1ROCA

Crystal structure of the histone deposition protein asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
155
Chain Sequence
GASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-silencing protein 1
publication title Structure and function of the conserved core of histone deposition protein Asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, chaperone
total genus 26
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1rocA00
2YGVA 2CU9A 2Z34A 5BNXD 4EO5A 1TEYA 5C3IA 2DZEA 2IDCA 1WG3A 5BO0D 1ROCA 4ZBJA 2HUEA 4RRPM 2IO5A 2IIJA 3AADB 5EIIG 2I32A 2Z3FA
chains in the Genus database with same CATH superfamily
2RA1A 1EHAA 1NAKH 1S8DA 2WVVB 4GQ9H 3LRLA 3ZVVA 1JGVH 1Z0MA 4QOKE 4U7MA 2J21A 5D2LB 4YSUA 1GY2A 1OGAB 2LQRA 2OMYB 4PEEA 4U3HA 5I8KL 1O9ZA 1S4IA 4XCYA 3SKUD 2DQJH 3VYNA 4E9XA 5JO5A 1CYWA 3VD0A 5D1QE 3DV6A 4DP7X 1XSIA 3LYRA 3PDOA 5AKTA 4HEMA 2DIEA 3NACL 1YEJL 1M7XA 5AZ2H 4ZX4A 3F7QA 5DJXB 1J0KA 1TJHL 1JIBA 2F53B 5D1XE 4R4FL 5LGHL 4X5WB 5G5DB 2COVD 5C0BD 3QQ3B 2FB4L 3EBGA 3BKYL 4NOBA 5T5NG 4IHBA 3FQYA 4PJ8A 3FTVA 1MUJB 2ZXWB 5JW4N 1G0XA 3OAZK 5KTEH 3RU8H 2I60L 3C09C 3FMGL 3BW9B 5TE6H 1MXGA 3D3VA 3HRZC 1JWSB 4WFGD 3VB9A 4K7FB 3TA4D 3O6FB 1MRFL 3N40P 4DWHA 2QADD 4NQCB 3FYEB 2LLNA 4QOKD 1WGOA 4BM7A 4LLWA 3UAJC 1IGIL 4FP8L 4KZDH 4YDJB 3T2NL 3WIIH 4L29B 2XTJC 2IPTL 2DKMA 1SHWA 1NCCL 4OUUA 1KTDA 3HMWH 3SPCA 1RZ7H 1ZDQA 2Y0SA 4QRQA 4A6YA 3N1MC 4FC3E 2G75A 4CRPA 2X4QB 1Y6KR 3MV8B 3FQWB 1A7PH 2AK4A 4N8UA 5D1XD 1MPAH 5D70L 4YS4A 2ZF8A 5I17B 1TQBC 5F9OL 4E42B 5I0WA 3CCHA 2C3GA 1VADA 2BERA 5DO2D 4ZSOB 4GAJL 4PSRA 1CS6A 1RIHL 5EHFA 2OXHB 1EBAA 2C1PA 2WVSA 5KVEE 2I60H 4GBXA 3FMGH 1Z5YD 3KLLA 4X0KA 4ODXB 1GGUA 5ITFB 1OT1A 3L95A 3MLXH 2B2XL 1FVEB 1MRFH 3E3QE 3QUKA 4JCMA 3ZIYA 3NIFB 3B83A 4Y5YB 1ZPUA 3MMEA 5EIIB 2BMKA 1IEBA 3SDXF 1IGIH 4FL4C 5I2IA 1QWHA 4NJAL 2DH3A 2P8LB 3ZDXE 5ISZE 1NCCH 2V9UA 2Z93A 2OMZB 1UTDA 4B9YA 5KBLA 2R7EB 1SBSL 3P4LA 3TU6A 1AHWC 3VFOA 3P3SA 3KYMB 4Y9EA 4JRXA 1CFMA 1OQOA 1IX2A 1NBQA 5KW9H 4MXWL 3QEUB 3RVVD 5D70H 4F58L 2HX9A 3B9KC 5F9OH 1MI5B 5IK3B 5CCGE 4KDTA 1NKOA 4G8EA 3L3IA 4HK3N 1WBZA 3F00A 4GAJH 4HUWA 1RIHH 4UDTA 4A1RA 5J6GB 2ZKXA 5AW4B 1LK2A 5E6UB 1M7IB 2NYYC 5J3HC 1KB3A 2BWDA 3II3A 4TL4A 1I8LA 3NAAL 1J5DA 3NPSC 2GJZB 2EIBA 3R19A 1J1PL 1Q1PA 2KLTA 1J5OL 2ZE0A 3IGAA 3S3BB 1TNMA 2QMKA 1PKQA 3IDYC 3JWNE 3EOBB 3CN2A 4BH8B 5IF0A 3HC3L 4NJAH 1FNGB 1QSFE 3EH4B 1UASA 5ISZD 4RQQA 3VNZA 5HHQB 1SBSH 4LRNL 1N6VA 5ETUA 4UILL 5E4IA 1F3JB 4FXKC 4J1UA 5CGMA 1PGRB 1T4KB 4WV1C 4MXWH 5IBTL 3VWKD 5C0BB 1DN0A 1RK1A 4KXAA 3G6JA 3K74B 3D08A 1WTLA 4CNIA 1GGBL 3ARSA 4O2FA 2DL9A 2VAJA 4Z7QE 1BJ1H 1K4CA 4YFLI 3D39A 4MZ3A 3FU5A 1A22B 4QKXB 4M1CC 4TNVF 4G6FD 2Z35B 4XE0A 1V3KA 4BWUA 1J1PH 3ALWA 1J5OH 2QADB 1NM4A 5GZNA 4FFWD 3RBGA 4OQTL 4XH2B 2WP3T 1WEJL 2MNUA 3HC3H 3ARDD 1QSFD 5KANG 3UJJL 4Z7WB 3FO1A 4LRNH 3CPLA 2X0WA 4KRPD 5I1IL 2E4FA 4F15B 2EIMB 4IBQA 1H9DA 1IKOP 3KE0A 3MRJB 4M7KH 2HTLC 4MD0A 3ABMB 4JY4A 5E8OA 2X9YA 1HXMB 1Q9KB 5ESQB 4I3GA 2V33A 2XWZA 4AQ8C 4OF8A 1GGBH 2VDQL 2QPEB 2ZSVB 3CPUA 1INQA 2D7QA 3F2LA 1NFIA 3IGFA 3MRPB 4QCIB 3GHEH 1L9SA 1YPZA 3NEEA 3V4UH 3BZEB 3L4ZA 1XSJA 1UUNA 4IRSD 4WI0B 2IJ0C 4OQTH 3GUTA 1KJ2B 5BRPA 4GKNB 1WEJH 5F9WB 3UJJH 5FCUH 2VO5A 4IK6A 2B59A 3EJZC 2JKLA 4A2EA 1KXVC 3IWVA 3O9WA 4LCWE 3C5JB 4XRCB 1PY4A 4YDNA 2HLFD 4E2OA 3RP1A 4AGOA 2O4EA 4F7TB 5CLTA 1BQHG 1T5WB 2X3BA 3P73B 1GYAA 4O5LL 3TBSA 3QXDB 3VXTA 2PXYA 1NOLA 4HHGA 1JPFA 2XYBA 5F6IC 1HDMA 4ACPA 2WBXA 3O4LE 2AJUH 2A9AA 3H42L 2VDQH 4DIXA 4IYKA 4I0PA 3QUHA 3TZVD 2FD6L 5KSBA 3BWUF 3MJ8A 3DX9A 2YAMA 3AZUA 4L18A 2QR0B 1OY3B 2YD8A 3QXVA 3FCGA 4MJIA 4AGQA 4I3SL 4QT5B 2ICES 5HHOD 3TBYB 1F8TH 3DRTA 5G55A 2OMTA 2KZ1B 3ZDXB 5ISZB 3HZYA 4TM9A 3EJRA 2BSRA 3VFWA 4PJEA 4JPVL 3IJYB 2NYZA 4MNQE 4NKMA 5CO1A 2R29H 3M88A 1BD2E 1CF1A 4B3VA 3VI3A 5GSVB 1WD8A 4Q9RL 2Q86A 2NCMA 2G2RB 4KI5C 4ZW6A 4O5LH 3VWKB 1O5DT 3BVUA 5I26A 2F9BT 4OZFG 5IT2L 2NX5A 1LNUB 2RJMA 1C08A 3KBHE 3BWSA 4YAQA 4U7KA 4B9CA 2CLZB 5DJ8B 2OXGA 3QFJD 1OAJA 2FD6H 2ARJQ 8FABA 3GINA 2A9DA 4GW4A 3U0TB 3VQ2C 5BMFL 3OKLB 1A1NB 1PVHA 2XXCB 2D9QB 1P6FA 4G6FB 1AY1L 4Y5VA 1OT2A 1IO4C 5L8LB 2AJZB 3MUUA 1MWAA 3B7SA 1WH0A 4RRPG 3W0WD 2XVLA 3E9UA 3I75A 2HP4A 5DD3L 3B2PA 5BZDA 2Q3AA 4U0QB 5CN2A 3GSNL 4ZUVA 4WUUA 1QFHA 4MNGE 3J27A 4UTBA 1BBJB 4JPVH 2MKLC 4ELME 5IROC 2JQAA 3V0WL 1X5XA 4KRPB 4OJDH 2G9KA 1IILE 4Q9RH 2F7OA 1NTDA 4L0YA 1DHKA 3VXOA 1GHFL 4HIIB 1TO5A 3QP3A 4DKAA 4CKVX 1TETL 2OMXB 3AAZB 4HS6B 2WVUA 4OR1A 2OMBA 4IIZA 3OG4B 1W8OA 4IBUA 3DNKA 3EXJA 2AMUA 1U58B 4I1PA 1AY1H 2IGFL 4J3OF 4P2OC 1C5DB 5K39B 2PYFB 3RA7L 1KGCD 3UIYA 4IRSB 3QC6X 4YPJA 4LLVA 3DDGA 5GS2H 4ZJ9A 3HTLX 2J1XA 3HE7D 5AVRB 4N90E 4Z76A 3GSNH 5C0FB 4O02B 1E5UI 1MCRA 1PW3A 4PVMA 3WXWL 4HMEA 3V0WH 5IW6A 1Q94B 2VISA 1DJWA 5HYJD 3DARA 1K5NA 2ADIB 3FL7A 4NQEE 3S5LB 3WLBB 1GHFH 5F7UA 2ZWSA 4QWWD 2EDWA 1CFTA 5LN4A 1MAJA 5FAAA 4PV9A 3W37A 1T89C 2YQGA 4HJ0C 4ZMOA 3ILQC 1ZHNA 3BPLB 5A43C 4U7SA 2HWZH 3TZVB 1QO3A 4AVIA 3VM5A 2FQDA 1LDSA 3ULVD 1JHLL 