1ROCA

Crystal structure of the histone deposition protein asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
155
Chain Sequence
GASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, chaperone
molecule keywords Anti-silencing protein 1
publication title Structure and function of the conserved core of histone deposition protein Asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1rocA00
2IIJA 5BO0D 2HUEA 4EO5A 2DZEA 2I32A 5EIIG 4RRPM 4ZBJA 2IO5A 2YGVA 5C3IA 5BNXD 2CU9A 1TEYA 3AADB 2Z34A 1WG3A 2IDCA 2Z3FA 1ROCA
chains in the Genus database with same CATH superfamily
1KT2B 4LCWB 4HX1A 2IG2H 3WJJC 2DWSA 4G9FD 3TM6A 4ZDHA 3Q13A 3HG3A 4RFNB 3INUL 2A38A 2NZ9D 4KK6D 1G7IA 5CFHA 2AS5M 2VXQL 1CT8B 4MNGB 5BS0E 4GW1B 4FLQA 3VRIB 2VJ0A 3GS7A 1A21A 1A4CA 3KPNA 3NIFE 4P4KC 4MVBD 3QHTC 2VWEC 5ID1B 5F1OB 5GGUA 5IEHB 1ZANL 4FLSA 2BIOA 5TF1H 5IOPA 4J3TA 3V6ZA 1A9EA 2IPTL 3L6FA 2JKLA 5DO2C 2BVUA 5EEUA 3PJNA 3QORC 4PWHA 4KKNA 2JB6A 3OB8A 4TSAL 2WLNA 4FQXC 3TT3L 1FO0L 1U8LA 3EBGA 3OAUL 1D5IH 1TMQA 4QF1A 2EDLA 2H41A 1HZKA 4QHUA 1IL1A 4PB0L 2R4SH 1DBMH 4GBXD 3QDME 3DBSA 1RJYB 3H9SB 3N91A 5BV7C 4G71B 4KROD 2XKNA 4LCVA 4Q0XH 5E2TL 3QDJE 2FLBT 2WXKA 4G8GE 3RL1B 4NP4H 2VAJA 1E9PB 3QUZA 5HI5C 3ZDZE 1G7IB 2YN3A 4A68A 4N0YL 3S88H 4UOZA 3VFNA 1YYLL 2XQYK 4C4UA 3KPNB 1QRND 2I60L 2JB5L 3VSUA 5MENE 3IFOB 1Z6JT 2FEDD 5GGUB 3A4FA 4B5EA 1N5YL 3U2JA 3LH2L 5DJCA 2E9WA 5DA0B 3WKQA 5IOPB 1A9EB 1P7BA 2EXWD 3L6FB 4KQ3H 1INQA 2IDUA 2CUMA 3HNTH 1VGKB 6FABH 3ZL1A 1A6ZB 1HSBA 4NQTA 3GHBL 2Y0SA 3EO1B 1HHHB 4LLQA 1F97A 4KJPD 1TLKA 3CMOL 2GTQA 4GSQA 5E6ZA 4DNLA 3LKRA 4S2SA 1WUNT 4H0GA 2FE0A 3HLKA 2Q86B 4R8WH 1MCKA 1ADQL 4Y4HA 5TE7H 3RE0A 5H8DA 2FBOJ 4JKKA 1AXSA 4HQQH 1NPNA 1HC1A 4D3CL 3V7AG 5C0BD 4EIUA 3L9EA 4QY8A 1YMHA 1KUMA 3C5JA 4OBSA 5BOZG 3LKPA 3QUZB 1DZ0A 1CPUA 4AYDC 4DP2X 5E5LA 4XP9H 4D0CA 2ZSVB 5DMYA 3ARBA 2CCLA 2ZOTA 2VDNB 4LIQE 1P53A 1YO4A 5DVLA 3HMXH 4P3DB 1AGFB 1Y6MR 3NT0A 1HQRB 2ROYA 1AZUA 4KRPB 4OZHF 3L4CA 5T3XH 3V6OC 4AUYA 2HUEA 1SYSB 3IDNA 3V2AR 3ZL4L 1MVUA 4MQSB 1HSBB 2PETA 1EXHA 1RZIB 1V7ML 2F8VA 4X9BA 4BKLB 3BFQG 3NN8A 3QRFM 2J8OA 1LNUA 1UQSA 1GY1A 1P2CA 3BN9D 1NCBL 4ONHA 4OLWH 1RLWA 4PJ5A 4S1SH 1RULL 3B9AA 2EUZA 4RZCB 4UNVA 1PG7X 4FI7A 3F05A 2HP4A 3FTXA 5H94A 3V4UH 3FO1B 4ZXBA 3OKOA 4N8CL 1KBPA 3NCXA 3LKPB 2BS9A 5A2KH 2NXZB 3RVUD 5F1NB 4H8VA 4RVBA 3VTMA 5IHBA 2XJKA 2UYLA 4KGLA 4U3XA 4Y1AE 2HCZX 3A4AA 3IXTA 3E8UL 5IWLC 2YPVA 5KUMA 1MFDL 3F65A 2EO7A 3BQVA 1MOEA 1Q0XH 3ULAB 1U58A 3IDNB 2KZ1B 3CN0A 4NGHL 3ARGD 4LRNL 2DQHH 1O6VA 4HDIB 2FLRT 4O51A 4GXVH 1A4JB 1UXWB 5D1ZA 5IY5B 2JJTA 3BWAA 1Z32X 4IIQC 4PJ5B 5ESQA 5C3LD 4LCCA 2H9GA 1ID5I 1NAML 1DBAH 3D0AA 1FHNA 2R0LL 1UJ3B 2BNQB 2FO8A 4PTTA 4ZFFA 1YCSA 2VE6A 1XL6A 3QQ4B 3FXIC 3FPXA 3K6SA 1E5AA 5GRJH 2OKMA 1BPLB 1G9MC 4GW5B 4ZXBB 5ILTH 3MRRA 1G0DA 1TTRA 5JDJA 4M3JA 12E8L 3VM7A 2FJFA 5DVPA 1DANU 1S2EA 2NY4B 2IGFH 4L9LC 3RGVA 2PP8A 3NACL 3T0EC 3GF8A 1FLTX 3ZE2F 2UYLB 3W57A 2AABH 5GIRA 4OD3H 1QSZA 3IXTB 4ZPVB 4YC2C 3UMNA 3WFZA 2J57A 3LTVA 3FO2B 1Z0MA 4PR5B 3MREA 1U58B 4DZBB 4N85A 3T0XA 3T8VA 1NM4A 2Y24A 2SODB 5GSVB 1OF2A 3O4OB 4ENEC 2Y69B 5E70A 4H5SB 4BJLA 4OGXL 4O51B 2YARA 3FBKA 1SOSA 4R97B 3E6FA 1ZK5A 3ZHNA 4N1HB 4Z7QB 4PD4J 4UM9A 4CC1A 3FQTB 4LCCB 1IQDA 2H9GB 5C6PB 1FL3B 5DZAA 2WSKA 4WKXA 4KJYB 4ZFFB 2EKSA 1OP3H 5EU6E 1RZPA 3O9WA 4U7SA 3K6SB 5E9DE 3X1BA 4K5PA 4CILA 3UERA 3MRRB 5DSCB 1QWHA 3F7QA 1G6VK 2X4QB 5KYUA 3QHFH 5EBLA 4XBGB 3FT2A 4ZBJA 4Y2OA 3K5SA 5D5MB 1ZTXL 4DZ8A 2XTJE 2HFFA 3RKDD 3SY0B 1URIA 1NCOA 5I1CH 4JB9H 5F9JA 1N5AA 2E8YA 3S8GB 4RMBA 1F86A 2Y6TE 4E36A 2PNDA 3CZLA 1W0YT 4WEBL 3SJVE 2ODHA 1IRAY 3JT0A 4EN3A 1GCYA 4XCCL 1VFMA 2DWDA 4R0LC 3VFOB 2NR6D 3I75B 3INOA 3N06B 2BWQA 5F0MB 4UIMA 4IU3B 2E56A 4MD0A 4F7EA 1NL0H 3MC0A 4XBPA 4C58B 4XTRC 4WEEA 5JZ7D 4E0RA 5HDBB 3KWTA 1YPZA 4XAKE 3NFPA 4WGWB 5J7CC 4JRXD 4BZ1L 1MJ8L 2EKSB 2R39A 2XN9A 4KY1L 4N0RA 4KXDA 2QDWA 3IXAA 4LOEA 2L7JA 4L23A 3S96A 5CEXA 3U7WL 3HNVL 2D8KA 4OGYH 5IV2A 1CI5A 1DVUA 1UB5B 2VERA 4XHJD 2J3SA 2R2BB 4H26A 3QWNA 4OLVL 2CRMA 1FV1A 5TD4A 1JRHL 5DRWA 3KL5A 4DZ8B 4D0DA 1OARL 2J6EA 1B2WL 4K7PY 2F18A 2WN2A 4MA7L 5E6IA 3QPXL 3M8OL 5KSUA 3DI3B 4GO8A 1UXSB 3TJPA 4AZ8B 5IB5B 1ICTA 2NY6C 2LQRA 5LLIC 5ABDE 5JW5A 5C8JA 5F0JB 1PLCA 4WDIB 1Z5YD 1NKGA 1UB6B 3W5NA 1GKEA 4F57H 2X28A 4X4KA 3WS3A 1BG9A 2V5RA 3MUY1 4I85A 4OZHA 3UG5A 2BY3A 3WNNA 1CK0L 4MXVF 2QDVA 2Y6SC 2VM3A 2JK5B 1RURL 3CD4A 3ULUD 2JI2A 4HISA 2Y2TA 2WXLA 2XN9B 3DLQR 2BP8B 3DRTA 4M93C 1G0YR 3LNGA 1KGIA 3FYIB 4LLUA 3S96B 4O5LL 1LYQA 4MDIA 4D9RE 1GMEA 3SN6N 3DXAB 1J05B 2F19L 4PJBB 1FCGA 5IIEA 4PJ7B 2WYZA 1IKOP 1ET8A 1XCTB 4NQDB 1HOCB 3C6SA 1UH4A 1E28A 3IEAA 1DVZA 4G1EA 3QPKA 4B95C 3OC5A 4X5LA 2ICCA 3NZHH 4XVTL 2I9TB 1T0MB 4PHZA 2E6PA 2CPUA 1MY5A 3OLEA 5IQ9A 1FGNL 4YHZL 5C8JB 3B2UD 1YC7A 1QFUL 3ARZA 2C9RA 5LGKA 3ZKND 5SWZE 1LK3L 2P8PA 1E9OA 1WAAA 1KN4L 3PL6D 4D7PA 2WM0A 5C9JB 8PAZA 1XR8B 2YMTA 3FU5A 4NO3B 5E8PB 1IEAA 5D4JA 1UD8A 4Y19D 2BXZA 5CEZD 2PTVA 3OSVA 1KMGA 1CFSB 3OB0K 4U1SB 