1ROCA

Crystal structure of the histone deposition protein asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
155
Chain Sequence
GASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-silencing protein 1
publication title Structure and function of the conserved core of histone deposition protein Asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication, chaperone
total genus 26
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1rocA00
5BO0D 5BNXD 5C3IA 5EIIG 4EO5A 4ZBJA 2I32A 1ROCA 2IDCA 2HUEA 2Z34A 1WG3A 2IIJA 2IO5A 3AADB 2Z3FA 4RRPM 2CU9A 2YGVA 2DZEA 1TEYA
chains in the Genus database with same CATH superfamily
1MCPH 3MFFA 4K8RH 4YUEH 4CADA 1MRFL 5EOQL 1JGUH 3O4OC 5D1XD 5AZEH 2XQBL 1LEIA 1AO7A 1M7XA 3KWXA 3VXTA 2JSFA 2BO0A 3FC8A 3GRWA 3SEPA 3U7YH 3UABA 4AQ8C 1CYWA 2DLIA 1JK9B 6PCYA 2CNYA 1R3IH 4RMUA 5SWQB 1XEDA 4MSWB 1Q0XL 2N56A 4LBEB 4WGKA 1BZ7A 2J73A 5GGRB 4JFED 4L4VB 3ARBA 4XNBA 4IBSA 5E8EB 1IEHA 3N1MC 3G5YB 1DJWA 5F7DB 5C09E 4X6CA 4BZ1L 1SOQA 1P6WA 4FRWA 3GMRB 3EOTL 1MFVA 4DT2A 1NLBH 1N5YH 2BVOA 3C60A 1SM3H 3KDPB 1VB9A 3FQWB 3DXAB 3U6XA 3NPSB 1GZHC 4X6DF 4DPBX 1IT9L 2VR5A 2FB4L 3SQOH 3AT0A 3SKUD 4GG6A 1NKRA 4WQOA 5ITFA 1GZQA 2AJVH 2GUOB 4BK5A 5IG7A 4EDXA 3B9AA 3N43B 1N5AA 2EADA 3DX6B 4E0RA 3CFKA 1BFOB 3QUYC 4K7PL 4MMZB 4NJ9L 1QO3B 2DBJA 5DQJB 3V8OA 3W9DB 2W65B 2DI9A 5BQDA 4PJGF 5IROD 1N0XL 3TPUA 4LLYB 1WFNA 4UQIM 3QCTL 5L4JA 1CBVH 4KO6A 4HP5A 4F7PA 3BD4A 3D8MA 1VZGA 3GZPA 4PMEA 4XXDA 2Z3FA 1KPUB 1A7QH 5IMOB 3MJGX 2HJFA 2V5MA 1YQ2A 1OO2A 1EDYA 2K4AA 3FSOA 4M62L 2IQ9L 3B5HA 3LVEA 2CDFB 4WKZB 4N2AA 3G6DH 1VSCA 2YK1L 4ZTOL 1KCVH 2Z6FA 3OMZA 1QI4A 2ORBH 3OM3B 3NCWA 4Y1SA 3BVDB 2BIIA 5C9JA 3TH3T 2A6KB 3PV7A 3BWZA 2ZXDA 1KIUB 2GSGA 4WGVB 5E2UL 2DL2A 4MJ5B 4XGZA 5AW4B 4ELME 5LNEA 1T1XB 4CGTA 1JN6B 1OSYA 3P9WB 4X8GA 1BVNP 2A6JB 4FTVD 3G9AB 3FFOA 1L9MA 2FX7L 2PN5A 3DYOA 5GRWA 1IL1A 3BRGC 2DQGH 5HPMA 4OD3L 4LHUG 4YE4H 1A1NA 3QJFA 3FQRA 4NZ8A 3NJFA 2AAVA 2VQTA 1JZDC 2NY0B 3C5ZC 2F1AA 1ACCA 5JXEA 3MBEB 4EI6A 3FCTB 2Y69B 3LEXA 4V33A 2VXUH 4HT1H 4PY7A 1KLGB 2B9BA 1NCTA 4FL4C 4JHUA 1G7HB 2R2BA 3R1GL 2MNWA 2P1YA 3B3IB 5D7EA 1AQMA 4UQ3A 5M95B 4JY6A 2P46B 3IGAB 1FLRL 5KYWA 4XPBH 5HXMA 5KBKA 4GW4B 1YEEH 1TNNA 2BP5M 4J3OF 1X7SA 3IBEA 4Z7VB 5JDJA 4RISH 4EBQH 1CC3A 1CQYA 2E27L 4NQEB 1ITBB 5KW9L 4KXCA 4GO8A 3EF4A 3U0PB 2KL6A 5TE6L 1H15A 4HK3N 5EDXA 3J2PA 2YRLA 3OX8A 3BQUC 3O0RH 4FP8H 5DCCA 2R1WA 4JZJA 2DDQL 2P5EB 3WL9A 4Z77B 4X7TB 1JMZA 2XN9E 4HH8A 3WTXA 2V2WB 1AHWA 1EDQA 2VDQL 4XAWH 3QR2A 4L3FA 4PYHA 3K2KA 4ELDA 1UATA 1I85A 3F01A 2B59A 1PG7L 4KKAD 1TJHL 1EV2E 3FF8A 2Y1AA 3PDOA 4KO5A 3VFMA 5FGCB 3P2BA 3GQFA 1H0DA 2Q7YB 4X6CF 1XGTB 1KLFA 2YN3A 2E59A 1S7RB 3QRGH 3GMMA 4WNSA 5C0JB 2ED7A 4EOWH 1S5IL 3AWGA 3ULSB 4ZAKD 3FRPB 4TUKH 4YPGB 4FKEA 4N2FA 1ZANH 3ZKMD 3AU1B 1UH3A 4HPYH 3QXVA 4ONHB 5GGVL 4FNSA 4JO1L 1FA4A 3KLAB 3ISRA 4OIBA 3H53A 4LQFL 2AABL 4YFEA 2Z4QA 3QO0B 2ITDA 1J7VR 2VDML 3HZMB 3FZUD 5DJ0B 4AGPA 4WY7L 5BUPA 1I1YA 3IGLA 2FEDD 5FYJD 3P0VL 2PR4H 2AV1A 1QLEH 4FG6C 4EO5A 4PJ5D 3ORJA 4Z7IA 3B1UA 2D3JA 4L3AA 4DWHA 3IE9A 1VFUA 1JZ6A 2MOQA 1WEJL 3M1BA 5HGAB 2GSIB 3U48A 5FOJA 2DH2A 3WDHA 1E6OL 3ARSA 4AITA 5IF0B 5EEXA 3N5AA 1NMCC 4LPCA 4N0YH 3TESA 3F8UB 2WWKT 1KXVC 3QUZC 4WF7A 3TZVB 4HJEA 3BKJH 1KNOA 3F6LA 2CO7B 4P07A 4R8WH 1AQHA 2BVUA 3FXIC 2AJYL 2DIJA 1X5YA 3JV0A 1VFAA 5DC2A 1UGKA 4HEME 1U93A 3NSDA 1VF5C 3MX0B 1J5IA 1JHTA 4FA6A 1MCOL 5FWQA 3P9MA 1O5PA 4JEGB 3V4VH 4QXGH 5CP7A 4X4YA 4Y1AB 3PGCB 4BINA 1N10A 1U8QB 4GO6B 4QEGA 1QKZL 2QSTA 3L3IB 2R1XB 3HE6C 3ML9A 4EUPG 4U3SB 5DJYA 2CR3A 3ROOB 2I27N 2FEJA 3M7OA 3EDEA 3OHMB 3H4FA 3UL4A 4M03A 5ISZA 3VSQA 4BDVB 4I4WA 3X14B 1I8IB 4U7SA 1WFOA 3TIEA 3LB6D 5FXCH 4N8VG 3Q1EA 4AGNA 4IRZA 1F5WA 4XOCA 3V5DA 2VM9A 5CBEA 4C4BA 1BYPA 1JZFA 4OCNC 4HZLA 2I7SA 1QFWM 4M5ZL 4BUQA 2GPZA 3WHE0 3KVQA 2BOCA 3DBXB 4KDVA 2C4FU 4JHBA 4Z3HA 1UXSB 4NFBA 5I75C 4X7FC 2XT1B 1MG3C 3QZNA 4OH2A 3ESPA 3OB8A 1U6AH 3T4YA 5I17A 2NZIA 4MD5B 5F1IB 4F7MA 1NCCL 2X2YA 5D1QD 3ZX1A 3I9AA 5BJTB 5KVGE 3IFLH 4UDUA 4ZD3L 1A22B 1ZXKA 4DGVL 4RGMB 4GQZA 2K78A 2J8OA 5IM7B 4HJ0D 3FTGA 4KJYA 3QIBA 2EDXA 5GGSY 2XQYG 3U7WH 