2IGFH 4U1MB 1LLAA 4WAFA 3RA7H 1FAIL 4HF5L 2VC2B 3OHMB 4L8CA 3V5HA 2AJVL 3EFOB 3D9AL 1IJNA 5I16A 5JW4M 1F3DH 3GSQA 5HHOB 3AADB 3EJQA 1HKLH 4RA0C 4HLJA 4OU3A 4YLCA 5CCKL 1F6AB 3BJLA 3FAWA 2VDNB 1CICD 4LASL 4RWHA 4G42B 5D2LF 2K7QA 2YFOA 5ICYA 4UDUB 4F5CE 3DK0A 3DTUB 3U0PA 1NCUA 1PG7X 4NQED 3DTDA 2DWTA 1JZ5A 5C0DB 3U36A 1S7SB 4NOFA 2NY3C 1A66A 1V8HA 3PNWB 1KBWA 2ZX5A 4FNLL 1TKWA 4G9FE 1OWRM 4ZFZB 3VRIA 3JT2A 2R2CA 3QFJB 3MRIA 3VGAB 1NKGA 4JDVA 3P3UA 5HDBB 3WFBL 4FAAB 5JW3L 1SF3A 2B1HL 3RGVD 2F2HA 4HUXB 4MMZA 1IARB 4TSAL 1K9TA 3MLVL 1FAIH 1RZPA 3QAZB 4HF5H 5ABDE 4PJFE 4PTUB 1U0QA 4CJ0A 3OXRB 4MSWA 3W0WB 2YRZA 5AB0A 5GXBB 1UZ8A 5CCKH 2NPLX 5AENA 4HIEA 4W9LC 3UTTA 3OTTA 3WG7B 4LASH 1X9RA 4IU2B 5HHXH 5B4MC 5B1CA 3BUDA 4KMQA 5HBBA 4LCCA 4GSQA 3AT9A 1GC1H 3UH8A 1XCXA 3FB7B 5DZNA 5ENWA 1FCGA 4E9VA 1EANA 2KQNA 1CFQA 5H2BA 5T1MB 4ZPVB 2XPZA 3SDAD 3UDWC 4G7VL 4B6ZA 3EDEA 3GYRA 4FNLH 2DMHA 1Y7VA 3QXTA 1U42A 2WB7A 1PQZA 5E8NA 4XGZB 5HGAA 5DSCA 4NCC2 3AFLA 1R0AL 3UP1A 1QBAA 2B1HH 1JNHB 4HZAA 4Y2OA 2OL3A 4ZI8A 3M6DA 3MLVH 5LGYA 3BZDA 3LPOA 3PFQA 4N2FA 12E8L 3SKOB 3OC8A 4H26B 1FO0H 3DX0A 4F33B 3IMWA 2WO4A 3HE7B 3AS1A 2EADA 4F24A 3KL3A 3ZQWA 5CP3H 3U0WH 1QZNA 3UJTL 1FZKA 2YUXA 3NIFF 4JFWA 4MQSB 1FCCA 4HETA 2R2HB 2ZZUT 3WLWD 3FTYA 5HYJB 3KYKL 1BWWA 2JMRA 4L8SC 4N20A 4ORZC 1QI3A 2FVNA 4ZMAT 1BOGB 1MKFA 4XNZC 5CEZE 1WT5C 1G7LB 4G7VH 2XX1A 4GH7B 4MRBA 5C0JB 3O4OC 2FR4B 1A6ZA 3QI9D 3FU0A 1RJYB 4IOIB 3LTVA 1CZ8L 1XTMA 3COOA 1KNOB 1R0AH 3I3EA 5I1HL 2J55A 3MBEA 3QRBA 4QUOA 2X4RB 4JNXA 1TJGH 3IDNA 12E8H 2HX8A 4OZIA 5IFJB 1L4IA 4MRCA 3NP3A 1MCDA 3H3PL 3V0IA 3L4VA 3REVB 3RKDC 4AYMC 5T5FL 5JUEH 4LSTL 4RAVB 3H6AA 4KX8A 3X2QB 3HG2A 5K1JA 3VDBA 3UACA 3ZHDA 3CSFA 3TA3C 3UJTH 1GW6A 1CICB 2VZ1A 3F83A 4LZKA 3C5XA 4XVUC 2CUHA 1WHOA 2QMJA 3CFQA 5IBUG 1M3JA 3KYKH 1XEDA 4NQEB 2AMGA 3K5SA 3OL2A 2E7CA 3PABA 2QVIA 1ZY9A 4OZGB 3KW7A 3GXMA 4OVUA 4RGNE 5CEZD 3GI8L 2GAZA 3QORC 3P11L 1TZHB 4L9LA 5JXEC 1NANI 4MGXA 4J3VA 2P5WE 2BSED 1J10A 5I1HH 1GZHA 3QUGA 4CW1B 4DO4A 3RGVB 3X1NA 2W9EL 2BVOB 4DZ8A 4NLHA 3EYUL 3EJTA 5I5MA 3RKPA 3Q6FB 2ADFH 2BSSB 1T83C 1N7MH 3LSOA 3H3PH 3QUYC 3VTMA 4LSTH 2NR6A 2DW5A 3KS0J 1HNFA 1BXXA 1G6RA 3BUPA 5FYLD 2EE2A 5GIRB 3IFOB 2BSDA 2HLEB 4OTXH 1DVXA 3WKYA 5C3LD 1KB9K 3TYGH 3L1FA 2N3JA 3PXHA 5JPMC 4Z7WF 1F42A 3BKML 2ZAGA 4W6XB 1L7IL 3CX5J 3GI8H 4RGND 3HPLA 3Q2NA 2V9QA 3P11H 4GP8B 4HCRH 3SDAB 4DGYL 1KPRB 4ZMQA 2DEWX 2P5WD 3WO4B 5BUGA 3K6SB 2AXFA 4A7UA 2BSTA 1GW0A 3NIGE 1YYML 1KIPA 3VXMD 4AI7A 4K5MA 4M6ML 1SOKA 1U92B 3MXWL 2W9EH 4LF3B 4MXVE 4NUMA 3EYUH 1MVUA 1T21B 2IMNA 4HDIB 3HMXA 2C7UB 3BUYA 4WWKD 3QCVH 5LBSA 4YPGA 4KUZH 1WRFA 4BCXA 4X8JB 1ROCA 3L9RB 3T0ED 4PJAA 3NFSL 1Z1WA 2IANA 3ILDA 3V6ZB 4ZZKA 2EDOA 4HPYL 1BQLL 2F8XC 3BKMH 1L7IH 1DVFA 1Q0EA 5CWSA 3RWHB 3C5ZC 3R06B 4DGYH 3VXUA 4ODHH 1EERB 2XWRA 1VFUA 2LABA 3QI9B 2VMEA 3H8NA 2EVIA 3QHFH 3JV4B 3QDGE 3IMVA 5EWIL 1YYMH 3WIHA 1KIUB 1TG8A 5CJ8A 3AQZA 3MXWH 5EU6A 3WJJC 3WTWA 1ZVHA 1ETZA 4LP5A 4OF0A 1A21A 1MVFA 3NZ8A 4HS8L 4X6DE 4CVZB 3BD3A 4JFEA 1M1XB 3HBZA 2X4TA 3B34A 4JRWA 3B2DC 4E9YA 4KV5F 4MXQC 5IJDC 3CDGA 1CQKA 5E23A 3RTQC 1YNTA 1HH6B 4N25A 2P5EA 2EIEA 1GH7A 4PG9B 1NBCA 3ECVA 3HG1E 3NFSH 4NQQA 3G5ZB 4UIKL 3ZDXF 1JP5A 1BQLH 3OLGA 5IB3B 2PPEA 3FT4A 1IM9A 3UC2A 5T33L 3FRPB 1DVZA 4K3HA 5BV7B 4UCFA 5I18L 4FEIA 3ZE1B 1XH0A 5EWIH 1OE3A 1MW1A 5TDNB 3QC5X 2P49B 2NCEA 4G1EA 3AGVA 3KNBA 2MFNA 1D5BB 3ZQXA 3IRCA 1MH5A 1SMAA 3OAUL 1ORQA 3DETD 5DEJA 4HS8H 3I74A 3PHAA 4X9FA 1QNZL 3QFDA 1RHFA 4AK1A 4C56E 4WWOA 1EDQA 1U3JA 1X4YA 1TSRA 2GC7C 4PRPA 2FLRT 3LZFL 3FUJA 3RDTC 5EBLB 3KPTA 2JQZA 4G80B 3EADA 4NSKB 3MUGA 2IH3A 4OD2A 4UIKH 1XEUA 1FSKC 2Z0BA 5C0AA 3ULAB 1UM6L 2AEPH 4X5XB 1U8PA 5CILL 5T33H 1AE6L 1PNDA 3UBXG 1T22B 3VM7A 1ZSHA 1AXSA 1M53A 2R8SH 4CGTA 2P5WB 1U8CB 2Y7QA 4FXGB 5JIQA 2ICWJ 1BYOA 3VA6A 3WL9B 3VXMB 3TFKD 1UA6H 4QF1B 1RZ8B 5ID1A 3DXAE 2Z7YA 4HK0A 4JJ5B 4AQ1C 3T6VA 4CVWA 5F88B 3Q8BA 4WWKB 1X7TA 3ZGHA 1N8ZB 1NIFA 1QNZH 3DBXB 4BFRA 3L5WA 1IKFH 2YPKA 4O51B 4C56D 2VB5A 2AI0H 3EYQC 3KPNA 1UOVA 3BE1L 5DVNA 4JANA 2Q6WA 5EOQH 3LZFH 3SPVA 1FZOB 2HT3D 1WZKA 2GJJA 3T0EB 2A0LD 5LQBL 2B3RA 1EFXA 3SO3B 4FFTA 2OV0A 3ABLB 4NHCH 4BGLA 5IW1A 1UM6H 2YR3A 3IMSA 1UUSA 4NPJA 5CILH 5T1LA 1AE6H 5DQJB 5C3IA 2IDUA 4ZPTA 5L9DL 5I71B 3FQUA 5DRNB 1AXIB 3BN9D 3DYOA 4L4TA 5IZ7A 2ISDA 4HQQL 4J3TA 3GSUA 2R1WA 3B3IB 5MEPA 4DERA 3NEXA 2X9WA 1RUKL 1CXIA 1AHKA 4PLKD 2X4OB 2ZXCA 1EA9C 4M5ZL 3DXAD 4OJAA 5FFOA 3WMSA 2OJZL 4EQ3A 2KZWA 2XV0A 3DA0A 4DCQB 1UATA 4MTMA 4FJZA 4JBSA 2IAMA 2UVFA 3BE1H 1JZ6A 4R97B 4FXLA 3TBVB 3MCKA 4X6EA 1MCFA 4GG8B 5D5MB 2DMBA 2Q7YB 2JJSC 2F54E 3TFBA 5JOPE 1R46A 3FZUD 4A7SA 4GY4A 1C12A 3OR7A 4NWUL 1VERA 5DC0A 4N1HB 2WXLA 4ALAL 5L9DH 2HT2C 5HHPB 3JQOB 4HQQH 2X89A 4HHAB 3L5HA 3T0BA 5JHDE 4JQVA 2PYEE 5FX3A 1RUKH 1AI1H 1MVYA 3QH3A 4MA7L 2X70A 4N1EA 4ZO9A 4FYTA 3VFVB 2OJZH 4EDXB 1JPGA 4G8FA 4MD5A 5JHMA 2AXGB 4Q4IA 1QQDB 2ZCLH 3N1GC 2ZWLT 5HDBF 4MWFB 3WMPA 4XP6L 5B1JA 4YXLL 5IM7A 1JGDA 2EABA 4CADB 3KJ4B 4V1DA 1MHCB 4XCEB 3CSYA 