1ROCA

Crystal structure of the histone deposition protein asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
155
Chain Sequence
b'GASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-silencing protein 1
publication title Structure and function of the conserved core of histone deposition protein Asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, chaperone
total genus 26
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1rocA00
2CU9A 2IO5A 2Z3FA 2IIJA 4RRPM 5EIIG 4ZBJA 5BNXD 3AADB 1TEYA 2IDCA 5BO0D 1WG3A 2DZEA 5C3IA 1ROCA 2I32A 2Z34A 4EO5A 2YGVA 2HUEA
chains in the Genus database with same CATH superfamily
1WIUA 3FUEA 1LDPL 1WT5C 2G75A 2F53B 3AMKA 4QI3A 4OD3L 5E70A 5IHUL 3QDJA 4XPFH 1MEXL 4RZKA 3SBQA 1DTUA 1ADQA 1G7JB 5E8NA 1MOEA 1OD7A 2YBRB 4X7SL 2Z7UA 2WQXA 1QTSA 1P4IL 3QFJA 5BJTB 1QABA 4QRTA 2OR9H 1G7HB 3UPAA 3T0ED 1I7RA 1B2YA 1H3UA 1NJ9A 2BVOA 3GLAA 5JHDA 4OZGB 2XFXB 3I50L 4GSDL 4K71C 4L8SC 4WWPA 4KO7A 5EORL 3WCYA 5B7EA 4AE1A 5T1LA 1WISA 3BISA 2EXYC 1VSCA 5K5YA 2ZCLL 2HT2D 4XP1H 1AKJB 3SBRA 4I77H 4HOMA 1ZTXH 5J1AA 2UXTA 2KYIA 3MRFA 3MXWL 3OV6A 4KNSA 1BIHA 2CRIA 5JOEA 4GG8A 1D5MB 1ZK9A 5HY9A 1H6FA 4EOWL 1P6AB 4R90H 1BEXA 2DTMH 5GS2D 1G1YA 4K71B 4L8SB 3Q13A 3ZZQA 4LPVA 5GPRA 3PWUB 3K71A 4P3DB 2JLPA 1WF5A 3RFZA 2JCCF 4U1HA 1CXKA 3BKMH 1TQTA 3FTGB 3QEGH 1JGUH 5DR5L 4XXDA 1UZ8A 6TAAA 5JTWA 5FUCE 1U8JB 3WIHH 4XXWA 1P5VB 1WBXA 2W38A 1QFWH 2K9FB 4J3BA 3IU3A 1IAKB 5ADOL 4OFYA 4GAFB 2XT1B 1J8HD 4MRBA 4ZS6D 1NWOA 4PGDB 3QJXA 2CGRL 4U31A 2IH1B 4LDLB 5E1QA 2VM3A 3PXLA 2FX7H 4I18A 4S1DC 1BM3L 5C2UB 3TJEH 2IBZY 5BRZB 5KSAD 4M7KL 3FTWA 2VMJA 4LLMA 1AI1H 2AAAA 3I6LE 4X9FA 5DSCB 1V5JA 3BSZH 2F9BT 3ASNB 2CJUL 5DJAB 3GEFA 2F54E 3CD4A 1SRDA 2ISDA 2ESVE 5CS7A 2BW4A 2BJMH 4F2FA 4HXBH 5EIIG 2QFPA 1P1VA 2CBQA 3LNEA 1AIZA 3K2UL 2YRBA 4N0FA 3PHOB 4U1NB 4B53A 2ZTBA 3QJZA 2MSPA 5EC2B 4ERSL 5EZJA 4HMEA 3QI9D 1JWUB 4XN7A 1II4E 4X5WB 3T6QC 1EUUA 3VMNA 1H15A 2R69A 3DX8B 1U8OB 4IMKA 5C0DA 3H42H 1N5YL 1MHEB 2DY2A 1FRGH 1T89C 4NWUH 3UTTD 1X9LA 1U8IB 3UH8A 3E1F1 2UZPA 1Z3RA 5JHAA 4JZOB 1IJ9A 4RMWA 3L8QA 4YUEH 3BKCH 3I75B 1AP2B 2CUMA 4N25A 1IGYA 1IEAA 1E4HA 1O6VA 2ORBL 1X7QB 2B2XH 4K8RL 4OLWH 4TSBH 5IZ7A 4MB5A 4NZUH 4JFEA 3RWEA 3VFOA 1Q1PA 3MBWB 1KB9K 1MCKA 1WZ1L 3SOBL 4H0LC 1JJUA 2VLKB 3QDGD 1E40A 5SWSA 1T2XA 4L4VD 5D70L 3VFGH 3HN8A 2JIXB 5MENB 3LCYA 3FO1A 1ZTMA 1TJXA 4UBDC 5EDSA 1MIML 4NB7A 2C9PA 1A0QH 4FA6A 5JW4R 3QRFM 4AVKA 1R6VA 3PJNA 5E6SB 5EA0L 4ZAKD 4HFWA 5T5NF 4NHUB 4JN1H 4FG6C 5EBGA 4AKOA 2FBRA 2VMEA 3Q2LA 1TFHA 1J5HA 2G3ZA 4XP9L 3FQ2A 4GMSL 1EHNA 4PJHB 4UI2A 1EO8H 1CDIA 2OI9C 2JXMA 3DSNA 1UH3A 2XNAB 3GSNA 5GHWH 5FB8A 4Z8FL 2D9QB 2XQYG 4HK3N 4E41E 3Q05A 5BVJA 35C8L 3WSQL 2R2EB 1A8ZA 1AY1H 1NCJA 4LOFA 4NQSA 4DJMA 5FFGA 3HE7D 1DUYB 2EC9T 1IAIH 5T1KD 3S96B 5HHOD 3DYMA 4F80A 3K1KC 3NH7H 2OI9B 4AGNA 1Q9KB 1U30A 4N9GB 4YFLF 3IGAB 2GYSA 2L4OA 4MLSA 3Q0HA 4HJJH 4JJ5B 4PJEF 3FU7A 4BKLA 2I24N 3OJMB 3FONB 1Q1JH 5I1CL 3IFNL 5C07B 3RILA 1CCZA 2H6UA 3DUSA 3QEUB 3SGKC 3UZEA 4A6YA 2BZDA 2D31A 4B9IA 4U1IB 2ZKYA 1I75A 1NOLA 1A9EA 1TTRA 1XT5A 1QSEE 3B6SB 3UDWA 3UERA 4UQ3B 7PCYA 4HWNA 4YVNA 1KBGH 1S4IA 3I3EA 4NQDD 1L9OA 3WLBB 4LESA 4FNUA 1CGVA 4B9ZA 4G43A 4O02H 3SJVE 3IXAB 1D9KD 3EZJB 4GXUN 2CDEA 3QO1A 1MCPL 3MZTA 3WDHA 1JXKA 4LSVH 4X4XB 3GRWA 5EN2A 1LEKA 1BX2A 3VMOA 2AJSH 1IBHA 1FNHA 2X4PB 1MZZA 1CL7L 4L9DA 3FCSB 2C4XA 1XB8A 2V7NB 5JZ7C 2YA0A 4U6XA 4YSEA 1U4FA 5I23A 1PLCA 1JTPA 1DZ0A 1T3FA 2XHNA 1NCIA 4OIIL 3ZZLA 2GTQA 5IMMA 5IT2L 5I6LA 1TJHH 4XBPA 3HC0A 2GJZB 1P6FA 4G80B 2CGZA 3KWTA 2K45A 2W0PA 4OJYA 1TU2A 5K39B 1MF2L 2E4FA 2NNXA 4IYKA 2R23A 2AVFA 5D7IB 5E2TH 4GKOA 1YMHA 3PY9A 4OGAC 1G87A 4HWZA 2ADFL 4HH9B 5L8JB 3ARBC 3ME0A 1ZLDA 2ADYA 3QXTA 5FUZH 2CGYA 1C7SA 4OLVL 3UTZB 4OZGF 4N6RA 3VYOA 4IU3B 4W9GC 3ARDC 2FYYB 1LK2A 2FJUB 2XQYK 1CICD 1AJ7H 3ES6A 4LL1A 4GKZB 3GM0A 4DGVH 2LW3A 3GMRB 3P30L 2FQFA 2VXQH 2HN7A 4BDVA 3L45A 5HXMA 2IMMA 2VAAB 3AQXA 3KYAA 4DUXA 1WS8A 3NABH 1YEKH 3ARBB 4M6AA 3HUJE 3AAZB 5EOQL 5LB1A 4NO3B 3GS7A 4DN4H 2NW3B 3I6KA 3WGUB 4ANVA 4OKDA 4KRLB 1FI8C 3ARDB 1PTZA 2IAMD 4WSJA 1ZVNA 4QJ3B 3TONA 5H8DA 4G8AC 4PJIE 3UTSA 4PUBH 1DEDA 4HJIA 1RJZB 1F8TL 3HHMA 3MLRH 4B7IA 1E9QA 4U3XA 3NK3A 5DUPL 4OKVA 3MRJB 4FQXD 4JANA 3T4AC 5IESH 2J20A 2Y0SA 3KPRB 3B1UA 3RBSA 3VTMA 4MNGE 4UTBH 3FOLA 3HCVB 4E42B 2WQSA 1B2WL 1U8QB 3ULUH 1OB1A 3GZOA 4B60A 2Q0ZX 3VFNB 2LVCA 3WKMH 4XPGL 4LSQH 2CUAA 3ZL2A 1JDCA 3QXUA 3EG9B 2B5IC 1EZLA 3T4AB 2VITB 4RZCA 4WK2B 4LRNH 1NZRA 1T1ZA 4K7FA 5TTRA 4MKTA 5C0RL 1N5AA 4AQAA 3CU1A 5CMAA 5I0YA 5D55A 4ANUA 4UNVA 4UU9B 1O9WA 1MFUA 4P2RD 5IG7B 3EFFB 3T65A 2B5IB 3MU3A 2ZOKB 2E7LC 4WI7A 2CE6A 5FGBA 3KHOA 3GUTB 2LAAA 4GBXD 1WAAA 4YLBA 1JPTL 1CI3M 2ZXWB 2WLIB 2HVKA 1CDYA 4PCYA 2CA3A 4KNQA 5FM5M 2YQGA 3GBLA 3AS0A 3REVA 2R2BA 2DMGA 4JY4B 1O6SB 1QSFD 5F44A 3LXCA 2B0SL 1VENA 1Y6KR 2YD8A 3TVMC 2ZQKA 3QWQB 4RGNC 3QDMA 2VDOH 4XMPL 3CVBA 1C5CL 4LCCA 4KITB 5A6LA 1BEYL 1DR9A 3S8WA 3WEBA 1RVFH 4PP2A 3FB7B 2XWXA 4IOSA 4Y1AB 5GZOA 1OGSA 3UIYA 1OAZH 