3G5XB

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
DVQLQESGPSLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYISYSGNTRYNPSLKSRISITRDTSKNQFFLQLNSVTIEDTATYYCVTAGRGFPYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 806 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 216
sequence length 216
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xB01
5DSCB 4TUOB 4P5TB 5JHDE 2WINB 4OCYL 3O3BA 4S1DC 2VH5L 1VACA 4TRPL 1Q1JL 1OSPL 2EO1A 2VTFA 2BNQB 3CFEB 3IJYB 5D71L 1A9BB 5E2TH 4NKDB 3TYFA 1BP3B 3MJ7B 3RZCD 3ARYA 1GGCH 4GAYA 3O2WL 1BVLA 3LSOB 4OZGF 3VRJB 1MCQA 2XWJB 4NUGL 2AEPH 5ACLA 3QQ3A 5C0AD 3RPKA 3O4LD 3V4VL 2F19H 4X6EA 5KVGH 2GTZB 2ZSVB 4DEPC 1NANH 1YC7A 3U7YL 4O5LL 3CC5A 3IGAA 1PSKL 4U6YB 4XI5C 3GK8H 3RWEA 5L2KE 3HZMB 4DEPB 4OIAA 4AG4L 4ZS6D 5DK2A 3OKLA 5DWUH 4KI5D 5CMAA 4KKLC 1T03H 4HK0B 4X7EC 1S5HB 3NIFF 4XTRD 2VAAA 5FGCE 3IDIB 2AV7A 4F33A 4ZPVB 5A16A 4ZXBA 4ETYA 2F5AL 2AP2A 4J3OC 1FZMB 3IU4L 4I4WB 1IKFH 3VWKB 4NCC1 1R3HA 4E41D 3D39D 2GHWB 5T5FL 2XNAB 3FAWA 4J3UA 1ZLWK 5B38A 4KXZI 2R2HB 4LARH 3IU3B 4ZS7H 1MH5B 2VLLB 3VXQA 1JNLL 5I73C 4Z7UE 3OAYK 1CFVH 3Q48A 3W0WE 1LQSR 4I77L 5DJAA 4NQSA 3QB7C 3WUZA 2BHUA 1I9IL 5DYOB 2BSSB 3AS3A 1BM3H 3BJLA 3TO2B 2V9RA 2IH1B 2DQDL 1TZHA 3ARRA 4P99A 1YY8A 5DK3A 2CR3A 3TBWA 1FP5A 3F62A 3K80A 5ETUB 4RISH 3VI4F 3ZL4H 3U4BL 1FVEA 4XVSH 5E03A 5BMFH 1IKNA 4XBPB 5J6GB 1OM3L 5DQJA 3VXUB 4O02H 4KMQA 2E9JA 4AK1A 4PJ5A 5HI3D 2XN9D 4FXLA 4K94H 2BVOA 3B2UC 2X1PA 2EZ0C 1CN4A 5D7IB 3GMLA 5LGJA 1XR8A 1I9RH 1ZSDA 4LASL 1E6JL 1KELH 5B39G 1CGYA 2Q7YB 4KVCL 1MRFH 4CVXA 1FGNL 5KTEH 2QQQA 2K1MA 1J1OH 1D5MA 3NFNB 4ONHA 5C3TA 1MI5B 2F74A 2CLVA 4Y4KD 1CICD 1QD0A 5IMKA 1OY3B 1RZIB 4NNPL 3NN8B 2X4OA 4U7MA 2ICWA 1MWAA 3F7PC 3K0WA 5DGQA 4NZUH 5DQDH 1E28B 3HAEA 3ULVF 1UJTA 1P4IH 1LEGB 5GGVL 4YDVA 1VADA 3TLRA 4KZDL 3FQWA 3UX9B 3SCMC 4OFDA 4JO4H 1IGIL 1R3JB 3H42L 4JFOA 3KLAB 4LSUL 2FX9H 1UZ6F 3JBG7 2HYMA 4R90L 4U0RC 2HFFB 4APQD 3SCMB 1F3DJ 4J1UA 4XHJC 1LO4H 3C2AH 5GS2D 3MRQA 4X98A 3FMGL 4U0RB 1AXTL 3FN0H 4OZHF 3F58H 4K2UL 1P84K 3L1OL 2JELL 3MMEA 1FNSH 4J6RH 1KLGA 1LO0H 5L2JA 1ZHLA 5FO8B 3FQTA 3OR7B 6CGTA 3MC0A 1IGFL 1PY4A 1S9WB 3QHFL 3WDHA 1IC5H 2YPLD 1Z6JT 1CXEA 4IRSC 4LSPL 5BRZA 3MR9B 3CSBA 4NDMB 4FTVD 2ZJSH 4JDVB 3VGGA 1XGUA 2QKIA 3KR3L 4OF6A 4TTGA 3TBVB 3LN5A 4U4BA 5F6HI 1NAMA 3H3BC 1O5DT 2P5EA 3H0TA 5IVZA 2OTPA 4WVRA 1PZUB 2DTSA 4FZ8H 1KPUA 4WJ5B 3QPXH 1VFBA 3TPUA 5C0AE 2FD6L 3O4LE 1YJDC 1MCSA 3V7MA 4PJAB 3VXPB 5JLZB 1CK0L 2C3VA 1IQWH 1C12A 5LCVL 2Z92A 4PJ8D 4X99A 1NDMA 2EEAA 3VGHA 2DQCH 4U6TA 4X8XA 5M7QA 5HBBA 1A7OL 3DXAB 3GMRA 5EU5B 4P4KA 3WUWG 5HHPB 3MCLL 4GQ9L 2AEIT 3QIBC 4F7PA 2BRRL 3FO1B 4UUJA 2JJWA 4WW2B 3OGCA 4E41E 3D39E 3WLWD 3QIBB 4QRPE 4QHMA 3KYOB 2F5BL 5GZND 5DDHB 4FQLH 5BJTA 3SDXA 3VWJD 3TF7C 2Y36L 4JFZH 3STBA 4DWHA 3DGGB 2H2SD 4NUJA 3MV9D 1IQDB 1U6AH 2IFGA 2O5YH 3D18A 1G0DA 2Z8RA 1CR9L 2EYSB 3GJEA 3MLXL 4I2XB 1U95B 2CJUL 4KJWD 4YGVB 4NGHH 1EO7A 1HZHH 4MCYB 3V6BR 5TE7L 1BAFL 2GI7A 3RQ3A 2BNUB 4NHCH 1XZ0B 2BVQA 1CYGA 2C9AA 3MLTA 4JDZB 1ORQB 2IQ9H 3IKCA 2J3SA 4JFPA 2XKNA 1U91A 1MAKA 1RUAL 4Z7WB 2EDHA 3C8HA 3QQ9D 4MAYC 1IE5A 5CD3A 1T80A 5CSZB 1I3UA 3AREA 4NHUA 2R0ZL 1JZ5A 3I3EA 1TCRB 2JK5B 4KQ3L 4UOW0 1RU9L 5CIPB 4MAYB 4OKVB 4JY5L 3QZWG 5DEFB 3BSZL 4YX2H 4FFWC 3C6LA 2JE8A 1GAFL 3F8UB 4JFFA 5C8JB 3EYVB 4M1GL 5C0FB 1IAIM 1RIVH 1NBVH 2G2RA 3B5TA 4NOBA 3PJSB 5J57B 4FXKB 4IMLB 1A6TA 1G7QA 3KHOA 4ZPTA 4PJGB 5GGQH 2A74B 2DIAA 3MJGX 5DJYB 3SQOH 5E9DB 4G80A 4ODXB 4PRBA 3W9EB 3B9AA 1LDPL 2EH7H 4ZOCA 2E27H 4P59H 4MHHG 4NKMA 4PYGA 3D0VA 5IMMB 1L7IH 1BJMA 3FOLB 4BQCA 2VLME 1I3VA 2MMXA 1ROWA 4JDTH 5MEND 2JIXB 3CLFL 3RWHA 4WI5A 4Y5VC 1XFPA 2WWMC 5F21B 3LN4A 4YFLF 5H8DA 2O61A 5JNYB 1FNGB 4QWWC 4X6FB 2VITA 3UTQB 3GIVA 4Y5VB 4PRID 2FYYA 3WJLA 2N7BA 4JHAH 2O5ZL 4LOUD 5D72H 1KB9K 1ZLVH 5JOFB 5DJCB 2QSQA 3G6DH 5FA4A 1LHZA 4M9PA 1EEQA 4GAYB 4QF1B 4OQTA 2Q20A 1BVLB 3U30C 9CGTA 4QXUH 5L2KA 5DJ6A 4LSVH 4UMGA 5EU6A 1F45A 2YPLE 3JWOL 5D2LB 4X7SH 1OHQA 3U30B 4YEFA 4MAUL 3ZKMD 4XP1L 3L5WA 4OSUH 5SX4I 3HLAA 4XNYL 3IGAB 1F8TH 1M7IA 1N3NA 2CRYA 3H3PL 1BIHA 2Y7QB 3RWEB 1ERNA 2R23A 5I1HL 1DBBL 1S7XB 4LHUA 4N1CA 2Q1EA 5IQ7L 4PFEA 5DK2B 3OKLB 1ZVYA 5CMAB 4ZXBC 3O6KL 5FO9A 1WCQA 4C4KT 4KK8C 1YEFL 4F33B 1HKLH 3QDJB 4UT6L 1IGTA 4DN3L 3QUMA 2V5TA 1KFAH 1YC8A 4IOIA 4IOFD 5I1GL 1R3HB 2VXUH 2ESVE 3BPCA 3W81A 4Z7UA 3DIFB 4NBXB 4R3SA 5IBUG 3VI3E 4G6AC 4HUKB 2IAMD 5B38B 3W0WA 3RPIA 3JWDH 1SHMA 1QBLL 4PJ9D 1G7MA 5E8PA 5I9QB 1MPAL 1LNUB 4N8VG 1GSMA 1OP3H 3GNML 1RZ8A 3O6FA 4GXUM 1DQMH 1U8OB 3D0LA 3RVVD 3ARBD 1LE9B 1KUMA 1OAKL 2EICA 2YUZA 1J0ZA 2CGRH 2V6HA 2VMFA 3SDCD 1F97A 1I1AD 1QLRB 1AO7D 4LDLB 3OJDA 3W11D 4AYFA 4A2MA 4YHNA 4JLRA 4ODWA 1IKNC 3VFRB 1TZHB 1ACZA 1YY8B 3NGBB 3RX8A 4JM4H 3U36B 5KW9H 1I1FA 4RCAA 3BI9X 1PVHA 3UP1A 2M26A 5DQJB 5KVFL 4K23H 2GSGA 5DD3L 3U0WL 4MDJA 4LLUA 4OCSL 2W91A 3R8QA 1DE4A 4RX4D 2HFTA 1FQ9C 2JJSA 1DN0B 3INUL 4UIMA 3QDMB 3G9AB 1J88A 4OAWB 1F3JA 1KNOA 3MRCA 1Z5LB 5IJVA 4LNRB 2GK2A 