3WEBA 4EN3C 2GFBB 4NNPH 2VN6A 1KJ2H 2P45B 3I3EA 5DK2B 3VFGH 5C6TL 4IMLA 1ZJBA 5H4ZA 4OTXH 4FD0A 4JG0H 4PJCE 3ZQXA 4MXWL 4UIKH 4LSSL 1J5CA 4ZPVB 4OZGF 1ORSB 1MIEH 4L3CB 4QGYA 2VQUA 4HZ1A 1EO5A 2J1WA 1JZEA 3B2VH 5GRVK 2E6QA 3EFFA 3CHQA 3BPLB 3EJUA 5F7EL 5BNXD 1A1MA 2Z91B 3A4EA 5IIEA 3SKMA 1HE7A 1KCBA 4HUVA 4KRNA 2V8LA 4QYOB 3X2QB 3OKDA 4YS4A 2X9ZA 4B5EA 3QR1A 5L6YH 1M56B 3C5JA 1M71B 3SDXE 1ZLEA 4BA0A 4PRBA 4DO4A 1CXHA 1CICA 2J8HA 3NIGF 1I9RL 2QTEA 3IFNH 2H7WA 2F61A 2OK0L 2O5YL 2NUTB 4NCC2 1G84A 3PHAA 1RZFH 4IRJD 1U2YA 1BX2A 3BIAX 1BIIA 2WZ0A 1M05B 3BSHA 5IQNA 3ZLQC 2A0LC 2V0AA 1QBML 3ATDA 2C3VA 5IOKA 1G9EA 1JPFB 2JMRA 5CMAA 4DK3A 1P6FA 4KROB 4KV5E 3OPUA 1JXFA 4R7VA 1P4LB 3S35L 1JGIA 1PDKB 5ESQB 1Z66A 3UTZB 1HIMH 1CI5A 1L0XA 1S9VA 3B7RL 2DEWX 4QUOA 2RIKA 2D0FA 2FSEA 1YZZA 2X42A 3KDMA 5F1SA 3VO0A 4HWEH 4EEEA 4WNJA 4X98A 4H1LG 2CNZA 2JE8A 4PY8J 2NQDA 4PJEB 5KZCD 2UZYB 3GSQA 3T6WA 2HKFL 3OSKA 5AYQA 5IW6B 1DLFL 5ACMA 2XC8A 4OFIA 4NB7A 3OAYH 4OF0A 4GPVA 4PWJA 2NZ9C 3PQYB 4XX5A 5E2TL 1EZUA 5AZ2L 3F7YB 3S8WA 4OVUA 4XB8A 2A77L 5I66B 5I1GL 5ADPH 4GI6A 4Z5RA 4EI5B 3GGWB 3T2QA 3DI2B 2MOVA 4M6NH 1KJMA 4NRZB 1Y6MR 1CD1A 1FN4B 4MGXA 1CLVA 4NQCD 4DFIA 4XI5C 3MRNA 4Q2ZB 3W56A 3T0EB 4JFDD 2VC2B 2BSTA 3EYSH 3O6LH 1BJ1H 3ZUCA 1ZTMA 4G70B 4MNQA 3GM0A 5AL8A 4AJWA 4HXBL 3I2CH 3VG0L 5J1SC 2BP8B 2DOCA 4PJDE 2EH7L 2VAAB 3K81A 4L9LB 2QGEA 1F58H 1QYGH 1JIBA 4UWQB 1AXTH 1Z3GH 1T7XA 2VABB 4OV6F 3L4ZA 4HK0B 4ZFOA 1T21A 1DBJH 4PJIF 3VFRB 5KYNA 5F7UA 5TE4H 5F93C 2DYSB 1I8AA 5EU7E 1OWWA 2RBLA 1DVFA 4KJQD 2E4TA 3VXSA 5LVEA 2EXWD 3U9UA 3PDDA 2G5UA 1D7BA 1J8HE 4OFVA 4JPVL 2DKSA 1TZIB 1E9OA 2APXA 3GI9L 4XMLH 4Z7UE 5CUSL 5BVJA 3MLXH 1ES0A 5KVDH 4XXCA 2PTVA 3E6HA 4G7VH 1NEZG 5AENA 1BBJB 4AE0A 4MNGA 1BM3H 4FJYA 2EECA 5L2KB 2CPCA 2QJDA 4PRIB 2VB5A 2IDQA 3CC5A 4XCNB 1H3PH 4XN4A 4NHUB 3MGTA 1BM7A 2X4TA 3NFPA 4NIYE 4PJ8A 4QRAA 4E9LA 1O9ZA 3KYAA 3NAAH 5GZND 1XR9A 3QAZC 3D48R 5I2IB 3L8QA 5DYOA 4LHUA 3BWSA 2J4WL 4LRNL 4KHXH 3T4AA 2OMXB 3RDTA 3BH4A 2OSXA 4KQ0A 3JWOH 4FTDA 3QFGA 4Z0XB 5E6YA 1MCKA 2CLZB 3OZLA 3UIZA 3OMNB 3QWRA 2YWYA 4FNPA 2JCCE 3DROA 3S36X 4PJ9B 1M7DA 1XMWA 2K8MA 1QX1A 2A9NH 1HKLL 4P0DA 4Z7NE 3QIWC 2FK9A 3IDMB 2XKNA 5PCYA 4POZC 4PGJA 1MCSA 3SCMB 4B9IA 2G0KA 3W2DL 4G9DA 3DK2A 3EOYG 3D25A 5D6DC 4OCLC 4M9PA 1P4IL 3POHA 3ETBJ 4JAMA 3LTVA 3QEGL 4MCYB 2R2HA 1OGTB 2AJUL 3CQQA 4PU2A 5EIIG 5AD0A 3VRJA 3HHSA 3RWGB 1DQDH 2AC0A 1FH2A 1UWGH 2VDNB 1WBZA 2OCCB 1DVZA 4GRWF 3ZDYE 2CCVA 1K3ZA 5I15H 3WU1A 3LZPA 1ASOA 1BEXA 1TQUA 2HLEB 3DV4A 3MA9H 1YHPA 4JFOA 2W0PA 5J6SA 1G6RA 1CO1A 1MI5A 2IEPA 3VDCA 4X5RA 5A3IC 4LSRH 5FKPB 4PY8I 4XPAL 1IGYA 2DL9A 2E6PA 4JZNB 1KTDB 5KUMA 3BFOA 4HDIA 3SDYH 1IFGA 3QEQD 5F89B 1JDAA 4YSAA 5GS0C 1Y07A 4S11A 3RVXC 1HQ4B 3O45A 3OF6A 3HPLA 5AWNL 4PBVC 3BUYB 5DC0A 2ICEB 2VJ8A 2ED8A 4P5TC 4CSSA 1AS6A 4P9ML 1G9NC 3CZKA 2IALB 1TITA 2SODB 4J3VA 4RMRA 5D7JA 4FQIL 1MJJB 5EBLB 3RIFF 1SY6H 4D9LL 2YUWA 1RZQA 3DRQB 4IDJH 2HWZH 3B6SA 1E5UI 3KXFB 4IU2A 4NN7C 4YSOA 5HY9B 1MCNA 4LCUA 4JHVA 4IW4C 1OY3B 4YHLL 2Y7QB 3VGDA 1L7TH 3ARGD 1PSKL 2WXMA 3OKOB 4K15A 2FR4A 3OWRA 1ZHLA 4XO9A 2DQTL 4H8VA 2WLIA 1S5HB 4AL8H 2B3IA 1KPRA 1NMBH 1XQ4A 5EZIL 2P48B 3QUXD 4O5LL 2Z35B 3GHPA 2J2ZA 2MSPA 3RWDB 1IM3B 1N4XL 2C9XA 4LEOA 2VAJA 2YLHA 2J43A 5CWSA 1FAIH 4H0LC 2OM5A 3SOTA 3HLAB 1PBYA 1FRGH 5T3ZL 3WFEH 5AW3B 2HH0L 4YEEA 1MFAH 2VDOB 2O61B 2Q0ZX 3BPNC 2E7DA 2FWOB 5KVMC 5T1JA 4JDEA 3HNTH 3X3FL 1ZVSA 3KLDA 4RMWA 3TO4D 1VESA 5AW1B 1KCRH 2AKRA 4AK1A 4CDGC 3UOAB 1U0QA 4UT9A 2LQRA 1EBAA 2BS9A 4YVNA 2XWJA 1RK7A 3O3EA 5JMRA 4P2QD 4N2KA 4A6YB 1CGSL 1BWMA 4HFUL 5L7XL 4NX0A 3DWTA 5FA3A 2ZCHH 4DO5A 1GCYA 4NO3B 4PRPB 4EUPA 1A4KA 4P99A 1B88A 1C7SA 1SJXA 4GBXB 3VH8G 4G7SB 4KK8D 5SWSB 1THCA 1M1SA 5C07B 3EOAA 3D2UD 4FNLL 3UTOA 1E50A 3MROB 4XCCL 1IGFH 1RIUL 5GS0L 4N8VA 1SXCA 2RFXB 1A6VH 2V3DA 4HWBH 4AIEA 5ANMB 4EF3A 1K8DA 1U8PA 1G9NL 2QSCH 3HBPA 3LKQB 1AJ7H 4WO4D 5F9OL 4TVPH 3OKEA 1T2XA 3QQDB 2X4OA 3HC4L 4B95C 2JKRM 4AIXA 1T2JA 4C59B 4UMSA 1MW0A 3HC2A 3QK0A 4G42A 4GKNB 4V11A 4AUYA 1IFRA 2LLLA 4R2GB 3ILPB 1IGCL 5DVMA 1CK0L 1BECA 4QXUL 4HWUA 1T5WB 4TF4A 3H7BB 1H9VA 3O2WL 2I32A 4K0OA 1BEYH 