZSVA 3CVHH 2PCPA 2QV2A 4YX2H 1CL7L 2P5EE 3VFMB 4CN4A 3VW3L 3BI9X 1OP5H 3O6LH 4Y8AA 3VU2A 4FTVA 1A7QL 5IGXL 3K4DA 5B38A 3RL1A 3VXTA 4MD4B 5DJAA 3MLUH 3KYNA 5EZJB 3PV6B 3ULVE 3DSFH 1GVIA 1MF2H 1JFQH 3QIBA 2KUTA 2I25N 4CNIB 1IC1A 3CDGA 1XGQB 2J5LB 2NY5H 1G7LA 2GUOA 1HH9B 4ODUA 5KVGL 4IOSD 4R7NA 4NQXA 5F7UA 3CZJA 3O2VL 2AJVL 3CC5A 3VFRB 3QUMA 1UB5B 5ID1B 3GIZL 2EO9A 3MLSL 2FX9L 3IFOA 4I0KA 5T1DL 5KZCB 1MY7A 2VE6B 4WRLA 4KMTH 3ZKNC 3BPCA 4P9ML 1DUZA 1GSMA 2OL3H 3JTSA 2BJMH 3VCLA 3V4PL 2H3NA 1I1AD 4WI4A 3X3FL 2VLMD 5C0CD 4KHTH 3C2AL 3ISWA 2CMRH 4WW1A 3WUWG 4OCWL 3C5ZC 1GOFA 4JGMA 1KJ2L 5DC0A 4WO4A 4UBDC 3UBXB 1NGPL 3QEQD 5TQ2H 4YO0A 1A1MB 4HS3A 4G9DB 4UOW1 4G7VL 1WZ1L 4Q9CA 4MXQC 3WUZA 2VDPL 1VHPA 1JZ7A 2PW2A 4OB5H 4WFFD 3C5JB 3VXNB 2VL5A 5F9AC 5T33L 3HUJB 1KBGL 2F5AH 2LAGB 4R4FH 5KANG 1ONQA 5F6IB 3VG9B 2X09A 1HKLH 4G8FA 3U48A 4HKZA 3T77A 4BFIB 2W9EL 2ZOLA 1PY4A 1CFQA 2AJXH 3AXLB 4JQIL 5KSAD 1ZGLP 1A1OB 4MB4A 5IHZA 2K3TA 4I0PA 4ZXBC 2WQRA 2EC9T 4LCUA 4YXKH 5C0AA 5DYOA 2GI7A 3KLHC 3ARED 4NZUH 1ODAA 2DQIH 2ICEB 3VXRA 5JXEC 3QNXA 4AEHH 4D9LH 1PSKH 2ADIB 3HB3D 5I8KL 2X42A 3D5OF 4O58H 4RISH 1G9MC 3EOAA 3OX8B 5DURD 4M62L 1JBJA 1MRFH 1I7TA 1UA6H 2C3HA 3LKQB 5AUMB 2J8OA 5IB3B 4M6AA 4TSCH 1PX4A 3MBEC 4R0LC 2IF7A 3OXRA 1EEYB 1AGEA 2Q8BL 3IAGC 5HXMA 8FABA 3NABH 4X6DF 1MHEA 4EUPH 2ZJSH 1CE6B 1JK8A 4O2FB 4OBSA 5FO8A 4JKLA 4JRXE 3FQRA 5JHDE 2QQNH 1WITA 2CRIA 3D0VA 5EBLA 2UWEB 4RAUB 4C56E 3PWLA 4WV1C 5FYKL 4ZPTB 4E5XB 4JHZA 5I1LA 5MENB 2X05A 1I8LC 3VWJB 2H9GA 3IVKA 1FVDA 2E6PA 1IAKA 3WEXA 1EERB 2QSQA 2UYLB 3OKKB 5FUZH 3BIKB 3GMLA 3MRLA 2PTUA 2YA2A 5F89B 1FNGB 1YMHA 3K8KA 3RWIA 3QUYA 1CTOA 3SDAA 3NACL 4DQOL 5IWLC 4TUJB 4GW4B 5DHVA 2ITCA 4F2MB 2RCSH 2YD7A 3MRNA 2ESVD 2ED7A 4FQJL 4R6UA 3RWFA 3I02B 3BE1H 4LVHB 4LIQH 3KLAB 3QHFH 2ZSVB 4RFOL 4Q58C 4KXZI 2PCPB 4PGDB 3NN8B 5FGSA 1F6LL 1DVFC 3VXUA 5DMGD 7FABH 3E0GA 1H5BA 1DBJL 1BMGA 3RL1B 1XGRB 3MV7D 3VXTB 5I1DA 3TLRA 1K5NA 2ZG1A 4J8RA 3KYNB 2FATL 1WFTA 3QIBB 4KK6D 3B6SB 2DI9A 1AO7E 3QUXC 3CK0L 4ZOBA 1QBLH 1V3LA 1KSRA 3L3GA 5E6ZA 4Z76A 4QXGH 3ZT7A 1J11A 4ODUB 4PJHA 1GRWA 1DN0A 2C3XA 4GRLB 4GBXD 4NQXB 4R7NB 5I8EB 4MLSA 4Z8FL 1RZ7H 2AJZA 1U6AH 1RIUL 1RUKH 3QUMB 3TCXA 4X4XB 3DBXA 4YBQC 3OMZA 4HGWA 1RAMA 1YEIH 1BZQK 2Y9RT 3LIZH 4LSUH 4Y16A 2VXUL 3NFNA 3RL2A 3V8OA 1EV2E 1UXWA 3PQYA 4LHQB 5F7LB 3TBVA 3BPCB 4QCIA 1KCVL 2CK0L 4L5FH 4MJIA 5JMOC 2VLJE 2BOCA 3KVQA 1INEL 3BXNA 4WI8A 2Q86B 5IKCA 5C3LD 2Z31C 5MEQA 