3FQ4A 2D03L 4PB0L 3TOPA 2NQ3A 3G6AB 4AY0A 5JOPD 5ANMA 3OPZH 4I5BA 4LBEB 4NWUH 1I1FB 1SJVA 3MFGB 3OR6A 4LLQA 1S7WA 1JN6A 4ALAH 4R0LB 3GTTA 4L37B 1ESOA 5J1TC 3KWUA 1B6UA 4YSDA 2DQFB 4CMHB 1U8JB 2GBAA 1KIRB 2AZUA 3QZWG 1UJ3B 2HUEA 1A02N 4IBSA 3QNFA 4MA7H 3H7BB 5JHDD 4HXBH 2YK1L 5AVZB 2YAEA 3S97C 3PHOB 1MUJA 4Q6IC 4N0RA 1DJGA 1KV3A 4XPTL 1KCUL 4NZUH 4ZAKC 4K7FA 4XZ4A 3V4VL 4I4WB 4PG2A 3B7YA 2G5RA 2VXQA 4ISVB 4YXLH 4C56B 5JZ7C 3GLZA 1X5IA 2O6CA 4FG6D 1BAWA 1INDH 5KSAD 1IC1A 2CWRA 3TNNB 1KCRL 2GT9A 3JUYA 3TXAA 1I3UA 1RUMH 2JJWA 2D03H 2DM3A 3H9HB 3JWDC 3B56A 4E0RA 1JGLL 4KK6C 1OP9A 2A83A 5B7EA 3ZK0A 3SQOL 2UZXB 4TSBL 1FFOB 4N0CD 5HJ3A 3MR9A 3HE6D 2H0JA 4NQXA 1KBVA 3QJTB 4ELMF 1JDCA 3MV8A 4MVBD 1U91B 4ODSL 1R3KA 5L4JA 4ZUSB 1MCEA 1HI6B 2VZ3A 4ZNCD 2EEAA 1D5IL 1T1XA 4MMYA 4OFKA 5I1CL 4KZEL 2F74B 5I17A 5AB9A 4NN6B 3EJUA 4KRNA 4X9HA 4O2CB 3TESA 4LRIC 4OD1L 4AM0A 4ZSOA 1KFAL 1MEXH 4AYFB 2OXHA 3DXAB 2CMRL 4XPTH 3A67L 5DZAA 1KCUH 3NIDB 2FJHB 3V4VH 1W72A 3IDMB 4IGBD 5BRQA 3D8MA 2P46B 4YFLF 5DFVC 2APXA 2CJTA 3K80A 2D3JA 3ULVF 4Z3HA 3C6SA 4AC2A 1NGYB 4WSKA 4BDVB 4FLRA 4IK7A 1JZ2A 3FS9A 4QRTB 4ZS6D 3UZEA 1NCTA 5DURD 2OMZA 1OANA 5EUKB 5C1MB 3C9NB 3SQOH 1E9QA 1UYWL 2DL2A 4HOXA 1BREA 1WUZA 2V3FA 2VERA 1D6VL 3UP6A 4F37K 4ODSH 1DQDL 3AG1B 4YFEA 3D0LB 1GGIL 1FNEA 5I1CH 1HOEA 1D5IH 4KZEH 4JL2A 1GZPA 1WFJA 4XN4A 5IK3A 2AAVA 3UGXA 4OZGF 2EVHA 5IV2A 4GAYB 5HGBB 4OD1H 5CMAB 3HRPA 2IIJA 4IIQB 4KI1A 3RPIB 4YHNA 5HP5A 1JI1A 4JN1L 3P2TA 2E46A 4JRYA 1AKPA 4LK4A 1OGTA 2Y4SA 2EC9T 4MQXD 3QJUB 1LK3L 1BV8A 4AVHA 3D85D 2ESVA 1KLUB 3JWDL 1L9PA 3MNWB 4JPIA 3MPCA 2A74B 1MDTA 3NJGA 4J27A 1W0WA 4BH8A 1J8KA 3ETBF 1HHHA 3RVWD 1IVLA 5HHQA 3H0TB 1UYWH 2X4UB 1F02I 3VFPB 1MFUA 1EUUA 1F3JA 3PWPD 1YYLH 4OCMC 2YIHA 1D6VH 1EUTA 2XFXB 2AEOA 3K72A 5F0MB 1HZKA 4PIRF 5TFSH 1GGIH 3FOMB 4H4NA 5AZEL 2V7HA 5DJ2B 5JHDB 2O1AA 2WXJA 1FL3A 1SYVA 1ZV5A 1FIGL 2XCMC 3BH9B 3O2VH 4KROD 4Y1AD 4YHKH 3OF6A 5DGQA 5AD0B 2K8MA 3QYCA 4ELDA 4JM2D 2Y7MA 1NBYB 1G43A 2FSEA 3CFTA 4PJ9D 4ZMZA 5JHLH 2P52A 1PEZA 1LK3H 1ZTXE 4KTDL 5DF0A 3WN5B 1JD7A 4WENB 4AIZA 4QOKA 2VIRA 4QTHA 3VW3H 1KFGA 2FECL 3QIBD 4ZTEA 1FFNA 4PJFF 5KSAB 3MLWL 1ET5A 4CGUB 5HY9A 5D1QA 5HDLA 3VVWA 4HCIA 1IQDA 5IHZB 1CE6B 2YPLD 3QUMB 1K6QL 3S3PA 2DIJA 3HFFA 4I2XE 2YEQA 4PS4L 3HE6B 4HWZB 5BQ7B 4PJXE 1HAWA 2FQFA 5C09E 5D1XA 3L3KB 4JCWA 2A99A 4UQDA 5F7BA 1Q9KA 2Y25A 4PGJA 4JO4L 1QSVA 3G5YB 1BDYA 4KAQL 1I1YB 4KPHH 4KK9C 1W91A 3QDJD 5L8KB 2W07B 4AH2B 2V9RA 3LN5B 1NFDE 2IVFC 2IXQA 2J6EA 2DLTA 1HWWA 3AB0B 5JLZA 2DQCL 4EE2A 7FABL 1PAZA 2FH6A 5IHBA 1NAMB 4JPWL 4QCIA 1XCTB 1KCVL 4FNTA 1KJ3L 4EN3C 3BZEA 4X9IA 2GHZA 4NIKB 4KTDH 1CDHA 4KGJA 1TZIA 1DZBA 2DJUA 2QPUA 2R56H 3MV9D 1R3JA 2P7TB 2DQEL 4BSVA 2RQEA 1SM3L 2HT4D 4WHYH 5ID0B 2R69L 4JG1L 4NENB 1IU1A 1J5CA 3M17B 5DURB 4X7EC 4N8VG 1P5UC 4B7LA 1K6QH 2BSBA 2VL4A 2E9IA 3APNA 4PS4H 5I8EA 3O3UN 2J71A 1I1AC 4GO6B 5D7HA 3MJ7B 5CJ5A 3V7AG 3WEOA 5GGSY 2E27L 5C09D 4APQD 1CD1B 2ENJA 2XYCA 3KPQA 4JO4H 2ZXDA 4HG4J 3QJSB 4P2YA 4MNHB 3MBWB 4MMXB 1LO2H 2WQUA 3MI6A 4JCLA 4X6CA 2ENPA 2I85A 4XVTH 3LXBA 2DQCH 4Q2ZA 5F89A 2MOQA 7FABH 2MH4A 2XLLA 2IQAB 4JPWH 4PJCB 2ADJB 2EKSB 1KCVH 4DOHB 2QR0A 3EG9A 3VXSD 1AR1B 4PRBB 3GS7A 3D85B 1MFNA 3MV7E 4LCYA 4C47A 2VDKB 1NMAL 5GS3A 3TBYA 3CN3A 2HJKA 2EINB 2VQUA 3US9A 2M8XA 1PSKL 1QLEL 2OI9C 2R69H 4JG1H 3BQUA 2VSKB 1FC1A 2EUXA 2YXFA 5HYSG 3GT6A 4FMFA 1CVRA 3MNZA 3KZ8A 2B15A 4IBTA 5E1QA 5FKPB 3IDGB 3PWPB 4PP1C 1J86A 3V5KB 2EICA 1MCJA 3ZYIA 3QJOA 4QRSA 3MROB 3BMVA 1AXTL 1DO5A 3P77A 1OAYL 2AVFA 2I27N 4W9GC 4G71B 1ES0B 1VGEL 4XNUH 4KROB 3R4DA 4Y1AB 2HUHA 2OSLA 2OZ4A 4MX7A 2CLZA 3DV4A 4TKWA 5FV2A 4XXCA 4FULA 3HI1B 4JM2B 4YDLB 3O45B 4WY7H 2BCMA 4KWUA 4WQOA 1DBKL 1R5IB 2FYYB 3L3JB 1FN4B 4G5AA 2AJZA 3TJEL 4AQ8A 4YFDB 3PFUA 4FJ6A 4KX9A 4OLWL 5L8JB 2VXVH 1NMAH 5DA0B 5K1NA 2D4DA 3QIBB 3VG9B 2HTKD 3KW8A 5AOLA 1PSKH 1QLEH 1UWGL 2OJEB 3ARDA 3WIFB 2F61A 2WANA 2YAOA 1QSFA 1KB5A 4FQPA 5B39G 3RWGA 4PWJA 5JA9A 1UXSB 2YPLB 3U6RA 1I8IB 3UO8B 2VDLB 3HG0A 4OF3A 1JTOA 5CGYD 5EH1A 4URTB 4LHUD 4AEFA 5J6HB 3VYPA 4FG0A 1XH3B 1R1CA 1AXTH 4LQFL 3EAKA 1OAYH 3R4RA 3I9AA 3QXAB 1VGEH 3QDJB 1KXVA 1GYWA 2YGVA 1HSAA 2ZYIA 1HS6A 4GO9A 1YMHB 4NCDA 4NNYB 3T2OA 1A65A 2EE0A 3NJIA 3T8MA 5ECGA 1XBRA 4I48B 2P44B 5K39A 2G0LA 1DBKH 2PYFA 2LW3A 3ZKMD 5M95B 1GJIA 2BH0A 4HFUL 4PCYA 1D9KD 4OLWH 3UPRB 1ZT7A 2HAZA 3IRZA 3MO1B 1ZEAL 4MXVF 2OX5A 3MV9B 3L3DB 5DUML 3MRCA 1A7RL 4WSJA 3X14A 1UWGH 4NQTA 2ZP0T 4GQPH 4HC1A 4OFYD 2EIKB 3GDBA 1N68A 3DLQR 1JNNL 3R8QA 4N9GB 3DIFA 2F5BH 3FB5B 1ORSA 2ZWKA 1HJCA 1YEKL 3KPMB 4FFVC 4I2XB 3KS0H 1TOXA 5D5MF 1XT5A 4HUVA 1NZRA 3P54A 5CLXA 2RAMA 1RLWA 1A6WL 3P4MA 5C09B 2DMKA 4APQB 1PJWA 4LQFH 1R4XA 3ML8A 4PJBB 2F19H 2EO1A 4PRDA 1PDKA 4YVNA 1U8OB 4EUPB 3L3HA 3MOQA 2X2UA 4GJTB 4FFYA 1GY1A 1HNGA 1XF1A 5FO2A 3GMOB 4ZMXA 1S3RA 4AYEC 4ADJA 3VXSB 2DS4A 4HFUH 1XZ0B 2CCWA 3DURB 2HMIC 1A1MB 1ZEAH 3ATAA 3F5WB 3KYOA 4MCZA 5DUMH 4D8PA 5L2KD 2VXSL 1A3RH 3RFZA 1A7RH 1FFRA 4Y16C 2F0CA 1CDIA 5DJYA 2WXMA 3EO0B 4LGSB 4X6DF 4ZFOB 