1ROCA

Crystal structure of the histone deposition protein asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
155
Chain Sequence
GASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the conserved core of histone deposition protein Asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, chaperone
molecule keywords Anti-silencing protein 1
total genus 26
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1rocA00
5BNXD 1ROCA 2HUEA 2IIJA 3AADB 4ZBJA 4RRPM 1TEYA 5EIIG 5C3IA 5BO0D 2IO5A 1WG3A 2DZEA 2I32A 4EO5A 2Z34A 2IDCA 2YGVA 2Z3FA 2CU9A
chains in the Genus database with same CATH superfamily
4Y2OA 2F58L 1FQ9C 2D31B 4LCIH 4N8UA 3UX9B 3MRRA 1M05A 1P7QA 1BEYH 4AYBA 4YL4A 3WDHA 1S9XB 1EAOA 5IGXH 3WTUA 2XN2A 4NRXA 3BWZA 5EUKB 1A3ZA 4YEEA 5IBTH 1OALA 2JTYA 3O9WC 2EIJB 4OZ4A 1INQB 4PS3A 2COVD 4LDOB 2YD1A 4J3OD 4JCWA 3C6LA 4DERA 4MJ6A 2P8LB 4OQTL 1ILUA 4H40A 4MAYC 3RGVC 3EYFA 4N90E 4MJ2A 2L7JA 1PD6A 5DTFA 2X2YA 4U1JB 2WXFA 4Y7MA 1DCLA 2IGTA 3FQNB 1TSHA 2NNFA 5D2NB 1XX9C 5C8JA 1HCVA 4KGJA 1NCIA 2H0JA 3QAQA 4G7QB 3F5WA 5FGBA 1V05A 4XODA 1JYNA 2BNRE 5T1DH 2XZQH 4FYQA 5K39A 4Y4HB 3PJSA 4PJHA 1DJYA 2ADGA 4PJ7A 1ZVHA 5H2BB 2X09A 2WD0A 1K85A 1E27B 1HWHB 2EDQA 2WXMA 1L9SA 4O9HH 2OMZB 3SQOL 3RUGA 4TOYL 1K8DB 3VFMA 5BZDA 5GGQL 4WWKC 2FEEI 4M4PA 4BE5A 5CSZA 3SDAC 3BYYA 4B9IA 2DLEA 4LSPH 5IR1B 3BKJL 1C5CL 4ABUA 2YARA 2DJ4A 1ZT1B 2Q3XA 4JG0L 3TV3L 1FCGA 1Q1PA 1EZLA 5AAWA 4HFWA 1RULH 1A6AB 4JDEB 4WHTB 4XNBA 5DHDA 5I74B 5SWSD 4DN4L 3QWOB 4QTIL 4UT9A 2VISB 3MC0A 2ZPKH 4NZ8A 1UD5A 3HMXL 4KMTL 5FYJL 2YC1B 2JVUA 1UM4L 1WYJA 4Z7VF 2DLFH 1IAMA 4MQXD 1TXKA 4OLYH 4PG9A 2K78A 1IFGA 4OLWL 5C0CA 3CJJA 1MREH 1T1YB 3D25A 1IAKB 5HXMA 3QK0A 4UTAH 1FFPA 3HHSA 4JUSA 2V8LA 4ELMB 3BT2L 5D2NE 2CZNA 1IGMH 2P8MB 4NAMA 1WF5A 3TBBA 3GGWB 4FNPA 1HXMB 1N7ML 1G7PA 5KAQG 3PQYB 3V6OA 3FHEA 2CIKB 4U3CA 4F9PA 1FL3A 3QUYA 3W39B 4BA0A 1KTRL 3FT4B 5FYJE 2FEEL 4IGBA 5DJYA 1SBSH 4DUVA 2VDOH 3CBJB 3F12A 2OSLA 3GXNA 3IDJB 4FLSA 5LHDA 1GGBH 3BWUC 1GH7A 1NAMH 4IIZA 3C5ZB 5E8PA 4ZJ9A 3U6XA 5BS0B 4PGJA 1MH5B 4HH9B 4PTTB 1MCKA 2EIBA 3BGMA 2MOGA 4D7PA 2UXFA 2EUVA 3QI9B 3R18A 5JXED 2J3SA 1E9QB 5E4EC 1CGYA 2CHZA 4ZFOB 5CCGE 4AYID 5E5LA 1D6EB 1BCIA 4PVMA 2MTPA 3SEPA 4A55A 4L5FL 5GZND 4ELDA 4OJEH 1TTBA 4JKKA 1E8ZA 3QJHB 3JYCA 3BKML 4M5TA 5MI0C 4YDZA 5JYLA 2Z7YA 1N18A 3C8KA 2APBA 3VFUB 5CGTA 4O9HL 5EEZA 4I7ZC 3U9PH 4WW2B 3GNML 3B7UX 1E43A 3RZCD 3H4FA 3ILEA 5HHVL 2AJXL 1ADQH 1N0XL 1EEYA 1O6TA 4KH9A 3EYQD 4PRAB 2ZXCA 2QELA 4JFDD 3HRZB 2YUVA 2QHRH 2Q2LA 1FL6B 4DOHB 1A7RL 1MI5D 2VDRL 2DS4A 2DQEH 4OGYH 1NGXA 2E6PA 3DJSA 5C0JA 1DEDA 1S5IL 4M61A 2A74A 1G1CA 3MRGB 4JB9L 4YR6A 3M17A 5T5FA 5D93B 4BFNA 3DETD 1DL7H 4UIMB 1QLRA 3U7WH 1J0HA 3CN2A 2DEWX 3WO4C 3VXQA 1SRDA 4GAYB 3P1VA 1PDKA 2HA1A 3G5ZA 4P07A 2AQ1A 5C0BE 2XWZA 4OLWH 2HLAA 4FP8L 5F7KC 5IJKA 2I9TB 5D1QD 3FUHA 3SPJA 5HVGB 1QG3A 4OZHA 4ZYKB 5C7XL 1F97A 4N8PA 3MJ8A 1ZXQA 1Z0NA 2ITDA 2N59A 4U6YB 3V6OC 3QNXB 3BLBA 3RTQD 3VRLE 3DX8A 1KBPA 3RGVB 3S36X 2HRHA 3F5WB 4PWKA 3S3PA 1B4RA 2X4PA 2DIJA 3H42H 4Z3TA 1CGUA 2IC2A 4M8VA 3K74B 4HIIB 4AGQA 3MN8A 4AEIL 3DVGB 3SDXA 1ZHBB 2OP4H 1H9VA 1DEEA 1PLGL 5FK9A 4ZBJA 1QA9B 4B95C 2NZ9D 5CU9A 4OCRH 2K9UA 1EBAA 1RHHA 4U4IA 1BFVL 5IHWA 5FA3B 4HEPG 1BVKA 3KXFB 3S36L 1ZHLB 4Z7WB 4UZGA 1X4YA 4PG9B 3LN4A 4OZIA 3BW9B 2DQ6A 5FO7B 3TNMA 4YDIL 2NNRA 3GSWB 4PJ9C 5CJXA 3QO0A 5L8LB 3V6ZA 3C6LD 3UMNA 3MQIA 3EBGA 3DURA 1IFHH 1QD0A 2XQBL 1IBHA 3D08A 2OKMA 1NCWL 5TQ2H 2UX6A 1HE7A 4CVZA 3RIKA 2ZXAA 1N3NA 1OAQL 5JNYB 4I0PA 3GZPA 1NGYA 1CFQB 2Y36L 5DJ0A 5G4NA 3CTTA 1B2WH 3QDME 1QFWM 2DI7A 3IJ9A 4PJGA 5FX3A 2EEXA 4KDVA 3CVIH 4NQUA 4ELMA 2NY4B 1XCTA 3CFKB 3LAFA 1FA4A 3MNMA 3U0PB 1CURA 3CZFA 2Y5QA 4FXGB 2VRKA 4B9YA 4DH2A 3RVUC 4OCNC 1D5BB 3ZYZA 2G3ZA 4YEFA 3HJ0A 2GG1A 2EINB 5BS0E 3NQKA 4HSAC 4FFTA 2W0LA 1GOGA 5FB8A 5IB3B 3US9A 2AV1B 5CU5A 4MLSA 1WBYA 3KPLA 4JO4H 4M6OH 3AG3B 2JCCF 3OGOE 2EUXA 1HX0A 4K8RH 4JPQA 1T20A 1BD2E 3SCMC 4LKXA 4BFIB 3L1GA 1YQVL 1QP1A 1FL5A 4NN7C 2NNAB 1W0VB 2WOYA 3EAKA 4NQTA 5LBSA 2J8UA 3K6IA 3ARGA 2IH9A 1CQYA 4EF3A 4GI6A 5DMIH 4WFED 3EZ8A 4QAMB 5KYUB 1I8KB 3AMKA 4NRXB 1U3JA 3OC8A 4DQOL 1HXYA 5D5MF 1NGZB 4MAYA 4DZBB 5C09E 5I1LB 4A38A 3ULVC 5BPPA 3P3YA 4JRXD 2ZCKL 3ZHLA 1SDDA 3QQ3A 2MOVA 4J28A 2JMRA 2YEZB 1VFAA 3C5JA 3TONA 4H8WC 4HG4J 2XJKA 4JMXA 1MJ8L 2ENYA 4X7TA 1OF2A 3BIAX 3DHPA 4MDIA 4KHTL 3GMQB 1U8IB 1FCCA 5LQBH 3B34A 5I5JA 3LS5L 2Q2EB 2K9FB 3M17B 4QJ3B 2ENJA 2FJGB 1TF4A 4F57L 3JWOH 2XVGA 1F18A 5E7BA 3MJ8B 2BVOB 1UUSA 3KPSA 1PEWA 2QADB 3BP7A 4ONGL 3RIAK 2ZXEB 1VEMA 5IM7A 4L9DA 1NCWH 5C8JB 5TQ2L 3HI1B 4G80B 4I85A 3ROLA 2WBJD 2XXCB 4C59B 2C9UA 2C1OA 2HG5A 5BO1H 2F0CA 3GINA 5LBSH 2QADD 5CFAA 5F3HB 3R4DA 5C07B 5J8OA 2EE2A 3P3TA 4PJEB 3MOQA 3FTVA 3HW7A 5D5ME 1EA9C 1KCKA 4JPVH 2CG9X 2BY2A 4I3GA 5D1XC 5E2UL 1S9VB 1XV8A 3ZVVA 4DKEL 1ZIBA 1Z9OA 1KG0A 4URKA 4GMSL 4IDJH 4LOUC 5HYQA 5E6IC 3I74A 5FDWA 3LPWA 2PO6B 2FWSA 3RZCA 4HXAL 1KCSL 1HS6A 2BY0A 4UQCA 3TZVC 5INDA 3DV6B 1XSKA 2DKSA 4WHYH 5BRQA 4N5UA 3U4EB 1MLBA 