3G5XB

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
b'DVQLQESGPSLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYISYSGNTRYNPSLKSRISITRDTSKNQFFLQLNSVTIEDTATYYCVTAGRGFPYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 806 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 216
sequence length 216
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xB01
1DBJL 4X8XA 4NO5B 4PREB 3EFDH 1YECL 1G84A 5IBUG 3DHMA 4JRYE 4JDZB 1WK0A 2WLZA 1ADQH 1C16B 1U8KB 4UTBH 3VXNB 2YZ8A 2OQJB 3LKOB 1X9QA 5A2FA 4KZDL 3C5ZB 5JUEH 4ZXBB 5DMKA 1FL5B 5FDYA 5F7KC 1AR1C 3WO3B 1BFVL 5IBTL 3TO4C 3GJEA 3IDXH 3LH2L 4RNRB 4BFIA 4Z8FH 2X89A 1SY6L 4QWWD 5E00A 3VH8G 1FZJA 1MHPL 3W2DH 3TA3C 4PRNB 4HF5L 1FNLA 4XP9H 1EFQA 1YEGL 3I6KA 1JHKH 5TH2B 5HDOA 2UYLB 3OKMA 4ZSOA 5C2UB 1JYWA 1XGTB 5F44A 1E27A 2GT9A 3VRLF 3O4LD 4X6CB 5EWIH 4XAWH 2ADJB 1FYTD 5E7FA 3FB6A 2VDOH 5HY9A 2VLKA 4TNWF 4PRID 1BD2B 1RIVH 3RWCB 4MB4A 4ZD3L 3TYGH 3CPLB 4NCDA 4JPVL 4X6BB 3IDNA 1AGFA 5IW1A 5MEQA 4PV9A 4ZQKB 3UPRA 4LCIH 3BKJL 4U3CA 3A6CL 3BZFA 4X6CE 4NZUH 4YBHA 5E8OA 3O4OB 3TGXA 4JQVA 2NY2B 5FM8A 3HI1B 1QSEA 5JW4Q 2XKSA 5B4MC 1B3JA 2BHYA 5ALCH 2FJFB 3JTSB 2KZ1B 2QSCH 1CT8B 4PJIA 4MAUL 1H8NA 1U8NA 1KENL 5F7DA 5D7KD 5HPOA 3LN4A 3CDCA 3H42L 3L7EA 3SDCA 1OGAE 1T2QH 5JIPA 4L8SA 4CW1B 1HILB 1RUKH 3PDDA 3BP5A 4OF8A 3KYNB 5C0FB 2BVQA 1A6ZA 3C5JB 4C56A 2YXMA 1OW0A 3CFBB 4NUGH 2AI0L 4M1DL 3PHSA 4WWKB 2C4FT 3MRDB 1MCCA 1ROWA 4IRZL 2EEDA 2ICEA 2J8UB 3OX8B 4ZPTA 3SKMB 4HK3J 3RL1A 5J6GA 5IM7B 4V1DD 1RZ8A 4BSWB 1XAUA 4R6UA 3TVMC 4UINL 3WO4C 1J1PL 1OAZH 4OZHA 5F3HA 3AU1A 4JGJA 4Y88A 3OKNB 4LEOA 4G9FA 4D0BB 4OAWB 4XP4L 4WHYG 5J11C 1OB1A 2F53B 1J05A 2VERN 3VGAB 1DE4A 5HHVH 3SQOL 2W0KA 1N6VA 5ICZA 4Y16A 1NAMB 2F19H 2NNAB 5DK2B 5TQ2H 4KAQH 1YDPB 1DQMH 2NY5L 2EC9T 4OM0H 5DMIH 4FQ2H 1JWSB 1UM5H 4EI5B 1EJOL 2HYMA 3VU2A 1HDMB 1A0QH 3MRJB 4IMKC 3FZUC 3I02A 5B39A 3KYKH 4QGTA 5GRXG 1E4XH 2HVKA 1SVCP 1EERB 3ARSA 1EV2E 1AO7B 2YPKB 5A2LH 2V2TB 2IG2L 4U33A 2M8XA 3DMMB 3ARGA 4JKPH 1MY7A 3RVVC 4LF3A 1BIIA 3B5TA 1TXKA 1A7OH 4F9PA 4MCYA 4M5YL 3LQAH 4XC1L 3MUY1 5LGJA 3NCBB 5D6DA 5FAAA 4GG6F 1A3LH 4W81A 1GC1H 3GBNL 1MF2H 2DD8L 3DJ9A 1EUUA 1YY8B 4LCCB 4YDLB 4HMDA 1MFAL 2HFFA 3U30C 1XCTA 1XIWA 4GRLB 5DJ0A 4U7MA 5I66A 3RBGA 4J3WA 3MRKB 2NMSA 4Y5VA 3RAJH 1RZFH 4KVNH 1QPPA 1KIQB 5MP6L 3JWDL 4XCFL 4XP6H 3QEQA 3QXAA 2P43B 1DVFA 2BOCA 4U1KA 4XXDB 2X4TA 5HGBA 2JTDA 3QDHA 1CS6A 1RZ7H 4NWTL 3MYJA 3MV9B 3MSPA 1UA6H 4EBQL 1CICA 4NRXB 5F9DC 3NFSH 5DO2D 1KXVC 4Z76B 4GH7B 1BM3H 3MLYH 2JE8A 4TUJB 3CCHB 3L3OB 4X80L 1M71A 4WNQB 1A6VH 3IXTA 4U1NA 2ICES 4PYHA 2MNUA 2WINB 3OJMB 1UVQB 1ZTXH 5E6ZA 5KZCB 4L4VE 1AXTL 4JFOA 1P4IH 1WC7A 1A6TB 1YQVH 2WNGA 4QRRA 2DLFH 2YMXL 3UJIH 3UYRL 3H7BA 2HKHL 3L3KA 4BSVA 1S7SA 4PPTA 5BMFH 2R0ZL 2E7MA 3OJ2C 2QQLL 1R24A 1M7DB 3WJJA 5DEFA 1Q9OA 1S9XB 3M45A 4CMMB 4P2RE 1LO0L 4P4RA 5IEKB 4X7SH 5MEOB 3TIEA 3WIHA 3RDTA 4I3GA 4YJZL 4FQPA 3WE6A 1F4XH 3QIUD 5L8KB 1NUDA 4M9PA 3VGBA 1KB5L 4OZFA 4X9BA 3BT2H 1IAOA 4Z5RA 4RA3A 1UH3A 3S36X 5FYLE 2OK0L 1OHQA 5ESQB 1ZT1B 4OQTA 1A6AB 5I75B 2BNQB 4X4YB 4QRPA 1MFNA 4JDVA 4ONGH 1CD1A 3MXVL 4YR6B 4KK5D 3EO9L 3LKNB 2B1AL 1BOYA 4R96A 3BDYH 3WEXA 3JWOL 1QSZA 1CDHA 4GMSL 4XI5D 3VH8B 2IPUK 3LDBB 3T65B 1ZXQA 1RU9H 4ZOBA 1ETZA 5IMKB 1MCWW 1QSFB 5DD0H 1UWGL 2VL4A 2AGJH 5D7LD 4YHOL 2H26B 5HGHA 3MV8E 4X5XB 3BW9A 2HN7B 4JN2A 3VXSD 3IETA 4NOFA 4J12A 3DECA 4U1JB 4JQXA 1CN4A 1GGIL 5ICYB 2G60H 4PRHD 4FN0A 3DSFL 3TPKA 5CFHA 1HNFA 1QSFE 3WL9A 1F42A 1FFQA 4NNXA 4N0CC 4WW2C 3U82B 1MFEL 1BOGB 3MMEB 1Y0LA 2R2HB 4HJGA 3KYMB 5CEZE 4K3GA 3RJDA 2CLVB 5FA3A 2BNRB 2X4RA 3QUXA 4M6NH 3QP3A 1HIML 2NX5D 1T5WB 3AXLB 3C2AL 2E5EA 1U41A 2JB5H 2BFVL 4XPAH 4N8VG 4JZJB 5KSVA 1QA9B 3HG1D 3SE4A 2YHGA 2N7BA 5FGCB 5CD3B 4PJAF 5EA0H 3V4VL 4LRIA 3X3FH 4MYWB 4CU6A 2A77L 1WF5A 3DXAA 5C1MB 5F7WC 2HT2C 4TTDC 4XWOC 5DWUH 5MEPA 2RQ8A 2G75A 3C9NB 3OHXB 3PWPA 1FORH 3EYVB 2BP3A 1ZS8A 2GSIA 3WFBL 1T2JA 2IQAB 2A1WL 1N5YL 5DJ8A 2Z9TA 3MFFA 4EDWL 1FO0H 3CH1A 4UNUA 1CQKA 2XN9D 3EO0B 4RAUB 4OI8A 4HWBA 4NDMB 4Z7NF 4LMQI 5EU4A 4R3SB 4CMHB 1A14L 5HI5C 1U58B 1ZE3C 4XCCL 1U8LA 3K1KC 4DTGH 1LE5A 3PGCA 4BZ2L 3AM8C 3O9WC 2ZOKA 1F6FB 3MLVL 3IVKA 4KZEH 5EUOF 3HNVL 4YBQC 3U83A 2R15A 4NP4L 2C7UB 4O2EB 5ERWA 2HRLA 5T5NF 3GMPB 2EKSA 3KPQB 4NKDB 4YXKL 3QWRA 4M61B 1OAKL 4S1RH 2DMKA 1EH9A 1S9VA 3LEYL 3MGAA 4NQCA 4XMKL 1MUJA 1R3HB 3D39A 4P2OA 3B2VL 2J6EH 2CIIB 5EORL 3L3HB 1SYVB 3QG6B 4ZFGH 5IP4A 3VXOB 1HINH 1RUQL 4PJDA 2P5WD 5IJKC 5BRZD 1EGJH 2ZOLA 1HXMA 3BPNC 1EFXA 1FFOB 3MO1A 1YMMA 1NMCB 3JV6A 3R0MA 1NCCL 3ARBD 4PJAE 3KNBA 1MCWM 2EC8A 2Z8SA 2CGRL 2NY0D 4G6MH 1ORSA 2NY6D 1K8IB 4X5WA 1S5HB 2CKNA 1FNFA 3T3MF 5IOPB 2IF7A 3QXDA 3VWJA 3VFGL 4WW2F 2OP4L 1CE1H 4OFDA 4AIZA 5F1OB 4XP1H 1II4E 3HCVA 3NGBC 2H41A 3EZJB 3A0OA 4LQFL 4ZAKB 5F7HA 3DVGA 2V7NB 5L88L 2HJFB 2OL3H 1IAIM 4RSVA 4HIIA 3GSWB 3FONA 1MRFL 1WBXA 1CGUA 4A2MA 1N0LA 2UWEF 3VJ6B 3PGDA 4XBPB 1JYXA 1NPUA 3QRFM 4OFIA 5ACLA 4JVWA 2YC1B 3RX8A 1K3ZA 3Q3GB 4P9ML 1F2XK 4JO1H 1CFTB 