4OGZA 1LWRA 4TSAH 2EXYD 3FN3A 2ED8A 1ORQA 4ZUWA 3E3QC 4ZFFA 3RY6C 4HS3B 5H35A 3N9GH 4S2SA 4AENA 1FCGA 1SM3H 2PW2B 3TYFA 5I1EL 4XC3L 3RUGF 4UDTA 1ONQB 1CDJA 1Y0LA 2X41A 4KQ4L 5I1IL 1A3LL 4G8FB 1GGTA 4HMEA 2QADD 2ZOLB 1GCFA 2X7LA 1CFQB 1NAMB 2WUBH 3QPXH 2ZUVA 1XF5B 5CZVH 5KVDL 1TZIB 1I7ZB 2E8YA 4HWNA 4LCUB 4XXDB 1S7UA 3NA4A 3JUZA 5DYOB 1BIIB 4LAQL 2C1PA 5IQ7L 5HYSA 2XZQH 4MNQD 2LFGA 2HT4C 2NNAA 3HI1A 3N0PB 2NX5E 1JV5B 3O3EB 3A67L 1SY6L 2FWOA 3F6LA 2K9UA 1AJ7L 5E8OA 1I7TB 5IHUH 4XMKL 2IADA 5JA8B 1ITCA 1MI5E 2ARWA 4QRPE 3RVTD 2ZNXA 3CFKA 4X7EC 2VB5A 4TYUA 1BFTA 5JOPD 5D7JA 4ZD3L 4JRYA 3H9SB 1AHWC 1T6VN 4LQFH 4JFPA 4MXWH 2P46B 1ETZB 5LBSH 3EO9L 3ARFB 8FABB 5CGYD 1GIGH 2FJFB 5JR1H 4HMDA 3FZUC 1Q0YH 3ZKMC 4HDIA 1KFAL 3D0VB 4GRWF 2IG2L 2DQCL 3I6LD 1G7PA 1BLNA 1GPOH 4N5ED 4WIQA 4E0RB 1OW0A 1FZOA 5ITFB 3IVKB 4XPFH 1MHCA 3WEXB 1IAKB 3IXTA 5E9DA 4ZAKA 1HYRC 3GMLB 4P0DA 3MRLB 3GSNL 1YMHB 2Z8SA 3VDBA 4NUJA 1XF2A 1KB9K 5C07E 5FGBC 3SDAB 5D2LB 4GW1A 3MNVA 2H2SC 2E9JA 2HVKB 2UY6A 2XN9D 5DHVB 5AWNL 2ITCB 4NN7B 4JQVC 5EG6C 5KSVB 2A6IA 1MHHB 5DXWA 5L9DL 2NPLX 3GJFB 2H1PL 3SE3C 4YDVA 2AS5M 5HDQL 5KJRL 4M02A 2AXGA 2WP3O 3QJHA 4M7ZC 5GZOD 3B83A 4S0SD 3QCUL 5C08B 5F96H 4ZTOL 3KPSA 2IAND 4PRAA 4OCSH 1MRDL 2VXQL 3O6FC 1ORSB 4G6KL 1NSNH 2R1XB 1NEUA 3MRRA 4PJCF 5F71A 3RHWK 5I1DB 5J7CC 1MCJA 4M8QB 1K5NB 4J8RB 3MRGB 4P46B 1EGJH 1FO0H 3ULSA 1KCKA 4LSRH 5F7MC 4MDIB 2X2YA 1T22B 3L3HB 4JREC 3GGWB 2CGRL 3L3GB 1J88A 3B2VL 2WBJB 3MV8E 3QP3A 3BRGC 2VC2L 1J1OH 5SWSE 2ZCKH 4XRCA 3LKNB 3DBXB 3F5WB 5GGVY 5BCAA 2NZ9C 3BO8B 4HGWB 5DF0A 4HS6A 3HFML 1II4E 4Y16B 5GGUB 3NFNB 5FOBA 3P4MA 5I71C 4GXVL 1WIUA 5TGBA 3TBVB 4HG4K 3O11A 2B2XH 4QCIB 4MJIB 2QQLL 3L3JA 1X7QA 2BOCB 4QXWA 3V6BR 1A6WL 4EUPG 3BXNB 4NP4L 1K8IA 5IKCB 5L2KD 3HAEA 3QRFM 4FP8L 1ADQH 5H2BB 1PEWA 5BZDB 2VZSA 3I6KB 5HHOB 4I18A 2A77H 3QULB 1FAIH 5H35B 1XGPA 3RWGB 1V5JA 4S2SB 2JLLA 4J6RH 1QR4A 2RHEA 4WGWB 1YY8A 2VIRA 1K3IA 5DS8B 2HTLC 3QI9A 2BFVL 1J8KA 2DQFA 5M95B 4HWZB 4ZOAA 2X7LB 3HPLB 3LD8C 5IVXB 1MCPL 5EU6A 1TZGL 3PWPE 1NCAH 1YEKL 1S7UB 4Q9QH 5ILTL 4Q6IA 3MRKA 1R3LA 1RZJL 1ZT4A 2C1PB 4KPHH 1T04B 5HYSB 3ZE1F 3T8XB 5IEHB 4H1LG 2AK4E 3BAEL 5DRNB 1IKNC 1F45A 3HMWL 4PRPB 2FBJH 5DJXA 1CICA 1BVKA 5E8OB 2OI9B 5CJQL 5C3TA 4ODVL 3OR6B 2IADB 2H45A 1DUYB 1TPXC 1Q9KA 3C60C 3OAZH 3SKOA 5B3JE 4N0YL 1FBIH 2VISB 5E8DL 5F7EL 4K3JH 4XWGH 5C0RL 2HJKB 3UTSE 2JJWA 3UDWA 4TVSa 1F13A 4CMMB 3ALPA 4FNLH 3U9PL 3CSYA 3NFSH 4HHAA 3WNMA 