2CJTA 3UABA 4P5TD 4HJIA 1MHCB 3JWDH 4RZKA 1AHMA 2VC2B 2J2ZB 1UWEH 4RGMC 2XFXB 1F4WL 2NY1D 1CU4H 1I8IA 1RLBA 1XTLA 3AG3B 1KV3A 3F7KA 4J6RH 3KPQA 1SF3A 2BDNH 5SWSD 4Z5RB 1E28B 3GKWL 3SDAA 5AYQA 4IJ3B 1CL7H 3OR7B 4PWKA 4KH2A 4ATWA 3P0VL 3HG1D 5D2LA 4ZYKA 2FEJA 4PRIE 4ONOA 4EI5A 2XX0A 4HSCX 1C1EH 1I1AD 1BM3H 3BKJH 4LSPL 1DBKL 2P5WB 2IQAA 5EU7C 4EKXA 2OSLA 4KI5C 4G82A 4A04A 3TFKC 2AVFA 2J73A 1JGLH 3GSWA 1TJXA 3GSUA 3L1EA 1C9SA 1BF8A 1PAZA 2X6AA 1N0XL 4A6YA 3REWB 2AW2A 1ZJAA 3GKZA 4NJAH 3CFIC 3VYOA 2AXJA 4N9OB 5F7NC 3BP7A 3CLEH 3D39B 3QFGA 4AV0A 1F5WA 3LX9A 3DC0A 5C7XH 3QUZC 4NWTL 5IFHH 3ZHFA 1JFQH 3I50H 4JN1H 2A9DA 4Q2ZA 3OHXB 1Z5HA 3O3DA 5BVPL 1NM9A 5CXPA 3AADB 1YG9A 4JE0A 1FORH 4G3YL 5JOFA 4TYUA 3KPQB 4CGTA 3CVHA 5I15L 3C08H 5F9WB 1NCGA 1UZ8A 2AV7A 4G6FB 2JI3A 4XVUC 3TH2T 5D2LB 1RUQL 4PRAA 2MCMA 1GXEA 5I23A 4EI5B 2QLYA 5AOKA 1MFMA 4G8FB 3ECBA 2AANA 1I53A 3GIVA 5CBAA 1BD2A 2VLRD 4G8IA 2DQDL 4M00A 4WJG3 1CFNA 2A6IA 2KDGA 2YLKA 4JL1A 4M7LH 2J6EH 4D0BA 3CDFA 1HSAA 4F5CE 4BH8B 5J8OA 3VDBA 4Y4HC 4ICWA 5F7BA 3MTRA 2CJUH 4A6YB 1A0QH 4P2YA 4JPKH 1YQVH 5DGQA 4LSSH 3D33A 5DEFB 4YSOA 4U05A 3JV6A 2WUCH 2F6AA 3VRJB 4ECNA 4JRYD 3SDCA 3O6KH 3WEXB 4OV5A 4Q2ZB 3ARBC 1PSKL 3WXVH 1SUJA 1DVFD 2HG0A 5MP6H 2CE6A 4QEGA 3D4YA 3NA4A 4YSUA 5AW3B 3ILQC 1GYVA 3FU9A 1M9SA 3KD4A 3IDXH 3JUYA 3AQYA 4Q4IA 2VZUA 4MJJA 2AV7B 1DVQA 4GQ9L 2GSGA 1WD8A 4PRAB 2A4CA 1YEDA 1EEZB 1QSFA 4ZD3L 4JQIL 5I71B 4UV4H 4HJUA 2FIKB 4ODSH 4XNXH 2VR8A 5F0LB 3EGSB 3NQKA 1O6SA 1BD2B 4G8IB 5J3HC 1FZOB 1GGIH 3C6LA 4KU1A 1CFNB 2BIIA 2DIEA 2A6IB 3STZA 3KG5A 4KKLC 3IMSA 2E75C 1Q1JL 3MNWA 3QT2A 5A6MA 4LVOC 3JWNE 3S4SB 3QZOA 4XPGH 5FS5A 1AR2A 4M7JL 4YPGA 5FM5M 4ZXBC 3QQ9D 4WFHE 4KTGA 3JV6B 4ODTL 3UP6A 1OSYA 4OV5B 4OCLC 2Q9OA 1MWAA 2GIYA 4HPHA 1SXZA 1N9PA 1CF1A 1V8HA 2GBTA 1ZE3H 5CGYD 5D1XB 3TT1H 5CP7A 4LSQL 3WD5H 1OE2A 5T3ZL 1JVKA 1A7NH 4AJ0A 4QRQA 1U8KB 3V0IA 3N9GH 3LHPH 5AVXB 3ZHLA 3X1EA 1AD0A 1CD1B 3H7BB 2DQEL 3HS0A 4KKAD 3REVA 4YFLI 2ADIA 1O6SB 5D1ZC 1J87A 2GITB 5TDOB 3C6LB 5MHSE 1AGEA 2IOOA 2JJTC 2B20A 1ZPUA 4LCCC 2K3HA 2DLGA 4CDHA 5HHQA 4NNPH 1OK8A 1NUFA 1QFWH 1Z1WA 2WLJA 4X7SH 5C0CA 1TVBA 4BCXA 1MFBL 2X53A 2BSSB 2HVBA 3OSKA 4XI5D 4ZMVA 1KCBA 1BSIA 5TGBB 3U1SH 3EYVA 2H2SC 2VITA 3EOBB 1TJGL 3SDDC 3TX4A 1FYTB 3ZY7A 2YN5A 3RGVC 4KJQC 3U0TB 3VFSA 4DKTA 1ZLEA 5DVNA 2YC1A 4DW2H 3PWPB 1ZHKB 2NNCA 4HH9A 1MPAL 3HBZA 2GK0B 5CP7B 4QAWA 2JMRA 1I8UA 2UZXB 5LVEA 3QI9D 3HE7B 4BGDA 35C8L 4QRQB 2BMKA 3ZHKA 4L5FE 1TSRA 1SNRA 2CGYA 3IAPA 1AD0B 4MAUL 2AF2A 3VXSD 4MA1C 2P48B 3DNKA 2BLFA 2ADIB 2C9VA 3GMPB 1IM9D 3BZEA 2BSDA 3TN0A 4BWTA 5F88B 5DQJB 3JWOL 2LTQB 4NN7C 2E3VA 1J1XH 3RVXD 1JCKA 4HUXB 2OS7A 4M8QA 4OCXL 1ECZA 2CAKA 3CHOA 3K4DA 4CMHC 3G6JE 3O9WC 2DBLH 5LG6A 4FJYA 1L4IA 1MREH 5LAPA 5EBMB 4ZQTA 3EYVB 2YAOA 3ZZQA 4AIXA 1TDQA 4NYLB 1CDGA 5KSBF 3G08B 4BE6A 3CFCH 4HH9B 2CLZA 3V4LA 3HB3B 2KC0A 4ZTOL 3FH7A 1ZJBA 2N1KA 3PV6A 2XPYA 3ZKQD 2QHRH 3FN9A 3NEEA 4NENA 4G8GB 2BMKB 2AAAA 4ZOBA 2MCG1 3SDYH 1KGXA 3ATFA 2I32A 2AI0L 3KXFE 5KJ7E 5L4FA 1LDPH 4Y9EA 4EN3C 3QXWA 2BIPA 3ZIMA 1GSKA 1MI5E 3D12B 2Z4QA 3N41B 4FFZA 4XPTH 3V0FA 4HIEA 3RZCB 4AC2A 2PLTA 5CP3A 3TN0B 2JKRM 5E8NB 3MHZA 1U95B 1LTXA 2GUOA 4Z3HA 2WK2A 2UWEA 2Z35B 3X3FH 1KJ2B 2VW6A 5HVFB 4UNIA 2DL2A 5I8OH 3EBHA 4AZUA 4N20A 3HPJB 3BP4A 4WY7L 2OCJA 5I1AA 3WLWC 1CD9B 2GBVA 5HPMA 1NMAH 2OMYA 3H6AA 1ZA6B 3HN3A 1B9ZA 5EWIH 1S78C 2VUOA 4X4XA 5DHMC 5JYLA 5GRUH 1FP5A 2KLRA 1HHJA 4MCZA 1QLEH 1ZT1A 2B4CL 2E27L 1M9WA 4L8SB 5E6IC 4R2GB 3TBYB 1P7QB 1ZVYA 4AW4A 2E7LA 2R59A 1QBLH 1N70A 1MW0A 3HTLX 1MWAH 1DHKA 4LSRH 4BHUA 4X99A 1CXHA 4IBUA 5E2UH 1UZGA 4UQBA 3LZOA 2P8LA 4UIKL 5JIDA 1AFVH 2DQGL 2I25N 2VMDA 4RMVA 4X9FA 3VDCA 3SO5A 1N3NA 2M2DA 3H7LA 2P24B 2UWEB 3HKFA 4PLKC 5IB1B 4OI7A 3V0AC 1WV7T 4PGCB 3EYFB 3LKSB 2WZ0A 1J0YA 1BREA 3L3GA 5GS0C 4H40A 4U1NB 5JHMA 1J5HA 1FBIH 1T5XA 5F7DA 1JZFA 5GPRA 3GC3A 3AABA 4AL8H 1AOHA 3ZE0E 3ES6B 1M1SA 5IF0A 4WWPA 1F4YL 3TXAA 3KPRB 4JKPH 3GGWA 1HH9B 1CQYA 3LD8C 1OCRB 1HHJB 4MCZB 3ZOAA 3O4LD 1ZS8A 2R2EA 1YNKL 1H5BA 1ZT1B 4PRHE 4F8TA 2H1PH 4TNWF 3W3BA 5FX3A 3LEYH 3DPDA 3BKYH 4WVRA 5FYJD 3GXTA 5CLZA 1HH6B 5AYUL 5G4MA 1PVHA 1RPUA 2VR5A 4CJ0A 4AYFB 5KTEL 2P8LB 4PP2A 4JS7A 1MZYA 2WLKA 3NSXA 2MSPA 4ZPTA 4TLUA 3T2NL 5JXEA 1YEIH 5FGCE 5FA4A 3N42F 3VFPA 2CDEB 1R6VA 4L9DA 5E99L 1DLHA 3IE9A 1GC1H 4KDTC 3AS1A 2WLZA 4AWJC 1E27B 3AUWB 3FB7A 3MODL 1KGCE 4IM8A 4O58H 1TQSA 4TL5A 5CLWA 1T5WA 4H2AA 2CBMA 3CSGA 3J27A 4P5RA 1AHWB 4PUBL 3FTZA 5DVKA 3S37X 3SDAC 2UY6B 1XH3A 1UM6L 1G94A 2JFCA 2O61A 2IH3B 3MLSL 1ZS8B 1KG0B 1H5BB 1H6FA 3V9CA 3BKML 1YJDC 3ARDB 4YGAB 1WHOA 4JGJA 4QTHA 3QUGA 3WSQH 2FQGA 1OEZW 2X2YA 4JL2A 3P4MB 2IGLA 5I1IH 5GGVY 1G7HB 4NUQA 2PYED 1NEZB 3G5ZA 1CO1A 3LDBB 4GXFA 1KBVA 4L4VD 2NXYC 1JV2A 2LW3A 4UB0L 3VU1A 3C60D 3T3MF 2AJVL 3VGAC 4AMKL 1U93B 5HGGS 2DIAA 2KZBA 1ECYA 3VFPB 5FFGA 2NUTB 2ZP8A 4FFZH 3F6LA 1F11B 4IOSD 3ZL2A 2LU7A 5F89B 2CM6A 4X7FC 1QNZH 4N68A 5IB3B 4KQ0A 4MJ6B 1T5WB 3VQ2C 4KHXL 1OSPL 2DJSA 2G3MA 2D7TH 2N56A 5HHMD 4HGKC 4JFEE 3FSZA 