4Z7NE 4Q9BA 4ZPVA 2ZCLH 3ALPA 2FEEL 4ENEC 4U1MB 4KPHH 4OLUH 4U0RC 1KB9K 25C8L 4RAVB 4U6YB 4BZ1L 5C3LD 5FFLA 5EBWB 1N2RA 4GMTH 1DP0A 4ZUUB 5D96B 3MNZB 2F54D 3D85D 4P2QA 5E9DB 1GPOH 3UTPE 1I1FA 2J8HA 3G6AA 1S7XB 1MFBH 3KPRE 4OGYL 1KBGL 2H6PA 3QDGE 5DI8A 1JPFA 4G8EB 3RX7A 3FQRB 4KY1L 1BJ1H 5C0AD 4LFHG 5GGTH 3W5MA 3OKOA 5DA0B 1R3KA 3FO2B 5E9DE 3UTQA 3VI4F 2P48B 3LHPH 1QFUL 2GSGB 1NUFA 1FBIH 3VFMA 4KQ3L 3RUGB 1JF1B 4G8IA 3BPLB 1AY1L 2PCPB 2VUYA 2NY5C 1JHTB 3RFZC 4PS4L 1T04B 2YA1A 2ESVD 2Z31D 4G8GB 2OTPA 1CLYH 5ID0B 1J10A 1JPTL 3EYQC 5LG1A 1DLFL 3T3ME 2YWZA 2CK0H 1DLHA 3UJTL 5DRNB 1P7QA 3F7YA 4DQOL 3TBYA 5I71B 5FECA 1T3FA 3EHBD 1I7TA 3TBTA 2HG5A 1D9KC 3FO0L 4L8DA 2FLBT 4LLQA 4WUKH 2VDKH 2HTKC 5HYJB 4X7TB 5E2VH 5H37G 4OF5A 3HZKA 4PUBL 3S96A 1OLZA 1A9BB 4N5EC 5J06A 2GJ6A 4HGMA 3T09A 4GXVH 4WI9A 2UWEE 4E41D 4X0KB 2ZCHH 1D7FA 4D9QD 4JFDA 2X7LB 3FRPA 5GGSY 5CUSH 3VD7A 1HKFA 5LJYH 2FH8A 3HZMB 5HYJE 5EU6B 1NBZB 1DFBL 1JNLH 5F71A 5LGHH 1QR1B 5DJ2B 3K8MA 5CMAA 1A1MA 3PL6C 2DKMA 4YHLL 5DEZA 3JWDC 2BVYA 3U4EB 1RMFL 1RJZA 2DQGH 5JNYB 5JXED 4AK1A 1CF8L 1AI1H 5BS0E 3OKLB 4N8VB 3VI4E 5D2LF 4LPTA 4PTUB 1J88A 2VSCA 2A74B 3PWJA 4R0LA 2XA8H 3MROB 4PRDA 5E70A 1NFKA 1E4KA 4G9DA 3MRBA 3I75A 2Q3ZA 3LSOA 4Y1AA 5ISZB 1EEZB 4FQXB 4ZFOB 3O11A 2JCCF 2CRMA 3RGHA 4JHAL 3BWUC 1AJ7H 2C4XA 2WP3O 4CJ0A 3O4LA 4LIQL 4ACPA 1FYTA 2I26N 5C0IB 1GJIA 4NQSA 1CBVL 1FL3B 2DYPD 4ZNEE 1BZQK 1Q1JH 5IMMA 3QI9C 1MSPA 4YIQA 3O6FB 3K0WA 2I60H 4K2UL 4KRPD 1JGEA 2ZJSL 4N0FB 3Q6GL 3H3PL 5ISZE 2FO4B 3MRRA 3FMGL 1LVEA 1EXUA 3V0AC 3C5SB 1JGUH 5TFSL 2HA1A 3TCXA 4PJEA 1B0GB 3LKPA 2ED9A 3CDGA 4WI8A 4J3TA 1X5IA 1XCQA 1M05A 3NZHH 1HHGA 2YN5A 1QLFA 2WWMC 5D1QB 2LVEA 3VWKB 3DUSA 1T0MB 2O5XL 3QQ4B 3U0PB 3QWQB 4M9OA 3I9GH 2P5ED 4ERSH 3CK0H 4ZFFB 2GEEA 2KQNA 1MCFA 2W60B 4HEPG 5TDOA 3WN5C 4Q6IC 4MQ7A 3JWOC 5CGYC 1P4LB 4YPGA 4PB0L 3QAZC 4KV5F 1ZHKA 1R3IH 4MJIB 4V1DA 4IEFB 3ZMRA 4OJFH 5I73B 4QEGA 5D2LE 1W72B 1HWGB 5IWLC 1CGYA 1UCBH 4BYHA 1DUZB 5FYKL 1U95A 4PJHB 3RPIA 5F3BB 5I1JL 4LHQB 2AK4A 3HR5A 4F80A 4I0PD 3UBXI 3CFIC 3CXHK 5F9WB 1MWAH 3QH3A 4KJWC 4TOYH 4MJIE 2WBJC 3SDAD 5F9AC 3MFGB 4ZODA 2IADB 3U7YH 1OTTC 2JCCE 3U4AA 1B88A 2HVJB 4N0RA 5DSCB 4PLKC 1CLZH 3BKYH 1FH5H 4XVJL 4PBVC 1FN4A 3CU7A 5T1MA 5I8CA 5JDSA 1OF2A 2JIXA 2XY2A 4Q6YA 2OTWB 4NN7C 3S7GA 1S78D 3D69B 5HHOA 4XNZB 4S2SB 4RWYL 3T1FA 3MRIA 3D6GA 3V0VA 4OT1L 1GAFL 3KR3H 1T5XB 4UNTA 2Y5EA 3ULUL 4HUMB 2FECI 3WFCL 3GB7B 2YRPA 3MLPA 4XT1C 4KK8D 4JKWA 4JR9H 2ENYA 4PP2B 4W70A 3V2AR 2CIKB 2MOVA 2X4OB 4L4TD 2CXGA 5J3HC 3ECBB 3TNNB 2Z35B 5IMOB 1P1ZB 5J13B 1DQQA 2LU4A 4JY6B 1H8SA 3T4AA 2PNDA 2VLJD 3ARDB 2JJUA 4DUWA 2XQBL 3EGSB 43CAB 4LSQH 1X44A 2ICCA 4NC2B 4OZIB 5CJ5A 5EBLA 4N5UA 5D4QA 1K85A 3VMNA 2EDXA 4PJ5A 4BFBD 3WHE0 1C1EL 3F7VB 5EIVA 1TJGL 2GJZA 3NAAH 3BOVA 5SX5K 3GUTB 5JHLL 4XGZA 4JG1H 5ESAA 4KV5E 5DMGC 3REVB 1NGYA 1UG9A 3P0GB 1QHOA 5AZEH 5C0CD 1JUFA 4LVHB 5IB5A 4AIXA 2JJSA 3U9PH 2GAZA 1OQXA 3WHE1 2O26U 1QBBA 2EE9A 3PL6B 3RWFA 1FVEA 1UENA 2IQ9H 3F12B 4JLRA 1J1OL 4NZDA 2PYEB 1AIFB 3SN6N 3EJJX 2HP4A 3ZE2F 1TJIL 1MCPL 3CSGA 1RZGB 1OAYL 3SDDA 5TQ0H 3BH8A 5EO0A 1ND0B 4HC1L 3CFKB 3O3UN 5HVFB 3KG5A 4P46C 3RI5K 5C0EA 5I1EL 3MXWL 3CSBA 4XH2A 3CC5A 4WI6A 4JGUA 5JO5A 3DWTA 1YPZF 3ARFC 3P73B 1JFQH 4ZDHB 5CZVL 4K7FA 1E6JL 2BVPB 3H9SB 3LMJH 5FOBB 5CBAB 1KGCD 1WJ3A 4OM1L 4M7JL 3F6LA 2VDLL 4JO4H 5IROC 4FTVB 3FOLA 1A47A 5ESVA 5K9KB 3QIUA 3QJFA 5IHZA 4ODSL 1HOCA 1F6AB 1DBMH 1RIUL 3IDJB 5HVGB 1ZVHA 1MH5B 1U8IA 4NFDA 1D5MB 2YR3A 4HPOH 5FKPA 4ELMB 5EZJB 4Y5XC 1DQJA 2AERT 1MELA 4U1IB 1C5DB 5DR5H 3QDJB 3DV6B 1UWEL 1NBVL 3CD4A 2Q20A 2FNBA 1L0XA 1MJ8L 3HC4L 3KXFD 1XF5A 1DZBA 3UPCA 3D9AH 4X6FA 1OCWH 3V52H 4C54A 4ELME 4QCIB 3UPAA 3QQ9D 3QDJE 3I50H 4XPFL 5JLZB 2JLLA 3KDMB 5FHAH 4KJPD 1QR4A 5KN5B 1CIUA 1FGNH 1OAQL 4N68A 3KPOA 1N0XH 2A9NH 5F96L 1CR9H 3BRDA 4P57B 2PXYD 5D7LA 1BAFL 4G43A 4NQED 2VE6B 3FT2B 2X1WL 2OI9B 5BVPH 1NQBA 3EFFB 4YLQT 5I0DA 4PRHA 2VTFA 3ZE2E 5ADPH 4HH8A 4JCLA 1GGCH 4GO6B 4JPWL 5KSAB 4P5KB 4C83B 3WDIA 1D6EA 5HVHC 4HFUL 4N90E 3VRJA 1S8DB 4CN6A 5I1KL 1RURL 4RFOL 3BIBX 3BP7A 4S11A 2NX5A 3T08A 4CN1A 1WWWX 1YPZE 1K9TA 4XRCA 1KLGB 1R5VA 1QNZH 1XT5A 2NY4C 5ILTH 1VPOH 4DN4H 4YHYB 4G80B 5CD5D 2CRYA 3GKZA 4LARH 1MNUH 1IFHL 3DO3A 3UC0H 5T5FH 5C08D 3QEUB 5IB1A 1MIEH 4K8RH 4UU9B 5BZDB 1LEIB 2VIRB 5DVMA 1RK1A 1IC7H 4ZTOL 4PY7A 1WAAF 3I6LE 4LLUB 2AABH 3ZTJH 2HWZL 2NZIA 1LP9F 2H2SD 5F6IC 5HTSA 3MGOA 3B4NA 1G7MA 5CSZB 1RHHB 4DUXA 3VCLA 3TBVA 4F8TA 4BH7B 3O8XB 2BY0A 2CK2A 3V8CA 1VA9A 5A16A 1PQZB 3L5WA 1JNJA 1JV5A 4EUPG 3RJQB 2IWGA 3QB7C 4O00A 4MDJB 4H0IA 2IGFH 5BJTA 4FXLA 4G6KH 1JF5A 5IIEB 3L3GA 1LK2A 5DFVD 1HNGA 1NFDB 1V7ML 4O5LH 2AVGA 5D1ZA 2H3NB 4YDVA 1RZIB 1T6WA 3DOSA 3MRMB 5C6TH 3UTSA 3ZLQC 1WV7T 1NGWA 1I1CA 2ZG2A 3QSKB 4WU5A 5GZOC 3G6JF 3HUJF 2ZUQC 1NFDE 2MKWA 1MJJA 2E9WA 1MQKH 4BFEA 1WVZA 1YJDL 1XZ0A 3WUWA 3NFPA 1VEOA 4PGEA 2NXYC 3EYUL 3DIFB 4P5TD 4I4WA 5C07D 4PJ8C 4F7PA 4RMQA 4Y2DC 4MJ5B 4HUKB 5JHDA 1SMOA 3EYOA 4CVWA 3GO1H 3RQ3A 1Q9WB 1OP3H 2FBJL 