3JWDH 5K1NA 5T3ZL 3CCHA 4OZ4A 3MROB 3TVMB 5DQ9B 3DK2A 2DQEH 3FFCB 4RGNB 1J9QA 5DTFB 2BSED 4JR9H 1BOGA 4ODVL 4QRRE 1DVZA 5EOTA 5KYYA 2OJZH 4R0LA 4U6YA 3DXAA 1CD1A 3BVNA 3ZKSD 3LH2L 1ZS8A 4H8WL 3VE0B 1SHSA 3PL6C 1CZ8L 3QULA 4HKXA 2OL3L 1B0RA 4PRHE 4ZX3A 2RB8A 2V9RA 3VSQA 3RY4A 1B88A 4PP1C 1NCCL 1U8HB 4G9FA 4PJHF 1CD8A 1VZGA 2E27L 3EO0B 1QR1B 2F08A 5IREA 2Z65C 5D5MB 2IADB 5HVWA 3N91A 2H32A 4OT1L 4XHQA 3TGXA 1MPAL 5H4YA 3MGOB 4HJ0D 4ZS7H 2VO5A 4OJCA 1JYXA 4KJWD 1EZVX 3PL6B 5IUCA 1XQ4A 4ZRGA 5T1DL 5AVZB 1OPOA 4QGYA 1DBMH 4NO0A 4NRYA 4NQEB 5DK3A 2DMHA 1EQWA 2GEEA 4ZUUB 4CBZA 4ZQKA 4A2DA 3E6HB 5KG9A 5FFOA 1IBFA 4RGOL 2XV2A 4WFEE 5F9JA 2IVFC 1XF3A 2D03H 5D1ZC 3U9UA 2WUBL 3TBWB 3TBYA 1CFBA 3FN0H 4ZYKA 5BW7C 3DOSB 2OYPA 3VXOA 3T77A 1QSZA 1VEMA 4RCAA 1N6VA 4QYOA 2JV6A 4M4RB 2APSA 1PL3A 2IDTA 1YY8B 2NXYC 3TASA 3UC0L 4AZ8A 1KB5B 5E2VH 5SWQA 1VB9A 2R9HC 3QH3A 5CP7B 5D1ZB 4HBCL 1DVXA 3SE8H 4V1DE 3CDYA 5JO5B 1VESA 2JJSC 5KTEL 5C0AD 2WXKA 3QIWA 1O6TA 1PMYA 1S5IH 3VMPA 4QJ5B 1CDCA 5IEKA 1FE8H 2NXYB 1V7NL 2ITDA 4AEIH 5EWIH 3NZSA 2J55A 4QRPD 3HTLX 4M6OH 4NCDA 3WJLA 3TJPA 1SEBB 3BWZA 2AXJA 4N1EA 1E0OB 2P45B 3BT2L 2FZ3A 4G8IA 5IMOB 1LEIA 3OR6B 3RUGA 2DWEA 4QGTA 1LNUA 3VNZA 5CFHA 5HYJB 2WZAA 3II3A 4H5SB 4AEEA 5I30H 1A4AA 5AL0A 2VLLB 4Z3GA 4NZJA 4AW4A 4LFHD 1BZ8A 1F56A 4ZFOB 1EMTL 1VLXA 5ACLA 3LEXB 1P7KA 1TVBA 5MHSE 3RNKA 1MLCA 4AUUA 3OQ3B 2XVLA 1A4JA 2FNWA 3PJSA 3FQXB 4NQCA 4PG9A 2L7QA 4ZTPH 5JW4M 3P0VL 1N12A 4AG4L 5D7IF 1K6QL 1OAYH 5GGUB 5IVOA 1CYWA 1U3HC 3NOIA 2JKJA 2GUYA 3RVUD 4P4RA 1F3DJ 1BA9A 4EF3A 3IJEA 3BP6B 2N7AA 4OZFG 3C8HA 3D30A 2DQUL 2H2SC 3U46B 1YJDH 2TRHA 1E4JA 1HL4A 1UCBH 3IM1A 3WIAA 4D7PA 2BCMA 3BPNC 3HAEH 1UVQB 2K0RA 3ZKQD 1U3HB 4YGVB 3D25A 3D4GA 4OF6A 5FV1L 1UACL 2J4WL 1NDGB 3CSPA 3C60A 3OKEA 4G7YH 1TYRA 2X4SB 4WI6A 4F7MB 1MFVA 5FECB 1T1WB 5AWNH 1UATA 1BAGA 3HNTH 5DK2B 5EZIH 1N8ZA 1NGXA 1IO4C 3CG8A 4PU2A 2HX7A 3BPNB 5G5DB 2I25N 1EIBA 3HE6D 4FFYH 1I8IA 1J0IA 3IU4L 2B15A 4LSTH 1PZAA 4JQIA 2AQQA 2WY3B 3ELAT 4GAJH 1RFDL 1DEEB 1HNYA 3DSFL 1FJ1A 4MKMA 1TLKA 3MLUL 3QCUL 3QIBC 5CJBA 5F9DC 3MJGX 4ILDA 1IQDB 1OEZW 1BVNP 4U1JB 1F4HA 3M7OA 5C0CD 4QEGA 4BA0A 2W8CA 4I48B 1AXSA 4X6DA 4X7DC 3QIBB 1MCHA 2D7TL 1JPFA 1MFCH 4RDBA 4TSAL 4LU5L 3JT0A 4WI4A 4QRQB 1GKOA 1RZGB 4PJCB 2XA8L 2ADGA 1KV3A 1M3JA 3H7LA 2WO2B 1QBML 1FL6B 4PJXA 4BH8B 4OU3A 3LXBA 3N41B 2BNRA 5ITFA 2VJ8A 1TUPA 1LGVA 1CFQA 5ITBL 1WWAX 3G6JB 2VZTA 5IY5B 4JFFE 1F42A 2VERA 5KJRH 2WZ5A 3P40A 4ABUA 2WK2A 4FNLH 4NQTA 4O58L 2EVJA 3BUYA 4NIKB 4DHLA 1RUKL 4QMEA 4G1EB 1CU4H 2XCMC 1V3KA 4TRPH 3UEZA 3PHQA 3WDIA 4H2CA 2FL5B 3PPEA 3BD5A 1RZQA 1KPVA 1RZKL 1EAPB 3R06A 3GM8A 5FYJD 3Q3GA 3FB8B 2FTAA 4N5UA 3QPKA 3O8XD 3CFEA 5D93C 1ND0B 1FWXA 4WJ5B 4RA0C 4MBRA 3WFBL 5IJVB 4M61A 4PMFA 4PWJA 2HP4A 5IHZA 3LN4A 3SQBB 4HGWA 4PD4K 3RX8A 4NNXB 1E27B 1CDHA 1Q94A 3P1VA 3F65A 2ILLA 2P5EA 4KX9A 1CGUA 1DJXA 2WXIA 3TCLA 2DJSA 2NTFB 2C3XA 1J0YA 4H40A 4W68A 4FTVE 3OLDA 4KZCA 5D93B 1UC6A 5F7DA 2B9AA 4X6CA 3U0WH 2J8UB 1KIUB 3SEPA 3SY0A 2WMPA 4K9EC 1YEHL 1MWAL 1MZYA 1VFAA 5AVTB 4X6FB 1QO3A 3RL1A 3TA3A 1FYTE 1I1AA 3OKLA 4XP6H 3N50A 1AOHA 1T22B 1FNAA 2WXNA 3SPJA 1IFHL 2EDMA 4GIPD 3A5VA 2WXLA 1JNNH 2XC8A 4MDIA 1TZGH 4K5NA 1EHLH 5GGTL 2WIIB 3MLTA 5JIKA 3DNKA 2UYLA 3OG4B 2X7LB 3QUGA 3RWCB 4RMUA 3ALWA 4HEMA 4B27A 1DBKH 3HNSL 3D9AL 4UQBA 2X2JA 4N8UA 3KM1A 3I9GL 1SY6A 1A3ZA 1AO7B 2BSTA 3L4CA 4G70B 3DTUB 4R2GD 1AQKH 4E9TA 3L3GB 3FUIA 1N19A 2XWBB 3HC4H 1GC1L 4QLWA 2QZ5A 3IKCB 3VFUB 1A14H 2J2ZA 2J56A 3DJZA 4PWKA 5BS0B 3FKUS 1YYMH 3ZSTA 1THAA 1T5XA 4S1SL 4YFLI 5DRNB 2NZ9D 4MA7H 4AH2A 1YG9A 3L3KB 2HJFB 1Q0YH 5AKRA 3BPCA 3EYSL 4G9DB 5IB4A 1YUKB 3SO5A 2XZAH 4JY5L 3O2DL 1JHTA 3W9DA 1T1YA 3CHSA 5HDRA 4MXVE 3BVTA 1YNTB 4S11A 5KW9H 1YN6A 4K3JH 5I15L 1KBKA 4X0NA 2PCPB 2ZXQA 3BAEH 1UH2A 1Q9LA 2FDBP 5EU3B 5FCUL 4MJID 4Y2DD 5IROD 3PGDB 5HJ3B 2A9ML 3NCYP 5T5FH 4YDVA 3SPHA 4LQFL 3RHWF 1VCAA 4NKMB 1MFDH 4PBWD 2AERT 3MNMA 1OTTD 3TBCA 4JDTL 5DI8A 2NNRA 2VAJA 1BMWA 3N04A 5HGDA 3WY3A 3SYQA 4DTGL 4PJ5D 2YHGA 1NKRA 4OCYL 5SX5H 3Q8FA 1CDUA 1FPTH 4JFDD 3FQNA 1ECZA 2Q76A 5I8OH 1H3WM 1LTXA 1VA9A 5DEFA 4MYPA 3MBXL 5IMLB 2I9LB 2CM5A 4GG6B 4ZMAT 4ZXBA 5I8KH 4N2FA 5I76B 3NJIA 4TNGA 1WLHA 2ZWYA 4Z23A 1E9PB 4HX1A 1FF5A 3CSGA 4Y2NA 4XN5A 3EJSA 5JW4N 5L6YH 4AQOA 5FA3B 5D7LD 3PYCA 4GW5B 5C0EB 1HZHH 3I9IA 4KDTA 3UGUA 1XGPA 2WOYA 1J5IA 3CZFB 1JK8B 2PYFA 3U30C 1X9QA 2Y07H 1KTRL 4GXFA 3HG2A 3E3QC 4U6TA 3D3VD 5CBEA 4A67A 1G0YR 4C83A 5J6SA 5C2BH 2GJ6E 2YD2A 3R4DA 2QTEA 3E6FA 5BZXA 3QQNA 2DDQL 3MC0A 3SE4A 5L8LB 3FSOA 3NEOA 4NRZB 3MMEB 4JW3A 4L4VE 4ZUWB 2AHIA 4ADIA 2C8NA 2H3NB 3U30B 4HETA 2WXRA 4OZIA 1WZKA 5IB3A 1THCA 5IVZB 3EFDH 4BEIA 1PW3A 5I9QC 1GTFA 2ZAGA 4ALAH 4MAYC 2PW2A 4TVPH 2BZ7A 5IOPA 5D4HA 3MV7E 1JOIA 1ROCA 4JREC 3QFJE 1F58L 5KVFL 3SDCD 4HCFA 5IBLD 1DDTA 5CINH 3BH8A 2EIDA 1OSZB 5JA8B 4WWID 5I9QB 3VSVA 3CK0H 4N8PA 2F19L 2RFXB 4KXBA 4R4ND 5DDHA 1A9BB 4MAYB 1XIWD 1GXEA 3WXWH 2A3TA 2A77H 4PH8A 1S9WB 2J1XA 3ZRCC 2YGPA 5C0BA 1AZNA 3S8FB 1N2RB 2G2PA 3GMOB 4JREB 4MSWB 