3G5XB

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
DVQLQESGPSLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYISYSGNTRYNPSLKSRISITRDTSKNQFFLQLNSVTIEDTATYYCVTAGRGFPYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 806 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 216
sequence length 216
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xB01
1RZ7H 1KEGH 3REVB 3MRPA 3TPUB 1AP2A 2FJHA 4KTEL 2EIEA 1CK0L 5FOJA 5HDLA 3QDJD 2P47B 3U46A 3K1KC 5GS1B 1RVFL 2WK2A 1H3GA 5TDOB 1A3QA 1AGFB 3L3DB 4IOFC 3PQYD 4TULH 2Y07H 4YBQD 5DFVC 3DO7B 2W65A 3JWDL 5L2KD 4K3GA 2XA8H 3WEXB 1J9CT 4X7CC 5F7EL 4K3HA 3ETBF 2I24N 3TVMA 7FABL 4YHIB 4XWOC 3CZFB 2QV2A 2WWKO 3RFZC 1FG9C 1FFRA 1NUNB 5DJ6A 1I8MA 5E6ZA 2J8UE 4CVXB 1CR9L 2VQUA 1WT5C 4LQFL 3QCVH 2CKBL 1UWGL 5DK2B 4U1GC 5TH2B 3ARDA 4LSQH 4IRSA 4PGCA 1FNEB 4FTVE 5DJ2B 1JK8A 3TN0D 1U8LA 3TBTA 3QXDA 1T1WB 4IM8A 3O3EB 2LVCA 1PG7X 4Q9QH 1ERNA 3ULUF 4OAWA 43C9A 2ZCKH 1NGQH 4RCAA 3GMLB 3IETB 5C6PB 1G0DA 2NCMA 4GG6E 3JVGC 2X4OB 3U36A 3VWKD 5LVEA 4YAQB 5I74C 3HAEB 3ARPA 3UO1L 4M8VA 4OT1H 4WJ5B 5GGUB 4JJ5B 4JFZH 4AM0B 2BRQA 3PWJB 3SKUD 4RGNC 4PRDA 3BPOB 2HA1A 1HEZA 5ANMB 3WFCL 1AQKH 1NGWB 3F7VA 3OR6B 4CADB 4Q74A 1TZGH 5C07A 2DI8A 4JPWL 2Y5EA 2CR3A 4XC3L 1YMMA 4NPYB 1SMOA 5BZDB 4MCYB 4K3EH 4TSCL 3DRQB 1KPUA 3RX7A 5J8OA 3J7HA 3FO0H 4WHCA 5I9QB 4PIRF 3QEUA 1CYGA 4ZUTB 3RNQB 5TE6L 5LXGL 1KNOA 4F15B 3P73B 1FO0B 3BMWA 1OLZA 3I6KA 5ERWA 3SKMB 4C54A 1KG0B 1EXUB 1WK0A 3SOBH 4V1DD 2FJFB 1L6XA 3SDYL 1J87A 3VDBA 5FYJE 3DOSA 5SWQB 4JPVL 2CIIB 2HFTA 2F53B 1RIHL 1JHTA 2FECL 1JPSH 3BD5A 3TA3D 4HMCA 4HWNA 2VZ3A 2D0HA 4PJFB 4RX4D 4XPGL 2HRPH 4BZ1H 5C09E 4Y1AB 3HG1E 3QSKB 1RJCA 1AC0A 3MLYH 3IKCA 5D8JL 4C56A 1TQBC 1AO7B 1ZT7A 1NMCC 4U1KA 3WBDA 1ULVA 2XTJC 3O6KH 3BZEA 3B9KA 1U9KA 2P45B 2D4DA 3KYMA 3QDME 5JLZB 4ZD3L 1WV7T 1ZAGA 4PP2B 5EUOF 4K9EH 4L29A 3SPVB 3HC0A 4UT6L 5BMFH 2AXHA 1OB1A 5L88L 3MGOA 1JN6A 1UKTA 3PWUA 3LY6A 4HUMB 2MTPA 1TTFA 4DCQA 3MV8A 1T66C 3NGBB 5D1XD 1MJJB 1DEEA 4K71B 2ARWA 4G5ZL 4LSPH 1NBYA 1UWEH 3GB7A 3S6CA 2W9LA 1KT2A 3ZYOA 4MXWH 1S78D 1UACL 2I60L 3D3VB 4TVPL 4WO4D 5GRUL 3WHE0 3CSBA 3D69A 4HFUH 3WNLA 2Z0BA 1DUZA 5E6YA 5MEND 5DTFB 2AV7B 3P77B 4ZFFA 3BUYB 1SYVA 5IROA 5C0RH 3NIFF 2EKSB 3SKJL 1OARL 3S35H 3K7UA 4PLJD 3RL2B 4PGDA 2R4RH 1H3WM 2ORBH 2PYEE 5BCAA 2VLJA 2H26A 4YE4L 1FSKB 5JOPD 4UV7H 5CAYB 4YZFE 4NO5A 1TNMA 5E8DH 3BZ4B 4WWID 1YUHB 1MHPH 3RIFK 2LVEA 5I8EB 2DQDH 4GOSA 4LHQB 4OGXL 4ZMAT 2JIXA 1J1OH 3RVTC 4PJ5D 3EBAA 2JJUA 2GTWA 4ZFOL 4BELD 1MH5B 1MJUL 2B4CL 2C9AA 2FD6L 4OGAC 3MXVL 3KVQA 1NBQA 4YFDB 3QXUA 1HI6A 2VXSH 1IAOA 5DI8B 4BYHA 2CKBA 4X98B 5JOFB 5IF0A 4Z18A 4NKOA 4JREC 4LLWA 3O9WB 3T04D 3ULUL 3DHJA 4UNVA 3JXAA 3PABB 3ARVA 1TVBB 4P3CL 4PJBE 5K9KB 4GW4A 5FA3A 3KPPB 2C1PA 1BJMA 3V4VL 4LLYA 5IFAL 4LLQB 2HH0L 4L3AA 1C1EL 4OJFL 5JW5A 4F2MA 3CVHA 2HVKA 1QSFE 5D7SL 2X89D 3F62A 4MNGE 3S8WA 1RUML 3FQXB 2ERJB 3EYVB 3D85A 2E7LA 3G6JF 4PJCE 3TLRA 4X6EA 3WIFB 2FGZA 5KVGL 5M95B 5BS0D 4OD1L 3BYTA 4X0KA 5F8RC 4KKLC 3B4NA 3GMPA 1FGNL 5L6YH 3CDGA 1YJDC 3MCLH 3HC4L 5IHZA 3KYKH 3H3PH 5IMKA 1JTTA 3GJFA 4PB0H 4N0CD 4ELME 3RVUD 3SJVB 4JKKA 1FFOA 4RRPA 2PR4L 3TPKA 3W9EB 1E0OB 3OKDB 1MRCH 4N9GA 1SM3L 5ESVA 1MRFH 3OPZL 4W81A 3CX5K 3KYOB 4E41D 1S9XA 2IALB 4PJHB 4X6DB 3V2AR 4E42A 5LGKA 4R0LC 4MD5A 3GSOB 2CLVA 1QBAA 3IU4H 4TUJB 5BVJA 4ERSL 1NFDB 2ATPA 4NN6C 3LIZH 2DMBA 1B0GA 3KPLA 4L8BB 5B3JE 4Z8FH 2VDPH 3VXPB 1FCCA 3ZE0F 5AWNL 4WENB 4EBQH 2BOBB 3ZL4L 4M5ZL 4KQ3L 2VDQH 5DQDH 4I0PB 3EYUH 1JV5B 3BE1H 3IAQA 5CJ8A 3ARFB 5ID1A 1JTOA 4YH6A 4HZLB 3GGWB 5GS3A 5GRVL 2AK4E 2F5BL 5ACLA 2X1OA 4ZOBA 1QSEA 3Q0HA 1SEQH 4XC1L 5JW4M 1OTSD 1R24B 3N1GC 5T3XH 3TESA 5FYJU 1HYSC 3GSUB 4X8XA 4XPHH 3FHQA 3PHQA 1CBVL 2VDMH 3P9LA 1I7RA 5BO1H 5IK3A 5F7DB 5EFIB 2APBA 1WZMA 1G0YR 4JO4L 4OZHB 1TTGA 2W91A 1V7MH 2ZCHH 2HWZH 3OKYA 4HPYH 5IG7B 3KPOB 3FB6A 4GMSH 4BFIB 3MRNB 4BUGA 2IPUK 1WIPA 2CRZA 4G8IB 5I19L 3TCLB 3ZDZF 4FFZL 2DDQH 5F1NB 5ANME 2JJWA 4F58L 2HTKD 3QHZL 5CHNB 1G9NH 1KN2L 3O2WL 5MHSE 3ARGD 1U8QA 3MFFA 4HJJH 3C5ZD 3RY6C 3TJHD 4D0BB 3BIKB 4XVSL 3QI9C 1IQWH 5F72S 3KLHD 4W6YB 2BVPA 1GC1L 3NCBB 1Z9MA 1RI8A 2J7LA 5SX5H 4AIXA 1V8HA 3TC9A 1TVHB 1T5WA 3FTGB 1C5CH 1CIUA 1DQMH 4LVHC 2GTZB 4ZFOA 5D7JB 5HI3D 5CIPA 3AFLA 5E5RB 2R0WL 3HNTH 4HKBB 3MACL 2ADJA 4Z7WF 3ZSSA 2XTLA 4ORZC 3TH2T 3VFSA 2D0GA 4PR5B 5C71A 4R4FL 3LKNA 4JQXC 5ICYB 2O61B 4LFHD 1MRDL 2I9TA 4OUOA 1NEZG 1LE5A 1C5DA 4FZEH 5D2LE 2N7AA 1F4HA 2VL4A 4WI7A 5A2FA 1U3JA 3EDFA 5HGGS 1G1CA 1RJZB 1Z0NA 1FL3B 1P4IH 4WHDA 4P23D 4YHML 1MUJA 2Q8AL 4ELKA 3QR2A 2W38A 2Z35B 1JYNA 3EKCA 1IFHL 4D9QD 5IQ9B 4WUUB 1HHHA 4HS3B 4BA8A 3QRGL 4F7EB 2CDFA 2AJ3B 4YR6B 5GRJH 5T3XE 1ZHNA 1QLRB 2R0LL 4MXQC 2DQCH 5EOTB 3U0TA 1QRNA 4OZ4A 3MNZB 3MGTA 2VDLL 1IJ9A 2OTUA 5MEPB 2NY4C 3ES6B 3MROA 5CGMA 3BH9B 3MV7E 3VXSB 3MCKB 5BJTA 1MCLA 2J5LC 1DDHA 2B0SL 3QUMH 3X12A 1AGDA 4NUJA 5C0DA 3FO2B 2VABB 2HN7A 5DJAA 1D6EB 4NYLA 2VISA 2XPGA 4NSKB 1T3FB 32C2A 4RMRA 1AH1A 3C87A 4ZTOH 4YDJB 2XZAL 3FT4B 