3QIWC 3CHRA 2WGXA 5MEOA 3CN4A 3D5OF 4L48A 1YEKH 1J0IA 2R51A 4LCWA 5CUSL 1SDYA 1GRWA 2NZ1A 3AXLB 4NX0A 4PGZA 2JKTM 3BYYA 3D0VB 3NFPA 5BRZE 1A6WH 5LLIC 1HJBC 3S5YA 3F05A 4M5YL 3ABGA 4NS0A 1WFOA 3QWQB 4L5FL 4WHDA 1KJMB 2PF6A 3UAJD 4DTGL 5BVJB 5EF2A 3PNWA 2ZOWA 1BAGA 4S11A 3SKJL 4FA7B 3ARXA 3O4LA 4PJDB 1P4BL 1RV6X 4WK2B 5FDWB 5HPMB 2BOBA 3DHMA 5E1AB 3PAZA 3V0AC 5KSUA 1PLGH 3VUAA 1IRAY 2O5XL 3FB8A 3PQYD 1FVCA 1OF2B 3IKCA 3T1FB 3RZWA 1WE5A 2FX7L 5DHVB 1SEQL 1TQWA 5CEYA 5BJTB 1BEYL 1MQ8A 3BWAB 2VLKE 3QA3A 3H9SE 3SODB 1YN7A 1YAIA 2G3NA 3IDIB 2O72A 4MNQA 3B3BA 4H1LG 4TXVB 3BPNB 1NCIA 1BD2A 3LZQA 3ECBB 3U83A 5C86A 4LHUB 2DIBA 5DUBA 3VNYA 1AYOA 3CVHL 4Y0GA 4XP5L 1QFWL 1P69B 2JKSA 4YR6A 3ZZ1A 4DTGH 2C3WA 3NSXA 3SKJH 4QAMB 2X7LB 1P4BH 4XGZA 1ADWA 1S9VA 4FX5A 4NT6B 4TNGA 5EU7E 3TPUA 5I1LB 2GJ6D 2CGRH 4XBMA 2OMVA 1LO4L 1KPVB 3CIQA 1D9KB 2CJSA 1DTUA 4DF9A 2HPOA 2DOCA 3BAYA 4FCAA 3KLQA 3B9KD 1ZPLA 2BIMA 4Y5XC 1BEYH 4F33A 3HE7A 5FCSH 1R6VA 3LN9A 3UZVB 1PBYA 1KLGB 4MNGA 3D25B 4QYOB 3C75A 1H3GA 3SYPA 5KYUB 4ELMA 2R2HA 2NYYD 3B9EA 3SBWA 5J3HD 1ZVYA 4LSPL 3F6JA 3U9PL 1PS3A 3EOAB 5IEKA 2WBJC 2L3BA 2QV4A 2WQXA 2GY7B 4XP5H 1T20A 3C6LA 4YK4C 3KYAA 2WXPA 5LAXB 3HB3C 3HN3A 2Q8AL 4DSYA 3UADA 1JHKL 4WEMB 4AX3A 3O3EA 3OHXC 1RJYA 1IBFA 4GSUA 4OCLC 5HHVL 1DE4B 3DTXB 1A7NL 4R7XA 4RMSA 3RNQB 1I9JH 3QZBA 1SDAB 2LE9A 4EZMA 3HNVL 3ME0A 4I89A 4HISA 4Y19D 5H4ZA 1PZ5A 3RTLA 4BKLA 5L2KB 1JK9B 1B4LA 1E43A 4OBRA 3SPGA 5F3BA 2A4CA 1W2KT 2AGJL 2AERT 1J1XH 3EYOA 3S5ZA 3LKNB 2NLJA 3C09B 1QWUA 3RB5A 5F0LB 4M1CD 3HRZB 4H44C 2XACC 3LKPB 4WK4B 3RBSA 3U9PH 5B3SB 5GZOD 3IDJB 3BDYH 1KY7A 1LM8V 4KZ0A 4PVBA 3BDBA 1BEXA 2Q8AH 1OK8A 1JHKH 4FYQA 1WS8A 4PY7A 3MKKA 3QEQD 3TO2B 1RXLA 5E1GA 2ITEA 3CK0H 2AJ3A 5DDHB 4QXTB 2YEZB 1PIGA 4GT0A 1ZSDA 4OAWA 1A7NH 1T7WA 3UDWA 2CNZA 4RCAA 3PQYB 3HNVH 4WDIB 3CH1B 3D4YA 5HVGB 3SPIA 3FT0A 2AANA 1NGXB 3QWRD 2H3NB 3WY2A 4KTYA 4TULL 1X6LA 1VZHA 3Q5OA 5C70A 4ZFFA 1OD7A 1TQBB 1W0VA 1R5VB 2BS71 4BUHA 32C2A 4XNMA 3UYPB 4NZJA 2AGJH 4P48A 1Z9OA 4UI2A 1H6EA 3M8OL 1JK8B 1WDAA 1BVKB 5GS1C 1JWMB 4F5CA 3S36L 3B9VA 4MDJB 5EORL 2WLJA 1NCWL 4AVJA 5A6LA 3QULA 1J0HA 1GAFL 1M7UA 1R3LB 4F8QA 3HHRB 3AQDA 1XR9B 4FL4B 5IMOA 2TSBA 1ZA6B 1CO1A 2C26A 1BX2A 4G9FA 5GS2D 5KOVC 5EUOB 3TJHC 2NTSP 2VR5A 3EJZD 3FO0L 5ES4B 2GJ6B 2MQ0A 3K4ZA 1AHWB 4IRJC 4AYDC 1DANU 2IDFA 2WV3A 3M1BB 5DZ9A 1RCYA 2CDGB 4M4PA 4KRMB 1ILSA 4HDIA 4PJFA 1EAQA 3V6FB 5I6PA 3DO3A 4HWBA 4ODWB 3KYNA 2OCFD 1X5GA 3O3AB 4UZGA 4TULH 3B9KB 3IK2A 2VDPL 4DK3A 4OZHB 3OLEA 1DQJA 3ZTJH 5J8OA 3GMNB 4JHZA 5DZVA 1O5PA 2XIIA 3S4SB 5JIDA 3TLRA 3ZTNL 5EORH 3DUUB 3NPSB 2VDQB 1NCWH 5MP6H 1Z32X 4MKTA 1GAFH 1ECZA 4NYLB 4UQAA 3U4BL 4FNSA 4MAUL 2XXGA 3WJLA 1DL7L 3IDYB 2E7BA 3T0XA 2CD0A 2ZTBA 3VSTA 4AV5A 2IH1B 3QI9A 2PWGA 2J4WH 1A3LL 2Y1ZA 4XNQB 2MJWA 3F12B 5HPOA 3V95A 3CVBA 2N4IA 1UACL 3VQ1C 1EHKB 5B1KA 2QQNL 4FXKB 4OZFA 1II4E 1K4DB 3PAYA 4Y19B 4WV1B 5DA4A 4UM9A 2YJLA 2W59A 4R7DB 2PETA 4PJCF 3VB8A 1ZA3A 4R5VA 4Y4HC 5IVZA 3T5WA 3WFHA 4G7YL 1X7QB 1XF4B 1IFRA 4G8IA 4RMWA 3JUZA 2OTUB 3G08B 3GMPB 4HP5A 4L3ED 2UXFA 3ZTNH 4DP4X 5F9JB 1KF9B 1HESA 2BY1A 3DECA 1F45A 3G5ZA 1U8MB 4JAMA 4OFIA 3WGUB 2XN2A 4UU9B 1A4KB 1ZVSB 4V2CB 3U4BH 3PIQA 3FRPA 4MAUH 1DL7H 2JLPA 2QGDA 5EO1A 5HJBA 5IB4B 4TQEL 4ANVA 1OAQL 3SD2A 3QEQB 4FQIL 1OSZB 4NRXB 2EACA 3VFSB 3T0WA 4R3SB 2BDNL 1EXHA 5DVMA 5IROD 4GRWH 1UACH 5IB5A 3QDMD 1I75A 2DQUL 2YUWA 3MLPA 4UQBA 2FJFB 2QQNH 3OX8A 5GRVK 4R7NB 2ZWYA 2NDFA 4PP2A 2DMCA 2ZAIA 4JM2F 3TV3L 2NRDA 1ZJBA 1T3FA 1IGTA 2OW7A 4G7YH 5FLUA 2DKSA 3ZDZE 2YS4A 3GFUA 2DWXA 1TLKA 1B6DA 4GRLC 4X4XB 4RNRB 4WJKB 1G7MB 1SN2A 4GOSA 5DQDH 4G80A 2D7OA 4LEXL 4P2OD 2WW8A 5DRWA 3WEXB 4P3DA 4CILA 1B2YA 2WWKT 3TEYA 5HGHA 1ZMYA 1F4WL 1BM3L 3GJFH 5IVOA 3P4OB 3O81A 4IW4C 4UT9A 2OYKA 4TQEH 4CU8A 3CFEB 3MUHL 1N5YL 2UXTA 4FQIH 3TM6A 5FO7B 2BDNH 2XG5A 4N3TA 3WL9A 2BRQA 1YEGL 4AQAA 2DQUH 4QF1A 5IB2A 4XMKL 3GSNB 2IWGA 1YLBB 2XVKA 1I85A 4XPHL 1GKEA 1I82A 4Y2DD 4OI8A 3TV3H 2Y7SA 1TQVA 1KUMA 3DBXA 4K5PA 3O11A 1MIEL 1K8IB 1N5AB 3GJEB 4PJ7E 2X4PB 4DUWA 4WWID 2I7SA 2L7QA 3MRBA 2AP2A 2NW3B 1LL1A 4KHXH 4AQEA 5KBNC 5F7WC 4LEXH 4OCXL 4QXUL 4IKIA 4ZDHB 3SYQA 4H8UA 1BM3H 2IMMA 1EAOA 4JY5L 4JG5A 4PGDA 1I53A 2B39A 2EE9A 1XIWD 3AM8A 4A2DA 4N4YB 4DESA 1CN4A 1T1WA 4JN2B 1SY6L 4F2MB 1YEGH 4PJBF 3FT9A 2X4OA 4ONOA 2NY6C 1A4JB 4PJ5B 1CR9L 1H3VA 3GXNA 1TT6A 1BFTA 1P9MA 2ODHA 3LPWA 3C60A 2NY3D 2AJYL 4DT2A 4C59B 4PLJC 1E5AA 5FC9A 2HRPL 4RMBA 1E2ZA 1MIEH 2ARJB 5EZOL 4RSYA 4L3EB 2IWFA 3G5XA 3ISYA 4MLSA 3BAJA 1U95A 2DQIH 4O2EB 4QXUH 5A40E 1IFHL 3MLTA 4HLZH 3L5JA 4YC2C 1KN4L 3UTZA 3BUQA 1VGKB 4JY5H 4RDQF 4A2GA 3RWIB 4G8AC 3VI4B 3HS0C 2BNQD 4LOUC 4RFOL 3F6IA 1OHQA 1JRHH 2H5UA 8CGTA 3FQNB 4R96B 1U2CA 3QDGA 4XX1E 1W15A 1WFUA 1PY0A 1UFUA 3TYFB 1CBVH 3QDMB 3GMQB 5FK9A 1CLOL 1Z7JA 3VFVA 5GRYA 4S0TD 4FG4A 3KPSE 4EDXA 1SFDA 4HWNA 2XDHA 4X5LA 1G94A 1CR9H 4PJDF 3VWJA 4OZ4A 4X6DA 2YO3A 2AJYH 5E0FA 3QZOA 2HRPH 1LO3H 2FJUB 3D51A 4ZQTA 4A68A 2F6AA 2DQDH 3WNNA 4LPCA 3HG1A 2VITA 4WNQB 4A67A 3IU3A 2VDOL 3CXDH 