5DO8A 5HYQB 3HKZA 4FA7B 4UILL 2XWTB 3FOMA 1JFQL 1UKQA 4PJCF 1KGUA 2QT6A 2CCWA 5ESQA 4ZX4A 3VD2A 3KPSA 1A6PA 5I2IB 3NJLA 4Y4FD 4OTXH 3MV9B 4FS0A 4DVBA 5DS1A 1U8NB 3FZUD 4MDJB 5ANMA 2YPLD 1Y6MR 3WENA 3VQMA 2QKSA 4S0HA 4M5ZH 3N41F 4ESKA 4CKQA 3G6JF 3CH1A 2AQNA 3VXUA 4DPBX 4X5XA 4R4BA 1H9VA 1RZIA 3VI4F 4ZMWA 4FHBD 1TTBA 3B3BA 1QVOB 3H6JA 4A7GA 4WWNA 4YHYB 1MHHB 3QWRD 4YSQA 4WV1C 3ARZA 3IN2A 4L4TE 4YE4H 2EXWC 3UIZA 3BLKA 4FMVA 4XBEL 3KXFE 3DV6A 2XPGB 2X41A 3H85A 4BRVA 5K9JH 3U4EA 1QBLL 5A2IH 4XNYL 2H9GB 1JNJA 5PCYA 3HC2A 4QRUB 3QO0B 3RVVC 1CLOL 2O26U 3UBXA 3W0WB 1NEUA 2J43A 1GCYA 5KUKA 4WV1B 5HJBA 1SOXA 4MFHA 3WMSA 4DW2L 4F33B 1ET5A 1QUNB 1OCWH 5K9KA 5ICZA 3T8MA 4RAHA 1M1XA 5DA4A 1A6AA 2XG4B 2CDFA 3D07A 5D6CB 2D7PA 2GIXA 2E7CA 3QW9A 2KI6A 5I1IH 1FC2D 4D3CH 2J8UF 2Y24A 1SJXA 5EBLA 4WGVB 4MJ6B 4QKXB 1GW6A 1R5VB 3Q1EA 3KEHA 5JW4Q 2A6KA 3EF7A 4MWFA 1I7TA 1VFUA 2BFGA 3FTUA 3PP4L 5GISL 4DOHE 1KCBA 5F2FA 1C16B 4A2MA 4BKTC 1KUMA 5MERB 3SGDH 1HILB 3EH4B 4KHTH 2DI9A 4UZGA 3WIFA 4YHNB 1OAUH 1ZHKA 2KUTA 3VXRA 1DYZA 3L4TA 3HNVL 5F6IC 5FGRA 5ADPL 3P54A 4JRXA 3NRQA 1BG1A 4UT9A 2VDPL 2ARJQ 3QJHA 1KELH 2DQDH 3LMJL 4FFVC 4P2QA 4HS3A 1ADQH 4KC3B 3IFOA 1QWUA 4X99B 2JNZA 4YL9A 2Z31C 1FNEA 3FT1A 2FJFA 2R1WB 4WTZA 2B1OA 2P4AB 3L3OC 3UL4A 2TSAA 2XX1A 5F6IB 4ONOA 4XE0A 1G43A 4NUQA 2A9AA 1TVHB 3HW7A 5KYUB 2PF6A 1IUZA 5CIPB 2WCPA 3V4PH 3D8MA 2Z31B 3R4RA 2Q2LA 1ZT7A 4PRIE 4JX0A 2WIMA 4S2SA 4TLUA 3DGGB 3VXME 4V2BA 3DKHA 3L3OB 2Z64C 2UXVA 2JB6A 5EO0B 3TIEA 1A21A 5D4QA 3IRPX 2N1TE 5DVLA 2QMKA 5CP3H 4KZDL 1KF9B 1BFTA 1M6UA 4QXVA 4X4ME 3MCG1 3MNWA 5T3XL 1SJHA 3UAJD 4LARH 3WYRA 1IC4H 2OMTA 1O0VA 3I6GA 1D5IH 4LIQH 4DO6A 5D7JA 5I5RA 1CFTB 3CMGA 5I66B 1ZV2A 3LQZB 3LIZL 1QRNB 3JT2A 3L2NA 2D2OA 1CE1L 4UTAH 4XPHL 4Y16D 4KHXL 1INQA 2YAQA 4GXVH 3W3BA 4XZUA 4K15A 4CSSA 1TETH 2X9YA 5IFHH 4PGCB 5E8PB 4XCCH 1D7DA 1QFOA 5J12C 5CZRA 1U91B 1ASOA 3V10A 3U6XA 1UWGH 2IBBA 3CVHA 4Y1SA 2BNQD 5DQJB 3QRGH 2YPVA 1ZLWK 4BSVA 4XVJH 4GG6F 3AVEA 2FHCA 1AGBB 1X5YA 3ZGIA 2A6DA 3HBQA 2DQGH 5JMRA 5I6PA 5J12B 1KG0B 2D73A 1TTGA 3WMPA 3IFPA 2G9HA 2FR4A 2CLRA 4HS6A 1TENA 4XMVA 4G5AA 3V4LA 1PJWA 4ORGA 2CU9A 2XY1A 3TCXA 1JHLH 3EJRA 3KGSA 5AFAA 4CW1B 3G5XA 4KI5D 5KVDH 1P7HL 3KCPB 5LXVA 3FQRB 2ZCKH 4N0UA 3QJRB 2HWZL 3MA9L 4M1DH 3S4SA 3SDDA 3CMOL 1HQ4A 1G7LA 2R69H 2B8OT 4X42A 2XY2A 1QATA 3O6KH 4HPHA 4WFFE 2LQRA 1PZBA 1U6AL 5EU4A 2M8XA 3KLSA 1U8CB 3EOTL 3GB7B 5KSBE 1G9HA 1F3DH 1NAMA 5IW3A 3VD9A 4KMQA 2BLFA 2KT6A 2P8MB 1F11B 2Q10A 4UINL 1G1CA 3V4VL 4XI5C 2FX9H 4L1SA 4MMYB 1MQ8A 1DVFD 4X7TA 3G3LA 4I0KA 1SDAB 2IGFL 3EGSB 1J7VR 3QQ9D 1OP3H 3IMVA 4WTXA 1BF5A 3LZQA 1A7OH 1GPOH 1UJTA 3L4WA 4ONGH 3OMNB 3NIDF 4F7PB 3RWFB 4LPWA 4JFHE 2NR6D 3DRTB 2FBJH 5L8KB 2C34A 2QGDA 3FQ1A 5DJZB 3WV0A 4YDIH 4XODA 4JE4B 3QUYC 4OCLC 3NSDA 2EC8A 4QNPF 4F57L 3SQOH 5E0FA 3P2BA 3SPVA 1HKFA 4NZTL 2AVGA 1F1AA 1GGIL 4YZFE 3WEAA 3LQMA 3ZT5A 3TBBA 4TTGA 2QQQA 1XWVA 3CGTA 3GSNH 3QUYB 3H3PH 2BC4A 4LPUA 5CGYC 1YMME 2HKFL 3RVXD 3ZO0A 5FAAA 1XO8A 5D7SH 5DJ2A 4BELD 4D8PB 4ZMOA 3L5JA 4QF1B 1UZGA 5DRXB 4J6RH 2HFFA 3B2MA 2VSMB 4A37A 5C6TL 3T0EA 2WZ6A 1TQSA 1NUGA 5DMIL 1SZNA 4UM9B 3DIFB 5D71L 5EO1B 2ERJC 1QNZL 4MZ3A 1RZFL 4YOKA 2GSIA 4YO0B 3DO7B 1U4EA 1ASPA 4OVUA 4CVXB 4K07A 4EBQL 2E76C 2Y7SA 1GL4B 4UF7C 3C6SB 4XC1L 4BCYA 5EFIA 4WNQB 4J5VA 3UACA 4IOIB 4B9PA 4WI0B 3P3SA 4HZ1A 2CLVB 4E5XB 4H1LB 4BSWB 5KS9B 3QHFL 4UNIA 2ERJB 2BP0A 3LZFH 4LCUB 3U6RB 1PYWA 1T0OA 1HXYA 3A6CL 4EI0A 1UA6H 3D85D 2CJ3A 2WB1A 1ZJBA 4KQ3H 1D7BA 3GJEA 3K6SB 4P99A 3UBGA 2DH3A 5E5LA 1F3JB 2J8HA 3IPBA 5C9JA 4XBMA 3P11L 3FDWA 1UD8A 4YWGH 1NFAA 4X98A 1T03L 1NBYB 2O5YH 5DJ6A 5C9KA 2RBLA 1JZEA 2WOBA 3MOQA 5LBSL 2JFCA 3HG1E 4NZRL 4MXWL 2X4RA 3W57A 4G6AD 1QA9B 5BV7H 3QUXD 3WUWA 1E28B 3KBEA 3VI3E 1IEBB 4HCIA 2UZIL 5HHVL 1HI6B 3ZX1A 4AXWB 2Z4TA 4OGXH 3PABB 3CHOA 3KYNA 3QDME 4IK6A 3VFSB 4BFFA 5KSAA 2YAEA 3WE6B 4AYEC 4J8RA 3WNIA 4Z3JA 3CVIL 1LXMA 2I7OA 5DEJA 1BFVH 1M42A 3D1MC 3GXUB 1EV2E 2PTVA 4KJYA 2DBLL 3N1FC 4ISVA 1CGYA 3QORD 2OMUB 5AVYB 4YAQA 1MFEL 1IGJB 4Y2OB 5DHMC 3U4BL 1OT1A 1PZCA 1WC7B 4IDJH 3ZHDA 4Q6IC 2E7DA 4RBPK 1RPUA 2IFFH 2AI0L 5JPMA 2W0FA 1YNLH 2F54B 1K5NA 2ESVB 5EB9A 4U3SA 4YDKL 3AS1A 3NN8A 1NGWA 1FLRL 4Y89A 4ZOEA 3FT9A 2X6VA 3MCLH 1I7UB 1RIHL 4OSUH 3L3JA 4ELKA 1LEGB 3APFA 3QI9A 1IBBA 3GBML 4N90E 1BZ7B 1ZEAL 2FSEA 4YQXL 1PBYA 2C1PA 2VERN 5E0QA 4Q6IB 3LS5H 3GBDA 5IM7A 5EOCJ 5BVPL 5FO9A 2X1WL 1AFVL 1A4KB 3UTTA 3MCKA 5CLXA 1DLFH 4PM1A 1NC4D 3MLZH 1B0WA 3MLSH 5C0IB 4YXHH 1CVRA 2JJWA 4W9KC 1GJIA 3W38A 3GFUA 2Q7NA 1WWCA 4EDWH 4DZ8A 5AZEL 3UJTH 4DN3H 2HJKB 3FUKA 4F37F 1BIIA 1N7ML 5E9DD 4K7PH 4LPTA 5D1ZI 1ZLSH 1HHGB 5JUEH 3NCJH 1O5PA 2EO9A 2ZJSL 3MJ9A 1XH3A 1NPUA 1IM9B 3U0TA 5HDQL 1L6PA 5E7BA 3P77B 2NQDA 1DBJL 1E8WA 2CHNA 1U8PB 2VZUA 4MD5A 2ZSVA 5AQ0A 1IGCH 2X4QA 5INDA 3TBSB 2XACC 3QPQC 1K5WA 1OOAA 5FYKH 5C86A 2XQBL 4ZAKA 2C7UB 4W9CC 3WFHB 3AY4C 4ZPTA 2WUCL 1BLNA 1MVFA 1S5HA 3BFQG 3OXSA 4PJ7B 3RVTC 5AKTA 3STLA 2ALAA 1JHKH 5T3XD 2WTOA 3W2DH 3QJTB 4JM2C 4PJDA 3IMUA 3N1QC 4M02A 2YUVA 