3ULSB 4OZFB 1YEGH 1DE4A 4MJIB 3LEVL 4LLMB 4PJ9D 2VLLA 4G6KH 3E6HA 1K4DB 5C0ND 1X44A 5HXMA 1QSVA 1P4BL 1G9MH 5B8CB 2FHFA 2AJUH 4L4VD 5D1QD 5TF0A 5EH1A 2AV1B 3ZDYE 4XVUC 4L8DB 1XGQB 5CFHA 5I8CB 4Y4FC 1JNLL 2Q6WB 2D7TL 3OX8A 1RUQH 4HS8L 1ZANH 3QIWB 3GSQB 1BFVL 1DCLA 1JHKH 2FIRT 2PO6A 5KVDH 1JZ8A 2GY7B 1OPGL 2BOCB 4OD2A 1P5VA 5EUOA 1HXYA 4DEPB 3DYPA 1IRAY 1M1SA 1NANH 4KC3B 3V6OE 3STZB 4LIQL 2OI9C 4UQ2A 1ZT4A 2YPLD 4UIMA 3SE4A 4EI5B 3ZKND 3RX5A 3GEWB 2ICCA 1W8OA 1F4WL 4OCSH 1P84K 4LKCB 4YGVA 4YHPB 1F11B 3WS6C 4JFFE 3D39E 4JFQA 3VFPB 5AG8A 5FEBA 5LQBL 4JRYA 3M1BB 3ARED 3QRFM 1AD9B 2NY0D 4TPRL 4YXHH 4LVOC 1QBLL 5M7QA 5EORL 1VA9A 1MCPH 3EOBB 3HZYB 3HZKA 3WNNA 1I9JL 3LS4L 1J05B 4PG2A 3LEXB 1WC7A 5CKAA 1MCRA 3L6FA 1VEPA 4PRHD 4XXCA 4HIHB 4MSWA 1J11A 2AJVL 4HX1B 2G75A 1XIWA 3IYLW 3MRMB 5F9JB 1D5ZA 3V7AG 1R5VB 1M71A 1PX4A 1A14H 4JRXB 1U8KA 4DKEH 4LSRH 2NY5H 3WS3A 1UZ6E 2OQJA 5I17A 4J3TA 4MAYA 5FO9B 4CVUA 4HCRA 3RGHA 4AJ0A 3HI6L 4QRPB 2Z92B 3B3IB 3EO1A 2XT1B 4MQ7A 3G08B 4RGMC 2RFXB 1DBML 4PJAF 5B3NA 3GMNA 4Y0GA 1LEKB 4TUOB 2ITCA 4Z77A 5TGBB 1KBGL 2WWKT 2X7LA 3VGBA 4I3RH 1B9ZA 1X5ZA 4NQVA 5E99H 2J6EA 1FL5B 4NGHL 3O0RH 1XGYL 5B4MD 1YMHA 4PJEB 2H3NB 1T6VN 5KSBB 2NXYD 4X4XB 2NW2B 4EN3C 2VXUH 3NAAL 3T2OA 2B1AL 4Y4KC 3IFOA 3G5ZA 1KPRB 2A6DA 2YBRB 5DQJA 1RZGB 1X5KA 3GK8H 5E9DD 1DVFB 2MPAL 3QNXB 2QSCH 4MD0B 4NQCA 1FAIH 3B6SA 4JGUA 3SEPA 1H5BC 3B9VA 5DMKA 5DJYB 4H25B 1CVRA 1KFAL 5DMGD 1HN1A 1IC7H 4XZUA 1ORSA 3DYMA 5C0EA 4I0KA 3C8KB 2OSLB 2H1PH 3UTOA 5BRZA 2P7TB 3VD9A 3CMGA 5D5MB 1KB5H 3MRRB 1KIPB 2IANB 2O93L 1FP5A 2IPTH 2FEEI 3VGAC 3MRLA 4HWZA 4Z7UF 2H2SD 1K4CA 3WNMA 4KJWC 5F6HI 1HSBA 5D6DC 5IEKA 4HUVA 4RGOL 2AJSL 4OZHE 3MRFA 5AZEL 1GPOH 4MNQB 4QRSA 4G8GB 3TZVD 1N3NB 1OAZH 2NYYC 2Y36L 3QXVA 2E9WA 2F19L 4P57B 3IS1X 1UWXH 5JPNA 5IGXL 1KXQE 4MYWB 3UTQB 5DF0A 2PYFB 4YHOL 4KAQH 3V6ZA 1ES0B 1I8IB 1IBGL 2FBJL 3PXJA 4M1DH 2NNAB 3O2DL 1CVSC 3KPQB 2XKUA 1QQDB 2V2XB 3IFNH 3RVXD 2AEPH 3C2AH 3MNWB 5IM7B 4ZS6C 1DBJH 3D0LA 2WNGA 3O4LD 2WUBL 5ISZB 1HSAB 1JGVH 3ILQD 1NAMB 4NT6A 3ULVC 1NCCL 1OW0A 3BKYL 4HUUB 3LQAL 1F4YL 3IAPA 1BHGA 3V5HB 3MJ9H 1I7UB 5KAQF 1K3IA 3FQUA 5LGHH 2NX5A 5JNYA 3IXAA 2OL3L 3T4AA 4DN3H 1LO2L 4FQXD 1TVDA 2Z4QA 1HH9A 1NC4D 5EUKA 3SDAC 2QR0B 3L5XH 4IIQC 1CN4A 4K7PL 2FWOB 1BBJB 4LLUA 5DJDB 5JXED 1P4LB 4NO2A 4QOKA 1BD2B 5FF6A 1IGFH 2FSEA 1J18A 3HC3H 3HTLX 4BK5A 4XBGA 1WZ1L 5FCUH 3E3QC 2HJKA 3PL6B 3LPWA 4R9HA 1OSZA 4NQDD 1HKLL 1D5BB 4L4TE 1RUKH 5T33L 3MUGB 2YXFA 1ZHKA 3N06B 1NMAH 1FYTA 1ZSDA 3VXRA 35C8H 3HMXH 5E5MB 1LK2B 1KJVA 5SV4A 4JVUA 5HYSB 1ACYL 3CU1A 4APQA 3ARRA 8CGTA 1AFVL 2DIJA 5GGSA 5DHVH 4MXVF 2ESVB 4D9LH 4G3YL 4IOIA 1E6JH 1R3KA 1LO3L 5D9SA 1YEJL 1UKSA 3OZ9L 5SX5K 5LJYH 4KKAC 2B5IC 1PD6A 5F6IC 3RDTC 3WN5B 5MEOA 5F7HA 3VD7A 3UPCA 3VW3L 3PDGA 1D9KB 5HI5D 3IDNB 3RTQC 1FQ9C 1FVCB 2EO9A 3U7WH 5F70A 4CVZA 3DRTA 5E94A 5KTEL 4JFPA 5IMMB 4U6XB 3CK0H 5CILL 3OJ2C 1Q9OA 4CN6A 5LG1A 5E1HB 2VLME 4OKVA 3C6LA 4GS7B 1FRGL 2DLFL 4RRPG 4J23A 1NCAL 2VH5L 3L3IA 4TTDD 1T04B 2FEEL 3GSVA 4HIJB 4HKZB 2DOCA 1FPTL 3EDJA 1CGUA 1BX2B 1XGPB 3CX5J 3KJ4B 4Y16B 5TQ2L 1R6VA 1CFTA 2KDGA 1JNNL 2GK0B 3LMJL 5EPMB 4PB9L 5DJ0A 1QOKA 4Z7WA 1T03L 4DTGL 1X5JA 1I1YA 1GHFH 4I1NB 1CXLA 5IVXF 3VXUB 3LKOA 3KHOA 1BLNA 5I1LB 2ICEB 1G6RA 4GAGL 1YPZB 1T1ZA 3CNKA 5BZWA 3WLWC 1YYLL 3AXLA 2BC4B 5SWSA 1ZLWK 1YY8A 4AEIL 2C3VB 5IW6B 3REWB 4JAMB 4CNIB 4YWGL 1P7QB 1R3LA 1C5BH 2FO4A 4KGJA 5J56B 5DHYA 3QEHB 2XN9A 3RBSA 5K33A 2LAGB 1RHFA 1N64H 2QKIA 4P2OA 3BGAA 5DRXA 3QNZA 5J9PB 3BGMB 1YEHH 3IDMA 3LDBC 4M48L 3HA0A 5IB4B 4YXLH 2AJYL 3TBWB 3LN4A 1KEML 1XMWA 1RZJL 1LK3L 4N0UB 2IBZX 4IOFD 4YEFA 2FRGP 3LKRA 3VI3F 5DFVD 2BVUA 4O00A 5IMOA 5HY9A 3CFBA 3WMSA 1IM9B 4G9FA 1WFUA 1A4KB 4O2FA 4JQVC 1AGEB 3AMLA 1NUFA 4P2RB 2Q8BH 4FQCH 4M03A 1VERA 3IJSA 4GG8B 4IEFB 4HIEA 1NL0H 2J88L 4U1SB 3QDGB 2HTLD 4F7PA 3C5JA 5E8EA 4GRLC 3KR3L 1FFPA 2E5EA 4WGWB 5FUZH 4FXLA 3VD5A 2F53D 1S7RA 1ZA3B 3UJTH 3UTZB 1NAMH 3O2DA 2YKLH 2EDFA 1OAKL 2Z8VC 3I2CH 3O6FA 4ZTPH 4O4YL 5LGJB 5FYKH 1MY7A 2NXZC 3KPSB 4M93B 4OLWH 5ACZA 4ZS7L 2D03L 3BHBB 5DEFA 5AUMB 1HH6A 4Y1AD 1WIUA 5D7IB 3F12A 2P5WE 3WD5L 2R23B 2PW2B 3G5VA 5AEAA 1AO7D 2OJEA 1MREL 5DSCB 1A1OA 5DWUH 4GQ9L 4FQIH 3ZDXE 3BPNC 5J12C 1OHQA 5DRZB 1N7MH 4FNLL 4FXGA 2DQUH 3QEQE 4XVTL 2BNUB 5DJ8A 4LCWE 3MC0A 3PIQB 2QEJA 3UTTB 1TXKA 1MI5D 4GG6F 4GAJH 4RFOL 3GBMH 3KLAB 4NHCL 2EC9T 5JW4Q 4TRPH 2WBJB 3WFDH 3O4OC 2GCYB 2OXHA 3AU1B 4TSAL 3SE8H 5KSBE 4QCIB 5J1TC 5HHOA 1KOAA 1GXEA 4FQHB 5J1SC 3I6LE 3VXOA 4WW2F 4G8FA 4GRLA 4PGEA 2D7PA 4Z0XB 3D3VD 4Z95H 1TITA 3ARBA 4TVSa 2IQAA 1TQCC 2VIRA 4HT1L 1VFBB 4OF3A 4GBXA 4LHUA 4LF3B 3LRSA 3GM0A 4XHJC 1MNUH 5KSUA 12E8L 1UT9A 4PBVC 5KS9E 1HIMH 1U6AH 4U7KA 1QG3A 3NFPB 4MDJA 3QO0B 1IAIH 2A77H 2AEWA 3LS5H 4NQXA 1FZKB 1V7NL 2CKNA 3VXMA 1OD7A 1TPXB 3GM8A 4OF5A 1NDMB 3WYRA 4ZPVA 5HDOA 4P2QB 5CZVL 1MCCA 3TO2B 1T4KB 4DZBA 3TM6A 1D5MB 4PPTA 2ARJB 4MNQE 2X4RB 2ZSWA 1N4XL 5E6IC 2Z31B 2BNQB 1RV6X 3BP4A 4Y19B 2R0ZH 2YR3A 1MQKH 1NEZB 3T0EA 4JZOB 2HLFC 4X80H 