5D7IE 1Z5LB 1XZ0B 3QE5A 2WLLA 3MRLB 2XG5B 3GDCA 4UQ2B 5BRQA 2EYRB 4FKKA 4EIGB 3WKMH 3PHOB 4LASL 2XQYA 4ZX5A 1G7LB 1RHHA 2ADFL 2V7NB 2X40A 1A7BA 5IVXE 4J2XA 1I8UA 2PCPA 2QADD 4BFRA 1W6LA 1JWMA 3HG1D 4A38A 2EDLA 2WLHA 3VI4B 3WFBL 1I7RB 1NGQL 4LO9A 4P4KD 3FH7A 1HHKB 4PV9A 1H8SA 3CV5A 2RH0A 3V52L 3QIUC 5I1HH 3QPKA 3ZO9A 3LS4H 3UTPD 4GP4B 4DFHA 3ZYZA 4KPHH 1A7PL 5BQ7B 5FV1L 3FPXA 1IGTA 1E7UA 4M6ML 2WBJD 1QW8A 3FTYA 5AOKA 3SBWC 5MEND 3A3YB 3G7TA 2YEQA 1AGDA 1KV7A 2WJ7A 3RY6C 3TN0A 2DQIH 4O4YH 1A1OA 2OJEB 4ENED 1YY9D 4UTAH 1RK0A 3CZFA 3FU6A 2YSSB 2EILB 5JIIA 1CFQA 3PWPE 4MDJA 1FG2B 1T22A 2XG4B 4R5XA 3UPAA 4DUWA 4OM0L 4AXWB 2YA1A 1XGZA 5HDBB 1YMME 3MV8A 4N0FA 1GXEA 3NCYP 5EZLB 1IAIL 3C9NA 2I5YL 5DRWA 2AQTA 5JPMB 3TJPA 4BSWA 4YSRA 3BKMH 4BH8B 4F9PC 1BQHB 2NPLX 3WS6C 1URLA 3CXDL 3U30C 1Z9LA 1KGWA 3VFOA 4XBPB 4YHYB 2VZTA 3L4XA 4K71B 1IJNA 1JL8A 2XIBA 4PGBB 4Y4FC 4PJ5B 4PJBA 1PCXA 3ATEA 5B38G 4X5WA 3HBQA 3ZE0E 4HH9B 5CFAA 3HJ0A 3DOSB 2PYFB 4TMPA 5C09D 4CA4A 5IOPB 5E1IA 1Q9LA 3I6KA 1NAMA 4H1LA 3N40P 1FL6A 1U8NA 2GVYA 4KTEH 3IE4A 2F74A 2LHAA 1O7DE 2GJPA 2QVMA 5E03A 2WXIA 4OUUB 4I18C 1PY9A 4I3SH 5IVZA 5T5NF 4DKDC 1OAZH 5F71A 4B3VA 4N8CH 2NNXA 2VSKB 1NINA 4P23B 4HS8L 3PU7A 4G6AC 4Q8BA 4IOFC 1HDMB 1B0IA 2DB8A 4TLSA 5FW6A 5ICUA 4NN5B 1ADQA 2D0HA 3KJ6H 1WFMA 4FJ6A 2PP7A 2A6DB 4JRYA 5AVQB 3KM1A 3F3HA 5EC2B 3VUAA 4PR5B 4H88L 1NH6A 1E4XH 4J3UA 4JKPH 2VERA 1LD9A 4P05A 2XN1A 3RNKB 5KTEL 2Y6SD 2AXFB 3MRRA 4PI0A 3I75B 2DQDL 3EJCA 2EEAA 1ROCA 2DD8H 5JHLH 1SLUA 4JFZH 3GSVA 3B9VA 2HUEA 4QHNB 3EFDH 2X70A 3GK8L 4KXZI 3EW3B 3ULVE 4MAYD 3MTRA 4FYTA 3U0WH 1Q1JH 4R84A 1ORQB 5LKNA 3K71A 2W9EL 5CCGE 4F57L 2D2OA 4Y4KC 4YOKA 4BFBD 1J87A 2ZSVA 3BT0A 1NDGB 2DLFL 2R2CA 3FOMB 4S2SB 3ESUF 2ZWZA 1QVOA 4ZUTB 3QXTA 1NCIA 3JV6A 1YNTA 2YD0A 4JHAH 3QZBA 3GSUA 3UTSA 5KSAC 4GKSA 4L1BA 2I07A 2TRHA 1NEZA 5CJXC 3RFZA 4K55A 3QUYB 1A14H 2EDWA 3GD1C 5LG6A 2Y5EA 1XSJA 3BLBA 5FOBB 4XNYL 2O72A 3S88H 3VXRB 3K6NA 5AZUA 5J3HD 1RAMA 1F4WL 3TNNA 1FL5A 2ZCKL 4RFEA 1DL7L 4RFNC 4UILH 5IT2H 5D6CB 1OPOA 3FTZA 5F1OB 5KYYB 3OKNA 5CEZE 3C5SB 3OVUB 3FTVA 3KLHD 3QEUB 2VRAA 2KT6A 2VLLA 2ROYA 1MRFH 2BNQB 5EOQH 2XQBH 2YAPA 3GIVB 4KRPD 3QFJA 2WYIA 4D0CA 1UFGA 1VPOL 4NJAL 1QI3A 2ZXCA 3P2TA 3T8VA 2X6UA 4JFSA 3AGVA 2ZICA 2IAMA 4E2OA 1Q0XH 3R4DA 5EORL 2WNKA 3UC0H 5EH1A 3UAJC 4ODSL 4TLTA 3PAVA 2O5ZL 3WMPA 1WPCA 3BT2L 4MVBD 3UPCA 1ECYA 3B2UD 4BZ1H 1A3LH 4Q56A 3QO1A 3IRPX 5JOFA 3EOTH 4I0CC 2P3YA 3FUDA 4F2MB 3CHPA 3RPIA 5KG9A 5D2LB 1HXYA 1SLWA 3RBSA 1TYEB 1OP5H 2P42B 1XAKA 3HG5A 4XPGL 4RNRA 3ATBA 4LLAA 1IT9H 5KZCB 3WY2A 2FB4H 4F7TA 2A4EA 3PL6D 5C1MB 2AJZB 4KNQA 3L2MA 1N3NA 3L7EB 2DMHA 1GGIL 1AP2B 2Y1ZA 4YNYA 5LAXB 5TGBA 3P11L 1SLXA 4K7PH 1ZGLA 4NJ9H 2G9HB 1VGKB 3MTXA 1LE9B 3V5KB 2NZ1A 1SJEA 3LSOB 5K33A 5IW1A 1D5BA 3VXME 1N0XH 1KXQA 2EZ0D 3BQUB 4Z3FA 4KVNH 3QCTH 3T0BA 3V0VA 3LNEA 2YKLL 1Q38A 3E1ZA 4NZTL 1MCRA 2DWYA 5DLML 4E41D 1ETZA 3MOBL 3WD5L 4UOJA 1YAIA 4YHOL 5I82A 2F68X 3WI9A 1ZT4B 1U3HD 2ZONA 2BVPB 4M62H 5CLXA 4QNPE 3QORC 3IDNB 4JFDB 1IIKA 4ONOA 2IQ9H 4X83A 4I88A 2HVJB 3ECWA 4FFVD 4PWKA 3SJVE 4AH2B 3GJEB 2YK1H 4ZTOH 1OD7A 3HW7A 3G5XB 1N9PA 2Q8BL 3Q5TA 1GY1A 3GXDA 4LIQE 3CFJB 5AAWC 1NA8A 3GF8A 3HUJB 4X9BA 5KS9B 1U3JA 3JWNH 4TVUA 4F2FA 1SXAA 1NBZB 5DI8B 4P59H 1U3YA 4U1IA 5E2UH 5E6IC 1MW3A 3RURA 1EXGA 1F3DH 1TKWA 3FH8A 3EBAA 2FX7H 5EUOB 5F7YC 4I85A 3IJ8A 4OD3H 4D9LH 1IGIL 4HJGB 1Q0EA 4FS0A 4PM1A 4ATTA 2AP2A 4BV1A 2EVHA 4MS8D 4Q9RL 3BD3A 4UTBA 1S9YA 4X5LA 1G9MC 2YEZA 3OR6B 5DEJA 1LL1A 4NC2B 4K9EC 3R1GH 2WTRA 2CJ3A 1NIFA 3O8XD 2M83A 3F7VB 1XGUA 1PZ2A 2YBRB 1J86A 5DMGD 4HAGA 2ICWA 4MLIA 3GS7A 1YA5A 4H0GA 4L8BB 4RMSA 1YNLL 3W0WD 2JQAA 4DERA 4HALA 3CU1A 1WWBX 2Y07L 3SDDC 2E27H 3DIDA 5KOVC 1QRNE 5KW9H 3CVHB 3QPQD 2XVGA 1NMCB 4AUUA 4WI4A 2CA3A 1TVDA 1IE5A 3VH8A 4PJCF 1L5GA 3R4RA 3K0WA 5EF0A 1ECZA 3HRPA 2NX5E 2DDQH 4U1HA 3NEEA 3W5NA 4LCCC 5FO9A 1W72L 4AQAB 3BJLA 3T0XA 5EN2B 2XTJD 5ID1B 4AUJA 2VDQH 2OYLA 5FW7A 3K72A 2ZXAA 3MNZA 2BP0B 2L4OA 3BGMB 4KUZH 1JPTL 1NFDA 1AGEA 1PG7H 1TJHH 5TDOA 1KB5L 3HI5L 3SDXF 2G9KA 2BVTA 4OLZL 1R3HB 3NJIA 5INDA 1YMHA 4UM9B 2EAEA 5F6HJ 4R26L 3SGJC 4AEIL 3DGGA 4XX1E 4KXDA 