5IP4A

X-ray structure of the c-terminal domain of human doublecortin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTASVNIIGGNHWAWYRQAPGQQRDLVASLSRYNANYADSVKGRFTISRDNAKNAAYLQMNSLKPEDTAIYFCALENYYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords XA4551 NANOBODY AGAINST C-DCX
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Lama glama
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ip4A00
4JFDD 8FABA 4E9LA 3DVGB 4PJ9B 4NUGL 1LE9B 3RI5K 4NO5A 4GAJH 3OR7A 3AAZB 4DUXA 4L3CA 3LRGA 3O6FD 4WU5A 4QHKI 1JYXA 1WZLA 4V2CB 3SGEH 4F15C 5F1KC 3VU2A 2CR3A 1ROWA 5F6HI 3OAZH 2MPAL 1AR1C 5IHZB 3MJ9H 2P4AB 3QH3A 4MZ3A 1RZ8B 3NABL 4OM1H 2CK0L 4PRPB 5HYSG 1UENA 1HH9A 3T8XB 3FQTA 3JTSA 4IHOA 3TV3L 5HD8D 2NY0B 4JY4B 1G7IA 3HNSL 4KI5C 2H2SD 5A3ID 1CL7H 1XF1A 4LQ1A 1M71B 4XNYH 4OLYH 5DRNA 2FL5B 2NYYD 1QFWH 2LU3A 3QUXA 1NCDH 1C16A 2W07A 1YNTB 4OF8A 4URTB 2BMKA 2PYFB 3OG6B 3GSNA 4C56B 1RK0A 4HUXA 1LO5A 1KJVB 4KZDL 2W91A 2P45B 1IGYB 4HFWB 1NSNH 3QUYC 5DEFB 1E27A 3NPSC 1E4XI 2AKRB 4JREC 3X14B 4ZS6D 3BRDA 5T3ZD 4LVOB 1IC5L 5L2JA 3ZYOA 5F9OL 4FA8A 3TF7C 3HS0A 3HNVH 2DMKA 3DV6A 3GM0A 1MLCB 5GGUA 5E6IA 3D85B 1M1SA 1DBMH 3TH3T 3ZKQD 1FL3B 2BVEA 4OD2B 2VLLA 5T1DH 5DRZB 1K2DB 3EDKA 3OAYK 4RGMC 5MERA 5E24E 4GBXC 1S7SA 1T1WB 3SY0B 2IPUK 2EE2A 2NY1D 1YEHL 5CGTA 4YXLL 1IM3A 3SDAD 1PW3A 1FCCA 3ECBB 5D7LE 3O6FA 1FE8H 1NCWL 5KG9A 3BO8A 5IOPB 2WBJC 2YUXA 3I84A 3L3IB 4N8VA 2KDGA 3MRRB 4JO3H 2XG4A 1T4KB 5F7YC 3P11H 3CDYA 1M6OB 3VFNA 4JZJA 4TRPH 4JFEE 2CLZA 4O2FA 1J86A 4LSQH 1N6QH 1HHHB 5A16A 5EU5B 5D7LA 4KJWD 3S3PA 3IF1A 2X10A 1MFDH 5ESQB 3RY6C 5J11C 2AXFA 2BOCB 5B3JE 4YDVB 3HC3L 1GHFH 2A74B 4JFEA 4K94C 3WFBL 4X98B 5FYJE 4FP8L 3R8BB 2FEDD 1A7RL 2Y7QB 3WFHA 2P5EB 3AS1A 3CFDB 5E8NA 4M5ZH 2D3VA 2GT9B 2VLJB 4ZTPH 5HVWA 1OTTC 4OFKA 4OD3L 4RRPG 2Y06L 3B9VA 4ZTOL 3N1FC 4AK1A 1EBPA 5I18L 4PLJD 1QPXA 1S7RB 4G6JH 2OJEB 5GJTH 1A0QL 3EFDL 1Q72H 3VXRD 5DHYB 3NIGE 1K3ZA 1DBKH 3RKPA 5DURB 2BSTB 2DTMH 2LQRA 4O02L 2ATKB 3TO4A 3QJHB 4ZO8A 3JWDL 4DW2L 4OIIH 5ALBL 3MJ8A 5FGCB 2BNQB 3QIUD 1EAJA 2A77H 1INEL 2XTJD 1YMMD 4D94A 4HULB 1RZFL 1U91A 4JAMA 1EA9C 3RZCA 4NZUL 5ICZB 3UAJD 4U7KA 2OTPA 4ORGB 2QSQA 1QSFD 4LLMB 3BVNA 5T5FL 4BA8A 5GS0L 1IKNA 4PP2A 4WFGE 3MGOB 1X44A 4P5TC 5F3HB 3SJVE 4Z7VB 1D6VL 5HYSB 4F15B 2I07A 1DL7H 3D1MC 4HMEA 3VFMA 1WBZA 2QQLH 2IPUG 3MOBH 5EPMA 5FUZH 4AL8L 4WWKC 5EZIL 4AJ0A 3VCLB 4J3SA 5DT1H 5I8KL 9CGTA 1CE6B 5GZOC 1JPTH 4GG8A 5T1MA 4PJAE 5DLML 1MFEH 3QDGE 2LU7A 3UTTB 3SJVA 3TFKD 4X6CB 4G7VH 3OKLB 3DLQR 4NRXA 1P53A 3KR3L 3EJZD 1QD0A 1G7JB 2VXTL 4ZFOB 2OL3H 3C09C 4P4RA 4CU6A 1N0XH 1EZVX 2IAMC 4F9PA 4PJAA 3QDGA 1A6VL 5J6HB 2GTZA 4K3JL 4OI9A 1MJ7L 4PJXE 1SBBA 2CLRA 4PV9A 4L8CA 2AJSL 5GGRA 1LEIA 1F97A 3UX9B 5LWYH 5B3JF 5LBSL 3DTXA 1K8IA 1EGJL 4G6AC 2QHRL 2R0KL 3CX5K 4ZUUB 3O8XC 3MRLA 5AD0A 1OLZA 3RP1A 5ADOH 1MREH 4RWYH 5FGBC 3BKJL 3PWLB 5GGTA 4HBQA 5I71C 1PZUB 3EIFA 3HZVA 4WHYH 3HE6D 3NPSB 2IF7A 4PJXA 2NY2C 5JOEA 1LEKB 5H37H 4HV8A 1TJHH 1KIPB 3BZDA 4UINH 5MEQB 5KS9E 5FYLL 3VFWB 3X17A 3F7YB 4NQXA 1AIFA 5LXGL 1JGEA 3DHJA 4K9EC 3VMPA 5CLWA 1EXUB 1DQLL 3S36X 3TYGH 1FL5A 1NCBH 4YHPA 4H8WL 3I3EA 5KS9A 4YK4C 5FV1L 5GHWL 1IEAB 5AWNH 4HIJA 5TQ2H 1BBJB 2MKWA 4CKVX 2BY0A 2Z91B 3FT4B 4ZPTA 1S7WB 2PO6D 3ULVE 5C0DB 2JB6B 1GPOH 5GGSB 2QR0B 1WV7T 1V3KA 1A7OL 4XCNB 1JHKH 1Z6JT 4RGMB 1KBGL 4GBXB 5JOPD 4MCYB 3EYSL 1R3LA 2EDEA 2VITB 4YO0A 2R1WB 4BH8B 1RUKH 3W5NA 2Y36H 4MA7L 1MCPL 4F7CA 3D25A 1MPAL 4XTRC 5B21A 1MQ8A 3VRLE 4A6YL 3OKKA 2HT3D 4PJAF 4LCUB 4PY7A 1AGDB 1EIBA 4U6YA 2GTWA 4JJ5B 1ZANL 5CEXB 4IRZH 5ESVA 3GMMA 3IVKA 2X4UB 3F7RA 5EUOB 3B4NA 4X7FC 5J11B 3TT3L 1QP1A 3UTSB 1JPSL 5K9KB 4WW2C 4BZ2H 5FV2A 1TJIL 3V4VH 4PJXF 2X5PA 3CFIC 5JPNB 5C0GB 2G5BA 3LKRA 1Q94B 3ALPA 3C6LC 4TVPH 2FJHB 1T1YB 3PGDA 3PWUA 4JQVC 3PGCB 1D5ZB 4RA3A 4V1DE 4X83A 3MCG1 2L0DA 5IJKC 1A9BB 4LASL 1HCVA 4LCWE 5JR1L 5KS9F 1N7MH 1IQDB 3LRSB 5C9JB 3OKOB 4XB8A 2YRPA 4X4YA 1PSKH 3WFZA 3U4BH 4LKXA 1WC7A 4V1DA 3L95A 5D1ZA 4HK3N 4MA8H 1S5HB 1T5WB 1ZWIA 3QFDA 4LCWA 5TH2B 2AJZB 4JKPH 4WTZA 1HYRC 2VL5B 4HMDA 5MI0C 3ULVF 3LZFH 2ZWLT 3N9GL 3HB3C 1VESA 4EUPG 2A9ML 3GSVA 3O3DA 5JDSA 3ULUC 5EOCJ 3CXDH 3MGTA 1FNLA 5CP7A 5KVEL 4IMLA 3MREB 4IDLA 4UAOC 2FIKA 3FFCE 4WWKB 3P4NB 4PB9L 5ID1A 1ZLSL 4P9HC 5J9PB 1AGFA 2PNDA 1UJ3C 4JFOA 1CGWA 4OGAC 1IGIL 3ARDC 4WV1A 5IFHH 5EUKA 5ITBL 3JV4B 1GGUA 2NXYD 4XXDB 2P8PA 1BWMA 1QFUH 3VRLF 1A2YB 2PYED 4GAGH 3QXDA 3C09B 3FFCA 4PJ7E 2IAMB 1QRKA 3FQUA 4MJIE 1R24B 2NQCA 3N1GC 2DWEB 1SQ2N 4O2CA 4OSUL 1I8IB 2F19H 1XGPB 4W81A 2H1PL 1OT1A 2E7HA 1YQVL 5HDBE 3F62A 2YC1B 1I7RB 2I9TB 1A14H 1VGEL 4RAUB 4NHCH 4PJ7A 1LO3H 3O8XB 4MJIA 5IP4A 3B6SA 3ZE0F 1D5BA 2N7AA 1F3DJ 3UBXA 3GRWH 5I71B 3OJMB 4Y4HD 5ID0B 3WSQL 4ZO7A 3T0EC 2NY2B 2JJSA 4JEGB 3KXFD 2CMRL 3HMXA 2BOBB 3W0WB 5KSUB 5DSCB 1V3JA 1SYVA 2ZKHH 1QKZL 4TNWF 3MRBB 1JI2A 4BFGA 1G0XA 2CDGA 4XCYA 2EDFA 3FN0H 5GRYA 5BCAA 3RWHB 4AG4L 5IIEA 4YHNB 3TZVC 2ZOLB 2FX8H 1DCLA 4YK4B 1UH4A 3SO3C 4D0BA 2UZIL 4X5LA 3SDDA 2DB8A 5F7DA 2R69L 5D1XD 5E2TH 