1AJ7L 4NZUH 4AL8L 4KH2A 1EGJH 3H0TA 1S7WB 4I77L 4RISL 4PJAA 1BFSA 5KN5B 5ESAB 2HKFH 1XF3B 3VFUB 4XCEB 2N7BA 2EXWC 3BFOA 1LHZA 1LVEA 1IILE 1MWAL 2JB5H 2VL5A 3HZMB 4X4ME 1OP5K 4IS6B 4JY6A 1SJXA 4G7VL 3O9WD 3RZCA 3ZE2E 4CMMB 1UQSA 3UZEA 2CR6A 5BXFB 4OZGB 2YZ1A 4NNXB 4HUXA 3VGFA 1RJLA 4LSUL 5EZLA 5FYKE 1KCKA 3FCTB 1UH3A 4P9HH 3K46A 3TBVA 2VOTA 5H94B 4KUZH 3Q1SL 4PRPD 5CJXC 3FB7B 5HHXL 4XGZA 4Z76B 4JY4A 5E4EC 1T83C 4JM4L 1IGCH 3PUCA 2R2BB 5ETUA 1M6OA 5KZCD 5GGTH 3G5YA 1P9MA 3TO4B 5ADOH 4R3SA 4WWKC 3DV6B 4FQJH 4TNVK 8FABA 3AB0C 2YD6A 1QSZA 3MRPB 1F58H 2E8ZA 1P5UA 3L9RA 3DXAA 1P84J 1AP2B 2FJHB 1GAFH 4L1HA 2VAAA 3OKOB 3U46B 1ADQL 1S3KH 1OAXH 4HJ0C 5I1JH 3HE7C 5GJTL 4N90D 4KK8C 4Z7UA 5C3TA 2FIKA 4H1LA 4Z7QE 5FV1L 3Q6GL 5DT1H 3NFSL 3PWVB 2W65B 2R1YA 4WIQA 4YZFF 4CRPA 3RJQB 2XOTA 1ZWIA 4MAUL 1UM6H 5EU6E 3SJVD 1Q72H 1KIUA 1HWGB 3TVMB 4A6YH 3LH2L 4RA0C 1IAKA 5DJ6B 1I8MB 3SHSA 4NZDA 2EH7L 2VDNH 3INUH 3ARDB 2GEEA 4IRSB 4PGCB 1GL4B 4KJQC 4OLUL 4Y4HA 1JK8B 1U8LB 2DQEL 3TBTB 2VUOA 3QXDB 4NRYA 2LE9A 4PUBL 3ZZ1A 3P3YA 1FLRL 4M9PA 3P11L 1XGUA 5A2IH 1NCTA 3AS2A 3K81A 5FB8A 4OAWB 43C9B 1NC2A 4M43H 3ARFD 2ZUXA 4KRMB 1MIMH 4XCCL 5JUEH 4M7JH 4JLRA 1JZ4A 2HMIC 4TN9A 5F96L 4LVNC 2LTQC 4XPAL 3G5XA 1S7SA 4PRDB 4GW1A 1GGIH 1W72H 1I9IH 2UVEA 4RWYL 1Q9KA 3P0VL 4M7KL 5L7XL 1HEZB 1IGML 2GQHA 3F7VB 1U3HA 2PKDA 5C07B 3S37L 4NC2B 4NZTH 1YMMB 4JKPH 4UT9H 5EOQH 3X3GH 2VWEC 3HB3D 4ETYA 4YPJA 1KPUB 4U6TA 1QLFA 4K8RH 3DGCR 3QEUB 2Q3ZA 3DARA 3AAZA 3WDIA 1KNOB 5DD6B 4PREA 3U6RA 1CIDA 1MFBL 3I6KB 5ERWB 4QXUH 4M8QA 3WSQH 1NCUA 5DVOA 4IRJA 2BDNH 1AGCA 3C09C 2AJXL 1FC1A 1AIFA 2WQ8A 2AK1L 3WJJC 5HHVH 3LB6C 1JHTB 3PWPA 2EDLA 4CL7A 5FYJL 1EUUA 4OD3L 1T7ZA 4GAYA 2Z91A 1IEBA 1RZ7L 1KEGL 1LO0H 3BH8A 3U9PH 4JVPA 3VDAA 3IKCB 1ZT7B 3QDGE 5D7JD 3W5NA 3BZEB 1RY7B 3B9KB 4TTGA 4TULL 3TEUA 2Y07L 2JKXA 1BM3H 4L29B 1I1AA 3HC0B 4G6MH 1OB1B 1OQOA 3WFBH 3MGOB 3KPSE 1JN6B 2IC2A 2PF6A 3PWUB 5E8NA 2YUVA 3FFDA 2O26U 1V3MA 2P5EB 2Y6SD 3MV8B 4DCQB 3X14A 5IVXA 5HHME 5E24E 3VWJC 1UADC 1DEEB 4NNYA 4LARH 3QCVL 1F90H 5GS0D 1NBYB 4XB7A 2DD8H 2ADIA 3GB7B 1CGXA 2G2RA 4LSQL 3X17A 1CZ8L 1KT2B 4OLXH 1Z9LA 3I75A 4KUCF 4WUUD 1LD9A 3ZT5A 1DUZB 4Q9QL 1JGLH 1ROWA 4ZFFB 1SYVB 4FFVD 5IEHA 2EXYC 2ZCKL 1NGQL 1AR1D 4MS8D 2YPKA 3BUTA 4PGDB 4XNYH 1N6QH 2VLJB 5CZKA 2H26B 3W0WE 3UYRH 3DGGA 3PWNA 4NO5B 3QIUC 1GRWA 4QHLA 1U92A 4JHAL 4KJYA 4OQTH 4OT1L 4JFZL 3VXSD 5FYKU 5CEZE 1LEGA 1GOFA 3P30H 3D5OF 5I75B 1X4YA 4X9FA 3FQWA 1V5JA 2VTFA 2JIXB 2GJZA 1AQKL 2GTWB 3D1MC 3SKNA 5KJRH 1TZGL 3WUWA 3R0MA 4MJID 2Y06H 2P46B 1T6WA 3ZYZA 5TE4H 3MO1A 4KKBC 4K3EL 4OSUH 1HI6B 5CEYB 1IAOB 3PNWA 3CH1A 4WV1C 2EDTA 3FO0L 2CKBB 3HPJA 5IF0B 2WP3O 3KWWA 2EIBA 1AXIB 4NKOB 3RZWA 3FKUS 3OB8A 4LLWB 4XPTH 4DOHB 4JFEA 1YQVH 4OCNC 1OQXA 5T1LA 2BNQE 4KI5E 4PYGA 1UM4H 4PBWD 4ZAKA 3SCMC 1HHGA 1L9MA 1P7KA 3QIWD 1UC6A 2J4WH 4FTVA 4GW4B 5FA3B 1A6UH 2V7HA 5D2LF 2JE8A 2C1PB 4LLYB 5FGBA 2FYYA 5JW5B 5I8KH 4F2MB 1MVFA 1V05A 2X4PA 3CVHB 2HVKB 1UZ8A 2HRPL 4BZ1L 3BQUA 1YNLH 3DX7A 4FG6C 4GG6A 1GIGH 3MLYL 3D85B 2FNBA 5ENWA 4X6EB 4OZGE 2YS4A 1M4KA 4EIZC 4X0KB 3NVQA 3ZYJA 1X5AA 3GMPB 3K4AA 3NN8A 3ZO0A 4I2XE 5BMFL 4WW2A 5FYLH 3WLBA 3CDGB 3HRPA 1CFNA 1E6OH 5IHZB 5MI0B 2FEDD 5IMKB 1QEWA 4M6NH 2CO6B 5DFTA 3GJFB 2EEDA 2IBGA 2C3WA 3WHE1 1A1NA 1FFOB 3CC5A 2QSQA 1DFBH 4LSPL 1UWEL 4N9GB 5ESVB 3AM8C 1YDPA 4KGLA 4MXWL 1LWRA 5KSAA 4JRXD 5KVEH 5HYFA 1S9XB 2DJUA 3MJ7A 4E42B 1VEOA 5IBLC 4HFUL 4IMLA 1I9EA 4MD5B 2CLVB 5IT2H 5BVJB 4QRPD 5C0RL 2ATPB 2VE6A 3S35L 4XNXH 1OP9A 1B0GB 3KPLB 4CDHA 2R4RL 5F7FA 3NPZB 2VN4A 3MBEC 4UV7L 3WDHA 3S34H 5GGVH 3QQ3A 5ID1B 4NUGH 5E8DL 4ODXA 4H0GA 3ZDYF 4LSTL 1MHPL 1QSEB 2LU7A 1CQKA 4U6YA 3EZ8A 3HG1A 1VEMA 5TF1H 3C60B 2R29H 4POZD 1EFXA 1DSFH 2COQA 1BWWA 2NY3C 1BQSA 1J1OL 2X4NA 4MQTB 4KROB 3QDMA 1DVFD 3P9LB 1I7RB 1XT5A 5IK3B 4O58H 3QXAA 4Y8DC 4BH8A 1U8PA 4L3ED 1KJ2H 2VO5A 4C4KO 3GSNH 2GJJA 4GJTB 1ZA6A 4ZXBC 1XF2A 4DK6A 2DKMA 3HUJE 5FM4A 3FB6B 5EBLA 4OCRH 4XX1E 2IAND 5TJWK 2NY1C 1MCNA 4OQ1A 3FAWA 4L5FH 4DGVL 5JHDE 4LHUG 5C07E 3TBSA 1U8QB 1CLOH 3MFFB 3C2SA 4HAFA 1YMME 4G8GD 3QUYA 4YHYC 3UYOD 1C7SA 4NDMA 2IFFH 4K7FA 1WFNA 1MLBA 5J4MA 3MA7A 2L7UA 3V7AE 4MA7H 4UNTA 2BVPB 4YDVA 2DWDA 5FYLE 3FRPA 2XXMB 1WWWX 5HJ3A 1XR8A 4GRMA 3CFEA 1UZ6F 1T5WB 2ZNXA 4ZFOB 1S7UA 5E2TH 5CIPB 2X2YA 3E2HC 3L5IA 3CSYA 2ADJB 5L6YL 4M7LT 3MCLL 3VFSB 5J06A 1J1XH 3KYKL 2ZUQC 4LDOB 4ODVH 1VENA 3H3PL 3LKNB 4U2YA 2OLDA 3FHAA 2VZVA 3EO9H 2QHLA 3O6MH 5J0BA 4PB0L 2I9TB 1Z0MA 1LE5B 1C5DB 4Y4KD 4P5KA 4RMSA 1DANU 1MRCL 4QKXB 1MRFL 3I9GH 2DM4A 4C56E 1QO3A 4RGNE 3CVHH 1XCTA 5FA4A 1HILA 2IJ0C 2F54E 4ZOEA 2RJMA 3RUGF 1BD2D 1MUJB 4ELKB 4DFIA 3S97C 4EVNA 2PXYC 4HK3J 1S5HB 3RWGA 3V9FA 4KXZH 3LIZL 4PJBA 1HHHB 2VDPL 4EBQL 4WFHD 3GKWH 5HGBA 3MJ8A 3K8MA 2VDQL 5DQDL 3EYUL 4WFFE 3BE1L 2CDFB 2GY5A 4XP9H 2IAMC 4KJWD 5J13C 5IBTH 4HF5H 1G7LA 1ZHNB 1QSFA 5E95B 4HK0A 2I26N 3U0TB 4MA8H 1QRNB 4OZ4B 1SEQL 3MGTB 4MNGA 2OTUB 2ESVD 5T3XL 1PDKA 5BJTB 2YUZA 3NCJH 4XPHL 1DDHB 2N1KA 2VDML 3X12B 1AGDB 4NUJB 1J5OH 