3OKLB 1S46A 5D70H 5MI0B 1T1ZB 2WINA 3STZB 2GQHA 3K5RA 3WLWD 4APQB 1S5HB 1XGPA 3LOWA 4XP5L 4OM1H 4LFHG 4M6OL 4G9DA 2YC1A 5IVXF 3QR2A 3BW9A 1UM6L 4TSBL 5TGBA 1MFMA 3M46A 5DO2D 1BFOB 2CD0A 1P6AB 3R1GH 4Q2ZB 4EZKA 5JOEA 1P84J 2JELL 3ILPB 3CZGA 3WDIA 1YYML 1FHNA 4UAOB 1EAJA 2R39A 3O3DB 4YPGB 2AEWA 1KYAA 4F7KA 2C34A 4AQAB 3QT2A 1G9NL 4KK9C 3RVVC 3ULVE 5G4OA 3KYKL 3E6FB 1JHKL 1PX4A 1J0ZA 1TLMA 3IDJA 2MCPH 1Y18B 1Y1DA 3QR0A 4XPGH 1XCTB 3UTTB 4LLWB 4OF0A 1NPJA 2CAKA 2DQJL 6CGTA 1DE4A 4FQIL 5CEYB 4UUJB 2YAQA 5DDHB 4GBXC 3G5XA 3OXRA 1NLBL 3RWIA 1YEGH 3LKQB 4LLMA 4JM4L 5L9DH 4KY2A 2OMUA 4IOSA 4QO1B 3LS5H 3E9TA 2VZ1A 1E5UI 1JI1A 2GIXA 3L2LA 25C8L 4M1GH 3JTTB 3HPLA 4TUOB 2V5SA 3I84A 5CEXA 3S34H 3WOVA 4WEBL 3QCVL 1FFTB 2AXGA 4P5KB 5T3ZD 4OJFH 4X0KB 1JMZA 4QKTA 4UNIA 3GJFK 2FO4A 3BE1H 5FW8A 3T0WA 4L1DA 3REWA 1KIQB 1F1DA 3QPQD 2QTEA 3SD2A 4JFPB 2X89D 5DGRA 4JPVL 3AM8C 4JN1L 4GSDH 3WLBA 3GB7B 4N3TA 4WU5B 1NBCA 3B5TA 3U1QA 1E5YA 3HUJA 3BZEA 4IGBD 1EEYB 2BS8A 3OR7B 1KEGL 4OGXH 2FLBT 1JZ3A 1G6RL 4R2GC 1M1SA 3EO0A 3T77A 5BQ7A 4J2XA 4MD5B 1D5ZA 2FJHA 4TUKH 4YBQC 1I9IH 5L7XH 5DA0B 2OXGA 2OCFD 3MPCA 1IGIH 3MMEB 4ZSOB 1J9QA 2KLRA 4B27A 3LRKA 5I1CH 2GFBB 3RX7A 3PGFH 1RZ7H 4ZO6A 1AHWA 4DSYA 1WTGT 2UXGA 5IBTL 3N1PC 1K4DA 2I9TA 1BEXA 3VXTB 5JLZA 3ZDXB 1FV1B 4WUUD 1TMCB 4XWOD 4Q97A 2P1YA 3QUYC 4JJHA 2H3XC 1DFBH 1DDTA 1VCBC 4WU7B 2AV7A 3UBGA 3F62A 4JFZL 1YYMH 1AD0B 4N6RA 3KWVA 3W0WE 3ROLB 3RY4A 4ZI8A 5ICUA 1G9NH 4Q4EA 1D2OA 2AAVA 4QRRD 4IBSA 3TYGL 2CUHA 2LW3A 1MRCL 1U8NB 3QJSB 3M1BA 2AKRB 1U36A 5DEFB 1E4XH 4HDIA 4X98A 5SWQB 2BCMA 2H41A 4X6FB 4L9LA 3IDXH 5E08H 5TF1L 1M7IA 5FKPA 1MPAL 1H6TA 3HC0B 3HR5B 2HWZL 4MMXC 1KNOA 2E7LA 4YXLH 1N6QL 3MHZA 2ATPB 3PGDB 4Z7WA 4BBWA 1BAGA 1LNUB 1VZIA 2J25A 1KLFA 4HWEL 3UOAB 2EYSA 3SKNA 2WSKA 3MO1B 2DQCH 1KDJA 4IKIA 2GEQA 1CC3A 3KPSE 3X14A 1SQMA 2MPVA 5JXEA 3AZUA 3BSHA 2ZICA 4Q6IB 4C4UA 2YO3A 3SQRA 3WXVL 5ELIA 5C6WH 4OR1A 4CVZB 3BRDA 2L3BA 4NKMA 5J11C 3RG1C 1FRGL 1S7UB 5EF1A 1GZHA 3FT3B 4JN1H 5A2BA 4ZNCD 4RFOL 3CN0A 5AUMA 2R0WL 4OJCA 4UOW0 4F2FA 1LILA 1KEGH 2D3LA 2BOBB 3H9SA 1D5XA 5E99L 4OQ1A 1AKJD 4JM2C 4IS6B 2M26A 3QEGH 1AR2A 2IGFL 4ETQA 4OI8A 1F86A 1QLFB 3CZNA 4FG6D 1SJMA 2VJ8A 1OCCB 3UTTE 4UTBL 4X8JB 4IRJB 3N42F 1YJDL 1JZEA 4AE0A 2AV1A 2CE6A 3BXNA 4JGJA 4QO1A 4IBYA 5DD3L 4DKFH 4TUOA 1DLHB 3SDXF 4BZ2H 1AC6A 4L29A 2HKAA 4RGOL 4RAUA 3OKDB 3WLBB 3K1KC 1UEYA 2X4QB 5B39A 2NY6D 4O2EB 1QRND 1MQ8A 3W3BA 5IJVA 5JW4N 1F90L 2K4AA 5EZOH 3UZEC 4EIUA 3OWEA 5DWPA 3O3UN 2OSXA 2Z4TA 4PJFF 5FGRA 2F9BT 3D87B 5KYUA 4OAWA 1MXDA 5DJXA 4B97A 1NCJA 4KNUA 2HH0L 1XXDC 2AS5M 4MD5A 1NGZA 4MAYB 4N2HA 4DHLA 5A6MA 5I1LA 1EMTH 1GC1C 3KPNB 4JHAL 4PCYA 3NAAL 1JNHA 4PJDE 5KANI 4NEHB 1J8SA 1WUNT 1U4FA 2HWZH 4YE4H 3II2A 3RFRA 4PWIA 3HHMA 4JHWL 4BDVB 1AQHA 2NY1B 1XTMA 2F61A 3MCLL 4MZRA 4DP4X 5BOPA 1ZA3A 1AI1H 4OF7A 4P9HL 2D03H 2FJHB 1JXFA 3CC5B 1MJUH 4MS8D 1ZWIA 4U05A 3VUAA 3BP7B 4JPWH 1WTLA 3ZU8A 1JK9B 1GMEA 4FGMA 1JZDC 4BUQA 1KJ2B 4P5TC 3PJNA 3B43A 5CBAB 5JHLA 3TCXA 3G04A 1DL7L 4FG2A 2BVQB 3D12B 4B3EA 4LRNL 1U9KA 5DMKB 4M5ZL 4WTZG 5LWYH 5GS1A 4KZDL 1M3JA 5DYFA 4NUMA 2PYFA 4AH2A 2V17H 1ZAGA 1BWMA 1DQQB 2K0RA 5D71H 1NIAA 2X7LB 1ORSA 4JVUA 3VSTA 2IH1A 1JXDA 4K71B 4YHOH 1H3PH 4G72B 2I5YH 4HOMA 2VLRD 2YAEA 4TQEL 3UCRA 1QMUA 1T7ZA 2CK2A 2FBJH 3DUUA 4Q6IA 3TJEH 3ZOAA 1JF1A 2VO5A 5I8EB 4M1DH 4K0OA 1MOEA 3IFOB 3RYMA 4YDJA 3DGDA 2FWUA 2R4RL 4PV8A 4M7LL 4TQIA 1KLFB 3C5ZD 3MXWH 1FNGB 1JUFA 3EFDH 3KJ4B 5TGBB 3UBFA 3THMH 1D5MA 2B3RA 1U8KA 3KPRB 4P2OB 3A0OA 3U1SL 3N50A 3TF4A 3DVNA 3GSQB 4NQSB 4U6HA 4NQQA 3M7OA 1EHNA 4P4KB 4LFHD 4ERSH 5FECB 1LYQA 3BESR 1NCDH 2FQEA 2UVFA 3K81A 3NYKA 4L4TB 5KW9L 1ASQA 2BSBA 3V4VB 1JZ4A 1JV5A 1IFHL 3QC5X 3INUL 5D1XB 4XPHL 5F1OB 4CVXA 3SBQA 1RUAL 4IBLT 1ZT4B 4BWTA 5FYLL 3ZDWA 1NMAH 1NUFA 2HLFC 3VXRA 1DR9A 4Y5YC 4HJSA 4PJBE 4PJ9D 2AC0A 1NUNB 3HS9A 3L95A 4I18B 5FUZL 2NCMA 1PAMA 4FRWA 4KROB 4GSUA 1GZQB 4PRIB 4HG4K 4OBRA 4K3DL 4HKXA 4JQXA 4AVHA 1YEWA 1OTSC 3EZJB 5FOBA 3CHOA 3VG9B 4I3RL 4XN9A 4V1DE 3KYMA 1FG2A 3HZKA 4RMWA 3O6FB 4JFPA 4N0UB 5KVDH 2W38A 5DZAA 1UH2A 1I8LC 2FT6A 2P28B 3KPNA 4MZ2A 5EWIL 4R97B 2O5ZH 3TN0C 1J5DA 4WFGE 4XVSL 2VDPB 4G7RB 1CXFA 2ORBH 1UFGA 1IFRA 4LVHC 5C97A 4OCMC 4LPYA 1CICA 3KW8A 4N1HB 1YNKL 3DSFL 5E2VH 2EICA 3CHRA 4B96A 1NEZA 2Y5TB 4JFEA 5KYWB 5IY5B 2QR0B 4M1DL 2WVVB 3T0EA 1T7YA 1DO5A 4M48H 3PPEA 3IAQA 2EIKB 1LP9E 3AY2A 4GSRA 3GMPA 2WXRA 1Y6KR 1FYTE 3DPBA 5D2LE 4QYAA 2CRIA 1USQA 2BIOA 3OJVC 5DI8A 4DT2A 5GGUB 1GGCH 2AV7B 2P5ED 1EO8L 3UFIA 4DKDC 4RH4A 4RRPG 3L4CA 5CR8A 4PJDF 1D6VH 1XAUA 2PYFB 3UPRA 3VI4F 1DVFC 2ZP9A 4MSWA 1JDAA 4KK9D 3WKQA 3MGAA 2N1KA 5EUOF 1ONQB 3PL6C 1RUAH 2KLTA 5DEFA 3UO1H 3QORB 4Y8AA 1KTKE 4A6YH 3OAUL 1AIFB 4OZFA 3RWDB 3GM0A 3E0GA 1ETZB 4PLJD 4YC2B 5E9DB 1QOKA 1L9MA 2PTTB 3IPEA 2N01B 5FOJA 5I8EA 2A6KB 2F5BL 5D4QA 5T33H 4YDJB 4QRTA 4JFFE 2YK1L 3FF8A 1THAA 2PETA 2OI9B 3F7KA 3WNJA 1EH9A 4AITA 4ZXBB 3MCG1 1R3JB 4GMSH 1BOYA 3OAWA 1JF1B 1GSMA 4I3RH 1KGXA 4OD2B 5LNGA 3ZX1A 1C08A 1HCZA 3H6AA 2PP8A 1KACB 1TU2B 