1XDTT 2YD0A 2X4OB 3H3PH 2JCCF 1CXKA 3ARYA 4HC1L 4QRPA 5EUOE 3V55A 1FVCB 6PCYA 4EAEA 3KPMB 1EAQA 1GGCL 3G5XA 4MRCA 4Z7UE 5E9NA 5I71C 1N6QL 4CL7A 1PZBA 4FQIL 3DGGB 2VUKA 2XTJB 3G5ZB 5SX5K 1U8NB 1RZKH 5F3BB 3QS2A 4MNHB 4RESB 2FJGA 4HH8A 4UBDD 3OKDA 5J89A 2OTWB 1AO7D 5IVXB 1ZA3A 4X5PA 3QUML 2WCSA 4FXTA 4AK1A 3ZTNH 4FNQA 1JF1B 3BUQA 3E38A 2IPKB 1UM5L 2ITEA 3WMPA 2HT3D 3F64A 1E4XH 1HAUA 3D3VA 3SDCC 5J9PA 1UH2A 5FDWB 5IK3A 3GMLB 4YDLC 3L5JA 5D1QC 3RWCA 1EJFA 2Z91A 3NIGB 2RFXA 2EDTA 1W6LA 5GZOD 2YIHA 3LNHA 3RVWC 3VDAA 3FH5A 4PWIA 1J8SA 5EC1A 1FVEA 1KB3A 1X5IA 1HJCA 2AEQH 3US9A 2C9SA 4MX7A 3E3QC 3MRFA 4M61A 3DDFA 3WFBL 1ASPA 3NCYS 1Z3GL 3HRZA 3K3QA 3MYJB 5FO7A 1IBFA 3TWYA 2ESVD 3L1FA 4OKVA 4G9FE 4OCSL 3BVNA 4RIRA 5DD0H 4RWYL 3C6LC 1ETJA 1J88A 4AI7A 3C2AL 1VAHA 3CAFA 3MSPA 5JLZB 2IXQA 3OKDB 2JIXA 3D6GA 2ZOWA 2XQ0A 3PG2A 3L1OH 4NCC1 4NEHB 4YNYA 3U9UB 1ZLUH 5AW7B 1HN1A 5D7EA 1G6RH 4F8QA 4HLZH 3DX8B 1M3IA 1T2JA 1NCTA 5I30L 1OTSC 2BOBA 5IK3B 2GJZB 1H3GA 4X5WB 1JHLH 3TBSA 3U9PH 4XMTA 4NHCH 5FYKL 1G9NH 2COVD 4N2OA 3B9KB 3V0HA 1LO4H 1LO3L 2PXYB 4YHKH 3WO3B 1I7UB 3D0LA 5EC1B 1F45A 4Q9CA 5TTRA 1X4XA 1HKLH 3SE8L 3UXFA 1MCQA 4I1RA 3ML9A 4FDWA 5EV7A 5FO7B 1XMWA 3HS0C 2W60A 2ZAHA 4P06A 4ZAKA 1YYMH 5ADPH 5DC2A 4EEEA 1CFVL 4LCUA 4RIRB 2ZG3A 1WZ1H 3BIKA 4Z18A 1J1PL 2ZX7A 3CH1A 1WBZB 1AP2A 2UZYA 4NFDA 4PS7A 1OAZH 3WE1A 1F90H 4J5VA 2VXQA 5DA4A 4O4YH 4FQQB 5CFAA 1F4HA 2X41A 2E9GA 3PCYA 1MFUA 4FQJL 3D5OF 4JN2B 1QRNE 2ZXAA 3IM1A 5D7LD 3FZUD 4PY8J 3HHSB 3DOSB 2XG5B 2YXFA 5GHWH 1OM3H 4BV1A 3JBG7 2FO4A 5B1CA 5SWZB 3WCYA 3EJSA 4OZIF 5BZDA 4FG4A 4MXWL 1M1XA 2VDLL 3ROLA 3P9MA 3HB3C 1DN2A 1FO0A 4Q9QL 3QR0A 2XACC 4XCEB 2W59A 4JM2F 1OSZB 1QPPA 1V54B 1ET5A 3BO8B 3OQRA 4ZUWB 1JZEA 2P52A 4AVIA 5PCYA 3KZ8A 5D96B 5B7FA 4HK3J 4O02L 4Z7WB 1GC1C 3SYCA 4ZAKB 1YSOA 5M95B 3W0WA 3MUHL 4TL4A 3F84A 5EU3A 5C0BE 1QTPA 3WKYA 1IGTB 4JDZA 3BIKB 3UTZA 1WA1X 2EDXA 3AROA 3GSXA 4AIOA 3BIBX 1D9KA 5DK0A 4HJ0C 1BLNA 2XA8H 5DD6A 4PJEB 1ZSDB 4MQ7A 1GYAA 5DC0A 2AK1H 2I07A 1CF8H 4R9HA 3TVMD 2HJFB 4YXHH 3SCMB 4HHAA 4AIZB 2ZP9A 3EG9B 3MRIB 4TM9A 1QZNA 4N2MA 1MHPL 4BKTC 4U4BA 4CN6A 4LKCB 3ROLB 3VWJA 2J8UA 3FU7A 1RUAL 4S0HA 1FO0B 1C5DB 2VSMB 5C0GA 4ZMXA 4GIPD 5FO9A 4AEIL 3GI9L 1SOQA 3QH3B 4ZUTB 3W56A 2K7PA 2LLLA 4YHML 5DO8A 5IROD 3P30H 1UA3A 1ADQA 1A8JH 3WNOA 2DJMA 3VACA 3B7TA 3W0WB 2OMZA 3DRQB 1W8NA 5EU3B 2JCCA 4UQ9A 1DQKA 4WUUE 3QZMA 1C5CL 1FG9C 2QGCA 5DQDL 5E24E 3BYYA 3LKNA 2X6MA 2EC9T 4K71B 2EXTA 3MOBH 2VERN 4UYQA 3RURA 4YXKH 2VLJD 1I8KB 5AB2A 3ULVD 4C83B 2NNRA 2VQ1A 1MEXH 2WWNA 1F3JA 1Y18B 4U0RC 1A7QH 43C9A 3C75A 3ARFC 3KAAA 4X80H 4FNPA 4OCWL 1JPGB 4BK5A 1S7RA 1QW9A 2H6PA 4HIJA 4IOIB 5CF3A 3IF1A 4G7VH 4GP4B 3VWJB 3FU7B 1ZT7A 2ZWSA 1WVZA 3LKQA 3L4ZA 1RZKC 4IDLA 4XGZA 1ZLVH 5C0GB 3W2DH 5FO9B 4ZTEA 5B4MC 5LB1A 5LBSL 2E7LC 1N59A 3LRSB 3B7YA 3T6VA 3IMVA 4NUGL 4CUCA 1XGTA 2WXGA 3TIDB 1ND0B 1I9JH 3JV4A 3A6OA 4ZMLA 2ZPKL 2VKXA 5D4IA 4PRPD 5C0EA 3KLLA 4ZFOL 3H9HA 1A7OL 3DSFL 5D7IB 1FZJB 4N2FA 1E3ZA 5EU5A 1BQRA 1KJMA 4Z7VF 3Q9QA 1J0KA 2IH9A 2ZCHL 1P69B 4K23L 4FA7B 5LNGA 2DQIH 1RIVH 4J6IA 3KLHC 4MYWB 2O6CA 5I82A 3RRQA 1FFTB 1JPEA 1KCVH 1PIGA 4PHXA 3SE9H 1RK7A 5KVDE 4GEJA 2H6PB 1U2YA 2AJUL 3IF1B 3RUGE 5T1MB 2IO5A 4WHCA 5IB2B 3K6FA 3QJZA 5I28A 4QUOA 4ONGH 3WY2A 1DQML 3BGFC 3CFNA 3L3HB 1O6TA 1N59B 3KBEA 4PJGE 1O5DT 1YY9C 4Z3GA 1VACB 3KR3H 4H1LG 4B7LA 4OFPA 1NAMA 1MF2H 1HCFX 4LCIL 1IGCL 1S7UA 1UEMA 2BZDA 2WWMD 3D69B 1L3NA 1NFDE 1NEPA 4LCYB 5JXEC 1MCSA 1NPUA 5C0EB 3WHE1 4QHKI 5DYOA 1QNIA 3IGLA 4K9EL 5EHFA 2J1ZA 3QIUD 3X3GH 4UUJA 2HSIA 2P46B 1VZIA 1N64L 5EU5B 1Y6NR 3EH4B 4UF7C 1XV8A 5BQ7A 4AKOA 1CFQB 1QUPA 2A0LD 3RVVC 4KKQA 4H1LB 1KXHA 2XV3A 3EO9H 3ECVA 1U91A 5EZLB 3V9FA 1JD7A 1I8MB 2QSTA 2N01B 1KACB 3UJIL 1DJWA 2F1BA 1AI1H 4PD4K 4XP4L 1SDAB 1KJVA 1L9NA 1BGXL 5CKAA 2LOEA 3UH8A 2BY1A 1G7PA 2NZ1A 4OZIA 2N59A 4NN6B 2WBJB 5FUZL 5ECGA 2R2CA 4XC1L 3I6LD 1NAMB 1KZYA 4AENB 3SQOL 4MA8H 4JRXE 5L2KD 1DJIA 2X4PA 3BPCA 4E9WA 1E8ZA 2PYFA 5EU4A 2FATL 5GS2D 4IBSA 3VMOA 5I6XB 4PW4A 3FMGH 2HN7A 3IU4L 2CHNA 1CD8A 2P47B 3CPLA 1CVSC 4PIBA 1N2RB 4N25A 5ICZB 4MJIA 1IAKB 2NY2B 1L0XA 2AXWA 2CHXA 3EJYD 3P0GB 2XX1A 4MNQD 4U0QB 4BSVB 3EYQD 1WWBX 4XMXA 3ZTJG 1XXDC 2QJDA 4PREA 2V4LA 3NPSB 1DVTA 4YBQC 2W8CA 4ZSOE 5AZ2L 4AH2B 4ZNCD 4GRWF 1GYUA 1AE6H 3U0PA 1R24B 2QADB 3G6JB 3MLRH 2D3VA 1G7PB 3K81A 1I1CA 1SVZA 3EH2A 5GJTL 1SYVA 3T1WA 3PRZA 5JA9A 3WGUB 2GABA 2V3EA 2ERJC 5F6HI 3MLWH 1MCOH 1QWNA 2DI8A 3ULUE 2ENJA 2GJJA 3L4WA 4HJGB 4BZ1A 4DEWA 2HT4C 4MQXC 2XETA 1AKJA 5EU4B 3VXQA 4PJCB 1H0DA 3IDIA 3HBGA 3Q5TA 3QCVL 2HN7B 1PX3A 1OTTD 3TLRA 2AK4A 4ZG1A 2HKFL 3HZMA 2ZXGA 5FA3A 2YAMA 4UI2A 4RQQB 3ZKMC 3H2QA 4M9PA 4JFZH 2VZVA 4KKBD 1FZMA 1JNHA 3DTXA 4CVXB 3FULA 5KOVC 2F7RA 4G5ZL 4WWKD 1TIUA 3BAXA 5E51A 4UT7H 4A2DA 2YQ2A 4F8OA 1OGPA 4HPYL 4BK8A 4C56D 1MJUL 3GB7B 3O6FA 4W6YB 2A73B 5EOCH 1AIFA 4M7ZC 5DHVB 5C97A 4JFSA 1ONQA 3VW3H 3IMUA 3BOVA 1D5XB 3EYOA 1OOAA 3KWWA 2M83A 5C1MB 2MKWA 1T0NB 4PRBA 1E5ZA 1G7QA 3HRZC 4YWGH 5DRXA 3EZJB 1ACCA 2EZ0D 4GSRA 