1EJFA 4PJFA 1S5IH 1V8HA 4MBOA 2OX5A 3VD1A 3FK3A 4N0UB 4G9FB 4LSVL 1OAKL 4X7CC 3P4OB 5HYIA 4LSPL 1LP9A 1TQCC 4RGNC 4U1KB 3MREB 5LBGA 3UPRA 4PP1D 1MJ8L 3NK3A 4G8EA 5GGVH 1VFBA 2VMFA 5SV3A 4KKZA 1Z9NA 4KV5F 1SHXA 3S3DB 4JO1H 3WY1A 3QXDA 3U9PL 4LQFH 2D3NA 1MDTA 3DMMD 1S7SB 2AABH 4B0MM 1W15A 4MQ7A 2J44A 1R4XA 4TTDD 4YHPA 3Q13A 3UZEA 2R69H 3M6DA 2VDMH 4XMKL 1EZVY 3HTLX 3WTYA 4XO5A 1EZVX 5C0DA 4WY7H 3DTXB 3P0VH 8FABB 2EQDA 3U6XS 3QEQB 2PXYD 4WWKA 2WPGA 1M6OB 5I76A 1KYOJ 4KH2A 3GI8L 3T08A 4K9EL 1WEJH 3ABLB 1A25A 4GG8A 4K7PY 4QTIL 5D70L 4ZT1A 2OMTB 1IBYA 5IJCC 3T5WA 1E6OH 3S2CA 3JZ7A 3HR6A 2C8NA 3ES6A 2GJZA 5FCSH 3HIZA 1MVUB 2DYPA 3RU8L 1H6EA 1U2CA 2CXGA 4AYMC 4ANXA 5IJKC 3A23A 4DW2L 1VEOA 3PV6B 1HEZB 3VXUB 2BVYA 3QZWB 3ARGB 4WI0A 3KBFA 1KIRA 5DJAB 4Z76A 4L8SA 3QR0A 3LPOA 4ZUWB 1XHHA 2F54E 4OLEA 4QY8A 4IOSD 3L9RA 4W81A 1MCOH 2BVEA 3VXOB 5B38A 1BAFL 1PQZB 4HKZA 4TQ8A 2QQLL 3EYFA 3I74A 2D7PA 3IPBA 2ISDA 1YY8A 1CB4A 1K3IA 1W9XA 2BDNL 2HCZX 4MA1B 4YHIB 1MJUL 4WKXA 4BFJA 4ZNEA 3N50A 4N20A 1M57B 4ZQKB 1K5NB 4B50A 4WI2A 4CAGA 1G7MB 1S7UB 1MKFA 3AQDA 5EC1A 1B6DA 3A6BL 4NC1E 1XH3A 2W60A 3ZE1B 3VI3B 2WWMC 2FNBA 2E74C 3L9YA 2A73A 4KI5E 1D9KA 3TO4B 2JJTA 4M5ZH 3CWGA 2XOTA 3BO8A 1PLCA 1SF3A 1WC7A 3O9WC 3FQXA 2ATKB 5F3HA 2MTAA 3E8UH 4FNUA 4I2XB 4PS8A 1WA2X 1P5VA 3IMUA 4C8XA 4J5VA 2C9UA 3TO2A 5LO7A 5E08L 4EVNA 4AV5A 1I8KA 1AZRA 3CTTA 4HXAL 3KYMA 3QHFL 4WK4B 4QTHA 1NCCH 3FYEB 4U6YB 4WWID 4N9GB 4YHZH 2XWEA 3GRBA 5DFVC 5DK0B 2ZUWA 3SE9L 4ZD3H 3JT2A 4OF8A 4QJ5B 4DGVH 5F3BB 3G04B 2XZZA 4CSPA 2UY6A 5FFOA 1EK3A 2IXQB 2WQXA 2WYTA 3KWUA 2V8MA 2IPKB 1A6PA 2EJ1A 3KJ4C 2SEBB 2XFXB 2FWSA 4W9GC 5C6TH 4Z7WF 2Y7SA 2F19L 5TF0A 4B9GA 4MXWH 1R34A 4LSSH 4Z3IA 3BESR 2NR6D 2JCCF 4J6IA 2BZDA 2AJSL 1BFVL 4PJHB 1LQSR 2J3SA 1ZMYA 3NH7L 2DKUA 1RD6A 4FFYH 5CD5D 1ZA3A 1SEBA 5EU6D 4Z7NF 2WQVA 3ROLB 3L3KA 3CZUB 4KK6D 5F7EH 4B53A 3RY5A 5MI0B 3SD2A 5ID0B 3PY9A 2XY1A 5F6HI 3VQ2C 2E8ZA 3FN0H 3BEVA 2IANB 4H8WC 5D7LE 4J3OC 4MA7L 4OFYD 1I9RH 1VENA 1BD2A 2OK0H 3D87B 3UDWC 2VQ1A 2O5YH 4AYDC 4KKAC 4YHNA 2OR8A 1CT8B 1XCQA 3NGBC 4LU5H 5AYTA 1DEEB 4JDVA 1JZ8A 2QADB 4MNGE 1EPFA 5CHNB 5GGVY 3V0GA 4GW1B 1G5GA 3ILQD 1QBMH 3ZDYF 4DP5X 4UQBA 2I24N 3AUWB 3SPJA 4P4KB 5JPNC 2XTSA 1UCTA 3CDGA 3QQ3B 4ZAKC 3ZRSA 3S35H 3VAEA 2YFOA 3ZKMC 4LOVA 4M7ZC 4WEUD 2NY1D 3CVIL 4AVJA 2V2TB 4R7DA 3ZK0A 3AS2A 3N41B 5CSGA 2WBJB 3E3QE 4IRSC 1MH5B 5FIEA 4DZBA 4CW1A 4U1NB 2BC4A 1OSZB 3LV3B 3AXHA 5E24E 2VR7A 1ML0A 2EYTB 2X2UA 4OZHA 3T6XA 1MQKL 3V2AR 3N85L 3NA9L 3FZUC 5GIRA 1LQBC 2IWGA 4OCWL 2W81C 5B8CB 2FEDC 2Y2TA 3QAZB 5E2TH 2HYMA 2YMOA 3IKKA 1JVOA 1OF2A 5E8PB 5AZ2H 5HYJD 4ZW7A 4G8FB 3CH1B 2A77H 1KSRA 5I1GH 4XO3A 3WMQA 4LBAA 3TBWA 1XIWD 2XNAA 4L8DA 3OKKA 3UJIL 2CDGB 4TNVF 1ZT7B 1FYHB 4GAYA 3KYKL 4IIQC 4ZFZB 5EUKB 5G4OA 4XMVA 3IB4A 2R8SL 2DJMA 4NNYA 4YQXL 2MH4A 1DJXA 2FD6L 1DQLL 4RLDA 1PEZA 3O6KL 3OB0K 2BRRH 3WV0A 1YEIH 1LGVA 3VWJD 3U46A 3R18A 4HXBH 4J8RA 3VG0H 4NSKB 1TLKA 4GAGL 1HX0A 4NBYB 4OZIB 4WU7B 1F90L 2EH7H 5IR1B 1X4YA 1ZA6B 4WV1A 3P3TA 1SQMA 2FO4B 3KGUA 4C56A 2R7EB 1PZAA 3RTQD 3PE9A 3D3VA 5FUCE 5GGRA 3VD5A 5CZVH 3RWIA 1XSOA 3O6FD 4DO6A 5FW8A 3ZKSD 3MMEA 4PRHB 5F7DA 3Q43A 5GJSL 1YC8A 3RIFK 4M5YL 2E3VA 1IZJA 3CMGA 2FRGP 4JPVH 5E99L 1OP3K 3QDGA 3GI9H 5D55A 5CUSH 1CZ8L 3S3SA 4L8CB 2YLKA 4JVUA 3B8YA 4G8GB 3MV7B 5C0IB 2ICCA 2ZUQB 1WCQA 3LB6C 3WJMB 1VIWA 3NCCB 3MC0A 1F1AA 2N1KA 1E27B 2MMXA 1NBQA 1O7SA 4LNVA 4CVZA 1CXLA 4MHHG 4LKXB 2OSYA 1G7JB 1WZLA 4MD4A 4L4TB 4P5TB 1Y1DA 1X7QB 1BF2A 1CDUA 3PCYA 5DTFA 4QRTB 5J89A 3U4KA 1QO3A 4Y2DB 2ENQA 4LRNH 2J4WH 4R97B 2W65A 5D1QC 5L8JB 3Q05A 2WYHA 1OCWL 2HAZA 4K4KA 4LLYA 4XC1L 4URKA 1S9WB 4BIKA 4DKAA 1V3MA 5FYJL 5E0QA 2Q86A 2VE6B 3FO2A 5AW5B 1U8CB 1X9QA 3V4VA 1A6AB 4M61B 5EF2A 3O3BA 1FYTA 1HEHC 1UGNA 5KANG 5IUSA 1HKLH 4WW2A 4IBVA 4NO5B 1DQJB 1GCFA 3QCUL 3CPUA 4H2CA 5HYQA 2HT2D 5ECGA 3W2DH 2B1HL 3RVVC 4UT7H 5C0GA 3KPNB 3T3PB 4A7GF 3SBRA 1P4IH 1KIUA 4O2CB 3BP4A 1ZXQA 2AJUH 2WYZA 4JZJC 32C2B 4N85A 2E86A 3BP7B 2CPUA 2R51A 1MAJA 1VHPA 2A74C 1AVAA 1SVZA 2A6JA 3BPNB 3AU0A 3DK0A 3LHPL 3NUKA 1YPZB 4XNZC 2PO6C 5DA4A 3VNZA 3TH4T 1PEWA 3BZFB 1SEQL 4KRPB 4R0LC 3MBEA 1KLGA 3AM8A 