1BXUA 2MNUA 3O6LH 5D7KE 4YUEL 5DZVA 1Q4NX 1SDYA 1X9LA 3H0TA 4IMLA 3EG9A 3FCBA 4FC3E 1JUFB 3TCTA 3RNQB 3FO1B 5C0BB 3P54A 4MB4A 3WTVA 2P5WD 4YDNA 4RVBA 3O4OB 4QRRA 4GW5B 4XBGA 1PG7H 3NEOA 4U6TA 4PGEA 2BOBA 1O6VA 2QSVA 4PHZA 2C9QA 3D0VB 1EDHA 4GS7B 2VDKB 4FYRA 3IDYC 1T89C 1R9FA 3SBWA 5B1CA 2YBGA 1A02N 2PWDA 1JF6A 1TKWA 3W37A 2BP0A 3J07A 1PZDA 5FF6A 4PJ7E 2HT2D 4H25A 5BXFB 2OZ4A 1X7QA 4AUYA 4FQJH 4NUPA 4Y2DB 3TS8A 4NRZA 5EUOB 3TX4A 4JMNA 3CMGA 1P5UB 2V5TA 2XTJE 1T1XA 3JVGC 4G59C 4KGLA 1Z5LB 3KYKH 3L95B 4Z3FA 2VXUL 2YA2A 4XX5A 5MEOA 3O6FA 4XO9A 3WSQH 4LCUB 5GGSA 3WELA 5AZ2L 2X4UB 2TAAA 5SWZA 3VM7A 3VSQA 3RVVD 1YEGL 5L9DL 2ADFH 2WY3B 3UMTA 1OGAE 3DX0A 5CZKA 4S0TD 4H8QA 4XI5D 1DQVA 4FABL 1N8ZA 3CH1B 4X2UA 1NC2B 1ZANL 2FE0A 1WPCA 3PDDA 1I7ZB 4NGHL 2R69L 2A38A 1JERA 3OB0K 4Y4HD 4LVNB 3DOSB 4IRZH 2CKBB 5JIPA 4LLVA 5GS0L 3TEWA 1MFVA 2C9SA 4OB5L 2FH6A 4TTDC 4HJ0D 2BLFA 4L4VA 4MB5A 1MWAA 4R26H 2F15A 5KSBA 2YUZA 3BH9B 4H8PA 4K7PH 2B4CC 3VWKD 4NYLA 2XFXA 1BOGA 2DQHL 4HPYH 5ABZA 5HHNA 4LSTH 5LGYA 3S97C 2MEJB 2D7MA 3MR9A 5DHMC 4JE0A 4C56E 2B9BA 2PCYA 3D69B 1E9PA 2GSMB 5F9JA 2LU4A 3VG0H 5IBUB 2H9GA 5CD3B 1MFAH 4GRWE 2J20A 4UM9A 4WJ5A 3T0XA 2YFNA 4AM0Q 4QOKA 2CXGA 5EZIL 1YECL 4O2CA 1UZGA 4BKTC 4KUZH 3WY4A 5DC0A 5BVJA 3RWDA 4QWWC 4A2MA 2J6EH 4Z76B 1ID5I 3HFMH 3EJUA 1C8QA 1MHEA 1KXHA 2JJSA 3FU5A 4XO8A 1TJGL 2ZF9A 1A1NA 4UNUA 5D6CA 4Z7IA 2O6DA 3O6ML 4NI3A 4BXSV 4L2LA 4HUNB 4GJTB 3IF1B 3REVB 3FN9A 4WI3A 4PJHE 4KQ3H 4YHLL 3OD3A 4NP4L 2MCAA 3NJIA 3TYGH 5F0LB 5I6NA 3SB3A 5ENWB 2X89A 3RUGE 4GQRA 1N6UA 4N2CA 3SGKC 5E0QA 5GSRB 1MNNA 1S9XA 3GS0A 3K80A 4H8UA 4J3OC 4W4OA 4OZFH 2IDTA 4PH8A 3KCWA 12E8H 2DI8A 1BQHB 4NUJA 3RDTB 2AGJL 3RL2B 1Z5YD 4N2FA 3UJIL 5A43C 1CFVL 4ABVA 5FYKE 3K0YA 4I2XE 4XBGB 1R33A 1LEIA 3X1FA 3DIVA 2H8PB 1RAMA 1GC1H 4MA8L 2QSCH 3NRFA 3NP3A 5KVGE 3RNQA 3LXCA 3LZNA 1MHPL 1DN2A 5HGDA 3SDDD 3VW3L 4FLOA 4CKVX 1GSKA 4JPKH 2ITCA 5TE6H 3SJVE 2ATAA 1JGLH 2CO4A 1G7IB 1P4BL 1X7QB 3MJ7A 5J9PA 3ULVD 1KB5H 2GJ6B 1PSKL 2CHWA 3R0NA 5C6TH 1K8DA 1R5IB 5F8QC 1DJHA 3HCVB 3RLSA 4IBUA 3D0VA 3T2QA 1QBBA 3QEUB 1OCRB 1RZKH 4K7PL 2ROXA 3HAEB 3IXAA 4G6AD 2W9EL 1YEJH 3Q1SH 1VDGA 1P9MA 4ZS6C 1NOLA 1THCA 3BO8B 1T0MB 4LHUB 3W81A 1E3FA 4ZUUB 1T1XB 3QXDB 4AQOA 2FQFA 4DN3L 1C7SA 4ZZFA 1OO2A 3DECA 1CICC 4EQ2A 2ZYSA 4B9GA 5CEZL 3BYTA 1Z3GL 2WSPA 1A3LL 3ME0B 5EZIH 3HZ3A 2DIEA 2VRAA 2ZWYA 1TITA 1N8ZB 2F53E 2G4GA 3LN9A 3ZL4L 1JV2A 5H35A 4I9WD 2GT9B 2DH2A 2M1KA 2W65B 4P4KC 3KYNA 3TNNA 2WZ0A 1ZLSL 5B3JE 3AQYA 4H13C 4XXDB 3BH8B 2EDHA 4HUVA 2H32H 4UQ9A 5F1NA 1L6ZA 1YMMB 2WQXA 2WC7A 4HKZA 4NQEA 4AGLA 4HEPA 4EIZC 5HHQB 3ARFC 3ML8A 2WGXA 3GMRA 4TVSa 2Y7LA 1UOLA 1SJEB 3KHQA 3OKKB 4NO5B 3T1WA 5E56A 1RK0B 3OHMB 1U93A 3HFFA 2W60A 1SOKA 4JVPA 4WKZA 1OT4A 3UZQA 5KSAC 5J1AA 1ADQA 3NFNA 1I53A 1ETA1 3VFPB 4E41A 1IAIL 1P1VA 2B15A 4W6XB 3S9DB 2IQ9H 2X2UA 3P73B 3QIBB 2VQ4A 2NYYD 4LO9A 4A1RA 2EE0A 2V7HB 4H20H 2ED6A 3C5ZA 3MV7D 5BS0A 1OP5H 1GAFL 1AI1L 2JV6A 1RD6A 2VSMB 5I1JL 3NABL 3GIZH 3WNIA 1MHPH 3DNKA 4V1DA 4P23B 4RQQA 5ANMB 4ZFFB 4Y9FA 1JIBA 3A6CL 2X5PA 2L4OA 3QI9A 5F6IC 1E7UA 3AT0A 3WEXA 3O0LA 3DO4A 1IKNC 5HGGS 5C0EB 2YXVA 4U1GB 3PP3H 4J12A 1OWWA 3FQ2A 3GXIA 5GRUH 5D4JA 4QRRE 1OGTA 3ESOA 4LOUD 3N5AA 4KKRA 2UY7A 5KSBF 4MA7H 4N28A 3KPPA 3MRHA 6FABL 2DKUA 1H3VA 1JN6A 3N41F 4AKPA 3SDYL 2ICCA 1A1NB 1HILA 5D6CB 3N1FC 1HINH 3LZOA 1KCRL 2FEJA 2OM5A 4ADIA 4CMHC 1ZTXL 3VRIB 4G42B 3Q8BA 2WBJC 3BSZH 3UJJL 4YXHH 1DBML 3MLWL 4JFQB 1N59B 4OD2A 2CO6A 2O72A 2G9KA 4MCNA 1Y6NR 2IH8A 4JX0A 1HKLH 3CZLA 2R56H 4JFHD 4LIQE 4XP9L 3BUQA 1ADWA 3K4ZA 4P46B 2EZ0C 1L7TL 4H1LA 1WT5A 4QEGA 5ALCL 2WXNA 5KVFH 5CKGA 2R0KH 1G7IA 2BO0A 5B3JF 4R9HA 4I0CC 4W9HC 3D85A 2A3TA 2A99A 5LBGA 3MXWL 4YDVB 2OJZH 2WKLA 5I75B 4J3OH 3QEUA 4UV7L 3G5ZB 4JNXA 2QL1A 3RTQC 3LRSB 2AJ3A 4RX4A 1QRNB 2H32A 5JOFB 3IGAB 5I28A 5IW1B 4K15A 3MUJA 3LHPL 3W11D 3IVKA 4BFRA 3Q3GA 2YLHA 3V0VB 1UURA 5MEND 2Z35A 1FAIH 4DPRA 1P5UA 1M6UA 2JCCE 4JFOB 2GBUA 3S96B 3U6RA 4AM0A 3KPTA 3CHSA 2J8UF 2IWGA 2DBLL 2R1YB 3PJLA 1KXTA 4JZJC 4ZFGL 4XAWH 5BW7C 1VKXB 1IBBA 4OZIB 1UWXH 1JV2B 2YQ3A 1M1XB 4H20L 5DZLA 3W56A 3DTUB 3K71A 2AK1L 1DQJA 2H1LM 1HQRB 5AYUL 3ZDXF 2WSDA 1BDYA 2UWEF 5ERWB 4OFYD 4UIKL 1NAKL 2FBOJ 3BP4B 4AMWA 2IQAB 1UKTA 3L9EA 4GQ9L 1BSIA 3V4PH 3QQ9D 4XVOA 3T8XB 5GS0C 5JNYA 3AGWA 2CU9A 2J71A 2JJTA 4NQDD 1FFNB 3QDJE 1KJ2H 3DX9B 2IEPA 2WLLB 1OOAA 3II1A 2Y23A 2FATH 1M7DA 1AO7B 1WWBX 3I50H 4ZOEA 3FSOA 1U6AL 3WN5A 3ZE0F 3GHPA 1KGIA 2YKLL 4BGLA 1QI5A 2P45B 4UB0H 1E5AA 4BQBA 4AMKH 4IBQA 2ZJSL 2YPLA 4DUXA 4L3FA 1R46A 4RA0C 3C2AH 3NIDF 3NSCA 4Y4KC 5I1EH 2R29A 4YGVB 1RK0A 2YLKA 3WIAA 4J4PA 1BYPA 2JF1A 5AZUA 4WI0A 1FGNH 4JL2A 4PW4A 4ZMVA 4FXGA 4RIRB 2JKXA 5B7FA 4LSQL 4X4ME 4WI6A 3GXTA 5C86A 4IGBC 3ARED 3MREB 4PSRA 1WCBB 4HCIA 4PVLA 1Z9NA 1RZ8A 4RBPK 2BVUA 4E9XA 4NFDA 4XNAA 4KVPA 3F8UB 5SWZE 1JN6B 5I18H 2ESVA 2R0ZH 4MDRA 3BEVA 4CC0A 1NFDE 1I9JH 3ORJA 4XVTH 3Q48A 3BAKA 5AVWB 3COOA 4W4NA 4ZAKB 1UD4A 1FIEA 2HG0A 5KVEL 2F54D 4L4TD 1IJNA 3HMXA 3KPPB 2WIIA 4S10A 2HAZA 2NMSA 1HSBA 