1V3MA 3I02B 1PLGL 1V7ML 2FX7H 3MRFB 4MJ4A 3NTCL 5MP6H 2UUDK 1YEIL 3MA9H 4K23H 1PD6A 3QPQC 3V79C 3PL6B 2X4SB 3VXSB 3ILPB 5ISZB 2YBRB 1UB5B 2O61A 1N8ZB 3BKYL 5E2VH 4X6FA 1DQML 1GC1C 5JZ7D 2DBLL 3FO0L 4WTXA 1P5VA 3DIFB 1OOAA 1DFBH 4F58L 5FKAB 4WI7A 3AS3A 3MUJA 1RZIA 3QUMB 3TGXA 3TWCH 5SX5H 3GMQA 5IROA 3RWIA 2OJZH 2VMFA 5J8OA 2NNAB 1MCSA 4DUWA 5TDNB 1GL4B 4P2QB 4AENB 3A6CH 3RTQD 1VKXA 1MFAL 3LEYH 3KJ4C 4HLZH 1BJ8A 4MAYD 2KZWA 2AK4B 1BOGA 4PJ7F 1R6VA 3S34H 4OCYH 4XHJC 2KL6A 2VQ1A 2HJKA 4JFYB 1M05A 2WW8A 4QF1A 4QTIL 1JF1B 4WW2B 3QXTA 3T4AA 3T04D 4V2BA 1AO7D 5EC2A 4S2SA 1MWAL 1T83C 1A6ZA 1EHLL 4BSVA 4UB0H 1XR9A 1FO0H 3GEWB 3FMGL 4XPBH 2NXZD 4LLDA 1SJEB 4QTHB 4OCXH 4ODSL 2MCPL 4NJAH 2AERT 3VFUA 3JVGA 3IGAB 1IL1B 4IRJD 2JCCE 5MENB 3TBWA 5HYJB 3RFZC 5HXMA 1HK6A 1J05A 4M7JL 1EEYA 4FQCL 3H3PL 4UU9B 3RZWA 2RFXA 5IT2H 3QDJD 1DUYA 4M62H 3K81A 3WS6A 4P5KA 5F9DC 5J1AA 5JIIA 5EBLA 2JCCA 2X1QA 4HCRA 5ALCH 3V6FA 3RVTC 4YHML 1DDHA 4X0KB 3QIWC 2JELH 4R0LA 5C0CB 3S3JA 4G6KH 3K4AA 4QHMA 5MI0B 3VI3E 2Y5EA 4P9MH 3OGCA 1I9IL 3U6RB 1CICB 3BN3B 5FF6B 4LL9A 3D9AL 1FIEA 1QBAA 5GGSY 3U30B 4JQIH 4PJGB 4UAOB 1WTGT 3F7VB 4NSKB 4PLKC 5L8LB 4HHAB 1L7TH 1GRWA 1KB5B 12E8L 5L8KB 2GFBA 1UJ3B 4F2MA 1G7LA 2GUOA 4KMQA 4OCWH 3ARDB 1SY6L 3O6LL 3U46A 4HUVB 5J89A 5EZOL 1RZGA 4HH8A 3P9MB 4YHKL 3GUTB 2R2HB 4X7EC 3TA3A 1S3KL 3V9FA 3BUYA 4XCCL 4P2RE 4HK0B 1AKJB 3D0VA 3RKDC 4DAGH 2X4NB 1NAKH 3BH9B 3MYJA 1FPTH 3IJSB 1AFVH 3WO3B 3NIFF 4PRIB 5ICYB 2X05A 1CD1B 4XX1E 3L5JA 3ZMRA 4E42A 5DC0A 1U92B 4QRSA 4YR6B 3BEWB 5FUCC 4HJJH 4YC2C 4P2RA 1RJZA 1EDQA 2J88L 3HAEG 3NCJL 3O3AA 4F9LC 4NQEB 3BPNB 1WAAE 3T0EB 1OW0A 1CQKA 4P3DA 2C3GA 2EYRA 5L9DL 3CPLA 2GSIA 25C8H 5EIIB 5J3HC 3V5DB 2FATH 3EOTH 4HWZA 4PRDB 2AAVA 3U0WL 2JCCF 1ZTXH 4NUJB 5C0ND 1G6RA 1ACZA 3KPTA 1T66C 1WAAA 3QHFL 4NRYB 2W92A 4WI8A 1FNSL 1IBGH 3FQRA 1FH5L 3TZVB 4F8TA 2VTFA 4JRXB 5A40E 3IJHA 4OF0A 3RU8L 1NFKA 3SO3B 1MHEA 1YECH 3EO0B 2IBZX 2Z8WC 1EJOH 3PQYD 3FB5B 4GKSB 4MJ6A 5C0FB 3EO9H 3S98A 5I1KH 2VRAA 4MHHG 1ZS8A 4UIKL 1FQ9C 4PJ5E 5TE4H 1TZHA 1B0WA 4A6YA 1W72H 4R7NA 1J1OH 3SDCA 4HFUH 1ZGLB 3RGVC 5EFIB 1X7QA 4MX7B 5IB4A 4GRWB 3P9WB 1JE6A 4XP1H 3MJ9L 2VDLL 5M94B 3MBED 5J7CC 4TSBH 1KENH 4UBDD 4PJ5A 3O4LE 2QHLA 2BNRB 2BVYA 4FRWA 5EOTA 2H32B 5IEHA 5T1LA 5TDOB 2BZDA 1VFBB 5ENWB 4DGIL 5T3ZH 5K9OA 1ZE3C 5J13C 1QRND 5E94B 4ZXBC 4D3CH 3UJJH 5DEZA 1A8JH 3L3HA 2LVCA 5EDXA 3KJ4B 3CFBA 1ONQB 2NLJB 5E08H 3O4LA 3A6OA 5CJQL 4CJ1A 4AT6A 3QJFB 3DHMA 5IV2B 1ZKAA 1TZGL 1BMGA 3GB7B 2GI7A 3ZKXC 1H3WM 2QQNH 3OXRA 2WWKT 3SO5A 4D9QD 2XWTB 2C3VA 4NBZB 5HHOD 1UXSA 4QHLB 3MOQA 4YAQA 1NJ9B 1QOKA 2GHWB 4KRPD 1HHJA 3VD3A 5IFJB 4LCIH 2EKJA 4F7TA 2IPKA 2FZ3B 1LD9B 2CLVB 4J3VA 3U1SH 3VGFA 3BEVB 5E0QA 3UZQA 3CDFA 4JY6A 3MRMB 1G7HA 1ND0B 4FFZH 3CVIH 4GUPA 2C3WA 4Y2OA 3S35H 3B9KA 4N90D 1QBLH 5I1DA 3MNZA 4I5BA 1RAMA 1TCRA 3OAYH 4UT6H 1HI6B 3E0GA 4WO4C 1RHFA 5KTEH 5T1DL 5M7QA 3QIWB 2G5RA 5DD3H 5HHNA 3A6BH 5BVPH 3V7MA 1NBYB 3JWOL 4U6XB 5H2BA 2R0ZL 3G5XB 2FGWH 4QYOB 1BM3H 3VFSA 1VDGA 2XV6B 1D9KA 3W2DH 4BUGA 1A3RH 5F3BA 4Y1AE 5I15L 1T7XA 1PKOA 4GFTB 5CEZE 5JLZA 1FE8L 5FOBA 3QUKB 3G6AB 1RFDH 4NN6C 4XMPH 4UDTB 3RNKA 4HIEB 1ZK9A 2X70B 4JZOA 1YEJL 2N4IA 1QRNE 4WFHE 1HWHB 4TRPL 5CWSB 1VFAA 4NZTH 5GRJL 1N6QL 4Y1AA 5C09B 1G9NC 3L7EA 1SJHB 5I8EA 1P6AB 1I3RB 2EKSA 2V5MA 1MFDL 5EU6B 1CDUA 1KXTB 1QRNA 2E6JA 3DRTA 1FZKA 4JFHD 1F8TH 4ZD3H 1OL0A 3HAEB 4RFEA 4U1LB 4QCIA 1HZHL 4D9QE 1FZJA 3F5WB 3VWJD 1EMTL 4LEOA 4YC2B 4ZTPL 2M26A 5HHOE 5IKCA 3QCTL 5IHUL 3FO2B 4GW5B 4EEEA 5DFVC 4G9FD 4YXKL 4G6JL 3EO1B 4NGHH 4Q9RH 4P23B 3ES6B 4PJBB 3PGFH 3X3GL 1DBKL 1DJSA 1YY8A 1ZA6A 1T5XA 4Y19B 2P24A 1QFPA 5HHOA 4Y5YC 1X5GA 4DEPC 1SBSH 4OIIL 3G08A 3MLXH 3BQUD 5KANG 4BQ9A 3O81A 3KWWB 4TUOA 4LLAA 2VNCA 4K3EL 2DM4A 2A77L 2ZOKA 1VENA 3F12B 4GOSA 3L9RB 1CD9B 1KT2B 1BFVL 5TPWH 4CNIA 3RWCA 4M3JA 1YYMH 3SQBA 2IG2H 2Q76A 1U8PB 2CKBL 5IMOB 4F7EA 1MCOH 2FDBP 4JN2A 5C0JB 3DV4A 2AV1A 3PABB 4XRCB 3V6BR 5I66B 1LMKA 4U3CA 1UQSA 4NM8H 3I6LE 3U9UA 5IF0B 3LCYA 2QQLL 4P4KA 5FGSA 1WZ1H 3RGVB 3ZSSA 3UPAA 4RNRB 4PLNC 4HJGB 2BY2A 4FXKB 1JPTL 1MHCB 2LV4A 2X4TB 1CT8B 5TF1H 1MFEL 4DUVA 1PEZA 4R4BA 1QFWM 2VABB 4CVUA 5J13B 1CFNA 1CU4H 2DLHA 4MNGB 4PRNA 1HDMB 3CJJA 4IRSA 3FB7A 1ZGLM 4U2YA 4G6FB 5I76B 4FMKA 4KKCD 3ARBD 5I0DA 3C8KB 1UZ8B 4XHQA 4ZUSA 1A6AA 4U6HB 4QRPD 2RCSL 4M4RA 2HJFB 4AEIH 2C5DC 2K1MA 3U0TA 5ADOL 1VGKB 2FHBA 3FTGB 3KPSE 1HYSD 3LN4A 3MXWH 4LSUL 1YN6B 4G9FE 3VG0L 5HYFA 4OV5B 4MD5A 4F37F 1A9EB 1HHGB 1D5XA 4XP4H 1A6UH 4OUUB 4OZIE 2BVTA 2VE6B 3V0VB 1NLDL 3QEQE 3N50A 3TBSA 4AIOA 5HGDA 1IGJB 3KPSA 1OM3H 4JFQB 5IJVA 5JQ6H 2ESVB 1YEEH 4YHOH 1N5YH 3QNZB 2AI0H 1NLBH 4G9FA 3TYGL 1NCBL 3PXJA 3ARSA 1DE4A 1BD2D 1MUJA 4LNRB 2C1OA 4PR5B 3RUGE 3L3GB 5JHDB 4OZIA 1FFNA 4H88L 2FSEA 3A0OA 3QEQA 1NL0H 3MXVH 2HT2D 3RVWC 3I50H 3U4EB 3MNVB 3R06B 5TQ2L 3DUUB 4EUPH 4QWWD 4WO4B 2WMPA 1T22A 5DA0B 4OQTA 3E8UH 1JHKL 3IDJA 4YFLI 2EYSB 1T7ZA 2CIIB 3QEUB 3LPFA 3RUGA 4CU8A 1SY6A 1X9QA 4LCCB 2JIXA 1I8LA 5IMMB 2Y36L 4R3SB 2J12B 1B3JA 3P40A 