1IRAY 1G7HA 1OKEA 2AXGB 2XHNA 4DP7X 3P4NB 4XPAH 3S3BB 4HIPA 1N6QH 2BZ7A 3EJRA 3IGAA 4UI2A 5JHDD 3B7SA 4JPWL 3CZGA 1U91A 4KGLA 3REVB 2EC9T 2P4AB 4RDBA 1RZKC 4FXKC 1KJ2A 3TL5A 4X7EC 5LDSA 4QHPA 1EO7A 1OALA 2CJUL 4P9MH 1WHPA 4TQHA 4NQEA 4WUUE 4IHOB 2X3BA 3EJYD 4FQIH 5TQ0L 4NWTL 1ILSA 4Z1PA 3D18B 1E6JL 3SPVB 2GBTA 1E30A 4RMBA 1MWAL 3VG9B 2VISA 3IJEB 5E9AA 4AKQA 4YHLH 1M1XB 3FCSA 3ZE0F 1OSPL 5AW6B 3ERXA 4YSCA 3PL6B 4IGBD 4X7TA 3VD9A 1MCDA 1OIOA 4M48L 2KLRA 4BFFA 4Y2OB 3PWPD 5JW5B 2DQTH 2HTKC 1FZOA 2D7MA 5EZIH 1KPVA 2ED9A 2IPTL 4O5LH 3DSNB 3K3QA 2HFGL 3SSGA 1N4XH 3LIZA 5MHSD 2Q7YA 3QNXA 3HN8A 4L29B 4JHWL 1ZE3H 1S7RA 1RZGB 3QI9B 4HCGA 1J9CT 5C97A 3CDCA 4Y8AA 2X05A 3BEWA 5T3ZH 2OI9B 1R46A 1XO8A 2HH0H 4K7FA 3AU1A 3TA3B 3EAKA 1JFQL 1CYGA 5C0CB 1NSNL 3ZU8A 1PZUB 2FUQA 1KCLA 1LK3L 1PX4A 4GOSA 3SZ6A 5I8KL 3KCPA 1UT2A 2FIKA 3FTXA 3LCYA 4GJTB 1KYOK 5BOZG 4GMTL 2ICWJ 3QO0A 1ZHKB 4MS6A 5FGBA 3HZMA 1NKOA 2ZG2A 4UT6L 4HFUH 1EVTC 5L7XH 3LJ3A 1MFUA 4AW7A 1H3XA 1XSKA 3ARBD 1KN4L 5CIPH 3APDA 5HGAA 4FNLH 2ZUXA 4JJ5B 4YK4C 3K4DA 4XCCH 3QZLA 2IQAB 1RIUH 2D0GA 2ZXQA 1G94A 5GS0H 4F5CA 2ZX7A 1PF3A 3LEYL 3TBSB 4Q9QL 4ZUSB 3U30B 1RZKL 4JO8A 3UG5A 3JWNE 1NGWB 4AX3A 5BO1H 4UANA 2DJ4A 2O6DA 1G9NH 2MFNA 3CLWA 3TZVA 4Z7QE 4XH2B 4Y4FB 1EA9C 1FZJB 2AQRA 3W0WB 2YPLE 5DQDL 2VXQA 5F9OH 1P7QB 4ZMVA 1X5GA 5FS5A 2DWDB 3HC4H 1PJ9A 3MAWA 1NANI 4KDWA 1SXZA 1JV5A 3MCLL 3R19A 5CF3A 2ARJB 3Q2NA 5FKAB 4LEBA 2NT0A 3NJHA 1WRFA 1IGCH 3QNYB 3ASOB 4A2GA 5DVLA 3VXQB 3ULVD 4QXUH 3MLRL 2EYSB 4YDKH 4I18B 3O2WH 4JRYE 1U8QA 4MJ6B 5ETUA 5AVWB 2YUZA 3CFMA 3L3IA 1B9KA 3LNDA 4NM4L 3V5HB 1MREH 2VLRA 2ZUUA 2O5XL 4LASH 3FSAA 3WLWD 3GTVA 2ADFH 4Z0BL 1N68A 2XTJB 3FHQA 4KZEL 3Q9PA 5I1LA 5JIQA 2A4CA 4L23A 4RETB 3GNMH 4R7NA 2NMSA 5D5MA 4G6JL 3WFBH 1NGQH 3L5WB 4OI8A 3BH8A 1UWXK 2A83A 3OGCA 3V52H 5CCKH 2BSSB 3ULUE 4BZYA 2WB1A 1EEZB 4FABL 2ILLA 5CLZA 2AXWA 3DBXA 1A7PH 3FAXA 4YX2L 4MJIE 1NDTA 2B1AL 3CZEA 2HT3C 3TBVB 2AXHA 3PGDB 1NICA 4BD4A 2XWZA 3IFOB 4OI9A 5F1IA 4ZW6A 2DEYX 5FUOL 5BMFL 4OM0H 2J5LC 3KS0H 5GPRA 1IAIH 1UYWL 2I5YH 3HMXL 3LZOA 5JXED 5D9SB 1DANT 4AC4A 5IM7A 1E9QA 2LTQB 4N0RA 4JM4L 1Z6JT 5FWRA 3CXDH 2OZ4A 4AZUA 3X1BA 1HZKA 4YEFA 2XICA 1HNFA 1DN0B 3QA3B 1CCZA 1ET8A 1KCKA 1N70A 2PXYB 4LLVA 1MY5A 3BH9B 2J1XA 2WCGA 5ESVB 5T1DL 1CE6B 3L4TA 1ORSA 4YE0A 3VFSB 4PTTA 3ILDA 2OSWA 1XGPB 2EDDA 1JSYA 1Y6KR 4J4PA 3RG1C 1TQSA 4U49A 4N24A 2Z91A 4RRPM 3QZMA 3F58L 3KLKA 3I9IA 4GY4A 4BRVA 4QYOA 3ARYA 5AFAA 2R4SL 2W0LA 4OF3A 4OLUL 5CGTA 5IESL 4KY2A 3CFDB 3BP5A 5E1AB 2NUTA 1XGQB 1OGAE 3Q1SH 1S9XA 3RX9A 4HS8H 4DEWA 3FT9A 1LO4L 2I26N 1BVKB 4YXKL 1TPXB 3T0VA 5K59E 2HJKB 5FECA 2R2EA 2BNRA 5DZVA 2Y23A 1FL3A 5F7NC 2HMID 1DUYA 1JPFA 3QFDB 2ICWI 3VFNA 1P4LA 4IM8A 3VXMD 1PDKA 1DHKA 3JXAA 4TSAL 3C6LA 4H88H 3W11D 5JNYA 1UA6L 1GR7A 1MELA 2B08A 4JQVA 4CC1A 3WUWB 5I1EL 5KTEH 1OCZB 4KNSA 4PJEA 2GTZA 2VWEC 4AGMA 2OS7A 5ALBL 5K9JL 1GOHA 5IW6A 1XVSA 4PV8B 4AC2A 3GK8H 3TXAA 2JXMB 2RALA 3PQYA 3NABL 4HAFA 5C0BE 1WO2A 4WNQB 2EIDA 2W9EH 1TENA 2OSLA 3ZIMA 4G83A 4F57H 1INDL 5F21B 3U79A 1H8LA 4P9HH 3FYIB 2DLFH 5I66A 3TASA 1CGYA 1IEBB 2OULB 3TV3L 3EO1A 3GGWA 3MJWA 4F15B 1NKGA 3FQUA 5JORA 3LRGA 4NRZA 3MJ6A 2CBMA 3KYNA 2DQUL 1TUPA 1B3IA 1MHHB 1QRKA 2XV0A 3G5VA 1FNFA 3HE7A 4YN3A 1EEUA 2H9GA 2CUMA 3VMOA 1TTAA 4DQAA 1AI1H 1HL5A 3SY0B 3ZKNC 1UZ8B 4XNYH 4NPYB 4KTGA 2AK1L 1YDPB 4HHWA 5D5MF 1QPPA 4PJ7A 4NBXB 1F4WH 5FYKD 4G8AC 4GSRA 2VAAA 5DZPA 5J12C 2V33A 4BXVA 4L9LA 4OD2A 1DL7H 5AB2A 4MMXB 2X2IA 3E1F1 3TVMA 1HHGA 2GKIA 4BUHA 4WO0A 5C6PB 4YGVB 1QRND 1CGXA 1PKQB 3HB3D 1UD3A 4OY9A 3K1KC 1LM8V 1VPOH 4D9QE 6CGTA 3GSWB 1EXUA 1H8NA 5AYUL 3ZQWA 2NX5D 2TAAA 5E2WL 5E6IB 3JTSB 4NZRL 5EORH 4HIIA 4OLWL 5DJXA 4ODSH 4PJAE 1SVCP 5TDNA 5I28A 1BBJA 2NYYD 2O5ZH 4P2RE 4JB9L 3BT2H 4M56A 1E8YA 2YRPA 5L2KA 4PRIA 5ISZD 1IC1A 4XCNA 3ZRFC 1I3VA 2YGQA 4HWBA 3CU7A 4NHUA 5DS8B 3L1FA 4XCEB 3D39B 3WELA 5CCJA 1S4IA 1MFMA 3K6IA 5IHHA 3W5MA 4YL9A 2K45A 4Y16B 1M6UA 1YY9C 4FQCL 3QPXL 1ROWA 4L37B 3ALWA 5GS1C 5I16A 3H9HB 2OR7A 4XOAA 4HSQA 4XPGH 2QPUA 3IKCB 1BP3B 1EFXD 4KK9D 4Z0XA 3SKNB 2CLZA 2ITEA 1L0QA 2F2HA 4W4OC 4YSEA 1GGIH 3BAIA 1UB5B 1MHPL 4PJ9A 3P11H 5DD6B 1IEAB 