1RCYA 4PJDB 3VRLF 3AB0C 5DQDH 4JG5A 4HSQA 2Q20A 4G8EB 2OK0L 2ZOTA 4X7TB 5I0XA 1U21A 4L0PB 2V2TB 3B2PA 4ZMAT 3VQMA 1A7OH 2Z31A 3QO1A 4NZRH 2A2QT 2NX5D 1H19A 3V4VL 3T3MB 2J88H 4XCFH 2EKSA 1CB4A 2MCG1 4DGVH 1MAMH 3GHEL 1QKZL 4ODSL 5D6DA 1R5VA 2AJVL 2P8LA 4TLTA 3WFDL 5JMOC 4P46A 4N4YB 4FKHA 3G3LA 1IT9L 2B77A 3SN6N 1KTJA 4Y88A 4B9FA 3DSNA 1FO0H 3IGAA 1I3VA 3OM3B 4WK2B 3WE1A 5DTFB 1IM9A 2R29L 3DGGB 5AOIA 2XXGA 3Q3GB 1FNFA 1HDMA 3LVTA 4G3YL 2DWDA 4NO0B 4QRFA 4WWOA 4WNQB 3V9FA 4GH7B 1R24B 1H8SA 3UTPE 2HFFA 2Z93B 3LEXB 3W0WA 3JBG7 3RGBA 2Y2YA 2GPZA 3GXFA 3ZRCC 4CC1A 3AROA 4ZMWA 3D3VB 3ARTA 5E6ID 4JQVA 6PCYA 3FUFA 4X42A 1BZ7A 4YHYC 4FXGC 4P5MA 2NDFA 1LO5B 1T0MA 1DQJB 3OGCA 4DGIH 2ENPA 2J2ZB 3TH3T 4NNXA 2JCCB 1U8MB 1BMGA 3QXDA 2NYKA 3MV9E 4HS8L 1L4IA 5D9SB 1H9DA 5KYNA 1DQML 3K2UH 2NT0A 2LV4A 4FCHA 2N1TE 4B41A 4XE0A 4KQ4L 4R4BA 4LSPL 5JQ6H 3GHBL 3CHPA 1G6RB 3KJ6L 3QW9A 4BFBD 5GZOA 1MRDH 3I9GH 5D2LB 15C8H 4H5SB 3ZKXC 5JIIA 3RY6C 3HIZA 3QDJD 4FEIA 5EOTB 1TYRA 3SDCA 1AXSA 4B53A 5I18L 3HUJF 1KXQE 2VWEE 3WD5L 2UYLA 1F4YL 3B6SA 1M2VA 1SN0A 4LNVA 5C0CB 4HZAA 5CJBA 4DP2X 4RMBA 2WLJA 3GLDA 4D3CH 4LDLB 4AJWA 1UM4H 2CDFA 4QPEA 1X44A 1J0YA 1T7VA 2HLEB 3GMRB 5EU6B 4N0FB 4G1EB 4ZUVA 1JBJA 4L8BB 3UGEA 3FUDA 7FABL 2QVTA 4FABH 1IE5A 2FUQA 1V55B 2XQYK 5DRWB 4U1MA 3FOLB 3G6AA 1NCAH 4HK3J 5JZ7C 1DBAH 4ATWA 3RWIB 4ZG1A 4LBEB 3C60A 4G8GE 4B9PA 3IDIB 4OLZL 3QNZA 4U1KA 4ZW5A 3UTTA 1RZ8B 3QZWG 3ZHKA 4D0DA 1CLZH 1QKZH 1BJ1J 1A2YA 2G0KA 3KPQB 4KJYB 1BP3B 5LO7A 5JOPE 1KYDA 2ZUQB 5HDOA 4RIRA 1NBYA 2H3NB 3RWCB 3HLAB 3WY1A 1U3HA 4LSTL 5PCYA 5L2JB 2CM6A 4GAJH 3ZDXE 3HBZA 5DMGD 2BVPA 3MFFA 1KGYE 3MRIB 4LAQL 5KYXA 2GTWB 4Y1AE 4E0RB 5JPNA 3QDHA 2YD2A 5SWSE 5DS1A 5CJXC 2G3MA 4MD0A 4PCKA 1UQSA 2UY7B 2VC2B 4L8CA 3E2HC 2CBPA 1CI3M 35C8H 5D4HA 2XVBA 3OR7A 3C8KB 2ESVB 4CU6A 2WCPA 4M6ML 1HCYA 4PRPD 4CA4A 1NBVL 1OANA 2MRYA 1IC1A 2APSA 1OQXA 1BZQK 4PJIF 1OT1A 4PJ7F 2MJWA 3UAFA 3TEXA 4PGBA 3WLWC 1ETB1 1GJUA 4HS8H 1XZ0B 4X4YA 1GJWA 4DEWA 3FFOA 1MUJB 1SN2A 2A83A 5A7EA 2ZD0A 1SLVA 2Z91A 4G6MH 3M07A 5EORL 2QZQA 5EBLB 3K1DA 4DO5A 1B4LA 3AU1B 1DVYA 2OQJA 3O6KL 5T3XL 5ESAB 4K94C 3BFWA 4Y2DC 2AQQA 2EXWC 2WXHA 3BAJA 3Q2WA 2ZE0A 2BIQA 1CD8A 1VFMA 1W8EA 1G7HB 2DQEL 4P46D 4NX0A 3QHFL 3CXHJ 4LBAA 3WD5H 1HYSC 4GAYA 4PBXA 4W1TA 4YDVA 4X9YA 3R19A 4HEMA 2X4RA 3NCYS 2HLAB 2AGJH 3UJIH 2NXYC 4HV8A 4AYEC 1IKNA 1HE8A 4GIAA 1MCOL 3PJSB 4PJHB 1FDLL 4XTRC 3W0WD 2ITDB 5DU7A 2E0PA 4WWNA 4DGUA 1F6AA 3I9PA 2VQ1B 3CFNA 1QLEL 3QIWA 2BY1A 4MYWB 3C5ZC 1IM9D 3IXTA 3QDGD 3VQ1C 5T3ZL 3ZZQA 5C0IB 2ADIA 1F0LA 2VLLA 2WPGA 1A6UH 4HIEB 5F7EH 1AR1C 3B2UD 3GK8L 3GWJA 4FI7A 4LLDA 5J56B 3GXDA 1YDPA 1PSKH 2GI0A 4GNKB 2OZNA 3QDGB 2F1AA 2IAMD 2JI1A 4C47A 1XVSA 3QZWB 1YAZA 2BNRA 1RHHB 3GTTA 4AEIH 1AXSB 4XOCA 1YEJL 3Q1SL 2VR3A 1XGQA 4F1ZA 2JXMB 4GW1A 2HFGL 4TNGA 1RJYB 3N40F 3SYCA 4TPRH 1JFQL 3TN0D 4LCYA 4UNVA 3JYBA 3X14B 5TDNA 4H0IA 2H5UA 3FU3A 4JFUA 4OD3H 1BZ8A 2ZAHA 4XZ4A 5SX5K 5K1JA 4I0PB 2DQMA 1LO3H 4XNUH 5IT2L 1CLYL 3FT3A 4ETQB 3VD2A 3MRCA 1CUOA 4HIPA 4KK5D 3BT0A 3F84A 3P9MB 4R96B 2H2PD 2R15A 4G1EA 1Z9PA 3IRCA 4I0PD 4OSUL 4X8JA 3A4FA 5HHMD 4AQEA 2XETA 4OU3A 3GMMB 1J88A 2P24B 3EO1B 1HQ4B 3GKZA 5I76A 4LMQE 3CZSA 3KWXA 1E9QA 1Q1JH 5ACLA 1IGJA 2VDPH 2W9DL 1UB6A 3JV4A 4C56B 1G9MC 4F15B 1FVEA 1NIDA 3V6OE 1QSVA 4ZMZA 1GXEA 2NY6C 1G84A 3GMNA 5E4IA 5F97E 3LXUX 1UWXK 1E5BA 2BVPB 1T04A 4RDQG 4I2XB 3VFSA 1IEAA 3AXHA 1KCWA 2CNZA 1FWXA 4NCDA 1GA2A 1VESA 4GXUM 4ODTL 5CUSH 4FJYA 4G71B 3VU2A 4CJ1A 5I71B 2HKFH 5GGTL 1MIML 1ODUA 3K6SA 2Q3ZA 4X4ZA 2Y7QB 3EJYC 2HX8A 3CQQA 1A6UL 1QSZA 1D7CA 1C8PA 32C2B 1P6FA 2GJ6D 3BZ5A 2VQUA 2ZWZA 1FGVH 3NK3A 3ZMNA 3DUHA 2LLLA 2YPLE 3O8XD 2WQRA 2QQLH 3K2IA 2WP3O 1ZV9A 1BG9A 2DIAA 4JFEE 1VFAB 3C5JB 1NUDA 5C71A 4XNYL 3T2OA 4MDIB 2EVFA 4HWBL 1ZLWK 5EBLA 1CE6A 4FS0A 2V8MA 4P2QB 1ZJAA 3NH7H 4YXHL 2FJGA 1ROWA 2X4TB 1IM3A 5IVNA 5DFVC 1GHFH 1MCBA 1WC7B 5T5NF 4LCCB 3NMEA 1HDMB 4X4MA 5JOPD 2EKJA 4GINA 2VQ1A 2KQMA 2X4RB 4EN2A 1J9SA 5DT1L 5IB3A 2F1BA 1DN0A 2ESVE 5HHPB 1JWUA 3RL1A 1MFDL 2QQKH 2YKKA 3C5XA 2HPOA 4OF6A 1TQCB 1XCQA 2MQGA 3KHOA 1NJ9B 1IGYB 3UGXA 3QUKA 2Z1KA 3QDGA 3R8BB 3OZ9L 5FFLA 1JRHH 1JFHA 1KTDB 1X6LA 2AJUH 1OCWL 5C0IA 5CBEB 3VGHA 1HOCB 5E6ZA 1TIUA 3FQTA 2W9DH 1IVLA 3T3PB 1UH4A 1OM3H 4HIQA 3T4AA 1IZJA 3DURB 3RPIA 4KTDH 5GRVK 2ZSWB 2Z64C 4U6HB 5KVGL 5I71C 1LO4H 2B20A 1XTLA 1LD9A 4OM1L 5E6YA 5GGTH 5K69A 4BD4A 1P53A 1DQDL 3NA4A 4TLSA 3VXOB 2WO3B 3RPKA 3T8MA 3IGFA 1AS7A 4PJIE 3ILPA 1K3IA 1KB9K 3V0DA 4KTGA 4LL1A 4Q9BA 4A04A 5HDLA 3U0PA 2PWHA 1PFCA 4U1MB 5HHME 2WANA 2X4OB 3DDFA 3MV01 4HH8A 3T65B 1TQSA 1JV5B 1TQVA 4AZ8B 4TN9A 1FZKA 1ZPLA 3D85D 4L05A 2B08A 4PJAF 4H8WH 4LLWA 4TQPA 3JVGA 5F96H 2BSRB 4S1QL 1E42A 3HN8A 3GDCA 5DK2A 1YEEH 4ZXBD 5FFOA 3RWCA 5FKAA 2NR6A 4P05A 2XUWA 1Q9KB 3MFFB 4F33A 4Y4HC 5T1DL 4EDXA 1LWRA 2G4EA 2ZQKA 4WVRA 1U3ZA 3PABB 5MENA 2OMBA 4TTDD 1JE6A 2ZNWA 2EE3A 5TFSL 3VVWA 2FIRT 4MASA 1OWRM 3I2CH 4KKLD 4WLCA 3WIIL 3BT2H 2OLDA 1A1MB 3KYMB 5AW5B 3D6GA 1OW0A 3V6FB 5GGVH 1ZSDB 1G9MH 5AW4B 1XIWB 