4MCZB 1T0PB 4YNYA 5HI4D 4F3FA 4LHJB 3IAGC 4I3SL 3QZWA 1KB5H 3AS2A 1XF4B 4Z5RA 1H8SA 3VFGH 1Q0YH 1KUMA 1XGYL 3BP4A 2EC9T 1P4IL 1IAKA 4ELME 5FK9B 4NBXB 1EZVY 2NX5E 2XQYK 1NCNA 4PJIE 4IBLT 1OAQL 4MDJB 4RBPK 1JYVA 4MXWH 2UZXB 4YH6A 2F54B 4Z76A 3RVXC 1Y6KR 2R2EA 3BIBX 3S8WA 3EDEA 4ELMA 4DVRL 3P4OB 4HWNA 1IAOB 5JOFA 1MSPA 3DNKA 3P77A 3QUXC 2NX5A 3TNMA 4BZ2L 4JPVL 3V4VL 5HYQA 3OXSA 4MMZC 4PJIA 5T5NF 1EVUA 4YE4H 1C08B 4TVPL 2AEWA 1FZMB 2G2RA 5DJDA 1QA9B 5D72L 4YWGH 5GSRA 2EXYD 4JCLA 2VZSA 5LCVH 1J11A 1Z9OA 1R3JB 2V7NB 5JA9A 3NCFB 5CCKL 5SWSD 2BY3A 3EOAB 3QEHA 4BK4A 1XIWA 3LN5A 5EZJB 2V2TB 2CGRL 1YEKH 1ORSA 4Y5YB 1KLGB 1PSKL 1UXWA 1SJVA 1IGFL 1NC4B 1MCHA 1CGVA 4PG9B 4HUWA 3KLHC 1MRDH 1A7QH 1MJJB 5E6IC 2WNGA 1U36A 2Z31D 2O5XL 3RUGF 3GSRA 1XGUB 3LV3A 3O2DH 4RMUA 4B7IA 5KSVA 1F13A 5JA8B 4D9LH 1TVHA 4XAWH 1S9XA 5DJYA 3LZFL 4WY7H 3LKPA 2EO1A 5IB1B 2DRUA 3VXOB 2AQ3A 2NMSA 2LU4A 4RZCA 1F6AA 4ONFH 2WZPD 1XR8B 3O6FC 4ZFZB 4ZAKA 3QPXL 1FJ1A 4KKBC 1C7SA 2J4WH 5D7KD 2QTEA 4JR9L 3H7BA 3Q6GH 5D7JA 4RISL 3VD9A 5IQ7L 4M6OL 4XWOD 4ELMF 2ADIB 4XT1C 4N8VG 1CR9H 3HUJE 5IFAH 5DJCA 3DX6B 2XQYG 2VN7A 4JM4L 3BH8B 4PJIF 5B4MC 2YD5A 4GKZB 4U1IB 3KPQA 4PB0H 4KY1H 3VXTA 1K4DB 2H2SC 4S1RL 5HBBA 4HG4K 4I3RH 1TJGH 4Z7UE 4NHCL 4QRRB 4WENB 1TITA 2B0SH 3HUJA 3IKCA 3WEXB 3GIVB 3S96A 2W9DH 3GRWL 1I8KA 2WK2A 4GAYB 4EOWH 3G6DH 4UTBH 3F7PC 1B6UA 3PDOB 4IS6B 1LO2H 4JFPA 1AXSA 5E03A 5HDLA 1T6WA 1SMOA 4Z7UA 3MRHA 3D3VD 1ACYH 4QT5A 1QPPA 5IB5B 3FQWB 4LHQB 4NQUA 3NFNA 4GMSL 3BP5B 1FP5A 15C8H 4OCMC 1NCTA 3FN0L 3IDXH 1ZLWK 3CH1B 2O5ZH 4ZS6C 1A7NL 2FLBT 3LRHA 1HIMH 3WJLC 3VJ6B 4X7TA 1JNHB 4OFDA 2C7UA 1EEQA 3FCTA 1TETH 3DVNA 8FABB 1YJDL 4WUUE 4NWTL 4PRHD 1YY9D 5CIPH 5E2TL 2UUDH 3RZCC 4FQPA 3MV8D 4NO5B 3OR7B 3C8HA 4L3CB 1MCRA 5F89A 1MCFA 4WU5B 3WS3A 1FC2D 3WUZA 4WUUA 4Z0XA 3MO1A 5E2VL 3DECA 3TT1L 2R8SL 3M45A 5A2LH 2ORBH 3OKEA 3CLEH 2FX9H 2R1XA 4GRLA 3QH3B 4XC1L 4OFVA 5D7KE 1UZ6E 2NY1C 1HH9B 2XA8L 3FQTB 5DK2B 3JTSB 4HJ0D 5FYKH 4OCLC 5E9DE 3AREA 4PJEA 1FYHB 4IHOB 3B43A 3SDAC 3A6CL 4KRNA 1TVBB 4E0RA 3CVHA 1NGPH 3KPRD 4F9PC 4AMKL 1BJ1H 4JVPA 5DRNB 3O3UN 2E5EA 1XGQB 1ZV5A 3JV0A 5E9DA 1CTOA 3PDGA 2DIJA 3B9AA 1KJ3L 1U8HA 3QUXB 2BDNH 4LAQH 2IH3A 4XCFH 4PJ8D 5K33A 4BK5A 4KJWC 1INDH 3DSFH 3VD7A 3ZDZF 2BMKB 3GSNB 2MMXA 1RK0B 4HUXB 4Z7UF 1LO5B 2EH7H 4R90L 1QSZA 3TH2T 3U7AA 1E27B 3UJTH 1U8NA 4RMWA 4U7SA 4NJAL 3SPVA 3KYAA 1LK2A 1NMAH 1BLNA 2YKLH 4K55A 4M1DH 4NO0A 3HS0B 4XC3H 1GZPB 4NKOA 4PLJC 1BVZA 2JB5H 3QISA 1S7TB 4P49A 3DV6B 5IT2L 5GGUB 3T0BA 3VRJA 3OHXA 3BJLA 5IMLA 5E6IB 2Y72A 4UT7H 4HZAA 3ZSTA 2VLLB 4TNWK 3IS1X 3RWEA 3QIUC 2JELL 3SKJH 2XXCB 2X9XA 4G6KL 1KYOK 4P9ML 1RZJH 4JFDB 1S7SB 2XTJC 3DYMA 2LTQC 4J4PD 4PG2C 3QXAA 4JQIL 3UAJC 3QT2A 5C6TL 1IM3B 1G0YR 1HCFX 4PJEF 3QWOA 3HNTH 1L7TL 4JHAH 3O6FB 2VZVA 5IVNA 3GKZA 5KG9B 2JJUA 5GISH 1FFOA 3BO8B 4N8VB 2EDBA 2M1KA 4LHUA 3EHBD 4JO1L 5DVKA 2W59A 1A3LL 1V3LA 1DQJA 3V0WL 3VFNB 4JZJB 3KPRE 2CLZB 2ITCA 3MACL 1YUHA 2G60H 4BJLA 1R3IH 5D7LB 3GSOA 1NBZA 3IF1B 4QY8B 3TFKC 3BIKA 4WHDA 5ACLA 2AXFB 1F02I 1NAKL 2ARJQ 2UVFA 5HY9B 2HVKA 4JZNA 1IC7L 2QBWA 3KPRA 4JFEB 1C5CH 3BIAX 3MV01 4O51A 4KPHH 3WFHB 3VH8B 2PCPA 2HFGL 5E8NB 4K3GA 4ZS7L 5SX4H 2OP4H 3Q1SL 4PJ8A 2GITA 1WWWX 4Q6IA 2OS7A 2D4FA 1C5BH 4TULH 25C8L 1CFSA 4HSQA 2DQTH 2FATL 1PG7W 3HE6C 3TO4B 3DMMD 4YGAB 1ZTXL 2UY6A 2VL4A 3KLAB 2FYYB 1IBGL 4OLWH 2PXYA 3GFUA 1UYWL 2NY4C 3FOMA 1TZIB 2APBA 4OTXH 1M7DA 4JAMB 5DF0A 1BVKB 1U42A 2H3NA 3RZCB 1S8DA 1CD0A 1CDYA 4DGVL 1CLZH 3WFCL 3SDYH 4JM2D 5FYKU 1JV5A 1J1OL 4EQ2A 1P7KA 2P49B 3MNWA 3P4MA 4WTZG 4HFUL 2I07B 1GSMA 2PO6C 2VIRA 3FJTA 4NP4H 1WBZB 2FO4A 3BYTA 4XP1L 3IETA 2YK1H 1CFQA 2VOTA 1I4FA 4X7DC 4GG8B 4H0GA 2NY1B 1VA9A 2I9LA 3QQ9D 4AEEA 2Z92B 3BKCH 1LVEA 4WV1C 3SJVB 4NRXB 3V4PH 1BBDL 3SDAB 4EI5D 3IJYA 1ODAA 4P4RB 4M5YH 5I1CH 1HSAA 4MVBD 3BP6A 5C0AE 5DK0A 4JGMA 4CDGC 3RPIB 4KHXH 3IFPA 4PJAB 4WGWB 5HPOA 3JV5A 3QDGB 3QWRD 1NGYA 2Q3ZA 4NKIL 4IM8A 2CLRB 4PV9B 4TYUA 5GGRB 4RWHA 4K94L 4QOKD 4XNUL 1GIGL 3DTXB 2VH5L 4NOFA 2N56A 3O11A 4NCDA 5C0AA 1JZ4A 2WQRA 3GHEL 2VDPL 5AZEH 4TOYH 3V6ZB 5IGXH 1YNKL 2R4RL 4NZRH 3HZVB 1KPVA 4X8JB 3THML 1GZQA 1L6ZA 4DK6A 1U3JA 5DD0H 1RZKH 4HBCH 4LCIL 3DVGA 5JW3H 4JG1L 3UBXG 2F74A 1AIFB 1TMCB 4KHTL 4C4KT 2D7TH 1YA5A 1WICA 4HKJB 4PRPE 4BFBD 1JRHI 3E1F1 5F1OB 5IK3B 1JGLH 3ILQD 5HHVH 4YHPB 1MNUH 3CVIL 2FJGA 3VFTA 4AM0A 3S35L 2IBZY 3G6JE 4Q0XL 5FHAL 1RVFH 1UG9A 4HIJB 3SDDC 5HHME 5ANMB 2NY5C 4WCYL 4ZPTB 4LCYA 4UT6L 4LMQI 4KMTL 2ZCKH 3QIUB 4PRPA 3A6BL 3HG1D 4X5XA 1CFVH 3T8XA 3KPNA 2LTQB 1BM3L 3G6JA 4FFYL 3UJIH 3W2DL 1A3RL 4YO0B 1U6AH 5DQDL 1MRFH 2FWOA 1QSFB 3H9YA 1M71A 1JTPA 1RFDL 5IG7A 2JJWA 4XMKH 5IROC 1LK3H 4R26L 5GS0D 4BSJA 1WF5A 4YBHA 4NZTL 2VQUA 1I7UA 4U6YB 5C1MB 2GTWB 2PYFA 2LFGA 5BS0E 3O4OC 1A7PL 4JANB 4KROD 5CSBA 3IVKB 3GMMB 4OCSL 2XY1A 1FV1A 5JQHC 1KJVA 4HFWA 1IGYA 2NXYC 3HMWH 4LPTA 4M3KB 4ALAH 2DLIA 3X14A 4EKXA 5DVMA 1BQUA 5BS0A 4LKCA 5AUMB 3PHOA 4RX4A 4DN3H 2G5BB 1MHPH 3LKRB 1MFCL 1CL7I 3SGJC 3H42H 1N0LA 3PGDB 3PWUB 2R1YA 3KLDA 