3RTLA 3EHBB 3G6JE 5IQ7L 5HYJB 2B1OA 1RQ5A 3OKYA 1WVZA 2CD0A 3OKLA 3QIBD 3UTQB 4PLJD 4NZTH 5DLMH 1L9SA 1XIWB 1JZJA 4C57C 1PIFA 3MOBH 3WD5H 4MCYA 1QUPA 1OGTA 3HPJB 2R56L 5HD8C 1SDDB 5ACZB 5CU9A 1RJLA 4NERA 4LMQE 3LXAA 3H9SB 4NCDA 3ABZA 2FLBT 4Q89A 2Q8BH 1X5JA 1CG9B 1EJOL 1FVEA 4P5SA 1HSAB 4UTAA 4YDIL 3VFVB 2MQCA 3DPDA 1TZAA 1U8OA 2WIIA 4FQHA 4JQXC 4M93B 1RPKA 1H5BC 4HSCX 4ZW8A 1CICD 3PXHA 3RTQB 5D1ZC 2XWXA 4RGNB 4WI6A 3AUVA 1KDJA 3FONA 1DQQB 4APXA 4PGCA 1NFIB 1QNIA 4MXQD 1IGIH 2O93L 2OQJA 4Q9RH 3Q9QA 1AANA 1A47A 3W39B 4F24A 2IFGA 1KBPA 1MLCB 4Y5VA 4A2DA 3BYYA 2KPWA 3CUPB 4BCYA 4LFHD 4ICWA 3RZCB 3T0AA 4C58B 1UM5L 2CCWA 2X53A 2ADJB 3T1FB 2X1PA 3DRQA 2R4RL 4FLSA 3DURA 3UBXG 1DVTA 3U0TB 1PTZA 3DUSA 4EKXA 1YNLH 5IB5A 2R23B 2Y7QA 2R0WL 4MAYC 4P06A 2RD0A 3F12B 4AZ8B 1A2YB 4JFYB 2HTLC 2Y07H 2ZOLB 4O9HL 5AAMC 2IPUK 3BSZA 3OJMB 1F45A 3AAZB 3GKZA 2N59A 3CHXA 5DJDA 2CRYA 3GSNH 1T7VA 3M17A 2FYVA 1W0VB 4KI5D 1S5HA 1FI8C 2ZP8A 2GHZA 2G2RA 2WWOA 5I1DB 2XV6B 2CLVA 2DTMH 1TF4A 2Z35A 2R27A 1IM3A 1UD4A 5KSBE 3QXWA 3FQ4A 2XJLA 4L3EA 1NBCA 3O3UN 3T1WA 1W72H 4BCZA 3PIQA 5IMMB 2M8XA 3Q8AA 4U3CA 1KG0B 3T9WA 4DN3L 2A5UA 2UXFA 5E9DA 3I02B 3L3DB 5I73B 2N0KA 4H26B 1ND0B 1RH8A 1NOFA 1G9HA 3E6FB 2YAFA 1AD0B 2O61A 1Y18A 1H6TA 3FOLB 1JPTH 2FWOA 3QYCA 4NRXB 4YXHL 4GH7B 4JL1A 4OGYL 1KB5H 1RUAH 3HI5H 1BFSA 2TRYA 4OLZH 1MAML 1CE1L 3P0YL 4R26H 4NI6A 4AEIH 1HXKA 4TPRL 2VR4A 3OAZH 3P73A 3D30A 1D5ZA 4PIBA 3K8KA 4A6YA 4LSVH 1OAKH 1URZA 4LSPH 2B4CC 5A6LA 2Y7OA 3L7FB 5EDSA 2DLGA 3RJQB 1UD5A 1MJ8H 2X7LA 4D8PB 3OJDA 4PRPA 4RAUB 2HFFA 4BWTA 4LVOB 4PJGB 1TVHB 1AAJA 4M8QB 3E9TA 2MKLC 4JANB 2ERJB 1DVFD 3VXSD 5C07A 1QHPA 3K6DA 4KQ4L 1JGEB 3H3BC 4YLQT 3JV4B 2QHRL 4P2OC 4XMKH 5D7LD 3QS3A 5DVNA 1ZJAA 3OXSA 4JKWA 3I84A 3QXAA 2FBJL 1DCLA 2V5YA 3NMEA 2FJFB 2Z31B 1BA9A 1I1CA 4F93B 4IJ3C 3TH2T 1RVFL 1VERA 3IN2A 3GI8H 1QSFE 5B7MA 3HKFA 1EZSA 4K9EH 3RKDC 4E9RA 2BNUA 4QTIH 5D70H 4AI7A 3DUUB 3EJQA 1P0SE 2DM7A 5K9KB 4PJ8D 5CZRA 4ZPTA 1YUHB 5DJCA 3U2SB 1QEWA 4ZMXA 1MRCL 1JZHA 1VFOA 1U2HA 1WWAX 3H7BA 4LHUD 3NIFB 5AOLA 1F97A 4EAEA 3RDTD 3KPOA 1OHQA 4DW2H 5EZOL 1XZ0A 4KX8A 1HL8A 2IH8A 4UQ2A 3BAEL 3AB0B 4I1PA 4IGBB 4NQDB 3TX4A 3MLVL 1EEYB 3DX8B 2V7NA 4PGDA 1AQKL 5SX5K 1BZ9A 3QWRD 2EZ0C 1KLUB 4QOKB 3KPMB 2BXZA 3FN3A 2PYEE 5K9OB 5DHYB 3VI4A 4UAOC 1LDSA 2Y4SA 2QGCA 2JKIS 1NEPA 1BAFH 4K73A 4KI1A 4OVVA 1PW3A 4FLHA 5B1BB 8CGTA 2QQLH 1KYUA 4JFFA 4LSUH 4PLKC 1U3HC 5TJWK 4BZ1A 2AJ3B 2BDNH 5BQ7A 1MJUH 3GBNL 2Y7MA 4FFVC 1AXSB 3WIHL 3N1PC 4DKFL 4A2LA 1N7ML 3LKOB 3A6BH 2QMJA 3KPLB 2OJEA 3WNJA 4EQ2A 2PNDA 4OZHE 5CN2A 4JL2A 1WCBA 1AO7B 3VXTB 3W9EB 2C9VA 3KPRA 2B4CL 2PP9A 1BJ1J 3QZWG 4BH8A 3U2IA 4HIHB 5DEFA 4TNVK 2PWEA 1O0VA 3LAFA 3IRZA 4UUJA 5E08H 4LEEA 5F96L 1L3NA 5CGYC 4IRSB 1F00I 4HXAH 3QWOA 3QHFH 1BZ7B 1HH9A 4RAVA 3GEWB 3ZL1A 4EPSA 3ARBB 4DKEL 4NLAA 4ZMOA 3SE9H 1BYNA 3ALPA 2PYFA 4X6CB 3O8XC 4N2DA 2O5NA 1AKJA 5DMGC 4MZRA 4E68A 2NXZD 1A64A 2MIZA 5CLTA 4Y5XC 3NK4A 1WUNT 3FU3A 4X4XA 4HUKB 2EDRA 2X3AA 3CSTA 5D7JD 4TYUA 2FJGA 2BVOB 3C60B 5I19L 5EHFA 3WTTA 5BRPA 2F19H 1MPAL 4HMDA 4HGWA 3QPQC 2AJSH 1BFVH 4N28A 3NH7H 2QKIC 4I0PC 2JH2A 1D6VL 2EEBA 4GG6B 1QSVA 1R5IA 4V2BA 4MCZA 4L4VE 5ITFB 1HSBA 5E7BA 1GZQB 5EWIL 4PMFA 1Z9MA 3MLWH 3VX1A 4FFTA 3WKPA 3KVDD 4B5ZA 5K69A 5IG7B 4EDXB 3OQRA 1N5AB 4E0RB 3H9ZA 5E4OA 3NCJL 3OLGA 5KUKA 4AQ8A 1UKTA 4AK2A 1JE6A 3VSVA 4N8UA 1KCSL 2DMGA 4MA7H 3UMTA 3H2WA 1IV8A 3WE1A 5GZOC 2UY7A 3D85A 1AZZC 1KBWA 4OQ1A 4P5MB 4F7PB 1R3JA 5KAQG 3SE4C 2X1QA 3DXAE 3FTSA 1QFWL 1ZVYA 3EH1A 1OAXL 4XN7A 3I75A 4L05A 2HJFB 1BXXA 4R4NC 5AVXB 2C34A 3OAWA 2VITA 3EH4B 3OLDA 1F4YL 3BP6A 1G7IA 1IC4H 1FSKB 1KEGL 3CVIH 1R0AL 4OQTL 4ZMTA 4KUCF 5EEYA 3VXPA 4NQUA 1A9BA 2X41A 4PRDB 4XGZB 1GZHA 1PD1A 4Y9FA 4NGHH 2ZSWA 2I60L 4CGUB 1AY1L 4TXVB 5B1CA 5CEYA 2XKSA 5DHEA 5I23A 4PWHA 4TTDC 4ZUTA 4H40A 4EQ3A 3WNNA 1IL1B 1MQKH 3N85H 5HPMB 3FKUS 2AQ1A 3MRKB 3PHQA 1A1NB 3QJFB 4OCWH 4D7BA 3T0DA 1SHWA 3QUYA 3LEXB 3EXLA 4QMEA 5GRUL 2ALAA 1AACA 1WITA 5DUBA 2ZKWA 2MCMA 1WLHA 4UQ3B 3WEAA 1CGVA 2OMUA 4J3BA 3UJIH 5KYWB 2DIEA 3KYKH 4DUXA 2M2DA 2R8SH 2E9BA 1L7IL 5EBGA 4FGMA 1C08A 1DDHA 2IBBA 2PUQT 3C5SA 5TF1L 4DGYL 2FD6H 