1UKSA 3EOTH 3BPCB 4JG0H 1H5BA 5C2BL 1FORL 5GRZA 6PAZA 2PO6D 2E46A 4YNYA 5C3IA 2VDOL 1XSJA 1I9JL 2FWLB 4KJWC 5KZCB 1CFBA 2B5IC 4XC3L 1CE6B 1E9OA 3DXAE 1JZ5A 1NEZG 3LKPA 1XSIA 4U1HA 5K9QI 2OQJB 5DI8B 2VW7A 1G6RH 1QTYT 3CXDH 4Y2NA 2GJJA 3JQOB 1A66A 1NEZB 2Y5TA 4JFEB 3QI9C 5F9DC 2UWEB 4LCWA 3HNSH 4U3SB 2GFBA 5CD5C 3DJ9A 4FXLA 4UTAL 3T0EB 3P2DA 1QRKA 2XN9B 5DQ9B 3T8VA 4OFKA 4MMZB 2HUEA 1YEHL 5DVLA 5I1CL 4YDLC 4N0CD 3GS7A 3W1ZA 4R7DA 5DZ9A 4Q89A 3P9WB 4WU7A 3CDGA 3X3FL 3HE6D 4L1TA 2R2EB 2C3HA 4D9QE 3ARFD 4E9WA 1ITCA 3LCYA 3NPSB 2YSSB 2RAMA 4NQDB 5F1IB 1CDUA 1ADQL 1N0XH 2ADIB 4FAAB 1OZUA 4QHLA 3ZTJH 1EXUA 1NJ9A 5FGSA 4UOZA 1K5NA 2W92A 3QQ4A 5HHOB 5KYYA 1KFAH 4OGYL 3U4EA 5F96L 5HGAB 2VZVA 5E94A 2PTUA 4TRPH 2DQGH 4ES9A 3C60D 3F7YB 5AW9B 3HG0A 4KHXH 4WTWA 4TUJA 1UOWA 2BIMA 4G9DB 2CGRL 4GEJA 3QFJD 5D5MA 3L1OH 3BMWA 3ZBMA 4RWYL 1X6NA 2ICEA 1OM9A 4PP1D 3NUKA 4W9LC 3SE3A 1AGFA 3X13A 3E2HB 4XNZB 4YXLL 1N6QH 3AG1B 5JHLL 2FX7H 2VSCA 3ZDZE 1SXBA 4RESB 2YZ1A 1CL7L 3OJDA 3IRPX 3OHXA 5K9JL 4QTFA 1AANA 4BIKA 4PG2A 2FB4L 5FM5O 1NCCL 1ZXKA 4Y19E 1KEMH 3EG9B 4UYQA 2H2SC 4G7VH 1NC4D 2HVBA 2OYLA 1A7NH 3TJHD 5DVPA 3GT6A 3N41B 5H4ZA 1JHTA 2QFRA 4KKAC 1FRGH 4PGCA 5BXFA 4K94H 3MROB 3P4NB 4JB9H 5KN5B 5IHUH 1NMBL 3Q6FB 4FXKA 5HYJB 2KPNA 3G6JF 1VZHA 3L5WB 2W80C 3T65A 4OCRL 2YD4A 3GZOA 2WMPB 1A4JA 1W9XA 3WKMH 1FYHB 2NXZC 2V7NB 4MMYB 4PY7B 1A7PL 1JVOA 1FNAA 5MEQB 4IU3B 2VXTL 3BISA 4F8LA 5L4IA 4BQ6A 3AT8A 1HYSD 2DW5A 1U0QA 2IFFL 3K8MA 2C7FA 2NNCA 3QXAA 1YEHH 3Q8AA 1Z5LA 1OW0C 3BKCH 4F8TA 2Z4QA 5I6XC 1TVDA 3ARUA 5EO9B 1WRFA 1XH3A 3X11B 5I23A 4YSAA 2CHDA 1NC2A 4O00A 4JGMA 1L5GA 1DBBH 2EABA 5ILTL 1UCTA 1NAMB 3WL9A 3TT1L 4QXTB 5LN8A 4A66A 1HZHL 1IC7H 3DOHA 4U33A 4QI3A 2BDNL 2JFCA 32C2A 3V95A 4DFHA 1LTXA 3UBXB 2H0PA 4NO0D 3UJTL 5E6SB 2JH2A 2QSTA 5GRWA 5DWUH 1D5ZB 1H5BB 3GC3A 4U6XA 5JPNC 4NYLB 2W07A 4EDWH 5C0NC 4YHKL 2HH0H 4KHXL 1T0PB 3VA6A 4MFHA 4FLQA 4G8GD 3NCFB 3UTPD 1XR8B 5EN2A 1TJXA 5I8CB 3FB6B 1V7MH 2ZCHL 5JLZB 1NDMB 1LWJA 4R7DB 1HSAA 1OTUD 4LLYA 5C08D 5ADPH 3VXSD 4Z0BL 3CH8A 1TO4A 3UTTD 5L0QC 4JRFA 2P80D 1MCQA 4GQPH 4AYSA 4N2EA 1YQVH 3MCKB 2RFXB 4M1CC 5DK0B 4WHYG 3MGTB 4GSQA 5DJZB 1PQZA 4AK2A 3QC6X 1EO7A 2EVHA 3WTTA 2P7TA 5CSBA 4PD4J 5TE7H 4UILH 4HKBA 5ADOH 1K5NB 1NCNA 3CPLB 3QQ4B 1PYWB 1IQWH 1KTLB 1WQVT 2NZIA 4JG1L 4M4RA 4EI6B 1S7RB 3SGDI 3V4LA 2UZXB 4HGWA 5F21B 2EXWD 4FZ8L 3NZ8A 3AFLA 2ZCKH 4MCYB 4KV5F 4AYFB 2XCMC 4N2OA 1H3XA 1A7QH 2OX5A 3ET9F 4LL9A 3KLHD 1UCBH 5GSRA 4A7TA 2IOMA 3CE1A 4XBEH 1U8CA 1NDGA 4BH7A 4NJAL 1I8IA 1QLEH 3FCSA 2WLZA 4WSJA 2FUTA 4XBPA 5LQBL 1Z9SA 3QFJA 4F5CE 4WI2A 5DJAA 5B4MC 1KSRA 2Q87A 3B5GA 3BKCL 3Q2CA 1GCYA 1VPOL 3B9KB 3DA0A 3KBHE 4WW2C 5ID0A 3JWOC 3AU0A 3TJEL 2J4WH 2QQQA 4MMZC 2ZXDA 4YFLI 2Z7WA 3WFHA 3DRTB 2VLKD 2OJEA 2W0FB 2CJUH 3SDDC 3MROA 3P4NA 3LIUA 2BHFA 3D50A 4U3HA 3IMVA 3TT3H 1XZWA 1IC7L 3LN5A 2Y6SC 1OOWA 4X7EC 3F7VB 3GD1C 4ZT1A 1YSOA 2R7EA 3AS0A 1GMIA 3HE6A 3L16A 3LRGA 4XP1H 3UBXG 2FZ3B 3M6DA 1B0RB 3O45A 2K45A 4EDWL 3FB5A 5I0DA 4YHKH 1NSNL 4Y1AD 1SXZA 5DHVH 2GSIB 2HKHL 3FO0H 1YNTB 1H0DB 1WH0A 2GW5A 3O8XA 5CGYD 2VB5A 3WIFB 1E40A 2APFA 3FB8A 1B4TA 2Z31D 1XH1A 4XP5H 1X3DA 3FOMA 2YD3A 3NSFA 2YRZA 5LBSL 1H15A 4IRSA 3T1FA 4LCCC 3S35L 2VLRE 1V3MA 2NTSP 4MKTA 5DHEA 4JKPL 4YX2H 5C09D 1I1FB 3FO9B 2VN4A 4FEMA 3NJNA 5KTEH 2CUIA 5J0BA 4QUOA 4HCRH 3KD4A 4H2CA 4N26A 3L3OC 2YGPA 1UOVA 4X9IA 2CUMA 2GTZA 2CBOA 2KHAA 4LQFH 3FS9A 4L9LC 2IDCA 1J05B 3IMSA 1VF5C 2ZUUA 1J1PL 1WGOA 3LYRA 3PWPD 4CVWA 1KCSH 1DQLH 3BAIA 4Z7NE 5BVPH 4GAGH 1GGIH 2XPZA 5CIPH 4PJIA 1LO2L 2ZNXA 3NEEA 4X6DF 3EDEA 4X9BA 1I1AB 2MSPA 4POZD 3ZYIA 1FP5A 4W6YB 4YDMA 1UCBL 3T3MF 3NZHL 1YY9C 3RFZB 2K1MA 5I8KH 4YPJA 1U33A 1I9EA 3CG8A 4AV0A 3VXNB 1MIMH 3OKNB 3ZKND 5J1AB 5F1NB 5LUMA 2Y7OA 1QPPA 2F8XC 4JM4H 2YPKB 3OX8B 2W07B 2XWTA 3HZVA 3PL6A 3QRGL 4F2MB 3TTYA 5GGRB 3D7PA 1XDTT 3U2IA 4CDHA 3L4TA 3F58L 1BGXH 3Q5YA 4KOBA 2CLVA 3RUGF 3VFGL 4K3JL 1FE8H 5HJ3A 1U8HA 3U4BH 2NW3A 4ISVA 3VDCA 1UM5L 3BE1L 5LNEA 2EDXA 2D4FA 2Z92B 3PV6B 1WAEA 5IKCB 2ZXQA 4HGWB 4E41E 1F00I 1KLUA 4GKSA 1WFUA 1T6WA 2B3IA 1HU8A 1S78C 3HNVH 3QA3A 3TN0B 1P0SE 5GZNC 2C4XA 3O4LD 2P7TB 3OLIA 3NACH 2AQ3A 3JUYA 3U2JA 1ECYA 1HILB 3EBAA 3FPXA 5CEZD 3EYUL 3NSDA 2X2JA 3S34L 3PFQA 1I9IL 1A4KB 1NOAA 2VTFA 4N0YL 3L9RA 4HXBH 4ZQKB 3GJEA 1MHCA 3O0RH 3VG9C 2HVJA 1CICD 2ED8A 2UXTA 4XXCC 5DD5H 2Q7AA 3EH1A 1NL0L 1A6PA 4L1LA 3VE0B 2XA8L 3FQUB 2GK2A 3MXVL 5DMYA 1KPUB 2BNUA 5ACZA 1JYVA 4PCSA 3WEOA 2YK1H 3VRIA 3BI9X 2CGZA 2ICEC 1E8YA 3MBED 3MLPA 4ZS7L 4LQFL 3TEYA 1N9PA 2CDGB 1IUZA 2HJLA 4HW6A 1DDHA 4M3JA 4AL8H 1JHLL 3FO1A 3LQZB 1W91A 3VDBA 4Z0XB 2ICES 2NY0C 2XX1A 2DQDL 4L8SA 5ID1A 1E27A 3P4OB 1XXFC 4RSVA 1MRCH 3FJTA 5EG6C 2N7BA 4LSVH 3V79C 1TNMA 3KL5A 3AQZA 1AR1B 4FXKB 3VXRB 5L2KD 3NZHH 3UTSB 4S1DC 1MAJA 4FMKA 4XAKD 4PN6A 1F1AA 2PF6A 4NC1E 3RVXC 3VXUE 5HYJD 5HVHC 3O11A 3LKSA 5L2KB 5IHBA 1E8XA 1TQWA 4LNRB 3V52L 5K9OB 2IFGA 2IADB 2BFVL 1TDQA 5KVDE 2QPFA 1XWVA 1FNEB 1ZKAA 4QNPF 1U41A 1EIBA 5AOKA 4JDZB 4MCMA 2CXKA 4P99A 3CVCA 3MLUL 5DA4A 2V6HA 