3EYOA 3F58L 5E8OA 2K7PA 1OGAD 5L88L 1QFWI 3JVGC 4JRYD 1QSED 1UA6H 4Y4KD 4Y4HC 3CX5J 3HE6B 4K9EL 3V7AE 4L3ED 5B8CC 2JJTA 3MLXL 5D1QD 4X4YB 3OKNB 1RD6A 1RIVH 3IAPA 2DDQH 1T1WA 1WC7B 3VFPB 5JXAL 3CLFH 4V1DB 3L95B 5TPWL 2NY4B 1Q38A 1YYML 1ZWIB 5FYLD 2OSLB 3AY4A 3QFDB 4LCWB 4WEBL 2R2CA 3BPLC 2E7LA 1FLTX 3G6JF 4LSPH 1XCTA 1AJ7H 1EVTC 1NANI 4OB5L 5IOPA 4G6ML 5AG9A 5CJ5A 4U1MB 2D31A 2GAZA 4NM8L 3QB7C 4Z6AT 3O3DB 1PJ9A 5JDSB 2ZJSL 4J12A 5D1XC 1WZ1L 3MGTB 5CP7B 3O6ML 2PO6B 1DZBA 4APQD 6CGTA 5GJSL 4P3CH 1HHHA 2FIKB 1K6QH 4ODXB 5EU5A 3CC5B 3MQIA 1FNFA 5ID1B 3EYQC 1AY1L 1J0HA 3M8OH 3MV9D 5TF1L 4JFOB 3X11A 3SKOB 4RMSA 4WV1B 4YDVA 5EUKB 5AAWA 2P8PB 2X09A 5JZ7C 2GY5A 1MCWM 2XWJA 1UC6A 2B39A 3EKCA 3FQUB 5FDWB 4NOBA 4L4TD 3BGMA 1NUDA 1LP9E 2EDJA 4L8SA 4O9HH 1FVEA 1KNOA 3LKNA 4O2CB 5F9JA 1BF8A 2BNQE 4OAWA 1S7RA 2HWZH 1IILE 4MZ2A 4AEIL 4E41D 3G5YA 2ICWJ 2DM2A 5DHYA 4MAYC 3HA0A 4ZUVA 4LQFL 4PJ7B 4WTWA 3MUGA 5C07E 2D7MA 2D2OA 3MXWL 1D5BB 1F6LL 3B6SB 1LP9A 1IARB 2YWYA 1KF9B 2BNQA 5EBGA 4XP4L 1DQQA 1A02N 2AXGB 1T1ZA 1SYVB 5C07A 1OM3L 1VACA 5ICZA 1YEEL 4NIKB 4YHOL 4M9PA 1WBXA 2CDGB 1IT9H 2OXGA 3K80A 4XCYB 1ZXQA 2AEPH 1E4JA 3BP7A 1EX0A 2NXZC 4ODWA 3B2VL 1K8DA 4HX1B 4XX1G 3S88H 5IIEB 5F7WC 2BERA 3MGOA 1GGCL 3MXVL 2H26A 5CMAA 2BNUB 4MD0A 4D0BB 5I1IH 4CGTA 3SDDB 1TLKA 5F7DB 2OR9L 4KI5E 1T1XA 1CE6A 3LIZH 3BDYL 5L6YH 4YFLF 2IFGA 3DO7B 5I0ZA 2WUBH 4JQXC 1IQWL 2DQUL 1MEXL 4FMFA 4QRUA 4UV4L 1IVLA 3BFOA 2EIBA 2XZAH 3MJ7B 3OKLA 1I1RA 3ULUL 5JXED 1G7JA 4ZFOA 3RWFA 2VZOA 4U1SA 2O61B 4WI3A 3BMWA 1FGVH 5BXFB 2AJUH 1DQTA 4BZ1L 1KB5L 1KJ2A 4OLUH 2VR9A 1PEWA 1RZIB 3WIHA 3GMQB 3MLVH 3RWIB 4APQA 2IPTH 5KZCB 1JPST 4YZFE 4OKVA 4U2ZA 3GGWA 4YLQT 1VKXB 3O4OB 1IFHH 3EYVA 3B5TA 1ADQA 4RFOL 3AM8C 3PWLA 3QUZD 4MXWL 3JSSA 1DVFD 3BXNB 3RL2A 1BOGB 2B5IB 4GSDL 5DRWA 5DUMH 3QUYA 4MNQD 1FNGA 4O4YH 5DJAB 4HS8L 5JTWA 4AIXA 2VQ1B 4PREA 5CP3A 1M05B 4LSDA 3INUH 2YUVA 5D70L 3VFWA 1RZ7H 1JFQH 4QKXB 3T4AB 2VDNH 5E6YA 4M02A 5B39A 5JORA 3L1OH 5EC2B 4S2SB 4YE4L 4KZEH 2B4CC 1A6ZB 2A0LD 5GGRY 4BSVB 2F5BH 2I27N 1X4XA 3NZHH 1J7VR 1KCSH 4LLDB 4LLWA 2VC2L 4M03A 3EJJX 5ELIA 5KN5A 3WNLA 3BDBA 4LSSH 2EIEA 3FT4A 4Z7VF 1GJIA 4Y4HB 3EZJB 3TBWB 1J05B 5B8CB 1B0RB 4FNLL 3KXFB 1UM6L 5DR5H 4WFFD 2RFXB 4GBXA 2EDRA 1A7QL 3H3BC 1OT2A 1N5AA 4R6UA 2VITA 4P5KB 4PGJA 5J1AB 2JCCB 3BPLB 3V6FB 5C0NC 4XAWL 4HXAH 5DJZA 5EUOE 4KI5F 2BC4B 2WBJA 4QHMB 4PGCA 4GXUM 4ISVA 2VR5A 3OGCB 4LARH 4OGXL 1MHHB 3G5ZA 4L9LC 3UPRA 4LCUA 5D1XB 1IAIH 1D9KC 2VZTA 2DQDH 3I2CH 3B2UD 1GC1L 1F6FB 3DX7A 3E6FB 2WANA 3MX0A 5TGBB 5EUOA 1HXMA 4NKQB 2GFBB 2J4WL 4F2MB 3OJVC 2QL1A 4BQ6A 2GUOB 4KVNL 4TTGA 5JXEA 1KFAL 2D0HA 3Q6GL 1RZGB 3MBEC 2HG5A 2BSRA 3NFPB 4KDWA 1CR9L 5LGJA 1CFBA 2CXKA 3BUYB 3MLZH 4JGJA 4MNQE 4YZFF 2VZ3A 4U49A 2CQVA 4FQHA 4Y0GA 4OZ4B 3MYJB 4PB0L 1UVQB 2ZSWB 3OJ2C 4M48H 3SE8H 3CFKA 4ZFGL 2IH1A 1JN6A 1KCUH 1A9BA 2B0SL 4YUEH 4E42B 4QRSB 1IQDA 1UT9A 4MNQA 5FFLA 3OKOA 3EZ8A 3AMKA 4UTBL 1RJZB 2BHYA 2XN9E 2QSCL 4JPWL 3S36L 4ERSH 3ORJA 3LS5H 2WQ8A 4NWUH 1LO2L 3U9PH 1TPXC 4HS6A 5LGHH 1ACYL 3QO0A 3IDIB 4P3DB 1T5WA 1E4WL 2EYRB 1AO7B 2O26U 1F58H 5F44A 3RAJH 3CPLB 2GSIB 1ZLWH 2WP3T 1RMFH 3CK0L 4HWZB 3IDXL 3WFEL 2O5ZL 2XN9A 1WIUA 1E6JL 4EXKA 1G6RB 3OX8B 2NXZB 2AEQL 5HHXH 3EYUH 4P5TA 3KYOA 1WCBA 2B20A 3T4YA 4RMRA 3IJHB 3RHWF 3IDMA 1MHEB 3MREA 1QO3A 4MJ6B 1NFIA 3BRGC 4KKAD 2WUCH 1NFDE 1LGVA 1ZS8B 1TZHB 3JV4A 3CU7A 5EUOF 1OAZL 1SEQH 3O2WL 1A2YA 2DD8H 1X7QB 5FHBH 1CI5A 2FX9L 3VFOA 3ULVH 1R24A 3TEUA 1GOFA 1KGCE 1W8OA 1NFDA 3MRCA 5CLTA 3RA7H 3SOBL 1U3YA 3C60D 4PJ5B 2DWDA 3TIEB 5FYKL 3CFCH 5EOTB 5T1LB 2YC1A 1I7RA 5K9OB 1NGXA 4KWUA 4IRSC 4WHCA 2VXQH 3CFBB 3AVEA 5FGBA 3QR2A 3O4LB 4R2GC 5ID0A 2RJMA 4AT6B 3DGCR 4GMTH 3O2VH 4M7KH 2Z8SA 3V4UH 1F3JA 2BDNL 4XCFL 1B4RA 2BOBA 1FIGL 5FYJU 6FABH 1QLFB 1NC2D 3OXRB 4UT9H 3PJSA 3MRJA 2DQFA 3GJFB 2EH7L 4Y5VA 2C3VB 2F8VA 2FBJH 3V5KB 1S5IL 1B4JL 1UXSB 5DTFA 1HINH 2FECI 3MBXH 2VAAA 3IXAB 4UOJA 1HHJB 5ISZE 1J5OH 5I6XC 3R1GH 1OLLA 2YKLL 4YHIB 4F7TB 2IPKB 2VO5A 2Q8AL 4C83B 3VWKD 2F58L 2CRMA 3P4LA 3FONB 5T5NG 4M9OA 2AJXL 3EDFA 2PTUA 5T1KD 4JY6B 5INDB 1GGTA 1G7HB 2HRPL 5ISZA 5C2UB 4JPIB 5I1DB 3MNZB 5FM8A 4CRPA 1TCRB 1KCLA 2RR3A 3BQUC 2DJSA 2HP4A 4ZYKB 3SKJL 3NABH 4YHYC 4RMTA 4W6YB 1OARL 2CK0H 2EDOA 1ZMYA 3QUMA 5HHNB 1WJ3A 2W1NA 5H2BB 1E6OL 4L4VD 3TV3H 3VFSB 3HTLX 1YC7A 1D9KB 2XZZA 1I8LC 4C55A 4K8RH 5F3BB 4XNMA 3TPUA 3TO2A 5DXWA 5JLZB 3WD5L 5FOBB 5GISL 4WHTA 4BUHA 3RNKB 4HWBL 4JFFE 2DS4A 4GXVH 2FR4A 1CF8L 3TH4T 5CHNA 4P3WA 4JZOB 2NR6D 3WCYA 3HRZB 4LVHB 5FDYA 4KK9D 1VFAB 1KULA 5EU4A 3NBNA 3MBEB 3QZWG 4Y1AB 2G60L 1OD7A 1FORH 3P0GB 1R3IL 2ARJA 1L4IA 4NFBA 3L7EB 3S4SA 4YEEA 5I8EB 2EKSB 4WFED 4JO2L 3C6LA 4KZDH 4JFFA 5HGBA 2CUIA 1QRNB 1BF2A 3DRTB 5EBWB 1FZKB 4UI2A 1KV3A 2DLGA 1IC5H 4RFEB 1QLRA 3IGAA 4KPHL 3WKML 4JO4L 4QCIB 4Y16D 1FZJB 4LEOB 5L0QC 2OP4L 5IKCB 7FABL 4UU9A 3T0WA 2DKUA 3BZFB 1Q1JH 1QHPA 1JK8B 4TULL 1TPXB 2VYRE 3Q48A 1HYSC 4KGLA 3RX5A 2IANE 2DQTL 3NH7H 1XIWC 4CVXA 3KGRA 1YY8B 1ZA6B 2D7OA 1T5XB 4DFIA 2L7UA 5HHOB 