5BO1L 2HN7B 4EKXA 5DJAB 4NYLB 4KHXH 1D9KD 2VISB 1U8JA 2OTWA 2W0PA 2XPGB 3NOIA 2DQHL 32C2B 4R8WH 4H1LG 1EHXA 3KPRE 1V7ML 5E2JA 5GRZA 2XY2A 1DE4B 2R9HD 2ZCHL 4P5TC 2VLLB 3VFOA 2HWZL 4OFYD 3ULVD 4HPYL 3EOTL 3OBAA 1ACZA 3E6HB 2XTJE 4GMSL 4U2ZA 1W0WA 4LLDA 2DF3A 4FQPA 4I48A 2VQ1A 4X6BA 3OX8B 4Y16D 1G9NL 2BVQA 1SY6H 4X7SH 1Q0YH 4CU8A 1NGXA 2R15A 2PO6B 1CQYA 1YJDH 2MHAA 4EDWH 4OD2B 3T77A 1IQWL 1OOAA 4XAWH 1HXYB 3VXUD 3DVFA 3RVWC 4OZIE 1NANI 3LHPH 4Z7OE 1AQDA 2MKLC 4LASH 4NBYB 1C5CL 4UQ2B 4EEEA 1DQML 1ZT4B 2NMSA 1YEIH 4K23H 4HULB 4PJGF 1RUPH 5DO2C 4HC1L 2YD3A 3HNTL 4HEME 1DLFH 1P7QD 4QHMA 2IBZY 5DJXA 4MMXC 4YGVB 2R1WA 2VZTA 3TP4A 4R2GC 4ZDHA 4JFQB 1BJ1J 4JRYB 4UV4H 3OKEA 1E28A 4FZEL 4ZYKA 5C0CD 5A43C 4NHUA 3HZKB 3I3EA 5IVOA 4AEHH 4Y7MA 2P8PA 3RTQD 1WC7B 3MGAA 3F5WA 3L6FB 3B5TA 4I18A 5EZIH 4MSWB 1NLDH 5DQ9A 2G75B 5GPRA 1XIWB 2Y9RT 1D5ZB 4ODTH 1M71B 3L7FB 1LE9A 1U8KB 3SGKA 4P0DA 4HKXA 4P2RD 4YBLC 2BNRE 3WS3B 1PAMA 3FT2A 5EN2A 2ZUSA 2OQJB 5I17B 3QYCA 4MAYB 3KGRA 2YRLA 1FZOA 4JZJA 5DUML 5CIPH 3EO1B 4MQ7B 2AERT 3PP3K 1A3LH 5GRJL 2DQCL 3GMNB 1U93A 2ITCB 1DQQA 4N8VA 4Z77B 5K59E 5DC4B 2X7LB 2NTSP 3LSOA 4UTBH 1KPVA 2VLKD 4NQVB 5DRNA 3TYGH 3QPXL 4ZFZA 3HE6C 4FZ8H 5J57B 1YMHB 2YC1A 4TNVF 4RAHA 5I1CH 4LSDA 3VXQA 4ZTOL 3IFOB 3G5ZB 3LD8B 2F74A 2A6DB 2NZ9C 4AQOA 5DQJB 2VZSA 2A38A 1YEGL 4FQQA 1WCQA 4ENEC 5A16A 4U0RB 4NQCB 5I18H 5IMLA 3B6SB 3BP5A 3JV0A 2YSSA 3QT2A 4G6KL 5F9WB 3UTTD 5DMKB 1ZHLA 1XGTA 5D2LA 15C8H 1A47A 1QSEE 4C59B 4HUKB 2DQGH 3NA9H 4MQSB 4YDIH 1G9ML 4XZUB 1ORSB 5I8OH 2AJUL 5C0EB 7CGTA 1QFUH 3SDDA 1ZGLP 5BRZB 4CMHB 3MREA 4P4KA 1RUQL 2APVA 3QUZA 5E08H 4D3CH 3HKFA 4H20H 3MRLB 4HWZB 4G80A 5KVDL 1JHKL 1K4CB 4ZSOE 1MF2H 1HSBB 5IEKB 4C83A 4HUVB 3MRFB 2QHRH 4P48A 4QRSB 3EHBD 4RFNC 3BN9C 3DI3B 1HINH 2C4FU 2M8XA 5JPNB 4FQ2H 3BIAX 4P59H 4UINL 5T3ZD 3P40A 3BJ91 4QGTA 3V6ZB 1B2WH 3VE0A 4X9BA 4OCSL 1PW3A 5SWZD 4IOSD 2IPKA 3MV7A 3T08A 3CXDH 1U8OA 3D0LB 4P2QD 3IKKA 4DW2H 2XWBA 5GS2H 3LPGA 4YXHL 1SJHA 1DBAL 2J8HA 2NR6C 2Z31D 4NT6B 3GMOA 1MCPL 4Y19D 3WHXA 1CLCA 1I75A 3EO0A 4EQ2A 1AKJA 3WUWG 3U48A 2ZJSH 3GUTA 3FOMA 3BAEH 2W0KA 2NX5B 3FQUB 5JNYB 3IXAB 4OUUA 1U42A 4DZ8A 4M02A 3T4AB 3LZFH 2Z4QB 1HH9B 1YEEH 1J86A 5EUKB 1A14L 2D4FA 5D2NC 4LLUB 3QO1A 2NY5L 4LSRL 4NO2B 3ZDXF 4QOKB 5FF6B 4JB9L 2FSEB 3MLXH 1E4XH 4XBGB 4M6OH 3DVNA 4UQ3A 1OSZB 3AMKA 4W4OC 5HVHB 4KZEH 3IXTA 4ONHA 1ZHKB 4AT6A 2AS5M 3VXRB 1FYTB 1ZSDB 3FFCE 1DZBA 1I3UA 2WAHA 1JPTH 1KJVB 2VITA 1PSKH 4I3RL 4NQEE 4XHJD 4WU7A 1FNLA 3LV3A 4HH9A 4HGKC 3TO4D 3TN0C 4APQB 4UTAH 4W4NA 3O0RL 1M7DA 1KCVH 5CWSA 3MLRH 5GGSB 1ZLUH 1UCTA 4IOIB 3CFDA 4O5LH 5FDWA 1R3KB 4YGAB 5D9SB 2VXUL 4G6FB 5MEOB 2QSCL 4JFFA 3D39A 5KS9F 3MLTA 3VWKC 4WHTA 5D96B 3CFJA 5I0ZA 5ICZA 5J1AA 3QDJA 1XR9A 4HCRH 4CVZB 3DRTB 1I8KA 1IC7L 5E94B 4JFPB 4PRNB 5L0QC 3PQYA 2H1PL 5D2NA 2BRRH 1KB5L 4OKVB 4PY7A 4MHHG 3C6LB 5EA0H 3TVMD 2CIKA 2IPTL 3X13A 3L3IB 4OFVA 2YWYA 3GSVB 4NN5C 3LN5A 4M5YH 5L2JA 4CJ0A 2WZPD 4LGRB 3WNOA 2J6EH 3MRBA 5EU7C 2E7MA 4K2UH 1EUTA 1CFTB 4IRSD 3EGSA 4XNQA 1GPOL 5DJ0B 1EBPA 3O3DA 3NMEA 5J89A 4Z7WB 2JLLA 4AQ1B 4AIZA 4OLZH 2XFXB 1OAZL 1I1YB 1RUAH 4LDEB 4KAQL 2E7CA 4HIXH 1UB5A 1BLNB 2V5RA 4M1DL 2WP3T 5D7KD 1G6RB 5FHBH 3QUMA 1ZEAH 3THMH 1EIBA 3IFNL 2AEPL 4K94C 3C2AL 5BZWB 4J3UA 1CT8A 3MXWH 1DBJL 3AXLB 4PJ7F 5SWSB 4FMKA 1YY8B 1A6AA 1KF9B 2EIDA 5BOPA 5K9QG 1G7JA 1R3LB 2FO4B 3BSZH 5I2IA 2XN9B 3CJJA 3RUGA 2QKIB 4P2OB 1YECH 3ARTA 3MJ9L 5DRXB 3QNZB 5EUOE 4F37K 3U2SA 1KJ3H 3IDMB 5D70H 2EDJA 5LGHL 5AYUH 4V2BA 1P1ZA 1SEBA 3TIDA 3LN4B 1F4AA 1OP3H 4M6MH 2DMKA 2E3VA 2IPUG 2X9WA 4QTHA 4LGSB 3EFDH 2MFNA 5F88A 5CBAA 3L5XL 5IWLC 5DA4A 3LKRB 3TV3H 3D2UD 3GMQA 5IMOB 5HY9B 1IGFL 3CFBB 2XG5A 4A2MA 3IS0X 4G9FB 5FCUL 2XV6B 4O2FB 1MHCA 1NEUA 2C7UA 1RUKL 2DWEA 4JRYE 1BQLH 4Z7QF 3IJSB 2ENYA 4HIEB 2VXTH 4F7PB 4ODSH 1MCEA 1NMAL 3C5JB 5E8EB 4NCC2 3HMXL 3L1OH 4Q6IA 1FFPB 4KDTA 1BOYA 2CDEA 4WW1A 4JHBA 3NIFE 2NLJA 1S7RB 5JIKA 3VFMA 1MCSA 3O6FB 4NBZB 1S78C 1PYWA 4WO4C 3PGDA 2UUDH 4D9LL 3TJEH 5EOCJ 5ACZB 1E6JL 4WEBH 2JCCE 5DEFB 3TA3A 1HH6B 2BHUA 2P44B 2YUXA 3FRPG 3F12B 2JJSC 5CSZA 2QBWA 1OM3H 3G5VB 2OJEB 4RX4A 3DMMA 3M45A 1A1OB 4H5SB 5KOVC 3MV9E 1ZLVH 3OAUH 4QYOA 3B9KD 1D5IH 3U7WL 4PFEA 1NFIA 4FXGB 5DJ8B 5E8PA 4Y5XA 4M3JA 2X6MA 4WGVB 3CK0L 1MAMH 3QCTH 4Q7DA 1RFDH 4H8WC 1JNHA 2Z8RA 2P5ED 1F3DH 3MV8D 2HKHH 1F2XK 4XXDA 2CQVA 2EDRA 3OKNA 3NCFB 5HHOB 1FGVH 2ZG2A 1IKNA 5EC1A 1QPPA 1FVEA 3VXOB 5I1IH 1DLHB 4G8FB 5D1XA 2X05A 1B3JA 4PGEB 4PJGA 5B21A 4YK4C 2HYMA 3BJLA 4NQCE 4JFDD 3ARBB 4L4TA 1CL7H 1RK1A 2IQAB 2VIRB 4GBXB 4LHUB 5TPWH 3LRSB 1GHFL 5KSUB 4C4KT 3K74B 4WTZA 4S11A 4R97C 3TT3L 5KOMC 1NLBH 2Q86A 4J3WA 1GGBH 1IAII 4WNQA 3UTPE 5BRZE 1WEJH 4MDJB 2VLJD 3BKJH 2KZWA 1RIVH 3QH3A 4XMLL 1YN6A 4NQXB 1WWBX 3VXMB 3G6JE 2YD2A 3W39A 1QFPA 1C5BL 4JFXA 4ZPVB 2BVYA 3LRGA 1N64L 2ICWI 3WXWL 4LPCA 4DZBB 1N59A 1YEHL 3T2PA 2YN3A 1P2CB 1CF8L 2JIXD 5DD3H 3QZWA 4YXLL 2ZSWB 4W70A 4Y2DA 2KBGA 3KLSA 3BP4B 2HG5A 2DS4A 1A7NH 3T0EB 1U8IA 3TYFA 2ZKHH 1KB5A 4LDLB 5F3HA 5TQ0H 