5MHSE 2HH0L 1ZXQA 4LHUG 1H8NA 1JP5A 1BLNB 1OD9A 2FECL 2IGFL 3GRWH 3BT2H 1FZOB 3ARDC 3FQWB 5T3XE 1F58H 1TETH 3P4OA 1MHCB 1QSVA 3IXTB 4ZAKB 4F7MA 4AT6A 5C0GB 1QSFB 1YEFL 2ADJA 4YK4B 2R69L 1TNMA 3DI2B 2R9HD 2R0KL 4NUJB 4X4MA 3AB0B 3CXHK 4KAQH 2JCCE 4UILL 4XT1C 3UROR 3KJ6H 4EN3B 4XPAH 5DGQA 4GW1B 3MNVB 5J8OA 3RZCB 2C3VA 3D69A 4WEMB 5D2NA 3KXFA 1OARL 2EDXA 4HWEH 3X13B 1DZBA 4MCZA 1YECH 3H9HB 1XH3B 3FB5A 4K55A 3QJHB 4PD4J 1I3GH 1P5UA 2P44B 3FOMA 2VOTA 3KPSB 1KJ2A 3OJDA 1FJ1A 4HJ0D 4JFED 5IVZA 4G9FB 4G8GB 1VKXA 1FQ9C 3RA7L 1HEZA 1GGUA 1N59B 4LCWA 1UCTA 5IQ9B 2VSDA 4XPHH 3BKML 3BD4A 3C09B 5HHME 1T1YA 4WY7H 4HBCL 1KYOK 3QO1A 4OF3A 5I8OH 5LQBL 3H3PH 3KYOA 1J9CT 4TULH 4M48H 5A2FA 4FTVD 3U7AA 3MV11 5C0ND 2QQKL 2RR3A 1S7XB 1FNSL 4XRCB 3MMEA 1PKOA 3NAAH 3PDOA 4ELME 1BFOB 1ACYL 5ANMA 1JNNL 2VAAA 3BN9C 3QIBD 4GG8A 4PLJD 4APQA 2YPVH 3CX2A 4CVWA 1WT5A 5DD1L 5GRUL 3P4MB 2HWZL 2PYEA 1U2CA 3O11B 3GKWL 4YHIA 5C92A 1QKZH 4LPVA 3W39A 3MLYH 4MSWA 1PG7L 3CGTA 4IDJH 5KSBF 2YRZA 4XBEL 4MAUL 5GXBB 2YMXL 3HAEB 4K7PX 1I1CA 3TIDB 3TO4C 3D3VA 3LDBB 2XZAH 4K3GA 4XNMB 3CX5J 2APFA 3TVMC 4EJ1C 5IB4A 1S5IH 1NFIB 3FN0H 1BD2B 1T0MA 1YY8B 2VIRB 1Q1JL 1X6LA 2ZCLH 3SE9L 2F5BL 3QI9B 2DQFB 2NY2B 4M93B 5EUOB 3V0WL 3X3GL 3BFOA 5JW5B 4Y5YA 4WO4D 4P5TB 2E7HA 3GSQB 4NFBA 4ONOA 2AGJL 1YYMH 4WVRA 4L3EB 5EU6B 3TH4T 3EDFA 1K8DA 1MCDA 3MRKB 3OB0H 4K2UH 2Q87A 2W1NA 3VG0L 4XX1E 3FRUA 5GS0C 5EBMA 1GL4B 3TA3B 5HBBA 4UT6H 4WFGD 4XP6H 3D85A 2D03L 4K7PL 5DJXB 3DO7A 1CICB 4HUMB 1G9MH 4I0PD 1AD0A 4KFZC 4NRZA 2E7LA 1F8TL 4JCMA 5C0AD 4Z7QF 2D2OA 4MD0B 3LH2L 3E8UH 3HZVB 5E8NB 1EHXA 4DVRL 1I8IA 3SKOB 3VXRD 3BX7C 4XP9H 1OP3K 2VKWA 1V05A 5GGTL 1A3QA 1CFBA 3SGJC 1XGTB 3VGFA 4H88H 5DJ8B 3CSYB 4HHAB 1AR1D 1HILA 1Q9WA 2J5LC 5KS9E 4HK0B 1HCFX 4UT9H 2R56L 1DBKH 3BMVA 1LNUB 3B4NA 3UTTA 3P4OB 4M7KH 5IT2L 1YQ2A 4HUWA 15C8L 1NGWA 2C7UA 2EE6A 3WXVL 3L1OL 4PJIA 4C57C 3DPBA 5IHBA 2GITB 1G9EA 1MQ8A 1I9EA 4N0RA 2GK2A 2R0WH 3LQZA 4BZ1L 4H20H 4JKMA 1XR9A 4J3SA 5B21A 4XVTH 4MCZB 1WBYB 3HZKA 2VH5H 4KHXL 2N7AA 4G6JL 3QUYD 2YUXA 5GS2D 3SDAD 3ZO0A 4KVNL 1U3HA 3HG1E 4ONGL 1J0YA 3FOMB 3QZWA 4ORGA 5D1QB 1KJ2B 1MFEH 3OJDB 4KV5E 3DV4A 5MI0C 1I3UA 1VKXB 4YUEL 1GOHA 4QO1A 3KR3L 4JO4H 4WDIA 5F6IC 2AXFA 3VG9C 5GJTH 5D96B 4JVWA 1WJ3A 5EU7E 1NEZG 2GJ6E 1KIQA 2DLIA 2W92A 1QBMH 1NCWL 5EU3A 3KYAA 5JUEH 3VXUD 1Z3GL 1CGUA 2FL5A 4Y4FA 5D6CB 4KK8D 3P2TA 4OJFL 4JM4H 1E0OB 3DVFA 1UM4H 5HGDB 4AQOA 1CLCA 4F9PC 2KH2B 1QYGL 1OAYH 3FQTA 