2O1AA 5E2TL 2BW4A 1NGPL 4L8DA 4X6BB 1KB5B 4PWGA 4JAMA 1NIBA 5TTRA 5TDOA 3RJOA 1KMGA 3SKOB 2OS7A 3CLEH 3NJFA 3WG7B 4G1MA 5KS9B 4LP4A 2R0LL 4O58H 1KBWA 2GVYA 5E6RB 1F4XL 3HAEH 1J0KA 1L0YA 2EDOA 4PFEA 4YSCA 4YC2C 5DJDB 4LSUH 4Z95H 1SY6L 3H53A 2BOCB 4G6JH 4Y19A 1UA6L 1RZJL 1RUML 5EFIA 4WENB 4KX7A 2VC2L 3IKCA 3SOBH 2F7IA 3FT4A 1I7ZA 3GMLB 3WFBH 2XFGB 1NFDA 3O0RL 4LLVB 4E9LA 5KBLA 3L17A 3KLAB 4H44C 5IESL 2CLVB 5DD5L 1L7IL 4X5XA 5CLZA 1GKEA 3WXVH 2CALA 2D0GA 1CK0L 3MXVH 1FORH 2Q1EA 5AD0A 2VQTA 2XWJA 4KKLC 1CBJA 3ZTNH 1IBDA 2YXWA 2GJZB 1FZJB 1YQ2A 4Z7NF 1TG8A 1DSYA 2EDBA 4XC3H 2J44A 3MV11 2EXTA 2R0WH 4YWGL 4NN5C 5C08B 2P8PA 2JB6A 4UDTB 1LEKA 3ZSSA 3QJFB 3RJDA 3QRBA 4U49A 5DRXA 4Q9QH 3PNWA 3VG0L 5JIDA 3QEGL 3N42B 1CD0A 2PYED 1XIWC 1ZA6B 4HBCH 2NY2B 3VD5A 1MFAL 3H9SD 4IBTA 3AACA 3ILQD 3WO3B 2WNKA 3SPVB 1CGWA 4EI0A 4I3SH 4I77L 5F72S 4RGNB 3PHSA 2VR7A 3NCYP 5GHWH 1A6AA 4JDEA 3HRZA 3MRRB 5D7SH 5HGHB 4A2DA 2J6EL 5F9WC 4Z7OF 3BC9A 3MCLH 2HFEA 4RGOH 3BN3B 1X9UA 2QV2A 1A4KA 2RGSA 5AG9A 2B9AA 3DXAD 2ZTBA 3H7BA 3MODL 3V2AR 2YQGA 4XTRD 1R5VB 2IAMA 4NC1C 3KXFE 1NM9A 1DANU 5AOLA 3ZTCC 1AJ7H 1LQSR 3IJ7A 2DQGL 3SZKC 3U25A 3V5KA 3NCMA 3EYFB 5DR5H 1ZRUA 1P9MC 1E3ZA 2QVKA 1T4WA 3OV6A 4UIMA 3ABLB 1F4XH 4GW5A 3Q7JA 3L1OL 3GYRA 1UGNA 3VNYA 5B3SB 5D2NA 5CHNB 1SY6H 4G6JL 4P49A 3TO2A 1S7TB 3CFTA 3FU9A 4LOVA 1FNSL 2FX7L 4RZCA 3Q8FA 4ZPTB 4E9SA 4HT1H 5IROC 1FI8C 4HIIA 4X80H 3TPUB 4YHOL 4XB7A 4QRPA 3SBWC 1KY7A 5DMJB 4Y4FC 2A1WH 4CL7A 3VW3H 2H6OA 1DHKA 4YSRA 5D7HA 5B1JA 1L7IH 2DM2A 2VDLL 5GJTH 5ETUB 3GSVB 2NUTB 1BVKB 4NM4L 2Y3NA 1ROCA 1V3KA 1ZE3H 3UTQB 3C9NA 3ZTNL 5IHUL 1AY1L 2YEVB 5CN3A 1AD9B 1RZKL 5HY9A 2AMUA 2IBGA 1DEEB 1MVYA 3QFJE 4NO2A 3THML 2ZXGA 1QO3A 2A9AA 2HMIC 1QA9A 3EDFA 4X83A 3BPNC 1AVAA 3U1SH 4ZMQA 3DBSA 4CU8A 3Q9PA 2UZIL 3UDWC 3VI4B 2X12A 1GZHC 2AJZA 2IFFH 4I0PC 3S2CA 2V3DA 3L3OB 5E03A 4P2RB 1AXTH 1LP9A 1O9ZA 3PHOA 5HDBE 3UEZA 5CP7B 4CBZA 5KJ7E 2I5YL 5D2LA 4PY8J 5GHWL 3UROR 3MUGA 3T0BA 4WWPA 4LXFA 4CGTA 5JXEC 5KSUB 1ZEAL 2GY5A 4AKQA 4Z78B 3RE0A 4LDCA 4J1UA 3ZKMD 2ZUWA 1YMME 1XCWA 2CPUA 3WAKA 1MY5A 4WHCA 3VXUA 2RTTA 5ISZA 4BH8A 1D5BA 1WG3A 4G5AA 3VFVA 3ZW3A 1K6QH 3U0WH 2V4LA 4MRCA 1HH9B 1EO5A 1S7SB 4YIQA 4D0DB 1MH5A 2P8PB 1J18A 5KVMC 4XVJH 3OAZH 1N12A 4ERSL 5AD0B 1FH5L 1UXWB 2A73A 4JJOA 1BVNP 2XWJB 5DR5L 3C60B 3ATDA 5IMMB 4NRYA 3ZDYB 1NIFA 5B38B 4XPHH 3RILA 3A6BL 4KMLB 4L4VE 5BVJB 2PYEE 1YNLH 4F8NA 2GITB 2VMFA 2H6PA 3MBXH 4Y16D 4QRSB 4AIZA 1KENH 1IKOP 1S7WA 2XX0A 3WFCL 2OMVA 3KR3L 1H3WM 1L3NA 2F53D 4PJBF 3QUHA 5C0EA 3D2TA 3VFUA 1JZ2A 3CVBA 3OMNB 4PJBB 1NIEA 2BM3A 5AAPA 3H9ZA 1AQKL 2C5DC 3A6CH 4WWID 1FL5B 3GBLA 2GK0B 2BMKA 3A4EA 4DEUA 1RZKC 4YSUA 3RA7H 5BW7A 2RALA 4D0BA 4JANA 4DP0X 5I6LA 2IGLA 1U92B 4L1BA 1JS4A 3KG5A 2BRRH 3WMPA 1I9RH 1Q9WA 1UH3A 4M48L 4XPBL 3DIFA 4D9RD 4YQXL 4DPCX 3ALWA 5ACZB 3V0GA 1SVZA 4X4YB 3GZQA 2IBZX 2BP5M 3ILDA 2HJLB 3K2MC 4OM0L 5EO0A 2AXFA 3IFPB 5EC1A 3T6XA 1NM4A 2HG5B 2EIZA 1PZSA 1DVFB 2AVGA 4PJHF 4KRPB 1DVQA 3QDJB 2R56L 5DHYB 3U82B 1JPTH 1TZOA 2ADJB 3D39D 3V4UL 2ZF8A 4HA1A 5ALCH 2TSAA 3H54A 2AZAA 3UTSA 2R0KL 3OAUH 5B38A 2Z0BA 4LLQA 4RZKA 2TRYA 4TL5A 2CRYA 4FNLL 1WO2A 3WHXA 4OLUL 4O51B 4O4YL 2HJFB 5D1XE 1KPRA 1OPGH 3IVKB 5JHDB 2FT8A 3DV6A 1LL1A 1YEDB 3QDGE 1XFPA 4B7IA 4LHUA 5BUAA 2ZUVA 1EO8H 2OXHB 3DYOA 3K0WA 4XP1L 2ZOWA 3S96A 1ZLWH 3WFEL 2C9VA 2PR4H 3VJ6B 4AM0B 3FH7A 3U6RB 1UXSA 2M2DA 4NPYB 4PJAE 3BVNA 1WGVA 4X6CB 4RISH 3KXFA 4JEGB 4EBQH 4X8CA 3SGEI 2X1WL 4F9PC 1KIUA 4ZOCA 3M8OH 4HWZA 1A6VL 5MEPA 4G82A 1I8KA 2X42A 1G4MA 1Q94A 1HHKA 1XB3A 2VDLB 4N22A 4PJ5D 4RMRA 1OEZW 3RVUD 3H2QA 4R5TA 4HUWB 3NVQA 1U3NA 2E7MA 3S35H 1G5GA 1NANI 3VXSB 5E6UB 5H37A 1NFAA 4HX1B 5BZXA 5KSVA 4U7SA 4RETB 5IJDC 5A1AA 1FFNA 1DFXA 4CSTA 1AQKH 5AWNH 4P2RA 2X9YA 4CMHB 5I6KA 5I15L 3EJZD 3VM5A 1KYOJ 1Y18A 3C60C 4EVNB 3B9VA 3HS0A 4P3DA 1Y0LB 3MRBA 4WKZB 4YQXH 4X6EB 2MCMA 4BH8B 5ISZB 1ZVSB 1PZBA 4GRLD 5GGRY 3L7FA 4HAKA 1I7UA 5E7FA 1JP5A 2OMTA 1ZK5A 3SQBB 1ECZA 5CLWA 1XH0A 4XN5A 4CMMB 4D0CA 3VGAB 1A4AA 1FYTB 3MLYL 1QBLH 3QRGH 4B9KC 3DV4B 1HEJC 1EVUA 5IROA 3REWB 3JTTA 4L5FE 2F5AH 3BPOC 3QPXL 5DZJA 3RY6A 3IGKA 1J1OL 5MP6H 4Z77A 4JO3H 3VFGH 1GYVA 4R2GB 4OD1H 1VGKA 1WIOA 2D31A 4P2OC 4PS4L 3FMGH 3MRHB 2NY2D 4CSSA 3Q13A 4WI7A 4Z18A 3KJ4C 4ZD3L 3C2SA 3BEVB 4MRBA 1KIQA 4LVNC 4AE1A 1PKQB 2QJDA 3EGDB 4MBRA 3GFUA 2IAMC 2G30A 4PRDA 3IDNB 5AZ2H 4JK0D 3UTZA 4N0UE 5HPMB 3NACL 2CLZA 1MW1A 2CO6B 4X0NA 1BFOA 4XCNB 3TP4A 4AQZA 1LLAA 2IAMB 4Q9RL 5E8OB 1WWAX 3VD0A 2CKBL 2F7QA 5EBMB 5AZEL 4PRIE 3HRZC 3MMEA 4GI8A 2FK9A 4ZSOA 3WNLA 4EPSA 2PYEA 2BVOA 3KPSB 2N0KA 3D39E 2P52A 1RP8A 5GS0H 5JW5A 2VMDA 4OB5H 2C1OB 3UABA 5FC9A 5AWNL 3VYOA 4JHUA 3VWJD 1IM3B 1XCQB 1HTYA 4KK8D 2I07A 4W9ZA 3W9EA 1ED3A 2GC7C 5C0ND 3ARWA 4GEIA 2GKIA 4TLKA 3CFBA 5E9DE 3WNOA 2YZ8A 5LNDA 3VFWA 1EZSA 2JJWA 2VLRB 3B3IA 3W39A 1ZHNA 3FW6A 4TMPA 5JW3L 2K3TA 1SVBA 4OJDH 1BQ5A 5AVZB 3I9IA 5JHDA 2QSQA 4QLWA 3MOAH 3D30A 4HDIB 4Q0XH 5CZXC 3I6KB 5LDUA 4M43L 4M7ZB 4OI7A 4NO2B 1YECH 3MLVL 4WHTA 4IKNA 4LGSB 3O4LA 1XL4A 