4NWUL 2V2WA 4GBXC 4R8WH 4WFGE 1PAMA 5ACZA 5IWLA 5IMKB 1MFDL 3QIUD 5IUSA 3LRGA 3O45A 4GBXB 5INDB 3PIQA 1MWAB 5DUMH 5F7DA 2XTJE 1XCTB 3FONA 4WV1A 4YBQC 1QBAA 4NNYB 3FT3A 1CDUA 4YDVB 1MFEL 3FQWB 3KYKH 4U1KB 3EOTH 4U1SA 3Q6FB 3C6SA 2PW2A 2F58H 2XA8H 4YDKH 1LD9A 3LHPL 3NCYP 3QEQD 4IHOB 5CGTA 1FLRH 35C8L 4PJHA 4J1UB 5TF1H 4DUWA 4M48H 4X98B 5FHBH 2UVEA 1W72L 3G6JA 4XX1G 1F90H 4N0FA 4AQ1B 4DZBB 5F96H 4NO2B 3O3DB 3MMEB 4H8WH 5T1MA 4RGMB 4CVZB 5L2JB 4JGUA 3FQTB 1JPTL 5TQ0L 4YBLC 1KTRL 5CUSH 2R1YA 5DQ9A 3VRLE 3RWJB 5IP4A 3RZCA 3B83A 1KSRA 5F1OB 6FABL 4BUGA 5BRZB 3QRFM 1C1EH 1JPFA 4PJCF 4JPWH 1I8IA 4YBLB 2H26B 4CMMA 5C09D 1XGUB 5GHWH 5C0AA 3O4LA 2QKIB 4L9LB 1YEKH 2K7QA 4UV7L 5IVZB 2WUCL 2DQGL 4LIQE 3P0GB 4P2QD 3UPRB 1K4DB 1DQDH 5HDBE 4YUEL 3ARQA 1F4YL 3V6ZA 1BFOA 3V5KB 1DBML 4MCZA 3RHWK 2DD8H 1JTTA 1N4XH 3L3GA 3WCYA 1A0QH 4AIZA 3O6LL 5E6ID 2ZG1A 4FZEL 3EFDL 3C5SB 1HEZB 3PDOA 3BH8A 4E41A 2W0FA 1NDMB 3D39A 4XBGB 5DJXA 1XAUA 5F71A 1AR1D 5DJZB 5FYJU 3QIWD 5EZIL 3NA9L 4O51A 1UB6A 3HC4L 1YEIL 2Q76B 4EVNB 4D94A 3D5OF 1JMZA 3VXSD 1SEQL 5B3JE 5GXBB 3GRWL 5IQ9B 4D9QD 3IDYC 3LKRA 5D7JC 4PGDA 1IM9D 1EZVY 1UM5H 3CUPA 4QHMB 3FN3A 4PY7B 4MJ6A 3ULVH 1P69B 1SY6A 3WJJA 1MY7A 2BSTB 5HVWA 4OGAC 4C59B 4F7TA 5C6TH 3IDYB 5D7JB 4C54A 1M7XA 3FCTA 4FS0A 1Q94B 3S4SA 2DN7A 1A7RL 1NGXA 3PXHA 3D3VD 1OAZL 1X5IA 1FNFA 3BO8B 5KVDL 4R96A 3T0EE 5I8KH 4Y1AE 1WAAA 1RUPL 4RFNC 4Y0GA 2KQNA 1BVKA 3HE7D 4OZIE 2AEQL 3AUVA 4HPYH 1AO7E 1P84J 4XH2B 3IKCB 4RFNB 4ELMB 4BZ2H 1U91B 3AREC 4X7DC 3BT2L 2XN9A 4Y4HD 5E00B 1KG0B 4OIIL 1MFNA 1Q9LB 5AZ2L 1MJUL 4KJYA 3FB5A 1J0JA 1UENA 1Y6NR 3C6LC 4WO4C 5JDSA 5L7XL 3ZTJH 2NY4C 3L3JA 3QCVL 3QDHA 1J05A 2D7QA 4F58H 2AJYL 1UCBL 4JVWA 4WO4B 1EVUA 3BKMH 3TBTA 1IM3B 4Y4KA 1CICA 4AEHH 1NBZA 4BM7A 4H88L 2W07A 4FABH 4TVPD 1LMKA 3C9NA 4PD4K 5IGXL 1RAMA 4CADA 5FUOL 1A3RH 2W0LA 1A6TB 1ZK9A 1AR2A 2C3XA 2Z8SA 4RZCA 4PGCB 4G80B 1I9EA 1CF8L 3GSQA 2D03L 2NY3B 2UWEF 5JHDB 4APQA 3DMMD 1PEZA 5E8NA 5SWSE 1DEEB 2VDML 5IB1B 3ARDD 5D4QA 1JZ7A 5EZJA 2R2EA 4PGBA 3BRDA 4X9BA 4RMVA 4D8PA 1KGCD 3WJLC 2K3TA 5IR1B 1R3LA 2AJXH 1G9NL 1KXVC 5FF6B 1K85A 1FNEB 1QSFD 1GGIL 1BJ8A 4X6DE 5E56A 2YPLA 3CPLB 2YSSA 4HWUA 3W39B 5J56B 3WHE1 3QJHA 4FTVA 4GAJH 3GHBL 5FA4B 3V6OA 4K7PX 4JJ5B 3B43A 3NTCH 1PBYA 5E5MA 4TNVF 5L2KB 4NRYB 3KDMA 4DKEL 2XZZA 1GC1L 8CGTA 3FQXB 5E95B 5K9JH 4QKXB 3LQMA 1E0OB 4FQPA 4NQXB 5FGCB 5FYJL 5C09E 1PGRB 1KBGH 1YA5A 2XFXB 4H1LH 4LVOC 2GAZB 1MHEB 3PE9A 2H8PA 4NZDA 3BEVB 1T89A 4P2QE 1MCCA 1DANT 5FO9B 2Z91A 3VCLB 1YPZA 2VDPH 4KTEH 1OPGH 3WNNA 5EPMA 5LGHH 2VXTL 4PJ8A 1RK0A 1RK1B 1IGTB 3WNPA 4BELD 4WFHE 2UZIL 4XVTH 1AGBA 1G6VK 3Q3GB 4OCWL 1MIML 4HWEH 1MHPL 5C07D 3EZJB 2PF6A 4Y88A 3NZHL 4P5MA 4Z7UB 1QKZH 4U1IA 3QFDB 3T8XA 1T2QL 3HS0B 2B1HH 4W70A 5TDPA 3W0WB 1FE8L 2OTUA 5C7XL 3ZDZE 2FJHA 4OFPA 2LQRA 1OAUL 3MODH 1PYWB 3O6FC 4X0KA 4CAGA 2ZCHH 4DN4H 1LE5B 3O2VL 3VWJA 1KXQE 1RZ7L 4QYOB 3BW9B 4GKSA 1RZ8B 1I85A 3MV9A 3O6FB 4D9QE 2WBKA 3NH7L 1YNTA 5KN5A 4Z7QE 3N1GC 1PG7H 3GMOA 4ZFFA 1Z3GH 3LOWA 4RGNE 3D25A 12E8H 2AKRA 2P8PA 3OJDB 3DBXB 3RL2A 3BP6A 3KPRD 1MF2H 4RWYH 3WFCH 5I1CH 4LSSL 3GJFH 5EH1A 1QHOA 5JW3L 1S7TB 3FT2A 5HGHA 2V9TA 4ZYKA 5GSVB 3HRZB 2CPCA 4LLDA 1RZGB 1DLHA 4ONFL 1G9EA 2WAHA 1P9MA 2DQFA 4MDJB 4JN1H 1DE4B 1RZJC 2UVFA 1U8PA 2X09A 5GS0C 1KB9J 3U82B 1RJYB 1I8MA 5IVNA 4N0YH 1NCWH 2BMKB 1VGKB 4J8RB 1KNOB 3MRCB 5IWLC 4GXUN 1BJ1H 4IRJD 1EV2E 4PRAB 4C83A 1FL5A 1ZLUK 3B9VA 3N9GH 4UDUA 1AGEA 3KGRA 2V2WB 3MCG1 4WV1C 5ACZB 3IS0X 1T1ZB 1GXEA 4PJDF 1YQ2A 5E2WH 1UADC 3PIQB 4EOWH 5HGAA 2IALB 4TVPE 3FONB 3RU8L 3VJ6A 2J6EH 3HMXH 4BZYA 1IFHH 4MLSA 4U1SB 4ZTPL 4LGSB 2G9HA 4KJPC 1PZ5A 5F7WC 2NR6C 2V7HB 4ELKA 4GMSH 5DJDA 1HINH 5DZNA 1H9VA 3BX7C 5MENA 5AD0A 4Z7NF 5GGUA 4H20H 3BKJL 4UTBL 4NRZA 1BZ7B 4Q9CA 5EBLB 1B6DA 2UYLB 4GSDL 1OVZA 5EIVA 4HEPG 1FO0A 3Q5YA 4N0FB 1TVBA 4LP4A 1I7UA 4PRIA 3FTGA 4CU8A 2AJUH 4N9GA 3QRGH 3P0YH 5D1XD 1JF5A 5ITBH 3ISWA 5HGDA 1BVZA 3RKDC 4OB5L 4HUUB 2DLFL 4JFYA 3S8WA 5T1LB 4ZUTB 2I60L 1JPFB 5IHUH 4HKJA 4CMMB 1V7NH 5C0AB 3O4LB 1UA6H 1INEH 1ZHBA 4Y5XC 4QRUB 1T6WA 3KYNA 2V17L 1UQSA 3S35L 5C70A 2BY0A 4ZS6C 1U8QA 2O93L 3OZ9H 4GKOA 1VEOA 2B20A 3WFZA 4G6JH 2ZG3A 5BO1L 3CXDL 4Y5XB 4XTRC 3V6ZB 1BFOB 2VLKD 2MQ3A 3M8OH 4M6ML 4YPGA 1HH6B 3CFIC 1EBAA 4LCWD 4AIZB 5ESVA 3TVMD 2ZUTA 1H3WM 5HHME 3QI9C 1PLGH 2CIKA 3AS0A 1ZHKA 4X9IA 3S37L 4MWFB 2NLJA 3BH8B 4E41B 3D39B 2A1WL 4NM4L 4QRPB 3QI9B 1NJ9A 4CBPA 2GT9A 4WTXA 2IAMA 5EO9A 5AYUL 4KAQL 4QRRE 1S7WA 1UKSA 3RWCB 3H7BA 4PJ9A 5CZVL 3RY6A 1XGYH 2DDQL 4XMPH 3FFDA 5DC9B 4Q6IB 1CGSL 4P57A 1EXUA 1RI8A 1F2QA 1VKXB 5L6YH 1M6OB 3DVGA 3K7UA 5DMKA 4PG2A 2QSTA 2XZQL 1PX3A 4F7TB 4NQDD 3E8UH 5TPWH 3ARBA 4U3HA 2AI0H 4XC1H 1K6QH 1YMHB 2P8LA 4NQVB 4R26L 1NGXB 1CFNB 4OCRH 1I1AA 3ZKND 1HWHB 1AO7A 1NBQA 1QRND 4QHNA 1O0VA 3D9AH 5KANI 3DROA 1MCKA 4R4BA 3VD3A 2P4AB 1EMTL 5HTSA 3S5LB 5JXAH 4P9MH 1MCDA 4N90D 4YHKL 1AY1H 5GGRB 3CMOH 2VUYA 1HKFA 4OTXH 3FRPA 3KPRE 4PJBA 2QQKL 4RX4A 4U3CA 3TEUA 1UJ3A 4JG1L 1VPOH 3BD5A 5J11C 3IETA 2HT3C 2J4WH 