5DTFA 4Z7QF 4Y19E 5CEZE 2BO0A 1Q9KA 3L5WB 2KHAA 1SDDA 1AKJB 4ODXA 3QDGD 4NQEB 2EXYC 4XXCA 3ORJA 3TZVD 3CJJA 4ZQKB 3UYRH 3BH9B 5ISZA 2WIIA 1EDQA 2F58H 4TKWA 2WMPA 4GAAA 1ZDSA 4KMLB 5F7EL 3S98A 4XCFL 5FA3B 5SWSE 3T65A 3W1ZA 1AR1C 5EULV 4DUXA 4E5XB 5EEVA 2ZJSL 1MCJA 3C12A 2PW1B 3K71B 3IMBA 3LQAH 5D5MF 1FZMB 3GNML 3DTXB 3HG1E 1QD0A 3SPVA 3U2SB 3ZUNC 3PHOA 2AC0A 4HEME 1JGUH 1TENA 2WP3O 4JZJA 3Q8EA 4FG2A 5I5JA 2DM7A 1RHFA 3L7FB 4RISH 4OGQC 5EZPA 3UAAA 5J11B 3F58L 4PRBB 2B0SH 4JFVA 5IEKB 2OMXA 1BOGA 4ZAKC 3EJTA 4V2CB 1JNLL 1AD9A 3PF2A 3GZPA 3PJLA 1RZ7H 1SDDB 4ODXB 5HDBF 3H3BC 4J1UB 5CNHA 1JIBA 4K3EH 4PJ9D 5DLML 5E6UB 5IMMA 3CC1A 4GAFB 3KNBB 5JHDB 1KC5L 5DUML 1RXLA 3BSHA 1B4LA 3PGFH 4A2LA 4BDVB 4FKHA 1TTGA 2WMPB 5DFTA 3NRQA 4W1TA 1ZSHA 2J55A 4HBQA 2XNAB 3CZSA 3MV7B 3HR5B 3SDXB 2GVYA 4Q9RH 1F3RB 4M62L 3E2HB 3T3PF 1JK8B 3OAZH 4XCNB 1A3RL 1ITBB 2V2WB 2C26A 4NZRL 4RMRA 1ID2A 2A7BA 4D8PA 3DX3A 1Z0NA 1E40A 3D2UA 2VLRE 1I75A 4Q14A 4DWHA 1M6UA 1YEJH 4NKIL 3SOBL 1DJZA 2IFGA 1FIGH 3DOHA 3UDWC 4BSJA 4AQAA 4N9GA 1T4WA 1WFTA 1BZ7A 4JO3H 2OMXB 1RUMH 1A64A 1BOGB 3FUMA 5ECJE 5T1KB 4ODUA 4Y5YB 2AEPL 1AQKL 1GIGH 2N4IA 1SOXA 1G7JB 1HESA 1F1DA 2WB1A 3BAYA 2AJXL 4RGNB 1FA4A 1L9TA 2FL5A 2QELA 5CCHE 5IMMB 3CDGB 4JRYE 4K71C 1INEH 4LP8A 1D9KC 3SBRA 4RH4A 3QWRA 2J4WH 3ZQWA 1RK0A 1RZFH 4IRSA 4JANA 4LGRB 3QNXA 1CBVL 3WENA 3MU3A 4PJ7F 3JTTA 5D7JA 1T80A 4S1QL 4OIAA 1J48A 1RZJH 3UBXI 2FJHB 3Q0HA 3TV8A 3VJ6A 2OZ4L 4D8PB 1EZVX 3L3DA 2GY7B 3VWJC 4TULH 3EOTH 3WTUA 1NCAL 4JDVA 2X2IA 2YS4A 1RSYA 3MXVL 2WTPA 4QYAA 1XSJA 3NRPA 3H9ZA 1P1VA 3QJHA 3GXFA 4EIGB 3BCFA 4WW1B 4OFVA 5DMIH 3K91A 4AQAB 3GSNA 5BJTA 2NQDA 2GEQA 4PMFA 1X5LA 1KENH 4J3XA 4OTXL 2CGRL 4QPEA 2EUVA 4R4NC 4ODUB 3B3IB 4JR9L 4R3SA 2H6OA 3FUNA 4A7GA 3HNSL 1BFOB 2HLEB 4JFEB 4RDQF 2P7TA 4OBRA 3CDZB 1F56A 1HINH 1U3HD 2AXHA 2A9ML 4EIBA 3FJTA 3GMNB 5HHXL 3R4RA 4WF7A 1J5DA 1PGRB 3OMZA 4PJIA 1P4LA 1RK0B 4IRSB 5JW3L 3EBIA 1EUTA 3TF4A 3OKEB 2YXWA 3N0AA 4TUJB 1IAII 3MRCA 4R4FH 4TTDD 4BK5C 3V5HA 4LASH 1HE8A 1F13A 5KVFE 3CVIH 1BXAA 1P5UA 2QL1A 4BCYA 5D70L 4JQIA 3MLUH 4BA8A 5DRZB 4IGBB 5F93C 1YEEL 1BAWA 3WJMA 2FD6L 4NKOB 4U6HB 2OI9B 1PTZA 3RB7A 4AEHH 2YAPA 4PJ8A 4B0MM 3UAJA 5BJTB 4JG9A 4B97A 4GQQA 4XMKL 4N1EA 5AOZA 3HVNA 1KPVB 4R3SB 5J6HA 4BM7A 4JY5L 2DQCL 2G5BB 4N5EC 4PPTA 5F7MC 2ZYIA 4P2OD 4EBQH 1E30A 4J2XA 2FT8A 1OGAD 1BIIA 1PLGH 3CFUA 3DMMD 1FH5L 3VB9A 3ESPA 5EZOL 1LD9B 4PJIB 1P4LB 3ZW3A 1UKTA 4YXLH 1QASA 4RMWA 4IQHA 2X9WA 4X6CA 4XPHL 1JF5A 5D93C 1T7ZA 3MCKA 3HZKA 3LY6A 1YHPA 3VAEA 2VR9A 1MRDH 3V5HB 2BNUA 3B2VL 3BT0A 4XP1H 1VADB 1P5UB 4LOUD 1BFSA 4G7YH 4BH7B 2Q2EB 4YN3A 3VXSE 1M4KA 4JZNA 3GXUB 4HHGA 4PS3A 3BKCL 3G5YA 4Z3FA 5DO2D 2F53D 2IDTA 4JQVC 5IFJA 1RVFL 4L1BA 2NNAA 5KVEH 3LPWA 3BIAX 4FQXD 1QMUA 1YEKL 3QUHA 4LZKA 5JQ6L 3NZ8A 4TVPD 2Q8AH 1XMEB 5GRZA 3VNYA 4B3VA 4XAWH 1DP0A 2BIQA 5LCVA 2JQAA 3SB3A 2RJMA 4OQTA 1A7PL 3ERXA 3IGKA 1H6EA 4F7CA 2FQEA 2VDNH 1KLGB 2FB4H 3D1MC 4V1DA 5FYLH 3RFRA 3EUDA 3BI9X 1ZLWK 1URZA 4OF7A 4JVUA 1TXKA 4YUEH 2PCYA 4HCRH 4X6CB 3GDCA 3TONA 4Y5VA 2E9BA 1ET7A 3C6EA 3HZKB 3IFNL 1Z5LA 2RCSL 5DZOA 4KDVA 4U2YA 1J8HA 2BNUB 2YA2A 4PTUB 3VFGH 5E1HB 1QRNB 1OP5H 1HOEA 3V4PA 4JZNB 1DQTA 3NRFA 1QBAA 2L3BA 3G5YB 4I48B 3V4VA 3OF6D 5IFJB 5D7HA 5DJYA 3NBNA 1NOFA 4PY7A 5DLLA 1DANT 3P3TA 4JM2C 1WUZA 3D0VB 4U1MB 1TVHB 3RWDB 1JVOA 1XZ0A 3QO0B 4G8EA 1PJ9A 1JGVL 1QYGL 2XYBA 4MMZA 3WFHA 3JQOB 4ZFGH 5LGYA 2RH0A 3D06A 1EHLH 1UA6L 4MXQD 4FNRA 1LO2L 4GRWH 1CGSL 1NSNL 3CXHJ 2DEXX 3QZNA 1ZLDA 3PS6A 4OZ4A 4AV4A 1QR1B 4TVUA 1MFAL 4F15C 3SPIA 1SLUA 4I77H 2VH5H 1Z5LB 1D2OA 1XWVA 4B53A 4FEMA 4GSXA 1KB5L 1Z3RA 4J4PD 3MX0A 3S6CA 5HGAB 4PLOB 1YMMA 2WSDA 3DV6A 4UQAA 4PMEA 5D2NB 4UTAA 1GPOH 3MXWL 3P3UA 4PS4H 3CZJA 4KX8A 1QFWM 2F7QA 4OLZH 1A1MB 4OLUH 5E1AA 3TBVA 4AQEA 4OB5L 3HPLA 2WZ5A 3VU2A 1A3LL 4KRLB 4PP1C 1EFXD 1CTMA 4Z1PA 3S8FB 1R5IA 4QXGH 4K07A 4D94A 1H9DA 2OL3L 2Z8RA 3LXAA 5ALBL 3P4NA 1XZ0B 4IRJA 4Z0BL 4G8EB 2ODIA 4X0KA 1I85A 1CIDA 1RZJC 3WFHB 4Z7OE 4PJDE 5AKRA 5F6IB 5EZJB 2MNJB 5ABZA 3VGDA 2CPCA 5FCSH 3ZMRA 4PGZA 1NMBH 1QEWB 3CLWA 3FT4A 4M7LT 1B3JA 3EJJX 2J5LC 5GZNA 5SX4I 1EHKB 4OM0L 4KTDL 15C8H 3O4LE 1EH9A 3F5WB 3WYRA 1D5MB 4NKDB 2JLPA 3CXDL 5FYJE 2BVQA 1A66A 2W0FA 4FQLL 5B21A 1S9YA 1KBGL 4FGMA 1A65A 3O6FC 2IPUK 4TOYL 2P5EA 1MJ7L 2GCYA 3V6FB 1YMMB 1CR9L 4XVSH 2HPTA 3NIFF 1OP9A 4XN2A 3TNNB 2EIZB 3MRGA 4N87A 3WKMH 3HPLB 1YEWA 2WWOA 1MIEL 2OMBA 3DKHA 5B3JF 4B9GA 3P4NB 4XXCC 1PG7H 1YECH 4KVCH 1KGWA 5FHBH 3GMMA 3FT4B 1VA9A 3NCWA 1BQLH 4ANKA 4E68A 4I4WA 2H6UA 1R3HA 4WW2B 4B9CA 1XEUA 5D9SA 1MIMH 3FHAA 4FTDA 2AQ1A 5FB8B 3ZGIA 5LCVH 2WP3T 3UC0L 3CV5A 4OQTH 2MPAH 3TWCL 3MV01 3P3RA 1S9YB 1CGTA 3ZYJA 2JELL 3BH4A 3MJ6A 4MTMA 4JZJC 5C71A 2PYEE 2P5EB 3ZDZF 4L4VE 1LO5A 2O4EA 4OF8A 2R69A 4WU5A 3L5HA 4FERA 1XT5A 4PFEA 3BUYB 2O6FA 4HZAA 3H42L 1UCTA 1E65A 4FULA 1NAKH 4JO4H 3RUGB 1VESA 3CX2A 5JHBA 1TQVA 4MMXA 5I6OA 4FQ1H 4DGIH 3V4PH 4RGNC 2J44A 4UYPA 3AREB 2Z3FA 4M5ZL 5TJWK 3KYOA 3V4VH 1NGZB 4KZCA 5TE4H 3GIZL 1AS6A 4AQ1B 1JZ4A 2YRBA 5HVHB 