2AKRA 1C16A 4JFHD 3H0TB 3OV6A 1I9RH 4PJAB 1MPAH 4JFOA 1EDQA 1JF6A 5F7MC 4WU5A 3D0VA 3LKSA 4FFYH 4CW1A 3WO4C 2VL5B 2XQBL 2AW2A 1G6RH 2Q8BL 4HBQA 4JY6B 4FQCL 4QXTB 3RZCB 1UQSB 4RDQF 3VWJD 4S1SH 3SE3C 1MCWM 4ZUWA 1A0QL 4HUXB 1RJLB 5EZLB 3RY5A 5FUZL 2JB6A 5F21B 5DR5H 4X7FC 5F3BA 5HYQA 5I0DA 3UJTL 1UEMA 1NAML 4KDWA 4NM8H 1CGVA 2YKLL 4LLAA 3I2CL 1E4WH 3FN3A 4PJXF 4XGZB 4ZTPL 4JY4B 5FYKL 1HQ4A 5ECJE 2VLRE 4JANA 3ZHKA 5ETUB 1M6OB 4GT7A 3G5YB 5ADPH 3WXVH 4R3SB 1W0VA 2EXYD 8FABB 2WV3A 5HYJD 3EYSH 1ITCA 5DWUL 4FQIL 3MJ9A 3IDUA 4HGWA 3ZT7A 4FMFA 2W59A 4EIGB 1F4XH 3R06A 1F2QA 1DQLH 3DXAB 3MOBH 3L9RB 4F9LA 4IMKA 1N7ML 3QQ9D 1AXSA 2DQUL 2VAAB 3VXRE 5C0AE 3ZE1E 2EYRA 4MWFA 3H2WA 4O51A 4Z7UB 2FIKB 4H1LB 2LU3A 4Y5YA 4GAJL 1OTSC 5E4IA 4X5XA 3GBML 1K5NA 1KSRA 2DYPA 2R1YB 3TH4T 5L8LB 4TRPL 5F7UA 3WFDL 1ZWIB 2DM3A 4TUKH 5C0BD 2UVFA 3SE8L 1WF5A 1FNFA 2E27H 5BW7C 1F8TH 1QA9A 1A7BA 1IAKB 3UZQA 4S10A 4QRQA 4YXKH 2BFVH 2WLZA 4L4JA 4KKBD 3WNPA 1AHWA 2C3HA 2ED9A 3DSFH 4JPKH 4Z95L 2EZ0C 5IOPA 3HMXA 3V95A 3U30B 1MNUL 4Y4HB 2PW1A 1YC8A 2KQMA 3MOAH 1KCSL 4NRYB 1HIML 1U6AL 2W07A 3DSNA 5DHVA 3UEZA 1XGUB 3SCMD 1IAIL 2A77L 3LS5L 1FDLH 5FB8B 4QRRB 2I9LA 4UOW0 1NC2B 3E3QE 1JWSA 2AQ1A 3ARGC 3MV01 1RULH 1DQJA 4KI5F 3SDCC 3C60D 2N4IA 3C5ZC 2P5WA 5EZOH 4JLRB 3RI5K 1D6VH 3TJHC 2EDKA 4JM2A 4Z7WE 5JQ6H 3KLHC 1J1PH 2R0ZL 3G5XB 1S7SB 3A6CH 1MQKL 4GW1B 4KROD 4F7CA 3H42H 4ODBD 3B9AA 1Q9KB 4OI7A 4OFDA 1PY4A 1JPGA 3A6OA 2VDRH 3QEQA 4LCWA 3RRQA 4GO6B 4QHKJ 4X80L 2H9GA 4NZUL 3DTXA 1EGJL 1U3HB 4LCIH 5HI3C 2HKFL 1R3IH 4ZNCD 1A7QH 2JB5L 3RWIA 3UBXA 2R56L 5AAMA 4KV5F 1QLFB 1T89C 4TVPD 3OAYK 1EERB 2XN9E 3QIBC 1UXSA 3AAZB 2ENSA 5CMAA 4NQTA 3OB0K 3U6RB 3C8DA 1NCNA 1UA6H 1ZK9A 4P9HL 4M8QB 5BOZG 5FAAA 3Q6FA 3GRWH 1Z6JT 6CGTA 1EZVX 4IRJB 1AGCB 1AIFB 2X1XR 5EO9A 1A1MA 3WKMH 4P23C 1IGCL 5C08D 5KS9A 3PWPB 2W9DL 1FORH 5GGTL 2AQ2A 5T1DH 5ADOL 3IDIA 2CJUH 1CFVL 2H6PA 3ALPA 4FQJL 4GAYB 2Z91B 4X7TA 1SVZA 3QG6A 2X1PA 1IEBB 4I8DA 2BY3A 4XMKH 3O11A 4N5EC 5I16A 1HKFA 3BH8B 1F58L 3MRKA 3VFRB 5IB5A 1GAFL 5F9AC 3OXSA 1S3KL 4FRWA 1D3CA 5I1JL 4U1IA 1XF4A 4Y5VC 4ZUUA 4U1MA 5DT1L 1CDUA 4WFED 4EUPA 1I1AB 1ORQA 2NY3D 1EX0A 1CICC 5J6HB 4HXAH 5E8NB 3UTSE 5IJVA 1UM6L 1MWAB 4KY1H 1Q72L 5EBMA 1KGCD 3FFDB 3A6BH 4A6YL 1QACA 1RPQA 3QNYA 1CI5A 3I50H 3X14B 5IVXB 3ULUD 3Q5YA 4NNYB 4X4MA 3W82A 2VDNL 4L9LC 3VXTA 5DD0H 1IGYA 2ADIB 4RMTA 3UMTA 4QXGH 1A5FH 3PE9A 3IDYB 3D9AH 3Q3GA 3I75B 1WWAX 3O81A 5E70A 1LD9B 1TIUA 1ZLSH 4GRWH 5D1QC 2IQ9H 1IZJA 2A6IA 1MFAH 1R3HA 5IEHB 2YPKB 3HUJF 4H1LH 2NW3B 3WCYA 4AENA 3CZJA 1PQZA 2YD7A 1A7OH 3ROLA 1MIML 3H9YA 1QRND 1J0HA 5HHOE 5JUEL 4M7JL 2QLVB 3DGGB 2OCFD 1JI2A 3PWNB 2XA3A 2UUDK 4QHLB 5DYOA 4KJYB 5IFJA 4MZ2A 2VJXA 3GHEH 1LEGB 3ZMRA 1GGIL 1W72L 3QJFA 1I9IL 3FQWB 4F9PC 1FIGH 3RGVA 3D18A 1FNSH 2GJZB 5CEZL 3OMZA 5DGQA 1ZLVK 4KPHH 5T1KD 4GMTL 1CGWA 3SKNB 4OV5A 4Z0BH 3SDXE 3WUWB 4U1LA 3QPQD 4NZTL 3TIEA 4YBHA 2X4SA 4JKPL 2ITDA 4UT9L 5EOQL 4DGYH 4HD9A 3MO1B 3X3GL 4F33A 5K93A 5IW1A 3ZKXC 1RQ5A 2MWCA 3CH1B 3PNWB 5EU6A 4BSWA 1T21A 4JPIA 4K8RL 1QHOA 5FM5M 3HPJB 2Y5TA 4PJ9A 2AEIT 1YNKL 3AREC 3KWWB 1AGBA 4YX2L 1Q8MA 1LMKA 3HNSH 2HT4C 4QXUL 1PZ5B 2KUTA 4JFEB 3WSQL 2EDDA 5T1LB 2BDNL 4ZAKB 3CPLA 3HNVH 4L8SC 1HHGB 4P46C 4FTVB 2AXJA 4N0FA 3H9SD 3UXFA 2X1QA 5HHVL 2V7HB 2E8YA 2D2OA 2PXYD 4L9DA 1OD9A 2FYYB 5E8OA 4XBPB 3O8XA 2X4PB 2ZSVA 5H37H 5C2UB 2IG2H 2W92A 1WQVT 1Q1JL 3DX7B 3BQUB 3FMGL 1GCFA 1LO0L 5CD3A 2ICWA 1T7XA 3U9PL 4GG6B 1FH5H 1IE5A 5ENWB 3FZUC 1A3RH 2D7OA 2YPLA 5D7LE 1JGUH 3IFLH 3NN8B 4G6ML 2BERA 2AI0L 2RB8A 4WW2B 1HCFX 3WLBB 3WFBL 4GUPA 1CFNB 5GGRB 5B4MC 1NBVH 3H3BC 5FDYA 4X6CE 2E7BA 1IT9H 5HVGB 1QEWB 4KZDH 3WFEH 1A9EA 1ZV5A 2WM0A 4LARL 1A1NB 3CFCH 4W68A 3CC5B 1F90L 2OR9H 2FR4A 1I85C 4NO3A 4P5TD 2DD8L 3SE9H 1ZS8A 5HI4D 1YDPB 4OLXL 3NPSB 1E27A 4GRWE 4NC1E 4PRHA 5KSAB 1OLLA 3MJ7B 1EFQA 4IMLB 3VXNA 5DMGC 1ZGLA 3L5WA 3P0YH 1JGLL 3QAZC 4MAYD 3HMWH 4YHLH 3HFMH 3PWLA 5GGTA 2Z9TA 3BKCH 2DBJA 2VE6B 5HYEA 4OI8A 4XNYL 1N6QL 4M7ZC 4MNHA 1MCBA 1MHHA 5D1ZC 3U4EA 3QQ3B 4ODXB 1FL6A 4U6YB 4UZGA 5C09B 3HG1B 3P30L 3OQ3B 4FXKA 1EFXB 3TZVC 3N85H 5C2BH 1FFNA 2X4NB 4OM0H 1M7XA 5A2KH 5KJRL 1FJ1A 3QDMB 1G9EA 5CEXA 1I8LC 2Y06L 4A6YA 3QXAB 4XPBL 4OZIF 4KVNH 4Q2ZA 4Z7OF 5TE4L 4BH8B 1U8PB 5E9DA 3SQBA 5JZ7D 4LQ1A 1FHGA 1ZA6B 1L4IA 3ALXA 1XF2B 4PJXA 3VG0H 3ILQC 3QFJE 5IQ7H 5EBLB 4XPTL 3BDYH 1YQVL 2HFGH 4WCYH 3MLVH 1HNFA 1UM4L 4N5UA 3BRGC 4FQLH 1RZFH 2DIBA 2J4WL 3VMNA 4XVJH 4NO0D 1A6UL 4FQXC 3JSSA 3DIFA 3H9ZA 1UJTA 3TBSB 3NIGF 5DK3A 5I8KL 3S36X 2Q7YA 2PN5A 3QUYB 3ARZA 4WTZG 1YNLL 4NDMB 3I84A 3OXRA 4Q9BA 3MA7B 1GIGL 3NH7H 4DKAA 3W0WA 3C8HA 1F00I 4YDVB 1MCHA 2VR9A 5GHWH 1W72A 1KTLA 4MLIA 5H8DA 2AAVA 1XR8B 4GRMB 3UC0H 3CFEB 4YHNA 1UJ3C 1S7UB 1CGSH 4PJHF 4X6DF 3CSYB 5FYLL 2AEQH 4XP1H 1A6ZA 4LCCA 1E6OL 3MCG1 3CLEL 5FFLA 3QZWG 1QVOB 2EE3A 3WL9A 3JWOC 4YLQT 5K59F 4M6NL 1X5FA 5D93B 4XBEH 1MJ8H 5SV3A 2DTMH 5GISL 3VFVA 4P5KB 2NX5D 3PP4H 4ISVA 5GS1C 5HI5C 3BT2H 1QO3B 3ZKMD 1XCTB 5FA4B 1HILB 1ZT1A 4E9LA 4JGJA 5CLTA 1QP1A 