2FNBA 1JV5A 4Y4KC 3OKDA 1J05B 4HLZG 4MVBD 1P4BL 4FFZH 3NIGE 4YZFE 5J11B 2YHGA 3V2AR 2I26N 2HKFL 1F58L 1V3LA 1RZKH 1BEYL 3WSQH 1NBZB 3ULUF 3BPNC 5HHNB 4JFEE 3C9NB 3E3QE 3W2DH 1AE6L 3QIUA 4GRMB 1IEHA 4NC1E 3O8XB 1EAPA 2NY1D 3DUSB 3BPNB 5C0JA 4RFOL 2BZDA 4U1HB 4YE4H 5KVEL 1T22A 3KNBA 3KPSE 4RZCB 4APQC 4RNRA 4XAWL 4XPHL 3MRKB 4GRWF 5FXCH 3HI5L 3QEQA 3THML 2AXHA 1LEKA 2DQEH 4DW2L 3MRRB 1FC2D 3VE0A 4WUKL 3KYMA 2X4PB 4U0QB 4XGZA 5IFHH 1A4KA 1DBKL 4PGBB 1FIGH 3DUUA 1MRCH 3VU2A 1R3LB 3RTQD 3QWQB 3IAQA 4U6XA 2XPGA 5BS0E 1MCLA 3GM8A 4GG6F 2OXGA 3UZVB 4K71B 4R97C 2Q8BH 3ZE2F 5F9JA 4NQCD 2YSSB 3L9RA 4KDVA 1ZGLA 5IKCA 2D7MA 3QJHB 1QOKA 4JFQA 4R97B 5C09A 3AC0A 4CKVX 4MJ2A 2XWBA 5E5MB 1MCEA 4XZUA 2I9TB 2HLAB 2CDFB 3KAAA 3KDMB 1EUUA 4PJIE 3SDAA 2VRAA 4C57C 4HMCA 4P2QA 1MNUH 3V5HB 4YXKL 3FO0L 2ADFH 3ET9F 5EC1B 4OD1L 1T89C 3QCTH 3UJIL 3MNZA 5KSAD 1HSBB 2CK0L 3DETD 3GB7A 3TCLA 4ZTOL 4HXAL 3FKUS 4PJ8C 2YD3A 2ESVB 5E6IA 2NXYD 4G42B 5F89B 2VLKE 5B38G 1EHXA 4NJ9L 4PJ8B 1RK0B 3G5YA 1F4WL 1AGBB 3DSFL 2Q7NA 4LCWE 4G9DA 3WLWC 1FBIL 4XNUL 4LBEA 4P5MB 1G0YR 2ICEA 5KS9E 4U1IB 4FMFA 3VXSA 7FABL 4PD4J 3AY4A 5ESAA 5FGSA 5EFIA 2VLJD 2CKBH 2H32B 1X5KA 2GIYA 2OTUB 4HDIB 1OP5K 4BYHA 1IM9A 1NMAH 2NW2A 2H2SC 1I85C 2B0SL 3FRUA 4X0KB 3ULVD 3KPOA 3IFPB 2YMXL 2J88H 4QRQB 2NNAB 3KS0H 4OM1L 1DUYB 3MRMA 1HH9A 2JF1A 2OSLA 1NSNH 1YNTB 5GRXG 3S88L 4LP5A 2Y4SA 4E0RA 1HDMA 1WV7T 3D25B 4AEFA 1IILE 1DL7H 2AKRB 3GFUA 2HMIC 2P8PB 3CX5K 3SKUD 2WANA 3RL2B 1AFVH 1KT2A 3HE7A 5DEGA 5ECJE 4UIKH 3J8F7 4OI7A 3QQ9C 1B0WA 4KHXL 3RWIB 1QRNE 3G08A 2OX5A 5LG1A 1DEDA 1P9MC 3L3KB 2LVCA 4Y4HA 2VDKL 1SYVB 5EIQA 4GW1A 1T5WA 3BQUD 1AQKH 1QVOA 2X40A 5HVGB 2AVGA 3MBED 2Y07L 5AZEH 1KB5H 1WZ1L 4BSWA 4ZUSA 2XTJC 3HC3H 4FG6D 1A1NA 4G6MH 3MNVB 3N06B 4N5ED 5TDOB 3PP4L 3HAEG 4I3SL 4M62L 3WIFA 2XTJB 4WNQA 1YQVH 3N85H 4G7YL 1RIUL 4MSWA 4LPUA 3MLZH 5ADPL 5DA0B 5DURB 4OLUH 1C5DB 1B3JA 3MRJB 3VDCA 4M5ZL 4KV5E 4OD2B 5L8JB 5HGAB 3WS3A 3T3ME 4X4YB 2VDQH 3FZUD 1CT8B 1T04A 1VESA 4TSBL 3M17B 1WC7A 2VWEE 4WI3A 4FQXD 1OARL 5FUZL 1FFOA 5IK3A 2ATPA 3EGSB 4UB0H 5A40E 3V0WL 5I8OH 3DMMA 4XCNA 2VISA 1WBXA 2EIBA 1V8HA 3IDXL 4C56E 3ARDA 5DJDB 5DUPL 5I1IH 4G8IA 3IVKA 1EH9A 3PDGA 4OFYD 5AD0B 5GGUB 4LSQH 2PTVA 4XP5H 1FZOB 3F7QA 4A6YA 1Q9WA 4WHTB 1SMAA 1IAOA 3MV01 1FO0B 4QXGH 1MHCB 2OL3A 3R4DA 4JAMB 4LOUC 3T1FA 1QSFA 3N1FC 3RY5A 3NIDF 1NQBA 2O26U 4LFHG 5IB4A 1I8LA 4K3GA 3LEYL 3TFKC 1JF1B 5HGDB 2NQCA 2VE6B 2UUDH 2VXSL 3MUHL 1UCTA 2PO6D 5E2TL 4G6FB 3ZKMC 3S6CA 1NEZA 2PTTA 4LAQH 1KF9B 5HYJD 3CXHK 3QUXB 3MBXH 4UOJA 4NBZB 2AEPL 5K59E 3BD3A 4LNVA 2JCCE 3VGFA 1HYSC 5CINH 5I18H 4P23C 5KVGL 3PABB 4I13B 2J8UF 5TE6H 3ZDXF 1R0AH 2VIRB 3BIKB 1TQCC 3PNWA 2X9YA 3N1MC 3GK8L 4P23B 1N5AA 5C3LD 2CXGA 2A9NL 2EEBA 4DCQA 1TQCB 5DFWH 1KLUA 1T03L 1IGCL 2V7NA 3W9DA 5J1AA 5C07A 3TV3H 3CFBA 2V5RA 3MV7D 1NFDF 2CK2A 2GKIA 4UU9B 2P49B 5BOZG 4PJ9C 5DRXA 3RY6C 2VERN 2CLZB 5EO9B 2BXZA 4ZO7A 3GSNH 5TQ2H 4PJ9B 3RFZC 1JYVA 4PG2C 3FFDB 2Z93B 3RVVC 4P57B 3ARBC 1CLZH 4LARL 1HHGA 3MLWH 2ZCKH 5DT1H 2VLJE 4KH2A 3T0EB 5KSUB 1AGDA 5F7HA 1I1AC 4Y1AB 1CFVL 1R5VB 1TVDA 3ARBB 4N0UA 5H35B 3W11C 2BVUA 2BY1A 1LGVA 1IGYA 4OZIB 2DICA 1NDGA 1AO7B 4TTDD 4OLYH 3VXOA 2BVPB 3MRHB 4Y7MA 1BM3L 3KPRA 3DROB 1A9EA 2AQ1A 2H6PA 1WSST 3PV7A 3HUJF 5ACMA 1RMFH 5JPNB 3T08A 5HYQB 3GBML 1UJ3C 3VGBA 4RISL 3ZL4L 4KDTA 4XVSL 4Z8FH 5BMFL 4JANA 1UZ8B 2FL5A 5E7FA 4XVUD 1F2XK 2CIIB 5ANME 3LEVH 5DFTA 4K94L 2G5BB 4BFIB 5IHZA 5ELIA 4HIHB 1VGEH 3GI8L 3OKDB 1I9RL 4TQEH 4GKNB 4KKCD 4PBWD 1BREA 1KELL 4IRJA 2FSEB 1BIIA 4M7LL 1ZWIA 4ZFOA 2VH5H 5BZWA 1J1OL 5HY9B 1Q8MA 4M5YH 1NBYB 4U6HA 5JW5A 5K9OA 5D71H 2G5RA 3I3DA 3K74B 4XRCB 4W68A 4X9HA 5C0JB 1JPST 5SWSB 5CFHA 5HYSB 3TN0D 3MYJA 3EYOA 2Z31D 1SYSA 5I66A 1JNHB 1T22B 5HI5D 2C7UA 5CGYD 1QUNA 3OKNA 4PJ7E 3OKEA 3WNOA 1J0HA 4JO4L 3U7YH 1CTNA 4O5LH 3VE0B 5F1SA 3KYMB 1WUNT 4XGZB 4X6DB 3RI5F 4AG4H 5DO2D 2FHFA 3C2AL 3LKOA 3PV6A 4L8BA 3FN0L 3ROLB 4U6XB 2XPGB 5IFAH 1JHTA 5D1XA 1LP9F 1D9KD 5HHXH 1FNSL 3IU4H 1MELA 5EUKB 4PJEF 1ZGLB 5FOJA 4M00A 4X9FA 5T5FH 1CFQB 1IC5L 3PP3H 3HR6A 3SDAC 5FYKH 3C8DA 3NCYS 4TNWF 1JN6A 2HJFB 5C0EB 2GCYA 4RMQA 4IBLT 1EFQA 2C1OB 3WFDH 4LHUG 4K7PH 5EU4B 3SDAB 2HN7A 4R6UA 4P5KB 4GS7B 2VLKA 3RGVB 1D5BA 3T65B 1EGJH 1L6XA 4FZ8L 3QPXL 4ZDHB 4PB0H 4MX7A 3MNZB 4I77H 2IPKA 4W6WB 3GB7B 4LCWA 4OCXH 1XGQB 3TVMA 2AGJH 5E94A 3SGKA 5KS9A 2GK0A 1AR1C 4GAGL 4YHPB 4X4ME 5C0CE 1IQWL 2XIDA 1YDPA 3OHXB 4ERSH 4HV8A 4I18A 4M3KB 1AQDA 5K33A 3U4BH 43C9B 1OLLA 1FYTE 4HWBH 1OM3H 3PHOA 2ICEB 1ZKAA 3P30L 4XC3H 3ULUH 1EVTC 5DK0A 3RJDA 1CD0A 2FJGB 1IM9B 2HTKD 3F12B 5A3ID 2NW2B 3S97C 1RFDL 3MO1A 1XH3B 1ES0A 4RGNB 3BZFA 3MRDB 4NQDA 1EFXB 1U3HC 3HCVA 4FQLL 3WFHA 3OSKA 1F6AA 2FEEI 2OSLB 2AABH 4JFZL 4GRWH 5JXED 1G1CA 3DNKA 4JG0L 4DFHA 1QRNA 5I71C 1U3HB 1U6AL 1BX2B 2O5YL 3EO0A 3RA7H 3DJ9A 2L7JA 1ND0A 2CKBB 4LCIH 1BPVA 4NGHL 4P2RD 1HZHL 1KT2B 5E5RB 1BQSA 3A0OA 4TULH 5DA4A 4NHCL 3BIAX 3G08B 2PYFA 4Y4FD 1QBBA 1RHHA 4PRHE 4M8QB 2HTLD 3CFKB 4WU5A 3VRIB 1IGIH 4Y8DC 2IQ9L 4PREB 