4X0KA 1ZHLA 5F1SA 5K59E 3NCYP 4ENEC 4EDXB 3G08B 2ADJB 4OFYA 4YDJA 4TUOB 4W70A 4QXGH 3BUTA 3U6RA 4LMQE 4Y2DA 1DBBL 4AH2A 1YEHH 1LILA 2IANA 4B7LA 1OF2A 4YBQC 4YXLH 2Q76B 2ZG2A 1J8HD 3MJ6A 4HHAA 4QXWA 4F7EB 3RDTD 4JN2B 1NCWH 2FEEI 3DV4B 4IOFD 4PYGA 2AV1B 2HT2C 4L4VE 1UQSB 3PWJA 1LE5A 1I3UA 4HUVA 1LDPL 1F4HA 3D5OF 1T0MA 5I1LA 2YK1L 3EGSA 2MQCA 3O9WD 3WMSA 1DSFL 1S9VB 3L3DB 1MIML 2ZG1A 4L4VA 4R4BB 2KQNA 3V4PL 3T0EE 1Z9MA 3HC3H 3VMNA 3CX2A 4WI5A 5EBMA 1CFNB 4YGVA 3WFBH 1CD1A 5HI4C 3ZZ1A 4FP8H 4IRSB 4X99A 3OZ9L 1A7RH 4OV6F 4WFEE 3B3IA 4HQQH 5I1AA 3DUHA 3RVUC 2YPLD 4R2GB 4OD3H 2Y06H 4ZTOH 5JO5A 1Q9WB 5I18H 3T0EA 4ZUSB 1A0QH 3EFDH 2V17H 3U0TB 4I0PD 4P2OA 4I48B 3EBAA 5EIIA 5AZEL 3KJ6L 2VDOH 5IGXL 4LPXA 3RX7A 3LN4B 1IGML 1QYGL 4WUKH 4QGTA 4O02H 4NZRL 3DPBA 5HDQL 3JWDH 3VA2C 4RCAA 4DW2H 1QQDA 5ALBH 4MD5B 2OX5A 1D5XB 5DD0L 3BAEL 1NEZA 2HLAA 3MYZA 4ONHB 1INEH 3D2UA 3MLUL 2AXHA 3EO0A 5I6XB 4NNXA 3FB5A 1RZFH 4NZUH 3ULUF 5IJVB 1DN0A 1P7QA 1N26A 3UZVB 4G9FB 5I30L 1JGLL 1NUGA 1DE4B 5T5FH 5K59F 2RHEA 2C1OB 2UYLB 4OZIB 2FSEB 5HI5D 1ZGLA 3EDJA 5DQJA 2V7HA 1J8HE 1HNFA 2EDNA 1PVHA 1U8LA 4AL8H 3BESR 5D2LE 3BQUB 1VFUA 5C6WH 1T22B 4MDIA 4YHYB 3QQ3B 5DLMH 4S1SL 5EWIL 3RUGB 4XBPB 2Z31C 3HZMA 1VFBA 4U0RC 2JIXB 3KR3H 1J8HA 1U6AL 5DGQA 5D2LA 4KQ4H 4GRLC 4YNYB 3OKMB 4AY0A 3QZWB 1A6VH 4Z5RB 1LK3L 1MCQA 3QJFA 2WINA 1LO0L 4DCQA 1IAKB 1MJ7H 1H3TA 3O9WA 4XXCC 4IIQC 4OLZL 1IEBA 2QHRH 2R0KH 4J1UA 5T3XL 3BKJH 1HXYA 3HMWL 2RB8A 4Z76B 3VGBA 4U7MA 2R2EB 2LAGB 4QHLA 1F4YL 4RGNE 5JOFB 3WIIH 2NX5B 3TNMB 5FYLH 3OXSB 4KK8D 4Z7WB 4PJIB 5LXGH 1MHPL 5L0QB 2FZ3A 1LD9A 2CLVA 3IYLW 3EDDA 4U31A 2F9BT 3T0VA 4P57A 1DQLH 2G2RB 5DJDB 3NGBC 4Z95H 3RWJA 2QLVB 1T7WA 4QRPB 3MRMA 1OSZA 2G75A 4H8WH 2E7BA 3VW3L 2XKUA 1VSCA 1XIWB 3C08H 3LN5B 5EZLA 2NTSP 1E4XH 3P2TA 1GAFH 3DX9A 3I6GA 2PR4L 1A7OH 4TPRL 4HS3A 1JHTA 1D6EA 5SV4A 3UP1A 1JMXA 1F5WA 4WDIA 1NCCH 4S1DD 3GSRB 3LV3B 1OY3B 4LSPL 1UACL 3GK8H 4MA7H 1R0AL 1TVHB 3G6AA 1S9XB 5C86A 1MCPH 4HIEA 5D2LF 5DMGD 1QACA 4A6YH 3ESUF 5HGGS 5CZXC 1HNGA 4P3CL 4RZCB 4TVSa 1CVRA 2CUHA 2J1KA 5FUCE 1SJHA 3UYPA 1I3RA 3S97C 1FJ1B 1KB9K 2E3VA 3TT3H 4O00A 3H7BB 3UTPE 5I8CA 2ZUYA 2AJVL 1RHHA 4TSCL 3E3QE 1MCKA 3OL2A 1MI5D 1NPUA 1TJIH 4ZSOE 4PJCE 4NO3A 5DJCB 3F5WA 1MIEH 4Y19E 4LHUG 3PP4L 1LQSR 5HHPA 2OCFD 3FO2A 4O9HL 1J0ZA 4N9GA 4LBEA 1IM9D 1IGTA 3KPQB 2HWZL 5IVXE 3ARGD 3AROA 4ZSOA 2PW2A 2EDXA 5L2KE 4RQQA 4PJCA 3HUJB 3IKCB 3GSNL 4I4WB 5KSAD 4Y19A 2OR7A 2P44B 5JR1H 1AHWC 5CKGA 2B1AH 1WEJL 4I13B 4AEHH 4MQXD 1I8KB 3GMNA 4Q58C 1SYSA 3KWWA 4PJ8C 2OL3A 4Q6IC 5EOQH 3WYRA 4IEFB 4JFPB 1AXSB 5BV7C 5IVXA 4Z7UB 3R0NA 5HYEA 5L2KA 2NY3C 4OZGE 5CUSL 3BWAA 1U8PA 2FJFA 2YN3A 1IT9L 1T7VA 2AEPL 4TVPD 1KCKA 4Q9QH 4XRCA 1CIUA 4JDVB 3N9GH 3S37X 2A9MH 3B8YA 3D87B 3FCTB 1MF2L 4L4JA 1KC5L 2W0PA 4OF5A 3PNWA 3MRIA 4OZGA 3BGFC 1EUUA 4MNGE 4RNRA 5CAYB 3KPOB 4HJGA 3SE9H 3LIZL 4PB9H 3U7WL 3LQAH 1ZLSH 2WUBL 2MNUA 5F89B 4XVSH 1IGIH 5HGAA 5ITBH 3WS3B 4U0RB 2JLLA 4WUUB 4Z0XB 4ZXBA 3MO1B 4MNGA 3OAUH 1RULH 4RDQF 3OKEB 2AJUL 1Y6NR 4GRLB 5C0EB 1ZT7B 5I76A 5J57B 5DK3A 3AUVA 5TE7H 3HI6L 3OF6A 2H1PH 2IPTL 1YQVH 3ZTJG 4IIQB 5DUBA 1VGKA 3DX8B 3CVHB 4E0RB 4GRMB 4UZGA 2OLDA 1RIHH 4PJBF 2ESVE 1RUPH 1WUNT 1H3PL 5EH1A 4PJCF 3EHBC 5DUML 1T04B 1YN6A 4OV5A 5E9DB 2AQ2A 3WSQH 3ARXA 1JGDB 1U8HB 2IH3B 2CMRH 2NY0D 3KYMA 5I1EL 2VDNL 5KJRH 3L1OL 3MLTB 4MNHA 1QKZH 1YMHB 3IU4L 2ESVA 3TVMD 4GS7C 4LSVH 1J87A 3BPOC 5DYOB 1OAXH 3BSZL 4AG4H 3L3GA 1U8NB 3KPPB 2X4OB 3MOAL 4E5XA 1MVUB 5FYJL 3SPVB 4KUCF 3MNVA 3VGAC 4HG4J 4HDIB 3BDXA 1Z5LB 1LK2B 1BLNB 4C56D 4NO0B 4WO4A 1RJYA 4OZGF 4NKOB 1PLGH 3K3QA 2AXJA 3QEUA 4LK4A 2OYPA 4LPVA 3OHXB 3PDDA 1Z9LA 1QSVA 4LPYA 4M1CC 5EO1A 4HUMB 3BKYH 1D3CA 5H94A 4MCZA 1DQMH 3RWEB 4FFVD 1JUFA 5E56A 4UUJA 1DLFH 2F54E 3SKNA 3ARFD 4M1GH 4LARL 2V9RA 3TNNB 2DLFH 1N4XH 2DQDL 3I2CL 5F97E 3BD4A 3SE3A 5TFSH 5TE6H 1MFAH 1NBQA 1OTSC 3QWOB 2QADD 4JM2C 5DO2C 1BREA 1FFOB 2F54A 3H9SD 2RGSA 2HFFA 4LHUB 4ACPA 5F7KC 1FG2A 1PG7H 1BX2A 2VDKL 1CE1L 1DQJB 4R4ND 5C0BE 2ITCB 1E4KA 4JDTL 1YUHB 1EO8H 3I75A 3IS0X 4W4OC 3LOWA 3QQ9C 1NBZB 4C58B 4X4XB 1CG9A 1FZOB 1FZMA 3NZ8A 3BIKB 1Z3GL 3K8MA 4EI5C 1RK1B 1XEDA 1AD0A 2ICWI 3PWPE 3SCMD 3FMGH 2HVKB 3MRKA 2EIZA 3PHQA 2OTWA 4M48L 4MVBC 3T2NL 5C0BA 3KPRB 1A22B 1XGRB 4O51B 4YUEL 3CSBA 4ODSH 5CZVL 1FFPB 3PP3K 3DURB 2WWMD 2PCPB 4I9WE 5AYQA 2IBGA 5GGTL 3KPMA 4FQCH 3H3PH 4JVWA 4PJ8B 1F4WL 3U9PL 3PWPA 2E9JA 4Q6IB 1MJJA 2DYPA 5FCSH 5LGHL 5I1HH 4WEUD 4HGMA 1F58L 1KIUA 5T33H 2NY3B 2VZ1A 1P7HL 1XGUA 4KK6D 2P5ED 2X4PA 4YHMH 5EO0A 4YQXL 5BO1L 2XTLA 5HHXL 2X89D 2WAHA 4CBPA 1I9IH 4RSVA 3OGOE 3FOMB 4HZLA 1N64L 4XAKD 3BGFB 35C8H 3AY4C 5C08D 4UTAH 1M7DB 2E7LC 2B2XH 3QHZL 2H3NB 5DURD 1S8DB 3JUYA 3ILQC 4OQTH 12E8H 3DGGB 5KVGL 1P7KB 3MNWB 3BISA 1SY6H 3RL1A 4I8DA 3V7AG 2VIRB 3DUSA 2FO4B 4YHKH 3IETB 1CFQB 1JNJA 2ADIA 3ULVL 1I4FB 3GKWL 1YYLL 5EIVA 3H9SE 4QLRA 4XCCH 3RA7L 1SMAA 4KTEH 4NZDA 3TYFA 2BFVH 1BQLL 3CFCL 4GKZA 4U1IA 1KYOJ 3D6GA 4OGYH 1K4DA 5KSBE 3IJYB 5I9QC 1TTUA 1TQCC 1HSAB 1NGWA 2N1KA 5DK0B 