5BRZA 1FIGL 4F7CA 1VGKA 4AG4H 5D72H 4K8RD 5IB2B 1ZLVH 1OARH 2IMMA 5D7SL 5IB4B 1E4WH 1YEFL 4FZEL 4MS8D 3VFOA 4WI2A 3BYTA 4YBLC 3B9VA 5LXGH 3VXME 2EIZA 1UH2A 4XCYB 1IC1A 1WAAE 3TH3T 1WBYB 4YPJA 4DZ8B 3RWJA 1T80A 4PGJA 4WWID 1LP9E 2H32B 3JVGC 2Z93A 2PO6C 4CADA 2MCPL 4YAQA 3MV7B 1I7UB 3NBNA 2AV7A 4LHUD 3VDCA 3O2WL 4OD2A 3DHJA 3MLUH 3PUCA 5DUPL 1FO0A 5ID1B 4ZUWA 4YGAB 3MX0A 4LHJB 1IM9D 4YK4B 1RUMH 3QQ3A 1QACA 5CIPB 2IBBA 3W0WE 3VDAA 1ZVSB 3GJFB 5I16B 3SO3C 1OP5K 1KLFA 2F54A 4I3SH 4JB9L 2ATPA 1A6WH 3QT2A 2XRAH 3KLAA 3U79A 5J9PA 3K81A 3BRFA 3GHEL 1VSCA 1W0VB 4JG0L 4Y4KB 4HH9A 1LEKA 4YX2H 4JFXA 4WCYL 2QHRH 2J6EA 4O9HL 2J3SA 3DUUB 2ARJB 5CHNB 4I3RH 4EQ3A 3DGGA 3MLTA 1D5IL 1PLGL 4PJ9B 3UTTE 4XXCC 2G5BB 4P99A 4JHBA 3ZKMC 1UJ3B 2NW3B 4LASL 2HFEB 4XPHL 5I1GL 1SEQH 2HFGH 3OG4B 2DQEH 3FT4B 1IM3B 2ESVA 3ZT7A 5I1HL 4X4MA 3V5KA 1N5AA 4KTDL 4J6RH 2GK2A 3C6LD 4PBWD 3VFPA 3FO1A 4YFDB 5EU3B 3PV6A 3WHXB 4CVUA 4PRPB 2OXHA 1XH3A 5FYJL 4HUUA 1OGTA 3DX7A 5FUCC 1HHJB 1BF8A 5JIIA 3ULUC 4OBRA 2ZSWA 4KH2A 1BX2B 5JORB 4OV5A 3N85L 3GSUB 5FB8A 1NLDH 1M6OB 4F2MB 1HHHA 3QHZL 4TSBH 1TCMA 3JV4B 3PF2A 3BZDA 4NO3A 4NJ9H 4WV1B 4PRPE 4E41A 3T0EA 3D18B 4XC3H 4HDIB 3V7MA 5H94A 4IHOB 1TLKA 4JM2D 3TYFA 1T21A 1YC7A 4UB0L 4GG8A 4F7TA 3DTXA 3PQYE 1JYNA 3V4UL 1R5WB 4QHUA 4AEHL 5IFJB 2VH5H 3QUZB 4HWNA 1CI5A 1A5FH 1AXSB 1F8TL 1RK0B 1PG7L 1DN0A 4HJJH 4XNQB 1IGFL 4OV6F 2F74A 3V5HA 1F58H 3SBWA 3HRZA 2V9QA 1V3MA 4PRIB 1IE5A 1EA9C 1WZKA 3E3QC 4NIKB 4QF1B 5JXEA 3O2DH 5GRZA 1HYSD 5BXFB 2DJ4A 1DBAL 4FABH 1JMZA 1K4DA 3T04D 2XG5A 3HAEA 1FL6A 3L95B 5C8JB 1C5BH 3HE6C 2J88H 3RWGB 1I1AC 3JUYA 3MA7B 1ITBB 4CDGC 2RFXA 1NMBH 2FJHA 3Q48A 2BZDA 3UBXA 3QNXA 3CLFL 3HHRB 3LEXA 3M07A 4D3CL 5D5MF 1KCUH 4EN3D 1T20B 2APWA 1T7ZA 5J1TC 5SV4A 4ZS6D 5EC2A 1JGDA 5IG7B 4R26L 1BFTA 1INQA 1NGZB 3OB0H 4TVPL 4I5BA 5DZOA 4U2ZA 4M5ZH 4OZGB 4YC2B 2BVOA 4JFPB 1I8IA 4QRTB 4NHUB 1XGRA 3HTLX 5DJXA 4DGIH 4Z7WF 1UXWA 5TJWK 3DRQA 5HPMA 1C5CL 1VEPA 3VD9A 1WITA 2W0LA 3WIHL 4YHKH 4QHMA 3U46A 2EEBA 4PJCA 4O58H 1Z0NA 3NABH 4HX1B 3AREA 4MD5A 2YPLA 4POZD 2CRZA 5GS3A 1BVLB 1CVRA 5E2UL 4RZCB 4LIQE 3HI5L 5F9JA 1YN7B 1PKQA 1U8OB 4YHPB 4J4PD 5CLTA 4JY5L 3UAJC 3V5DA 1YNLL 5HGAB 1TZHA 3HC0B 2P5EA 4GS7B 4ODHL 4OQTL 1YQ2A 3BKMH 1N64L 4YGVA 3BWAB 3W39B 4UDTA 2VDNL 1ZHBB 4HG4J 4ZS7H 5DYOA 1I7RA 3ULUF 2O5YH 3AY4C 3IU4H 3LKRA 5DZNA 3RI5F 2EE2A 3OAZK 3MLSH 4Z0BL 4F15C 5C09B 3D0VB 1JGLH 1G9MH 3IJHA 1GOGA 5KW9H 5LBSH 5E99H 4MGXA 1AD9B 3RNKB 4I0PA 1NLBL 4LSVH 1QO3B 4ZG1A 4DCQB 1FGVH 3V6OA 5JR1H 2DQDH 1KN4H 5LWYL 4LCWB 5FDWA 5AWNL 2E7HA 1EEQA 1ORQA 3BQUA 3GI8H 4KXZH 2DOCA 1MCLA 5D5ME 1JN6A 3SGJC 2B0SL 1X4YA 1IKFH 1BIHA 1IGIL 2C9AA 4WDIA 4N0UA 1F45A 2P8PB 4G7VL 3S3JA 3QDME 4MNGE 4U05A 5IVZB 5DC4B 1F2QA 4PJXA 2UY6A 4ZFZB 4PB9L 4KKBC 3KLHC 1JJUA 3TN0B 4IMLA 5FYKE 3TZVD 1IQDA 2G9HB 4Z7WE 5EU7C 4KU1A 1CLOH 4XPBH 5EOCL 3UYPA 1B2WH 4IRJC 1AKJB 4L4TA 5I19H 4DVRH 3QNZA 2FR4A 1MJ7H 4PLJD 4QTHA 3FQNB 4KDTA 4Y4FD 1HQ4B 3LVEA 2DN7A 4NN5B 1EO5A 3MBXH 3ZO0A 1MFCL 1MI5E 1MLBB 4EXPX 1KNOA 1T1ZB 1XF4B 2VR4A 4NRZB 2OR7A 1IAKA 1QRNB 2AJYH 4ODVL 3BP4B 3VXRD 4IRSD 1IGJB 1LO5B 1U8QA 2QADC 1YMHB 4BQ8A 3OKDB 5FUCE 5GJSL 1R3LB 1I8KB 2EXWC 3EZ8A 3P30L 4Y4HD 2VLLA 4XX1G 1H9VA 3BGFB 4R90L 3B9KC 1IILE 1GGBL 1QRNE 2YWYA 3HB3D 1K3IA 3TO2A 4EQ2A 2IANA 4Q2ZA 3EYFB 2IAMD 1BGXH 5I76B 2ZUWA 3QWOB 4LLWB 4HWBL 4ZYKA 1G6RA 4IS6A 3GMLB 4A2LA 1NSNH 5HHXL 1AD0B 5IVXF 4U0QB 2FX9L 3RKDD 1OTUD 1TJHH 4NBZB 5MERA 2FJGA 4OLVH 4PRBA 4WO4D 4LLYA 3MOBH 1F02I 1S7RA 4DOHE 5J1AA 2R56H 5C0BD 3IDGB 3W82A 4F58H 3I6GA 1H3PH 4HFWB 4R7DB 3Q0HA 2QSVA 4FFVD 2X1QA 4K9EL 2AEPL 3RVXD 1A3QA 2V7HB 1EO8L 5DURD 5FCUL 5E8PA 5FK9A 1NDMA 4U6HB 2GTWB 4RRPA 5DJDB 1CFSA 2NQCA 5F1NA 3P9LA 3CUPA 2EZ0C 3KWWB 3T0XA 1IJ9A 5CEYB 5F89B 2WIIB 3RVUC 3SE9H 4YDJA 2DQHH 2EDKA 1OQOA 3VXSB 3SDYH 5FEBA 4XNYL 4F7MA 3DNKA 3QFJA 2VABA 4EOWH 1FNEA 3AMKA 3T0WA 4N1HB 5DMYA 3IU3A 2QHLA 2A83B 3GMMA 5D93C 5IKCB 3SCMD 4WFEE 1R5IA 3SKNB 4JQVC 3BJ91 3BHBB 4X4XB 1SYSA 3GIZL 1ZLUK 5FUZL 3E0GA 4XCNA 1U8PB 1QYGH 3EJYD 5DJAA 2C1PA 5IVXB 3QUYD 5IQ7H 3BKCH 4P2CG 4UNVA 5EBGA 5KVGH 2WBWB 1MHHA 4DVBB 1PY9A 5C0DA 1YEHH 3IDMB 3SDCC 4OGAD 4C59B 4LSPL 1QPXA 4L8SC 3MCKA 5T33H 4KXZI 4JN1H 5DD6B 3DUHA 4LAQH 1Z5LA 3HG1B 1MCBA 4NKMA 3HZVA 4OF0A 5IVXE 5D7IA 1OW0C 3GSXB 3I3DA 1KJMA 4XVUD 1CU4H 4W6YB 3CH8A 1CFNB 2YD5A 1NANH 4F33B 1R3JB 2AJXH 5DD1L 4XZUA 3S5LA 4NZRL 2FB4H 1QQDA 2BXZA 2KDGA 2VWEC 1BQUA 2Y07L 2XZCL 2OM5A 3V6ZA 5FUOH 2V2WA 5GIRB 2R1XB 2FSEA 1A2YB 1W0YT 2ZNWA 3MJ9A 1I3VA 1BBJB 4MSWB 3IFOB 5DLML 4CBPA 35C8H 1H0DB 1M7IB 1UXSA 4FZ8H 4ZTPH 4XNXL 1VKXA 3GSNA 1RHFA 4Y16C 3U9UA 5JOPE 4GSDL 1BBDH 2XN9B 2YK1L 3TLRA 5B3NA 4JRYD 1MCHA 4GBXD 4Z95L 4G6FD 2XWBA 2NTFB 1REIA 4M7LH 1RUAH 1KUMA 2H2PC 3CVHA 1TQCB 1QVOA 3C60D 4PV8A 3BZ4B 4MA3B 4W6WB 1FC1A 4TPRL 2DJSA 3FQUA 2QQKL 3HE7A 4JFYA 1KPUB 2F58H 3ARGC 4JY4B 4UQ2A 4WUUA 4Y89A 4TSAH 1P69B 3EKCA 4F9PC 3PHOA 4ZXBD 1N3NA 1Q72L 3C6SB 1AP2A 3VGDA 4RFNC 1ZLWH 5E6ID 1TZGL 5D6DC 3GSRA 4RMTA 5EU7E 5EUOA 