4P2OB 2HH0L 2IH9A 1KN4H 4LBEA 5FKAA 3Q43A 1JGIA 3WY4A 3NK4A 1YY8A 3US0A 4ZUUB 1KXQE 4R0LA 1D7CA 3AG4B 3ARED 4RFOH 5CSZA 3HS8A 1R9FA 3C8DA 3MRMB 4JQIH 3P2BA 4DNLA 3IAQA 3MLUL 2FT7A 3PF2A 3CX5K 1S9XB 1CLOH 3BVXA 4AT6A 5B8CA 2CJ3A 5D2NC 3N42B 5GGUB 2OYLA 1X44A 5D7KD 3KPSD 4F7PB 1PJ9A 3ZTDC 4DEWA 2PTTB 5JDSA 4Y2DB 3V7MA 5KBKA 5KS9B 2YN3A 1JFQH 3GZQA 5LNGA 2VLRA 2VRKA 2ENQA 2OMWB 4C56A 1ZS8A 2NY5C 4YDIL 2VYRE 1WWCA 1JPST 2FUTA 4XNDA 5EOCL 1QG3A 3LD8C 5DCCA 1CGSL 2YXWA 5AKVA 4KRLB 1DVUA 3KPPB 3IDUA 1OCCB 5DJDB 5I75B 1Q1JL 4XCFL 2OMNA 3VXNB 3RKDD 2AITA 2PO6A 4QHLA 1XIWB 2L8AA 4ZUSA 2NNFA 4X9BA 1IAKB 4JDTL 2C9VA 1G1CA 1UEYA 1ZHKA 3MLUH 4EIBA 3S3CB 3QUXC 4XVUD 2K7PA 2V3DA 3FU9A 4X8GA 1S7UA 3ARBD 4KNSA 4N2CA 4BUGA 5L6YH 3UL4A 5GRJL 3SCMC 5IW3A 5IVXB 1KELL 1NMBH 3QORD 2NY3B 1EAPB 4FTVD 2RD0A 2Z91B 5JXED 1TVBB 1XB3A 3R0MA 8PAZA 3FT3A 4BDVA 1TU2B 4FG2A 4U1LB 2GB2A 2NQCA 4QRTA 2EDRA 2E7LC 4MZ2A 4PGEA 4BSWB 2BFVL 3H2WA 1CGSH 4P5SA 1D7BA 1JXDA 2QVTA 1O6VA 3GXDA 1DVQA 1G7QB 4MKMA 3CJJA 3HAEH 4J5VA 1Q1JH 3QUYD 1UH2A 1KTBA 3E2HC 4UANA 4XCFH 4WUKL 4YO0B 1E5YA 4Z7UB 2BNQB 3D0LA 4B9JA 2JB5L 2O6DA 3ZKND 2DWSA 3O41A 5DEGA 4MA8L 1AQMA 3PREA 4CN1A 5HGBA 5GISL 3RPIA 1XCWA 3PWLB 5BW7C 4KKZA 2VKXA 3L3OC 2NY5L 5C0GB 5J13C 3OZKA 5GRJH 2H26A 3CGTA 3D18A 1KELH 2GBUA 2MOVA 1VFAB 1KLUA 1VCAA 3IMUA 5DMKB 4ZODA 4ATWA 1RZIA 4LSUH 4WI5A 3HLAA 3LB6C 5GRUL 3BSHA 4G8GD 1B90A 4NUJB 2BFVH 4PH8A 3WEMA 4DZBA 1YSOA 2F54A 3H0TA 5DQ9A 3ARVA 3C08H 3OB8A 3DX2A 5IQ9A 4UWQB 2V5SA 1JDDA 5D71H 2BC4A 2AV1B 5JPNA 4JE4B 4N2NA 1F4HA 2BP0A 4WUKH 1ID2A 4UM8A 2QDWA 3AREB 2FL5A 3CC5B 4HGWA 1AP2B 2JB5H 4NNXB 1T66C 1FZJB 4PREA 3VD7A 4B9FA 2R1YA 4PR5A 4MA8H 3U4EA 1BP3B 3F8UB 4N2IA 1IC7L 2PYEA 3BH9A 3S35X 1HT6A 2CLRA 4LO9A 2DLIA 3AG2B 4UAHA 5GISH 1MCOH 3I9PA 3FO2A 4PBDA 3IXAA 4NRYB 1HHJA 2NY5H 4L8SB 5EUOF 1EXUA 4WI3A 2XQBH 4CUCA 4XNZB 4JM0A 3QS3A 4RMUA 5IMLA 5T1DH 3C5ZD 4J28A 4YHML 5KUKA 3O4OB 4R26L 5T3XE 4PBVC 1L5GA 3OKNB 2EP6A 3OJDA 4HKBA 3UFIA 1S78C 3VMNA 4ADIA 1I8AA 1VFBB 3D06A 4Z3IA 2K6ZA 4JVUA 2EH7L 4OLUL 1NUNB 4RX4D 4R2GC 4FKEA 4OZHF 1FLTX 1BLIA 2NW2A 2YD6A 5AKRA 4R4BB 3PGCA 4ZFGL 2YMXH 4LSSH 5BQ7A 1HQRA 5T8IA 1ZHBA 2NY4C 3SDYH 2PP7A 1BF5A 3L3KA 2ALAA 2WQVA 3DGCR 4OKDA 3N3EA 4MXQD 2PPCA 3ULUC 5IQMA 1IGML 3G5YA 4N8PA 4NHUA 5C9KA 4GXUN 2YGNA 4H8WL 1YCSA 2VN7A 1IC7H 3N0AA 3OM3B 3V4PA 3WFCL 1H6UA 2TRHA 3ZHFA 3OZLA 2XOTA 2J7LA 1K3IA 3FULA 4BH7A 3ARBB 3WE6A 5EZLA 2FIKB 4JDZB 1WG3A 3IJEB 5TF0A 3RX8A 3WHE1 4FNPA 4JREC 4IGBA 3QORB 3ZLQC 1UXWB 1B0GA 1OM9A 4FTVB 4DN4H 3SY0B 3QUZD 2AQTA 4HAKA 1T0MB 1RD6A 3RI5K 3T1WA 3FUNA 3POCA 1HEJC 1JL8A 2ZKHL 4BK5A 5ID0A 2EH7H 1E27A 1MJUH 4K94C 1ZT4A 3ZKQD 1QLFB 1SMOA 1KTCA 3LDBC 3V8CA 4ZFGH 4Q89A 5FYJL 1I9EA 3I85A 4POUB 3QUYB 4XN1A 1DBAL 4KKRA 1E65A 1VF5C 4UQ9A 2YGPA 2CPCA 4O58L 5FIEA 3IJSB 4H8WH 4N2HA 1ZANL 1SQ2N 1Y1DA 3WFCH 3N9GL 2H2PC 1DBBH 2ITDA 4LAJH 4LKXB 2FECI 1OP3K 4UOZA 3JVGA 3GS4A 5IHUL 4KQ3L 3GTNA 4JVPA 3SDCD 3BP4A 4F8LA 1M6UA 4EN2A 1MSPA 3NN8A 2DJMA 5E6IC 5JPMB 5AVTB 3BWZA 4M1DL 2UZPA 5DD6B 3PWVB 4Y2LA 3B7TA 4HFWB 1HIML 5EO0B 4WFHD 1ZLDA 2BW5A 4UIMB 3ZDYB 2ZKHH 3P9LA 4G8GB 1G7HB 3KDPB 4RFEB 4ZOEA 3U48A 3BVVA 4E9LA 3S34L 4JKPL 4E9SA 5C2BH 1KGYE 2CM5A 4NAQA 1AZRA 4WI6A 2JTDA 1KBPA 1OB1A 1F1AA 3DVNB 3ULUL 1J8HE 2C3HA 1AG6A 3QJVB 3RY6C 1AAJA 1KLFA 2QPFA 1FYHB 2Z4QB 4LPYA 2XN1A 4ZK8A 3V5KA 3ESNA 3RZCC 1H15A 1DBAH 1BQ5A 5E5MB 4I0KA 3HN8A 5G4OA 3QJRB 5I66A 4HUUB 4LCIL 2OSWA 3EYQD 4O58H 1PZDA 4HXAL 4ZUTB 2R2BB 4TUKH 1ZANH 2Y22A 3N9GH 1HHIB 1DFBL 1MRDL 3GD1C 1X5AA 2ITCA 2Q10A 2DTML 4LEBA 4G7RB 3KLSA 3PY9A 4E9RA 4EPSA 5FECA 2PCPB 4M1DH 4PJ9A 1MHHA 3ES6B 4W9ZA 1NCNA 2ZG3A 3C5ZB 4IKLA 5TQ0L 3WNKA 3TNMB 4K94L 1PZ3A 3GNML 1FBIH 1HIMH 3WHE0 4JHWL 3ZPDA 1I7TA 1OALA 1XGTA 2ZOKA 2JELL 4H0LC 3VFTB 4ZTPL 1IT9L 2XWBA 4EN3A 5SV3A 4JKPH 3S34H 1D5XB 3MREA 1MW3A 1J8HD 5J6HA 1UVQA 3GMMB 4J4PA 3JWOL 1CXEA 5FB8B 1XF3B 1T7VA 1TQCC 3GSOA 3MRRB 5KUMA 3N06B 4HJJL 4XXWC 1KGJA 4W68A 1X5YA 3QXAA 4F7MA 1DFBH 1MRDH 1SEBA 1JYWA 3OJ2C 4GRMA 4H0GA 1NOAA 3ARFC 4N24A 4NNYA 2DTMH 4P2AA 1HH9A 3CWGA 4LEEA 3WOVA 4Z3GA 4XNXL 1AYRA 5ACZB 1M05A 3NJXA 4RISH 1KT2A 3FRUA 2ORBL 2HT2D 1NCAL 4JY6B 5CU9A 3GNMH 4AYGA 2XZAL 4I18A 3G5VA 4JHWH 2JELH 4ZTPH 1IT9H 4L8DB 4I77L 1AMXA 4PFEA 2X6VA 2WLHA 4N9GA 5FOJA 1C1EL 2DY2A 4ETQB 1BVLA 4UTAH 5T5NF 2K6WA 4C4BA 4JZJC 1HSBB 4I2XA 3S37L 5AEAA 4LOEA 1RK7A 4PJXA 3PG2A 3GJFK 2R0KL 3Q9QA 1I3RA 2G60H 1TCMA 3JWOH 2KQMA 1XGZA 4XN2A 2ATKB 3BUBA 4IM8A 4HJJH 4P23D 1G7PA 4O00A 5DJCB 1G7JB 5D1ZC 3VI4F 2XTSA 1NFDA 5F3HA 4NO3B 5D9SB 2GW5A 4M8RA 3SDCB 4HOZA 1FSKB 3DROB 3CXHK 3EFFB 4R90L 1JPSL 4D0CA 2NNCA 1HWHB 3WN6A 1R33A 2XQYG 2ORBH 3LHPL 1NCAH 4A66A 4LVEA 1KCKA 1SDDB 1S46A 5ERWA 4BFIB 3P30H 1ACYH 1E90A 5H35B 3VU2A 1MAML 1KPUA 3TBWA 2EDXA 2EE6A 2O61B 4G11A 4P46D 1GL4B 4HKJB 4AQ1B 4P5KA 3UXFA 3N41B 1WA2X 1ETJA 4F37F 4JPSA 1RJCA 2CU9A 4N87A 4CDGC 2R0KH 3D0VA 5FA4A 3CFDA 4AIOA 1HEZA 5MEQA 3S3JA 3K6DA 4HCGA 4UQ3A 4KX7A 5JZ7D 2IF7A 4BQ9A 4K3EL 4EI0A 1KXTB 1S9WA 3P0GB 2NY0C 5KG9B 