1V3MA 2ZNXA 4GW1B 1T5WB 3P73A 1QVOB 4R90H 4R7NA 1QR1A 2VZOA 4P9HH 2VLRE 1VCAA 4FQIH 5GGTA 2PNDA 4ZUSB 4WFFE 3FMGH 1U8LB 1A1NB 1AXTH 4MNGE 1MEXH 3U7AA 4YX2L 3KLSA 4JZOA 2QTEA 4WWID 2JELH 1J8HE 4M02A 1JWUA 1RIVL 1NBVL 2W38A 2VXQH 1YYMH 1BFTA 3QHFH 1MHHB 1NCUA 2EXYD 1ADQH 1J1PH 3DMMC 2EDYA 3IDGB 1WC7B 4CU6A 3KR3H 5GGQL 3ARDC 2Y5TA 3BISA 3DGCR 4KGJA 3REVA 3JV0A 4LLYA 2EH7L 1NFIA 4UBDC 2E27L 2RJMA 4P59L 4HSQA 5IEKA 4G8IB 4R2GD 1L7IL 2EE3A 3OBAA 4JKKA 3RIAK 2K7PA 4YR6B 4A6YB 4JDTL 3RTQA 4CNIA 1IAOB 1L7TH 3C5JA 1CK0H 2OL3B 2B1AH 1QRKA 3SE9H 4NQTA 5BV7H 3FOMB 3SE4A 4AMKL 3L7FB 4NQCA 1YUHA 2EKSA 4FNLH 4JHAL 1A7OH 2Y1VA 4ZSOE 3SDDD 1NFKA 5D72L 4J3VA 2BSED 3WN5B 2M1KA 4OGZA 3G6DL 1NLDH 4XPBH 2WNGA 2OZ4H 3F7RA 1S9VA 2FECI 3HR5A 4QXUL 3CX5J 4BQ8A 5HVHC 2EE9A 3DRTA 4ZFZB 4X7SL 3WO4C 4G9FD 5F3HA 4PP2B 5HHMB 4OSUL 5HVHB 5KSAA 1TJGH 4F80A 3S7GA 3QG6A 3PNWB 4C4KO 3WO4B 3TT1H 2RR3A 3LD8C 5CZKA 2Q6WA 2YD7A 1UKQA 4FXGA 2AK4D 4HK3J 2CO6B 3AMLA 2XQBH 3MXWH 4I5BA 3LD8B 4QTIL 5TE7H 4QRRB 4RQQA 1BAFH 1IT9H 1GIGL 5HHOE 3QBTB 4QHUB 1GGBH 3QO1B 5HVFB 3ARFD 5DJ2A 1KFAL 3CFBB 4HFWA 1Z0NA 4Q97A 2NMSA 3FHAA 5DUBA 4I48A 3F65A 1DR9A 5DRXB 2VXUL 2VLJA 1I8KA 4W4OA 5C0DB 4MDIB 2AW2A 1WISA 2WZPD 4KQ3H 1P6FA 4NSKA 2YWZA 4HXBH 1JUFA 2WP3T 1AGDB 5FGRA 2MWCA 3S96A 1WFOA 1HHHB 1XIWD 3VFOA 2OXHA 4PJXE 1DQML 5DJ0A 1L6ZA 3BWAB 1G7PB 1IGYB 5MEOB 4CRPA 2DQJH 3P4LA 1CE1L 1HQRA 2N1KA 4HZLB 2CGRL 2OJEA 3VXME 1C08A 3KPRB 1EHAA 2J8HA 1CG9A 3BP7A 4KDTC 5EOTB 2QR0A 3QT2A 4UZGA 1PEWA 5GGRY 2CDEA 2A0LD 4HJGA 1R3IH 2GITB 2NX5E 5KW9L 5EUOE 1PQZB 3BQUA 1BZ9A 4P2RE 3E3QC 4KGLA 4KK9D 3MBEA 1CQYA 4H25B 4NC1C 1U3YA 1ETZA 1RUML 3ALPA 4K23L 3TO4B 4IRJC 4GW5A 4JFEB 5IHZB 2DQIH 2F54E 4L4VE 5F8RC 3AMKA 2R0KH 3UEZA 5JO5B 3CH1B 1AP2B 3CXHJ 4MD0A 1ZWIB 4L8DA 4TOYH 1X5GA 2PYED 2APTA 5SWZD 4X5WA 3KPSB 1CWVA 1KCKA 4HWNA 5JW5B 1UWXH 4R8WL 4MD4A 5GRVL 1R5WA 3QNYA 43CAB 4JRXD 4PJ7A 2DJSA 5MP6H 2X4UB 4KVNH 3EYOB 4FQXA 5DUML 4ETQB 2QV2A 4KFZC 1JZ2A 4ISVA 2BK8A 5ERWA 3QNZA 2C7UB 3LPGA 4PLNC 2E7LA 1R5IB 2Y25A 4LLQA 1A8JH 3GSVA 2F58L 1K5NB 2XA8L 5BS0B 3L6FA 5IVXF 4OFYA 1XF1A 3P11H 1VFAB 3O41A 3FO9A 1FLRL 5TF1L 1B0RB 4M48L 3U2SA 4EUPA 3UJTH 3PV6B 5MEPA 4XNXH 5D1XC 5IJKA 5C9JA 1T5XA 3MRLB 4UAOC 1YY9D 2WWKO 1KTDA 1WZMA 1NCTA 1G6RH 1F90L 4O2FA 1IC4L 3RRQA 2VL5A 1FL3A 4GG8A 4XNMA 1JHTB 5D1XB 4ZUVA 4NO0B 3MREA 4H8WL 3IDUA 3MRGB 4UAOB 4BFEA 4PJIB 1H3PH 5I1GH 3DX8A 3NFSL 2PO6A 3B5HA 5TH2B 1JZ8A 3DX9B 5CUSL 2W65A 4U1GC 3JZ7A 4KROD 1JN6B 5HYJA 3V6FB 1NKOA 3L7EA 5JUEL 5CBAA 4JPWL 4Z77A 5GHWL 2D7PA 1QSED 3ZHDA 4U1GB 1MPAH 1KIUA 3OJVC 3JVGA 3QH3B 3HNVH 4M61A 1YEKL 2HN7B 2H3NA 3ARUA 1P53A 1SBSH 5D70H 4V1DB 4GUPA 4MX7B 3P9MA 2CRIA 3QNXA 4LF3A 4HHAA 1G9MH 5F7NC 1MOEA 2AV1A 4EN3D 1OF2A 2DD8L 4NQUA 5E94B 2LABA 4I18C 3PWJA 3FQUA 1U58A 3RAJH 5I19H 3MV7A 2Y06H 3JWDC 2G75B 4HV8B 4I18B 4Z78B 1DVFD 4WEMB 5HDQH 1NUGA 1TNMA 4JRYD 4MA3A 4JFXA 5EIIA 3P3YA 2DIBA 1ZGLM 3VXRD 1JGDB 1OD7A 4OCSH 5DK0B 4RFEA 3STLA 5KAQF 2XA3A 4EDWH 3OKYA 1HIML 1A6ZA 3VDBA 1ES0B 1OTTC 4GT7A 1G7HB 2BSRA 1UM5L 3BZFB 5I1AB 3BGFC 3ULVL 1FJ1B 5K93A 3O3UN 3WFHB 3WEXA 1KPVB 3VFPB 5C0BD 2GFBB 3L3IA 4FHBD 4YEEA 5C6TL 4NWUH 1QRNB 3BGFB 5M95B 1F6LL 3EAKA 3TNMA 2B4CL 5AAMA 1NGWB 3X3FH 4WRLA 1NGZA 1ND0B 5I8KL 2E7HA 4PTUB 1JMXA 2V2XB 1TTUA 2P8MB 2X1OA 1ZANL 2PYFB 4HUMB 5BQ7A 4HPYL 3I50H 3JTSA 5ISZE 3PL6D 1OAYH 5DVNA 3LHPH 4BH7A 2DM4A 4S1SH 5D7IF 4R7NB 5FYLH 5I1KL 3R06B 35C8H 5CLWA 2NXZC 4PUBH 1FFNB 3MOBH 3O4OC 1BD2E 1BWMA 5IB5B 1QNZH 1W72H 4PV9A 2NXZB 4F37K 5CEXA 2VWEC 4XPTH 3O4OB 4MMZC 2R9HD 2NY1C 2X4TB 4F58L 1I1YB 4QTHA 1DZBA 3X13A 3BKML 5D2NE 1N59B 2NY1B 4FABL 1JPTH 5L0QC 2RFXB 1A3RL 4OLVH 1IBGH 3TN0A 4C56B 2Z31A 3B2VL 7CGTA 1KYOK 5SWZE 3BDYH 1N7MH 5CEZE 5T3ZH 3GGWA 1KN4H 1XF5A 1NGQH 5DGRA 1NMBH 3V0VA 5FECA 5CS7A 4NQEB 3HI1A 5K9KA 2DQGH 1A1OA 1H3VA 3RTQC 3GSXA 5INCA 5E1AA 1LVEA 3KPPB 1YEJL 3TESA 1DQLH 3RTQB 2GYSA 4JY4A 5ICZA 3SE4C 3C5JB 3QUZD 3O6LH 2AJXL 1ZVHA 3X14A 4FZEH 1D9KA 3LQZA 2R69L 3RUGE 1ZT4B 1ZVSB 4WGVB 3TM6A 3BH9B 2F53D 3GIZH 5IFJA 2DWEB 2JCCB 1OGAD 2P24A 5EZIH 1MLBB 1JF6A 1HOCA 1YEIH 4GAJL 2W9EH 5EBWA 2FRGP 3MACH 1KJ2H 3AXLA 3NTCL 3EBAA 3UYPA 4FQQA 3HR5B 1A02N 5T3XE 5JZ7D 3JV6A 5KSAC 1K2DB 3BP5A 3K81A 3DVIA 4QY8B 1OTUD 2NXYC 25C8H 1HILB 3QO0B 3L3OA 4Z9KB 3QG6B 1KBGL 2FR4A 2I25N 1X5ZA 1I1CA 2ZUXA 4PJAF 3RY4A 2Q6WB 1EJOH 1W2KT 3BP4A 3IJHA 2NXYB 3QFJD 1KEMH 1Q72H 4AT6A 2EH8L 4I5BB 4FA8A 2VDPL 3SKNA 3PF2A 2EDNA 1RUPH 5LGHL 3ARGD 5SV3A 3TH2T 2CDGA 2A83A 4XVTL 3SO3B 1ZEAH 5DUBB 1VFOA 1SBBA 4HWEL 2AK1L 3EOAB 1UWEH 3ULUD 2VLJB 5ICYB 4WW2F 4AZ8A 1QKZL 5DC0A 2BCKA 2B1HL 1BBJA 2EDWA 1YN7A 4AIXA 1EEZA 5L7XH 4HGWA 5KSBE 1A21A 2EIZB 3QCVH 4JRYE 4LPCA 4NSKB 5DS8A 3MODL 3MGTB 2ZCHL 4DN4L 1CD1A 4ZNEE 1UCBH 4NZTH 5D7LD 5F3BA 1XF4A 5JXEA 1RJZA 5GGSB 3S96B 1Z2KA 5IOPB 2ITDA 2VDLH 4TVSa 2PKDA 4XCCH 1MFBH 1RHFA 5FUOH 4LPYA 1PG7L 4X7TA 5EUOA 1D3CA 2OJEB 4P2RA 1Z3GL 4NNXA 3ZE1F 5B39B 5C0BE 12E8L 3OB0H 4Z7VE 4XB7A 4Y4FA 5ANMB 3WFCL 3GMMA 4RWYL 2QR0B 5I1CL 