3S4SB 5CWSA 2ZKHL 4YSSA 3CDFA 3E80A 3MLYH 1IO4C 2DBJA 3P3RA 1F11A 3LEVH 5J1TC 1GC1L 4HKJA 2F5AL 3FL7A 4X4KA 4JKWA 5J89A 2MKWA 2A9NL 3ILQC 3L3OA 4NCC1 4ZTOH 1LP9B 2F74B 2ZWKA 3IFLH 3FNKA 3FMGL 1KZQA 2Q0ZX 4RBPH 1F3DH 4DUWA 3TC9A 2DL9A 1EHAA 4HQQL 1UACH 4YVNA 2DYPA 5F3BA 2PP7A 2OSYA 4BELD 5FHAL 1IU1A 2YA0A 3O8XC 3PUUA 1FLRH 5DJYB 5GS1C 1BQHG 2LLGA 1A0QH 3NTCH 2F68X 3JWDH 4Z95L 5E8PB 4QF1B 2CBMA 3B9EA 3D34A 3DI2B 4YVUA 3WNKA 3R8QA 3P11H 1G7LB 2GSGB 4XH2B 4QRBA 4F58H 1JXGA 3L7FB 1NA8A 3NCJL 5E8DH 4GBXD 3U9UB 4DGWC 1W0WA 1A3LH 1DBAL 4U1KB 2HRGA 4DP5X 2A0LD 1WCBA 1JGLL 2F8IA 3NK4A 3H55A 4DW2H 1CU4H 1OAXL 3I6GB 1E6OH 1RP9A 1TJHL 1YUHA 5I1KL 5FKAB 4RSYA 1WVZA 4PV9B 3D52A 2D7TH 2EEDA 3SO3C 3FSAA 5LGJB 3HAEG 5JPNB 4EUPH 4N9GB 4ZAKA 3OJMB 1A22B 4MQXC 1R3IL 2YPVL 3UYPB 1C7TA 4FQLL 4ELKB 1NPUA 5AG8A 3NIFB 1FG9C 2GABA 4NWUH 3GSXA 4ODXB 4D0BB 4H4NA 3NIFF 4WUUA 1RJLA 3QUYD 5TDPA 2AEPL 2IXQA 3BZDA 4XOBA 3GPEA 4BDVA 4TNVK 3K7UA 5EULV 3MX0B 3ZE1B 6TAAA 3FO2A 1A4CA 3OC5A 4JFDA 5D2LF 2WXQA 1QI3A 4E9RA 5D7SL 4ANUA 1I1RA 3KBEA 3QPKA 5L2KE 1BHGA 1JZ7A 1MAKA 1AHWB 2VLJD 3BVDB 4O2FA 5FO9A 3UXFA 5JDJA 4NAQA 3G04B 1QSED 3CC5A 3FTSA 3MV7B 1B9KA 1UWGL 2J73A 1OAJA 4AWJC 4N2KA 2VH5L 3CDGB 4M5YH 3QFDA 5GZNA 3VXRE 4U6YA 1OTTC 3O6KH 5ACMA 2VLJB 4YHPA 2EH7H 5DRNB 2FHFA 1Z9LA 4J3VA 5D7IF 2PXYC 1NDTA 1X5JA 2YSSA 1L9PA 3H9SE 4NDMB 4WDIB 1YY9D 2VR9A 1KLGA 2DI9A 4AEEA 1WZLA 1QFUL 1IAIH 2IPKA 3SDXB 3I85A 1E4HA 4P5MB 1RVFL 1MCOH 4X98B 2MNJB 3FUIA 3HPJA 3PV7A 3QIWB 1PY9A 1NPNA 3OKDA 1U8MA 3VXUD 2MQCA 5JHDD 3C5SB 2WTRB 5D55A 5D9SA 2LFEA 3AQXA 4O2EA 3FULA 3F6LA 2EVGA 1HK6A 3FN3A 5I1JH 3NABH 1VGEH 2VO8A 2B4CL 4GT0A 4TSAH 2WKGA 1IAOB 1EEUA 2ICEB 4K4KA 4JGNA 5T3ZH 1VRSA 2NY4D 3FUJA 1UB5A 1MFBL 2XSKA 4YHMH 5E0FA 1E90A 1FJ1B 5E5MB 4K71C 4XBMA 1W2KT 2EACA 1QRNE 1YNTF 1DJSA 3H85A 1JD9A 2H1PH 3D39A 4JHVA 4R0LA 3L7EB 2P5WB 2C9PA 2LFGA 1ZGLB 2D0HA 3N1GC 1OSZB 4V11A 4N6QA 4HIHA 3D0LA 2G0LA 3RY5A 5D1QC 3D4ZA 3BDXA 5EF2A 1R34A 2XYBA 4N2GA 1NC4A 4NHCL 5EDSA 1X5LA 4HHGA 3STLA 1AGBB 5I1GL 2VAAB 2XG4A 2YXFA 5IMOA 5GQBA 1TETL 1ZWIB 4J3XA 1JVKA 4KQ0A 1UJ3C 2MQ0A 4KUCF 4IRSC 3Q5OA 1WFJA 1NMCC 3AABA 1RPQA 1JZHA 2KL6A 1W8OA 3P2TA 3CLWA 4IU2A 1OP4A 3O2VH 3OKMB 4MZIA 5MEQA 1ZEAH 1YMHA 1LO3L 5IT2H 3DBXB 5IVZB 5IQLA 4PS8A 2YXMA 3G08A 3HN3A 4FG6C 3A47A 3X1BA 5AYUH 3CCHB 5D96C 5EIIB 2EAEA 1F13A 2J5LB 1BD2B 3MSPA 2K8MA 2WBWB 2Z4QB 4FMFA 4IRJD 1HYRC 4ALAL 3HE6C 2FO1A 2VR6A 4WSGA 4PRIA 2NNAA 3P0GB 3U0TA 1EBPA 3EJRA 3C6LC 5FA4A 2BFGA 5I73B 3HG1B 1QAWA 2XC8A 1OHZA 2YN3A 1BZEA 1KJMB 4WY7H 2Q10A 1RVFH 3MBXL 3WTSA 3L48A 1U8PB 4PUBH 1R6VA 1C5DA 1NFIA 4U6XB 4W70A 5DUMH 4G8FA 3LH9A 5BZWB 4F7TB 2BX5A 2Q7YA 1D5MB 2IAAC 3MDJA 2YEZA 1S7QB 2XTSA 1D9KC 3U7YH 1MELA 2B4CH 3WS3B 3BQUB 2HUHA 5HP5A 4GKOA 5SWSA 4P4KA 3ZYJA 1OCOB 3LV3B 3FQRB 4Y16C 1MFBH 3UBHA 5EH1A 3M7FB 2JLPA 3V0FA 3ECQA 2DQFA 4XNQB 1E67A 1YZZA 4OZIF 5EHFA 3ZSTA 1MJJB 3HRPA 5FWRA 1C5CH 2OR9L 1CLOH 3EXLA 4PY8I 1Q38A 2C3XA 1YLBB 3I50L 1CG9A 5I24A 3LZRA 1WC7A 4HWBH 3T5WA 3L3DA 5EZLB 4PR5A 2W59A 1CDBA 2DMGA 2CR6A 2RACA 4QTIH 2ZJSH 4XPFH 3N9GH 4ICXA 5I0VA 4GKNA 5JMRA 1CFNB 3KBPA 4G6FD 4XP6L 3DWTA 2OI9C 2PTTA 2SEBB 2XKUA 3T0AA 5I5MA 3DMMC 1GIGH 1ZLUK 2VLLB 2CJ3A 1DQQA 2CNYA 3AITA 1JPTL 4GRLC 5E00B 4KJQD 2EJ1A 1EHLH 3ARQA 3SPIA 4AI7A 1TNNA 3FHAA 1MFDH 4N0UA 1FJ1A 3EJSA 3L45A 5CN2A 4HLEA 4JY5L 4ZW6A 4D9RE 1QATA 1ACZA 1S2EA 2O30A 2JQAA 3DRQB 3BSGA 3KS0H 2KZ1B 1YEIL 4KFMA 4ICWA 1JAEA 1IAOA 2VR4A 1AMYA 1OCWH 4ODSH 3ZZSA 4A2HA 1PLBA 1RZIA 3VX1A 1SXAA 2YAFA 1TPXB 3A22A 3RI5F 1AGBA 1D3CA 5D8JL 4AQ1C 4WFGD 1J11A 4ZSOE 3AS1A 4PS7A 4NQCA 1J0IA 1A6VH 3WXWH 1S3KL 4P5TA 4XMXA 1JZJA 4HIHB 5CM1A 1YUKB 2Y6SD 2X1OA 1G1KA 2GIMA 5DVMA 4B9ZA 1O6SA 2ROYA 2WN3A 1SNRA 1TQCC 4YHZH 1BMZA 4NZRL 4RFEB 3ESNA 1MG3C 2A9DA 3MLXH 1KT2B 3PGCA 4P2AA 4XCCL 5D1XD 4UUJA 3GMMA 2DJUA 5DDHA 2QVMA 1CVRA 3O8XB 1B0IA 3WIFA 1MRFL 2AI0L 5MEOB 2PUQT 3ETBJ 3GMOB 2XV3A 3BOVA 5CEXB 3KVQA 4H0GA 4FFYA 3TEZA 5HYSA 1ZLEA 1BQKA 3KJ6H 4BA8A 4Z5RB 5JHDE 4X5QA 2FIKA 4G3YH 1U3YA 5GRYA 2H1XA 2KC0A 3CZEA 4TNWK 1ASPA 2M83A 3CDYA 2CLRA 1U42A 1J48A 2NOYA 2LOEA 2WP3T 1S5IH 3GZKA 5JIHA 1CTOA 4MJ5A 5C7ZA 2A6KA 2DIBA 1F4YH 3HOGA 1HEZB 2YGOA 1MCWM 1U8PA 2NR6D 1C5DB 2JTDA 1AACA 1WS7A 3C87A 4PW3A 4E2OA 1YEFL 3PAZA 4PP2B 2Y06L 2XIBA 2XIIA 3O6FC 5LCVL 1S7QA 3HG1A 1I1AA 4MB3A 1MCPH 2PLTA 3MOBH 4MD4B 1V10A 4MKMA 2XWBA 3DVIA 2V2WB 5A2AA 5D1ZA 2XFXB 3CBRA 3TFKC 1KCVH 3LQAH 1MRDL 2CJSA 4M3HA 4XMZA 2VMJA 1UC6A 3L4WA 3PL6D 1BWWA 5D7JA 3CFCL 4L23A 1P7BA 2J12B 4F15C 3L6FB 4PLJC 4PPTA 1XF3A 4JFYB 4CKQA 1CGTA 5JIKA 2YD9A 3ESVF 2VKXA 3QFDB 1WSST 4LAQH 1EDQA 5D8JH 5KANG 4GKNB 1IBZA 1E9PB 1CS6A 3K4AA 8PAZA 5IKCA 1DP0A 2YGNA 1E5ZA 3S5LB 1BF2A 1OARH 1S9YA 2Y7MA 3ZKMC 1HHJB 1RL1A 4YDIH 4NM8H 4NZTL 3L3DB 4AGNA 2P5PA 1ZHKB 2VM3A 3ROOA 4X6FA 2WLYA 5GGSB 4JZOA 1B3JA 4KMQA 3IKKA 3X3FH 2EDFA 2XQYA 2SEBA 3NGBC 1VFBB 4HS6B 5DUPH 4GKSB 3UYRH 1ESOA 2VSDA 5F3FA 5IVOA 1KNOB 1EJFA 3RWHB 2NTFA 2EDYA 2FR4A 3CVIL 1TO5A 4ZOAA 1QBAA 4XNXH 3FB7A 1TJIH 1R3JA 4ORGB 