4ELKA 4QLRA 5DO2C 3WIIH 3WS6C 5ANMB 1MJJA 1U8HA 4OCNC 1GGBH 1T2QL 3WNOA 5GS3A 4X5WA 5CCKH 2OQJA 3HRZB 2QJDA 1EO5A 2PYEB 1CF8H 2VLRB 1MH5A 3W39B 3B5TA 3LS4L 4MSWB 4PBWD 2Z4QA 5DT1H 4AEFA 5F7WC 4XVUD 1LD9A 4NWUH 4ONFH 1M71A 1EX0A 3T0VA 3HMXL 1V3KA 1FORH 3MOBL 2VDLH 5IR1B 2VDQL 4Y16D 3RVVC 3JWDL 1CG9B 2UVFA 3BJ91 3RPIA 4XGZA 1H3XA 3PQYD 5F21B 5D7IB 3R1GL 1REIA 1L7TH 4MJID 4PYHA 3D48R 3VWJC 5FV2A 3HLAA 3L7FA 1T0MB 4IRSB 4M4PA 1GHFH 4LKXB 2DIJA 1YA5A 3T2PA 1N0XH 1H3VA 5DLML 5I74B 3FT4A 1D5IH 5D1XB 1MJUL 3GSXB 1M1SA 5K9OB 3GSNA 4Y5YB 3PP3H 1I7RA 1UYWH 5IFHH 3DURB 1X5KA 1EJOH 5AYUH 3VWKA 4DN4H 1GOGA 4FQLH 4UIKL 4EQ3A 1MLCA 1K8DB 3PABA 4BQ6A 1HXMA 4NOBA 1R0AL 3FRUB 4MQSB 4HJJH 4LSVL 1AXIB 4CVZA 3CH1A 4U0QB 4O9HL 4LVHC 4X6DE 4OT1L 2RAMA 5CZXD 5E7FA 1RZGB 1AD0B 4NRZB 3WN5A 3MOAL 4B0MM 1IGFL 2CJUL 4XMPL 4NYLA 2GW5A 1OCWH 1YEJL 4JHBA 5CJ8A 4JFQA 1QQDB 3VFPA 4OGYL 3T2NH 4NC1E 5C09E 5C0NC 5C0BE 1K4CB 4PLOB 3V7MA 3UC0L 4RWYH 3RI5K 1MNUL 5IP4A 4RAVA 4OLWL 3OKMA 4IMLA 3QA3A 4L9LB 2VDNH 4QOKB 3NH7L 2DICA 1HILB 3CMOL 3MJ7A 3D9AH 1CD1A 1F4HA 3IDIB 5KOVC 1TQBB 4EDWL 2YPLA 5D7JD 1C5BL 4GRLC 4JRYD 5E08L 3L5XH 1CE1L 1CL7H 5EZIL 4EEEA 4LRNL 1A9EA 3QIWB 2C7UB 3QUZA 3RGVA 3VW3H 1UH2A 5BO1L 5C86A 3DROA 2WIIB 4JRXA 3JV6A 1A7QH 1I9IL 2XY1A 4PG2A 2AVGA 1AR2A 1A4KA 4X8JA 1EFXB 1C7SA 4WHTA 5IBLC 4J3WA 2R2EA 2AERT 2A6JA 2VYRE 5E9DD 4KTEL 1XR9B 4QHKI 4ZAKD 3V6OC 4WI5A 4P48A 2RFXB 4DOHB 2OBGA 3UPAA 5KVGH 3JWNC 2LABA 1ES0B 2NY1B 1FFRA 3QZWB 4D0DB 2QLVB 1S78C 4UUJA 2NMSA 3DV4B 1PKQA 4OKVA 2CRZA 1E6JH 1P7HL 4UT7L 5H37G 1B0GA 3OKLB 4NQCB 1TQCB 2VITB 5T1DH 4IMKC 1BFVH 1ITBB 2AXFB 4E41A 4RMWA 2EDDA 4P9MH 1FYHB 1E4XI 3BP6A 4GFTB 3O4OC 4CGTA 2P5EB 4TOYL 3F62A 1KIQB 3X3FH 3KPSD 5EU3B 3BP4A 1P2CA 4KGJA 3RPKA 1NUNB 4OCWH 1WAAF 3MLTA 1NGPH 1IM9A 1AIFA 1GGYA 2EH8L 2PNDA 3DIFB 4PJEF 5EDXA 1WZ1H 2YD2A 3FQTB 2VDPH 4W6XB 3ZSSA 1MJJB 2GTWA 5ADOL 3BD5A 2I9TB 3VRJA 1KBGH 1AR1C 4B41A 1IZKA 3V5DA 3GBML 1UXSA 5KG9A 2MPAL 3IJHA 2O5YL 5DVLA 2EEBA 1MCCA 5ALBH 4GSDL 4JO2L 4JQIH 2B4CC 2Z4QB 1NLDL 1YC7A 1QP1A 3BKYH 1WIOA 3RUGE 5E5UB 3ARFC 5GHWL 2FYYA 2NY7L 1IVLA 4WUUE 4PJ5E 5TQ0L 5EC1B 3BN3B 3VFUA 2H26B 3BGAA 4FZ8L 4LSDA 5I8KH 3RPIB 2L7UA 3NVQA 4QTHB 5CMAB 5I73B 4XGZB 5ACMA 2YUVA 1H8SA 3OXSA 3IKKA 4GXUN 3KPRA 5J06A 4M62H 3HLAB 3L7FB 2HP4A 4XCNA 1KPVB 4AMKL 2Y07L 3FT4B 2YHGA 4Z7WA 3L5HA 3S88L 1KB9J 1ZV5A 4CDHA 1LO4L 5DDHB 4ZDHB 1I7RB 5HI5C 1S5HA 1CU4L 4MJ6B 2BNUB 4ERSL 4M43L 2R1WB 4BH8B 