4PRIE 1J7VR 1T2QH 1A8JH 1T0MA 4EVNB 5IT2L 5KANI 3RWGB 3SKOA 1VDGA 3L7EA 4MJ6A 4KXZI 3RWFA 4PJBB 5JXEA 4XNXL 4P99A 5HGBB 2VWEE 3MJ8B 4TTDC 4WRLA 1BQUA 1CFQA 1FYTD 4NQDA 3S34L 5GGVL 2ZCLH 2EDNA 1G7LB 5JIHA 4NUGL 4OIIH 1MHEA 1QSFB 3SDYH 4HK0B 5CZXC 4APQD 5TF1L 4UT7H 2VR5A 4MNGB 2R29L 1EVTC 4Y89A 1DSFL 4LAQH 4MVBD 1X5IA 2ZOKA 4R7DA 3RWDA 1NQBA 4S1RH 4MB4A 2BHZA 4HK3N 5CINH 4I2XA 3U9UA 1U8JB 2OTWB 4DKDC 2MMXA 4F8TA 1KJ2L 1Q94A 5C7XL 1T22A 1TCMA 4XB8A 5LWYH 3VFOB 5HHQA 2P24A 3U4AA 4S1QH 5JXAH 3BPOC 4NKIH 4OCRL 1W0WB 4LLDB 3QFDA 3C6LD 3VI3E 1DBBH 4OBSA 4I48B 4L5FL 5F9DC 1EBAA 2VQ1B 2ZPKH 3CCHA 4X6BB 2DL9A 4U49A 2BVQB 1H3TA 1C12B 1MIEH 3MRIA 1NGXB 1CLOL 2ZG3A 3ME0A 3HI5L 3AY4C 2MHAB 3KPMA 5I9QC 1MELA 2H8PA 2IFFL 4S0SD 3F58H 4F15C 3T77B 4YFLF 4OQTA 4MA7L 1UM5H 2EDBA 2D0FA 2HTLC 1AQDB 4GAFB 4WFGD 2AK4B 5CLWA 4Z7NE 4JFEE 1WIOA 4BQCA 4M62H 5FO7A 5SWSD 3BIBX 5E2TL 3IETA 4WI3A 2GJ6E 4QHMB 5DJXB 4M61A 1J1XL 4U4BA 2R1WB 2APTA 1EHLH 4ZDHB 4HMDA 4P2OD 5DJCB 2CD0A 3EO9L 3HAEA 1A4JA 3OKEB 1E28B 2VERN 4ZYKB 3T1FB 4RBPK 2XACC 2DLIA 4MB3A 2GFBA 3NCYP 4NHUB 2MQ0A 3I9GL 2P8PB 3CVHL 5ALBH 2ZZUT 1IL1A 3F5WB 2VDOL 4I18B 4JHWL 3HUJA 2Q87A 2MJWA 5DQ9B 3UBXG 2KPNA 4G9FD 2EDEA 3V6FA 2FATL 1LE9B 1QFWH 4P9ML 4YFLI 4DUWA 1FZMA 3FT2B 5EN2B 4MB5A 3GKWL 4ZUTA 1I4FA 4PJIE 1FZOB 3NGBC 4JZJB 5HGHA 5JHDA 4XP9L 2XZQL 3ARXA 1ZVYA 5IBTL 3F6IA 4HF5L 4K71C 3MLUH 1EXUA 4YQXH 1U93B 2X10A 4MA8L 5GRWA 1DQQB 1WT5A 4N8VB 1HHJA 4LCYA 1BPVA 2BSSA 1AI1H 2A73A 2F53A 3LSOB 1SBSH 5F1SA 3CFIC 1KPVB 3V4VH 4MDIA 5DRNB 4QRUA 4ZFZB 1J8HE 3NCJL 1Q0XH 2P43B 3OKMB 1J0ZA 1YZZA 2YC1B 4JDTH 5DDHA 2W0FA 1J5OL 4KHXL 4ACPA 1IC4H 3NBNA 2H32A 1FSKC 5F8QC 2YD8A 3VXQB 4R8WL 1YEKH 4JE4B 4FA8A 5FKAA 4LBEB 2F58H 4FQQB 5IMLB 5A16B 5EC2A 3JVGA 4LNVA 3BP5B 1EMTH 4OD1H 4EUPG 4X7EC 1JGDA 2YSSB 1V3LA 4NFCA 2D7MA 3VFTA 1ZHLB 1XGTB 5D2LB 3S9DB 3RU8H 1I7TA 2J12B 2IEPA 1JGEB 3BISA 3SDDB 1MI5A 3ET9F 2F54A 3MREB 2RAMA 4P4KB 3QUZB 1RZKH 3VDCA 1D7FA 4X7SL 4BH7A 1Q0YL 1AE6H 5EU4A 5HGAA 4G80B 3BP6A 4FABH 3RHWF 4I9WD 3ARBD 4K7PX 4C83B 4EDWL 4LHUD 1R5IA 1A2YA 1UB6A 5E1AB 2WQRA 4XAWL 3V6OC 5ID0A 3O9WC 5J7CC 2ED8A 3P4LA 3SGJC 4NQUA 3LHPL 2DKUA 5FO8A 1R0AH 1NAKL 2ADFH 4LASL 5C92A 1QR1A 2VR4A 4K23L 1YEIL 1RJYA 1RUPL 2A9NH 2IADA 3VE0B 4M1CD 1VB9A 1RAMA 3VXMD 1DLFL 3L3GA 2F9BT 2EE9A 2IPKB 3MV7B 3VA2C 1U8OB 1DUYA 3T65A 3WFZA 1KJ2A 2XWBB 5E2WH 5GRYA 4AH2B 4UV4L 3GSNA 4ORGB 3QA3A 3RI5F 1SJHB 4OCLC 2ERJC 3GMOB 3WHXB 1JF1A 3KPRA 3T0ED 4HHAA 4AEHL 3EO0B 1AKJB 5F7YC 1JZ6A 3FOMB 3AS1A 1MSPA 2JCCF 4CU7A 4OUUB 4DZ8B 5T5NF 1H0DA 2RHEA 2OJZH 4ODTL 4M00A 4G7YH 3N1QC 1KGCE 1XZ0A 2BJML 3QO1B 3R0NA 2JJTC 1F3DJ 1E4XI 4LEXH 1ZOXA 3DVNB 2VUYA 3IXTB 4ONHB 1A3LL 4AT6B 3D6GA 4XTRD 5C6WH 3BKMH 4LOUC 1MFDH 3V0WL 3DUUA 1A6WH 1PKOA 4FFZH 2VITB 4UTBL 1NH6A 4OZIA 3KPNB 5FUCE 3QHZH 4WU7B 3LV3B 4PRPA 4HH9B 3DO3A 3TYGL 5DVNA 5CS7A 1M7DB 2YRPA 5CWSB 4FZ8L 3CFDB 5FDWB 2GI7A 5L8JB 5I1CL 4ONFH 4I0PC 2DJ4A 4QF1A 3Q5TA 3DXAD 1KC5H 3ARFC 2AJZA 3BZFA 5BV7B 4JFFB 1CU4H 3D39B 5I18L 3EYFA 3MLTB 2XQYK 4WHTB 3CFJB 5ICZB 4BUHA 15C8L 5J1AB 3QDJB 1XR9B 3C6SA 2DQGL 3ARYA 1I8KB 1U8HA 3NA9L 4YDIL 3SBWC 1WITA 2DBLH 1CXEA 4UOJA 5I1EH 5I8OL 1QFUL 3PQYB 3R1GH 2CLRA 4NKMA 4PY7B 2DM2A 2CIKB 5E08L 3X13B 4D3CL 1MRDH 5CGYD 3K4ZA 4H20L 3D25A 3LN5B 5L2JB 3CVIH 2BNRA 3MRBB 1PBYA 2VXVL 4KHTH 1F5WA 2QHRL 1EJOH 3EGSB 4XNQB 4Y4HD 1BGXH 3HB3C 3O3DB 4PJHA 4X6DA 4AIZB 1HINL 3GJFK 4FQ2L 5DUPH 3S36H 5IIEA 1N0XH 1NSNH 4OLVH 1B2WL 1UB5B 1W2KT 5HDQH 4QRRD 3K4DA 5E00A 2VDKH 3QUMB 3VCLA 4MA3A 3CXDL 1CT8B 4ZPTA 1A6AB 4DW2L 3EJYD 5SX4I 1G7JB 3L3HA 2E9JA 2JK5A 5I2IB 3GI8H 5JOEA 4LRIC 3RUGB 3EJJX 1A64A 2LAAA 3U1SH 4RDQG 5FKPA 2XWJA 4UIKH 3U2SB 2R4SH 2NY5C 4NNPH 2ZJSL 1MCIA 2P1YA 5IB3A 1N0LA 2AXGA 3BAEL 4JQIH 1P1ZB 3TFKD 1SEBB 3TIDB 2C5DC 2FB4H 4MA1B 5D7JC 3X11A 4QTHB 5JPMB 1CTOA 1EZVY 1G0XA 5F88B 5CBAB 2P8LA 2RIKA 4HS6A 1SY6A 2OX5A 1VESA 2CGRH 4J8RA 3VG9B 2XZAH 3GMQB 1JIBA 4WY7H 3MLXL 1E4XL 3B9DA 4M6OL 4OKDA 3TWCH 1MJ7H 1DQTA 2FX8H 3ZE1F 2NY6B 4KZEL 2C7UB 2DWEB 1N26A 4ZSOA 2Y6SC 1Z5LA 3ZT6A 5KVFH 1JPTL 4Q6IB 2EZ0D 2CDEB 4WW1B 2XRAH 5GS0C 1PSKL 2NLJB 3PWPD 2D7TH 4I3GA 5FHAH 4J4PC 3TT1L 2PTTA 4UTAL 4Q58C 1PYWB 1KCVL 3MLRL 3PGDB 3V8OA 3ULVF 1CD9B 4R0LA 1KACB 4GXUM 5KW9H 3TA3B 2BMKA 4FFVC 4Z7VE 3J8F7 1RU9H 5CSZB 4KTDH 1AR1C 4MS8C 3DMMB 1DTUA 5B38G 3QWOA 4QYOB 1HZHH 2NY2B 4TNWK 3SDCD 1NFIB 5C9JA 1U0QA 5D7JA 3BPLB 4HCRL 4Y5XB 1I1AD 4RA3A 2M26A 5DLMH 4Y2OA 2BRRL 3WNKA 5EA0L 4ALAH 5ICYA 2CK2A 1JNHB 4JO2L 4XXDB 4PLNC 2R0KH 1PJ9A 1QR4A 4M5YL 3OKNB 3OWEA 4M4RA 3CH8A 2J6EL 3V5KA 4K2UL 4F80A 1FVEB 5D1XB 4PJGB 4U3CA 1CL7I 1FL3A 4JFYA 2AJVH 4L4TB 1RK1B 4OLZL 1VADA 1OGAE 3QIBD 3GSXA 5B8CC 1RUAL 3IJHA 4HIXL 3FFCA 4UILH 4UBDD 5BV7H 1DBKH 3CSGA 3ARSA 1OT1A 3BPCA 5FHBL 4RZCB 2Q86B 1ZEAL 3THML 1H8SA 4WNQB 4NQEA 3QIWC 3MXWL 3QH3B 4UB0H 2AJ3A 1CG9A 1NCBH 3S5LG 1YN6B 5B22A 3W39B 5LCVH 3BSZL 4JCLA 1T0PB 4JFXB 5CP7A 3WJLC 3RY6A 2OK0H 4B7LA 4DEPC 1YECL 2VQTA 2DAVA 1N59B 3UZVB 3ZTJG 4N5ED 1KJ3L 3QI9A 3QZWB 4Y2DB 