3H9SA 4BSWA 1YZZA 5GS0C 1AP2B 3LQZA 3IFPB 4GAYA 4WW1A 2J88H 3NCJH 1OWRM 3UTTD 1OAKH 4IS6A 4XPTH 2IJ0C 3VXPA 5KSBA 4KROC 3FQWA 2CRIA 3BT2H 5L9DH 3O11B 3I3DA 3BP5A 3K4DA 1P4LA 1G0DA 4ZPVA 3BW9A 1BZ9A 4GS7B 2HN7A 2HTLD 3BPOB 3QP3A 4BM7A 3KHQA 2F53D 1KPVB 1JNHA 2OTUB 1GZQB 2VSDA 3SQOH 2FRGP 1V5JA 2DICA 1FH5H 4LIQE 3B5GA 1J5OL 5IW1A 3R1GL 3RU8H 3VGAB 1R5VB 2F74B 5IMKA 5DJ6A 3C87A 5A1AA 4PTUB 4UIKH 1D5IH 1U8QA 5F96H 2FJGB 3VFTB 4AM0B 4Y4KC 1IAIM 1RURL 4LEXL 4KTYA 1TVDA 4PPTA 5EULV 2VDLH 5D1QC 3LPWA 4LCYB 5FA4A 4H0IA 1FO0A 3QFJE 3GI9L 4X5XB 2EICA 5DK2A 2YUZA 1JZ7A 1WITA 4NNPH 3KPNB 1WWAX 3G6JB 4DGIH 1XMWA 1DBAL 3RHWK 5HHMB 3LKQB 4K8RL 4X4ME 4MWFB 1TVBA 2EO9A 4PV8A 2FWOB 4M00A 2GW5A 4JM2B 3QFJA 4NPYB 5IG7B 3OJDB 1XGQA 5E5MB 3HZKB 3QG6A 4GXVL 5CJQH 4APQC 5ITFA 4MJ2A 3RJDA 4X4MA 1TZGH 1I7UB 4TQEH 1FORL 3KHOA 3BE1L 3QIBD 1NMBH 3WL9B 5KSBF 2R4SH 4DQOL 5M95B 4IOIB 1FV1B 1A6WH 4K7PX 2QQKH 4FQIL 2X41A 2E9WA 4KI1A 4FQ2H 4F7MA 4EI5B 4LP4A 4H1LH 1Q0XL 2VXVL 4YBLB 4KJQC 1B90A 5BS0B 4LKCB 4FS0A 4N5EC 3PHOB 4MXVE 4ZUTB 1GZPA 4UMGA 3ZYZA 3U2SA 4W6XB 3GBNH 4JCMA 3NMEA 3PF2A 1A4JB 1S7TA 4FABL 4QOKB 1Q1JL 4JFDE 3UTSD 2R1YB 3EYOB 5B39G 1BIIA 5E8OB 4OF6A 2PTTA 3HMXL 3NH7L 3UTZA 4IDJL 3AXLA 2P42B 1N2RA 3JWOH 4QXGL 4JFDA 4WNQA 3UMTA 4UOW0 2R0ZH 2V5TA 5F7EL 3MA7A 4ZFFA 2A6JB 3CXHK 4U3XA 3IDYC 5I15H 2YA0A 1XCTB 1NCUA 4POUB 2D31B 2DQEL 2GAZB 1YEJH 5EC1B 4R4FL 5GRJH 2J5LC 5CS7A 4U1JA 3MUHL 3PXHA 2VLKD 4QY8A 4TNVF 2EE6A 5D5ME 1A21A 2J3SA 3X11B 1S78C 5JXEC 2VLMD 3EFFB 2Z4QA 5HY9A 3WFDL 4FQXD 1JL8A 4LLYA 2P5WD 5I9QB 2W9EL 2XWJB 3I9GH 1TQCB 3CDGA 4WWKD 5F88A 3CVHH 3VH8A 5LAXA 1HZHH 4HQQL 1EMTH 4PD4J 2PETA 1W72A 3BGMB 2YD3A 5D5MA 3QCTH 5IHUH 4L8SB 2JKXA 1FVEB 1KNOB 1TDQA 3LKNB 4RAHA 5F9JB 5T3ZE 1H5BC 4OAWB 1WBYB 4L1HA 2YXMA 4YXKH 1S9KC 4KROB 2AGJL 2V17L 3G5YB 5FXCH 5KVDH 3X3GH 4ZUVB 1IJ9A 5DEGA 1DVFC 3MUGB 5D2NC 2VDOL 4WUKL 4X6BA 1LP9B 4ZO9A 4ZDHB 5TDPA 3TP4A 1HQ4A 4MXVF 3KLAA 3WJLA 2FYYA 4K3EH 5IBTL 1DQQB 5DD1L 2OMBA 1ZLVK 1AR2A 3DI3B 1BFVH 1JNLL 1T1ZB 1TZIA 3BI9X 1HQRA 2I60L 4YDIH 5C07B 1BVKA 1VACB 3O8XD 5DJXA 5SV3A 1WBXB 2CKBH 4OI8A 2ZUSA 3BP7B 3CUPA 3H8NA 4ODHL 4ODWB 5SX4I 1K8DB 2EDYA 3GSWA 4F33A 1L6XA 2H26B 4GG6E 3ZYJA 5CMAB 3W0WD 4MD0B 4FQQA 4HCRL 1VERA 1RPQA 5D1QB 5IR1A 2PF6A 4TSAL 1T1XB 4X5WB 2CDEB 3Q5TA 3V8OA 3V8CA 4QRUB 3K74B 2Z92A 3QNYA 3BGAA 5J12C 2DIBA 4GG6A 1T3FA 3SDAA 5DDHA 4G7YL 3RWFB 4U1SB 1OVZA 4KQ4L 2HMIC 4M7ZC 3RPIA 5JDJA 2EZ0C 1KJ2B 4X9BA 1GGBL 4XVJH 1CXFA 1A5FH 4I77H 2EC8A 4GKNA 1NAMA 3BN9C 1G9MC 4APQB 3HZYB 1OTUC 3PL6D 3ARVA 3CDCA 3VXSD 3B2UC 3T0AA 4JG0L 3ZT5A 2RCSH 4OKVB 1TTGA 3CIQA 3GGWB 3Q5YA 5AAMA 3EYVB 1I9RH 5L7XL 3V6ZA 1FFQA 1CS6A 4LSUH 3RL2B 4LPWA 5DRWB 3QUYB 3KG5A 1FNGB 4X8JA 3VG0H 3P30H 3VXRE 2AABL 4JREB 3WIIL 1NEUA 1BHGA 4PREB 2QKIA 3WJJA 5IVZB 2YD2A 3NPZB 4P2QD 4HLJA 1NLDH 4PGEB 3RY4A 2P8MA 5ANME 5B39B 5JORB 1KN2H 4Y5VC 1IAMA 3NIGF 1P6FA 4HKJA 1AQDB 2AK4D 4Z95L 3VFVA 2D9QB 5IK3A 3W39A 1JBJA 3VXRA 1NCAL 2EEBA 2XTJE 1YMME 2YHGA 4HAGA 5CEYA 4Z78B 4H88H 4LLWB 2AP2A 3P0VL 5KN5B 2ZNXA 3C08L 5ANMA 1E4XL 3OBAA 1GAFL 1QSFE 1ZSDA 4XCEA 3QIUA 1FAIL 3MLSH 1G6RL 3UZEA 4JN1L 4JLRA 1ZVSA 2H9GA 1YMMA 5BZDA 2Q7YB 1N5AB 4PG2A 4M93C 1NCCL 3EYFA 5TQ0L 3V0AC 3IDYB 3GK8L 4GG6F 3H0TB 3NFSL 1QSFA 2LE9A 2Y07H 5MEND 2BX5A 3KS0J 2WIMA 5DJZB 5HYJD 4I3SH 1WFOA 2WBJB 2HFEA 4PGCB 2X40A 4ISVB 1XGYH 3G5ZB 1P4IH 3UPRB 1KTRL 4LDOB 3QRGL 4I0CC 2IC2A 4KKAC 4HEME 4JANA 3DX7B 1OAQH 3ZTJH 3NACL 1HXMB 4MAUL 4Z0BL 5C0CD 4NQCD 1WIOA 2NZ9D 4IJ3C 4DVRH 1J8KA 3NIDE 1CICD 2HVJB 4PIRF 4X7SL 4RA0C 3PIQB 1EHAA 2HG5B 2BSRB 2YD1A 4JPVH 3D18B 2F5AL 5AUMA 5LGJB 2FO1A 4NQSA 1MIEL 2GYSA 1BQSA 2N7BA 3C60C 4PP1D 5E99H 3ZKMD 4FQHB 2BVOA 4PS4L 5D72H 4OGAD 4XNXH 1NDMA 3MCKB 1H5BB 3ARDD 4QRTA 4TUKH 1IGCL 1SM3H 5SWQA 4HC1A 4NFDA 3S4SG 3CFKB 3DO3A 3QULB 2IH1B 5CCKH 1JN6B 5GSVA 5D2NB 3F7QA 1BZ7A 2CGRH 2WIIB 2B1AL 4MNQB 1ZT1A 3HE6A 3KNBA 4AEHL 3UTOA 1YPZE 2B4CL 3M17B 1AKJD 3OKNA 2WWKO 1IGFH 1BJMA 4P59L 3ZTNL 5EOQL 3VFPA 4HIXL 5KAQG 4HS6B 3QO0B 2OSLA 2B1HH 2O5XH 5CILL 3NA4A 2ZUVA 4JKLA 3RJQB 1YPZA 4M43L 2XN9B 4FN0A 5JOPE 4Q9QL 2ZSVA 4U1MA 1RUML 3MRGB 4WI6A 4P5TB 4NKMA 3UO1L 3KYOB 4Y2DC 1WCBB 3T4YB 2PO6A 1YDPA 3IDMB 3BRFA 1KXVC 1QO3B 4ODXA 3SE9L 3CC5A 1NFIB 3LQAL 4JY5L 1QFOA 3QPXH 4G8EB 3L3JA 4XVSL 3SKOA 2SEBA 4JR9H 1OP3K 5J12B 5GQBA 1WFTA 4JRXD 4UNUA 3P0YH 4RISH 3OAUL 5IQ7H 1RULL 4M6OH 3VFOB 2FD6L 5FDWA 4M7ZB 1JWSB 3QA3B 1MLBA 1NFDB 3MRCB 5DJ2A 4JM4H 3Q3GB 2DWDB 2XNAA 5TE7L 2XKNB 3QPQD 5IQ9A 1UGNA 3W9EB 4S1RH 3GZKA 1NGXB 1G84A 3NIDF 2CJUH 5CEZL 4M6ML 1RIHL 2K7QA 4GH7B 1RUPL 1JGUL 3PV7A 2E8YA 3U79A 1KCVL 2NR6C 5JW4N 4BFIA 4EDWH 4U6VL 2BNRD 3HC4L 5E8DL 3MUZ1 1MFNA 1F3JB 1AGEB 2AXGA 4KK5D 3QG7L 4HH9A 5KJRL 4P2OC 3PJSB 5GZNC 3ARYA 3MRJB 4GMSH 2ICWA 2DQFB 4Y5VB 5CJ8A 4LSVL 1EFXD 5JPMB 1CK0L 3IB4A 3KAAA 4P2CG 1A7NH 3VE0B 4HX1A 1OAXL 3BD5A 4XHJD 5DTFB 2NPLX 2VAAB 2ZZUT 1QZ1A 1BFOA 1MQKH 3K8KA 4NN5C 2BNUA 4Y16C 5FO9A 4N1EA 5IHBA 1YJDH 4LVNC 4NWTH 4BZYA 1MFBH 1F90L 3DO7A 1ZEAL 2BVPA 2X44D 