1QLFA 3EJZC 3PABB 1A6PA 4PJFA 4MXVF 3F65A 1HXMB 4R4BB 4U1HA 1YPZE 2PO6A 2Z8RA 1FIGL 2I60L 4I9WD 3QI9D 3VDCA 4AL8L 5FYKH 4LSTL 3MRMA 4P9HC 4Q74A 1J8HA 4FFYL 4NQSA 1BQSA 4ZQKA 1B2WL 3EO1A 4XTRD 2WZPD 5EU6D 3WN5B 3MRQB 1F2QA 4GRWE 4LU5L 3NZ8A 4NYLB 4WW2F 4NQVA 2MOVA 2HLFD 5F1NA 3VD3A 1PZUB 4OV5A 3VFPB 3VXMA 1UJTA 5TDPA 3KPPA 4DQOH 2PW1A 3U7WL 4Y7MA 4YAQB 2DQEH 1FZJB 2FLRT 1TCMA 4RAVB 4P46C 3CUPA 3RIFF 1CICD 4IMLB 5A2IH 1HK6A 4X6CF 1HDMA 3QA3B 4FQJH 3G5YA 2YRLA 5FHAL 2P4AB 1FNEB 2C26A 3KPQA 3MJ7B 2LVEA 4OM0L 1QFWI 1TLKA 2HRLA 4DN3L 1E4KC 4RGNE 1D9KA 3PGFL 5DRWA 4Y2DB 2WBJC 4OLXL 3QWOA 2YPLB 4U1SA 4ZO6A 3P0VL 1A9EB 1AGBA 1KGCE 3RGVB 5ICXA 2MKLC 4YR6B 3L3KB 5FECB 3GSWA 4JRXB 5JHDB 5D7SL 1SJHA 3JV6B 5D6DC 1X5JA 1TXKA 4Y16C 3I2CL 3U4BH 2V2XA 3UTPD 4C56B 5EOCL 2EDWA 1A4KB 4KY1L 1EMTH 4WHTB 5F8RC 2FATH 1J1PL 2OR8A 4M1GL 4MDJA 2A6JB 3V7AG 2O93L 3S4SG 3O0RH 2ATKB 4PJCE 3WDHA 3D25A 3PWVA 3RBSA 1DANU 5D7LA 3QCTH 4Z8FH 3OKOA 4UUJB 2V5SA 4HWBL 3MFFA 5L0QB 3FO1B 4CN1A 3KXFD 1B0GB 3K8MA 2VXUH 1IEAB 3BWAA 1LO5A 1PZ5A 4E41B 3DHMA 1KCVH 2AQ3A 3IXAA 3NIFF 4JY4A 1YNLH 4WFHE 1INEH 5GIRA 1QSEE 5GJSL 1DQQA 4IRJA 2VXVL 3AY4C 3EJYD 4MA1B 5IBUB 4AIXA 1PDKA 5K59F 1P2CB 1B0RA 1G7IA 3B8YA 1RJCA 1X4YA 4W4NA 1CDYA 4LCWD 4NQEE 1BVLA 5ALCL 1T03H 1AIFB 5E5RB 3LCYA 1Q0XL 4I3RH 1CGVA 5I1EH 3V5KA 1HZHL 2OI9C 1AO7B 4XC3H 3VRJB 1RZ8B 3BVNA 1UXSB 2BX5A 2A9ML 4KQ4H 5I1IH 1ED3A 4XMLL 2PYFA 35C8H 1ZVYA 1I9JL 3BZFA 1DQDL 3ZDZF 1ZA6A 3LPFA 4RFNB 5KVDH 3SDDB 1FFPB 2FYYB 3TBSA 4YWGL 1C16A 1U8QA 4LAQH 2DJ4A 4APQD 4R2GB 1M6OA 4N1CA 5IQ7H 4YPGA 4EDXA 4FQHB 5I16B 4DGVL 4Z7VA 2DM7A 2PYED 3A67H 1SY6H 3OXSB 4NWTH 2VZ1A 3BZDA 3KPRB 4P5MA 5KANI 5F44A 3K4ZA 1AJ7H 4KK5D 1U58B 4FQ2L 4LRIA 3ZE1E 1QZ1A 4I13B 4MVBC 4Z7WB 3CXHJ 2ERJC 3AB0C 3D3VD 4ZD3H 3TBWB 1RIVL 4EN3C 4FS0A 3Q1SL 1CR9H 4W4OA 3RZCC 3EO9H 3N85L 3LN5A 4CDGC 4PJFB 4M6NH 1AFVL 3NZHL 4UTAH 5FYKD 4NQUA 5BOPA 1KFAH 2UUDH 3PJSB 3STZB 1I9RL 2IG2H 2DQCH 2IPKA 4PRNB 4XP1L 1TVHA 4NBYB 4DAGL 4ODHL 2EKSB 3F7QA 1J8HB 2FLBT 2MQCA 4NQSB 4TTDD 1ZSDB 2HAZA 2C9AA 5BVPH 4ZQKB 1KXVC 2YWZA 4P59L 1FG2A 3UJIL 3EO1B 2UV3A 3TV3L 4GAFB 5CJOL 1GAFL 3CFJA 3GSNH 3H7LA 3NZ8B 2DYPB 3REWB 1X5YA 1BQUA 2XA8L 4X80L 3MREA 5FFLA 1S3KL 4NQVB 4OV5B 4XWOD 4NSKB 3V4VL 1W0VB 4JHAL 5TDPB 3KPPB 3RWDA 2WINA 4MZ2A 3K7UA 5HJ3A 1DQJA 5AWNH 3D85D 3FQXB 5C0EA 3CUPB 2W9LA 5L9DH 1HDMB 1KYOJ 2H1PH 5FB8A 3G5YB 5I30L 2XTLA 1QFUL 3TNMB 1MI5B 2DJSA 4QRPB 5HDQH 4ESKA 3M45A 1OAQL 