3TBWB 4QHLA 4R2GC 5IW6B 2VDML 5I1DA 4FQQB 3LS4L 1YNKH 3K1DA 4JJ5A 3A6BL 3QEGH 1YEDB 5EB9A 1QBAA 2CR3A 2ADGA 2DQCL 4H8WH 4NSKA 3MV01 1L4IA 2X70A 3DX6A 5BQ7A 5E8DL 2QADB 2D0HA 3GM8A 2BSSB 3L9RB 5D1XA 5BVJB 1V3KA 1EAPA 1XIWC 1ZLSH 4ODWA 2WW8A 1S7UA 4ODBD 2BC4B 3BVNA 3ARBB 2APBA 4Y5VC 3T2OA 2NY0B 3OGOE 2NY6B 3ABZA 4XPGL 3H6JA 4N8CH 2BCKB 2Y36H 3N1QC 4S1DD 2YSSA 4RGNB 3OAYH 5HHNA 1NJ9B 1U3HB 3FHQA 2VOTA 3MNWB 1WCBB 3VFTB 1T1YB 1DVFC 3QZWA 1BD2D 1G9NL 1FG2A 3ARXA 4P5TA 1LO3L 3PE9A 4HD9A 2MQ3A 2CD0A 4PJIF 3MRFB 3HMXH 1KELH 1BWMA 3HPJA 1CICC 5AYUH 4RGNE 3T1WA 1B0RB 1EJ6A 2NY2D 4PGZA 1OGAD 1CE6A 4NPYB 4PGBA 3MLRH 2AEQL 2ADFL 3P0VL 1TTUA 3RGVA 4WRLA 3BPCB 4YUEL 1N6QH 1EIBA 4OSUH 3WFDL 1D6VH 4WEBH 3QCTL 4M43H 3HLAA 3BEWB 2VN7A 4P5MB 1P9MA 5ITFB 1FV1A 4UQ3B 4D8PA 4HK0A 3E8UL 3OKKB 3QXTA 1CVSC 4HWEL 3GM0A 4JFEB 3C2SA 4G8FA 5AD0A 3VFWA 4NQDB 3WJJC 4N8PA 3S37H 4TUKL 2CUHA 3D25B 3EOAB 1BEYH 3TPUA 4ZSOB 3CMGA 4L9LB 3T2NL 3PWNA 3MR9B 4J3OC 4OZHF 5C0AB 4KUZH 4U6VH 2A9MH 2C3WA 4N9GA 4WU7A 1FZKA 3RDTC 4M3JA 5FGRA 2AJUH 1BF2A 1CGVA 2ICWJ 4P23B 4HAFA 4XX1E 4NQDE 4X9FA 2W0PA 3OKEA 4QTIH 3G04A 5TDNA 2V17L 4ZSOE 5IW1B 4ODXA 1AGFB 1FPTL 1KN2L 5E7BA 3P77B 5DRZA 3OXRB 2P44B 4OF6A 2MPAH 5C7XH 2FZ3B 5E8OB 2F53D 1QSEB 1T4KB 3ZSTA 5ELIA 2OMNA 4D0CA 2VAAB 4LGRB 4UTBL 2AKRA 1B0WA 4KQ4H 4KHTL 2E9JA 3GBML 4D0DA 4ONFH 2QV2A 2DAVA 3LN4B 3BN3B 5D70H 4CKVX 4EI5D 5FGSA 5GZNC 1RJCA 1N8ZA 1IGTB 4PR5B 1OWRM 1D5BA 5EH1A 1QSEE 4LOUD 2I25N 1KC5H 3IDXL 3QUMB 1NCNA 4FQLH 5GPRA 3V79C 4PJIE 2BSTB 2Y5TA 5GS2D 4Z6AT 1T6VN 3DROB 3OPZL 4C56B 1MIML 3OB8A 1IGYA 3T0BA 1GH7A 5IQ9B 4XP9L 5BOZG 2W0FB 4D2NA 2YUWA 2XNAB 2X4NB 4MAYC 5E56A 1T7WA 3E6FB 4TN9A 4DEPC 1I9JL 2EECA 5FYLH 3X13B 4ALAH 3RWEA 5KS9A 2R0KH 3MGTB 1G7JA 4C56E 4J2XA 5IJVA 4OZHB 3VG9B 5A2KH 4QRQB 1I1RA 5CEXA 2FATL 2XWTA 32C2B 3MACH 5FGBA 5K9QG 3MJ8A 1I9RH 1CTOA 3MNVA 2QKIA 1AGDB 3QUXC 4M8QB 3VXTA 1P7HL 2FRGP 4UV7L 2NZ9D 2EDBA 3SY0B 5C0JB 2DQUH 4Y16B 1YEIL 1U9KA 3W11D 1Q9LB 3CFDB 4OZHE 3PDOB 4UTAH 3SE4C 4HS6A 3NTCL 3O3BB 1KJ3H 4G6JH 2ZG3A 3OJDA 2IPKA 2I24N 2R2EA 3MBED 4LRIC 3UJJL 4K3JH 4A6YA 2Y9RT 2DDQL 5T1KB 1J11A 5JOFB 2C3HA 1RUKL 4L4VD 3D0LB 2OTUB 1NMAH 4M7LT 2FWOA 3CMOH 1RI8A 3X11B 4HGKC 4P3DA 2FLRT 2Q8BH 4NUGL 3CJJA 3ARPA 4N0YH 1OLLA 5CEZH 3QO1B 5CINH 5DEGA 5FO8B 1JHLH 4AL8H 5FA4B 1NGXA 4PP1D 2FD6H 5LGJB 2DYPB 3Q5YA 4P2RD 5KZCD 1G7PA 3GSVA 4OCSL 1JMXA 2D7TL 3AC0A 2ID5A 2YKLH 2HMID 3EOTL 1OAZL 3TA3D 5C0RH 4EVNB 2XT1B 1ZA6B 1XCTB 1ZSDB 1UB5A 4OUOA 1AQKH 2AJZA 2WUCH 5GGQH 3RU8H 1MRDH 2I9TA 2JELH 4ZO9A 4XWGL 5HHVL 1MREH 4S1QH 4KAQL 5KG9A 1MLCB 1KPVA 3GNMH 5DMIL 3QEQB 4M48H 4MCZA 3QXVA 2BOCB 1HQRB 2X4TB 4WFGD 4EN3A 4NJAH 4MD0B 5I9QB 2CKBH 1C08B 4YHML 3K4DA 3UX9B 1EAJA 5JPMB 4LEXH 1D3CA 2KUTA 3LD8C 2BNQD 2GCYB 2QBWA 5JW5B 1C7TA 1EHXA 5E4IA 1UYWL 3BRGC 3QEQE 5IT2L 5DD5H 2UZIL 3I85A 4K9EC 3GDBA 4R8WH 2VISA 3SDXB 4K23L 2ZPKL 5KTEH 4ISVB 3CVIH 1U3YA 1A7OL 3MV8D 3IS0X 5F21B 4MQXC 4UV4L 4O02L 3M1BA 2MCG1 4JAMA 4JFOB 4YDIL 2EIDA 1WC7B 2OZ4H 1O7SA 3D2UA 2AXFB 4BSVB 4PRAA 4ODTH 1QSFD 1YN6A 4GW1A 4WHYH 1CD0A 4NM8H 3LKSA 3SOBL 5LCVL 4QRUA 5EO9A 1P7KA 3SDAB 4QRRE 1GHFL 4NKQB 5E1AA 4NFBA 4HIHA 4TVPE 2C5DC 4X5LA 1K6QH 1RZFL 1FAIH 4KMTH 1DL7L 5T1LB 4UILL 3IF1A 5F1IB 5HYQA 3N9GH 4DJMA 1G7QA 3B5GA 5IHBA 3TVMD 4KMQA 3KPMA 4RGMB 5EU5A 4Z5RB 2QSTA 4PJGA 3O41A 1TVHB 5HHMB 4P49A 4XHQA 4K3EH 3PDGA 4FFYL 1F3DJ 3D3VA 3F7RA 4JDVB 1IAIL 3NFSL 1DQTA 4H20L 1U42A 1CD1B 3E6HB 3V4PH 3MLYL 4BK4A 2AXHA 1A6VL 5BZWB 5HHME 2CMRH 1KIUA 3QCUL 1RJYB 3NPSB 2A6KA 4KHXL 2VLJB 3HPLB 3TFKD 3FTGA 1B4JH 5DUMH 5LVEA 2W9EL 3UJIL 2OCFD 4Z7VB 1PZUB 2EDLA 1Z0MA 2EDQA 4OIIH 5BMFL 5HBBA 3TJHD 1BHGA 1E6OH 1ZHLB 4JN2B 5SWZB 15C8H 2OJEA 4NKIL 4X6DA 2DM7A 1ZGLM 1J0YA 4RBPK 2GUOB 1MCIA 1YUHA 3B6SA 4G42B 1FIEA 1KJ2H 2O5ZH 4KVCL 3THMH 4IDJL 4H1LA 3HS0A 1M7XA 1GIGL 2BNUA 5SWZE 1H5BA 1Y0LB 3BT2L 4RISH 3WBDA 2B8OT 3J7HA 1MFDH 1AFVH 1X5ZA 2BJML 1MWAB 2X4RB 3PNWA 4QXTA 4Y4FA 3FT3A 3V6FB 2AK1H 4KJYB 4KI5C 3MRLA 4PGDA 4UT7H 3P4MB 3MJ7A 5F7NC 1WIUA 5L0QC 4HPYL 2GTZA 3VXRA 4ONGL 1A1OB 4IRSA 2R4SL 4XVSL 3MUZ1 3RA7H 5C2BH 3L3DB 3S4SA 2R69L 3WFHB 1CDBA 4PJDF 1T7XA 3QA3B 4EZMA 3Q6FA 4IIQB 1KTLA 1J5OL 1BVKA 4DAGL 4MD4A 2IBZY 2SEBB 5DD0L 1I85A 3OF6D 4FQJL 3GBLA 1PKOA 1IEAA 2HT3C 3RTQB 4DZBB 1PYWA 2YD9A 4JO3L 3KPNB 5GGVY 4MLSA 1U8HA 3SE8H 2XTJB 5GXBB 3DXAE 3BO8B 3RNQB 3F58H 3VFVA 4NKOA 1INDH 4XMPL 1I9IH 2YEZA 5L8LB 4OLYH 3WFZA 4L8CA 3MFFB 3O0RH 3FQWA 3PWPE 5MI0C 1G9NC 1EHLH 4M6NL 1NCWL 5HDQH 1MRCH 3LN9A 2C4FU 3KXFB 4O2CB 3ZHDA 5LQBL 5IEHB 1U8LB 4DGVH 2NY1B 4PJ7A 4QWWC 4BFGA 2JB5L 2C3XA 4R0LC 4HMEA 4ZAKD 5H35A 2VQTA 1IBGH 3CZFA 1E4KC 1L6ZA 2H1PL 3DURA 3GSQA 5EDXA 5TE7L 3G5ZB 5DRXB 5DQDH 1A8JH 1WCQA 2EKSB 1KACB 1VCAA 3AAZB 1G0YR 4LBEB 1K4CB 3TNMA 1DBKL 1QLRA 2PXYB 2OX5A 3O2VH 5DQJB 3UTPD 1E28B 4NQEB 5I8OH 4MJ6A 1T1XB 4P2OB 4JFFA 2G2RA 5D2NB 1HHKA 4Y19A 2NXZB 4NN6B 4LSUH 1KF9B 2VJXA 2FGWH 2V5YA 2DBLL 5DWUL 2EC9U 2Q7YA 5DHVH 3L5XH 4P3WA 2VQ1A 1EFXB 5E9DD 2CO7B 3MO1B 4NQCE 4CJ1A 3U6RB 