1I7RA 1L3WA 2EDNA 1WS8A 5L4FA 3OAYK 1MF2L 4MMXA 4FQPA 4WFHE 5GSVB 5J3HD 3L7EA 3CFDA 3LKOB 4QRAA 2I9LA 2CDGA 3CMOH 3BAEL 4LT7A 2CSPA 4OH2A 1BYOA 4CW1B 1NBVH 3ECBB 1EZVX 3LRHA 4J3OF 4WW1B 5BZZA 4RFEA 3P4OA 2Y06H 4LVEA 3CIAA 1Q0YH 1QX1A 2Z8RA 5IMOB 2O5YL 2WLMA 3NEXA 5CZXD 4OTXL 3QCUL 2MPAH 1T66C 4R83A 4NS0A 4S0SD 3NPSC 4DFIA 3LQZA 1BIIA 2J1WA 2HX9A 4EZMA 2DTSA 4LEXH 4URTB 5F7EL 1GGUA 4Y5XA 1DSFH 1KCVL 3OF6A 5EBGA 4WJ5B 3GI9L 4H25B 3MJ7B 4NWTL 3RVXD 5DFAA 3QZLA 4O02L 4LMQI 3GTNA 4Z5RA 1ZD6A 3CX2A 3ATFA 3QXVA 1KUMA 5KJRL 2DJMA 2ENQA 1AHWC 2GHZA 3BXNB 3CFCH 3L5WA 1JWSA 4S1SL 2MTAA 1ITBB 1RIVH 2F54A 2CLRB 5DSCB 3PWNA 5A2CA 1M3IA 2BZ7A 2DWXA 4JRYE 2BSSB 3ECVA 3D09A 3AG4B 2E47A 2HFGH 1LE5A 3IJSA 3EOBB 3B9KC 1XD0A 4FD0A 3U0TB 4KHTH 2WXIA 3TNNB 3EYSH 1NCHA 4WO4B 1WHOA 3O2WH 3LPOA 4TVPH 3RBGA 4E42A 4NM8L 4N5EC 2D2CC 3FU0A 2BNQB 3AWGA 4DW2L 4A37A 1UEMA 5E1HB 2CKNA 5DJ2B 1OE2A 3MZGB 5I74C 1AFVL 4P5TD 3DOSA 4NO5A 4NKQB 4HULB 1HHGA 3SE8H 5CMAA 2UUDH 4L4VB 4DK3A 3FQYA 1PG7X 2O5NA 2Z7UA 3NFNB 1LDPL 1YMMA 3V0IA 2EDLA 3VB9A 1TJIL 3GMLA 4ZMLA 4UU9B 3EDDA 4WWKB 5FUCE 4ANXA 1FZOB 2EEBA 2ZG1A 5DUJA 4TL4A 2EDTA 3WUWA 2E9IA 3CMOL 3B2MA 4MXVE 3HI5H 1E5CA 3CVHH 4JQXC 4JZNA 3ERXA 2ODIA 4ACTA 2GUOA 5CXPA 1HSAB 1XF3B 2MKLC 4LLYB 4XHJC 2R2EA 2ZCLL 4FJ6A 5CCJA 2RFXA 5DK0A 1IV8A 1IKFL 2AQ2A 3VI3F 4WF7A 2F19H 2I32A 5IZ7A 4QHNB 3TO4B 4MJIA 4TULL 3QARA 1HHJA 2NTFB 4I5BB 2KQNA 3D07A 3WEXB 1E2ZA 3GI9H 3QUMA 2CWRA 4AJYV 1FVCB 1XH2A 4P4KD 2Y4SA 4G9FB 2OAAA 1R17A 5TE7L 3A4AA 3FQ1A 4UILL 5AAMC 5ADOL 2RCSL 4KY1L 2WTOA 2RD0A 4S1SH 4GRLA 2PCFA 2Q9OA 1XMWA 1CXIA 3CXHK 3NCEB 1UFUA 2A77L 2BP8A 1JYWA 2APXA 1A25A 1NDGB 4BH7B 2J1ZA 4N8CL 3TEUA 1J1XH 3KLDA 4YN3A 3X13B 2HLFD 4IHOA 1QPXA 1U8KB 2NY3C 2DQJH 3FT0A 3KPRA 4OGQC 4QAWA 1CXEA 2X9XA 2XNAA 5KUMA 2ZONA 1I1YB 1OK0A 1QSEE 3H9HA 3L3JB 4Y5YB 1LEIB 4R7NB 2Z8VC 1SYSB 4DQAA 3QXUA 1BLIA 3BEWB 5CJQH 2EXSA 3C6EA 3GUFA 3L4XA 4JPIA 4OGAD 1I4FB 3B8YA 5HGDB 3KLLA 4Z3EA 2Y1VA 1IGFH 2J4WL 1NKGA 2FQDA 5G2NA 2YEQA 5IROD 4U1IB 3Q6FA 4U4BA 5FWQA 2DY2A 3D3VD 5E6IB 2ZG3A 1Z6JT 4Y5VC 4Y4FD 3UTSE 2R7EB 5F7UA 1LDPH 4QRQA 3WO4B 3W2DL 1A4JB 4GSDL 5T1KA 2V7NA 2KERA 4GIOA 4RMTA 3I02A 1WDAA 1OVZA 4GS7C 4G6AC 4YK4B 5EEVA 3HI5L 1SJHB 4K9EL 5A16A 3HBGA 5KUKA 4BWUA 1LMIA 4ZS6D 3V0WH 1DJXA 5F0PB 3AT9A 3MACH 5J6GB 4TSCL 5T8IA 3VFNB 5BUGA 5JIQA 5KVGH 3PWVB 2WXGA 1IGIL 2EO1A 3H6JA 1SOSA 1I1FA 2G60H 4HMEA 4WTZA 1AD9A 5HY9B 3ISYA 3BDYL 3FN0H 5JUEL 4HFWB 2JQMA 4JFXA 3VXPB 5A2JH 3PCYA 2EYTB 5AB0A 3QWOA 2WQVA 4QGYA 4X6DB 1XGRB 4KRPD 5LXGH 5ERWA 4JDTL 5ITBH 3ARGC 3AAZA 4IYKA 2OL3B 3GI8L 1F6FB 2RBLA 2PW1A 4LB8A 3IK2A 1N2RA 2K70A 4RGND 4NKDA 3M88A 5HHQA 1WFIA 3GSNL 4P5RA 3ARRA 4Z7QE 1U8OB 1FZOA 1NCTA 2XWXA 3FQ4A 1QFWL 4P04A 4JQVC 1CD1B 3BP5B 1OAZH 4KVNH 5F88A 4F20A 3Q05A 2EE9A 2W60B 1KYFA 3FT2B 4Y9BA 1YEEL 1T21A 4KTYA 4DO6A 4KO5A 3AUWB 1E4XL 3QIWD 5FW6A 4UAOC 3VXUB 1YJDC 5CP3A 2XWTB 3PL6B 1XR9A 3WTXA 4JFYA 2Z34A 3B1UA 2WIMA 1J5OH 2NZ1A 1U95A 4H26B 4J8RA 4Z7VE 3SCMB 1DQDH 5C70A 1HH9A 5K93A 3QWQB 5IEHA 3PIQA 3VNZA 2WLIA 2ZUXA 3DK2A 2DKMA 3NRPA 3ETBF 5I6OA 2XLLA 4U1LB 5JW4R 1SF5A 1DZ0A 1BAFH 2RIKA 3DX1A 3WIIH 3LB6D 3EJCA 4U0RB 3KVPA 3W9DB 2EXYD 5GGVL 2HRPL 1A7RH 3GBNL 4JZOB 1BF5A 1GTNA 2WIIB 1SHMA 3QJHA 4NT6A 2XIDA 4NFCA 5DHVB 1RERA 4Q9CA 5EDXA 4JDVA 3TA3A 1Y7VA 1QQDA 2FHBA 2W5PA 3MLZL 4K9EH 3NCCB 1TFPA 3V0WL 1MSPA 4PRPB 2X6BA 1N59A 3VD9A 4EUPG 1EZUA 2GCYB 2KZKA 4LCIL 5IP4A 1Q9WB 1KIPB 3CWGA 4N0YH 2V2TA 3B4NA 9CGTA 3E6HA 3US1A 4X7CC 5D7KD 5C0BA 3EW3B 4EUPB 4LEOA 1XGTB 1TTCA 2N4IA 1DVZA 2V37A 3QDJA 3EOTL 5HYSG 3NZUA 4DGYH 4U1IA 2RJMA 4PJ6A 1EK3A 1FAKT 5DVOA 2Q5BA 2B16A 1DJIA 3HMWH 3LQAC 1R24A 3W0WB 2E27L 1Z3RA 1BBJB 3HE6B 4ZS7H 5C0AB 5ID1B 1MZZA 1IM9B 1JHLH 1U3HC 4K73A 4L8SC 1PD1A 3ZYOA 4JN2B 3JTSB 3VFMB 1S3KH 1G43A 5BZDB 4KO6A 3PQYD 1D6EA 5TJWK 5D7LE 1LO0L 3LEXA 1JJUA 4LSVL 4QRQB 3HZYB 1IC4H 1MLCA 3O3EB 4LCWD 1AAJA 3D9AL 1S7VA 3MLXL 2YS4A 4XCCH 1J5OL 4UQ2B 3IN0A 1ZT1A 4TXVB 2R1XA 2B1OA 5GIRA 1N6VA 1ZV2A 3NESA 4YE4L 4NXSA 4WI4A 4WW2A 2Y22A 4LRIA 3SQOH 4GAAA 2VMCA 4FQ2L 4OFIA 3WKNA 3KGRA 1HSBB 1AP2A 3CNKA 3WNNA 4XMPH 3FF7A 4NC2B 4DESA 4HX1A 1BM7A 1QTSA 2WUCL 1R3KB 4LKCB 4L37A 4U31A 4FZEH 5KSVB 1DQIA 2HRPH 3GSWA 2FNBA 4HUMB 3DX6B 5IJCC 4ZTEA 4PJAA 1NGXB 3F7LA 3TV3H 3X1NA 3CVHB 4AZUA 1R19A 3JWNG 1EUTA 1QR4A 3ZE2E 4JVWA 4K94L 2OCCB 2ZUTA 3VI3B 1P7HL 3VTTA 4F7EA 3QNFA 2CGRH 5EBWB 3OXSA 4IK6A 2C26A 1UXMA 4LBEA 4ZODA 4C58B 3DX2A 3ULUH 4IMKC 3UZVA 3L5HA 1T22B 3HZVB 1R3HB 3MLZH 5AOJA 4KZDH 1CT8B 1RUMH 2I60L 1HIML 2DH3A 2N0MA 2NX5E 5GS3A 1MCPL 5IEHB 5BRZE 4DO4A 1QNZH 2I24N 3ZDZF 4LHJB 3UP1A 4WI0B 2ISDA 4J3WA 3ULSA 4C56D 1QVOB 4IIQB 1J10A 1H3PL 2L7QA 1M42A 5IESH 1ZVSA 1KEML 3IU4L 3L1FA 2AEOA 3FTZA 3RJQB 5E5RB 1JDDA 1A7NL 5DFWH 2O6CA 3BGFC 3ZL2A 1FZMA 4HPOL 3S3DB 3HMWL 3FQXA 1BZ7B 4MNQE 2FAUA 1MFNA 1T0OA 1ET5A 2J8UE 4QHNA 2BJML 3N6YA 4S1RL 4B3VA 2XVKA 4YWGH 4JBSA 4ZW3A 4S11A 4WW2F 5EOCH 3IJYA 1EQWA 1I3RA 4XNMB 4WFFE 2VXTH 2WBJA 2WWKO 4JZJB 3BZFA 3RHWF 1PY4A 1MVUA 2WGNB 2WQSA 3AUV