1R5WA 1XR8A 4WI9A 4HH8A 1C8PA 1R3KB 3QWOB 4U1SB 5DRZA 1MQKH 3QISA 3FRPA 3QCUH 3H6JA 4GUPA 5J9PA 3GMQB 2HVJB 3IAQA 3UTSA 3ARGB 1VFUA 3V4UL 1MRDH 2VXQH 1E4JA 1KJ3H 3DX9A 3U1SL 5J0BA 3GSWB 3FB6A 3LB6C 4F8TA 3MFGB 1SJHB 4LLUA 1FC2D 1L0YA 5CP7A 2XQYG 1MFAL 2HRPL 3HE7C 3WXWL 1OF2A 3PWJB 4IOFD 3UTTD 2DQDL 4MDJB 4BKLA 3VRIB 1IZJA 1M05A 3MNWA 2CGRH 4EQ2A 1KJMA 2PXYB 4QTIL 3B2VH 43C9B 3VFGL 3KWWA 1P4BL 3D25B 4LVOB 3HMXA 3LDBC 4JZJA 5C07B 1I8MB 5D7LB 1U93A 2VC2H 3BW9A 2VLME 3P4NA 4X4YB 5D1ZA 5C0CE 4HUVB 5B8CB 1UH3A 3RVUC 2B0SL 2DM4A 3EFFB 1HOCB 2I27N 4PPTA 4RCAA 1PVHA 3ZYZA 5BQ7A 4GXVH 2M1KA 3BWAB 1LO5B 1EDQA 1PZ5B 1MJ8H 4FG6C 3GUTA 1NGZB 2NY2C 4M93C 4PJHF 1XF4B 2QQLH 4WFFE 1IKFH 1L4IA 4NZJA 1ZLWH 1U3HD 4P5TC 4IRJB 4PJAA 1Q8MA 5DJ6A 4YHOL 4LEXL 3B8SA 3CNKA 4FP8H 1UACL 2OMNA 1DDHB 4QXUH 3UYRL 2HLFC 5F7DA 4GG6A 1BOGB 1FFNA 4GXUM 3TA3C 5KSBE 3EZJB 3ARXA 2YD4A 3GBLA 3OTTA 4Z18A 5B39B 4Q0XL 5CJXA 3V5KB 4C4KO 4PJ8C 3T09A 1A14L 3H2WA 5DC9B 3BVNB 4GOSA 5E1AB 2BFVH 3VMOA 1T3FB 4OAWB 3MV8B 1OPGL 4Y4FD 1OM3L 5F1KC 5SWSB 1ZA6B 4FQQB 1NUGA 3QPQD 4LLQB 1MCPH 4XBPA 1TZGH 1K85A 2CKBL 5ILTH 1C16B 1U8QB 2DAVA 1RZJH 2HFEA 3FFDA 4WHYG 1I85A 2Z92A 4V2BA 3BPLC 3CPLA 4Z7VB 4DUXA 3KJ4B 1BBDL 3BAEH 1FZMA 1EEZB 1BGXL 3BQUB 3HMWH 4N68A 4EI5B 4QNPF 4JGJA 4ODVH 5FIEA 2PR4L 3DOSA 4IEFB 4KUZL 5DA4A 1VERA 1WVZA 4WGVB 1ZHKB 5I1JL 4N0YH 2FJGA 4EZMA 2V9TA 3GI9L 4ZS7L 1AI1H 3P73A 5C0RH 4Z7QE 1WTLA 1X5IA 1ZHBB 1KIRB 4RBPH 3UTOA 1A6UH 4RRPG 4Y5VC 3CFBA 1S7TA 2HH0H 2CLZA 3F6IA 3SCMC 1DFBL 3G6JA 3LZFH 5GRJL 5F97E 2ESVE 5JW3L 1TJIL 3WNPA 5T5NG 3FAXA 2ADGA 2Y06H 4AYFA 3DX8A 3SBWC 3VWKD 5D1QC 1DANT 1M7XA 3PWPB 1YEFH 3IYLW 3ROLA 2GK0A 5E6YA 3SDYL 3LVEA 2R0KH 2FRGP 3MREB 2BNQA 1KCSH 4LDOB 4YBLB 3GJEB 3FJTA 5HJ3B 4KQ3L 1DQJB 5D96C 4CN6A 5DEGA 3VH8A 3CLEL 1PBYA 4NO0B 3IFLL 4OKDA 4WU5A 1OARH 3VRLF 2G5RA 3TBTA 3MV7E 5I1HL 2DQHL 1XR8B 1R5WB 3PDGA 3QT2A 4K8RL 4XBGB 3IF1A 1G6RA 5DRZB 3KPOA 3KPNA 4JDTH 4DKEH 4L1DA 2WM0A 1INDL 4W81A 3UTSB 3B9AA 2NY0B 4FQ1L 4U6YA 2DQGH 3VXOB 4J3XA 1FRGH 3MRCA 3RA7H 3OAUL 1WT5C 5KS9A 1JPST 1UWGL 4K94C 3IFPA 2IEPA 2BSSA 2F74B 2YPLD 1OF2B 4JDZA 2NTFA 5IW1A 4OCLC 3H9YA 4HBCH 5HGAA 3GHBL 2Q6WB 4AEEA 4NO3A 3CFCL 3LQAL 1IAIL 1KJMB 3QUZD 1OWWA 4PRDA 3RGVD 3AGVA 1Z5LA 3QQ4A 3OHXA 3MRHA 1LDSA 2NYYD 3IU3A 4JRXD 5DD3H 4JZJB 1T0NB 2QQKH 4KJQC 1U93B 3TCLA 1RMFL 5TJWK 1FNSH 1ZT1B 4OZFB 1MCBA 4ZMAT 3JZ7A 3SGEI 1ACYH 2APXA 1JNNH 5BMFH 4IRSC 3TN0A 5EORL 5DD1H 3HA0A 5GRUH 