1J05A 3ULSA 3PGDA 4W81A 1Y6NR 3GM8A 1CFNB 1UB6A 3I3BA 3ILPA 4PRIA 1GSMA 1V27A 3SEPA 2PTUA 3LHPH 1MLBA 1OF2A 2WYHA 3N42F 3MV7A 4QRPE 3EH3B 3N2JA 1I1RA 2CO6B 4LPWA 1T6BX 3ZU8A 2HJLA 5KS9F 3FCBA 3RAJL 4YUEL 2BVYA 3IDIA 2LOEA 2AKRA 4PWEA 4AE0A 4YHOH 3BRDA 1J8HB 2H6UA 4Z7OB 2XHNA 2QFRA 5I76B 4U1NB 1NCBL 5DFVD 3D2UA 2L7UA 4LCUA 5IQNA 1SXAA 4HS3A 3HKZA 5F44A 3V4VB 2NUPA 2Y1AA 5GJTL 1KYDA 4TUJB 4LL4A 1INEH 4F7EB 2VNCA 4JFPA 5AYTA 5IBUB 2X2HA 5HI5C 1SJEB 3BI9X 1Q9LB 1J7VR 4GQQA 1U8QA 2VL5B 5D8JH 5EA0L 3SKNB 3SE4A 4DETA 3QHTC 4EJ1C 4LLUB 4JFHE 1FHNA 3MTRA 2IPUG 3QNZB 1EV2E 3TVMC 1KC5L 1PG7W 1UOLA 1AQ8A 3ZYOA 3KPRE 3S9DB 5IVXF 3RAJH 3IGKA 2QQKL 2IALB 1QSEE 3B9DA 3JTSA 1TTGA 1XMEB 4K5LA 4U1GC 3V6OC 5B38B 3CDCA 2MCMA 3W9DA 4P2RE 3L13A 3BEVA 1CI3M 1EHLH 2ETWA 1NCBH 1QEWB 2I07B 3LIZA 3UBHA 2G9HA 3MRQA 1PFCA 2P80D 5AAWA 4NM4L 1E28B 4P23B 1PFOA 4DEUA 4IOSD 5GJTH 2FHFA 3GI9L 5T1KA 2KL6A 1XD0A 3TCLB 4ZMNA 2FDBP 5C8JB 4Z7UF 1A9BA 4XB3A 1LEGA 2NMSA 1DE4A 2X1XR 2R0LL 4QRUA 2YAPA 5K1VA 4ESKA 2I69A 1FJ1B 5EA0H 2TAAA 2YD7A 3N44B 2VQ1B 4K07A 3RNQA 4HG4K 1NH6A 4EI5A 3REWB 4YX2L 4CBPA 1S7TA 4HWEL 4JFHD 2WLIA 1NL0L 4YSRA 2OMUA 3RWCB 1KC5H 1XSKA 3CLEL 3FQTA 1TITA 2D73A 1UA7A 2FEJA 2YA0A 3P69A 4LDLB 5ALCL 4UYQA 3KPRD 4TPRH 4Z77A 2OZNA 4Q6IB 2QQKH 5EU4B 3H55A 3I6SA 3EYVB 1KY6A 1MHPH 3LKNA 3MCLH 4HKXB 4W1TA 3MRDA 4M93C 4P2RD 4ZAKB 3FQRB 3P3TA 5CP7A 3IDJA 4BQCA 3L4CA 1E67A 1MFCL 4ACTA 5CSBA 5HJGA 5DS1A 3Q3GB 4LPXA 3FO9A 1RUAH 4ZRGA 3LVEA 4NM4H 4TYUA 3T77B 4BD4A 1PZ2A 2D7TL 1DSYA 3B6SA 5CLYA 3GI9H 3PHQB 1FFPA 4M03A 4S1RH 1QLRB 1UD4A 4ABQA 4J12A 2R0LH 2YEZA 3A6CL 4PWKA 3HR6A 2PWDA 4PJ8C 5SWZE 5I24A 1AD0A 4HULB 4YX2H 4HWEH 2ZSWB 2H3NA 1NL0H 1DSWA 3CLEH 1FYTD 1S9KC 4KKPA 4POZC 1U33A 5ALCH 4KK9D 3UYPA 5D7JC 2N7SA 1JUFB 3W2DL 1MZYA 4OJFL 1E4HA 1NDMB 5C0IB 1AZZC 1FLRL 3G5WA 4MDJA 3ZE0E 4IKJA 4KDWA 5FA3A 1DCLA 5BRZA 4C4KT 4APXA 5L4IA 1T2XA 4N8VA 2D7TH 2ZP9A 1EO5A 3CBJB 3CQQA 4KFZC 2VZUA 3M45A 1CL7L 4JM4H 1YYCA 1E2WA 5ITBL 1YJDC 3A6CH 1YNLL 3UTPE 3SDDD 5GGSA 2OULB 1UD2A 4UQEA 2FGZA 2AQ1A 2APTA 3KPLB 2XKNB 1WLHA 4JRLA 4WI9A 5SWZD 5EC2B 2YBRB 1TMCB 4N0UE 4GBXC 3O3AA 2GTWA 1MCKA 4EXKA 3CN1A 4X6BB 4HUVB 2XUWA 1MY7A 2NNAA 2VLKA 4J3SA 1A1OB 4R7LA 3H9SA 4KOCA 3QS2A 1IM3B 3BN3B 3W2DH 3LKRB 1G6VK 1ZGLP 3GMNA 1MLCA 1QR1A 2FYVA 4ODTL 5DZOA 5AVWB 1OKEA 4XWOC 1FLRH 3C5SB 4P57A 2ATAA 1UB5A 3UMTA 5B21A 1A6AB 1PX8A 4IU3A 4JFOB 2F7QA 4ENZA 4OF7A 5TF1L 3TIEB 3BZFB 4AQOA 1GTFA 4TOYH 1DJYA 3EHBC 4HJ1A 3D69B 4YSCA 4CMMB 2LR4A 4TVPE 3THML 4G6AC 5I30L 1CL7H 1WFIA 3L4WA 4XNQA 5A6MA 5DK0B 2FT8A 1MJ7L 2RMNA 5ITBH 2VC2H 2WB1A 3UTPD 4KDTC 1OO2A 4R4ND 4PP1D 4XAKE 1JV2B 4NWTL 4ZTOL 4M6AA 1IBBA 3UBXB 3DGDA 2R29A 2NTFB 5FGBA 3NCBB 3ZMNA 2VDNH 4PMFA 4FQLL 3VMPA 1I8LC 3UTSD 5JORA 1R5WA 5HYEA 3A23A 3KPRB 4WNJA 5EDSA 5LUMA 2IV8A 3VACA 4D3CL 4NFBA 4U05A 3FBKA 4A6YL 2XBZA 1JZ3A 3ASWA 1WFNA 3ZDYF 1AO7E 2J5LC 4HA1A 4P2RB 1TZGL 2GPZA 1U8MA 3MRHA 2PABA 5GZOA 4M62L 4X83A 5TF1H 4F57L 3FOLB 3ZDWA 2V6HA 5KYXA 1UT9A 2WPGA 4X6FB 2XNAB 1MCHA 1YJDL 2P42B 1XGQA 3THMH 2R9HC 4GUPB 3WE1A 1OSZA 5I30H 4PW9A 3BP7B 1U2YA 4JGMA 1JHTB 1C5BL 3NCCB 1QX1A 5E4AA 3K71A 5K9QG 3Q05A 1QLEB 3H56A 4WFEE 3V5DB 1QA9B 2GSGA 4NWTH 1O7DC 4ZTOH 1KTLB 1OW0A 2LLLA 5AOMA 5A2JH 1CGXA 3OLIA 4XPFL 2E9GA 3GB7A 2X44D 3PP3H 3A4AA 1FYTB 4K9JA 3RY5A 1ACCA 2GCYB 3O3DB 3HUJA 1CGYA 1V3JA 2W1NA 5GZNC 5F7EH 3DPBA 4P4RB 3BZ4B 2VH5L 3WD5L 1CG9A 4A6YH 3HC0B 4M7LT 3V0DA 4K5NA 4MS8C 4M62H 2ZOTA 3KVDD 4F57H 5IMKA 2APSA 4WCYL 5E7BA 2EH8L 5A7BA 2YD4A 1EZVY 4MD4A 1OTSC 1SLVA 1YJDH 3UYRL 3V0VB 3EYFB 3LAFA 3QG6A 4ONHB 3VD3A 2DH2A 5FO7A 4WW2A 2VWEC 1C5BH 1P5UB 4LGRB 5EU5B 2ATPB 2PW2B 2X4SA 4FFVD 3SDDB 1XGUB 4G1MA 4U1JA 4WFED 2ZKWA 1XR8A 1I1AB 3U1PA 4X50A 2HFFA 3OAWA 1NC2B 4U3SB 5SWZB 2VUKA 3BEWB 4XPFH 4Z0XA 3KHOA 1IZKA 3JSSA 5FF6B 3SY6A 2A6IB 4ZMYA 2UWEE 1FL6A 1XCQB 5C08A 1BZQK 3RVXC 4G6KL 2VH5H 3WD5H 2ITFA 2PR4H 4CN6A 2Q5BA 2EDMA 4HAFA 3IYLW 1MAKA 3JT0A 1SHSA 4WCYH 5ABAA 2EH8H 1L9MA 2OCJA 3O9WC 3UYRH 4GI6A 1ND0B 2OI9B 3ULVH 1ZT1A 4NP4L 1ZE3H 1U3YA 2Q0ZX 3QIWD 3L1EA 3G6DL 2PXYC 4OI7A 4YL9A 3WFDH 3PWJA 1P7QA 4K8RC 3NSCA 2X6CA 4M8VA 2Y69B 4LFHD 4OCRL 4L0ZA 3MLZL 4N2AA 2WSKA 1JZIA 3GSVB 4I0PC 2E7DA 3DVIA 2I9LA 4N0UB 3LQZB 4L1HA 3UTSB 4JFDE 4QPEA 3IJ9A 4MB3A 1DVSA 4KJQC 3L48A 3MRGA 3N55A 3UC0H 2GIMA 4G6KH 5JOFB 4NQDE 4TRPL 1DUZA 1TEGA 3H4HA 2X6UA 2DD8H 1WZ1L 3L08A 3VQMA 1H3PL 5JQHC 5KN5B 3KDMA 1WAAF 1WZAA 1XX9C 1TQSA 4A2HA 5F2FA 5TQ2H 3PJSA 3PYCA 2XZZA 4LLMB 4QY8A 2BS9A 3HHMA 4PVNA 4X7FC 1IJ9A 3N41F 4F2EA 3GXUB 5E00B 4KTGA 4NP4H 1RFDH 1Y18A 3G6DH 1DUYB 4FQHB 3QRFM 3GMQA 2H3XC 4OCRH 2FGWH 5AKSA 3MLZH 1YVLA 4K3DH 3E0GA 1M6OA 7CGTA 4WRLA 3NRFA 2A5UA 3DJSA 5ESAA 2CO7B 4FLOA 4Y5VC 5JIMA 2MPVA 2DWDA 3NEOA 4FA6A 5FOBB 1T0OA 4IDLA 1P1ZA 1T04B 2KT6A 2CR6A 4NQDD 2B1AH 2HXAA 2HG0A 4TRPH 4YGVA 5E8EB 4FQQA 1JRHI 1O75A 1QWNA 5EB9A 1VEMA 1WZ1H 1H3PH 1KEMH 3O8XA 4J2QA 2P8MA 1KYOJ 1FG2B 1O7SA 1LE9B 1M2OA 4KK5D 1CK0L 1SF5A 4K8RL 3E1F1 3RWJA 4Z7OF 3R7QA 5KVDE 1BIIB 3QEGH 3MRMA 4XMLL 1DJZA 