4IRSD 5PAZA 4WUKH 2MWCA 4WW1A 4F2MA 5J3HC 1P53A 2IQAB 4Y9BA 2VSKB 1TQWA 1HYSC 2Q86B 1DL7L 4I3SH 1LE5A 4W6YB 1G4RA 1W0VA 43CAA 4JM2B 3HE7A 3O9WC 4E41B 2BINA 4W9DC 2ZYRA 3KS0J 5T1KA 5HHOA 2IWGA 3RGBA 1Z9SB 2EDOA 2GK2A 3FT4A 4WHTB 3U7WL 1J86A 3VRJA 2WVVA 2OXGA 2YD4A 3FQTB 1MLBA 4C57C 4HOXA 3LKQA 1CDJA 2FATL 1Z2KA 2H7WA 2EH7H 2EH8L 5K59E 2GBTA 3DMMA 1VPOL 1IGFL 4TKWA 5IB5B 3ZL4H 2ZF8A 5IW1A 1OCZB 3OLIA 1MCIA 2AQTA 1WBZA 2O5XL 4GQQA 3MLWL 5G55A 3U7YH 3O9WB 3DWTA 2R8SH 1NFDA 5SV4A 3SKOA 3RIFF 2J72A 4ZSOE 5EBWB 4HK0A 1D6EA 1ZT1B 2VLRD 4N8VB 1T2JA 3CLWA 3H54A 1VGKB 4KV5E 1J5CA 3O2VH 1HYRC 4PRPB 4HQQH 1ZK5A 5GGQL 3MODL 4HVBA 4AYFA 5H94A 2P47B 1IKFH 4NQDA 3DX4A 1QSEB 1CF8H 1TVDA 3PP3K 3C5SA 3HB3D 2X2HA 4KQ0A 1YO4A 3BPOC 1D9KA 3GMPA 5T3ZE 4DPAX 4JZJC 1SEQH 3T1FA 4XC3L 2CZNA 2Z8SA 4Y7OC 4KTDH 4Y5YC 4Z7UA 5E51A 2IWEA 4G3YL 4WSGA 4D9RE 1C12A 2FWUA 3N9GL 4QXUL 5AUMA 5AVQB 5TF1L 3FXIC 4BZ2A 1KLUA 1XGUA 1I1RA 1WZMA 1R5IA 4UOZA 2W92A 3TT1H 3BPOB 2OZ4H 5JQHC 1GOFA 5DUMH 3DHMA 4JZJB 1JPST 3JWDC 1COBA 1I3RA 1NGQH 1XF1A 2P9RA 4N2OA 4Y5YB 3VA2C 1WZLA 3MQIA 2HTLC 2H32H 1YEWA 3WKYA 2VDOB 5B1JC 1BVNT 2XN9A 1XMEB 4B97A 3FQYA 2R0KL 2ATAA 5IMKA 5CN3A 1OXYA 3ZN6A 1ZV9A 1C8PA 1IBGH 3BZ5A 1DQQB 4GH7B 2MCPH 3RJOA 5T33H 5JR1H 2GITA 4WU7A 4HS8L 3GSRA 1E30A 3BLBA 2ICCA 1ZHNB 3BT0A 2UZXA 1CICA 2AEQH 5LGYA 2MCMA 4XO3A 3INUL 2TAAA 1HT6A 2AV7A 3Q2CA 2VDNB 3WY1A 4EXPX 4NOBA 1QLRB 5KS9F 5AOMA 3DETD 2KS0A 5HPMA 1OF2A 4QHNB 5L88L 5FHBL 3ALPA 2IAMA 1UUNA 1RJYB 1RUQL 2F53D 3WHE0 1WYJA 4U7MA 3EH1A 4K3GA 4M56A 1YEIL 4JFDE 2IBGA 2CBPA 4PJIB 2VKWA 5I1KH 2F1BA 2YAOA 4FQXA 2CCVA 2BW5A 3U9PH 3WHXB 3QYNA 3HJ0A 5HGHB 2ZWSA 1SYVA 3OAYH 3UO1L 1HFUA 1WTGT 4M6MH 3MRKB 4K0OA 1DSFH 1DE4A 3QC6X 2YEQA 3BRDA 2BRRL 4FQCH 4ZZFA 1ES0A 5DVPA 2WKLA 4NI6A 2O93L 5FM4A 1LP9A 2BHUA 3W11D 4IGBC 2VQTA 4M43L 1MFAH 3FH7A 4EDXB 4XRCB 5C08E 5LNGA 4FEIA 2RMNA 2J7LA 1I1FB 4G42B 4G7QB 2EXYD 3L4XA 3ML9A 4P2RA 4C56E 1I3GH 4A39A 4KVCL 3ETTA 4IGBB 4Z1PA 4GBXA 4Z7WA 3ULUD 1I7ZA 2F5AL 4PLJC 1CLYL 3TNNA 5I1GL 3GIVA 4TPRL 1OTUC 2ARWA 3OZLA 3SGJA 5EEUA 1XTLA 3UADA 4OZHA 3EADA 2E47A 1QSFA 3DK0A 3A6OA 3OC8A 2MEJB 5CGTA 1KJ2B 2E4TA 2ICWJ 2QGEA 5B8CC 2Z91A 1PEWA 1UADC 4JAMB 1JK9B 2RH0A 1M9WA 1YDPB 3D39E 3L13A 2H2PD 4GQ9L 5I26A 2P24B 3N44B 2DLFL 1PY9A 2F7IA 4ZD3H 1VDGA 1VGEH 3R19A 5E5MB 3ECBB 4TQEL 3VO0A 5B8CB 3PFQA 3WN5C 2BP5M 1H5BA 1HS6A 1YJDC 3MBEC 5JXAH 3EUUA 2BSEA 4JQIH 1JZ3A 1L9MA 3QEQE 2ZP0T 1A2YA 5FO8B 2OMZA 2EIZA 2P43B 3X3GH 5F9WC 1I9EA 2OYKA 4GSRA 1AGDB 4JPIA 3TM6A 4MD4B 4JKPL 1J9TA 3RGVC 1SMOA 3OWRA 4KI1A 3B7UX 5TF0A 3WN5B 4MGXA 5B39B 3MBEB 4PJ7F 1CR9H 2WWNA 1IE4A 1A3LL 2XTJE 2GW5A 1HOEA 1P84K 4QXGH 4AQEB 5F9WB 1TPXC 4IEFA 4XB3A 5GRWA 5E7FA 4JQXA 3HG5A 3RGVB 1KGYE 2FD6H 1GJUA 3RWGA 3B7TA 3T3PB 2RIKA 3FNKA 1RULH 2ROXA 1UYWH 3HBGA 4N3UA 1SF5A 1IC1A 1BZEA 2AXGB 1A6ZA 4HIQA 4L8DB 3KM2A 4JM2F 4G2AA 4QTHB 5CHNB 3KYMB 3U36A 4LLVA 1Q0XL 2BS8A 5CN2A 4Z5RA 1RH8A 1TPXB 5DHDA 2Z4QB 2ZX7A 2G60L 4WDIA 2R1YB 2ZKHH 2V37A 2IC2A 4UQ9A 4JFXA 4XOCA 4MA3A 4S1RH 5DCCA 2JIXD 4U4BA 5MEND 1NEZA 2IWFA 1HQRB 2X89D 4YPGA 3T2QA 1UURA 4KZ0A 1XZ0B 1ILSA 1ERNA 2YJLA 4MDRA 4ZX5A 4HZLB 2O4EA 1EFXB 3ILPB 3UPRB 2DI8A 5JORA 3NJMA 4FQJL 2L0DA 3LKOB 2XPZA 4UM8B 4M8VA 3SDAC 4FNSA 2DLTA 3A6BH 1XXDC 1XV8A 1NCDL 4I9WE 4ADGA 4X80L 4H0HB 3NACL 1MVYA 2BY0A 2QGCA 2XKNB 5C0AA 3PIQB 4XOEA 1D6VL 4GKSB 3HI5H 1OGAA 3Q1SL 1TJIH 1KB5L 4FG6D 2A4EA 2PR4H 1JWSB 3OKDA 2GC4C 1A8JH 2NPLX 4QRPA 3SDAB 3KR3H 5AZUA 3EIFA 4AC2A 4HC1L 4ZTOH 4RAUA 5HHXH 4Z7VB 1OARL 4NKIH 4AGLA 3GQFA 3MRCB 4XMLH 3X1FA 4BK8A 4D0CA 2BS9A 3F58H 1T7ZA 3QJSB 3C87A 3ULVE 3UTPD 3QXAB 1C5DA 2ZWNA 1F86A 3BN9D 5TDPA 5GSRB 5C07D 2D2CC 2XTLA 4JRYD 1I8KB 2ETWA 3ARWA 4MX7B 4XVUD 4IK7A 5GZNC 3MRDB 3ASWA 4HGKC 2EZ0C 4I4WA 1YUHB 3S5YA 3KDPB 2R2HA 4FFZL 3JVGC 4D9LH 3KBFA 1IGIH 2PCYA 3OKOA 2F2HA 1AD0A 1PF3A 2XZCL 3VFVA 3IDJB 1EEZB 3KE0A 4FI6A 2LLGA 2CKBB 5MEOA 2QBWA 2FJHB 3R0MA 5F9OL 3P9MB 3NFNA 5CSGA 2J6EL 3WFCL 1KT2B 5F7FA 4Z7QE 1SY6H 1G9MH 2CUHA 3NTCL 3V5KA 4ZFOL 4FRWA 3T8VA 4M7JH 4XBGA 3KJ6L 1KGCD 4JEGB 5DFWH 3G08B 3BXNB 3NA9H 1DN2A 3BEWA 1A6UL 2BK8A 2XWRA 2EP6A 4L3EE 4PJBA 1O5DT 2WLLA 5BUGA 4OJFH 4ZPVA 3S8GB 4P5RA 4UT6L 5GSVB 4TUUA 1UXWA 1ZXKA 3A4DA 2BSSA 4XNUL 4EN3C 1UM6H 5FKPB 3MNVA 3TJHC 1A7PL 4HHAA 4DCQB 1PPIA 3BHBB 2Z34A 4DSYA 4HIHA 4LSRH 1U9KA 4NP4L 2CR6A 1ROWA 2E74C 2C3GA 1DBAH 1LD9A 4FLHA 4N2AA 4TTDC 4AMKL 2Y36L 5D2LB 5EF2A 1NAKH 3HE6A 3QAZC 5DVOA 3ZTNL 2K1MA 2ZXCA 4EN3B 4FP8H 5EZPA 4QHMA 3VXUE 4WO4A 1GZPB 1RSFA 4PJIF 1ZE3C 1NWPA 3E80A 5JZ7D 1E5CA 3FH5A 1J8KA 2NY3C 4DK6A 3QDAA 2NLJB 3MUHL 1EEYA 4JO2L 5A2CA 1LE9B 2FECI 4ETQA 2W0LA 3MI6A 5C0CA 2NY5C 4JFQB 4L8CA 3QAZB 3V6OE 3ROOB 1QRKA 1VHPA 1M2VB 4F8NA 3LEVH 3US9A 2CK0L 3G5YA 2IH3B 2E9GA 2NY3B 1HEHC 3P73A 4P9MH 5DD3H 5FW8A 4OGAD 2J88L 1SDDA 1QSVA 3QCVH 1JNLH 3ARBD 3NDZE 1AANA 3UABA 1IE5A 3NBNA 4KI5E 4AE0A 1PZ5A 2VABB 2FX8H 1MJ8H 4WEEA 3ARDD 1OAKL 4ELDA 4MAZA 1IKOP 2ZOUA 1RSYA 3ZRSA 2D8KA 1E90A 2VIRA 5JHLL 3DJTA 4BV1A 5D2NE 1JYWA 2VQ1A 3F7KA 3JSSA 