2BSTB 1ZLVH 2IBZY 3MCG1 1EHLH 5D1XC 3GUTB 2FZ3A 2FBOJ 4JPIA 4KKBD 4R26H 2EDEA 3GBNH 4PJAB 1HHKA 4MAUH 5DJ6B 2YMXH 1FGNL 4I1NB 4AQ1B 4OI9A 3EFDL 3B9KB 1A8JH 3THML 1FFNB 4RGOL 3IU4H 4YPJA 1BQLL 4E41D 3ZTJG 3CFDA 3JWOL 4CL7A 3B2UD 4X99A 1HHJA 2F8OA 1B88A 5IW6A 3B5HA 4JZNB 1Q1JH 4MNQE 5ICZA 5DZOA 1HYSD 2H2PD 1ZANL 5FDWA 5C0FA 2VZUA 3V0WH 1O5DT 3X3GH 3DLQR 1I3VA 4FQIL 1IARB 1WFNA 1IM9D 2Q1EA 2JB6A 1FVEB 3OWEA 5T1MB 4BQCA 3FFCA 1P4LA 3UTQA 4ELMB 1Y18A 2EDOA 2ZSWA 3S34L 4XAWL 3GO1H 2D4FA 4P57B 5JOPE 2AP2A 3I84A 4L9LC 3VG0H 1YUHA 1F4XL 2Z92B 3CPLB 5IHLB 4L4TA 3Q6FB 5JOFA 4XPTL 1L6ZA 3EJJX 4K7PH 1TQBC 5IMLA 4F37F 2IJ0C 3CSPA 4IOFC 2W91A 1Y6KR 3UZVB 4A2LA 4BH7A 3R06B 1CXKA 1F8TH 2D0GA 2X9YA 3QUKA 4JQXA 3QIWC 1T7WA 3LH2H 5BW7A 3MUHL 3DGGB 1YEHL 4DVRH 4HULB 1JZ8A 5GGTH 2ZP0T 3QO0A 1UKQA 3U7YL 3P73B 2XPGA 1SJVA 5JQHC 4OGXH 4FA8A 3KPRD 4O51A 1SBSL 1ZLUK 3BUTA 3CFBB 1S7TB 3DV6A 4YIQA 1OAKL 4PJDE 2XN9E 4GS7B 2R56H 4MD5B 1FAKT 3UBXG 2O5XL 1CVRA 4LIQE 4PJBF 2NY1C 5ECJE 5IT2H 3R0MA 3RNKB 3SDCC 2AK1L 3WXVH 2GK0B 2PKDA 4MA8H 1FFQA 5EFIB 2A9NL 2BNQB 4KTDL 2PO6D 3C8HA 1A64A 2P8LA 4Y4KA 4F57L 2ZOKA 5CJ5A 3LMJL 1TQCC 1BQHB 4HWBA 2IANE 2APWA 5SV4A 3SGDH 1ZEAL 1NCBL 5BV7B 3C9NA 5DEGB 4XCEA 3VH8B 1R3JB 4P2RA 4WEUD 1J8HD 3T4YB 4K3EL 4BZ1H 1YEEL 5I1AA 1B4JL 5I66B 3EKCA 1MAJA 4KHXH 2GEEA 4G6JH 2OTUA 3WFEL 2JTDA 1IBGL 1WQVT 1IM3A 5C09A 1G6RB 3VXMD 1TCRB 3GNML 4KVNH 1Y6MR 1IFHL 3KPNB 5JDSB 1P9MA 1T1WB 3UTZA 2B5IC 3QCVL 3ULVC 4U6YB 4YGVB 4PREA 3KR3H 1RVFL 1AC0A 2HKHL 5KS9B 3B9DA 1D9KD 3IFPB 1JZ4A 2HJLB 2W60A 1AXTL 1JWSB 2NTFB 4XVJH 5HGAB 1NCWH 1JI1A 5CZKA 1KACB 1T5XA 3SKJL 1T5WA 2GY5A 4J23A 5BZWA 1M7DA 3SKNA 2CRMA 1EO8L 1A6VL 3T3PF 5I0DA 5I73C 5L2KE 1A4JA 4HCRA 2IBGA 2R23B 1KEGH 4MAYA 3L7EB 5TE6H 1FNFA 3T0DA 5TFSL 4S0TD 1T2QH 4F58L 1DL7L 1WAAE 4M9PA 1CLOH 2DLHA 2GSGA 1RJLA 4PJEE 5I2IA 1NLBL 3LS4H 4KJPD 5D7LD 1C08A 1T2JA 1HHKB 3ZKQD 4HKBA 4PP2A 4GAYA 1OP5K 3MOBH 2YC1A 5HYEA 2FIKB 2VDQH 1AY1H 4U2ZA 2Q20A 2F8XC 3MXWL 4YFDB 1AE6L 4F33A 3J7HA 1T83A 3JWDH 3GMOB 3CFDB 3R1GH 2AV1A 1JFQL 4NHCH 4X99B 1T7ZA 3LKPA 3OB8A 4JG0H 4UOJA 5IW6B 4IRJD 3U36A 5ICZB 5DLMH 5C0JA 1CTNA 4XZUB 2YUWA 5C0FB 1MJUH 4ORZC 3T1FB 2Y7QA 5LGKA 1EZVX 3VFTB 1UEMA 1GXEA 1XT5A 5FM5O 3FFCB 1LK2A 4UIKH 5EIQA 3OAYK 1R0AH 2WBWB 3PE9A 1CXLA 1HXYA 2CDGA 3EHBD 4HIIA 3CCHB 1TJHL 1WZKA 4CVXB 4JM2C 4L4TB 5DWUL 5MEPB 4Y2DC 4CU8A 2MCPH 2YOCA 3DX6A 3DETC 4OT1H 5IMLB 1H3TA 4MXVE 3F7RA 3FKUS 5I8CA 4LEOA 2EEDA 