1V3MA 1FO0A 3U30C 3BGAA 1E3XA 2AQSA 3PAUA 2VCOA 4HIPA 5HI3C 4EI6A 2FO1A 5CP3A 5DEFA 5GGUA 3AY4A 1IGYA 2WBJD 3MLSL 4WO4D 2PTTA 3QAQA 4X8XA 4Y2DA 1IGFH 1T03H 1FNSL 3HB3D 2CQVA 4XHQA 1BCIA 5D6DA 5KYYA 5MERB 3CVHB 2XETA 5BOZG 2VJXA 3FQXB 5BUPA 2OBGA 2O5NA 4DQOL 1BFOA 3N85L 3RPKA 2QVFB 2P8PB 3NT0A 3AS3A 1GVIA 1A6TA 1WBXA 4S1DC 3F7VB 4HJTA 4XODA 2MOGA 1PNCA 2VLJE 1N6UA 4GRWE 4KGLA 2P24A 3L4UA 2CLVB 3KXFE 4PY8J 1XXDC 2EVGA 4IDJH 4K8RH 4UOJA 1XIWA 4LP8A 1G84A 4XMLH 1BM7A 2A6JA 4W4OA 3QIWB 2G30A 3LKQB 3LH9A 1SMDA 3VU1A 3WJMA 2GSIB 2QSCL 2F8VA 5EBWA 1UZ6F 3N1FC 1TIUA 1S7XA 3NA9L 3QQNA 2AS5M 5DJAA 3MLSH 5MHSE 1USQA 2UZYB 1Q72H 1U3HD 1FNSH 1KZQA 2Z91A 1TVBA 3DMMA 2UWEB 1AQDB 4Q0XH 4WW1A 3X13A 3N44F 4DKFL 2F58L 4DVRL 4DQOH 3BGMB 4PJ7A 5DYOA 4UTBL 2MCG1 4LQ1A 1QACA 2H8PA 2BZCA 5E6ZA 3GIVB 4BK8A 1P5VB 4W93A 5LJYH 2DF3A 4AL8C 1OGSA 1SXCA 2BVQB 2EECA 5F1NB 4L3CB 5I74C 3WTTA 2R0ZH 4IRZH 2XWJA 1JV5B 3NJJA 3KXFD 4ZUWB 3IETA 1K2DB 4QNPF 3TEUA 4ELKA 1GZQB 1KB9J 4GKZA 4U1KB 3BXNB 4QLWA 1UKQA 3L3GB 1F86A 5K9OA 2BXZA 4HBCL 5AG9A 2WXIA 5JIIA 4IOFC 1G5GA 2Z7ZA 1WITA 1TTCA 3BH8A 2QSCH 2Q3ZA 4NQVB 2MTAA 1IAOA 2Y23A 1AD9A 3NA9H 1OZUA 2TSAA 3JTTA 3PWLA 5EZIL 2O5YL 2CBPA 4U6VH 5C0GA 4LKCA 3UROR 5EF3A 3DRQB 4WFFE 5FHAL 1UQSB 5DZLA 1AGBA 5FYLH 5IEHA 2HFEB 4MMZC 4DKDC 2CDEA 5DI8A 5IGXL 2DLGA 5DMKA 1AZVA 1PU0A 4JPQA 4DKFH 4DVRH 4FD0A 4HCRA 2WZPA 2CA4A 4NQDB 4FQCH 4MYPA 4HAGA 1KYFA 2HZHA 2D2OA 3NMEA 4GKSA 4IRJD 1IGCH 3I6LE 4M43L 4YNYB 5DRZA 1OM3L 3SDXE 3B37A 5EN2B 3SIKA 5C97A 1ZWIB 3L5XH 2D31B 1HC1A 3IMTA 4Y5XB 3IMBA 4JO5A 3AREA 1VKXA 5CN3A 3M86A 5H4YA 2EUZA 4FMKA 5J06A 3K8KA 4WJ5A 3HHSA 1MHEB 5INDA 3NOIA 4ZX6A 4HBCH 3LNIA 4N2LA 2ODIA 2WVTA 4IS6A 5AW7B 2ZG2A 2WAHA 2MEJB 4Q9BA 1E4WH 1CB4A 4F9PA 1G7IA 2IDQA 3GSRB 3E8UL 2O5YH 4GFTB 3KPSA 1NGZA 5EZIH 2WBJB 5M94B 2HN7B 2GQHA 4WO4B 3EJPA 2DYPA 4YK4B 2AV7A 5FHAH 1CVSC 2GBTA 1ITCA 3HB3B 3IN0A 3IRPX 4B7IA 1URIA 4MDIA 5IGXH 1T0PB 4HEPA 4AL8L 3BFWA 1A3ZA 3OHXB 4AEHL 4YSSA 2X41A 4NI6A 1NCHA 3DVFA 1FGNL 2J8HA 3U46B 3H3BC 4M43H 3IJHA 3K0WA 5JQIB 3I6LD 1OM3H 3WNPA 2JQMA 5AUMA 1RPUA 4M8QB 1QUPA 5J1AA 3QPQC 5G4NA 1KXQA 1E6OH 3RIKA 1CWVA 3OZ9L 3LEXA 3OKKB 1TYRA 3FU7B 4Y4HD 4UV7L 3W1ZA 2CH8A 1N8OE 2NXZC 2XV2A 5SWSE 25C8L 3CLWA 3UAEA 2ZONA 5EEVA 2G0KA 3A6BL 2L7JA 2FQEA 2VDPB 4BINA 2QQLH 2XG4B 3AG3B 3ABZA 3MX0A 4V11A 3OKMA 2E59A 4KFMA 4NDMA 3E8UH 4BFKA 3KCPA 4QLRA 3ARBA 4J3OG 1QRND 2EXTA 2APFA 2G3ZA 1U3HB 4N2BA 3BPOC 5DWUL 1Q8MA 2BIIA 5E2VL 5SX4I 5D7LE 4AEHH 3DSNB 4XVJL 3NJFA 3WHXB 2YQ2A 4YE4H 4Y2NA 1OAZL 2G2PA 5HDOA 2AXWA 2A9CA 3TBTA 2X38A 3S96B 3L8QA 4UV7H 2F1EA 4K7PL 25C8H 3MZTA 4L8BB 4PU2A 4AW4A 3OGOE 2GYSA 4GRLD 4L9LC 4Y88A 2YJQA 2ZAHA 4YHIA 5GS1B 2GFBB 4N0FB 1SYSA 2OL3L 1YNKL 3MLYL 4FYSA 4XP4L 3FU6A 1HILB 5EOTB 1GZHC 1E4XH 5DWUH 3ARWA 3RLSA 2ZXEB 2B4CL 4HFWA 1S7VB 5D7LD 4KDVA 3GJFB 4UMGA 4GMTL 4FQXA 1JCKA 4XVJH 2NR6C 4IRJB 4MA3A 1OAZH 3OKEB 4P05A 4D9LH 1AANA 3SE3A 4PV8A 4NO0D 4N5ED 1NEZA 1F58L 3L7EB 3QIUA 1FNAA 1OCZB 3KLAA 3CZFB 4K7PH 3SQBB 3UZQA 2R2BA 1A8ZA 1YQVL 3U9UB 2IPKA 4LL1A 1W80A 1Q9OA 4XZUB 2OL3H 2CKBL 1HOCA 1VFOA 1YNKH 3MLYH 3Q13A 4U3CA 3TS8A 3C2AL 5CD3A 4HZLB 3NCJL 3MYJA 3BO8A 2IDSA 3HBPA 3QT2A 2B5IC 3VFRA 2E8YA 2JJUA 4DP8X 1A5FL 2B4CH 3DX1A 4RVBA 5J4MA 1KN2L 5L4FA 4RH4A 3IF1B 1YUHA 3STZA 2EEBA 3CFJB 4JFFE 4ONGL 2XN9D 3K2MC 4QO1B 2V2WA 3ZL1A 4J8QA 4CC4A 2JXMB 4DEPC 2HG5B 2WYIA 1LO0H 1SFHA 1BZ8A 5FV1L 4PLJD 3TO4D 4Y4HB 1G1OA 3MRRA 1CPUA 2BINA 3BCDA 3FN9A 4NRZB 5A2KH 1DVFC 4Z7VE 1DQQB 2BOCB 2WJ7A 1CT8B 2A3TA 4LIQL 1N4XL 5CJOL 2CKBH 4W9DC 4XTRD 1U21A 2UVEA 3AJ7A 3LHAA 3OGCB 3K1KC 5ACZA 1QRNB 2C1OA 3NCJH 2G5BA 1K5WA 4D9QD 3VRJA 4AGNA 1AGEA 3PP3K 2V4LA 4X98A 3WDJA 2J12B 4LOUD 1A5FH 4BXVA 1A6VL 1KN2H 4KO6A 2RIKA 3QUZA 4UBDC 1Q0XL 1HWGB 3ZN6A 2WMPB 4LEOA 4XO3A 1A8JH 1Z2KA 4JFFD 3EW3B 2X1WL 5EIIG 2GIYA 4HKZA 3DBSA 3PV6B 3QRLA 2V2XA 4ETQA 3SGJC 1TMQA 1AS7A 3LNGA 2XJKA 3CVDA 3VE0A 2XPGB 1P0SE 4G5ZL 2BNRA 2JNZA 4YL4A 3MQIA 1FC2D 5A16B 1MFMA 1IL1B 2UYLB 3JV5A 5FW8A 3A4DA 2UY7B 3L5IA 3NCEB 4GRLB 3SB3A 1ZLEA 1VCBC 3N50A 5GGRY 3PDGA 4H1LB 4LIQH 1V3LA 2FSDA 3R1GH 1N4XH 5CJOH 3KPOA 3BVNA 1KULA 5D9SA 1GA2A 2IOOA 3SDCA 4ILDA 3APFA 3DROA 1WZLA 3W39A 3BAXA 5CSGA 3HMXL 3OWEA 3ALXA 3PV7A 2CIKB 2R83A 1HK6A 1AIFA 2ZJSL 4NO5A 1XAKA 1Q0XH 2A9ML 4U6YA 4M4RA 5D7LB 3VXQB 5I9QC 1U8NB 5I6NA 1S9YB 2LV4A 4Z7AA 1DJHA 2H3KA 1JS4A 1XL4A 4X7TA 4G83A 4NO0B 1E6JL 3CBRA 4LARL 5TE7H 4N2GA 4ORGB 4C83B 3QCUH 2VAAB 3TC9A 1ONQA 2XICA 4P4KD 1CFBA 3OBAA 4YWGL 4HVBA 3DPDA 5A2AA 4P9HC 1TVHB 2LFGA 3WIHL 1KMGA 3SQRA 4G43B 2BVPB 2W60A 2WIIA 4Z95L 5CEXB 2YLKA 4HH9A 3UO1L 4TTDC 3HMXH 2ZCHL 4DKEH 1QUNA 5E08H 3P3YA 3TN0A 2VDOB 5C0EB 1AGFA 2ZJSH 1EK3A 2OCCB 5ICZB 1NKRA 5JTWA 2YKLL 1J9RA 3EGDB 3QUXD 5ESVB 3L7FA 2XN9B 3PL6C 1I4FB 4JDEA 4ES8A 3ROLA 1HHKA 4DP2X 2IEPA 2JIXA 3CFBA 5FUCE 4LARH 4HH8A 4MAYA 4AXWA 3WFEL 2EDEA 1PY9A 1D5ZA 2BVEA 2N56A 4DGIL 5D2LE 1OGAE 3PNRB 1FRGH 2WOYA 5F0PB 4JK0D 1CTMA 3WIHH 1NAMH 4F7EA 1BYNA 3S6CA 1M71A 3Q1EA 2R15A 4Z95H 2JSFA 2NSXA 4IKKA 1Q9LA 