4C4BA 3S5ZA 1H8NA 4DESA 2PYEE 4HT1H 4RWYL 4YHOH 1N0LB 2HUEA 5EEVA 4Y5VA 4JFFB 1M3IA 1DANT 5D72L 3IGLA 3KPOB 4KKRA 4TNFA 1HEZA 5FOBA 1JS4A 1TCRA 3FHQA 5I0VA 3TPKA 4LL4A 1OAJA 3B1TA 4MCNA 2BSDA 1T1XB 2G30A 4PPTA 2R7EB 3ROLA 3JTTA 1EZVY 4EI6B 2X9XA 3O8XA 4H2AA 5LAXB 4JFVA 2BVUA 3H9YA 1EAOA 2NZ1A 3N44F 2XKSA 2MOQA 5TPWL 1HTYA 1PIFA 2OMYA 4FFTA 2XZQL 5B7FA 1N0XH 3GZPA 1C5BH 1MRDL 3CLEL 4LLYA 2A6IB 2IPTL 5J6GB 3MYZA 4MNQE 2BOBB 25C8H 4AIZB 4DFIA 2XZZA 4P2QE 3EGDA 1FUNA 1GZHC 2F8IA 3BGMB 3GZQA 3SZ6A 4O9HH 4PN6A 4B95C 3DVNB 4JHWL 2O30A 4ES8A 2D0GA 1F4AA 1MI5D 1S7SB 2W9LA 4R7VA 3L6FA 1RHHA 4FTVB 1JV5A 4IMLA 5KVFE 5DJCA 1CG9A 1VFBA 3HR5A 1HINH 2YPKB 6PCYA 1UZ6E 4EI5D 1A6VH 4MYWB 2RCSH 4NO5A 2X3CA 4FQPA 3N85L 5HYIA 4XVSH 3DX9A 4ELME 5KN5A 2VM9A 5DWUL 3RI5F 5DRWA 4PGBA 1RZJC 1K3IA 2HCZX 3WELA 4ANWA 3LRSB 5I5IA 4L05A 4GUPA 4NC1E 3PUUA 2DLHA 4P23C 1AKPA 1KPRA 1ORQB 2VCOA 1UWXK 2WAHA 4WW2A 1YEDA 2Y7QA 5B1BB 2L7UA 3T3PF 4AEHL 5F89A 3BP4A 3MFGB 1JPSL 2VN6A 4OLXH 3GSWB 3SDXE 4QCIA 4ZW6A 4WTQA 4HSQA 3O6LL 4Q74A 5EO9B 4K9EL 4EEEA 2OL3A 3TEWA 4P23B 2JVUA 1WE5A 3O6FC 2C3VA 4AQ1A 3CJJA 4F8PA 4L2YA 2YS4A 3OKYA 1ZPUA 4EUPA 1WA2X 2F5BL 1KTDA 2XJLA 5CEZL 4KQ4H 2DIJA 5EU6E 1BBJB 3HMXH 4F91B 4G5ZH 1UB5A 4NN5C 3O6FB 3DTXB 3KVQA 3BW9B 1RMFL 4Q9QH 1ONQA 4LSUL 1X5IA 3KS0H 3UZQA 3DX3A 3G6AB 3MJ7B 1TNMA 3EYVA 4PR5B 2KLSA 1ZHBA 2OMBA 2W9DH 2YUWA 3BQUD 2D9CA 4ABVA 1ZLUH 4KPHL 4MJIA 4Y2DA 5H37A 4DK3A 4E5XG 4NUGL 4PJAE 4PV1C 4NN5B 2OP4L 3M1BB 4ACPA 4NQED 4RIRB 2P5WB 3CC5B 2VO8A 4HW6A 2FEDC 5DZJA 2J3SA 3OX8B 4HALA 4MVBC 4UIMA 5LJYH 3DPBA 3EYOA 1QNIA 1RCYA 3ZE1E 3FBKA 1I53A 4N0UE 3P3YA 1CPUA 3TC9A 4WU5A 4HIJB 1BZ9A 1J1PH 4LCWE 4ONHA 4PJ5A 1PKQE 3QEHA 3MOBH 4MB4A 4XX1G 3PDDA 2JCCE 4QXTA 1GH7A 3CFKB 3DOIA 1QPPA 1XH1A 3U9WA 5FK9A 3I02A 5CU5A 1XGYH 2I26N 4POZC 4CUCA 3KLAA 4RNRB 3V52L 3WU1A 2D0FA 3WKQA 4X5LA 4JRLA 2WC7A 1TZIA 2BS71 3RU8L 2CMRL 2R0ZH 1A64A 5DMGD 3ZDXE 1RUAL 2GCYB 1N64L 1JF1A 2YSSA 5IHBA 5D7LA 2WNKA 2NXYD 4XX5A 1N4XH 4LP5A 2R9HD 4FN0A 3S34L 3DVGB 4U6HB 1OVZA 1QFHA 1MUJB 2XX0A 4XCEB 2GSGB 1HAUA 3K1DA 2DQJH 5E9DE 3D3VA 3L7FB 5J6HA 3MV11 3JQOB 2OTPA 2VLJD 3TCTA 4PCKA 2C1OB 2CNYA 2FK9A 3GGWB 4L29A 4U7SA 1TZHB 2XG5B 3QZWA 1GYAA 1W0YT 3JZ7A 2OTWA 4LKXA 1FNFA 1NBZB 3PE9A 1T5KA 3WJJA 3V0WL 3JWNH 4DNLA 1NDMB 4U1KA 4Q56A 2ATPA 3QNZB 4N0YL 5D2LF 4PY7A 4YDLC 2G75B 2QVFB 5L2KD 3IYLW 4BFEA 4LASL 3P0YH 1RP8A 4P46A 3QS2A 1L0XA 3QDJB 4DQOH 2EINB 2GVYA 3SDCA 5E8NB 1RIUH 3CWGA 4DEPC 4P05A 5L0QC 1PZUB 3HS0A 3QFJB 1ZXQA 2E46A 4K5MA 3HPJA 1T4WA 5SWZA 4YDLB 1XIWA 2HB0A 1FIEA 2EEAA 3JV6B 4N85A 3POHA 1IAII 4NDMA 4N2CA 1NJ9B 1MRFL 2BVOB 4UYPA 5TH2B 5T1LB 4A1RA 2YUZA 4LLWA 4EN2A 3PAUA 4JGMA 4PJGE 4DEPB 4N24A 3RFZC 3CVHH 3IXTB 5L0QB 1KEMH 5J1AB 1FGVH 2VDMH 3MRFB 2J5WA 1A9VA 2BXZA 4Y4FA 4GG8B 4XXWC 4PWHA 5HY9B 3C5XA 2HLFD 2H2SD 1L5GA 2YPLA 3LSOA 2H5UA 1KV7A 4ANXA 2GEQA 1SN0A 4I3RH 3WTXA 2DQTH 2Q8BH 1JGLL 3HI1A 1ZS2A 3RFZB 4U1HB 2V0AA 4CJ0A 3RTLA 4E9SA 1UGNA 4XXDB 5BO0D 4RAVA 2B4CC 2GSMB 1D5ZA 1M6OB 4HMDA 4I18C 5L7XL 1PY0A 4I87A 3IU3B 3QWRA 4PVBA 3F5WB 4G7VL 4B5EA 1WIOA 2RGSA 1NCAH 2A2QT 1G0DA 4JGUA 5D8JL 3CUPA 4L4TB 3GHEL 4HUWA 3KXFB 1JF6A 7FABL 1ZGLA 4I18B 2GIYA 1KFAH 3EJZC 2Q87A 3HC3L 1YLBB 4NHCL 1XX9C 1NAMH 4G6KL 1FCGA 3WNKA 3PLYA 4LLMB 4LVEA 5LBVA 1CGSL 2WQWA 4M5YH 2DH2A 3RAJH 1CFVH 4JVUA 1UUSA 2QHRH 3FB6A 2H3XC 5DRZA 2V2XB 5AB1A 3SDYL 3US0A 4N8VG 2W5PA 3FCUB 1OZUA 1W9XA 4IMKC 2MOVA 4N2HA 3DBSA 2BY1A 4JDZB 3SGEI 5F70A 3OKKA 3N5AA 3CFBA 1MRCL 1QASA 2BFVL 4J3OF 3VH8A 5I6KA 5EZJB 3NRPA 3IJ8A 2IANE 1H15B 2OCFD 2WBXA 1YSOA 3KH3A 4ONFL 2FECL 5C0DB 3PGFL 1D2OA 3ARFA 4Z0XA 4FKHA 4AL8C 2EDYA 1CXIA 4JG1L 3S48A 3T2NL 2JQMA 5ID1A 3OAWA 1OCCB 1DQMH 4HP5A 1NMCC 1DN0A 1IGYB 1IEAB 3RLSA 4ZNEE 2OS7A 1YEGH 5D4IA 3PXHA 3DPDA 3T0AA 5FDWA 3S35H 4F7KA 3RG1C 4JFEB 3RWEB 3FQUA 1CXEA 5E1IA 2AK4E 3C08H 4HPOL 4KXZH 1G7PA 4TL5A 4Z0BH 1BQHG 2CRZA 1QMUA 3ESMA 1MH5A 4OGQC 4Z78B 1P4LB 2XWJA 5D1QD 1OWRM 4M8QA 1CFNB 5BZZA 1CE6B 3NMEA 2C9SA 5GGTA 1IC5L 3ZW3A 1ZSDA 2A0LC 4DKFL 3CBJB 2X6MA 3M8OH 4P9HH 4JHUA 4NGHL 5LHDA 1A1OA 1B4JH 3TTSA 4PRNA 4UV7H 1K85A 2YQ2A 1RUML 4MJJA 3W56A 4QTIL 2EEFA 5GS2H 2D7NA 2XWDA 5KVGE 4B50A 3DBXA 2HH0H 3NCCB 4R8WH 3OWEA 3QG7L 3UAJA 4MXVF 1IQWL 4X0KA 2EIJB 1MFMA 2JXMB 1KN4H 1XCXA 2YO3A 3DSNB 4QJ4B 4OD1H 3NZ8A 5FB8B 1X5FA 3S88L 5E8EA 1CBVL 5CEZD 1I8AA 3VXSA 1QKZH 4HCRL 1V7ML 5LGJA 1AO7D 5KEZA 3EZ8A 3OJDB 3O2DA 3UZEC 2YKLH 4ODUB 4Y16A 1NUDA 3HA0A 3MLXH 3NFPB 3NCBB 1XL4A 1WK0A 4MZIA 2VSDA 3FU7B 4BKLB 1T0MA 1WQVT 3RFRA 1BBDH 1KCSL 4M9OA 4UDUA 1FDLH 5KVEL 1RU9H 2BNQA 4FMFA 3MRRA 5I0ZA 3DUSB 3T2OA 2XI9A 4A6YB 1YN7A 2D31B 4AGOA 4APQD 1B3IA 6FABH 3QARA 2F7RA 4HXAL 2JJTA 4HPYL 1IFGA 3FUNA 3MV8A 5IF0B 4LLQA 4N2NA 3UTQA 3DJRA 4Q58C 3CDFA 4I77L 2X3AA 1TZOA 1P7QD 1MHPH 2FVNA 2MH4A 2YQBA 5BRZE 5IP4A 5F1NA 3WMQA 1AHKA 2DTML 1SOQA 4PWIA 2CDEB 2EUVA 1HOCA 4U1MA 5CCKL 1M7DA 3D33A 3QO1B 4H26A 4Q52A 3DC0A 3E8UL 1E9OA 4U4IA 3RKPA 3EOBA 2OXHB 1A1NA 3BKML 4LLAA 1LEKB 5EN2B 1BX2B 3BWAA 3TFBA 4JHVA 1BVOA 2WPGA 