1ZWIB 1R0AH 4IOIB 4ONHB 3D39E 4WY7H 5IV2A 5KSBB 4MX7A 3BZEA 2HKFH 3R1GL 3T77B 3G6DH 5GGUB 3QUYA 2HLAA 3STLB 3VWJB 1FO0L 3KPPA 1LK3H 1YMME 1G7LA 3MUHL 1ZEAL 4JFHE 1T7YA 2AQ2A 4AIZB 5J57B 5C08B 2CJUL 3W9DA 4DTGL 5DHYA 3IAQA 4Z18A 1QTYT 1MHCA 4N0CD 3VMOA 2R0LH 4KI5F 3O3AA 3DBXB 1WBXB 3PJSA 3O3EB 1WEJL 4L3EB 2X5PA 3DETD 1ONQA 1Y6KR 4G8GD 4ESKA 2DM3A 4GKZA 3RWIB 3MRQB 4HUWB 1NC4B 5FKAA 3LH2H 5D71L 2X1PA 5DUBA 5FHBL 1I3GH 3BGAA 1SY6H 5BV7B 3MODH 4JM4L 1MHPH 2J6EL 1FE8H 3VG0L 4HF5H 1KJVB 2VR5A 4L3EE 2PYFA 4OKVB 3RIAK 3P11L 1QHPA 4P2QB 5HYJD 5E24E 1I1FB 3NOIA 2GITB 1CFQB 5SV3A 4LU5L 1K8DA 1AHWB 3TBSA 1JRHI 8FABA 4O51A 3IXAA 4K55A 4JJHA 2HT2D 5EZLA 4GBXA 1KCSL 4P2QE 3QRGL 3UTQB 2DRUA 4ZD3H 3MTRA 4JPVH 3UZEA 3H7LA 4JPKL 2B7DT 4FQHB 2N56A 5TE4L 5L2KA 3BKJH 2B39A 2I5YH 4G8IB 4XP1L 3C60A 1Y6MR 1XF3B 4LNRA 2R0WH 3EYSL 5BS0D 2MJWA 3ELAT 2X9XA 3VMPA 4MHHG 4JDZA 4PJBB 4BM7A 2NTSP 2OL3L 1C16A 1U8KA 3VXNA 2Q1EA 2X40A 2OQJA 3LKOA 1IZJA 3ZL4H 2DB8A 1KENH 4NWUH 5GGRA 1NEZB 3C5ZA 3H3KA 1L6XA 1FSKB 1FL5A 5C07B 3H42H 3TBYB 2EDEA 1U92B 4ZMAT 3DGCR 4PJBE 4RNRA 1AGCB 2L0DA 3TBTB 2JJWA 2HG5B 5GGRY 4L8DB 2GY7B 2ZCLL 1W72H 2MTPA 5GGSB 4PRNA 4M1DH 4J8RA 1HXYB 5TH2A 2UYLA 3HZKB 4KI5E 1VGEH 1GPOL 1BMGA 4NQTA 3S96B 5ISZD 2D9CA 1XGTA 4JFDB 5L7XH 2APVA 2P24B 1EZVY 1I3UA 1CTNA 1P5UA 4ZOAA 4PBXA 2EICA 2FO1A 5GGTL 5IHUL 4UINH 1J1PH 4PJEF 1ZT7B 1BD2A 3AS3A 3B3IA 3RWCA 5EC1A 3CPLA 3LHPL 4X6BA 4LPWA 2GJ6E 1PY4A 4WJ5B 1IEHA 4ZQKA 3P0YH 5CBEB 1FBIL 2JJSC 2AP2A 4JFDE 4LHUB 2D0FA 5CMAB 1A1MB 3L3IB 1DJSA 2FJFA 3JTSA 5HDLA 1CT8A 1NAKL 2Z8RA 3SDDC 5I2IA 3GSOB 1A7QH 3GMQB 1CLYL 2VDPL 1OAXH 3VWKD 4CW1A 1WT5A 3AS0A 1HILA 3SKOB 2MKLC 3KYNA 4PRDB 4R0LB 5DT1L 5C0FA 3C5JA 1OM3H 3CFBA 4MDIB 5F1SA 5DTFB 3LSOB 4Y1AB 4WWKA 4M5YH 2X9YA 1Q0XH 3MRDA 5B8CB 3IGAB 4GXVL 4HLJA 2J8UA 2ZCHL 3OX8A 3NIDF 3ME0A 3SKMA 3QIUC 3GBNH 5IMMB 4MJID 2DD8H 5L6YL 4BSWA 3P3YA 2R9HD 1JGEB 3BD5A 4ENED 3QJHB 4YE4L 4Y1AE 1KIRB 1MFAH 2LV4A 1JNNL 1NBQA 3MRRB 4MJ4A 3U1SH 1JNLL 4D0BA 3MREB 4OAWA 4Q9QH 4F3FB 4Z9KB 1EXUB 2F53A 2W91A 1NAMA 2NNAA 1A6UL 5DK2A 4KK5C 1YDPA 5MP6H 1SBSL 1M05B 3MRPB 1CL7I 4XCFH 5IBLD 1N59B 5FOJA 1JWSA 3C6LB 3IFPB 4EI5A 2DQGL 4NGHL 1HDMA 1AI1L 4PJEE 4L3CA 4EBQH 3QNYB 1BJ1J 2D7PA 2EH8L 1AO7A 2YPKA 5H37H 1KOAA 2WQRA 3LZFL 1IT9L 3DMMA 4X80H 3GMOB 3LV3B 2R2BB 2O61A 1J0KA 3RX5A 5CZKA 1EVTC 1KEML 5FM4A 1T1WB 2XWJB 5CSGA 3EYQD 1OTSC 4RCAA 1XF2A 4PJ8A 5DF0A 4X7EC 3LN5A 4JM2B 2XXMB 2HKHH 3SQBA 3ARDD 5JW4R 3VW3H 3IDYC 4AM0A 4CNIB 1YY8A 2R4RH 4LCCA 4F37K 2QQLH 3C87A 3NFNB 1G0XA 4APQB 2HTKD 1F13A 1LO0H 4GRLA 1MCEA 4R7NB 3QH3B 4QT5B 5E95B 1JGUL 4V1DE 2BY2A 3MRKA 4LFHD 3MJ6A 3HZYB 4NM4L 2K3TA 4JFQB 1KIQA 1V7NH 3O6ML 4GAJL 1KB5H 1RAMA 2D31B 2AK4E 3NZHL 5JDSB 4GRMB 3MOAL 2JIXB 4XXDA 1BQLL 5IR1B 4JVPA 1OWWA 2OK0H 1ZGLA 4NQUA 5HD8D 3N1MC 1YYMH 1UEYA 4XBEL 3MV9A 2RBLA 2B4CL 3PL6D 3ILQC 2VXTL 3OTTA 5E94B 4NRXA 4B41A 4Z76A 1KEGH 5E5UB 2PYED 3EO9H 3IKCB 4TUJA 5GGVH 3VXUA 3CCHA 3L3OA 2B1AH 4WNQA 3DV4B 4M93C 5IVOA 3UTOA 3JWOH 2AJSL 4HCRA 4Q9CA 5HHOE 5DK0B 3RVWD 1DQQB 4OB5H 3Q1SL 3T4AB 5AZ2L 1A6TA 2Y1VA 5T3ZE 2UVFA 3VGHA 1UWGH 4YHOH 2YD8A 5D1ZC 5EBLB 1M7DA 3RIFF 1S9XA 2MQ0A 4CMMA 1S9WB 1GGIH 3CX5J 1NUNB 2Z92B 2B20A 4QY8B 1J0ZA 4M7ZC 4KKNA 3DSFH 5MEOA 1G6RL 2VQUA 4X7DC 4EIGB 3D48R 1MFEH 3KLSA 3WD5L 2Y06H 5DFTA 4KK9C 4PJ5E 3E2HC 2VL5B 2IPTH 1M1SA 1HIMH 5IB5B 4LVOB 2GQHA 5ESQA 4UIMB 1ZT1A 3RPKA 1A6AA 3QDJD 4YEFA 3RWFB 2BNQA 4CN4A 3QO0B 4Z7QE 4OTXL 4X4YA 1ZKAA 1A4JB 2M2DA 3GHBL 2YA2A 4YR6A 3LKNA 4WEMB 1RULL 3BPOB 3SJVB 3BH8B 4ORGB 3WLBB 3FB5B 5JOEA 3V4VH 2RHEA 3VH8A 4HZLB 3LS5L 5C0EB 4U3XA 1H3GA 3T65A 4BH8B 5IMKA 3CC5B 2X42A 1JE6A 1VFBB 4HHAB 1QSFA 2XPGA 3VFUB 5JO5B 5KVFH 1QEWB 2H26A 3BEVB 4X5XA 3SJVE 2HN7A 4N90D 4U1JA 1J8KA 5CGYD 4PJFB 3FOLB 4U1GB 4JVUA 4TNVK 4PYGA 5ESVB 3H9YA 2B5IB 2XACC 3NAAL 2CUIA 3QJFB 5KSAD 3WFBH 2IALA 3WLWC 4JG1L 3O81A 2NW2B 2V2XB 2A1WH 1N5YH 3MMEA 2R2HA 3KYMA 4NC1C 2F8XC 2CLVA 4Y5YB 5AZEL 1DQJB 2BNRA 4JANB 4ELKB 4PJFE 4OLXH 3U9PL 2Z8WC 3AXLA 1A14H 1JZ7A 4KROC 4XCCH 4L9DA 2WBJD 3TZVB 2EYSB 4QOKB 3I6LD 4BZ2H 3U7AA 4JZJA 4PLKD 3MLVH 3FQXB 3DI3B 3ZDZF 3ZKXB 3INUL 2KKQA 4NP4H 5CD3A 1D5ZB 1OAKH 3KPOB 3LEYH 1QFWI 5A40E 4OUUB 3TT3H 4XMKH 4M1GL 2X09A 2J1KA 2VC2L 3B2VH 5EORH 1U93A 1T83C 1RUQH 4GUPB 3LMJL 3W9EA 4I77L 2EYTA 3C9NA 3OHXA 2ERJC 4E0RB 1P4BL 4JO4L 3EYVA 3MJ9L 5BOPA 5I18H 2AQ3A 1IGCL 1NCCH 5D7LE 4UUJA 4PG9B 3BIAX 2CGRH 1DBML 3GSNL 5KVDL 3PWUB 2IQAA 2P8MB 2Z31C 2YOCA 3VFGH 4LMQE 3EO0A 4HPOL 4RAUA 1JK8B 4JRWA 2Q86B 4P59L 3BUTA 1R5VB 2DICA 4LCYB 4R3SA 2ITDB 1U58A 2XXCB 3EHBC 3CVHL 3QIBB 1BVZA 5D7JB 4WO4B 3GJFH 1MRFH 4XPTL 3FRUB 3WXVL 2AJVL 3HAEG 3GIVA 5GRYA 4O2EA 2E27H 4P4KB 3I50L 5C0BB 5FHAL 5EO1A 3GMPA 4P9MH 5I74B 4NKDA 1CG9B 3BI9X 3ISWA 4X99B 3DARA 1DN2A 1WWBX 1N0XL 2A9NL 2RGSA 1R3HA 3MGOB 1G7MB 2CIIA 1IARB 3VXMD 3L3HA 4Z7OF 3VXOA 2LTQC 1G7IB 4O4YL 1Q9KB 1FLRL 1FFOA 5F7MC 3ZDZE 3QIWB 1KBGH 4YQXH 5CS7A 5ADPL 3DX9B 1DEEB 2GW5A 1W2KT 1LK2B 1GYAA 3SBWC 4J7RA 5D1ZB 1K8IA 2BX5A 4U7KA 