2CG9X 4J3OC 4YC2B 2YQ3A 2A6DB 2H1XA 2VL5A 1NQBA 3SKNA 4UAOC 3HS0B 5D1ZA 1XGYH 4EIZC 4TVSa 2VM3A 2YRLA 5DTFA 2WSPA 2Q76B 4U6HA 2YKLH 4HJIA 5TDOA 4JFFB 1F11B 5F7DB 2ADGB 2VSMB 3FH7A 1LDPL 2IAMC 3SE8L 4E9TA 2YPVL 2UWEF 1CMOA 1NJ9B 1N19A 5B38A 3E38A 2DMGA 4U1HA 3CXFA 4Q74A 2ZNXA 1AGCB 4DGIH 5AB2A 5HDWA 5EU3A 1E28A 1GOFA 3VFNA 3TEWA 3PWUA 3LB6D 43CAA 4LNRB 4Z7VB 2VDML 2DWEA 4J2XA 3MZGB 1ZLSL 5F9AC 1X5JA 1KIQB 2IPUK 3ZUNC 2A9NH 3VSUA 4JQVC 2VDKH 4XXDA 5BVPL 1A64A 5HI4C 1CFSB 1JGEA 3AU1B 4D0BA 2K8QA 1WWBX 3HBGA 1T66D 3OMNB 1ED3B 3RI5F 5G2NA 1RH8A 4FOMA 5FYJD 2CALA 4OW6A 1MZZA 4YMPA 2EYRB 5B1JC 5F7KC 3NABL 1P4UA 1LDPH 3SE8H 1WAPA 2OPCA 1QATA 2YPVH 4IJ3C 4P46A 5B3NA 5IP4A 1X6NA 1GSKA 4Z5RB 1I9RH 2YUZA 2KZBA 3Q7JA 3FQRA 1BQKA 5FUOL 5IIEA 4HIQA 2UXGA 3O6FD 3NIFE 2XRAH 4M7JL 3T65B 1IGJB 4TLSA 5LO7A 2Z8WC 4PYGA 3T77A 4KMTH 2HCZX 3ZBMA 3U7YL 3VFMB 5JHLA 1S78D 2CHDA 3PHQA 1HYSC 2VDMH 4L1BA 3LD8B 4K3JH 3SOTA 4EZLA 4QGTA 2AQ3A 1ZLSH 4OKVB 2DJ4A 4ZD3L 5D96C 4NPYB 4U1IB 2ZQKA 5L88L 2NXYD 5BVPH 4DGWC 3FFCD 4N5UA 2JK5B 4Q8BA 5JW5B 3N0PB 6CGTA 2BW4A 2ZSWA 5JR1L 1A2YB 2ICEA 3MRKB 5I5JA 3DOIA 3DHJA 3TIDB 5J56B 3ULUD 4HJSA 5E6RB 3CVCA 1MI5E 4K9EH 2HB0A 2AW2A 2JWYA 4OUOA 4NAJA 3QUXB 2XZCL 4X7SL 2JF1A 1MQKL 1D5MA 1UXMA 1QKZL 1H8OA 2WWMD 1O0VA 4J23A 1BIHA 1UCTA 3JWNG 1R24A 1NGPL 1NWOA 1R3HA 1WC7A 3Q5TA 4AUJA 4ZQKB 3CC1A 5FUOH 3EYSL 3SCMB 3ROOA 3TEZA 3OKDB 4AGPA 4M7JH 4XVSL 3RNKB 5KSVB 1RUQH 4TV3A 4XBPB 2HVKB 1DQIA 2QKIA 5CFAA 1F90L 3UEQA 1W16A 1E7UA 5D7IE 5F0JB 5LDUA 3TT1L 1GGYA 4EDWL 4XI5C 3EGXA 3NESA 4OY9A 4UINL 4ZD3H 1QBLL 1DQLL 5MEND 3S3DB 5L88H 2WK2A 1FHGA 2LTQB 1EH9A 4HX1A 4O9HH 3PWNA 3R7RA 2FBJL 3B43A 3WIAA 2HLAA 2GUOB 3O0RL 5I73C 1WBYA 3VRLE 4DHLA 4AM0Q 2WN2A 5IOPB 1CLYL 1QI5A 1HFUA 3FF8A 5HVFB 1G1KA 2B77A 1KG0A 4PW3A 2ED9A 4QRPA 5C0BE 5I1EH 4P5MB 4CBZA 2ZXQA 3E6FB 2PNDA 2H2PD 4W70A 5TE4L 4X7SH 3GHBL 1MQKH 4FI8A 3UYOD 3VGGA 1QKZH 1TENA 2C9SA 4DGUA 3SKMA 3P4NB 2MRYA 1NGPH 3L3OB 2CGYA 5E6ID 5GQBA 5IHLB 3EYSH 3UZEC 4OCWL 2EYTA 1ECYA 4NQUA 3KGSA 5TD4A 3BZFA 3QNXB 4OFDA 1S2EA 1BZ7B 2P80A 3ARYA 4JGJA 1J87A 4EUPH 2OK0L 5HGDA 3IGLA 1F90H 1RZKC 4GRWF 3T6WA 1HZHH 3DJTA 1LEKA 3TT1H 4DKTA 4EDWH 3IN2A 4GSRA 5DK0A 1EHXA 2RFXB 4Z7WE 2G2NA 2WWNA 3ZQ9A 1QBLH 3IWUA 4QHNB 5CFHA 2A73B 1DEEA 2YOAA 1JV2A 4UUJA 2Y5EA 3UPCA 3A22A 3RZCD 1TPXC 4PJ6A 1CLYH 4GKOA 1WA1X 4Y4KD 4QJ5B 4TLTA 2YA2A 3CHQA 1M57B 2KBGA 4QHUB 1IVTA 1DDHB 1EJ8A 3KPRA 3D4GA 3GHBH 4ODVL 2WXNA 1RLBA 3X1EA 1QSEA 1JMZA 1JF1B 4NJ9L 1G87A 1CL7I 2BHFA 3QQ4B 3DX8B 1ANUA 4FRWA 4GNKB 5C6TL 4AC4A 5D7JA 1DVTA 3POHA 2R23A 1QSZA 2XNAA 5CN1A 1WZMA 2OK0H 5I8KH 2VN6A 3GKWL 3VJ6A 4X2UA 2JKXA 2V5RA 1NGWA 3FCUB 5DRXB 2HRHA 3QPKA 3SD5A 1E8XA 3C8KA 3WXVL 3S7GA 4HJGA 2I24N 4P8QA 4UMSA 4OLYL 1M2VA 3CSPA 3EJSA 3NACH 1YEJH 2NXYB 2BX5A 5DHVH 3ABKB 3FFCB 5AVQB 1RK0B 4U31A 4UQ2A 1TJHH 1W72L 4EVNB 1TQUA 3FT2A 5LGHH 4R4FH 2FO4A 4NC1C 3KWTA 4MQ7B 1V10A 4LDEB 2FB4H 4Z7NB 4Y4FD 1I8KA 3BKYH 4I9WE 2XZQL 3FSWA 3ZRCC 2QADC 4ODVH 3ARFD 4BQ6A 3MJ9A 2FK9A 4Q7DA 5I28A 2VE6A 4NJ9H 5E8PA 4BFJA 4F8TA 1ZGLA 1JXKA 3ARGA 1DBJL 1ZCRA 3MRNB 4KV5E 1C5CL 5JMOC 4JREB 5D1QC 5BS0E 1RZKL 1H0DA 2EYSA 4Y9BA 4L9DA 5D6CA 5IKCB 3U82B 3NFNB 3GKWH 3JXAA 2F18A 2MQCA 4FP8H 1N26A 3VGBA 4GINA 3T2NH 1FQ9C 1SXBA 2IPTH 5D1XC 2X1QA 4GUCA 4BE6A 1O6SB 2APWA 5MENB 3VVVA 1MCWW 2Z31A 4M00A 2MNWA 4U3SA 1HL5A 3RL1A 4FLSA 3BEWA 1P2CB 3BP6A 4QTFA 3VGFA 1B9KA 1XL6A 3JBG7 1UWYA 5GGRB 1YMMA 2CHZA 2XZQH 2WLLA 1PLAA 4I9WD 1HXYB 5I5RA 4X99B 5E56A 2XQYA 4F7CA 3K91A 4IKNA 4CVXA 5E6IB 1C5CH 4GI8A 2CUMA 2B2XH 2CO1A 2EDHA 5BS0D 4JFYA 4XWGL 4PTTB 1NCGA 2CRIA 1MCPL 4LT7A 1JWUB 4AV0A 1OAXL 1X5MA 2YEVB 4D94A 1IEAB 5D7IB 5E9DD 4Y8AA 5LXGL 5AVSB 1PD6A 3FTUA 1SJMA 4LVNC 5DVPA 2JB6A 1ITBB 2MWCA 4AYID 2FTAA 3RZCB 3GMRB 3GSVA 2WO3B 3BFQG 4Y4KB 43C9B 4F58H 1Z66A 3S88L 5J7CC 1AS8A 1B0RB 2Z92B 1N18A 4Z78A 2EO7A 1EO8L 4NQSB 3MA7B 3MRFB 3SGKA 5JHBA 2ZXBA 3I2CL 3W11C 2IOIA 3MAWA 1SJXA 4I8DA 1KOAA 3K2KA 3NAAH 3BQUC 2Y2WA 3QJXA 4JLRB 4EF3A 3TJPA 3RVTD 4DO6A 4XWGH 4NKIL 1RMFL 3PGFL 3M7FB 4URKA 5E6SB 5E4EC 5K59E 1OAXH 4JHAL 2DM2A 4U0RB 3WY3A 2IBZX 4GEIA 1T2JA 4ZO7A 3FQ1A 4DPBX 3DJZA 4UILH 3K2IA 2KI6A 5IMMB 1JZEA 4XXCC 3AS2A 1THAA 5LG1A 5DMIL 1TQCB 2QLYA 4P2QA 5IBTH 3ZTEA 2ZCKL 3LKOB 1NFKA 1CDBA 3STLA 4N1CA 4Y4FB 2H4EA 1EO8H 3BPCB 2X2IA 3CMOL 5FOBA 3ARFB 1LO5B 1VACB 1KCWA 3GM0A 1S5HB 4KNQA 1N2RA 5HI5D 4FF9A 3JWNC 3ARDC 1HL4A 4S10A 4JO3L 1AO7A 1MF2L 4GSXA 1FZMB 4PW4A 5CCJA 2QVKA 4NKIH 4YSEA 3TVMD 5HHOE 5L2JB 4UNUA 1FVDA 1I7UA 5LGJA 5CBEA 2JCWA 4YZWA 5KJ7E 2PCYA 4XVOA 4IHOB 2J44A 3NBNA 1BZ9B 4GW1A 4W9JC 4QMEA 5HHNB 1N3NA 3JYBA 4LPUA 3U2SA 4PJGA 4JZJB 5I1IH 5FPIA 2Z7WA 4LP4A 3ZXAC 3W5MA 2RQ8A 4H25B 4O4YL 4YSTA 2YAFA 4HIJB 3X12B 3F7YB 1ICTA 1N67A 4HEME 2EDFA 2OQJB 2YC1B 3H4FA 4OV5A 3CMOH 3GTVA 4PRNB 5C9JA 4L4VD 3QFJE 4G59C 1RJZB 3NH7L 2W81C 5HDBE 2GTZA 1ADQA 2XKUA 3O3BB 1SJHB 4JO3H 1EEYA 1MF2H 4E5XB 1ET7A 1PG7L 5EZPA 3BMWA 4MHHI 5BS0B 3ATBA 1U41A 1KTKE 1AH1A 2CKNA 1IBHA 3W0WE 1E0OB 3MRLB 4TNEA 3UTQB 4QHKJ 2J2ZB