2WZ0A 5F7EL 5HDBB 4U6XB 2NOYA 4XP5H 2BPBA 2DQCL 2CA4A 1T3FB 1NDTA 4LRIA 1KXVA 1HNFA 3L9YA 4PS7A 4ZX6A 5IMMB 4DWHA 1ZANL 4WY7H 5TE6L 1DVFA 4XBPB 3HC0B 4XCFL 1TEYA 2AKRB 3CVCA 5A2BA 1MJ7H 5HYFA 3BC9A 1TU2B 2R23B 4R7XA 3V9EA 3PG2A 2YD9A 1YMHB 2AFNA 2NR6A 4L0ZA 1RL1A 4UQAA 2CHWA 4HWZB 2EVGA 5BUPA 1OAQH 4EIGB 2QSCH 1IARB 2VDLH 1PJ9A 3NDYE 4J23A 1G7QB 2A83A 1IKNA 3APDA 4M9PA 1LO3H 3ES6B 5CCGE 1QLFA 3TWCL 8CGTA 3BAXA 2GT9A 2VLKE 3FRPA 1A6TA 2HN7B 4BDVB 2KQNA 3FO2B 3O2WH 2CIKA 5B39G 3NAAH 3I6KB 2F68X 2WQVA 2QQKH 1IBYA 2WXGA 3C5ZD 3H42L 1ETA1 1Z32X 1BMGA 1FRGL 4H20L 2HG5A 1PG7H 2AMUA 2JK5B 3IE9A 1OSPL 4MQSB 4XWGH 1YMMB 1XGRB 5GGSA 5GJTH 2JKXA 1QLEH 2LLLA 3GHPA 2EAEA 5A2LH 3WIIL 2B1HL 4L3FA 4PJHE 4TUKH 5EF0A 3P3TA 1E9QB 4CAGA 4DKAA 5LNDA 2XICA 1KC5L 4IRJD 4JANB 5ANHA 5C71A 1E5YA 2PP9A 4GAGH 4V2CB 2VDQB 4KKAC 1JCVA 1A66A 4TSBL 3FOLB 3OAUH 3AREC 1MCWW 1FIGH 1HL8A 1OB1B 1N18A 1FGNH 1KB9J 4NUJA 4CGUB 15C8L 1JUFA 1WV7T 3LHPH 3ECWA 2X4OB 1D2PA 2E59A 1IEHA 2XYCA 1GZQA 5C09A 2EYSB 2SODB 4RZCB 5FGBC 4APXA 5KVMC 3NSXA 1CIDA 4K7FB 1RJCA 3MV9D 3D85A 3AREB 2YRLA 1RK7A 3GXPA 5EEZA 5CMAB 1JDDA 2BSRA 4JHZA 4KY2A 3AROA 1G4MA 5D7EA 5L9DH 3A23A 4OD2A 3T65B 1D5RA 1AYOA 5AENA 2R4RL 5CLTA 1PSKH 3BP5A 4FYTA 3ABGA 2W94A 4FQHB 5FLUA 1F4XH 3EOYG 2AGJH 1W8NA 2D7QA 2J44A 1WCBA 3QUXA 2HVKB 3FHAA 1R3IL 4KNTA 4R97C 1VF5C 3HG1B 3NYKA 2R2BB 1AY1L 1B0IA 1HH6B 5ABDE 1KULA 4WKZA 3WHE1 2YOCA 5DURB 4S1QH 3QDMB 3REWB 4FCHA 3O11A 5DD1H 2BVTA 3WIHA 3W0WD 1QEXA 3QORA 5I1AA 4FJZA 4HJJL 5HJGA 4R97B 2MQ0A 4D0DA 4PP2B 5T8IA 5CEXA 2EUXA 3H9SD 4M4PA 1L0QA 4M8UA 1NMAH 2A1WH 4HYTB 3BKJL 1FFNB 4OZ4B 2IEPA 3K74B 2GUOA 3FFDA 1FFOA 3RVVD 2Z3FA 3V5HA 5EOTB 1BOGB 1N10A 2HRPL 3FF8A 3Q6GL 4J1UA 4LMQE 3WLWC 4U6YB 4BE6A 4D94A 1F18A 3KGTA 1LDPH 3DXAB 2GABA 3ZDWA 3BVNB 1Y18A 1GIGL 1LO5A 4ZFFA 5I1LA 1C7TA 3I84A 1ZS8B 4YHKL 1A6WH 3F85A 2K7PA 1NC4A 4HIIB 4D9QD 2W9EH 3KGRA 4OD3H 3MGAA 4LBEA 4TLKA 5IHUH 1MEXH 2GBAA 2ROYA 3QULB 5D7IE 2A6JA 1B0RB 1FV1A 5I1DA 4X7SH 2I69A 3L9BA 2ENPA 4U3HA 4G9FB 1TQUA 5DEGA 4H8QA 3NEEA 1P4IH 4OW6A 1ZGLM 1AGFA 2H32B 1GOGA 5ECGA 2ZPKH 3ARGA 3I50H 4GSDH 2K9UA 5EORH 3FAWA 1LO4L 4XNMA 4NRYB 1YZZA 4I3GA 2DAVA 2C9XA 2NNCA 4KOCA 3MXWH 4ZK8A 1XDTT 2OJEA 4ZQKB 4LLUA 5F7MC 4FXLA 1KOAA 5KG9B 3IJHB 5FYJU 3WTVA 1JGDA 4EOWH 2AABL 5BO1L 1SUHA 4UOW1 1HKLH 4BZ1L 3P4NA 1JMZA 2Y06L 3F7VB 4NUPA 1REIA 2FH8A 4FFVD 4QAMB 4ZYKB 1R0AH 1NCBL 3F7RA 2PP7A 3I2CL 1U95A 3M6DA 1DBBL 3BAIA 2G4GA 2NSQA 3HZMB 5GRVL 3VXOB 3BZEA 3V0DA 4AYSA 1M7IA 4QY8A 4TM9A 3QIWC 4NRXB 4ACTA 2Z31D 5EN3A 5DR5H 1DDHA 1KCKA 5SWQB 3ZPDA 3QH3B 1EO7A 2VISA 1FLTX 3ESPA 3KPRE 4AYGA 1BD2D 1N3NA 1X5ZA 4NENA 5ADOH 5EEXA 4MNHA 1AJ7L 3KPNA 5DVMA 1IT9H 4JGJA 5FYKD 3QIWB 4DGVL 1XCWA 3OC5A 5IEKB 2CGRH 2RTTA 2ITDB 1JWMA 3NABL 1YEKL 2I32A 2V5YA 2VZVA 3GNMH 4UOJA 1BM3H 4NNPL 5DK0A 5FHAL 4M7KH 1ZHLB 2ENYA 4HUMB 2Y7LA 1FQ9C 2LV4A 4HKJA 3ETSA 2BOLA 4UT7H 1OT2A 3TYGL 2KL6A 4PUBL 3RPIA 1JGVL 5AALA 5FYLL 3H4FA 3MLRL 4PI0A 1WS7A 2VLRA 2N3JA 2EIBA 1KYAA 5B38G 1AC6A 3GJFA 1JERA 5E6UB 5KSBF 3VDCA 3K72A 3DLQR 2ZP8A 3AXLA 4ERSH 2VWEC 3RNKB 2UWEA 4KK9D 4NQCB 2FLRT 5A2FA 3PJSB 4JY6A 1UOKA 2ZAHA 4IHBA 1BXVA 5D7HA 1N5YH 1GSMA 1SVCP 1DJSA 1GTNA 4HISA 3UGEA 3LZNA 5F96H 2YBGA 1ZOXA 1FZOA 4LRNL 1YPZA 4NNYA 4P4RB 3H56A 4U2ZA 3C60C 3PUCA 5CBAA 3IJEB 2BSCA 5DQDL 4Y1AE 3GSVA 4PJEA 4K23H 4JVWA 4TNWK 2GKIA 1KNOB 4YHPA 4XNBA 2F74B 4K8RH 4Q0XH 3IMRA 4M8RA 1W0WA 3OZ9H 3IE4A 2ODIA 1I9RL 1UT1A 3GXNA 1GRWA 3VTTA 4RGNE 3FFCE 2ZCHL 2XRAL 1WZ1H 4H25A 3SOBH 4YSOA 4I2XA 5HPOA 3HPLA 2JSFA 3DX1A 1QEWA 3C60B 3OKEB 5JPNA 3RZCD 4G6FB 4YZFF 1KCLA 3RZWA 2ZUWA 2MQCA 3DX7B 1BYPA 1WA0X 3DO4A 1AGEA 3TH4T 3RDTC 1N8ZB 3L3HA 3VFWA 1NGXB 3GIZL 1MIMH 3K7UA 5EA0H 4TF4A 1ZV5A 1I8IB 1NC2D 3PF2A 5F3FA 4U6VL 2DWSA 3O4LD 1XL6A 2VDOL 3BZ4B 4LVHC 2AJXL 1FHGA 2MRYA 5D5ME 4GMSH 3LN9A 1YECH 4MS8C 5FC9A 3RDTB 3Q9QA 2HKAA 1EXUB 2GIMA 1HH9A 4XHJD 3APMA 4ICXA 1TYEB 5MEQA 3JWDL 4HIEA 2GK0A 3QS3A 35C8H 3HS8A 5AOZA 1UD2A 4LVHB 1AXSB 3WSQH 1OZTG 1B4LA 3N40P 4WFHE 4KRMB 1ZSHA 4XPBH 1JPFB 1XVSA 5ICUA 3GZKA 2CHDA 2F53A 4URKA 5A2JH 1B4RA 2ADGB 2VDNL 3CN4A 2IH9A 3C6LC 1DQTA 3FHEA 3BVVA 5KZCD 1V8HA 2GG1A 5I1CH 3IFNH 1CFQB 1VIWA 2VH5L 4WSKA 1AXIB 3TL5A 3F7YA 5G4OA 2QPDB 3ESUF 2VXQA 4NWTH 4MD0A 3MHZA 3BUYB 1QYGH 4OZGA 1JF5A 2RALA 4FAAB 5DHYB 1E65A 3C6LB 4N0CC 5T1MA 3ELQA 3PHQB 3K0WA 2R59A 5SX5K 2FIRT 4XN1A 1KPVB 4H0IA 1EBAA 2LHAA 3R06B 5E1AA 3Q3GB 3VI3F 2OJ1A 1OPGL 4Y19E 2ZKWA 4Q2ZA 2NY4D 4R7DB 3CFEB 1WP6A 4YIQA 4KKBC 2NY6C 5F1OB 4JHAH 4M61B 1HIML 3FN0L 2K78A 3MTXA 1MCPH 2ZX8A 3PWUA 5IHZB 3LN4B 3DHJA 4KRNA 1BVZA 3ARQA 5TD4A 2QLYA 1PZ3A 1X5LA 3EJYC 2ZKMX 1BOYA 3TA3C 2AEOA 4LL9A 2C9RA 3S2CA 1I1AC 1U8JA 2WKOF 5AW1B 1P5VA 1RZ8A 4C56B 2FGWH 3TCLB 5HYJE 1CL7H 4WVRA 5F7DB 3RRQA 3TEZA 2NY6B 4PQXA 5JDJA 4X7FC 3AS2A 5BRPA 1XEUA 5EIIB 3HLAA 4FQIL 2WMPB 4OIIH 3BVWA 5I8EA 3SY0B 3VWKC 4R84A 5IT2H 3RWJA 1VFAB 4LGPB 3V9FA 1QO3B 1S5IL 3RL1B 3TA3B 4NCC1 1KJ3L 1I1AB 1NGZA 3OKLB 4YK4C 2G2RA 1MF2H 3OPZL 4M6OL 1PD0A 3FT2B 2BVQB 3S6CA 4OAWB 