5CJXC 5DMKB 4LRNH 4ELKB 4HEPG 5KBNC 1OAYH 4PBXA 3MJ7A 1MJUL 1RUAH 4U1NA 4XP9H 1MWAB 2R8SH 3TT1H 3WXVL 5BXFA 4NC2B 4QNPE 3HN3A 1DLFL 4XC1H 4M1GL 2XA8H 1WT5A 3MMEA 5FA3B 2L7JA 5EA0H 3JV6B 2PYEE 2DLFL 4PUBH 4NRZA 1N4XL 2XYCA 4NT6A 2ARWA 5TFSL 2DQCH 5TE6L 1JHLL 3RDTC 4XNMB 3TPUB 3LEXA 1KOAA 3TO2B 1I3VA 4AMKH 3RVTD 2GQHA 5CGYC 3QIWD 3BXNA 4WHTB 1K4CA 5ERWB 2FR4B 4NO2A 1HILA 3FQNB 5CHNB 2PYEA 1PG7L 5DJAA 4BKLB 4XNZC 3FQXA 3VXUD 3F6LA 2DQIL 3O9WC 5BRZD 1KJ3H 3ZL4H 1EK3A 5EU4B 3BZ4A 4XB7A 1EO8L 3AU1B 3HE7D 4LGSB 5HDBF 2ARJB 2D7PA 3S4SB 3C60B 2CSPA 4M8VA 2DAVA 1ZHKA 3C6LB 3SGJA 4R90H 4JFFB 5HGBB 5LVEA 3KXFE 5FYKD 3GMRB 4P46D 3CSPA 1B6DA 3PP3H 2ED9A 1MVFA 1QLRB 2X4QA 5C09D 2J8UE 5I74C 5BMFH 4Y4HA 2J6EL 2YA1A 1MH5B 5DC4B 5E00A 5B8CA 1C7TA 1B0RA 5EU6D 1F2XK 3KXFA 2NZIA 4U1KB 5IWLA 5IM7A 4JFXA 4RGNC 1LEGB 2R29L 5I1HL 1NC2B 2MKLC 4I0PC 5T33L 2D7NA 2OBGA 5I1JH 4ODVL 4TUJB 2J8UA 4KV5E 4CVXB 2EE3A 3RWGB 1ZHLB 4OKDA 2BC4A 2UVEA 4YDJB 1MHHA 5EU7E 5A2KH 4Y2DB 3TJEH 4AH2B 2V5YA 4P23D 5D1XA 35C8L 2IANB 4YPGA 1OF2B 1NH6A 2GK0A 4UTAL 5C6TH 2B2XL 1PYWA 2DN7A 3E6FA 2ZG3A 1SJXA 5TGBA 5C7XH 4OQTL 3QRFM 2D03H 1WTLA 5HI5C 1R3KB 3LD8C 4DJMA 4B50A 5FUOL 3PWJB 1LE5B 2ZUQC 4JO1H 4ONGL 1A3LH 1T0MB 5I1LB 3V0WH 1W0VA 4C57C 3EGSB 3NFPA 3MACH 1H15A 4Q9BA 3GNML 3S3SA 2CK2A 4KTEL 1ERNA 2BFVL 1U93B 4L4VB 3WIHH 4OZ4A 3REWA 5BRZE 5K9JL 3RTQA 4OGYL 1UVQA 4MS8C 4XZUB 5CIPA 2ZSWA 1I85A 5EBMB 4Q7DA 4YGVB 1IC7H 3RGVD 1AO7E 2ZCLL 4MAYA 1IAII 4X99B 5EB9A 4ZOAA 1MCWW 2X2YA 3B3IB 2WV3A 5I1AB 3DI2B 1UWEL 2HFGH 4ZS7H 4RDQG 3MRPB 1GCFA 4AYFA 4CW1A 3K2UH 3Q1SH 5BRZA 3TN0D 1QHOA 1OAKL 2Z8VC 4NN7C 4XPTL 5JO5B 2CD0A 3HE7A 1IRAY 3LS4L 5IW6A 3IDIA 3E3QC 5CP3H 1AO7A 3BT2L 4BFEA 4P2OB 2R0WL 1DP0A 1EPFA 1UKQA 4G6FD 3O3BB 1T2XA 2J8UF 4HMCA 3VGEA 3STZB 1H0DB 3X13A 3OX8A 2YUWA 1QQDB 3SQOL 3QDJE 1HOCB 3GSXB 5CBAB 2A9NL 2R23A 4K3HA 1T20A 5MHSD 1NEZB 2HLAB 1NKRA 4KK8C 1UYWH 4IRJA 3QDMD 4NN5B 2XQBL 3WDHA 5AYUH 3CU1A 3D2UB 3ROLA 2F8XC 4YDLC 4NNXB 4LVNB 1DANU 3I3BA 3H9ZA 4ESKA 3MRDB 4KJPD 1DN0B 1P7QB 3QXUA 5EORL 3U4AA 2K9UA 2Z35A 1IC4H 4RGOL 4KV5F 4DGVH 4JQXA 3QDJA 3WFCH 4O5LL 4R96A 1D5IL 5KOMC 5D8JH 4Y8AA 5F96L 2C1PA 3VI3F 4ODUA 1ES0A 3PWVB 2H2PD 5DQJB 2V7HB 4FQJL 1U8LB 1ZAGA 5HJ3A 1C5DA 4HD9A 4MDIB 1ZLUK 2EDTA 2OZ4A 3LSOA 2R39A 3TIEA 5LG1A 4NNPL 2IMMA 5JHDD 3HZMB 4S1DC 3GJEA 4OZHB 3D39D 4BELD 1BBDH 1CBVL 3SGKA 1KELH 1J8HB 2OK0L 4R97C 2XXMB 3RDTB 4JRWA 4JKKA 5D2LB 3QO1A 5DMGC 4OLVL 3AM8A 4J6RL 4PRBA 5IUSA 4LDLB 5IBUB 2WINB 4KU1A 5DGRA 4DCQB 5I1GL 4R8WH 4XNZB 4NKIH 4L8BA 1A7BA 1U95A 3O9WB 4TQEL 4K94H 4XNUH 1QLFA 1FGNL 1GIGH 2VH5H 1NMBL 1D5MA 1IEBB 2OM5A 2R4SL 3W81A 4J1UB 4MGXA 1A6TB 1P84J 3GHEH 2AJYH 3GJFA 5KVMC 1A6WL 2VDPH 2QQKL 1HXYB 1GGIL 1YNKH 2R4RH 4FQ2L 3V5KA 1R5IA 3THMH 2GJ6D 3CSYA 3MPCA 3IXAA 3TPKA 3MLRL 3MUY1 1WAAF 4JG1H 2EYTA 1GGYA 4YHIA 5I74B 2V5SA 4KHTH 4NQTA 4C83A 5FB8B 3GBNL 4NJ9L 3FONA 4P57B 3RWJB 2QSTA 5INDA 1FDLL 1OSZB 4RGNB 2QQQA 3ARGC 3F65A 1A1MA 2G75B 2P1YA 3CZJA 3L5HA 4I0PB 1FSKC 3PQYE 1Z0MA 5KSAC 4MD4A 4JPIA 4Q0XH 5L8JB 1FVCA 5FHAH 1T03H 2ILLA 5EZLB 4MQXC 3MRNA 1OPGL 4WCYH 4C59B 3GSUA 4ZYKA 3DX9B 3I6GB 2XWBB 4KMTH 2YD6A 1I9EA 2IFFL 2IALB 4HS3B 4QHUA 4U05A 1JHTB 3W11D 1D6EB 1SHMA 4X8XA 5DFVD 3EOBB 4HUNB 4L9LA 3UC0H 3ZYIA 3T0XA 3PQYA 4WDIB 2ERJC 4FFYH 3ZE1E 1BZQK 5DA4A 4HGWA 5DQDH 1BQHA 3S5LA 2O5YH 3MC0A 3W5MA 1NC4D 3LD8B 3D39E 4R26H 3HRZA 3KLSA 3IDGA 4XGZB 2VJXA 3MBEA 3NA9L 3SE3C 5CINH 4GW4B 1A7PH 4LSRL 4OCSH 1OCWL 4HT1H 2DOCA 1M4KA 3D39A 4Q97A 2NY6D 3X12A 2KPNA 4YFEA 5EBWA 1K85A 1PQZA 5I8CB 4YHZL 4XMLH 1RHHB 1UM5L 1XZ0A 1E4KC 2XPGA 2FH8A 1PKQE 3I9GL 2ICEB 1I1AD 3K0WA 3CVHL 4K7PY 4NO3B 4HIHA 3MLYL 5B38A 5HHPB 3RVVD 1MFCH 4P2YA 4ETYA 4NC0B 2GJ6E 4M7LH 3MODL 4N9GB 4LLQB 3WE6A 4NN7B 5A2JH 4LBEB 1IGTB 3BZFA 1JK8A 1RQ5A 2DJUA 3F58H 3OMZA 1OB1B 5KVDL 5L88H 1KPRB 4ZSOB 1CXHA 2PW2B 4RQQB 4PJCB 5T3XD 4P5MA 1JMZA 4K9EH 1ED3A 4UQ3A 2GJ6A 3GMNB 1ZLVH 2Q6WA 4EDXA 2ADJA 1SYSB 4ZOCA 1F3DH 2OL3B 3DBXA 2RAMA 4N90E 3QAZC 5JXAH 1T6VN 2RQ8A 2BJMH 5IVXB 2HH0L 5GRZA 5F93C 2EH8H 5CJOL 5L2KB 4YDIL 4QRRD 4YDLB 3TVMC 4WEBH 3BWAB 2FJFB 5C3LD 1C8PA 1QUNA 4YHLH 1EJ6A 4G8FA 4GW1B 1VB9A 4OB5H 3D48R 2JK5A 3WIFB 1FRGL 4G6MH 4FG6C 3FT2B 3WO4C 1X5HA 2ZJSH 3PNWB 4MSWB 1OP9A 3MRIB 4OZGB 4MB3A 3O6MH 5AZ2L 3UXFA 3ZKND 5GJSH 4ZQKA 4L3AA 1XCQA 2HFTA 3QCVL 4LNVA 1S9VA 3L3DA 5CJBA 4ZO6A 1AY1H 1JPGA 3O45B 5D9SA 3K46A 3ULSB 3QUMH 1P2CA 4U33A 4FTVD 3KPLA 5HGAB 1H8OA 3M1BA 2VLRD 1JJUA 4GQ9H 4ZXBB 4FZ8L 4ETQA 2XY2A 3P73A 4R97B 1P1ZB 3HPJB 4Y5XA 2XICA 3ARFC 3EOYG 1U8IB 3H6JA 4XVJL 3O3EB 1A5FL 4I77L 1CWVA 4JFHE 5D7IE 3CH8A 1Q9WA 4WIQA 4DGYL 2QADC 5DUBB 3ZKXB 4I48A 4LQFH 2PUQT 1I9RL 2J6EA 1WK0A 1U8OA 4TNVK 1LO4L 1XGTB 3S35X 3UPCA 5D7IA 1HEZB 3P30L 4R4NC 4ONHA 4QEGA 4Y88A 3KYMB 3VWJA 5LQBL 5C0IA 3G04A 1U3HD 1X5FA 4MNHB 1KN2L 4JFZH 1T0NB 1IM9B 5BVJA 2X6MA 3SCMC 1EAPA 3B2VH 1G7PA 2UYLA 3ARGB 1GGCH 1C12B 1FVDB 3B83A 3QUXD 4E5XB 1FSKB 4R7DA 2YSSA 1PX3A 4RMQA 1CLOH 2OR9H 4O58L 3MCLL 3BQUA 1KIRB 1RJYB 1S7VA 3BDYH 2BRRL 