3ARFD 3TH2T 5CZXC 3QFDB 1KLUB 3SPVB 4TYUA 4XB7A 3U4BH 3UTSB 5JXEC 4GKSB 1H3VA 5E2WL 3SCMB 3WSQL 1QNZL 4PTTB 1VPOL 5IMLB 5B38G 1AY1H 3SGJA 1QBLL 2VXQL 3SGEH 3OJVC 4ZAKA 5TE6L 2V7NA 4KKAD 3UC0L 3GSWA 2XKUA 3S8WA 3UTSE 1XZ0B 4JGMA 3VJ6A 4XBPA 4K8RL 5AAWA 2YC1A 1DLFH 3Q3GA 3UJTH 3STZB 1C8PA 2FIRT 2AABL 3RVTC 4EDXB 3C08L 3ZDXF 1NCBH 2FGZA 4CGTA 4Z7UB 1V05A 5JHDB 3EYOB 4KRPC 4U1MA 3ROOB 1ZVYA 4U6YA 4F7CB 5EBWA 3SKJL 1VGKB 4ZUUA 3U0WH 2K7QA 1KCRL 2QLVB 4PUBH 1U91B 4UDUB 4U31A 4UT6L 4FNLL 1S7XA 2E8YA 4LRNL 3HFML 3ET9F 4FXKA 2EIZB 5I6XB 4G8EA 3FFDB 2HJLB 5JHDE 3WNMA 3KGRA 1EO7A 3FQRA 1TIUA 3UTTD 5IFHH 5BRZE 3GI9L 5M94B 2NR6C 3FO2A 2Y6SD 1XGPB 1FRGH 2GSGA 5C6TL 3EOBA 5C3TA 1A21A 4AJ0A 4PLNC 4Z7OE 3RUGA 2PW2A 1JF1A 4YAQB 1NCTA 3T0VA 3RZCB 4LPVA 3B9KA 2AV7B 1OY3B 4JQIL 1A7RL 4YHLH 4HIEB 1MCQA 1JHTA 4UAOB 1MQKL 1T04A 3G5YB 4JRYB 4YHZL 4G6FB 4U3HA 4G8GA 1RMFH 3DO7A 5E5MB 5F6HJ 1CF8H 5ID0A 4M7KL 2WSKA 1L7TH 2NY4D 4F9LC 4C4KO 4PRPD 4KFZC 1JPGA 2XQYK 1RPQA 2J5LB 4EUPH 3GO1L 5ANMA 1ZOXA 4TSCH 1A7NL 1X4XA 5HYJA 4X7TA 4I0PC 5D72L 1F97A 3V6OC 4X9IA 4JHAH 3PQYD 1E4WL 1PZ5B 5E6IB 4OLZH 1W0WB 4LIQH 4X0KA 2QQNL 2ZSVB 2FEDD 2X7LA 3MLXL 3BQUC 4RQQB 3O6LL 5HI3D 2VUOA 2F54E 5SWSB 4K2UH 4D9RE 3ZDXE 2ZJSH 2EE6A 3Q6GH 5I8KL 5EU6A 1NBZA 5H2BB 4LKCB 1S78C 3QUZD 1QR1A 5TFSH 3S3SA 1W8NA 3HRPA 5DJ2A 4WTXA 5INDB 5SWSE 3H9HB 3KYAA 4KK8C 4LLVA 3U4EA 3WXWL 3G5VB 5J6HB 2APXA 4MQTB 1OSZB 4MA1B 5JNYA 4XVTL 1CDUA 1KPRA 3OKLA 3PV6B 4N8VA 3KPLB 2B4CC 4KDTC 4HUUB 4HAGA 5GZOD 5A2JH 2DWDB 1OGAB 2ESVE 4A6YL 3BISA 5IF0B 4LSTL 1HZHH 2WUBL 4LVNB 4X4ME 4OV5B 3IYLW 4TTGA 5DD3L 1A6WL 3GZKA 2XRAL 1TPXB 4MXQC 5ISZA 1EEZA 2NXYD 4FQXA 4ZFOA 3T0EB 5J12B 5K33A 4GW5B 1OP3K 1VESA 5C0IA 1FL3A 2WWKT 3LRSB 1ZLVK 4Y2DD 4P3CH 1OP9A 3O6FA 5HI4D 4M03A 5FYKH 2UZYB 6FABL 4N0FA 4TUOA 3T4YB 5I1JH 1A02N 3RBSA 4E41E 4QHUB 3T0EE 4QHKJ 5JW4M 3FB7A 3T0AA 5FO9B 5KOVC 5L9DL 3WKNA 4PJCF 2DIAA 3BP6B 1IEBB 4L5FH 3C5SA 2YS4A 1OSPL 4JRXA 4JKLA 4K3DL 2QEJA 1B0GA 1NGQH 3IRZA 2BXYA 2F74B 1JI1A 3V5HB 5JQHC 4KK6D 2ARJQ 1SEQL 3GKWL 5DQ9B 4XVJH 5ALBH 1ES0A 2DQEL 1IKNA 1XGQB 3HRZB 4M6MH 1F3DH 7CGTA 2C3VA 3R8QA 1H3TA 4J6RL 5GJTL 5D1QA 1IVLA 2PO6D 1SVZA 4LLMB 4RWYH 4GXUN 1T0MA 5E6YA 4OT1H 1GAFH 1B6UA 3HAEB 5I30H 4K7PH 1SEBA 3HN3A 5ETUB 1FL6B 1S9YA 4NBYB 2VLRB 4M62L 4DN3H 2W60A 2RFXB 3VRLE 5KVEL 3UMTA 1H15B 1P4LA 4NJ9L 4OD3H 5EULV 4XC3L 2BOBB 3LIZL 2FX8H 2VLRE 1JGDB 2XQBH 5C09D 4MNQA 5EZIH 4LSDA 3VRIB 1DUZA 4PJHA 2CDGA 4I18B 1WFTA 5MENA 1C1EH 4LSRH 1JZ2A 5DRWA 1HSAB 4LCWD 4CAGA 1UXWB 5JHLH 3DRQB 2ATKB 2IADA 3VXPA 1HH6B 2HVJA 1YY9C 1F58L 5DSCA 4R4FH 3U46B 3NN8A 4PJXF 5CP3A 1Z9SA 3AREB 3C09B 5B38B 5SWQB 2OTWA 3UEZA 1S3KL 3UYOD 1PKQB 2FX7H 3D69A 3S35L 1KCVH 3KJ4C 2W07A 1T5XA 4PJCE 4DFHA 3IJYA 5ITBH 4YGVB 3TN0D 3GB7A 4KWUA 1MCPH 2PR4L 2YPLE 1NMBL 1OAYH 4PP2A 2PTVA 4JHWL 1JIBA 2GFBB 3FHAA 1AKJD 1PKQE 2CIKA 1XGYH 5GS1C 2X4OA 3P9MB 4HC1H 3ECBA 2Z35A 4JKKA 3MBEB 1P1ZA 4NO0B 1KCUL 3GK8H 5I1EH 3MXWH 4L4VB 3ARDA 4L1DA 1XGUB 4GAYB 2MWCA 4PFEA 4FFWD 5CZVH 4OZIA 4M5ZL 2NLJB 5I15L 2IH3B 2VXSL 1QRND 3AFLA 3O45B 4M7JH 2VDLH 4RAHA 1DANT 5T5NG 4LL9A 3F7VA 5LAXB 1NL0L 5AG8A 5EG6C 4P2RB 1DBBH 5CD5C 3V0WL 1HI6B 2OSLB 3X3GH 3TO4B 3MRNA 3GUTA 1IRAY 2R23B 3VE0B 1RIUH 4YHKL 4POYA 4GRWF 4O58L 2XKNB 3TA3B 3NABL 3V6OE 1CIDA 4GG6B 2LFGA 1JI2A 1J8HA 1UWEH 1DSFL 2JB6A 5BCAA 1FVDB 5IB3B 2HLFC 2H2SC 3F12A 1IMHC 3HC4H 4WTZG 1ZA3B 4H26B 3QZWG 5GRUH 2PYEA 2ED7A 3B5HA 4N0UE 4HLZH 3TESA 4YDKL 4GG6E 5DGQA 3HE7C 4HS8H 5GRVK 1RZKH 1ND0A 2O5YL 3CFKA 3IU4L 2FR4B 1OAQH 5IBUB 3MLSL 2EDYA 5F96H 3MLWL 4WGVB 3DYPA 1BAFH 2FHFA 4OIBA 5KW9L 3S37X 5E99L 3HE6D 4L4TE 3LEVL 3L5JA 3P73A 1I1AD 4KTEL 4ZDHA 5KANG 2BVPA 3H9SA 5CBAA 4LSVL 4BUHA 3MV8B 1U8QB 3ZTNL 5D1XC 3K8KA 4FTVA 4JPWH 3OB0K 5JXAL 5K9KA 3FFCB 4EJ1C 4HFUH 3HI6L 1F6AA 3OGCB 4DKFL 4G5ZL 4BA8A 1Q0YL 1R6VA 4X83A 4WFED 5I1KH 1RURH 1MH5A 3MRCB 4JCMA 3VFNB 4DGYL 3NVQA 3ARYA 1G7HA 3IDUA 1MVFA 4MXVF 4NNPL 1PD6A 5EZJA 4ELMA 1UACH 5DJ6B 1C5DA 5HHPB 4MAYA 2DIJA 2E7LA 1FNHA 4P5TC 1K5NA 4QGYA 3FFCE 2PW1B 3PIQA 2OR9L 2R29L 1IFHH 1E4XI 1S7VB 3B83A 2Q87A 1F3JA 4Y7MA 3EIFA 3TCLB 2AEIT 5MERB 3WNNA 3TVMB 4CVXB 2XFXB 2IANE 3WO4B 2RR3A 5EN2B 4QCIA 4K8RC 1KTDA 3RGVC 5JLZA 3KDMA 1S7RB 4MS8C 4GRWE 1WTLA 5E8EB 5KN5A 3WUZA 5J11B 1HCFX 2HWZH 5D7IF 1I3RB 1FNGB 2AV1B 3BN9C 4B5EA 1P9MC 3RWHA 5CLWA 2HT4C 4JZOB 2VE6A 4E9LA 4QXGL 3FT2A 2AJYL 3DYMA 3EFFA 5T3XE 2X4PB 1ERNA 1J1XL 3BESR 1D5XB 4JZNB 1S7TB 2CKBB 2X4QB 4P5KA 3P9LB 2VKWA 4TULH 5F1NB 2UZXB 3MUGB 3PP4L 2G5RA 4YDJB 3MCG1 2WQ8A 1FNSL 1QFOA 4I8DA 1IGMH 2WLYA 1S8DA 1KYOJ 4HGWA 5JOPD 2E7BA 5JW3H 1BGXL 1KLGA 5C92A 4DKEL 2VZTA 4FMKA 2H8PB 2YD7A 4G80A 3V6BR 3WJLA 4YHNB 3HNTL 1CGWA 1DUYB 2EXYD 3KS0H 4XTRC 2OS7A 4I48A 3QFJE 1SYSB 1TJHL 3QEUA 4E42B 2IFGA 2KL6A 1TDQA 4OLVL 3TP4A 3RKPA 4UU9A 1LEIA 4MA7H 3U30B 2VIRA 1QFHA 3MOBL 3R06A 4FRWA 4LLUA 4UBDD 3TV3H 5BW7A 4MXVE 1YEKL 3K3QA 2F5AL 3WS3A 4LVEA 4H88L 4F58L 5EOTB 1ZANH 5CSZA 1RHHA 2HJKB 1H3PL 4CL7A 3P4LA 1HEZB 1Z3GH 1F4YL 1L7IH 