3EDDA 1DQLH 3QEUA 4W1TA 3O6KH 1LK2B 5BZXA 3VSUA 2FL5A 3BGAA 2D7TL 2XU9A 4GAGH 1H15B 4R5VA 5HHOA 1F90H 1X5IA 3DX2A 3OX8B 4PAZA 1TQBB 3IPEA 4JZJB 4NDMA 1LE5B 2Y36L 5ICYB 1IBHA 4FI7A 2ZX5A 4P48A 2IJ0C 1AHWB 2LE9A 1XH1A 5KVGL 5F3FA 5GJSH 2EIZA 3C5ZA 4Z7VE 4M5YH 1CIUA 5E99H 2KZKA 4DGWC 3PJNA 1CZ8H 3PDOB 1XMEB 3VFMB 2BHYA 1CVRA 1H0DB 3EJSA 1KLFB 1AR1D 4LGSB 2YAQA 3GMMB 3CNKA 3C75A 2HKHL 3AFLA 5TPWL 2P5EE 3V8CA 2AJZA 4FXKB 1RLBA 4KZ0A 1T66D 1YCSA 2PMZA 4TOYL 2MRYA 3AMLA 1GYWA 3AG1B 3ZT5A 4JGMA 2G9HA 1PZSA 1VGKA 3DJSA 1TDQA 4P3DB 2Z4QB 3V5KA 1LE9A 3SHSA 1BQLL 2ITDB 4TSCL 1TNMA 1WWWX 1OCWH 3BQUA 4XC1H 5EU7C 2APSA 3WN6A 4KKCD 1I1YB 1UM4L 5BRZA 3GT6A 5FYJH 5HVFB 5FYLD 3K46A 5BS0B 4ZFGL 1K4DA 2ATPB 2KI6A 1J9SA 3B7UX 3IS1X 4FN0A 12E8L 4JREB 2VMEA 3FQTA 3UBXA 2BVPA 2K9FB 4XVSL 4ZJ9A 3ZT6A 1IC5L 3M1BB 4JKNA 4AV4A 4AH2A 5IZ7A 2NR6C 1W6WA 3G5XA 1CU4L 3RGVC 2OXGB 4HLZG 4QCIA 2B1HH 3I9PA 4Z23A 1U21A 3REWA 2VKXA 4P46C 3BVTA 3LH2H 4KY1L 1S7QA 1T04A 2VSCA 3CVDA 3DRTA 1KFGA 4KX7A 2GJ6A 4PP2A 1KNOB 4FZ8L 3SDAC 4B0MB 2YPLD 5I8EA 2H6PA 2J88H 3U1SH 5B7FA 5I1KL 3LHPH 4P2AA 2BHZA 1VFAB 1Z0MA 4D3CL 5C3LD 4HJGA 3ULUF 1MQ8A 4QRUA 1SEQH 1U93B 5E5MA 4TSBL 1HJCA 3P9MB 4IK7A 1OVZA 4ZW5A 5CP7B 3GZKA 4JRYD 4RESB 3NESA 3OR6A 3AVEA 3PWJB 1HHJB 2YGVA 5DJYB 1PIGA 2YBRA 5C3IA 5KJ7E 3CSGA 3NCEB 3HFFA 1MCIA 4L8BA 5AG9A 5ISZB 4I4WB 3ZBMA 4ANUA 3NDZE 4A04A 2K70A 4N87A 2HRPL 2CJUH 3SGKC 2QDWA 2QPSA 4N26A 5CBEB 1JNHA 2Q8AH 1OLLA 2FBRA 3CVHA 5IBUG 2XSKA 5TQ0H 3EG9A 1E6JH 1DE4A 1NJ9B 1U8MB 2V4LA 2BOCB 4L0PB 5E6ZA 4Y1AE 4POUB 1KXVA 2DF3A 3QUZA 1MWAH 1NCUA 4GI9A 4PW4A 1YVLA 1OSPH 4UNIA 4X42A 1A6ZB 1MHCA 2X89A 4FQPA 4FQQA 3MRBA 4GRLD 3TPKA 4AQAA 5I17B 5EN2A 4M48H 4DEPC 4F7MB 2O6FA 3IM1A 1NLDL 2OFQA 3GLZA 4M5SA 4BKLA 3UTSD 4UDUB 4FYQA 2BP0A 3BGMA 4MA3A 3DETD 1COBA 3BGFB 3LOWA 3HG3A 2IPTH 4FX5A 2H41A 1TZ8A 5C0ND 2HFGH 1RFDL 4KJYB 3QIBB 2FQFA 3ESOA 4UM9A 5HDOA 3QDME 2VR8A 3HE6A 4ZX4A 5T33L 4JHWH 4GW5B 4K8RC 3EDKA 3ARDC 3BE1L 4IMLB 3EF7A 4XP4L 5B1KA 5I24A 4G6KL 3NJKA 2CKBL 4NENB 5FAAA 5K59F 1R75A 3P4OA 1JFQH 1NSNH 2P44B 4U1KA 1LK3H 4X9YA 3EFFB 3UC2A 5I8KH 1S7VA 5C0AB 1O5DT 1A1MB 5IQOA 2Z4TA 5IIEB 4HUVB 4RMQA 4OGZA 5GHWL 4GMTH 3OKDB 1JMXA 3EGDA 3CLFL 3O6FC 4XRCA 4S1DC 1TOXA 4UT6H 1CICB 2VR6A 3D08A 5MP6L 4DKTA 3HEIB 2OZNA 5FC9A 1A8JH 2XWBA 1OGAD 4YBLB 1BX2B 4QRRA 5CZKA 3US0A 1BIIB 2DH3A 4LDCA 4F7EA 2OJZL 1O6SB 3ETTA 2J5LB 5JW3L 1ET7A 4CJ0A 5IKCA 2A9AA 2A9CA 4WI7A 2IGFL 1AZCA 1WYJA 1Z9PA 4EN3A 4Q9QH 5TE7L 1MCJA 1ETA1 1RZKH 1DQTA 1S9VB 3ATFA 1MVUA 2FSEB 4H8HA 3NOIA 3KDMB 2E9JA 3FAWA 5M7QA 1G1YA 1JK8A 4DVRL 4GRWB 4X98B 2E8YA 4H25B 5DQDH 5HBBA 1GYCA 4FQ1L 3GSQB 5DJAA 4HC1L 3MCLH 3DHUA 4GINA 4JHZA 5KANI 4J39A 1KBVA 1X9UA 3GHEL 3L3OC 2FBOJ 1CDBA 4X0NA 1NPJA 4BZ2L 5ICXB 3MLRH 3SQRA 5C0BD 4D0BA 1S78D 5EZJA 1PQZA 2CGZA 4UIMB 2BOBA 1UACL 3QZOA 1XL4A 2X6MA 4NM4H 4BFKA 4YDLC 5T1LD 3FTUA 4Z0BH 1UD6A 1UB6A 2OBGA 4ZQKA 1CD1B 2FO1A 3OC8A 5F7LB 4GUOA 1G7MA 2PCFB 4PJEE 4D94A 3MRNB 4LVEA 4A67A 4G6JH 3MCYA 4K8RL 5GS3A 2BSTB 2NYZA 2HLFD 1F1GA 4JO3L 1N12A 5AZEL 3EDJA 4MNQB 4FABH 1BGXL 2NY3B 3D34A 1SGKA 4YX2H 2ATKA 2AQNA 2EIEA 4PJAF 2B1AH 4MZ2A 4B96A 1QBLH 3VX0A 2YZ8A 3BZ5A 3MCKB 4ZFOB 1T21B 2E0PA 3FH5A 4HCIA 4NUJB 3AITA 4M9OA 5FUOH 5BMFH 5K39A 5LCVL 1S3KH 3BKCL 2ZUYA 3EYQD 1RY7B 1U41A 3U9UB 4W70A 1UYWH 3T0EE 3HMXH 3G04A 2DQHL 4L9DA 1E9OB 2IXQA 3EYUL 4ACPA 5BVJB 4JM4H 3DX9A 1ES0B 1S2EA 1NLBL 4UZUA 3X1EA 1KGIA 2HP4A 4HIEA 1BOYA 1TXKA 2XY2A 4ODUB 4KITB 2G75A 3M88A 1IQDB 4KKBD 3EJYC 2IV8A 4P2RD 1X6NA 4DP9X 4FNTA 4PJHA 5T1DH 3MRGA 2J8UA 3CC5B 5A2LH 3VVVA 1D7CA 2WXGA 5EF3A 1EH9A 4UAHA 4GMSL 2BXYA 4A55A 5DVOA 2DWSA 3G6JF 3MGTB 1RL1A 1YEDA 1AZVA 2X4TB 2ED6A 3NFPB 5I5RA 1A7OL 2EDFA 3F58H 1XR9B 2O1AA 2R4SH 4UINL 4LCWA 4OLUH 3T4AB 3MRPA 3CBJB 2IANA 3RDTB 1AKPA 3QB7C 5IESH 2V37A 1IB5A 2CE6A 5DEGA 1TYRA 1EUUA 1TTBA 3BXNA 3CK0L 5IWLC 1GW6A 2YSTA 1C5BL 1CT8A 2H26A 1LO4H 3IMWA 5F44A 2BSRA 4YXKH 2BW4A 5L2KE 3P40A 3DROB 4GW1A 1URIA 1ZTXE 1M7DB 2DEXX 4D0DA 1D5IL 4NUPA 1YN7B 3QQ3A 2XKNB 1RV6X 3QRFM 1FVCB 4TSAH 3Q48A 1CD9B 1LO2L 4G9DB 3D25B 4Z8FL 3J8F7 4Y4HC 4ZBJA 4RBPH 4JAMB 3II1A 5I1EH 1O7DC 2AK4B 1MH5A 