5AZEL 4I4WB 4LAJH 2C3XA 5HHME 1R3HB 3FU8A 3PJSA 4YHIB 1XF1A 3APDA 4P23D 5D9SB 1GOGA 2R2HB 4R26H 4PGJA 4HUVA 2FZ3B 3QG6A 5EFIA 4KQ4H 2NY5H 5C0RH 3KCWA 4M1DH 5DZLA 2F0CA 2UUDH 3KLDA 3U4EB 1WSST 4Z7NE 1QHQA 3WFEH 4NRZA 5CWSB 1EJ6A 4M1CC 2DTML 2G60H 3Q3GA 1OSEA 4L3CB 5JORA 2BSRA 4JFDD 4U3SA 5ICYB 1MUJA 4E42A 1AO7E 1YRKA 3NJKA 4IEFA 5J1SC 3K0WA 3QG7H 2G3XA 2AXGB 1JUFA 2BSEA 5FECB 4ILDA 1OD9A 1W72L 1GZPB 3IJSA 2Y7SA 5T1JA 4OJCA 4CJ1A 1IVLA 5DQ9A 2CLRA 4AT6A 1EK3A 1BJ1H 3F7PC 3SBPA 4F91B 4XTRD 3TF7C 5SV3A 1T21A 1LP9E 1D5ZA 5A6IA 3NESA 3C5SA 1H8OA 4IRSC 1D6EB 1IBZA 4JRXB 3FOMB 4NPYA 5BMFH 4JFPA 4XMPH 5D7JC 4ZO7A 4IKNA 3PDGA 4Q52A 4XHQA 4ETQB 4YS4A 2BVOA 1A5FH 4JJHA 2C7UB 4XC3H 3D25B 2J21A 4GRLA 4HSQA 3TTSA 2OSWA 4QRFA 2R8SL 1T7VA 4YGVB 1CICA 1J12A 4HUUA 4LBEA 5E03A 4X9HA 4AM0B 1H9VA 4S0TD 2OM5A 4HOMA 4BK4A 5IUCA 4U3SB 1XQ4A 4E42B 1SQMA 5HSFA 2K8MA 2IBBA 3KPSA 1JUFB 1PX4A 3FQ1A 3OPZH 4PWJA 2TSBA 4X6DE 3BUDA 3RWHB 4K94H 1S9KC 2VC2H 1YNLH 3QXDB 4P9HH 2FGZA 2NW2A 1IB5A 5DQ9B 2CLRB 2Z4TA 1GTNA 4QXTA 4X98A 3AG2B 5I1EH 4P05A 3VE0B 5C08D 1OCWH 1PNDA 1T2XA 1P1ZA 3IN0A 3OZLA 5KG9A 3GQFA 1M42A 4HALA 2BVTA 1D5ZB 2I24N 2PWFA 2WXMA 5FGSA 3BE1H 4PRDB 3VI3B 5HY9B 4QKXB 3NCBB 2G75A 3B9EA 3WS6A 2VN3A 3MNZB 3LS5H 2BVOB 2LAAA 5JMRA 3MLYL 1KCSL 1P5UC 5K9OA 4XNBA 4GRLB 1QSEA 5I9QC 5HYJD 3UPAA 2TRYA 1KELH 3OXRB 2ED7A 2VIRB 1CICB 1E4HA 4L8BB 5DS1A 2P9RA 3RA7L 3MJ7A 5JR1H 2QZQA 3QCTL 1AY1H 4OT1L 4PJ8C 1L6ZA 2NLJA 3W5MA 4KXCA 3CMGA 5F97E 3G04B 3QUMB 1UENA 1KCRL 2JXMA 3LS4H 4M6OL 5D7LE 4CRPA 4AXWB 2LFEA 1TZGH 2WCPA 4LARL 4NS0A 3U1PA 1S8DA 1FE8H 2AGJH 3D05A 4JY6B 4PJXE 4ALAL 1DR9A 5FO8B 4LL1A 2ZCKH 3Q8CA 4GB9A 1N8ZB 1IGFL 1DCEA 5K9KB 1IC4H 3UTQA 1IBGH 3DYOA 3ATBA 3UJTL 1OPGH 4JPVL 1JVLA 3N44B 1COBA 2VDOH 2Y36L 3LRLA 1JZ6A 2ZUQC 3QEQA 5BOPA 2H5UA 2BXYA 2ZUSA 1ZXKA 4LLVB 4NNXB 4HIIB 1QSEB 3QP3A 4AGPA 3QDMA 2KT6A 4G9DB 2Y1YA 4QGYA 5J56B 2WUBH 4GSDH 3V7MA 1KYOJ 5SWSB 2FEEI 3MJ7B 2X2UA 2ZKHL 1ZVSB 4MS8C 4X5QA 3QA3A 2NLJB 3UTTB 4Y7OC 1V55B 3HG1B 3QDJA 2WSPA 1UASA 1X4ZA 3OZ9L 4BD4A 1I1AB 1TZIA 3QXTA 4KI5D 5IVXF 2ATAA 5EORH 4MKTA 1D6VH 4QXUH 1TO4A 5MENA 1FSKB 4WKZA 5KAQF 3GRBA 2X9ZA 1TETH 1TCRA 3D9AL 4H8WH 4HULB 4JFFA 2XQBL 5EBWB 1XGUA 1TZHA 5AFAA 2H3XC 3O2VH 4JO2L 1DQJB 3QUZD 4ABQA 4Y5VC 3RVTC 5B22A 5I5MA 3L9RB 5DMKB 5FFOA 5C2UB 3W11D 4O02A 2XV0A 3EH1A 3U6RB 4F58L 3L9YA 1QFHA 3T0VA 3S36L 5MEQA 1D3CA 2AQ2A 2EDDA 5TFSH 3UJJL 3RPIB 1FZKB 5KYYA 4XVUD 5GRVK 3BZFA 5JTWA 4HAGA 3WOVA 1SN0A 3VXNA 3S5ZA 2AEWA 4KPHL 2E7MA 3QR2A 4GY4A 2VLJE 3FB5B 3ULVE 3P73A 5BVJA 5MI0C 5MEOA 5CJQL 4MMZC 3QZLA 1IC0A 4PJAA 4I13B 2MQ3A 4HU2A 1R1CA 2FGWL 3MCLH 4YVNA 1TCRB 2CXKA 4HJTA 4OGZA 3TJHC 5K93A 5L88L 1P7KA 4FQ2H 3FO9B 1WTGT 3MLZL 2W0PA 2G0KA 1TJHH 5LWYL 2VUYA 4DK5A 4Y9CA 4JRYB 3HCVA 2H2PC 3BRGC 1N7MH 3KHQA 3QWOA 1DVFB 2DLEA 5I8CA 1GY2A 4ORZC 5KYYB 1RCYA 4OFDA 4MASA 4MYPA 1SM3L 3QCUL 3BZFB 4PRPE 1KEGH 3WUWA 3OLGA 2KERA 4RLDA 3DV4B 4KX9A 4F1ZA 2YPLE 2NPLX 2CMRL 1YA5A 1F18A 2O6EA 3JVFC 1BBDL 5BVJB 5J3HD 4DKEL 4IRJC 3SY6A 4U6VH 1I9IH 1I85C 4KKLD 4PJ5D 4I3RH 5DUBA 5CEYA 4Y1AA 1IEHA 3FH8A 4LKXA 3V8CA 2DB8A 2BNQD 1KNOB 1F02I 1SY6L 3QARA 3WUWG 1P4IL 1ACXA 1QAWA 4YQXL 1MH5A 3RHWK 5AOLA 3TNMB 4B50A 4ZXBD 5GZNC 3WNMA 2DYRB 2XPZA 1P7KB 1J1OL 1AZNA 3HN5A 4LPXA 3AU1A 3FO0H 3QO1A 2LV4A 2SEBA 1OAQH 4WI9A 2NY4D 1R3LB 3RFZB 1MAML 1KGYE 5BV7L 5BW7A 1BQHA 2HVJA 1DSFH 3QWOB 3BZDA 3GRWA 3FRUA 3UBXB 3BZ4A 1T83A 3ARRA 1XSIA 4LPWA 4GAJH 4Z7WF 3X1NA 5AB9A 1F58H 2A74C 3L95B 3V0WH 3WUWB 1NLDL 1TO5A 1MCRA 1OY3B 2GI7A 4YX2L 1PYWA 4H2CA 1KXVA 2CXGA 2VJXA 3PUUA 5D1ZD 4JHVA 4LLDA 4N2GA 4AQ8A 1NGQH 5KSAA 4ATTA 3EFFB 1U8PA 3DYMA 5FC9A 5T1DL 1U8HB 4JRWA 4PJEF 3RBGA 4LKXB 3IDUA 1MDTA 5HVHC 2ENYA 5JIIA 3CC5A 2FBJH 3R06B 4NC1E 4JHWL 3ZJAA 1S4IA 1CE1L 4JFOA 2XXCB 4KVNL 1IGYA 4UT9H 2A9NL 3PREA 5I1KH 1WZAA 5F7WC 2H2SD 4YJZL 1KYDA 5E7BA 3HMWH 3RGVD 3E6HA 1SOKA 3EUUA 4LAQL 5GGSB 2C5DC 4KKCC 2GC4C 1GS8A 2Y07H 3P0YH 3BZ4B 5L2KE 4XNQB 4HIXH 4UDUA 1NDMA 1UFGA 4IHBA 3OMAB 2Z92A 1K2DA 5E8DL 4L8DB 3QI9B 1F1GA 3FTYA 4XZ4A 4ZFOB 1OHZA 4LOFA 2D0FA 1SGKA 3GMQA 4MMXC 1DQLH 4UM9D 4MNQE 3GUFA 2A77L 4E41A 2ZOUA 1U8PB 3Q2CA 2B3RA 5T5NG 3ZR6A 1OXYA 3LPGA 3U7AA 4ORGA 1MHEA 2W9EH 4BZ2H 3O9WD 1JJUA 3DHPA 1WFJA 3HE6A 4J3SA 3SJVA 1ZRUA 4U6YA 1AXIB 2DH3A 1WP6A 3EO0B 1MW1A 3QJUB 1UOWA 1YNTA 4QRSA 5IHUH 1IV8A 2I85A 3BVVA 1NLBH 2APXA 2UZIL 3L4TA 2YMOA 3HC4H 1OP3K 4LIQH 2ZICA 3QHZH 1NMCC 4J28A 1E9QB 4NLAA 5I17A 2CUAA 3BWUF 3CSBA 1HIML 4XRCB 2FWSA 5GGVL 3SKJH 2WTRB 4WI0A 5HDQH 1G4MA 2AMGA 3C5ZA 4FXLA 3M6DA 1OAXL 3CUPA 4EN3D 5E6YA 1FAIH 4LT7A 2FX9L 4F2ME 2QTVA 3DGDA 4A7UA 1EZSA 1N4XH 4E41B 4HLJA 1L7TH 1OK0A 2DTSA 4QHMA 2MEJB 2HFTA 3PDDA 1KULA 3PPSA 1MHEB 4N6QA 3OBAA 2XN9D 3RJQB 4JNXA 4C56E 3KPOB 4Z0XB 4A7SA 4W9CC 4XN9A 1RJLA 3RY5A 2ORBL 4U6YB 1JDDA 3Q01A 1MCDA 3LN9A 1YC8A 5CZXC 4FOMA 4OSUH 1SJEA 4NQDD 2A6JA 4P2CG 5IFAL 1J5OH 4N1CA 4GG6A 1R75A 1CICC 5I17B 3AMLA 1JI1A 3MUJA 1G9ML 2O5ZH 1HL9A 1RD6A 5E6ID 4MA3B 1F42A 3BD3A 5HGBB 3QDGE 4WI0B 3FCUB 1R17A 3B43A 