4BA8A 2A9DA 2FUQA 5DFAA 2ADFH 2PCXA 3VWKB 2KDYA 3DO3A 4MDIB 3O3AB 5BRQA 3D18A 4OLVH 1KJ2L 4XB7A 4KO6A 2UYLB 3FU9A 3G04B 4JKLA 3S3SA 4HWBA 3I6LD 4YK4B 3QWNA 5A6IA 2O5ZL 4Z7IA 1ASQA 2CALA 1H19A 2F54D 3VUAA 5EOCL 5F7NC 3ZE0B 2ESVD 3P30H 3PHOA 2YMOA 2VR6A 1KBBA 4UUJA 2ED9A 5EOQH 5EC2A 2YWYA 3BAWA 1JWUA 3BH9A 1FN4B 1BQ5A 2J2ZB 3QRLA 1WD8A 1WBYA 1AG6A 3O0RL 2P26A 4HU2A 1UWYA 2HT4C 3UJJL 5SV3A 1T5XB 2E8ZA 1J1OH 1SMAA 4OF0A 4JZOA 4GAYA 5CD5C 3BPCB 3QPXL 5IB4B 1F8TH 3RX5A 3LPWA 1AP2A 1GS6X 5DJXB 5DUPH 1JHTB 2WNXA 4OLEA 1T1YB 2FE0A 1MREL 1YJDL 4L3AA 4BHUI 1OAXL 2XBDA 1YN6B 3UEQA 2X2IA 2A9BA 4GEJA 5IFAL 3MBWA 1PZDA 2CAKA 2Y6SC 3IFLL 2EO1A 2IV8A 1W16A 1BVLA 4XPGH 5ALCL 2WWMC 2OV0A 5CJQL 3TTYA 5FCSH 4YDVB 3U79A 2X89A 4OBRA 4PJCE 5EIVA 3VGBA 3H3KA 3PDOA 5C0RH 1UKTA 2QADC 4IBLT 1S7TB 3VDAA 3CPLA 5K59F 4NHUA 4EVNA 4OJDH 5HGDB 1HL5A 1WEJL 1EHAA 4P04A 3G6JE 1RKRA 4W4NA 4PLOB 1RPKA 3E9TA 2Q76B 4OLYL 2L7JA 4FA8A 4Y4HC 5DEFB 2QJDA 2QADB 1IX2A 4KV5F 1JPTH 3SBWC 3AT9A 2ZE0A 4NS0A 1GA2A 5EU5A 1HJBC 4N87A 4HX1B 3ILQC 1JV2A 4JM2D 4JCWA 4RMQA 3ULVC 4E41D 4DP2X 2B0SH 1MFCL 3S96A 4FDWA 4Y4HB 5EF3A 3KL3A 4XMPH 4N9GA 1RAMA 1XGPB 1C5CH 2Z0BA 3IGAA 3TZVD 2B14A 4YH6A 1HYSD 1BEYH 2HVJA 2PYFB 2R29A 3R8BB 2XFGB 3ATAA 4C83B 3OLGA 4IBUA 5C07A 1QFUL 4XNDA 4JRYA 4GRWE 5A3ID 1H6TA 2WZPD 3NP3A 5T3ZH 4CC0A 2EACA 2HRLA 3E6FB 2WYZA 2N7BA 4U1IA 1OE1A 2QGBA 3PWNA 4ODVH 1PD1A 1RV6X 2O72A 4AT6A 1SBSL 4OZIB 3JWOC 5ALBL 5JIPA 5I71C 4GP8B 4CC4A 1G7MB 5GS3A 3LH2H 4F27A 1QSED 4H8WH 3UYPB 2EEBA 7CGTA 2PW2B 5DZLA 1CZ8H 3VACA 2OL3H 1D7FA 1R75A 2VL5A 2WXPA 2AMGA 1NCCH 1EANA 3BVXA 3ZK0A 4W1TA 1FH5L 1T83A 3BH8B 4EUPH 5I71B 2CBMA 5IB1A 1LVEA 4M1CC 4NBZB 4OT1H 4M62H 2FQEA 5JDSA 3SJVD 2CKBL 1UCTA 1MPAH 4X4XA 2WXHA 5DDHB 3TIDA 5F0PB 1Z0NA 3FCSA 5C0BB 1MIEL 4L3EB 4KKLC 1V10A 2GJRA 4JMXA 3IEAA 3U0WL 4BE5A 1XHHA 5AVUB 3RX7A 3ORJA 3RGHA 3FOMB 2VKXA 4RGOH 1VAHA 4NIYE 5ESQB 3KPSB 2WUBH 4G80A 4DVBB 5BS0E 1AGCA 1XBDA 4MMXA 5K39A 4LQ1A 4F5CE 2DQMA 3V6OC 3LNHA 2YXVA 3ETBJ 3VXUB 1G9EA 3HAEA 4X5XB 1JNNL 3UC0H 1AQDA 4F92B 1N6QH 2UVEA 5C0FA 3HRZC 3UTZA 1KTJA 3KBPA 1K2DA 3FH8A 1TXKA 5TE7L 5J1SC 4HBCH 5AD0B 2W65A 1KYOK 1BWMA 3FUDA 1DBKL 2ZZUT 4KK5C 5KTEH 4GKZA 4W9JC 3L5XL 1BVKA 3DV6B 1EO5A 3CIQA 5CSZB 2VAAA 1V7NH 1AQKL 4BBWA 2UX7A 3ARBA 2R4SL 3AAZA 3HRZB 4G59C 4K7PY 3G9AB 3LB6D 4LK4A 1Z1WA 5GGVL 4TYUA 3UBXB 3ARDA 3ZYJA 4XNXH 1MCBA 4OJEH 3D50A 4PMEA 5K9KB 2HMIC 3VQ2C 2RAMA 3N1GC 2ZCZA 1R19A 2GPZA 1M1XB 5J7CC 1RJZA 1A6AB 3FQWA 2CDFB 2P8LB 2D3NA 5DUBA 1SUJA 2NY5L 3PWJB 3QJFB 1E4WL 4NAMA 1ADWA 3ZYIA 5EBLB 1T20A 4O4YL 1G6VK 4K3JL 3H0TA 1GHFL 1U8QA 1EMTH 2X4TA 3O45B 2A6KB 3DYPA 4I1RA 4PJFE 1MFBL 5B3SB 5KAQF 4YE0A 3IGKA 4MWFB 1I7TB 3BAEL 5T1JA 2DF3A 1S78D 3P0VH 4M00A 4TNEA 1WTLA 4KROC 4AG4H 3TO4A 3PXJA 1RK1A 3EG9A 3A4FA 3T4AA 2W07A 2CO6A 1HHHB 3D69A 3LOWA 3WIFB 3T6VA 2PKDA 1YQVL 4HKBB 2NW2A 4GQPH 2DQUH 1RZPA 3VXRB 4JRXB 4JUTA 4NKOA 4OV5A 3QJHB 4KROB 4W4OA 1OP3K 3L3IB 1F1GA 3IDUA 1FPTL 4P2QB 4M29A 1CFSA 4HS3B 1H3PL 4EQ3A 1MI5A 3IFOB 2AK1L 4IGBD 2PXYD 3AQYA 4IS6B 4QHKI 1UACH 1FNEB 2J4WH 4OLUL 5FFLA 4K3EL 3CDCA 2JF1A 3WBDA 3H55A 2WLIA 5DVNA 1R5WA 2WXQA 2XXGA 3FL7A 4MJ4A 4NC1C 4P5MA 4EI5A 2F61A 1NCGA 2R0WL 1FSKC 2ZX9A 1S2EA 2FWSA 2F7QA 4GB9A 5AG8A 1VZHA 3IWVA 3M7FB 4S0TD 5ACMA 3QZPA 3DVIA 3IU4H 1FAIL 3WTTA 3EKCA 4K5OA 1HZHL 4PLJD 4GSUA 2JQZA 3P9WB 4WTWA 2WQUA 4PLKD 4ZODA 5D7JC 3VAEA 1RFDH 4JG9A 3DSFH 2BIMA 2G5UA 3QCUH 2JB6B 3MLUH 5E8DH 3C9NA 1FSKB 5C2BL 1UEYA 2WLJA 2DIEA 3MNWB 1SJHB 5DQ9A 4HU8A 3I6GB 1TTAA 1U2HA 5DTFA 2OSLA 1KCRL 2HA1A 5D7JB 2UY7A 4XMKL 1WDAA 3N55A 5HDLA 3SDXB 2F15A 5E2WH 4X2UA 3HBZA 2D7TH 3EFDL 4LU5H 5E99L 4P5TA 3KDMB 3MV9E 2XA8H 2GBVA 2YGOA 4HLZG 3VE0A 3OTTA 4TVPL 1QBMH 1QOKA 4XZUB 3MBED 1KXQE 2QEJA 1EH9A 2WNGA 4GYBA 4L37B 4DEWA 5FGSA 5ITBH 1DFBL 3NCMA 5EU6B 4DP8X 2ZOLA 1ESOA 3CVHB 1NFIA 4P3WA 4PRHD 4X6BB 3LHAA 4BSVB 2VDMB 4QT5A 2WLMA 4O58H 3BQUA 3RGVD 3STBA 3LZRA 1RUKH 4BSJA 4GNKB 3UYRH 2EDXA 4UQ2A 3WNOA 3S3DB 4ODWB 1CXLA 4MCZA 2A6DB 4NQEA 2VB5A 3FU5A 4N4YB 3SDDC 1HWWA 1XR9A 1RZKH 4X8CA 5BNXD 3MRNB 3IFPB 3ERXA 4PJAB 2G9HB 2FR4B 4HS6B 3E6HA 3FPXA 2CIIA 4LEXH 3IDMB 4ORGB 3S2AA 5HI5C 4AM0Q 5ID0A 3WFBH 1Z5YD 2FGZA 1KYDA 2ICEA 1IC0A 1S7QA 2RACA 3DOSA 3N1PC 5F7KC 4CU7A 4F7EB 4N0UB 5HI4C 3S4SB 3SDDB 3ULVF 3EH3B 1G7LB 5DHVA 4AW7A 1YYCA 1EFXD 1CFMA 2WINA 4YHLH 5F88A 1EXGA 5EU4B 3ABMB 3QNFA 2EDWA 1SJVA 3N2JA 3O41A 1HHIB 1HSBA 1YEHH 1MWAH 3L2MA 1VERA 2DW5A 3NSJA 3ZR6A 1HL9A 3L9RB 4YZWA 4V1DD 1TJMA 4YPJA 1BECA 2ZG2A 2LU3A 1LLAA 2OULB 4PJ6A 2VXUL 4X7TB 3ZDXB 3SDAD 1AR1C 4OUUB 4Z7QF 2P42B 2ZONA 3LXUX 4XCNB 1H6UA 1IFHH 3ZYOA 5INCB 2CWRA 2VLJA 3C2AL 3B56A 2QPFA 4YEFA 3OR6A 5GGTH 5D9SA 3RP1A 2CM6A 3C8DA 4R7NA 3GMNA 2Z7YA 2B9BA 3QFDA 1CK0H 3HNSH 4TLSA 1CLVA 3D9AH 1AR1B 1EAJA 4MCYA 4H5SA 3D06A 3IS1X 4D3CL 3I9GH 2Y5TA 2GTWB 4UNTA 5E9AA 3SPVB 2DPKA 5BOJA 5J89A 3VD4A 3OKMB 3LEXA 5CJXC 1GC1H 3A67L 5L2KA 4K55A 3T0EC 2XVBA 4NBYB 4P2OD 1P9MA 2LLNA 1V05A 2WV3A 3RUGE 3II2A 1BREA 2BC4B 3N6YA 5GGUA 5TE4L 5MHSD 1PU0A 4S1SH 