3MBEC 4Z7WF 3EUUA 4JHBA 2A6IB 3AB0C 4FG6C 3MBEB 1WK0A 2YUWA 4N5EC 1ETZB 2YD5A 3LQAH 3DARA 1MCFA 3WIHL 1EERB 1IEBA 5EZOH 5H94A 3W5MA 4RA0C 2HJKA 4PJCA 2PN5A 5FAAA 4XCYB 1WWBX 4K8RH 2QSCL 2I07B 4Q2ZB 4O9HH 4Y19D 4N0YL 4MD0B 1OCWH 4Z76A 4MNHB 1S9XB 1AC0A 3NCFB 5ID0A 4X5WB 5GPRA 3FZUC 4M7ZC 1MCPH 1FCGA 4MD4B 4M43H 4FQXC 1KTKE 5HJ3A 4PJ7B 4PJGF 2IANE 2E7LC 4M7ZB 5E2WL 1W8NA 5E6YA 3LKPA 4LVHC 1S9YA 4ISVB 4LGRB 3QDGD 4XPAL 2J6EL 5BXFA 3HMXL 5GS3A 5T5NG 4L3EE 1IFHL 3HZKA 4LLQB 5JA8B 2NCMA 4LVHB 4MHHI 5FYJH 3D85D 3L6FB 3GEWB 1FORH 5IJKC 4GMSL 3FO9B 4RDQG 3LRSA 5JDJA 2XY1A 1R6VA 3CDGA 1H15A 4EUPB 3HC0B 5CWSA 4H20L 1U8JA 4H26A 3GMNB 5MEPB 4E42B 1GJIA 1T5XB 3DTXA 1R24B 2PO6C 4MB3A 5FM5O 1FRGL 3ALXA 1IAIH 1NLBH 4ZUVB 1YEDA 3P9LA 3MREB 1GGYA 3QXTA 3P0VH 1KCVH 1T7ZA 3QRGL 3SDDA 5D5MB 3P0YL 1DDHB 4J3TA 4BKLA 3C8KA 5DMJB 5ADOH 2W65B 3L95A 2E8YA 3ECBA 3JVGC 4HKZA 3OKKB 5D2LF 3P77B 3L7EB 5IHUL 3T4AA 3NZ8A 1V7NL 4IIQA 1OGAE 2X4QA 1UA6L 1Q38A 1INEL 1P4LA 3O2VH 4G9FA 1RZ7H 3A6OA 4LAJH 1AIFB 1TLKA 3VG0H 4EIZC 1M71A 4NKOA 4GUPB 5C0CB 2ZOLA 1NC4D 1S78D 4LF3B 3GSWA 4HHAB 2AK4A 2A6DA 4HG4K 2XI9A 3HPLA 3M8OL 4BSVB 1CL7H 1OSZA 1FAIH 1WTGT 1FYTB 4WHCA 3PWJB 1EHLH 3FQUB 1U58B 4YPJA 3ARFA 1PLGL 2X9WA 2EDLA 1QLEH 4HJJH 5AEAA 5E99H 4W6YB 4M4RA 5JW3H 3GSUB 1DQJB 2HVKA 2CMRH 4B5EA 4JFDD 4Y2DD 4PLJC 4OF5A 3EYSH 3STLB 1QFWI 2IJ0C 1KIPA 1XGYL 4XMPL 3OL2A 4NN6B 3KPLA 4QRTA 1X5FA 4HUXA 1S7SB 4TTDC 3SOBH 5L6YL 1XIWA 3WEXB 2UWEA 3SGDH 1DQTA 1CD9B 3E8UL 5TPWL 1FN4A 4XC1L 1K6QL 3TNMB 3PWNB 4F9PA 4PRHB 4NC2B 4OCRL 4UT7H 1K8IA 3D9AL 3P4OA 1NGZB 1GZPA 2VN4A 2W59A 4L1HA 3TNNB 2LTQC 5D9SB 1MJ8L 1BGXH 2VLRB 5JXAL 2DI9A 4P9ML 3VGDA 3SJVD 3BUYA 5MHSD 4Z6AT 3NACL 2LTQB 1AY1L 4MNGB 1HQ4A 1T4KA 3CMOL 5HGBA 4YK4C 4BH7B 1KB5A 4KKCC 5CHNB 5T33H 1J8HB 3JTTA 3L5IA 1HXMB 3K8MA 1U8NB 2HP4A 1VPOL 4YK4B 3BKJH 1WVZA 1DUZB 3E0GA 3HE6D 2DLIA 4GLRH 4DUXA 4NZJA 2PYEA 5I76A 4FFZL 4U1NA 5SWZA 4QTHB 3G5XB 4V2BA 3X13B 1FH5L 1I3RB 1RZKL 3E1F1 3WSQL 3TN0C 1PY9A 2Z31C 1RULH 5HI5C 1AJ7H 4JRXA 2CUMA 1AH1A 3QPQD 2EYRB 1LP9B 3RWDB 2IGFH 2GQHA 3TN0B 4LLWA 2XKSA 3FB8A 3BZEB 3F5WA 3N50A 2YA0A 4YE4L 4CVUA 4PTTA 2BFVL 3B6SA 4WHDA 1MVFA 3V0VB 5FECB 3B9KB 3GSRB 3HPJB 4OUUA 5DO2C 1WCBA 1A1OB 1C5BH 3EYFB 3QDGE 2ADGA 2DQEL 3GSXB 4YHIB 1FG9C 4D9LH 3RUGA 4M6MH 3O11A 1HHIB 1D9KC 4ZSOB 1FIGL 3QUYD 1CS6A 2DYPB 4KKBD 1QA9A 1MRCL 4HZAA 3LKNB 1NEZG 3X14B 2SEBA 1D9KB 4LVNC 3QEUB 3OR6B 2HH0H 1Y6KR 4N9OB 4LCUA 2A1WH 5FKAB 4HIEB 4K9EC 4WI6A 2Q8BL 4U1JA 3JUZA 4LVEA 4LVNB 2NTSP 1FVCA 2IBZY 4FQCH 5AYUH 2FWOB 4KAQH 1BF8A 1X3DA 2R4RH 4M93C 4OLXH 1H5BC 4J3WA 2P7TB 1QSEA 2KL6A 2YD4A 3ROOA 1XGTB 1CGSH 1H5BB 1T21B 2R1WA 3FB7A 2KKQA 3IFNH 1MNUL 3ZKXB 4CMHC 4G3YH 5T1KD 5HHOB 5KZCB 1WJ3A 2ADFL 2HLFD 2X5PA 4EN3A 2VDOH 3RVWD 3BP4B 4P2OD 1UXSB 5D6CB 4AT6B 3MZGB 5CEYB 1ZA6A 2EE2A 3SKNB 1U8HB 5D6DA 3PHSA 1T0NA 4TNWK 5KG9A 5SV4A 4W6XB 2A83B 1DVFA 1QSVA 4JRYA 3L3HA 1TVHA 4QO1A 4ZNEA 3GSNA 1JGEB 3VXRA 2BHYA 2BC4A 4HEME 4PJDA 4XXDA 4XT1C 3QQ4B 2CKBL 1CXHA 3JV4A 4PJXB 1PW3A 2A6JA 4U7KA 4HGWB 1G7LA 5JXEC 3GM0A 2EDXA 1KYOJ 2D0FA 4ZG1A 4WWKB 3VXMB 1HN1A 1P4BH 2CRMA 4UINL 5EN2B 2J88L 1MCRA 5C0BA 3MFFA 2YEZA 1BFVH 1TZIB 4C58B 4Z7VA 4PJ5E 2A2QT 5IMLA 4CDGC 1NSNL 3ARXA 4XNQA 4HH9A 2NX5B 5EUOB 5TE4H 1FVDA 4P2RB 3PWPD 2BNRD 5EC2A 5FB8B 5GJSH 1E4KA 3MNWA 1ZGLP 1AFVL 1CL7I 3WLBB 4ELMF 4H0IA 1VFMA 3MPCA 3PL6A 2F54B 4L4VB 4CUCA 2VQTA 3SDYH 3MUGA 1BQHA 5C0GA 5FYLD 4KRLB 5FV2A 1AQKL 1C5CH 4NPYB 5DLMH 2W60A 3SJVE 5AZEL 5MHSE 1O7SA 3QG7H 2MNUA 5TGBA 2HJKB 3JWNC 1EEUA 3LIZH 3DV4A 3HC3L 1PG7W 3ZE0E 4EBQL 5FM4A 2WLZA 1W0WA 3QYCA 2HG5A 1QP1A 1EO8H 2P1YA 3B8YA 4LHQB 4AH2B 3MLZL 5TDNB 1F4XL 4OLUL 5HJ3B 5JR1H 1JNNL 4KXZH 5AG8A 3HZYB 3IXAA 4HS6B 4PGJA 5ILTH 1JK8A 1GOHA 3OMZA 3UJJL 2NY5C 3OAUL 3MA9H 1VERA 5EOCJ 1QQDB 1YJDH 4HCRH 4R2GC 4YNYA 3IDMA 5A2KH 3WYRA 4DVBB 1A6PA 1Y6MR 5DD1H 3HZKB 3K4AA 2Z8WC 1DSFH 4UB0L 5I8OL 4YHMH 2YD2A 1TJHH 2HRPH 4JQIH 2EDKA 3C09B 3UJIH 3UTTD 2OI9B 3UPCA 4D2NA 3QHTC 5I1IL 4U49A 1KIQA 2APXA 2EYTB 3CDGB 1H15B 4ZTOH 4LSQL 5CWSB 4TN9A 3TBYB 3QUZA 3I2CL 4XP5L 3P4NA 2FLRT 3EW3B 2X1QA 4TUJB 5HXMA 3VH8A 3IRZA 3DTXB 3RIFK 2P5EE 1HI6B 4ODUA 1TCMA 1NCNA 3I85A 4LLVB 2HT4D 3WNMA 2F53A 3DSFH 1OGAA 4UQ3A 4OKDA 3C8KB 2HRLA 4X6BB 1EBPA 1KLFA 1AXSA 3G5VA 3FQNB 1JRHH 1SJEA 3OXRA 2KQMA 5DI8A 1AXIB 5J3HD 4LAQL 5BZDA 1EK3A 2X4QB 4YHYC 3MBXL 1REIA 3V7AG 1P4LB 3CIQA 2Y5EA 1EGJA 3I02A 4DUVA 3LDBB 4LCYA 5I1EH 4OM1H 3HG1D 5CINL 3MSPA 5I18L 4NKOB 5E2UH 4YHYB 5B8CC 4OLEA 5TE6L 3DECA 1R0AL 3GSWB 1H3XA 5JQHC 3VFWA 3ARPA 3F7YB 4UTAH 4ORGB 1IZKA 1CFSA 3ARFC 5DVKA 5B8CB 5EO1B 2VDNH 3SHSA 4KMTH 4D0DB 5CIPH 5CJQH 3ARGA 2D7TL 1QO3A 5FHAH 4KDWA 1SEBA 3SDXE 3ARFB 3EHBD 3SKOB 4I9WD 4KHXH 2BERA 4Z7UF 4AQOA 2IC2A 2XZAH 5I1DA 2VDKH 1VEMA 3FQRB 4GMTL 2FZ3A 4XWOD 1Y18A 3UTPD 2C4XA 1A3LL 1I7ZA 4LSTH 4Y5YC 2WUBL 4LEXH 3LKQA 5IVOA 5IM7B 4L8CA 3WHXB 5TQ2L 5D1ZB 1KIPB 4QHLA 1XIWC 3O9WD 5J89A 3NPZB 4Y5YB 3S3JA 3KPLB 4QRTB 5D7LA 1DANU 4XMKH 5ALBH 4M62H 3MLWL 1XIWB 5DT1L 4F9PC 