3PABA 4AVHA 1DJSA 2B77A 2XZAL 3H6JA 3M7FB 4GMTL 2JKWA 4RFOL 4JO5A 3FRPB 1ETZB 2ZE0A 3MOAH 1OCOB 3FFCA 3GRWH 1NIFA 3KM1A 1WPCA 1SFDA 4F37K 2OTUA 1NIBA 1NH6A 2R0ZH 5IZ7A 3UTSA 4DGWC 3WHXB 2IG2L 1SZNA 3JUZA 4N4YB 2X88A 4PLKD 2IH8A 4O2CA 5GS0D 3E1ZA 1SN5A 5ESAB 1LEKB 3WS6C 4GRMA 4FYSA 5EOCJ 1Q9WB 4O2EA 3FQRA 1KXTA 3FFDB 4RAUA 5FLVA 4BCZA 5AVRB 4EZMA 4DP6X 2BP3A 1U2HA 5TF1L 3IDJB 4FKKA 3VFTB 1U92A 1BVKB 1CE6A 4GG6B 2EIBA 4M7KH 1Q0EA 2H0PA 3O4LB 1S9XA 2OSXA 2R0KH 3DVNA 3DUHA 3U6XS 3ZYOA 3WIIH 1D5IL 1SEBB 1CDUA 2F8IA 4AJYV 1ETA1 2VLMD 4YFLF 2R4SL 1AYRA 1DBML 2M8XA 1JK9A 4DVBA 5CN3A 4YHOL 4G43A 2VLKB 1FUNA 4U1LA 1HKFA 3FQWA 3GM8A 4LNVA 3DBXA 1GGBH 4W9IC 5HHPB 1GZQA 2WVSA 4Q0XL 3D39D 3O11A 3ZKXB 3DPBB 4LQFH 1EZLA 4NP4L 1E4JA 1ACYH 3UYPB 3TH4T 4PRIA 5J6GA 4Y16A 4ELME 4P57A 1MDAA 2EH7H 2NYYD 2UY7B 4G42A 4KXZI 5GRVL 4PB9L 3O6LH 2O6DA 4HFWB 2V3DA 3G6JF 4P59H 1QA9B 4ZS6C 2PKDA 4CC0A 5AD0A 3RNQB 3Q6FA 3LEXA 1HX0A 3M1BA 1CE6B 2YUWA 2ZG1A 1FQ9C 4G6FD 2CBPA 4KQ3L 3S3PA 4WI6A 1SJMA 5LGHH 3FW6A 3HNTL 6FABL 3S35H 3BQUA 4DFHA 5CLTA 4EI5D 5I1JH 1KWGA 5AYTA 4Y0GA 1OGTA 3JSSA 3N1FC 1W0WA 3V52H 5I1LA 5FV2A 1NCCH 2AQNA 3AWFA 2XHNA 4DVBB 1M3JA 4R8WL 1RZQA 4G43B 5HHOA 4P04A 5TE7L 2K1MA 3IWVA 4U1LB 3C60B 1VLXA 2PPFA 3S34H 3F7YB 5HHNA 1DVYA 3QNYB 4UZUA 3V0DA 5KSBE 4V33A 3HG5A 3IRZA 4TUKH 2A2QT 1LILA 4OQ1A 2HX7A 3FSOA 4FZ8H 4G42B 4PH8A 4XP9L 1VHPA 5I8EA 1ERNA 4DJMA 4PJHA 2EYRA 1ED3A 1R5VA 3RPKA 3F62A 4JDEB 3HMXL 3Q6FB 3LEXB 2YOCA 4F5CA 1NGWA 1EEUA 5T3XL 4PJFE 3VFMB 4KNQA 1B88A 3QYCA 4UAOB 4HGMA 1XH1A 25C8H 2OULB 5MEPB 3HR6A 3RWIA 2CK0H 4U1IA 4KK5D 1EVUA 4CVZB 1BD2D 3US0A 1E5BA 1KLUA 3CLFH 1IE4A 4AYID 1MLCA 5CZRA 5I1LB 4ADIA 1W91A 4FI6A 4OLWL 4S1SL 4DOHB 3O45B 5HHOB 1L5GA 5GGRA 3L3IA 4XXDB 1OTUD 4C47A 1EV2E 2WN3A 5DJXA 5ICXA 4OCYH 5IW3A 5I2IA 1KY7A 3V4UL 3DX1A 1PU0A 4K8RH 5EO1B 5HHNB 3BEWA 5JPNB 2VR6A 4ZW8A 3QUYB 5CJXA 3KDPB 1CLYH 4WJKB 5AOMA 1XAKA 3I6SA 2EH8H 5JA8B 1J0ZA 3AT8A 1LLAA 4ZUVA 1NKRA 1I7TA 1JYXA 2IOMA 4FTVA 2P43B 3VGHA 4ZOEA 4P0DA 5E94A 5C0FA 3MRLA 5A2CA 4XPAH 5ERWB 1Q0XL 1U9KA 2DS4A 2QFRA 3H0TB 3ZE0F 2APTA 1B6DA 1OGAE 2JI1A 1MQ8A 1EXGA 1QSFD 1QRKA 1ETB1 2DQHL 4GXVL 1YLBB 2C1OB 2ESVB 1D5RA 3C6LD 4XNZB 1MLCB 3QIBA 4GKNB 4PVBA 2EIJB 4RX4A 3L17A 4KUZH 3MA9H 1I4FA 1WBXA 3OQ3B 5EDSA 1DBAL 2DQTH 5HD8C 3L3IB 4KNTA 2H3NA 3JWNG 5A6LA 1FN4A 5GRJL 2W88A 5F44A 1QKZH 4C57C 5ILTL 1JZDC 5DRNB 3HAEG 1RP8A 3N1PC 3U0WH 4P5MB 4QIRA 3QQ3A 3LN4B 1FYTD 2IGFL 2F53E 3FF8A 1X7SA 4WHDA 1OT4A 3IGFA 4X4ME 4ZUVB 4HXAH 2AABL 1F41A 4KDWA 4RMUA 4Y7MA 4OD3L 4FTVB 3ILPB 4TVPE 1QUNA 4JVWA 4ZFQA 1T83C 3HE7D 1GGUA 5D6CA 1LO0L 2A9CA 1MVYA 4NB7A 5ANMA 1EXUB 3BH8B 1PNCA 2ALAA 1WCBA 3NIDE 3WDJA 4BEIA 1J7VR 3HZVB 3HAEB 4QYOB 4X6EA 5L4IA 1JWUB 1KXVC 9CGTA 2HFEB 3NSYA 2XOTA 3ZX1A 4J3OF 1A7RH 3HIZA 1P84J 1QEXA 2N7AA 1H8LA 3MO1A 3OKLB 3QIBB 3QNZB 3DK0A 4AQ8C 2FNBA 2XYCA 5KSAC 1WBXB 4XOBA 3D52A 2C9UA 3TT3H 5EG6C 3DA0A 2H3NB 4GMSH 3RP1A 4YK4C 1S7QB 5DGRA 4ZMQA 3H4HA 5GJSH 1UT9A 3UGEA 4DN3H 1NBQA 4W9EC 3QHFL 5GS1A 1A2YA 1NGPH 3R8BB 1R34A 43CAB 1SBSH 2NTFA 2W9DH 4A2MA 5G2NA 3UPCA 3HB3D 4CMMB 1ZEAH 2V5SA 3BD4A 4YDJA 3IKCB 3BWSA 3OJDA 4ODVH 5I1CL 4JB9L 4M6ML 3A24A 4ZO8A 2EO9A 1JGDA 1B0GB 2XWCA 1D7DA 5E4EC 1AQHA 1VKXA 3T5WA 1WCBB 2I60H 4BUGA 3K1KC 3PUCA 2Z7UA 4IDJH 2P1YA 5DU7A 4H4NA 3UACA 4OLEA 3TYGH 4WO0A 4BRVA 3O2WL 4WCYL 5EUOF 3TN0D 1LHZA 4MJ5A 3WDHA 4EOWH 4KWUA 4XWOD 4Z7UF 3SQBB 2VL5A 2ADJA 1PZ5A 1P6AB 2IBZY 2B16A 4HJ0D 4PLJC 1JTPA 3HE6C 1DBBH 2HUHA 4OGYL 3BVDB 4KK9D 4QCIB 4AOFA 3KXFA 2R29A 4DP0X 3V6OE 3WJLC 4QTFA 1MI5A 3DX6B 3ABKB 2Y7QA 2C9AA 4QRUB 3IETB 4WK0B 5LBGA 3VA6A 3QJXA 4YDJB 3FQNA 1H3PH 1OAYH 4B9IA 1BZEA 2WB7A 2BX5A 1P7QD 1JGDB 1INDH 1J86A 2IANB 3VVWA 3AGWA 3C5ZC 3FCTA 3C5XA 3PNWA 2WV3A 3CZNA 2W94A 4AYMC 2VDPB 5K39B 2ENQA 4F57L 4K7PX 3ESUF 3FQ4A 1AH1A 3I3DA 5FGBA 3SKOA 1RU9H 3KGTA 5EMYA 3TA3A 1DYZA 5I0WA 5ITBH 1PG7W 3TEXA 3LB6D 3F12A 4NZTH 1PZ5B 3CCHA 1T1ZB 4XNMA 2O5YH 3WNKA 5CJ5A 1I7RA 2ZOKA 2EE3A 4G6KH 2XG4A 3IMWA 1EPFA 1OAUH 3I84A 2JJWA 5C0NC 2X7LA 3GBLA 3GD1C 5C07A 1L7IL 1G84A 2MOGA 3HVDA 1OT1A 2OYPA 1WG3A 2Y7QB 4XPBH 3EGXB 4UDTA 1HILA 4NZUL 2HXAA 1FHGA 1K3IA 2X89A 3LPOA 1RL1A 3G5WA 1RK1A 4XXWA 3JTBA 3WBDA 2NY0B 5B4MD 4JX0A 4C55A 1DLFH 3NZHL 3QQDB 2OL3A 3ARQA 1PZDA 1HHGA 5CSBA 1E42A 5D7KD 3FCTB 1ZPLA 1HCZA 4OD2B 2VR3A 1SJHA 4APXB 1DSYA 1XGYH 2HRGA 3T4AA 4X7CC 2C9PA 4QXWA 2QFPA 5DJDA 4PY8I 3VGEA 1IFGA 4JFTA 2K9UA 3TA3B 3II2A 3VXPA 4QMEA 3F12B 4TF4A 4NDMB 3U2IA 1A47A 1KB5B 4PRHA 3IPEA 3JWDL 4MWFA 4IW4C 3WFCH 1UWEL 2Y25A 2F54B 1F4XH 3L7EA 4I8DA 3OXSB 4OFYA 2BDNL 1HILB 4U1JB 4UDTB 1EZUA 3ZSTA 1RK1B 4HKBA 1T7YA 4L5FH 5BNXD 4W9JC 4N2CA 1IFHH 3UBFA 2OL3B 4GSUA 1FFOA 1HHGB 3M86A 2ADGB 2IDCA 2LLNA 1DQDH 3MV9E 4H0IA 5JQIB 1YY9D 1C1EL 1WQVT 1BM3L 5J5EA 3BKJL 1CDHA 1O5PA 3T4AB 3T71A 5GGTA 5DJDB 5JXED 1JGLL 1T2QH 3GSRA 1P4BH 3P9LA 2NW3B 1S7TB 3CFBA 3I6KB 1JXJA 3BDYH 3BW9A 5DJ8B 1R46A 4NJAL 5F1IB 4Y5XB 3CLEL 4KXBA 2OYMA 4MD4A 1TQBC 4NO0A 2GPZA 5C7XL 5DD1H 5IFHL 4GW4B 4PV8B 3MLXL 3VWKC 