25C8H 4P49A 5AYUL 2DQJH 1PG7H 1NBZA 2HG5B 4RAUA 4EI5C 3FO2A 5JORA 1VKXA 1U8IB 3BI9X 3MMEA 3TYFB 2V2TB 2EDYA 1KB5B 3EFDL 5F3HB 1ZLWH 5IJKC 2V9RA 1KLUB 2AKRB 3KXFE 1C16B 5D6CA 3TV3L 2F5AH 4JFOB 4Q9CA 2MCPL 2UZIH 4WU5B 3D0VB 1CICD 4CW1B 4P2YA 1JJUA 1I3GH 4HZAA 1ZTXH 5IR1A 4JQXA 2FEDC 1ONQA 1BQLL 5HDBE 5T1LD 2VXTL 1MCFA 4ODSL 4ZAKD 4R96B 3L1OL 4ZUWB 4FTVD 1T2XA 2JB6B 2CUHA 5JIPA 5F3BB 2QADB 2GT9A 5HYQB 4OCWH 5FUOH 3DUSA 3DHMA 3WV0A 4D9RE 1HQ4B 3TJEL 2L7JA 4WEBL 4JANB 1JZ3A 2NY7H 5C0JB 2FH8A 3UAJC 1W0VB 1JBJA 1OM3L 5GSVA 3U82B 3W2DH 5ICXA 1U3ZA 2H41A 4HGWB 3OAUL 4V2CB 1K3ZA 4NRXA 1D5IL 4NJAH 1IBGH 3R06B 1AXSB 3FT3A 1JFQH 2EYRB 1I1CA 4MWFB 4O51B 5J6GA 3HAEG 5GRVK 3BXNA 4F7MA 1MAML 3MODH 1VPOH 3QCTL 4Y5YB 1DP0A 4POZC 4EQ3A 1FCGA 1RFDL 4X5XB 1K5NB 2WUBH 2DYPB 2HP4A 2HKHL 3HR6A 1AD9A 3RPKA 3DV4A 1FVDA 4IHOA 1DVFC 1IGTA 4K94H 1FGVL 1QA9B 3S37X 5I1IL 4QRQB 4P3WA 5MP6L 4XX1G 1AHWB 5KSAD 4P3DA 3DX9A 1CL7L 3EAKA 4OGYH 3IDJA 5TPWL 3SDXF 2PW1B 3QDJE 2HT4D 5FYJD 3WIHA 1NLBL 5DHVB 1MAJA 4KMQA 1ED3A 3PQYE 5D2NE 5TE7H 3GBLA 1WEJL 4WI9A 3BKJL 3NCCB 5DEGA 4P46D 3VFGH 1B4RA 2I9LB 1RK0A 3PGCA 5L2KE 3B2VH 4Y4FA 4J3SA 5IB2A 5TFSH 2R2HA 5L9DL 2JCCA 5C09D 1DQJB 3HG1D 4XPFH 1VFUA 2PTUA 5JO5A 2NTFA 2P5WB 4OIAA 4BZYA 2ZOLA 3QHFH 4JM2B 1F97A 1UKQA 5DD3L 5I1HH 3MV9A 1X4XA 3DX6A 3ECBA 5I73B 5JW4N 4F7CB 3QDMD 1J88A 1A7NL 3O2VH 2ZKHL 1JPGB 3QEQB 4LCWB 3FZUD 5TQ0L 2H9GB 3DTXB 1NJ9A 4XP6H 1I9RL 4S0TD 1RZGA 1MPAL 1BMGA 3WKNA 2A6JA 2IH3A 2Z8WC 1JVKA 4FFYL 3U0WH 4IDJH 1FYHB 3QP3A 3RWIB 1XGRA 1G6RL 3UBXB 4L3EA 3WS6A 5DJYA 3LCYA 4MGXA 1KJMA 2G60H 5D4QA 3RIAF 1UXSB 1HOCA 3RUGE 3E6FA 5CMAB 5CILH 4S1SL 4DAGL 2BVOA 2DM7A 3ZTNH 5DR5L 2DLTA 3Q6FB 4PY8J 4NM8L 1QHPA 1E4WL 4X6CF 3KJ6H 1NGZA 5LAXA 4IBLT 1A1MB 1OP5H 5KS9B 3QUYD 4DN4H 5DUBA 3WXVL 5ADPL 2PYED 3IDIB 3PL6C 4H8WH 2DQTH 2H6PB 4PB9H 3SO5A 1CE6A 3U0PA 4X7TB 5ILTL 3EYSL 3QG6B 4PJ8B 5EU3A 4GRWF 3O11B 5I16B 3G6JA 1F4XL 3QUXB 5D1ZD 1I8IA 1DQLL 2ZUVA 3MOBL 3MRKB 4NZRH 5IB5B 4PBXA 3OXSB 5FM5O 1FG2A 4LVEA 4U1IB 3EDEA 3PJSA 3WE6A 1J0KA 3OF6D 1XF4B 4ZUUB 1MY5A 1YYLH 4U1MB 4X5WA 4JDVA 4V1DE 4Z5RA 3GMMB 2YD5A 4KRPB 4O9HH 1ORQB 1JL8A 5FOBA 4X4YA 5I15H 5IJVB 4TUKL 5EBMB 5INCA 3WN5C 2E9BA 1F8TL 4EN3A 4LMQE 1D9KC 3QNYB 2UY7A 4YXKL 2BFVL 3VD4A 4Y4KA 3DSFL 4JPKL 3O6LH 3VXTB 2R9HC 1IGYB 3FRUA 1INDH 5DS8A 1H5BA 3KG5A 2EO1A 4UOW1 2HT2D 1EPFA 3Q3GB 4B53A 3MOAL 5K9JL 5MERA 1NGYA 4R7NA 4GS7C 4JDZA 1LP9E 4BKLA 3M8OH 1FDLL 2A6IB 5ITFA 1R3HB 2ICES 2WANA 3U7YH 3FAXA 2VLRA 3KJ4C 4Y16C 4AENB 4G9DB 3ROLB 1MFEH 1RULL 3A67L 3KR3H 3GHBH 3MTRA 3NIDE 5D6DA 1LEIA 2A9MH 5EZOL 4LL9A 1BWMA 2Z93A 5DYOB 4PJGE 3BVNA 1B0WA 4XP4H 5IFJB 1OAKH 2Y7QA 4OIBA 4U6HA 5JDSA 1J1PL 1OTTD 2ESVA 3A6CL 4LEOA 3QJFB 3H42L 4BSJA 4ZS7H 3RGVB 2VDRL 2OZ4H 3D18B 2EE2A 3C5SA 5C0AA 1LQSR 4Q9RH 4LCIL 4CUCA 5MENE 4OV5B 2BX5A 3CSPA 1K8DA 3AROA 2DLGA 4U1LB 1MREH 3TIEB 1R3IL 1A7QL 1AC6A 2X4SB 2DB8A 2ITDB 4H0IA 1YN7A 2CUIA 3FONA 3L5JA 4F33B 4AK1A 5IW1B 5EU6B 4BSWB 1T21B 4JPIB 4XVTH 5JOPE 1TJIH 5KANG 2Y5TB 4PJ9B 1BJ1H 1AGBB 4OFYA 5F71A 4LPTA 2P8MA 1UA6L 4XH2A 3WFHA 4NIKB 4J1UA 3GRWL 3EJZD 3CPLB 1IZKA 3BGFB 4TSAH 5C9KA 4N0FB 3WKML 4PJ5E 4WI2A 4BM7A 3SDAA 5T1DL 4IIQA 4YC2B 2CJUL 5E8OB 1DN0A 1T0NA 4S1DD 3O8XB 5ALCH 1CLZH 1S7XA 1I3RA 2ZSVB 3MLWH 3UX9B 4UAOB 3UJIH 3S35X 3RVVD 3VJ6B 1HHIA 4XMKL 4AY0A 5CD3B 2ICWB 4OB5L 4JZNA 12E8H 2AK4D 3O45A 1UXWA 5I1LA 2CO7B 1T2JA 2C3GA 5CZXD 1FE8L 1TFHA 4TYUA 1L0XA 2YPLB 2VKWA 4M93C 3BOVA 1P7QA 4GUPB 4HXAL 4KUCD 4KY1L 5D72L 1GZPA 3A6BL 3I50L 1A9EB 2K1MA 4M4PA 2NY0B 5CCKH 3RDTA 1XFPA 2I5YH 4XCNA 5C0CA 2FR4B 4NO3B 4RQQA 5DD0L 3BEVA 2A6KA 5DXWA 3RTQA 1ZS8B 4QXGL 2YRZA 1E27B 1A5FL 3U83A 3RIFF 4PRHB 3T0XA 3D9AL 1HXMA 3QISA 4NN7B 5BS0E 1KIRA 3VXNB 4ODHL 3MUJA 3F7PC 1JCKA 5DC0A 1ZGLB 1ZLSL 2XYCA 4LRNH 1FNAA 2WBJC 3DYOA 3PWLB 2IQ9L 5MHSD 1MFAL 1XCQA 1BFTA 1MFCH 1CDCA 4QLRA 1WLHA 3VRJA 4MNHB 4QWWD 4EUPH 3PHSA 1EEZA 1MHHB 4LSUH 4WVRA 3U4EB 3MJ6A 4DWHA 4YUEH 3UTZA 4M7LH 1FL6B 3GHEL 3EHBC 4FXKB 1P7HL 3RWJA 3V0VA 2ADGA 2O5YH 1FIGL 1MCDA 2VLKA 4E41E 1FNSL 1O0VA 1PKQE 3HS0A 1FFNB 4K8RC 4M9OA 1U91A 3KYAA 4KPHL 1X7QA 1FJ1B 4Z0BL 4EJ1C 2NXYB 5CEXB 4A6YB 1TPXC 1QLEH 4DGYL 4Q2ZB 2QQQA 4IJ3B 3UTSA 5HD8D 5E9DB 4PLKD 2XXCB 4Z7NF 3PXHA 4K7PY 3H7LA 4PJXB 2Z31C 3H3KA 5HHMB 3SDDD 3HNSL 4XRCA 4J7RA 3MRJA 5DC9B 4XNZB 4P4KD 3GJEA 3QUZD 1TJHH 2DKSA 1EJ6A 3HNVL 4QTIH 2FL5A 4P4RB 1OWWA 4J3XA 3IGAA 3A0OA 3DIFB 3LOWA 2DI7A 2H45A 4GXVH 3JWNC 4KJPD 2Q7YB 2BSTA 5C86A 4XNUH 2IG2L 3H6JA 4ONGL 3TF7C 4JQVA 5T3XD 3OXRB 1Z9OA 3BWUC 3DWTA 4OLUH 3MFGB 3K2MC 4C58B 3W0WB 2DL2A 4M3KB 4PUBH 2HRLA 4GW5A 5DD1H 4KQ4H 1W72B 4CKVX 1KTLB 3QO0A 1A3RL 3LQZA 4DVRH 3MV7D 4YNYA 4YHNB 4AIOA 1A21A 1JGUL 4PJIF 3IFLL 4AYFA 2A74A 4PLOB 5K9OB 4JY5H 2V2WA 5SWZA 3TO4C 4LCCB 2X70A 3MA9L 4TSBH 1NCWH 5F1KC 3RWEA 3WL9B 1T4KA 1IT9L 3SDXA 4KZDL 2QJDA 3WFEL 2WINA 3DNKA 1AKJD 1JWUA 3VFVB 3CFCL 2OR9L 2HVJA 2AABH 1JWMA 3IB4A 4ISVB 4I3SH 3SE9L 4OZFG 3GRWA 3QULA 4U1NA 5AZ2H 1ITBB 1ZT1B 5KBNC 1F45A 4WI8A 3FN0H 3U79A 