5EOCH 1X6LA 1FL6A 5I16B 2I24N 3A67H 4NYLB 1QYGH 2YUXA 2IADA 4KPHH 2A0LC 2B8OT 5MI0C 5ISZB 1P1ZA 3P4OB 4OLYL 1XR9A 1IAKB 1UVQA 2ZSWB 3NCBB 4KK9C 4OUOA 5EG6C 5E4IA 4JFFE 2FATH 1INQA 2X44D 3K2MC 5CP7A 1RMFL 2HJLA 1RQ5A 1BD2B 4GG6A 3PWPE 5DJ8A 1JCKA 3H9SB 2YS4A 1X5LA 1S7VB 4Z8FL 4P4RA 5IIEB 2H9GB 2HFEA 3HTLX 5DUPH 3S35X 3TIDA 2PXYD 5D2NB 3KXFD 4MJID 2OS7A 4X9GA 1JYNA 3C60D 3LEVL 3TGXA 5CBEA 4K8RD 5C2BH 4Y19A 1VFUA 4TQEL 3B3IA 4JPKH 4F7CA 3VMPA 3KPNB 1B9ZA 4AENA 1I7RA 3MRBA 3V4UL 1JGUH 2NY2D 4M5YL 3LEYH 1NCBH 1ODAA 2ICWJ 2A6KB 4YDJB 4LKCA 2WIMA 5I0ZA 1ADQA 2VXSH 1SVZA 5F8QC 3QDGA 3FB8B 4NO3B 3F7VB 3OX8A 2P5WD 2LU3A 3QHZH 3D85A 2QJDA 3S36X 5FYJD 4EI5D 1QFPA 3TJHD 2D0GA 2F8XC 3L3DB 3MLYL 3RUGB 1TPXC 4NBYB 3O11B 2R2CA 5F7FA 2A9NH 5EU6E 1QA9B 1S7RA 1TPXB 2Z35A 4N68A 1IGCH 4XCFH 4HS3A 5IFAL 4KROC 1WFUA 15C8H 4QGYA 5ESQB 5HHXL 4CN1A 4U1JB 5CZXC 3HB3D 1BOGA 2BHZA 4HIIB 2OZ4A 5HD8C 2YA1A 4YO0A 2FO4A 5C6PB 5IT2H 1UGNA 3CFDA 5FYKL 1UFUA 3WXVH 4L8SA 4HWZA 2ATKA 4KJQC 1J18A 3NFPA 3WFDL 2VQUA 2WQ8A 4K7PL 1H0DA 1QHPA 3UTSD 4EN3C 4FN0A 4KUCF 1NC4A 1JBJA 5EU3A 3CZFA 1Q9OB 1ZT1A 3QQNA 5GIRA 1M4KA 1EGJL 3CVHB 4XP4L 1CI5A 4PB0L 5KSVB 1HXYB 1QPPA 5I73B 1NKRA 5D6DC 1T1YA 1IL1A 4NKQB 3QXAB 4OCXL 3HG1E 2WIIA 4YGAB 1DVFC 4IRZH 2AGJL 3UYRL 4PY8J 2CUHA 5IV2A 5DHYA 3GBLA 1S7QB 2G60H 3K2UH 2DM7A 3M45A 1DVFB 4JM2D 5KSBB 3GBMH 1SJHA 5EA0H 4JRYB 3V5DA 2W0PA 3L3HB 4JFDA 4Y2DA 3DURB 1T0PB 3AAZA 3ZYJA 4ERSL 1TVHB 2EXWC 4PBXA 2D31B 2VB5A 4HWBL 5D96C 3U4EA 4XC3L 3ULUL 1JFQL 2AJSL 1MWAH 4I0PC 4CU7A 4YAQA 3TC9A 3VW3H 4DVRH 1R3KA 5D96B 3GI8H 5CD5D 3MFGB 3G6AA 1JRHI 1X5HA 1OGTA 4I0PB 4U7SA 5GGSY 4M7LH 5C0BB 2DQUH 5CLTA 4Z7VB 4ZQKA 2IPTL 5K9QG 5IMLB 4MQ7A 2AABL 4OZFA 2W9LA 2ZG2A 1E4KC 4XNQB 4HH9B 4HLJA 2OP4H 1IGJB 1QFOA 2DTMH 4YHZH 1QFWM 3OAZH 4HF5H 2CUIA 3RA7L 1KJVA 3ILQD 3ARWA 3MNWB 2JB5H 3PL6C 4P5TD 4WFEE 4LCIL 1QEWB 5FM8A 3C5ZD 3ZT6A 1TITA 1NCCH 5F1NA 3SJVA 4TULL 5SX4H 2OM5A 3V9FA 3PL6B 4CW1A 4YH6A 3QXDB 4KI1A 3I75A 2EDOA 2BNQD 4JHWH 4HAGA 5AUMB 1IEAA 4GW4A 4U1LA 2FEDD 2W60B 3HE6A 4HX1B 1A7BA 4P9HL 5TGBB 4XP6L 1JJUA 2FDBP 4FQIL 3STZA 4QEGA 4JKWA 2IANB 4OCNC 1JTPA 1MEXL 2OQJA 2FHBA 3RBGA 4XBEH 4BFGA 5EZLB 3I6KB 1CTOA 1M1SA 2VL4A 4PJHE 3WDIA 4P3DA 4KTDH 4R7DB 4L3EB 3QUKA 2VXQL 1NC2D 1YYML 3IXAB 4XI5D 3G6JE 3VFTB 3CFJA 1ADQL 1D6EB 1J1PL 4EUPG 4X5LA 3VG9C 4IRSB 1P2CB 2RGSA 3VWKD 3IF1A 4Z5RB 5C0RL 3VG9B 4URTB 1IGMH 4N0RA 3I6GB 4WIQA 3QUYA 1G6RA 3VH8B 1K9TA 1E4XH 1L7TL 1WEJH 3WUWA 5GRJH 3CGTA 4GAGH 5FO7A 2B1AL 5I8EA 5I1JH 4NM8L 3SE9L 5E1HB 1GOFA 2APWA 1JPGA 3MA7A 5BV7L 3U46B 1P7HL 2AJZA 3OG6B 1OGAB 4Z0XA 2OTWA 4KI5E 3U83A 1KULA 3AS1A 3IRPX 4FNLL 4NC0B 5JZ7C 2DQTL 3MJ9L 3O0RH 3TIEB 3P30H 1S7UB 1EIBA 2BVEA 1KPRA 1SJEB 1OTUC 1NLDL 4XPBL 2OZ4L 3WIIL 3V0AC 2IBGA 4MQSB 1RFDH 5H37H 4X80H 3HUJA 5ABDE 3QWOB 1U93A 1RV6X 1WZLA 1N6VA 4LCYB 4N5UA 5T1KA 3KJ6L 2ARJA 2E7MA 3K1DA 2ADIB 5DD6B 3VXUD 1S3KH 1CDBA 1LK2B 1U8IB 4G43A 1TJGL 4JG0H 5DHVA 4P2OA 1TETH 3TT1L 3VI3F 1CFSB 4K7FB 2NPLX 3X11A 1UKTA 1FZJA 1QPXA 4MQXD 2XQBL 2YWYA 2EDQA 5E2VL 1WBYA 3MXWL 2EZ0D 3H8NA 3WXWH 1SEBB 1F3DH 3H9YA 1IT9L 4QNPE 4LLMB 4G8FA 1GGBL 1MI5D 4Y16D 5DRWA 1JWSB 5SX5H 3VDAA 1Y18B 2VYRE 4JEGB 4L29A 1WAAE 4QOKD 3LKQB 2WP3O 2CO7B 3V4PL 1FHGA 2VZUA 4YIQA 3SGEI 1FIEA 2VZ3A 1MUJA 1OTSD 4HXBL 4PB9L 1LEIA 2PUQT 2M2DA 2XN9E 4YWGH 4BQ6A 5F9DC 1KCRH 1T66D 2JB6A 4TSAH 3SCMD 4AEEA 5CSGA 3U79A 1BBDH 4YHOH 3PWPA 2DQJL 2BNRA 3MJ8B 2GTWA 4BH8A 5BVJA 1P1ZB 1BOYA 3RKPA 2DMKA 4LLAA 1UVQB 2ED7A 5B21A 2YPKA 3OQ3B 4MJ5B 2F8OA 1BLNB 3P9WB 4P9HC 5CP7B 4MS8D 4FQ2H 4HK3N 3G04B 3MRIA 4XCEA 4MXQD 1A2YA 3EO1A 1R3IL 3UC0L 1EO5A 2C3WA 4LEOA 1OB1B 2XXMB 4Y2OA 4YXLH 4QXTA 2HFEB 4PJEA 3IXTA 4PG9B 3E6HA 3VA2C 1W72A 1FFPB 4OQTH 4RBPK 2QHRH 3M1BA 4WI8A 3VXNA 2DQIL 5J9PA 4KKAC 5CGMA 4F7CB 4EDXA 2ICWI 2R0KL 2WM0A 3O3BB 4TOYL 4AMKH 1VACB 1ONQA 3N0PB 2CXKA 5IW6A 4HUVA 5LQBH 5I30L 1ORSA 4O2CA 3TYFB 1DJSA 4D9RD 3QDGB 5MP6L 4KVNL 4X6CE 3U0PA 3RZWA 2VABA 3UDWA 1AD0A 3OX8B 4F15C 3QQ3B 3GUTA 3LV3A 4X6EB 3DXAD 5GRZA 4KMLB 2DLHA 4DTGH 3T1WA 3UTTA 4FTVE 3V6OE 4F15B 5JW4R 3CC5B 1FC1A 1D5ZA 1FV1A 4JB9H 3P11L 3VRLF 2C4FT 3I9GH 1WQVT 3GMPA 2VN7A 1RIHH 3NCJH 4JZNA 1A7NH 4OF8A 5GRYA 3H7LA 5E4EC 2ORBH 3UJTL 2NY6D 3QIBD 5A2LH 4MJ4A 4BQ9A 4XNXL 1CBVH 1INDH 4F57L 4QTIH 4WENB 2VAAB 1GIGH 2AV7B 1G6RL 5A16B 3ZTNL 4YHLL 1OLZA 3DX6A 5ENWA 4GXVH 5F9WC 1MRDH 4ZXBB 1H3PL 1UH2A 4L8SC 4NN5C 1BOGB 4WY7L 4F8QA 3GRWA 1CVRA 1YPZE 3Q2CA 1KJ2A 4LU5H 5F9WB 2FO4B 3VD5A 5LGKA 1YNKL 4NN5B 4L8SB 4ENED 2GJ6D 5IF0A 3R1GH 3NAAH 3DRQA 1S78C 5I74C 1H0DB 2E9WA 1K4CA 3HG1A 3HNVL 2IF7A 3VXQB 1T83A 1ZLSH 2A38A 1SBSL 5D70L 3MLSL 5EU3B 4ZOAA 2H41A 4S10A 5ID1A 3WFEH 4B53A 1KTLA 4PY8I 5DJAB 4NQSB 1G9ML 1J0YA 1CE1H 4QRSA 1T1YB 4NP4H 1C8PA 1DQQA 1ZXQA 2Q3AA 5B3JF 4OD3L 1MAMH 1C7TA 4S1RL 3VXUE 2E7BA 4V2CB 4Y2DC 5IV2B 5GS0H 1RZJH 4GO6B 2NW3A 3MV9E 2R2BA 1UH4A 4BK4A 4PLOB 4YXHL 3RAJL 5I19L 2Y06L 2X70A 4PS4H 1E4XI 3WKNA 1SJHB 3TBWB 4Y2DB 4RIRA 2J2ZA 1FVEB 5HDQL 4LQ1A 4YJZL 2CH8A 1A4JA 2CSPA 