2KBGA 3IKKA 3O8XA 1UKSA 1OAUH 1PQZA 4MQSB 3ES6B 2LE9A 5D7SH 1GOFA 1YEFH 2CRIA 4DW2L 4HKXA 4MDJA 3D5OF 1PX4A 1ACYL 3JTTB 4K71C 5IIEA 5F93C 2Z8VC 4DKDC 1NFDA 5CSBA 4PJAB 3SDYL 2H3NA 1RZIA 4HUVA 3MRMA 2R1WB 3UCRA 4AEEA 3GMRB 1NCAH 1WZLA 2DLEA 2FSEB 5FGBC 3FB8B 2QADD 4XP5L 1VFUA 2MCPH 2PUQT 3CXDH 3O2WH 1UXSB 1QLEH 5EBMB 4LQ1A 5E08H 1BZ9A 1HH9A 3MRHA 4AEFA 5FO7B 5EZOL 2A6JA 4RGND 1U3HD 1QYGL 2I27N 1UJTA 3DIFA 5GQBA 1WIOA 4RMRA 4M02A 1KJ2B 1YEHL 5L2JA 3QUMH 1RIHH 4MA8L 1DDHB 2YXFA 4UQ2B 4WUUB 4LKXB 4JG0H 1MAJA 1UM6H 3L6FB 4XCYA 4WCYH 3KPRB 5EUOB 1WBYA 1H3XA 3QDGB 4X7FC 2FB4L 2YRLA 1Q8MA 4HXAH 4DZ8A 2J4WL 5I1DB 5CJ8A 4NSKB 4WUUE 4J1UA 2H32A 1D5IH 1PLGH 1HYSC 1G6VK 5FUOL 4JFED 2ZCKH 4OFVA 4NQDD 5CILL 4RMUA 3MV7A 5EFIA 1I9EA 1I7UA 5EUOE 4LASH 4XPHH 4LPCA 2K9UA 3BH9B 4OFYA 1MPAL 2EZ0D 2ADIB 1DTUA 3MZGB 4FZ8L 4ZTPL 1EHNA 4HWZB 3RVUD 5A1AA 2BRRH 5I1HH 4IOFC 3OSKA 5ID1A 4KTDH 4P23D 2DI8A 1QOKA 1U3ZA 3CLEL 2CXKA 2ZKHL 3QZWB 4EN3C 4UIKL 3CDFA 1RUAL 4FP8H 4NZJA 1KFAL 5CIPA 4NUJB 1N7ML 4WW2B 3G9VA 1RUPH 3GJFA 3N85H 3MUJA 5I16A 1QSED 4PGBB 1FJ1B 3QHZH 4Z77B 3RGVB 2F58L 3S34L 2VZ3A 4TSAL 1W0VA 4Y4KA 1EMTL 3U7WL 5LKNA 2ITCB 5CJXA 4RDQF 2UWEB 3SDCD 5E4EC 5IFAL 4D8PB 3DUUA 2ARJA 5CHNA 3Q5TA 4H8WL 5GSRB 1I4FA 4POZC 1G1YA 2YPVL 1B4RA 1LD9B 4G8FB 4C56D 1MCNA 3RY6A 5KS9F 4OF3A 4QKXB 2IPUG 1U8MB 1NBYB 1F8TH 4PJ9A 1IQWL 3TPUB 1PG7H 2G5BA 4DKAA 1FCCA 1UJ3A 2NW3A 3O6KL 2HFEA 5EUKB 1LNUA 3FT4A 5DS8B 5EIIA 5GS0H 1IM3A 3UO1L 5CJOH 2NY3C 3GGWB 1NAML 1EEYB 2D0GA 2Y36L 4IJ3C 3OKEB 2Q6WB 1OPGL 3WKML 2B1HL 5TDNB 5DHVB 1AR2A 5T1DH 5EIQA 5EU3A 3WHXA 1UT9A 4MLIA 4PRPA 5BS0B 3PG2A 5IHLB 3CSYB 1KELL 2J7LA 5AYUL 5JORA 4PD4J 1NC2B 1WZ1L 3GSUA 4Y16D 4L8BB 4KKLD 4F2MA 3CLFH 3JV4A 1SQ2N 4D3CH 4FQ1L 4OSUL 4WV1A 2W59A 3D18A 1D6VL 4GJTB 4HDIA 4IHOA 1JNHB 4R26H 3HNSL 2EDOA 3S36L 1GZPB 4TVPH 5T1KD 3O9WB 4OCWL 3S4SG 2LU7A 1MAKA 1R5WA 4XNMB 5IFJA 1T0NB 1ZLWK 1AXSA 1BEYL 1RK0A 2CUMA 5I1AB 4XNQA 1OOAA 3BXNB 4K71B 2AS5M 1C5CH 3WIHH 4NYLA 1G7JB 3FN0H 4PRIA 5TDPB 3JBG7 4Q97A 1H5BC 4QF1A 4LSSL 2A6IB 4OZFH 4U6XB 1F4WL 2XWTB 3BPNB 3NCMA 4TNWK 1IC5H 5BXFA 4PLJC 4JY5H 4Y4FC 5JPNB 5DJCB 1U3JA 3NACH 1S7WB 3HKFA 3OAYK 4ODHH 5EOQL 4OQTH 5KS9E 2MPAL 3L95A 4X9HA 5C8JA 2CR6A 2F5BL 2Z4QB 4RMVA 1UZ6F 3RWGA 5GS0D 2VDNH 5C0ND 3BYYA 4HV8B 4IRSC 4MB3A 4HS6B 4KQ4L 3QEQD 1DVFD 3SHSA 4Y4HC 1T20A 4HCRL 4Z0BH 4YXHL 1UKTA 2IPKB 4UT9L 3NGBB 12E8H 2YBRB 2VXVL 4K94L 4U1HB 5IG7A 3HB3C 1KC5L 3U2SB 1NGZA 1ADQA 2VSDA 4FQLL 4OZGA 5D2LB 4J3VA 1NLBH 4P3DB 3RHWK 2A6DB 1I85C 2IAMC 4JFPA 3L3JB 5LGKA 4QRTA 3OWEA 4NHUA 5DEGB 4HS3B 3CFCL 2JK5B 5E1HB 1FZMB 3RKDC 1EBAA 5IK3B 1IGIH 1OTUC 4QRRD 4GOSA 2R0KL 4MXWL 2JCCB 4Z78B 2LAAA 4U0RB 4HX1A 1QZ1A 4E5XA 1BVLA 1CZ8H 4RZCA 1MOEA 3MACL 1YN7A 1U8OA 4HKZB 1JWUB 3HC0A 1CFVH 4OCXL 1C12A 4PJGF 3RDTD 3BWAA 2B2XH 3W39A 5EOCH 1U2CA 2PF6A 1ZHBA 4QRSB 4FFVC 2DKUA 3AS1A 5T1LD 3S88L 1HSBB 1PEZA 3TIDB 3UROR 2FH6A 1KJ3L 5K59F 4G6AD 5C09A 2BY3A 3D0VA 4Q9RL 5HHMD 2VDQL 4MNHA 4QHNB 1AD9A 3RRQA 3RNKA 4ODVH 1QO3A 4NO2B 1UZ6E 4HBCL 3KJ6L 4DK3A 2MHAB 3HC3L 4F7EB 4LCWA 1F6LL 1JHLL 3QISA 4Q0XL 4AL8L 3M1BB 1NFIB 4R4BB 4R90H 3WCYA 1KIPA 1D9KB 3D2UB 2GK0B 2DTSA 4X6DF 2P8PA 1TVBB 3DI2B 2XI9A 4GW1B 3QUYC 2CH8A 5K9JL 4I9WE 1A1NA 5C0RL 4NQVA 5SWZD 4HWBH 5JIHA 4XHJD 4ZFZA 1AQKL 2WUCL 5HHXH 5GGQL 2FX9H 4ZOEA 1MRDL 3TN0A 5C9KA 2JELL 2NY3B 3K2UL 4MVBD 1MREL 5CJQL 1AKJA 4KUCD 2Q8AL 1P6FA 1CFBA 5DHXB 1OVZA 5DMJB 5EU5B 4M48L 4YFLI 5ENWB 5D8JL 1I1YB 4KDWA 3FQNA 1T03H 1MLBA 1T1ZA 3IB4A 1XF4A 4GW4B 1FDLL 4XBGB 4NRZA 5ICXB 1RQ5A 4PJGE 3BP4A 1EO8H 1IGJA 1LO5A 1TQBC 5FCUH 5I0ZA 5KTEL 1YMHA 3CVIL 3OKDA 1R3LA 1I8KA 2A6KB 1NKRA 1O0VA 5F7YC 3D3VE 1JZ5A 3QDAA 4F57L 5K59E 2VXUL 1ZMYA 2PTUA 3DRTB 4ODTL 1P5VA 2Z91B 4GBXC 3EYFA 2APTA 5TPWH 2OJEB 5I76A 3QWOA 4PIRF 3RTQD 1UZ8B 1MJUH 3GMLA 3C60C 1AD0A 1Q94A 4H5SB 5I1LB 3CDYA 4BSJA 2XTJD 3QI9B 4FQIL 3HS0B 5HYIA 3GIZH 2E6PA 1A4KB 5A3ID 1TZIB 1L9MA 4RIRA 2V5SA 1F90H 4PJ7F 1CD9B 3C5ZC 3PNWB 4ZXBC 5IGXH 5KOMC 5GSVA 4NRYA 1KT2B 3IDGA 5CP7A 4LLDB 3MJ7B 4HFWA 1KB5B 2GTZB 2IJ0C 2NY1D 4R7DA 5BV7H 4P48A 3FCTB 3SKUD 2V7HA 3EJZD 3ULVL 4U6HA 2GTWA 5DJDA 5GHWL 5F97E 4GQ9L 5DD1H 5ABDE 3S4SB 3KWWA 3JWNC 4S0TD 5F89A 4M6OH 2X4UA 1B4JL 4NZRH 1VHPA 5DUML 4MMXC 4GT7A 5GRJH 3VXRE 4S1DC 4NQCD 2WZPD 3PXJA 3VXSA 4OBSA 2Y07H 4P2OD 3WN5B 3QUKB 4OIIL 3I2CH 4KJQD 4Q6IB 2NXZD 4ETQB 1IL1B 4FG6D 1PYWB 3AVEA 1M4KA 1XF1A 2XY1A 1YPZB 2A83A 3QAZB 5IKCA 1EFXD 2P7TB 4XNXH 1YMMD 3NA9H 3O4OC 3SKNA 4JPIB 2NY2C 2O5ZL 4JFHD 3BHBA 4X4XA 3ZYZA 4QXWA 2YK1H 2WP3T 1U8PA 4YHIA 1E4JA 4RISL 4Z95H 3T8XB 3VWJD 1MFDL 4LK4A 1H8OA 2WBJB 4DVBA 1T22B 2AK1L 3IDMA 3F5WA 3H0TB 1WT5C 4LDOB 5DD6A 1JRHL 3UTZA 2ZWLT 5CCKL 3HG1A 5BO1L 4TPRH 3M8OL 2QQKH 5K9QI 3GSXA 4NN7B 3G5XA 4WWKC 1CFNA 1Q72H 1WBZB 1AGEB 4L3ED 4F33A 2FYYB 1MHEB 1R3JA 2D03L 4XCEB 1TZGH 3ORJA 4OLWL 2BSRB 4PJ7E 4K3HA 1NC4D 2VDMH 2DBJA 3A6BH 2DQCH 4H8WC 2DI7A 3ZKND 2EDWA 3AROA 5GIRA 2R1XA 3NH7L 1A2YA 1YZZA 4EXKA 1BBJA 4MSWA 4P2QD 3IFOA 4TQEL 1H0DA 1M7IA 2LQRA 1MAML 