4B7IA 3P0YL 2AGJH 1T0MB 3FQTA 1KENH 1MLCA 3HMWL 4YHLL 3HFML 4K3JH 3L7EB 4KI1A 4MJ6B 3BKCL 3SKOB 4RMWA 1KLGA 3VFNA 4OCXH 3RWFB 5CUSH 4NKDA 3TNNB 1GOGA 4PRAA 3TVMC 1MCJA 2E6PA 1CFQB 5BXFA 1SHMA 4NQDB 1GYAA 3TH3T 2X9XA 4O02H 1MHEB 3ARDC 4IRSC 2Q76A 5C8JB 3OGCA 4PJ7E 3N85L 4G6AD 5C2BL 4MHHI 2ZOKB 4R7DB 3RWDB 4OM0L 4ODUB 2BVEA 3DV6A 3QXWA 4KWUA 1TJGL 4H0HB 1GVIA 3LQMA 5D7LA 5J11B 4I2XB 3U9UB 4JFFD 3D39D 4D9QE 4KVNL 3WO3B 2DIAA 1JMXA 3QJHA 2WUCH 4TNWF 4TQEH 1Q94B 3OKOA 4I13B 1T22B 4X6CA 3VG0L 1BF2A 1IC5H 5HHQB 3IVKA 2P24B 1FFQA 5IQ7L 3PWVA 3BDYL 2HFGL 4S2SA 1MCQA 2DLHA 1FC2D 3MLVL 3QFDB 1L7IH 4WCYL 1HK6A 5E6IA 4FQLL 1RZFL 1IAIM 4BZ2H 1M05A 4XVJL 4PJDE 3L5HA 1S9WA 3CLFH 4MX7A 3P2TA 4G42A 3CCHB 5K9QI 4IRZH 2OM5A 4YDLB 3MRIB 3LKPA 2AXFA 3KPMB 2H8PB 1CZ8H 3BW9A 3NH7L 2YD9A 2CXKA 1WZLA 4X6FA 1KN4H 2B1HH 2D31A 2I07A 5GHWL 2Y4SA 1N8ZA 3OR7A 4LOUD 1QBML 3HLAA 3UC0L 5I71B 1X5LA 4FQ1H 1RZIA 3RY4A 5FO7B 4G43A 1CGSL 4L4VE 1N2RA 5T5NG 1QYGH 1BEYH 5CJXA 2AEQL 4OBRA 1G84A 4XP1L 5I6XB 4M61B 1T83A 4XP5L 2Q20A 5HPMA 3SQOH 5EOCH 1A4JB 4JHAH 4XBEL 1MJ8L 4NRZA 2DTML 4WWKA 3O3UN 4I0PD 4TOYH 1N6UA 2W1NA 3PP4L 4WTXA 1BIIA 1U8NA 2GFBB 3F6LA 1BECA 3BT2L 3U36B 4LHJB 3B9KC 4MD4A 1IL1B 3QB7C 3HUJB 3S88L 3QFJA 1ZGLM 2HFEA 3MLSH 3HE7A 1T2QL 3V6FB 2YPLE 1QFWI 1I7ZA 3PF2A 3D2UA 2NY6D 1FZMB 1I4FB 1IGIH 1S7TA 5DD6A 5HGHB 5JHDB 2ZCLL 4FP8H 4OIIL 3VH8A 4JKMA 4UT7L 1HHJB 4LCYB 2BSSB 3GIVA 1CXKA 2A73B 4U1GB 4LAQL 1EHNA 3V4PH 4PRHE 3F65A 4MDIB 4QRUB 3QWQB 4S1RL 5IROC 4B50A 5JA9A 5DDHB 2W0FB 5CINL 3DMMD 3T0BA 1F6AA 3AGVA 4PV9A 2D9CA 3AC0A 2H32B 1MFNA 1GGTA 2NY2D 5FKAB 3QQ4A 5EC2B 5LWYL 1SYSA 3I3BA 3CFKA 2A83A 5T5FH 1JGDB 1H8OA 1KXTB 4S1QL 5I74B 3VFTB 5JXAL 4NKIL 5I75C 1I7TB 3KDMA 1WTGT 5DMJB 1DBBL 3JWDC 2E9IA 4C56B 1NCDH 4NQSA 4RGNB 4XHQA 1MI5B 4U1KB 2F54B 2ZPKL 5GQBA 1CE1H 2P5EA 2M2DA 1IGJA 4PRIA 4R26H 4BH7B 1MIEL 3KYMB 5EU4B 5HGAB 3BP6B 4L4TD 4HGMA 2XA8L 5EBWA 3F58L 3ZTJH 1R5IB 1A2YB 2UZYB 1UB6B 5E9DE 2DRUA 2DQIH 3JWOH 3NFNA 3X3FH 4PTUA 5ID0B 4JFDA 3L95A 4H26A 3ZHLA 4PJXE 4GLRH 4KMLB 1UM5L 5FK9A 5FO8B 1EA9C 4U6VH 4PG9A 3NTCH 5IBUG 1QR1B 4M62L 1RJYB 2CDGA 2IADB 3EOYG 3L3GB 4GKSA 4J4PD 1YNTA 3WJJA 1J12A 3G6DH 4RNRA 3D69B 4WDIA 5HYSG 1DUYB 1EHLL 3T65B 3P4MA 3RL1A 3I02A 1KJ2B 3GSNB 4LSTH 3QA3B 1TZHA 4CN4A 3JV4A 4WEUD 4Y2DD 3BP7A 2E7LC 1LO5A 1JF1B 3KPRB 2W0LA 4HHAB 4OLYH 5ALBL 1NMBH 2VB5A 2X44D 4GKNA 2ZNWA 1TQBB 1NMCB 3BO8A 4H88H 3QQ9C 2X40A 2RBLA 2R8SH 1H0DB 2XTJB 4Z7VF 1T5XA 2VLMD 4U1HA 4RMUA 5DMYA 4YO0A 1XZ0B 5MI0C 1QFWL 5CEYA 1BZQK 3DETD 3STBA 5GJSH 3VD3A 3B8YA 2P4AB 3PG2A 2O5XH 3O4LE 1NDGA 3N9GH 4O2EA 3MLUL 2QADD 4YQXL 2X4QA 3VWJA 1NGPH 1C7TA 1OAYH 5C3LD 3F7QA 2D3VA 3HAEH 3DUUB 1AI1L 4WHYH 4HUWA 4UMGA 5CJOH 4UDTA 1SBSL 4DGVH 4HIIA 3T4YA 4OZIB 4PRPB 1Q0XL 4JEGB 2OMBA 3PGFH 4JDTL 3SOBL 5IVZA 5I66A 3BZDA 1URLA 5KZCB 3CMOH 1IC4L 1YEDA 3PP3H 1EAPA 2GJ6A 1CDYA 3QHTC 1YEKL 4QF1B 1UH2A 5HYJA 2XIDA 2F58L 3T2NH 1JPSL 5IV2A 4NQDE 2AJZB 3BZFB 5IHUH 1EMTL 3EYFB 4BFBD 3VGEA 5GGRY 4HFWA 3C60C 1U58A 3QIUA 1CCZA 3RU8L 3C6SB 4KVCH 1G6VK 1VFOA 1FO0H 1U8HB 2DYPD 4MMZC 1GGUA 1UCBH 1AY1H 2Q1EA 4EI5D 2IH1A 2DTSA 2CLRB 1F02I 4KROC 4NKMB 4L3CA 3V52H 4OF6A 3O6KL 1RZKL 4KV5E 1AE6L 5C0BA 3D25B 4K9EL 4FABL 3V5DA 3C9NA 5EIQA 2WWMC 1HE7A 2BNRB 5KSVA 1OAQH 2O5ZH 4CBPA 1TLKA 4PJIA 3PDDA 4P2CG 4GKZA 4WV1A 4GSDH 4OCYH 4EXKA 1IKFH 4HWEH 2H32H 5ACMA 1R0AL 2UYLA 2ADFL 4JREB 5IIEB 1CDHA 2NZIA 2A9NL 2ZUYA 5E00B 3S96A 1CFSA 2AVGA 3VCLB 2CLZA 4HWUA 1HHKA 3SCMA 2C3XA 2IWGA 4F7TA 4MA3B 4RFEA 4JN1H 2J1KA 5HDBF 4ZPTB 1J8HA 4BQ6A 1WBYA 4WEMB 5GGQH 2P5WD 5E2WL 3NACH 3GMRA 3UAJD 4JM2D 3L3HB 1EO7A 2JK5B 1C08A 5DD5H 2YZ8A 4XWGH 1UYWH 2DQFA 3C60A 3F7YA 4R4BA 2C4XA 2ORBL 4BK4A 4NWUH 3L3JA 5FKPB 2XWJB 3QEQD 4LCWD 4UNUA 5IB3B 1U95A 2AXGB 4KK6D 1TENA 2JELH 3R4DA 3X11B 2OJZL 2B4CC 2V9QA 2DQDL 2P8LB 2DQHH 2G9HA 4HS6B 4IDLA 4G7YL 3SY0A 4DVBA 2H2PD 4J8RB 3MLPA 5JMOC 4LEXL 5F44A 3F7RA 4MJ5A 3I6LD 3EOTH 3PHQB 4GH7B 1FIEA 2NPLX 3W81A 4HLJA 1U2HA 5JTWA 4ZSOB 2OS7A 3ULUC 1Z5LB 3BKML 1MFDL 2VXSL 3MRHA 3G04A 1A6WL 5C0IA 5DFWH 3AM8A 3RKPA 1X5XA 3M07A 2PTTB 3MRDA 1EV2E 2FGWH 1O7VA 4R0LB 3MR9A 3BWAA 5C08A 4PJ8D 1EEQA 2KL6A 4ONFL 5GXBB 2YK1H 5IB1A 2BMKB 4NN6B 4JO1H 3QUXD 1LO4H 3OJMB 1KC5L 1EH9A 3N1PC 1CU4L 4P5MA 3QWOB 3HRZA 3MBEA 1GZQA 2XZCH 4MNQD 1JE6A 4QRTA 3N1FC 3IRPX 2DMCA 5C9JB 1JUFA 1D5XA 4KRPD 4HC1H 3L3KA 1XH3A 2ZUTA 1SMAA 2DBLL 5I1EL 4Y88A 1KYOK 2F53E 3RAJH 1H3UA 3R1GL 1VACA 4D0DA 3GO1H 3W11C 1ZHBA 3EDKA 1Y6KR 4PJFE 4NBXB 5ITBH 4Y1AE 3CVIL 3QPQC 3V5KB 5ISZD 3LAFA 3V4UH 4KHTL 1AO7E 1LNUA 1EJOL 4QNPE 1BGXL 4JFYB 4ZXBA 1VADB 2NQCA 5FYKD 4MJ4A 3GSXB 5DUPL 3EIFA 1S5HA 3MNVA 3S36L 3IJHB 1N0XL 1NSNL 1XF5A 4OLVL 3FFCB 5HDQL 1G7IA 3W5MA 1INQA 1EEYA 1LILA 2FCBA 3BPCB 1FNGA 2VDKL 3VI4F 2BZDA 1MI5E 1L9NA 4NQEB 2ATKA 3QDHA 5DUMH 4HKJA 2MSPA 2PO6C 2PUQT 3ELAT 1CG9B 5F6HJ 3GSWA 3IU4L 3ZKQD 3PL6D 4LKXA 3GI8L 3RKDC 1TTUA 2QQKH 2F8OA 5CP7B 4Z8FL 3QWRA 4OTXH 3U1SL 4ONOA 2ZG1A 2HJLA 4UIKL 3RGVD 2R4SL 3D3VE 3QI9B 4NNPL 5IESH 4FFWC