3T04D 1L0YA 1RUMH 5DRZA 5HYFA 4PJ5B 3O9WA 2IH3A 1LO2L 3JSSA 2BVOB 4YAQB 4MXVE 4EDWL 3GMLB 5LGJB 1XR8B 5E9DD 4MGXA 1ZSDB 3G6AB 4ZUWA 4QOKE 5J06A 3OB8A 2DJUA 4CVXB 4OZIF 1UACH 3C87A 2VO5A 1D5MB 4E5XA 1RJLA 4ONHB 2PW1A 4OZFB 5E6ZA 2F74B 2CLVB 5I8CA 1F42A 3CSGA 4Q58C 3B9DA 3X3FL 2X4OB 4LCCA 2ICWB 1BQUA 3HAEB 3ABZA 3MGOA 3SJVB 5GSRA 2GY5A 1VADB 3BRFA 3GBNH 2VZTA 4CW1B 4MYWB 3EOYG 2R56L 1T20A 1DCLA 3HE6C 3I50L 3O81A 3DX7A 1D5IH 1OAYL 1UXWA 4JFOB 2IBZX 1AI1L 2PXYA 3KXFA 4MJIA 4U1LB 4S1SL 4K3JH 3EOBA 3ZMRA 3C60A 4X5XA 5FYLL 4WW1A 1FLTX 3GI9H 5F97E 3SN6N 4PUBL 3MOBL 5E8OA 3MRQB 3ZO0A 4JPIA 3DYPA 1QNZL 5MERA 5J1TC 1WLHA 3QPQC 4P46D 3DHMA 4TPRH 4XPTL 1IC4H 1V5JA 2EDEA 2AQ3A 5SWQA 5TF0A 2AJVL 4OFVA 3S3SA 4OLWH 5MENE 2DRUA 4JN2A 1KLGB 5CJOL 1ZHLB 3JWOC 3NFSH 3BEWA 4HD9A 4OLVL 1IBGL 4PRIE 4DGYL 2MQ0A 3ZSSA 3BDYL 1N7ML 5JUEH 5T3ZL 4O2EA 4UOW1 3QDJD 1KN4L 2FH8A 4UV4H 1GPOH 2P5WA 5DEZA 1NGQL 1UT9A 4HUWA 1U92A 3LN5B 1CXIA 1NMBL 4EI5A 4XWGL 3HZVA 3UZQA 1NAMB 3G5ZA 4D9RE 3IF1B 4H5SA 2P5EB 2L0DA 2ITCA 3H0TB 4KKBC 4X6DF 4JCLA 2E7CA 1KPUB 1VFBB 2CLRA 3BXNA 5T5NF 1YECH 2GSIA 4IEFB 3TPUB 1DQLL 3OXSA 4F7EA 3MRPA 3WD5H 2MCPH 2RBLA 5FO7B 2C3VB 5I8EB 4UNUA 1T1WA 3RNKA 1C12B 1KIRA 3IJSA 2Z92B 1JPGB 4P4KC 3LS4L 4G5ZH 1LO5A 4X99B 4MA7H 3GIZL 3GMRB 5EU7E 4P4KB 5IW3A 1KPRB 4F7PB 4IDJH 5IB3A 4M03A 2W9EL 3VGEA 4UUJB 1U2CA 3MACL 4KC3B 3UTSA 1KJ2L 1HIMH 3OGCB 3BZ4A 1U93B 3RVWC 2VZVA 3CSYA 2ARJB 2YKLH 1I1RA 2WW8A 2GJ6E 5BJTB 4MB4A 3GKWH 3SDXB 25C8L 1T3FA 3MLRH 1C16A 1RUKL 3GMQA 5DHVB 3DO7A 4NUJB 1II4E 2B4CH 1EJOL 3D18B 1F3RB 3GJEB 1KEML 1Q72L 3ZDZF 5I1LA 1URLA 3QDMD 2XICA 1GRWA 1X7QA 3KPMA 4JM2A 1ZANH 4CJ0A 2C1PA 2BVQB 5DRWB 3MLTB 5I2IA 1ZEAL 3K4ZA 1ZLWH 4AIOA 4NFCA 3BUTA 4JFPB 2XKNB 4Z7QF 1UWEL 4XP9L 5I1KH 3X17A 4GBXD 3UTZA 4IS6A 5CD3B 4D0CA 1GVIA 3OAYH 1QTYT 2A73A 3AREB 3AM8A 4NHUB 3Q1SL 2NY0C 2UZXB 4HW6A 2YD8A 4OF0A 2RHEA 4YBQD 3IDNA 4PJBE 4NZTL 3C6LB 1CFBA 2NY0B 4JO2H 5KJRH 2NY4B 3BYTA 4JFFB 4RAVA 2BJMH 2JB6B 2XZCL 5IVXA 2G2RB 1U8KA 5F7UA 2VDLL 3IDJA 4OFIA 4XCCL 5DMIL 5DSCA 1MFBL 4TUOA 4P5TA 3V79C 5BVJB 3MRFA 3C5ZA 2WINA 3B2VH 2V2TA 2Q3ZA 2QADC 1WFTA 4H0GA 3RHWF 3WV0A 1G7QB 4ZPTB 1U8MA 3MRIB 4XCEB 1FGVH 1AGCA 2EDRA 2BNQA 3EO1B 3TCXA 3BGAA 4PRBB 2QADB 3IJYA 2V5SA 2J8OA 1A9BA 1PX4A 4LQFH 3MJ7A 1MFCL 4NKMB 1BQLL 3D0VB 4QXTB 1X4XA 3IXTB 3LQAL 4P3CH 2XWJA 1YEJH 3NMEA 2RCSH 3VMOA 2LV4A 5DVOA 5EZOL 3M1BB 4FQHA 3T3PE 3VXNB 3RWHB 1TQBC 2ZSVA 4K8RL 3QEQE 3LN4B 4O9HL 1OCWL 4U6YA 2O61B 2R69H 2DM2A 2VITB 4X6CA 1TQBB 5I75C 3GIVB 1V7ML 2FYYB 3FFCD 1ONQB 4KTYA 2DM3A 1NC2A 1MCPL 8FABA 5IW6B 4M43L 4HK0A 1S5HA 2EECA 3QXUA 4JGJA 1WIOA 3UDWC 3IDIA 4O2CB 1FPTH 4ZPVA 1HCVA 5GZOD 1FZMA 2R0WH 4I4WA 5DJ6B 3VWKA 1AD0B 5EU6B 4G8EA 3LV3B 4X4ZA 1D5XA 2X4NA 2XNAA 3L5WB 3HLAB 3N1QC 1FORL 1M7IB 4JREC 1N3NB 2R2HA 2R23B 3HNSH 2H32H 2VJXA 3IU3A 1MH5A 4JZNB 3LZFH 4LHUB 4MB5A 3CU1A 4JREB 2EH8H 4LVOB 3TJEH 2FX8H 3EO9H 5D7JD 3QUMB 4GH7B 1IAIL 2ICES 1NLBL 4IOIB 2JTDA 5J3HC 3P0VL 2BSSA 1KCVL 4AEIH 2AK1H 3BPCB 2YC1A 1KXTB 1JL8A 4R3SB 5ADOL 3MUJA 2W92A 1MJJA 3HMWH 5JOEA 1T83C 3RPIB 1TXKA 3DRQB 1BECA 4J4PD 5C6WH 1G7MB 5E8PB 3BGMA 4KWUA 3VXUA 3B8SA 1MREL 3VXSE 1XGPA 3VG0L 3BKCH 5ID1B 5D7IA 3D0LB 1MJ7L 1GL4B 4OJFL 3U4AA 2Q7YA 1CL7L 1FAIL 4JGMA 3NFNA 4XWOC 4OZ4A 4WO4D 1EHLL 1DLFH 1MI5A 2R2BB 4YHNB 4JLRB 4ODWB 4Y16A 3D3VE 4LHJB 1QLEL 2X70B 4HJJL 5E99L 2HFGL 4RMTA 4ODBD 1I1FB 2N56A 2WLYA 3O9WC 1RZIA 2CMRL 3S9DB 4HQQL 4AL8L 3RWFA 4QOKA 5LVEA 2EC9T 1E28A 2GSGB 2JJSC 2NZ9C 3UAJD 1F13A 1LEGA 5F7LB 3WIHH 4LLUB 3EYSL 1ZLVK 3WNKA 1B4JL 3UYOD 1F02I 3U1SH 2QSCH 1R3JA 3NPSC 4NT6A 3KLAA 4K55A 4UIMB 5D8JH 5GS1A 2NY3D 3R0NA 2B39A 5JHDD 4FFVC 3SOBL 1F3JB 1VDGA 2HFFA 4HC1L 1I75A 1RY7B 3IT8D 3SCMA 1J10A 1A5FH 1T0MA 5IJVB 1UEYA 1CU4H 3NPSB 4UQ2A 2ZUQC 4NWTH 1K8DA 1N26A 1BQHG 4UT7L 1TENA 5B3NA 4LL9A 3O45B 1FO0H 5F7DB 3LQAC 4WV1B 1NEUA 4XPAH 2EC8A 1OT1A 3FT3B 4YZFF 3NIGF 1BGXL 1KENL 3OR7A 2DLGA 2UY6A 3C60C 1S9WA 4K8RC 3C6SB 2PW2B 2FB4H 4LK4A 1G9NC 3O3AA 1LD9B 2VQ1A 3MR9A 4NDMA 4WCYH 4JDVA 5T33L 4PJHB 4LIQH 4N8CH 2VNCA 3TBVA 2NY2C 3TYGL 4JPIB 3R8BB 4LSDA 1Z9LA 3G6JB 4WJ5A 4WI4A 1T6VN 3L5JA 2NY2B 5IESH 2I27N 1FRGH 3RZCC 3IYLW 5T1MB 4JN2B 1OP3K 1KCSH 1UM4L 3O6MH 1KGCE 1RULL 1GC1C 5ICXA 1AJ7L 3HI6L 3VXPA 4NKIH 4PJAA 5JLZA 1Q0XH 3MTRA 3ALWA 2R1YB 5DQ9B 3RZCB 2MKWA 2IGFL 4HCRA 1QSFE 5JMRA 3OWEA 3FFCE 2I9LA 3TJHC 4O2EB 1I8IB 3FJTA 4DKAA 3CH8A 1RZFH 5EU5A 3VH8G 3G5ZB 5T3XL 1LO3H 2DL9A 4KI5C 4HKXA 1C5BL 3FO1A 2CLRB 3BXNB 4WW2A 1KC5H 3W0WD 4D9LL 3B4NA 1ZAGA 3QIBA 4MCZB 1GHFH 4PJFE 5IEHA 3KYOA 3L3GB 3DOSA 4HBCL 2C5DC 4JVPA 1VENA 4PJIF 3RNKB 3IJSB 3DGGA 1OOAA 1EPFA 1XCQA 1IQDA 3PDOB 2HH0L 4TYUA 5FV1L 2W0FB 3TA3D 2EYSA 3CVHL 5DJXB 4I2XA 2KZWA 4YGVA 2WK2A 3ZDYE 4FQCL 5CILL 4O51B 2GJ6A 1UB6B 2BNUA 2R4RL 4WDIA 4OLXL 4XMLL 2C26A 1XZ0A 3WJJC 5C07E 4JDZA 2EEDA 3LKRB 4PGDB 4YC2C 3CUPB 2R1XA 4MJ6B 4K3EH 2IPUG 4NZRH 3IFNL 1T3FB 4G3YL 2QQNH 2ZUWA 5B22A 3FCTB 2JK5A 5KS9F 3QA3A 2VDOL 1T7YA 3S4SB 3SDCA 4JM2C 5DEFA 4GRLD 1XGRA 