1JFQL 3I50L 4JN1L 4Y16C 4LVEA 4U7KA 2GJRA 3SKMB 1MCFA 1M7UA 3UO1H 2PPDA 3H1ZA 3DARA 4JFDE 4GI6A 5FWQA 1AIZA 1FORL 5AB0A 5C09A 3SKNB 2ZF9A 3OX8B 4WV1B 3C08L 4E9XA 3TBBA 3RIAF 1KSRA 1IC1A 2DY2A 2KZKA 2X70A 4IRZA 4LEEA 1HDMB 2QPUA 3SOTA 5C6TH 2YPKA 2Z31A 3L2MA 1FFOB 1D5BB 3BQUC 4X8JB 1RJZA 3VXUB 2R29H 1V5JA 4XN1A 4KK8C 2DICA 2Y9RT 3UFIA 4APQA 3GZKA 3WE6A 1BWMA 4M7LL 2R9HC 2J6EL 4NQXA 3D4CA 3GSRB 5F3HA 2MOQA 2CJUL 3CFBB 4YE4H 1A0QL 2WQ8A 1S7WB 3CZEA 1OE3A 4JPKL 1YQVL 2ZXDA 3P4LA 4MD4B 2BRRL 4NAQA 5AZUA 1AZZC 4LSSL 1OLLA 2VZSA 5DHVH 3CN3A 3OKKB 2OJEA 1MQKH 2BOLA 2HG5A 2ICWJ 2WUCL 4M8UA 3O6KL 4OZGE 5DUJA 3EKCA 4MNQB 3WXVL 2MHAA 1XHHA 5MP6L 1DDHB 3GHEH 3BAJA 4X0NA 4NUJA 3O3BB 4N3TA 5C09B 3W38A 1GKOA 1QACA 3IDXL 5HYSA 4WFED 3BPOB 1G7LB 2CO7A 1W72A 3M07A 3TC9A 3NJJA 2AEOA 2KMWA 4EN2A 2X0WA 3MLTA 1CWVA 1XL4A 3D2TA 4UV4L 2H8PA 4QOKA 2OJZH 5IBLC 7TAAA 5IQMA 4ODSL 4XNXL 1BJ1J 3QBTB 1SJXA 1TKWA 3IKKA 3BWUC 1GGIL 2XBTA 2IIJA 2AEIT 2HT4D 3F83A 5T1LA 2XY2A 2BHYA 1HYSC 3CSTA 5CR1A 1J9CT 3QPXH 5GRXG 5HYSG 4DCQA 2EEAA 1GW6A 1HXMB 4MNGE 2GSMB 1AQ8A 3QAQA 4XPGL 5AB1A 3L5XH 5H94B 1L0PA 4R7DA 3SGKA 3CFKA 2F9BT 3E8VA 4AUUA 5HYJE 4XN5A 1Y7VA 2HG5B 1GRWA 1OHQA 3ME0A 5CJXC 5TQ2H 1FNEA 5E0FA 5FK9A 2OXHA 1SVCP 1NOAA 1ZT4A 2MHAB 3ELQA 4D7BA 3J07A 4AEEA 1ROCA 4NRYB 3WD5L 3TT1L 4RAHA 4WWKB 3BSGA 3AY4A 1A7NL 2NSQA 3C8KB 2PXYD 4JJ5A 4JAMB 1VEOA 1W72B 2D03H 1CG9B 3I74A 1SLXA 1SHWA 1T89A 3N9GL 3JWNC 3PY9A 3LHPL 1BVOA 3IFLH 3H9SE 4GQPH 3MLTB 3RUGF 2H8PB 4QOKB 3U1QA 2YBRB 4I1PA 1H8NA 2X44D 3S48A 3PHSA 1TYRA 5JHLH 4AG4H 3K1DA 4OY9A 4IKLA 2YEZA 4PJGF 1K8IA 1I82A 1NC2B 2JIXD 2KKQA 1DE4A 2X4SA 3TZVB 1YJDL 4NNPL 3LCYA 1QFWL 1MRCH 4JREC 4X7SL 5HI3C 2J1YA 1NFDF 1QFUH 3N40F 3TYFB 2K45A 3BPNC 1AR1D 1VFAA 3A47A 3U1SL 2VL4A 2FWOB 3LRHA 5GGTH 3RDTC 4UTBA 2OXHB 4MCYA 2NX5B 2Y2WA 4DW2L 4ZS7H 4KITB 1ZLUK 3VCLA 2AFNA 3QJFB 5L6YH 2GUYA 1OF0A 4AGLA 4GIOA 2QQKH 2EO1A 4NOFA 4J3OH 5FFLA 5EU7E 3UTOA 2Q10A 4CW1B 1SXCA 4KI5E 4ZK8A 4XWGH 1F4WH 4JKWA 2EDOA 2E59A 2KLSA 5DZNA 3RQ3A 3BESR 4LEXH 4JM4L 2GJ6A 4ZAKD 4FA8A 3ROOA 3K2MC 2G2RB 3EOAB 1NTDA 4R5VA 4C4BA 5DK3A 1O7VA 1S5HA 4IRZH 4PW9A 1J1XL 1A9BA 4G6MH 2X87A 4MMYA 4IBVA 2DBLL 2ATPA 4P8QA 4H7VA 1JNNH 1MREL 3PQYB 1VFAB 3SCMD 2LLGA 4YIQA 1YN6A 1ZWIB 5GS1C 3KBHE 4ES8A 1NJ9B 3CFCL 5E5MB 3V7AE 3G6AA 3NFNB 1IARB 1TQCB 3VCLB 4OGAC 4F7TB 2QHRL 4TNFA 5KSVB 1V27A 1R4XA 3AQZA 4K9JA 3SDYL 2ID5A 4DH2A 2FX7H 1E3FA 2OP4H 3VXTA 4KY2A 1CDJA 4JUTA 4L1HA 1KB9K 3CVCA 1PIFA 4ZMZA 2GJ6B 1A4KA 3ROOB 3W0WD 3RWGA 4XPTL 5CN2A 3GSQA 4X6FA 3WTXA 4M5YH 4MHHG 1S5HB 3O0LA 5DD5H 1FPTH 3X3FL 2J88H 3MMEB 3W9DB 3ULUF 3CQPA 4MMYB 5I8OL 2IALA 4WZ9A 3PGCA 4L37A 1NMAL 2X2JA 2ADYA 3CHXA 2WLIB 2ZUWA 2CBQA 5DDHA 3P9WB 5EWIL 2BP0B 1VSCA 5HGDA 1CBJA 2EDFA 4M6NH 3RWFB 1ZGLB 2J7LA 1BM7A 3L3JA 4HZLA 5GRUL 3VWJD 2CD0A 3G6AB 3CX5K 1QLEL 4WUUA 5HGHA 5EUKA 3BLKA 2G9HB 1CLCA 5EZIL 5FKAB 5B1JA 4PJ5E 1QBLL 2WXHA 4AE0A 3VXTB 2WZAA 2AHIA 1TQWA 3KYAA 2X05A 2EVHA 1MWAL 2OXGA 1S7VB 1AGBA 2EDWA 4LSRL 3AB0C 2V7NA 2BNQE 4R4ND 1A4KB 5D1ZI 5E2UL 3RWGB 2AJ3A 5KUKA 4DF9A 3ARPA 3GSQB 4X6FB 1AFVL 2R7EB 4K3HA 3H2PA 5FGBC 4PJFB 3T2OA 3TA3C 4Z76A 3ARGA 4NHUB 3VI4A 5BO1L 4XZUA 1A3ZA 2IALB 1U3HB 2YKLH 3QZPA 2JH2A 1FBIL 4P4RB 2YSSA 1WEJH 4GKZB 3N44F 1ZMYA 2WQVA 1QZ1A 4AL8L 2CO6A 4XNUL 5FO2A 4N0UA 1U0QA 2IPUG 5I6LA 4J3WA 4D9LH 2HJLB 4BFEA 4WTWA 4X4YB 3L3JB 4JKPL 4HZLB 3Q7JA 4U3HA 5AKVA 4XXWC 4Z95L 4U1KA 4GS7B 3AXIA 2H1PL 5EUKB 4A7TA 2NY3B 3LEYL 3BKYL 4Z7QE 2ZF8A 4TLTA 2CLVB 3FSWA 2XCMC 2OXGB 1JZGA 2V7NB 3ASWA 5KBDA 1SY6A 1ZLVK 4B9KC 3FT3A 2ARJQ 1X5JA 5EIVA 4N5ED 2VOTA 1YEIL 1HZHH 4UINH 3T4YB 3VI4B 3WTYA 2MOVA 2Q7AA 1GC1L 5D5ME 3FU3A 5K9JH 2VDMH 2YSSB 4PJGA 2P42B 2PWGA 4O58L 3EFOA 4MKMA 2CO6B 2VN4A 4FG0A 4N0UB 2X4NA 3FCGA 4OF3A 5DZJA 2CO3A 4P2QB 1NFDA 4S11A 3QULB 4WENB 2BW4A 2PF6A 4P4KB 1CQKA 1NGYA 2Q76B 1IQWH 2B14A 4HHWA 3RX7A 3V5KB 5CILH 1KPUA 1PDKA 1TJGH 2WBJD 3Q8FA 4PQXA 4F7MB 3WSQL 2EDHA 5I76B 3KL3A 4DTGH 3QORB 5F7UA 5I1IL 5I1HH 3O3UN 4RMTA 4NO2A 1TQTA 4FQXB 3UZQA 5IMOB 3QW9A 2E6QA 3FT3B 3O8XA 3HG4A 4JE4B 3MUGA 1S7XB 2WVUA 3K6IA 5J57B 3NJGA 3GSOB 3VSTA 1LVEA 2AJZB 8FABA 5BV7B 2NR6A 5AOJA 4J3OC 4LSUH 4FFZL 3JXAA 4Y88A 2FWLB 5B1KA 5JIQA 1KPRB 1QNZL 3RTQA 2KPNA 2ALWA 2Z0UA 2XWBB 3GJEA 2VXTH 2D7TL 2R1WB 1QBBA 5LJYH 2QADD 1JXKA 2HFGH 3H3PL 2ZG2A 3VXMB 2Z31C 1PDKB 4EXPX 5I73C 3PHQB 1YPZE 5CINL 1F00I 2Q0ZX 3DYPA 4F8PA 1CLOL 1ORQA 4APQC 2V9RA 3QZWB 2DOCA 3KS0H 3UZQB 1UOLA 2XN9E 1RZKL 2D3JA 3WO4C 1FC2D 4PYGA 3QK0A 2X4TB 3OJ2C 4OAWB 4PG9A 1E5CA 4V11A 4ZSOA 1HXYA 1Z9LA 2FLMA 3MROB 2XRAH 2DYPA 4P5KA 4PJBE 4ZO9A 3ZTNL 4PJ7E 1EWHA 4AMWA 1GJUA 4LDCA 1JPFA 3I6GA 4NQDE 4JFUA 1ORSA 3W37A 2VZTA 2QPSA 5C2BH 4MJID 4EUPA 1E4XL 3S3DB 3BP6B 3IMRA 3MCG1 2YUZA 3OWEA 5A3IC 3RTQB 4HA1A 5LQBH 1HS6A 4H8UA 4I1NB 5E8OB 1U8MA 2OQJB 3ULSA 3IJYB 2R1XB 4WNQB 4JMNA 2PN5A 4ONFH 4N8PA 3LN5A 2AEQL 4EUPG 1BFVH 4WU7A 1OT2A 3N1MC 3VXOA 1BG1A 2GSIA 3KVQA 4G7RB 1ORQB 1B9KA 1AGCA 2F8OA 3KM2A 4PP1D 5DD0L 2KLTA 2AV1A 4N2HA 5DWUH 5I74C 2FQDA 1AKJD 