3G5WA 3MA7A 4UT6A 3B9DA 4P9HC 2EZ0D 3EYSH 1YEEH 2Z0UA 1G6RA 3BP6A 1U41A 4JY5H 3O2DH 2HFFB 4A7GF 3T0EB 3S97C 1A1MB 1NKOA 5EUKB 4EIUA 1X7SA 4PWEA 1KELL 1U3JA 1NLDL 1UVQA 2GSIB 5I15H 1Y0LA 3GMQA 3CBRA 1R3KB 5EZLB 2BO0A 1F97A 3GBNL 5FCUH 1XD0A 3VD3A 4XNQB 3ZTEA 5EFIB 5K9QG 4G6ML 5FECA 1T1WA 2A9MH 3W5MA 1J9RA 2VSCA 1QRNE 3B3IA 3VGGA 2EADA 1ULVA 3QT2A 1T7XA 2BP0B 3PV6A 4JDTH 1PYWB 5G5DA 3VNYA 4PAZA 1XB3A 3NESA 3KVPA 1IAOA 4ZS6C 3FYIB 3TJHD 4OCYH 3IJSA 3LQAC 3JXAA 2OTUA 5C9JB 3VXQA 1KJVB 1T21A 5KSAC 4X98B 3IPEA 2P52A 3MBXH 5DJ6B 1ZA3B 4EZLA 3CN1A 5CZXD 4WUUA 2RQ8A 4FYRA 3AS3A 4FLSA 2OK0L 5IQMA 4LARL 3QCTL 1D5IL 4LIQL 5GS1C 5I18L 3WUWB 3VW3L 5CKAA 2V3EA 5DJYA 2OKMA 2NY3D 4IIQA 1QD0A 3GLEA 3KYNB 4G1MB 1QI3A 4QRQA 5KSAB 2WXJA 2NDFA 4J8RB 3VFPA 4CMMA 3S5LA 4F9PA 2YMXL 4GXVL 4YDNA 2DYSB 1EJOL 4TUOA 4KJYB 1BJ1H 1KCUH 1S9XA 3QI9C 4ISVB 5GS1B 5LDSA 2VDKB 3NZUA 2B4CL 4M3KB 3MACL 1UWGL 2C3WA 4YDZA 4NT6B 2W0FB 2WJ5A 3QRGL 1K5NB 4NUMA 4P06A 5FA4A 2DDQH 4U3SB 3UROR 3VI4A 4QAWA 5IJCC 3NN8B 1NGWB 4JFFD 3U6XS 4JL2A 3GLZA 3RWIA 1I3VA 1MG2C 1O7DC 3CFJB 4ELKB 5K9QI 3QI9B 2OQJB 1FVCB 1QW9A 2DQGL 2FSEB 4PWGA 3RBGA 6CGTA 2C1PB 3BEVB 3OR7A 1UZ6F 5IM7B 2GAZB 3UTTB 1FO0L 3N43B 3WS3B 4ELMF 3LX9A 4WJ5A 2X53A 3RURA 2E9JA 2NX5A 4HIXL 3B9KD 1F58H 2H26B 2OBGA 3GXIA 5A2AA 4OCSL 3B2VL 4RFNC 3ARPA 5KVDL 1BIIB 4KBPA 3SQBA 3CQQA 2DI7A 3PV7A 2F19H 2YARA 4U2YA 1E27A 4R3SA 4JPWL 1NCTA 2UZYA 4MB1A 4ZAKC 4PBDA 2C7FA 1SLUA 3U0TB 3SDXF 1IZKA 1PVHA 3WNNA 2J8UA 2ZSVB 1KIUA 4RFNB 3FU0A 3SYCA 2X4QB 4E9YA 2AK4B 5D1QA 4FTVD 3JZYA 5C0ND 3BYYA 1AHWA 4KXDA 1SHXA 1MCLA 4ZAKB 3BZFA 4P4KD 1AMXA 4J3OD 3V7MA 1N6UA 3V7AG 4IBWA 1HDMA 4PRDA 5J1TC 1S5HB 3OXSB 3J07A 4AL8L 1FYTD 3STLB 1T66D 2VRKA 3J7HA 2QDVA 1HK6A 2DYPB 3W5NA 2F58L 3HE7C 2J1KA 1TFPA 2WIIA 4KUZH 4N1HB 2FBJL 2FCBA 4HF5H 4WW1B 1VJSA 2NT0A 3RWCA 4E0RA 1JZ6A 4P59L 4POYA 1MXGA 5CWSA 4AKQA 1LE5B 3QDHA 4LHJB 1GAFL 1W0VB 1S9KC 3VCLB 3DMMC 4XBEH 4YX2H 2X38A 4PJAF 1AO7A 3B83A 1QBLH 3HE7B 4XNYH 5TJWK 2KZKA 3L3GA 2IBZX 3V4PA 5T1KB 4ENED 2MMXA 3VB8A 5KS9E 2CJSA 3SODB 1INDL 2BERA 1DLHA 3FT4B 3LRHA 4WFGE 1OP4A 1CLOH 5DLMH 3VRJB 2WVVB 3OAYK 4C4KO 2ZUQC 3GHBH 1A25A 3TT3L 1MLBB 3ZE1F 3WFZA 3LKQB 1IM3D 4DW2H 1S7WA 3DMMB 5CP3A 5DRNA 5IW1B 2AEPL 4ZFGH 1LWRA 1WBZB 1EGJL 2C9UA 4IU2A 4J6RL 1HAWA 3O6FD 2P7TA 3SKOB 1XR8A 4APQA 4XX1E 2QPSA 3QWOB 4BD4A 5IB2A 2N7SA 1D6EB 2CK2A 2ZUQB 1L7TH 2XSKA 4LP4A 2MCG1 3TX4A 3EO1A 3JYCA 4HJUA 1YAZA 5DO2C 5I82A 4GJTB 2ED7A 4NQDB 4UTAA 5EU3A 5GISH 3C5SB 1P7QA 3PGDA 4J12A 5HJ3A 3ZDXF 2LFEA 3RWDA 2NQ3A 4A6YL 4FG0A 3OF6A 2Q3AA 4DGUA 3HFML 3GMPB 2P44B 2E56A 3T1FB 1MJUL 3LZFL 1EDYA 4QO1B 2V5SA 5AUMB 3HNVH 1AD9A 4DT2A 5ADPH 1KLUB 2VDPH 5E5UB 3LMJH 4J4PD 1CTMA 2IDFA 1TZAA 2B59B 5FM5O 5IIEB 4MVBD 1I3RB 2I9LA 2YLHA 4GG6A 3BIKA 1H3TA 3EBIA 3IKKA 3AG4B 3OMIB 5I76A 5KAQG 3U0PB 3LPPA 2WBWB 4OZFH 4XPTL 1KDJA 2XN9B 1EPFA 3GRWL 3BYTA 3FC8A 3ZTJH 1F00I 1I8UA 2L7EA 5J4MA 3H8NA 4AJVA 1UOWA 2H0EA 4U0QB 3MRGB 3K6NA 3BAYA 3KJ4C 4POZD 3CZFA 1U8MA 1BFVL 3WNMA 4JBSA 2GITB 4WU7B 1NMBH 3ETBF 3GSRB 3S37X 2DQ6A 3NZHL 4KZDH 4GUQA 4IKIA 2J6WA 4IDJL 1NM4A 1DVYA 4GFXA 2HPTA 3ZMRA 2YA2A 5T3XH 4JN2A 2WYIA 3OAZH 1RZ7L 2Q8AL 5C3TA 4BFIB 2A74A 2AV7B 3LZPA 3P4OB 4LHUA 2D7OA 2GJ6D 3KJ4B 4NRZA 5DFVC 3CZKA 4XOBA 4PJGF 4ZUWA 4ZZKA 1HZLA 3B2UD 5CJOH 3CLFL 4CN1A 5IVZA 5HPMB 1OF2B 1WO2A 1XFPA 2ZOOA 3BCFA 1T2QL 1CE1H 4KKCC 3C5ZA 4LEOA 4J6IA 4XPHH 2VZOA 4F1ZA 1UM5L 1XH0A 2YC1B 4KHXH 3S3CB 2WN2A 1PY4A 4XAKE 3OD3A 3PWPE 4PJ7E 3IDXL 1ZA6B 1D5XA 4Y4KD 5ICXA 3WTYA 2VZ3A 5EC1B 2E7HA 2ITEA 2GTZA 3VRIB 1BYNA 2R56L 3R0NA 4DN3L 1MFNA 1EEQA 4IRJA 3RIKA 4EE2A 2D7MA 1X44A 3MV7D 4O2EB 5D1XA 3TV8A 1RXLA 3QFJD 3BE1L 3F83A 5EUOE 2BZCA 2Y2WA 1ZLSL 1XBRA 3NCJL 2I85A 4UOQA 4FI7A 4M3HA 4JGNA 3X11B 4XN8A 5GGRB 3NFSL 4UB0L 4MA8L 3GMOA 4ZTEA 1UENA 2MHAA 1DE4B 2NNAA 1OO2A 1ES0B 1DQJB 5FYLE 5BOPA 2VDQL 3GJFH 4GBXC 4PV9A 3FTSA 4MDJA 1Z9OA 4GW4A 3SGJC 1UM4L 1GYWA 5E4OA 4DGYL 2HWZH 2PWDA 3IWUA 3MA9H 3HG3A 5FF6A 4P2RB 3PNWA 2QSQA 2ARJA 4GKNB 1V3MA 1ZT4A 2HFGL 1U6AH 4PFEA 4GBXB 1QVOA 4Z7WB 1I7ZB 3TNNB 2HG0A 5J56B 1RJLA 3GIVB 4PRPE 3VG9C 1OTSD 4J3VA 1ZDQA 3MR9A 1W72A 5IW6A 4QOKE 2BHFA 4RETB 4OZHB 1IRAY 2XPGA 1QSFB 1E6OL 4K5LA 4OFYD 3VYNA 1UD4A 3RTQA 2NUTB 3V4VH 3N43F 4L4TD 2IGFH 2ITFA 2WBJD 3KXFD 4MXQC 1H5BC 1X5GA 5E94A 3OSKA 3LH8A 3W0WA 3VG9B 4WV1A 2IG2L 3V95A 3FAXA 1NPJA 1MCEA 3H9SA 3ZL4L 3ZHFA 3U7YL 1JFHA 1AIFB 1KFGA 1WCQA 1H5BB 5DZNA 4F57H 1BV8A 1U8KB 2DJUA 1SXCA 2R39A 4UQCA 5HVGB 2P28B 5E6RB 2APBA 1TT6A 2OMZB 1W80A 3GMLA 1OIOA 1GGIH 2ODHA 4NZTH 5LN4A 3VDBA 2NY0D 4JPIB 3QYMA 4JQXC 4KH2A 1L9TA 2CPCA 4I89A 2K3HA 4KJWC 2BWDA 2DLGA 4W6XB 5MP6H 2WJ7A 2I9TB 5MERA 3A4EA 2AV1A 4GW1A 3F04A 4PTUB 5C8JA 2G3MA 1DJGA 4E9WA 3DECA 4PJ9C 4IEFB 4H4NA 5C6TH 1OM9A 4G8GA 3ECQA 5D71H 1CTNA 2QVMA 1QNZH 3RWGB 1HESA 4UQEA 3TT1L 3NCWA 3GTVA 4Y2LA 4EBQH 3U36B 4ABQA 4HZAA 4B9KC 2ZNXA 4LPXA 4Z5RB 4LHQB 4PJ9B 4XO8A 3K6FA 1YC8A 2ENJA 4WDIB 1YEJH 2HAZA 1VACA 5GIRA 2OA9A 3QHFH 4JFXB 4HJSA 4E68A 4MA3B 4RMBA 2BDNH 4FYSA 1TVHA