1IZJA 3QQ3A 4JB9L 3MLSL 1W0WB 1IQWH 1JF6A 2DQUH 1MEXH 4XBPA 1UCBL 4UV4H 5FO8A 4I3GA 4KMLB 4HPOL 1HKLH 4UV7H 3OV6A 3ULUH 5ADPH 5EO1B 4N0CC 4A2MA 2Y07L 5H94B 3N0PB 1NUNB 3FN3A 3TCXA 3DETC 4BZ1H 1JUFB 3OKMA 4UUJB 1K5NA 4NN6B 4P9HH 3SKMB 3SKNB 3QSKB 4XP6L 1DBJH 4HPYH 5E6ID 2X1PA 3AS0A 4LU5H 4Z7WE 1FBIL 4D0CB 4RFOH 3UDWC 3LKSA 4MQSB 1KPUA 4GSDH 4IOSD 2HFFB 2AQ1A 4M8QB 4QRPE 1FG2B 1O7SA 4HS8H 1BX2B 1RJLB 2A1WL 5D7IF 5D70H 2V6HA 4Z7WA 3I75B 3OR6B 3ARBA 3FO9A 5E2WL 5F72S 3VDAA 1CG9B 5E99L 1YQ2A 3D0LA 3NZ8B 4KKBD 2WBKA 4XNXL 4TUKL 4QRPA 1SM3L 1AD0B 4NM4H 1CGSH 3MRKB 3PHQB 2EIZB 3RNQB 2OTWB 4UDUA 2D9CA 5C0BB 2VC2H 1BFSA 1PX4A 2GCYA 4JJHA 4CVZB 2X1XR 3BKMH 4OZIF 5D7LD 2UWEE 4EVNA 4DEPB 3KPMB 1BD2E 3O0RL 2RIKA 4FNLH 5B4MD 1UM6H 2FB4L 3PWPB 3QAZB 2DYPB 1U3HA 2A6DA 4HF5L 1KJMA 3NN8B 4JFED 3JTTA 2B1HL 2Z9TA 2YPVL 3TVMB 3C2SA 5DI8A 2HTLC 2UWEA 2X4PB 2QSVA 4OZFA 5EO0B 1BD2A 1DN2A 1U41A 3OPZL 2CH8A 1QG3A 2F8OA 1B0GA 2BVQB 4C4KO 4OGXH 3T08A 2C26A 4H5SB 2EE9A 5E95B 5KOVC 1ITCA 3WO4B 2UV3A 2Q86A 1BGXL 4HZLB 5FYJD 1NGQH 5C0RH 3NAAL 4GRWH 2DQHL 1GC1H 4X80L 3TO4D 2D0FA 1MOEA 4N0RA 1OP3H 5IESH 5JW4M 4KVNH 5D71L 3HRPA 3RL1B 2H32H 1KFAH 2ENSA 3TC9A 4KXZI 4N8CH 1NANH 3P0YL 2DMBA 3U83A 3DUSB 3TIDA 5J1SC 2EEAA 3RZCD 1Y6MR 2CKNA 4HW6A 3ARFB 3CGTA 3RPKA 2DI8A 3TYFB 4Z7WF 3IFNL 5HD8C 3EW3B 4GXUN 1GVIA 4Q6YA 4Y4FD 1JWMA 1MJ8H 5A3IC 4EIZC 2QADB 4ZFGH 2CJUL 1X4ZA 1NGWB 4I4WA 2PW1B 5DC9B 3H9SB 1RV6X 4BSWB 3NCMA 2NYYC 3LQZB 4WW1B 1REIA 2J8HA 4EDWL 2ADGA 2QSCH 4WFGD 4JPWH 3S36H 5HTSA 2DQJL 3SJVD 3ZLQC 3QIBC 5SWSE 3VXPB 4KKLD 4JGUA 1U8JA 1MCCA 3MGAA 3OQ3B 3VH8G 4POYA 5KSBB 4NQVA 4EBQH 3N1PC 1E4WH 3GMPA 4AQOA 5GS2H 1P4LB 3TBYB 4ZPVB 5GGVY 3BW9B 1BZ9B 3CK0H 3SDXE 1XF3A 5B22A 2HN7B 3WFEH 3QDGD 3SCMB 1BPVA 1E6JH 4LDEB 2UWEF 4WRLA 2AEQH 4JDVA 4WI9A 5SWSA 1CZ8L 1MELA 1MQKL 3WNOA 1TENA 1AE6H 2E27L 5IW1B 4YEFA 2P48B 3KPOA 3ABZA 1MFBL 5IMKB 5DJ6B 3SDXA 4LF3B 5C70A 5LGKA 4F7PB 2YXFA 4J3XA 3C5SA 4LRNL 1M7XA 3RIFF 2BY1A 1OAYL 4GQPH 2Z31A 1U8QB 1CTNA 1OAZH 1MRCL 3O2WH 5F1IA 1RUAL 4XP9L 4Z77B 1MAJA 1F11A 2FLRT 3REVA 5FA4B 5C0EA 4KVCL 1ZT7A 1FO0B 4XP5L 4CDHA 5A43C 2Z0BA 4H20L 2CIKA 2V2WA 3SOBH 5INCB 5EA0L 1KLUA 1KEMH 3F8UB 4PUBL 3C5ZD 2IQ9L 4JHWL 5C08B 2HKHL 4XXCA 4IIQA 4G5ZL 2DQCL 4EZMA 3FFDB 4Q2ZA 3DX8A 4I18A 4GRMA 2VXUL 4PV8B 3QFJB 3V6OC 3HUJF 1T04A 1J1XL 3QG6B 2R0LH 5F1NA 1LWRA 5ITFB 1JGDA 3WUWA 1EHXA 3ZL4L 5GRVL 3HAEH 5FECB 1FIGH 4UNVA 4NC1C 2GIYA 4ORZC 4OD1H 4ZODA 3MLTA 3ULVD 1EEZA 1YMHA 1I3GL 4ZOEA 4FQXC 3H7LA 4Y4FA 4P99A 3TCLA 1N6UA 1RI8A 5DYOA 5GGVH 4F7MB 1S5IH 4BQCA 1B4JH 3D3VE 3KPPA 2FEDC 2X4OA 3WJJC 1MVUA 3VXMD 3DOSA 3GMOA 4HDIA 5BMFL 5JNYB 1Z5LA 2XA3A 3CZFA 2BXYA 3QEGL 2Q8AH 2F58H 3U2SB 2YMXL 2AJXH 3SDXF 3D3VA 1AXTH 4EJ1C 2UY7A 1BIIB 3S37L 5I1JL 2PTTB 4PRHE 2HRPH 1WISA 4HIIB 3MV8E 3UTZB 3AXLB 4S1QL 1P9MC 3QI9D 2F53B 1BOYA 1U8MB 1N2RB 4PFEA 1OARH 1C1EL 4LFHD 4IMKA 5HI3D 5CD3A 4WNQB 2VKWA 3B5HA 3TJEL 3TNNA 4PRHA 1E6OH 3MA7B 4ZFFB 1O5DT 3MV8A 4OJFL 5C7XL 2D03L 3WD5H 1NKOA 4HWBH 5FIEA 4KUZL 2ATPA 2Y6SD 1CF8H 4U4BA 1FYTD 1UZ6F 4V1DD 5D1ZD 2NY4D 2GSGB 4ZFOL 2MQ3A 4WJ5A 4LCWD 5JIKA 4U1JB 5CSGA 1DEEA 4W68A 4X4XA 1J0YA 1FZOA 1KJ2L 1R5WB 2LVEA 5E1AA 4JO2H 3C5ZA 1YEGH 3WIHL 3EJZC 3WHE1 4ZNCD 1RK1A 3TBVA 2Z4QB 3UYRH 4LLYB 3CFEA 1KEGL 1KTLB 1XGRA 2V2XA 4K8RD 3HR6A 4NBYB 1FFPA 3CDGB 3DURA 2A6IA 5F88B 4JO4H 3WKMH 5LAXB 1AHWA 1ADQL 1W72B 5CKAA 5D5MB 2PN5A 3K2UL 1KG0A 3PL6C 2ZPKL 1AQKH 1FHGA 5CFHA 7FABH 2XZQL 3VXME 3QIBB 2VSCA 5E2UH 2A38A 4MXQD 3FFCD 5GS3A 5DEGB 5E8PB 1EO5A 1Q9OA 4X6BB 2BP3A 2BHZA 4GLRI 5TDPB 1HQ4B 5CSZA 2E9IA 3BPCB 3VXMA 5EO9A 3X3FH 1WFUA 3BHBA 1TNMA 1DBBH 3C6SA 2XACC 3FN9A 5AYUL 1HQRB 5E70A 1G7QB 4MJID 2M2DA 1KCRH 5DJXB 2P8LA 3IDUA 1IC4L 5IEKB 3DGGA 4LPUA 4XPAH 2R9HD 3CUPB 3U36B 3RIAF 3ARQA 5D8JL 2YD9A 3GSWB 3ZE0E 3Q0HA 4F33B 1LDPH 5D93C 3VXNA 4N0FA 1XH3B 3QI9A 3FT3A 1ZLUH 1S7QA 2X4RA 4FQQB 5IR1B 1S7UA 4U0QB 1DSFH 1J9CT 2A6KA 3GBMH 1MIMH 3FO1B 4J4PA 1FYTE 1MY5A 4G9DA 4XPFL 4H0HB 3QNYB 5DS8B 4GG6B 2DKSA 1T3FB 5DDHB 2GJZA 5C3TA 1UB6A 2GK2A 1KELL 3HLAA 4K3DH 3WDJA 3NCYS 3SGDH 3SDDD 3CXHJ 1DTUA 1INQA 3GIZL 3OZ9H 3SHSA 1G9NH 3FAWA 1AP2A 1FYTA 2HT3C 2Q8BL 4GKNB 1NAMB 2C4FT 4R8WL 4N68A 2VLKB 2JE8A 5DZOA 1KIQB 3MFFA 1YEDA 2AJYL 5DUPL 2NZ9C 1QR4A 3KJ6H 1IGMH 1QYGH 4EN3D 4FQXB 5HDQH 2VKXA 1CICC 4PJFE 2OTUA 2CDFA 3U30C 2P5WB 3BAEH 2QKIB 1CXLA 2XI9A 1WCQA 4PP1C 2YRZA 1R5VA 4F57H 5KZCD 3MLUH 2P8MB 3KDMA 1KLFA 3ZKMC 2ZUWA 2ITDA 4PY8J 4PJFA 3VFVB 5I30H 1UM4H 1JNNL 3WLBA 4PTUA 3W39B 3VXQA 2E9BA 1DEDA 3ZDXE 1JYNA 1MCLA 1UWGL 4HWUA 3VXRB 4KDVA 1CYGA 4H26B 2DI9A 5CEYB 3V52L 2DIAA 4KRMB 5ETUB 3ARUA 1T03L 4ZUWB 3GMLA 3HCVA 3DMMA 2HYMA 1ZSDB 2X7LB 4LLUA 4XCEB 2FBOJ 3ARTA 2WP3O 4S1SH 4JLRB 3UC0L 5EWIH 1ZVSB 2H9GB 1YMMB 2XTJB 5BZDB 4PBWD 2Q7NA 7CGTA 4OCRL 1YN7A 3LKQA 4OGZA 3EYFB 4L5FL 4MWFA 5F7HA 4PGZA 3UTQA 3LKOA 3GI8L 4WGVB 5E7FA 4JM2A 4NPYA 4G3YL 5ACZB 2O5YL 3OJDA 3C5JA 1WQVT 3BPNC 3IT8D 4LGRB 5E5MA 4MA1C 1B2WL 3HZKA 2HFEB 2AV7B 1WT5C 5ACMA 2ZP0T 1LO0H 2HT4D 5GRUL 2YA2A