3DURA 4NQED 6CGTA 5F71A 1EFXB 1O9WA 3EF7A 3L1OL 3D18B 5I24A 5CIPB 2DYPB 4IIQA 4P5KB 4MCMA 2AK4D 2PPEA 2YRPA 4GNKB 2OMVB 3SGKC 3DROB 1ORSB 1G6RL 3HG2A 3IDGB 2YAQA 3IDYB 3NK3A 3OB0H 3V10A 4EUPB 3PAZA 4WGVB 1UVQA 2QQQA 3OMIB 5BO0D 3PL6A 4FMKA 5SWQA 1EO8H 5IMKB 4AEFA 3HUJB 4JFHD 2EADA 1ZHNA 5KVDH 3FU0A 1JHLL 1IC5H 3U9PL 4NHCL 2DLIA 3MGAA 5TQ0H 3AITA 3AY4C 1BZ9A 1U8MB 1USZA 4OR1A 3O6FD 1LO4L 2NZ9C 4KK6C 4YHKL 2BY0A 2VLME 3WN5C 1T89C 2FSEA 1WAAE 4NZJA 3PDOA 4OZFB 2QVMA 2QQLH 1R5WB 2YXVA 2XUWA 5J1TC 1F4YH 7PAZA 3D85A 2DN7A 1Q72H 2GSIB 1Q9OA 1YYML 2PR9A 5ADPL 2OMTB 1C08A 1DO6A 1QLRA 3MFFA 3D39E 5C86A 3GBNH 3FTWA 1WZ1L 2VB5A 2F5AH 4TQHA 1OAZL 3VTAA 5BXFB 1F90L 5JHDD 5ACMA 4O4YL 1FJ1A 2BOCA 2VR7A 1KIPB 4HEMA 2E9IA 3A4EA 3FSAA 4IIQB 1XD0A 3KBFA 4Q4EA 3PAYA 5F7AA 1R0AH 3WXWH 4GBXC 2X42A 5GHWL 1OAKH 1OM3L 3GMOB 3X11B 3CTTA 1GAFL 3MV7D 2GQHA 2YD1A 4YO0B 3GJFA 5KN5A 5D2LE 1ODAA 5E1IA 1TQCC 2MNUA 3T0EB 1TTBA 3MGOB 4WJ5B 4NQVA 1CFBA 4XX1G 5AVUB 2MQGA 5TDPB 3FC8A 3QFJA 4L3EB 3KEDA 4NPJA 1KIQA 4YC2B 1GOHA 1AG6A 2V9UA 5T1KD 1QTSA 2ZXWB 2Y23A 4PGEB 3PWJA 2X6BA 1DUYB 1IBDA 4UQ2A 5KYWA 1GH7A 4R0LA 4YHYC 1J8KA 4RGND 4FZEH 2DM4A 4MDJB 3VQ1C 1WH0A 3RYMA 4CKVX 4L2LA 1FJ1B 1PKQA 4KRNA 2XA8L 3ATEA 5IVNA 2VLRA 4HS3A 2DQFA 5DEGB 2AK1L 3POHA 1CF8L 5CBEA 1LDSA 3IAQA 2CCVA 4YXHL 4F7PB 4HMCA 1YDPA 3L13A 3Q9PA 4Y4KA 1R3IH 2W81C 2WINB 5HJ3A 2ZWZA 3UPRA 1B0RB 1XF4A 2EIKB 3CFDA 2CBTA 3E9UA 2AQPA 3D09A 3DIDA 1MN4A 1N18A 3V95A 4U1HA 2FQFA 4M1CD 3D2UD 1BD2E 1NUDA 3ZQXA 5CGMA 3VFUA 1MAJA 4QLRA 4PWFA 3LRMA 3AQDA 3OAZK 3P30L 1SMDA 4ERSH 1TJIH 4YSQA 4HXBH 3MRHA 4HIHB 2G3NA 1J9QA 3ULUH 4JFDB 5J12C 2IC2A 1FCCA 4FLHA 1THAA 3UG3A 2YA0A 2ZXBA 3ASNB 4NN5C 3WEAA 4R0LB 2YA1A 4BFFA 2WNKA 2ZSWA 3FONA 3MOBL 1N6QH 4YXKL 4U3CA 3QWRD 3OR6B 3MRDB 2DQFB 1JXDA 1MEXL 4IRSD 5J0BA 4NQSB 5CBEB 3HMXA 1C5BH 1A7QL 3A6BL 1ESOA 3FAWA 4Z7OF 4PJDF 5D7JD 2HLAA 1KIUB 3NJMA 3DO7B 3IGAB 1BXVA 1DVSA 1XF4B 1FNAA 2WY3B 3CFDB 4XH2A 5KVMC 3UPRB 4W4NA 2PPCA 3S2CA 4G7VL 1QSFE 1G1CA 3CK0L 2OMWA 4HUWA 4U1HB 4ODWA 3W2DL 4IGBD 4LLWB 2YFNA 3VFUB 3ETSA 5IW1A 3RVUC 2Z7WA 3LQZA 5B1JC 4TNVK 1M7DB 4YHNA 4NO5B 2ZUTA 4JFXA 3K4AA 4OIFA 3QPQC 1QR4A 4WHYH 4LL4A 4X8GA 1I9JL 2WLLA 2NY6B 5CEZH 2BS71 1A1NA 4NQCB 1WF5A 3NA9H 1QX1A 3T6QC 1DEDA 1AXTH 3H85A 1KTBA 2WGXA 3NCCB 4DN4H 3ARGC 1FYTE 3O3AA 4IBQA 5ADOH 5C08B 1TJMA 4YR6A 5J06A 3F7LA 3PWPE 4QRTA 2DQIL 1RIVL 4KAQH 3C2AH 3X12A 4FA6A 2ZYRA 2OLDA 1TSHA 4M93B 3SE9L 1KCVL 3WEOA 5DHXB 4XH2B 3IFPA 4UILH 5EOQH 4AUJA 3OJVC 4HS6B 3G6DH 1ACZA 1H19A 4ONGL 4WFFD 5KVGE 5HYJB 3BAEH 4RBPK 4HK0B 5IW1B 3WV0A 4N2NA 3P77A 5BRZA 3UAJD 4YHNB 5B3JE 2WYHA 3KR3L 3GJFH 4OD1H 5CGTA 5D4QA 1CDBA 1MF2L 1XB8A 2D0HA 3FUDA 4ZRGA 2E5EA 1XF5B 3GPSA 3O6MH 3SE8H 5KS9A 1HL5A 3W9EB 3B3BA 1U4FA 2WWKO 3ZDXB 3FHEA 4Q74A 1KTDA 4M8VA 3VXSA 3X3GL 2L7UA 2YD6A 1IGMH 1IM9A 4HX1B 2FTAA 1J10A 2K6WA 4ZDHB 5T3ZD 1CXIA 1MXDA 4H0HB 4AMXA 3EO9L 4N2KA 2E86A 3IFPB 4RGMB 1AI1L 1P84K 3WHE0 5I16A 4MD5A 4YDVA 5C9KA 2WHVA 3RBSA 4MB4A 4RRPM 5GGRY 4BFIA 3EJPA 3T0DA 4WK4B 4FN0A 5AL8A 3V6ZB 2OW6A 5IJKA 3D87B 2BH0A 5TE6H 4Z7NF 2JB6B 4MA8L 1MELA 3RKDC 5D72H 1U8LB 1YEFH 3ARUA 4QF1B 1GGTA 3EFDH 3O8XC 4JFQA 4QRRA 1BECA 4QHUB 3GLEA 1B4RA 1IL1B 3FMGL 5KS9B 1KZQA 4FFYH 2X9XA 3SZ6A 1JZ7A 1IKFH 2MNWA 2NR6C 4DP8X 2P49B 1NCWH 2YKKA 1AJ7H 3BLPX 1NANH 2XKNB 3EJZD 3BWZA 1C8QA 1G5GA 6TAAA 5JPMC 4ZOCA 2VRKA 2VLLA 3RTQC 1N0LA 1F6AA 1LP9F 3KDMA 3NJNA 3S3CB 3P3SA 3VFNB 3O41A 5E08H 3MLRL 3FTUA 4QNPE 3KPPA 1JTOA 1PPIA 5HBBA 4HJEA 1WD9A 4XHJC 1NINA 5IP4A 5KBMA 3F7VA 4P46A 5DJCB 4ACPA 2CA3A 2Z9TA 1UYWH 1MHPH 1KGJA 1INQB 4BHUI 4QRBA 5I8KH 2UWEE 3MLWL 1MCOL 1JZ5A 1E4XI 2KI6A 1OP5K 3PP3K 1UD2A 4IS6A 3GI9H 1JERA 4I2XA 4LLQB 4JFQB 4QRRB 4IOFD 4WTQA 3UL4A 2V17H 4YHMH 3LKRB 4FNSA 4S2SB 2W91A 4X6DF 2ZX8A 5FYJU 4Y4HB 4DP5X 3KPRE 3IDYC 5LNDA 1AXSB 2DLTA 4LU5L 5EEZA 4NKQB 2V8MA 1SBBA 2Z1KA 4JFZL 1NIDA 5I18H 4QY8B 1YMHB 3C5JB 1HEZA 1N0LB 4K4KA 5KVFH 4OUUA 4UT7L 1DTUA 2H2PD 2KPWA 3QQXA 3CFMA 4D0CB 3O41B 3ARBB 3J8F7 5EOCL 4OF5A 3VW3L 4QRAA 1YMMD 2GC7C 3ECUA 2AP2A 2IV9A 3T8XA 3OGOE 2CIKA 3F7VB 4P46B 3SODB 4HF5H 3HJEA 4ZW3A 2PWDA 4YWGL 2ZXQA 1MVUB 5LXGH 2MH4A 3UZEA 5H35A 3KWVA 1NCUA 4FCAA 3TCLA 5B3SB 1RIUH 1DQQA 2G5UA 4I2XB 3NN8B 2BZ7A 3CPUA 4FQHA 3T6XA 4O9HH 2WVVA 1LNUB 1UQSB 5I19H 1P2CB 4ONHB 5CU9A 2F58L 1IAIH 5ICUA 3B2UC 4OVUA 4LVOB 5GZND 2ZPKH 2HWZH 3W39A 3VFRA 1AG0A 5K5YA 3CFJA 1SXAA 2IWKA 3ALWA 3PL6C 1JMZA 4J27A 3OKOB 4PJXF 3MJ9H 1HEZB 4L0PB 1A7OH 4URTB 2ZAIA 5FHAH 5M7QA 2IFFH 2DYSB 2UX6A 1JGUL 1RY7B 4DP4X 1RI8A 4K5MA 2P5ED 1WIPA 1U30A 1JZIA 1JPST 4RISL 1WAPA 3T8XB 2CIKB 3GZQA 3TO4A 2B0SL 4JLRA 5IESH 5LKNA 1ASOA 2EACA 3WL9A 1BZDA 2AJUH 3MOQA 3FB6A 3AUVA 3P1VA 1BQKA 1RZ7L 4Q58C 2DKUA 4K3EL 5D1ZB 3ARED 4NM8H 3KCPA 1PEWA 2XY1A 3EYUH 4ISVA 1IGJA 1EO7A 1T3FA 3PGFL 3GPEA 3BWAB 4GUQA 3RWJA 5ESQB 2HVKA 1XSOA 2PYEA 4OLYH 5F8QC 5G4NA 5KZCD 3NVQA 4L4VA 4PTTB 2VE6B 4Q9RL 3ZRCC 2VN5A 1MNUH 3KJ6H 3VFRB 1DUZA 1Q38A 2WO2B 2FNWA 2YAFA 2XWZA 5E2WH 4XP5H 3BGAA 4CAGA 2FJFB 3SDDB 2Z8WC