3PGDA 4R96B 1K3ZA 5E8DL 5C8JA 2UY7A 3KPMB 5C0FA 4JM2B 3U9UA 1H3GA 1MJ8H 4N0UE 3UROR 5HI3C 1BVKB 2C1PB 5DFVD 3OJMB 3LH2H 4EKXA 5I2IB 3NACH 3ZKSD 2OCFD 3PJSA 5JHLH 5CD5C 1TDQA 4FXKA 4ORZC 4IMLA 4UT9L 3AM8C 1GOGA 1YNLH 2XN9B 2X4SA 5F1IA 2KZ1B 4F8TA 2XQYG 4D0CB 4KJYB 5E9DA 3FB5B 3U9PL 3W9EA 5JDSB 3BD4A 3L3JB 4XVJH 1CICC 5IMMA 2R8SL 1WIPA 1FH5H 5EB9A 3TBTB 1BFVL 4P5TC 4Z95H 2BY3A 4Y4KB 1CICB 3C5ZC 1BWWA 1ZA3A 3VGAC 3EKCA 1PDKA 2NR6D 1VEPA 4CADB 5GGVY 3DO3A 3F6IA 5TE4L 3MRFB 2DAVA 3C5ZB 2V2TB 5D7SH 5JNYA 2X41A 1FNGA 4X6FA 3VGAB 5GJSL 3UTQA 4Y5VA 4WEBH 4LRNL 1U8MB 2FEDC 2BFVH 2PR4H 4MZ3A 5TJWK 1AGCB 3GSQB 1FCCA 2J7LA 5A2JH 5DJCA 5JOFA 5LJYH 3SDYL 4APQB 3EYUH 5E8NB 5T1LD 3DI3B 4QF1A 4O4YH 1C5CL 5DLML 4KV5F 5EZJB 3RKDD 2R2EB 5D2LA 3QG7L 4FQHB 3T3MF 4D8PB 2X42A 4P46A 2FH6A 4KHTH 3LIZL 1OQXA 2X4RA 3E2HC 4X6CB 2Y7QA 2VDRH 1EO8L 1S7XA 4LMQE 4KUCD 1NC2B 3V6OC 8FABB 3KLHD 4BQBA 2YPLB 3E2HB 1NL0H 5DD0H 2BDNL 1OAQH 5JR1L 3VWKC 2EIEA 5ILTL 4FTVB 3QDJA 4F9LA 3KVQA 2XYCA 1CDCA 2X1WL 1LILA 5DTFA 3TPKA 3MA9L 1YJDL 2IMMA 2KDGA 2YUVA 4HCRL 4WUUD 4G8EB 4QRPD 1NUNB 3QI9D 3CLEH 5DD1L 3DIFA 1D5XB 2DL2A 1DSFL 2X4NB 5EDXA 4YHML 1TJHL 2HRPL 4JQIL 1JYXA 3BPLC 1KCUH 2H8PB 5EORH 1LNUA 2E9BA 2Z91B 3BPLB 1YPZB 1L4IA 1PG7X 5EPMB 5K59F 2BX5A 1U8OA 2JCCF 3SKMA 1KV3A 1MCHA 4PRPD 1LE9A 4NIKB 1YEGH 32C2A 3QIWA 3HNTL 1QLRA 1IZJA 5JIKA 3V7AE 2YC1B 1N5YH 1MCWW 5A2IH 3K3QA 4Z7OE 3T8XB 1CD8A 5GZNC 1MJJB 3VFRA 3J7HA 2RB8A 5TDPB 1JRHL 3ZHLA 2DMCA 3Q6GL 3VWJC 3U36A 2FJHB 4ESKA 4OV5A 4UINH 3BGMB 1RUQH 3S34H 3VWJB 3RWGA 4MQXC 4GKSB 1H3TA 1XGPB 5I1EL 4KJWC 4OBRA 1FZKA 5E2UL 3MV9B 3EJYD 5A1AA 1TZGH 3D3VA 5KN5B 2FO1A 2X6MA 3BDXA 3WNLA 3GMOB 1DN0A 4UTAL 4ZFFB 4Y16C 3QDMA 2DS4A 2VDNL 3QAZC 4OAWA 4KMTL 4NQDE 4OZ4B 5CJQL 1Z5LA 3MV8D 2HT3D 4LNRA 5FHAL 5LBSH 3BP6B 4Y16B 4BJLA 2ERJC 3QAZB 4TVPH 3FT2B 5HGHB 3DYOA 1L0QA 4ZYKB 3RVXD 2XZAL 3O8XD 4GBXA 4QOKB 2ADJA 2ERJB 5INDA 3RWFB 2GUOA 4AY0A 1XCTA 1OTSC 4LLDB 1DLHB 4LSTL 4NNYA 4LSRH 2DQFB 4N90E 4OZFG 4LEXL 5GS1C 1U8PB 1T66C 4U1KA 2VLMD 2XG5A 4IDLA 1RJCA 3Q0HA 3Q6FA 1I8MB 3D48R 3CK0L 4RWHA 4NT6B 5GS1B 5E24E 4EBQH 4XMKL 4RGOH 4IHOA 5ALBL 2IEPA 2I5YL 1T0MB 5EOCL 4YDLC 1FL5B 4C83B 3O2DH 4UQ2B 1JP5A 4UDUB 1AGEB 1F4XH 1K8DB 3A67L 1QYGL 4MS8C 2YD9A 2EE6A 1JNNH 4MXQC 4KPHL 2DBLL 4OZGE 4YDLB 3TH4T 4A6YH 5DMYA 4DZBA 4NO2A 3UJJH 3O3DA 4PRDA 1J11A 3OAUH 2OL3H 3VJ6B 1NCAH 4ODTH 4CVZA 4FFYH 2FATL 4POZD 2KPNA 3RWJA 3KG5A 3V52H 4HKBA 1B6UA 2G9HB 3C08H 1PZ5B 3O3AB 4R0LA 2VQ1B 4ELKB 3HRPA 2H26A 3JXAA 1HWGB 5MENB 3NIFE 1IAMA 2XRAH 4L9LA 3TT3H 2FLBT 3I2CH 4NRZB 4RAUA 4Z0BH 5D93C 3RDTD 2AEWA 3LS5H 1OWRM 3BE1H 4JE4B 5C2BL 2ZPKL 1T1XA 4JPKL 3UPRA 1K4DA 4K07A 1TVBB 1I7UB 4PRIB 3FFCA 3FTGB 5D93B 3V5KA 1LK3H 2ZUUA 4PJ7F 2C3HA 4N9GB 1A14H 1JGUL 1HCFX 1NCBL 5ICXB 2ESVD 5CKAA 4JFYB 4MLIA 4HMDA 4P48A 3C5SA 2I9LB 1B0GA 1HEZA 4HKJB 5EWIL 2FIKA 4XBGA 4NQCE 5FGBA 4PJFA 1ZHBB 4DQOH 5DJZA 3EDJA 3ELAT 4WW2C 3KYNB 3P4MA 1QFUH 1UQSB 3QHZL 3GJFK 3LN9A 1U8QB 2NY6C 2Q76A 4WTZA 4EVNA 4HKXB 5DZLA 5EU7C 5IQ9A 4HS8H 4WUUE 2NY6B 4YPGB 5IEHB 2Z9TA 4NJAH 2LU7A 1TFHA 2AQ2A 4PY7A 2NYYD 3BN9D 2VOTA 4IOFC 2BSTA 5ESVB 2D7TH 3MOQA 3VI4E 1MQKL 5D7JA 5D5MF 5GQBA 2CIKB 2D7OA 1FAKT 4XCFL 1Q94A 3KPQA 1ZHKB 1XCQB 2IAMC 2NLJB 4ENEC 15C8L 1NANI 2PCPA 3BO8A 4UNVA 1NJ9B 4GMTH 2GT9B 2K9UA 1A3LH 2IAMB 5F9OL 1IC7H 3LCYA 5JQ6L 2GJ6B 2WUBH 1S7WB 4PRPE 5IT2L 2OYPA 4WDIB 3H7BB 4J4PA 2VUOA 3BYYA 3WXVL 3GHEH 4KK5D 4KUZH 2EDDA 2DLEA 4XH2A 2HMID 5C86A 3MXVH 1MCWM 4ELMA 5GRUL 1EXUB 3LY6A 2R1XB 3DVGB 1KG0A 5E00A 1Q9LA 3SDCC 5DMKB 3CDCA 3VMNA 2WBJD 3TWCH 2LAAA 4LDOB 2V9QA 2P8LB 3QA3B 2B2XH 3SDCB 3ULVE 1I1AB 3MUZ1 3FB6A 4WFGD 4QHNB 1CLOH 3CFCH 1XGRB 3PGDB 4WO4A 4IRZL 4NFBA 1IM3A 3LRHA 4R4BB 3U9UB 2XTJD 1FDLH 1JWMA 2G60L 3K2UL 1UZ6E 5EA0L 2X05A 2HT2D 5DURD 2P44B 3MV8E 4LGPB 4PJBB 2X4SB 5F1IB 5E5UB 4OZHE 3K46A 2IWGA 1UJ3B 1XEDA 4PGCA 5FEBA 1MWAL 3IETB 4B0MM 3VW3L 4DVRL 1JV5B 5C08D 5JHDA 4JRWA 4EZMA 3T2PA 1A7PL 3QIUC 1DEEA 2DQUL 3IS1X 5IB1A 3A6CH 1T7WA 3V4UH 4O00A 5FK9A 1ZA3B 3GO1L 3QIUB 1EAPB 5IR1A 2OP4L 1EA9C 2DTML 3EZ8A 1HHJA 4YHZL 5FF6A 4HF5L 1FNEA 3ESVF 2JB5L 4M9OA 2YOCA 1NCCL 3KNBB 3LKSA 4RNRB 5I6XC 3CPLA 2A77L 3W39A 1HSAA 4K3HA 2DJ4A 1D6VH 3QEQB 4JHWL 1LEKB 5I6XB 4JJ5A 5F7EH 4P46C 3MLYH 3TFKD 2X2YA 4G6FD 4NRYA 1N0LA 3QUXD 1A4KB 3FQXA 5HDLA 1ZLUH 4P46B 3DUUB 4GFTB 4HFUH 2EDFA 5DMGD 4NQXA 4MXWH 1NAML 5E08H 2XFXA 2X4RB 2GAZA 1MHEA 4XBEL 3BOVA 3BEVA 4F9LC 3EIFA 1HYSD 4P23D 4KTDL 5F9JB 3L5XH 3L9RB 3U0TA 3VCLA 4YBHA 1OP9A 5IKCB 4TSCH 5KBNC 4OBSA 5BOPA 4JFQB 1RK1A 3PWUA 5C09B 5DTFB 2XWBB 3Q3GA 4AM0A 4XZUB 5GJTH 4OM0H 2ZUYA 1NUDA 4P2QB 3QFDA 3DVNA 3HS0A 5I9QC 1PKQE 4I1NB 4XP4H 4X7FC 5HYJE 5E6IC 1IGML 1J0IA 1MSPA 4ODHH 1PYWA 2ARJQ 3TCLB 1LE5A 4FP8H 4QYOA 5J8OA 3BW9A 5E6IB 3UYRH 3PGCA 1E4XL 1WEJL 2E8ZA 5GRJL 3T0ED 4YDIH 4M7KH 3QIWC 1N0XH 4Y1AD 5JIHA 3G5YB 3SKMB 5I1JL 4OQ1A 3TA3A 1TJIL 3WO3B 2FBJH 32C2B 3AY4C 3HFMH 4G9DB 3QIWB 3NGBC 1JIBA 4LBEB 1UH3A 3DBXA 3O0RL 5DR5H 3VXSB 5ESAB 1J7VR 5EFIB 1FYHB 1JFQH