3SE8L 3QPXL 4JFFE 3VGAC 4XPGH 4Y19E 2AXGA 3IJSB 4N1EA 3F58L 1SM3L 1CDIA 1I9IL 1VFAB 2XN9A 4OLYL 3IAGC 2HLAB 3O0RL 3N06B 1G9NH 3BIKB 1EHLL 1LO3H 3SEPA 4EI5C 2M26A 4LOUC 3F7PC 3QHFH 4LGPB 1LEGA 3BZ4A 4MA3A 1SJEB 2MFNA 5GISL 1BFOB 2XG4A 2ADFH 3P0VH 4TRPH 3DMMC 2CO6B 4JY4A 4YUEH 3L7FB 1MVUB 3HMWH 1P84J 3WFDH 1FZOA 4M3KB 2C26A 4JDTL 4OGZA 4DFIA 4GKZB 3NCFB 3QCTH 2E8ZA 5F72S 3WNKA 5I1IH 3PGFH 4CUCA 1P7QD 3TBWA 4KI5D 3O2VL 3PWLB 5IW6A 3VXMB 2W9LA 4FQQA 3GMNB 1CK0H 1YEDA 2P5WA 4HWEH 4LSUL 4LCCC 4YDLC 1ZK9A 2BSSA 3L9RA 1LP9B 4TUKH 5BVJA 4GRLC 5I8EB 2BC4A 2IH1B 4P46B 3ARBA 2NZ9C 1TVDA 3W5NA 2BDNH 3C8KB 1AGBA 2GJ6D 2FBOJ 3MRGB 1X5JA 4OGXL 4WY7L 1VDGA 2IFFL 4JFDD 2BCKA 3ARFB 8FABB 3MA9L 4O51B 4AEIH 1NJ9A 1U3HA 2ZNXA 3MNWA 1I8LA 1T1YA 2V17H 1FPTH 3ZKSD 1LK3L 5J7CC 2HT3D 3B9EA 4X98B 1RJLB 2CDEB 5L2KB 2F8OA 4U1SB 2KPNA 1FCGA 3MRFA 4LNRB 1MCOL 2CPCA 3SE3A 1B0RA 1UADC 4NPYA 3W0WB 5I1CH 3G6JB 2R0LL 3OAUL 4GAFB 3BPCA 1LO2L 3HUJB 3B2UC 4Y5XB 5GGRB 5L2KE 4KHTH 3GBMH 4GKOA 3RL2B 2L7UA 4PP1C 4ZFOL 3X12A 5JZ7D 3LPGA 5F6HI 7FABL 3BEWA 3ULSA 4K94C 1J0JA 4P5MA 5ITFA 1EBPA 3UP1A 3QCVL 4UQ3A 1I3GL 2UVEA 3G6JE 1XR9B 2Y72A 2VAJA 3HUJE 3MODL 3OKKA 3OPZH 1CL7L 1MIMH 1FE8L 2HMIC 3D85A 3LKQB 2J8UF 4JFEA 4J8RB 4NQDA 2UUDH 2OJZL 2RCSH 2A0LC 3D25A 3EOAA 1I9JH 4Y1AD 4HUXB 4HK3N 4L9LA 3AB0C 3ROLA 3MR9A 3UTTB 5C0AA 2W65B 2CLRA 4NQXB 2V9TA 2EDDA 3S97C 3QEHA 1T83A 4P23A 2XZAH 4JO2H 2ICWB 1EGJA 2FATH 3B3IB 1VENA 5EC1B 4I2XA 3P77A 3OXRA 1FHGA 1UB6B 4U1LB 4UV7H 1U6AH 3QPQD 2I5YL 2IC2A 1F11A 5I75C 2FZ3A 3DYOA 1C7SA 3ILPB 2R0WL 5HVHB 1YEIH 1T4KA 3BGMB 2Z31A 1BD2E 5T3ZH 2VAAA 4YNYB 3HR6A 3ZL4L 1F4AA 3NTCH 4NWUL 5I2IB 3EDEA 1CWVA 3PWVA 2NY4B 4D94A 1IGTA 3UJJH 4PR5A 1S7QB 2DDQH 3LDBC 4XAKE 3QUMA 2OL3A 5C9JA 4FXGB 3I3EA 3RHWF 2ZZUT 2BSTA 3DROA 1W72L 3OR6B 3N1GC 5IQ9A 2W0FA 5ACMA 3PQYB 3OG6B 2XNAA 2X4NA 4NT6B 3VXQA 4NCC2 1VGEL 3E6FA 1VFMA 2YUXA 3X13A 1CDGA 5F6IB 4NZTH 4DK6A 3FKUS 5L7XL 3MGTA 4OCSH 2W9DL 2D7TH 1VERA 2FL5B 3EOTH 4QRQA 1KV3A 32C2A 4K07A 3TH4T 4APQD 1AGDA 2AK4D 1X5KA 4M8QA 3P0YL 2J8UE 1JPSL 2APFA 4QHKI 2D4FA 4OQ1A 3SY0A 5C0JA 1EZVX 4XWGH 2VDRH 5GGTA 5ECJE 1Q9LA 3CFDA 3OZ9L 3PDOA 4JZJC 5F7EL 5CWSB 2FCBA 2JIXD 4KDVA 1A7QL 3O3BA 4KKCD 3TFKC 2F53E 4L3CB 4YHMH 1OAXL 4QYOA 2ZUQB 2CSPA 3TJEL 5HHOD 5T1KA 3EUUA 1TETH 5JOFA 1UYWH 3D0LA 2OTUA 5B21A 1N6UA 4GAGL 5IT2H 3TJHC 4OCRL 2UZIH 1OM3L 3X11A 2O61B 4K23H 5T3ZD 2NXYB 5INCB 2ZPKH 1FVCB 4HLZG 3QO1A 1CXIA 5FO8A 1XR8B 1I8MB 1XF2B 4UV4H 4O02H 5FA4A 4RFEB 1Q0XL 4PJ8B 4YDIH 5M95B 2DYPA 2DQFB 2EIBA 3BJLA 1AO7E 3LN5B 4Y2DB 4D9LL 4HQQH 1PVHA 4EUPB 4RBPH 4AM0B 1FAKT 5IESL 4X8JB 4KRLB 3SOBH 5LCVH 4EVNA 1CXHA 1RZJL 1ZA6A 2EDNA 3U1SL 1ZSDA 1GHFH 3WIFB 4Q9QL 2QR0B 4PJ5D 4YBLB 3TWCL 1BQHG 4XNUL 4CMHC 3JSSA 1TNNA 3DX8B 2DWEB 5HJ3B 1DL7H 1X3DA 1TMCB 4HG4K 4UILH 1MLCA 1BP3B 4LPUA 4AENB 4AMKH 1HQRA 2PO6B 3EDKA 3SGKC 1ED3B 4MD0A 1ZGLB 4LLAA 1C08A 5JPMA 4FFYH 2GCYA 1IAIH 3ALWA 3AUVA 5JW5A 4H20H 3N50A 3VXUB 2DQJH 2MMXA 4OF7A 3SDXA 3I3BA 4MB5A 2DM4A 3ULVC 3A67L 4ISVA 5D6CB 3SDDD 3QCUH 3DVNA 3SJVD 3MV9E 4KHXH 1FFNB 3VA6A 4JHZA 3CFEB 4F9LA 1NMCC 4LNVA 4EEEA 2W9EH 1T89A 2A73B 3NCJL 3SO3B 2AXFA 3VXUE 3IDIB 5D5MB 2VZ1A 3VW3L 2R4RL 4OFPA 3V8OA 3FO9B 3PHQB 3QDMB 4MNGB 1MCRA 3SDAA 3RZWA 4NKIH 3AB0B 43C9B 4JEGB 1QFWL 2Y7QA 1S5IL 4KVCH 4IDJH 1GIGH 4P9HL 4ZAKC 3FL7A 5T1LA 5F1IA 1V7NL 5L8JB 5JIKA 4Z7WB 1RD6A 2BJMH 5JMOC 4NNYB 5FF6B 1TVHA 3RP1A 2NY7H 1YYML 1W8OA 5F88A 3IAPA 4HPYH 1MI5B 4QOKD 2CDFB 4WFGE 2BMKB 3E6HA 2R4SH 1KEGL 4HIXL 5C70A 5GGVL 1INEL 4XVSH 5BZWA 5D96C 1JL8A 3P4OB 4DWHA 2AQ1A 4ODUB 4I13B 1RJYA 2BNQE 2VLJA 3HPLA 3JV0A 2R69H 4MHHI 4OB5L 4YO0B 4Z7VA 1ZHNB 1J5OH 2XPGB 4DAGH 1QKZL 4FQJH 1ZHLA 2OLDA 5SWZA 2W1NA 4JO3H 3MJGX 1RSFA 4O2FA 4FOMA 3ULUE 4ZUSA 1OTSD 2GUOA 3P4NB 4G42A 3BPLC 1LDPH 2IALB 4XMPH 3L1OL 3JXAA 1V3LA 2Y06L 5C0CA 5K9OB 1VACA 3DETC 1J12A 1YEJL 1MWAA 2IPTL 3V6FA 1NCWH 1NGPH 4DOHB 4KJYA 1L0QA 2N7AA 2HTLD 4M4RA 5LQBH 1CDCA 1J0HA 5I71C 2C3GA 3P4MA 1LHZA 3KHOA 2CLZB 1YJDC 3QIBD 1A1OA 5D7JD 5TGBB 2H1PH 2BNRE 5TE7H 3ARRA 4MWFB 2RIKA 3MZTA 3L3DA 4OCYH 2ORBL 4P4KD 1DBKH 3WFHA 3QA3A 3ULVF 2AJ3B 3GFUA 3HE6B 4IIQA 3E3QE 3QG7L 3ILQD 1I1AB 1UQSB 3VDBA 3BE1L 1U93B 2SEBA 5KVFL 2DBLH 5FGCE 3RTQA 2JKXA 3W9EB 4DZBA 2EYTB 1GZQB 3KPNA 1A3RH 2VITB 4YFEA 3QIWD 4G7YH 2X4SB 2CQVA 5DJYB 3ZZ1A 3BO8A 4EI6B 4UUJB 2ZP0T 4KMLB 3RNQA 3R1GH 1Y18A 2H9GB 1IAII 2LU3A 2Y23A 4WTWA 4NHCH 5D1ZD 4K7PX 3WDHA 4OFKA 3UTSD 1ZEAH 4OLXL 3IRPX 2EH7H 1QSVA 1CCZA 2BVUA 3KXFA 4MMZC 4XB8A 4O2CA 3U48A 2DLIA 5IEHA 2CJUH 1KTKE 2DQIL 4ZUTB 2R1YB 2PTTA 3UDWC 4WW1B 3U36B 1WEJH 3GIVB 3G5ZA 5DRXA 4G3YH 4AH2B 4KK9D 3WDJA 3OQ3B 5AUMB 4M00A 5EO1B 4FQXC 5C71A 3AAZA 4FFZL 1K4CA 4LBEA 5KSUB 1CGSL 1YNTB 5D71H 1P2CB 2PXYA 5DQJA 1VADB 5FHBH 3WFEL 1E28A 1Z9OA 4NQEA 3TT3L 1BREA 1T1XA 1SJHA 4JM4H 5JQ6L 5D2NA 4GFTB 2AEWA 3VG0H 5B39G 3O6FC 1LWRA 4BK5A 5JHDD 1JVKA 1YEEL 5GS1A 3P11H 1AQDA 1IC4H 1F4HA 2P8LA 4OIAA 5DDHB 1FFPB 4OD1H 4LU5H 4R4ND 4F15B 1RVFL 3U6RA 1ZWIA 4IOIA 4ONHA 5I18L 1N4XH