4BH7B 3QUKB 1IGFH 2CJUH 1DN2A 4P2QA 1YEJH 4PV8B 2EDFA 2NYYC 3HE6A 4OGYH 1MCOL 4JFXB 1NAKH 4GT7A 3DX7B 3QO0B 1JN6A 4HPOL 4PP1C 2B20A 1MNUH 5DQJB 2WWMC 4OLWH 3CFEA 1OD7A 4UNVA 2EDKA 1TJGL 3NH7H 4LLVA 5J6HA 4K23H 3CMOH 4YIQB 1HKLL 3PF2A 1F4AA 4EDWH 2CLRB 1C5BH 4X6CE 5E08H 5K9JL 4X6BA 2B39A 4OF6A 5EZIH 4LRNH 5DJYA 2C4FU 4HFUL 3ALXA 4P3CL 2DQIL 2ZNWA 5BO1H 3MX0A 4TUKL 1A1NA 5L0QC 1LO2L 1PSKL 3O3AB 2P8LB 2JIXA 3EO0B 1PY9A 1IC7H 4O58L 4U1NA 4CJ0A 2X4NA 4F9LA 4RISL 4JFEE 4JZOA 4OD1L 4U6XB 1HI6A 3ES6A 3PP4H 4XCEB 1OGTA 2YZ8A 1FVCA 3QYCA 1ZMYA 1KXQE 5KW9H 5E2TH 2OLDA 5I1AB 4YHLH 4MA1C 3DMMA 5F3BA 4LASL 4PJIF 1N6VA 4MQXC 1TTGA 3BZ4B 3LRGA 2OTUB 3TJEH 5C09B 2BDNH 5C0BB 4ZUSB 4Z5RA 3PWUA 3NABL 1N7ML 2PTTA 4GMSL 3UTZB 2ZJSL 5J3HC 4WCYL 3AS2A 4PREB 3FHAA 3MYZA 4FTVE 1IAMA 3LN4A 5T3ZL 3MBXH 3RJQB 3EDKA 1DBBH 4XHJD 3W11C 4KDTC 4KH2A 4PGBB 4TOYH 4LPWA 4RFNC 5SX5H 3SDDC 1TTUA 3PDDA 3UTSD 2ZCHL 4NZTH 1JGLL 5BZWB 4BM7A 1DCLA 3SKNB 5EBGA 3P0YH 2OJZL 4R2GC 3NIFE 1CZ8H 1UQSB 2CKBA 2PUQT 3OSKA 3DHJA 2EH8H 3LRSB 3DNKA 3MRJB 2AXJA 2W07A 3T0XA 5K59E 4JFYA 3L6FB 1D3CA 3OGCA 5ENWA 4U7KA 4JAMB 4BSWB 2Q7YA 4MCYA 3V79C 2GSGB 3UZEA 2AW2A 1LE9B 3ZKXC 2MPAH 4OUUB 4ZFOL 2O5YH 5I2IB 3LKOA 4OM1L 2VXSL 4GSDH 4JO2H 5JPNA 5FGCE 4QHKJ 1C08B 3WIFA 4JKPL 3QNZA 5D1ZD 3SGKC 1FH5H 2NY7H 4HKBB 4PP2B 3TNNB 4GAYB 3O8XA 5IMOA 5TQ0H 5FA4A 4KKCD 3RTQA 4FZ8H 5IMMA 3ZDZE 2X4OB 3JV0A 4LVNB 4YHYB 4N0FA 3QXUA 1VGKB 3MO1B 1G1CA 3S5LB 3X17A 5DFWH 3RWHA 4RNRA 4MA7L 2FEDC 2G60L 1CBVH 4WI3A 3BYYA 5F6HI 3UYPA 4WFGE 2J1KA 5JIIA 4AIOA 3ALWA 4L29A 2V7NB 5FYKU 5E99L 2F19H 3S88H 2JB5L 1UADC 1LO4H 4NQEA 3T3MF 4Y89A 3VFWA 3DVNB 3VD7A 1TNNA 2CLVB 1CU4H 3Q0HA 4IDLA 3LKRA 3I3EA 4M43H 5C0AE 3RDTA 3RGHA 4JY5H 3VXRE 5EPMB 1HXYB 2CDGB 1FIGH 1T7VA 2BSED 3K2MC 3I6GA 2OJEB 5BXFB 2I60H 4HKJA 1A6AA 1ZHNB 4L5FL 4AL8H 4LSTH 3DX6B 4FFYH 1VGEL 5I8CB 1GZQB 4TTGA 2YWYA 1B2WH 4BUGA 3ARGC 1OTSD 4TSAL 1YEDA 1FG9C 4WUUB 4KTYA 4PJ5B 1F97A 1KIPA 1UKTA 3PGCA 5C7XL 1NFDA 4QGYA 3IS0X 3HE6B 3A6BL 3NCYP 3U30B 4DW2L 3L3OA 1JN6B 4NOFA 1KF9B 3NTCL 1G0XA 3WUWA 1RFDL 5LGJB 1FZKA 3DSNA 5IJKA 3CFEB 2IBZX 1HHIB 2Z0BA 3GIVB 3L95B 5J6HB 2GKIA 2G5BA 1FPTL 2PXYC 5IG7A 1IQWH 3PGFH 4AY0A 1FDLH 5FF6B 4OLXH 3KPLB 4GO6B 3MCKB 3IDMA 1JMZA 4X6BB 5DJZA 3ARBA 5DJYB 3P0VH 5KAQG 5B8CC 2YN5A 4FQXA 4WU7B 1Z9LA 4EI6A 1UJ3A 3IJSB 1S9WA 3I2CH 1MLBA 3ULUL 4I48A 4R7DA 5EOCH 1T1ZB 4DFHA 1QSZA 2X4NB 4KY1H 3D87B 4HIHB 2H41A 3B3IA 2QKIB 5A16A 1J1PH 4M1GH