2R2HB 4LDEB 3VGAB 5AD0B 4U1NA 1MVFA 5ALBH 3HHSB 5K9JH 4KZDL 4JDZB 1WBZB 3GWJA 4DPCX 4AMXA 3IRCA 1SMAA 2CO1A 1QSZA 4JY4A 3SD5A 3DV4B 3WIFA 3NABH 3MVSA 1LWJA 4JFOB 2Q2LA 5E8PA 4OLXL 5EU5A 1G6RB 5BCAA 1INDH 1MI5B 4FJZA 2W07A 4K23L 1EJ8A 3SIKA 3CFBA 4OT1L 1IGYB 3TV3H 4B41A 3CQPA 4HDIB 3BI9X 4WWKD 1F3DJ 1CXFA 2CDGA 2DQUH 1DZ0A 3HPLB 3KWWA 2YN5A 1YJDC 1ESOA 1FPTH 1XF5A 2QFRA 4NS0A 2QBWA 3TU6A 1K5WA 2NXZB 4RA3A 3QIWA 1FFOA 4N2OA 3RUGA 4QRPA 2YPKA 5DVKA 1OB0A 5D7JB 1B4JL 2P5WA 2AK1H 1O75A 3IN0A 4DZ8A 3ZHDA 4IU2B 3B6SB 2DYPD 5D6DA 4WU7A 5B39G 3DPBA 3NCYS 3SKJL 1N8OE 4LCUB 2W59A 1FNAA 1WGVA 2R7EA 3V4PB 3ZR6A 1J10A 4WSJA 3T65A 5IHBA 1ZHLB 3R0NA 5LN4A 3UJTH 3VTMA 4KRMB 3AZUA 1KPRB 5I8OL 4JMNA 4WHYH 1AYOA 3K6OA 4ODWA 3V6FB 2J2ZB 2DN7A 3MV7A 4LEOB 2OMVA 1OZUA 5AYUH 3PABB 5E2WH 2K0RA 4NZRH 7PAZA 5CWSB 3WJMA 3RVUD 1KY7A 4KDTC 4X7SL 3KXFE 4P3CL 4AENA 4N2LA 2G5RA 2YPVH 3GZOA 4NP4L 1ZWIA 3V4UL 3E2HC 3KL0A 3MSPA 3KLQA 4YSTA 4P5TA 2DJSA 4JDEB 4QHMA 1WE5A 4HVBA 2EO7A 4RCAA 4KJWC 1ZVSB 1XWVA 1D9KD 1JF5A 2J8UF 5CN3A 1A8ZA 5KOMC 4FQCH 3QPXH 4AJYV 3N42B 3I6LD 1QUNA 4QRFA 2XWJB 3RWFA 4E5XG 3LIUA 3O3EB 4R7XA 4XWOD 1EBPA 4JQIA 3PS6A 4ZOEA 3IF1A 1D5RA 2WSPA 5FA3B 3ELAT 4PFEA 1A4KB 2X9WA 4G5ZL 3WNOA 5FA4A 1MHPH 1SMOA 2XPGA 3W3BA 3JTTB 4GAAA 3EZJB 3OHXC 2V6HA 3MI6A 5KVEE 3ZZ1A 4TVSa 5IQ7H 5F70A 3EOAB 4JM2F 4HD9A 2MTPA 1PZBA 1NCNA 5GSVA 4N8VB 4DETA 1S8DB 1AYRA 5I5JA 1YJDL 3TIDA 4ISVA 5JOEA 1UM6L 2AV7B 3R8BB 4NKMA 1ASPA 1K8DB 1U8PB 1VZIA 4MASA 1AS8A 5HJDA 4O2CA 4OUOA 2KLSA 32C2A 1UZ6F 3BP7A 3BUPA 3OKEB 2X4OB 1SPDA 1DO5A 3A4AA 3MNWA 4PVLA 2AGJL 1D2OA 4N2GA 4PRPE 2BWIA 2J6WA 3QQXA 2F1EA 4G42B 1XD0A 4OGQC 4QT5A 2H3KA 3BZFA 1U8JA 5SWSE 3WO3B 2EP6A 4G71B 4RX4A 3ULVL 4YDIH 1XH2A 1U58A 1YLBB 3INUH 5EF1A 4MMYB 2L7JA 2WLLB 1BD2D 1FCCA 3PNRB 3ME0A 3LXCA 2ZKXA 4NKQB 5ANME 3L4YA 5HYFA 3IDJA 3Q2VA 2JI3A 5EZPA 3LKPA 4M1CC 2PCPB 3QISA 3V6OC 1JWMB 4YBQC 1P9MC 3W11C 3ARZA 4XMZA 1E0OB 3CSFA 1GS8A 5D93C 4QHKI 4IHOA 4MAUL 3X1FA 4WHDA 2VDKB 4L1LA 5HJGA 4Y9CA 5LQBH 1K6QL 1G87A 1UM5H 2VN5A 3D18A 3F7LA 1E5YA 3LKRA 1BZOA 2RACA 4HCRL 4K3JL 4WTZG 2NSXA 3SPVA 2R4RH 3JQOB 3WOVA 4AYGA 1JVLA 3RUGF 2QQKH 1HH6A 1JG9A 3ARRA 4HS6A 4YWGL 4RDQF 2IH3A 1FZKA 4K5MA 3V10A 4WFGD 1L4IA 1Y6NR 1M1XA 2NW2A 2R0WH 3A22A 2WUBL 3D0LA 4ODXA 2IH1A 3TN0B 1A1OB 4O9HH 3A4FA 1RK0B 3CZFB 3FW6A 5CEZL 3WTSA 2G60L 3G5ZB 1CFQB 4MDJB 1T22B 2RB8A 3DC0A 4TQEH 1S46A 3MRJB 1OB1A 3MV8B 4N0FB 3ARWA 3VI4E 4DIXA 1OM9A 3HBGA 4JMXA 3C9NB 3UACA 4QHLA 4A2MA 1LVEA 4YLCA 3VTTA 3DO7A 4BSWB 1IIIA 3RRQA 3NIDF 2L7EA 4TN9A 4HPOL 2IF7A 1D6EA 5LNDA 2G3MA 3VFOB 1L6PA 3M46A 4N22A 4DN3H 5TH2A 2A4ZA 3MRQA 4ZODA 1ZLDA 4FQXD 5D72L 1QSEA 4JKMA 2ITCA 1ZAGA 5JQ6L 4O51A 5C0FA 2CM5A 1MIEL 3K2MC 5E00A 1Q9LB 4UAOB 5GJTL 1D3CA 4YXHH 4H1LB 4AEHH 1FL6B 1U8NB 4OGYH 5B1JC 1PZ5B 2F74B 3QIUA 1MAMH 5HDBE 1CE1H 5IP4A 3FUHA 4O02B 3ZGIA 1KULA 6FABL 4LQ1A 5KBNC 1NL0L 1Z3RA 3QYMA 1T20A 4NYLA 1OWRM 3SBWA 3IFNL 4C56D 2EC9U 4EMZA 3FB8A 3RY6A 3HFML 4GEJA 2WZ6A 5CR1A 4PJ5E 3S48A 4HWZA 4PJXA 5I9QB 3FUFA 1OTUD 1G7PA 1OTTC 2WV3A 4NRYB 5A2CA 2X6VA 2LLNA 2WQWA 2WXNA 2AZUA 4FHJA 4FXGC 2QHRH 2IQAA 2DQFA 2NY2C 2CA4A 4F9PA 4YAQA 3TBSA 1BDYA 4PLOB 3WS6A 1EQWA 1J8KA 3KW7A 1YYCA 2WQ8A 4OKVB 1NGWA 5CJQL 2FBJH 1GGUA 4G7QB 2P47B 3CHOA 4L5FH 4MAZA 4Y4FA 5FYJU 1FZJA 2MWCA 3DXAD 1RVFH 3KVPA 5DHDA 2DWDA 2F18A 2Y25A 2N4IA 3FB6A 3GSVB 3QZPA 2ARJA 2J7LA 4F8TA 2X70B 2CHZA 2FT8A 4KK9C 1PNCA 2DM2A 1H6FA 1MCCA 4Q6IC 2H6OA 5ADOH 1MVYA 4LIQL 1MRCH 2JB5L 2EYSA 4I18A 4DCQA 5H35A 5HYSG 4TKWA 1MAKA 1PX8A 2GBUA 3D9AL 2ZSVB 1UWEH 3DI3B 3TP4A 3D33A 3BAEH 1RERA 2F6AA 3MLVH 3QULA 3VWKC 3RJDA 1AQKH 3ML8A 1ZKAA 3JV6B 1YNTB 5I5MA 3GSUB 1HAWA 4GKSB 2I07B 1NEZB 2IIJA 1OARL 2Z7YA 15C8L 4BM7A 3FQ1A 3PAYA 4ZMQA 3QJOA 3TEWA 3KG5A 1UZGA 3CN2A 2G4GA 2VR3A 1FO0L 2QT6A 2AMUA 4OIFA 1CFMA 3TNNB 3WIHH 1JV2B 1FC1A 2FJSA 3AREC 4RFEB 3TBVA 3V9CA 3T3MB 3B9DA 5KN5A 1N7MH 1Z3GL 4NCC1 3A21A 1X5AA 3PGDA 4Z7VF 3ZZQA 3OKNB 3IFOA 3ZE2B 5CM1A 2ICES 4U6XA 4PJCB 5HVHC 2VLLB 2XETA 4WEMB 4B9FA 2NY0D 5EO9B 3QFJB 2B4CH 4OCXL 1JFHA 4D0CB 3MBED 4KU1A 5D9SA 4U1GC 5F1NB 1K4CB 4Y4KA 2IAMB 3UBXI 3VCLA 3VXRE 4CVXA 1WAAE 3MDJA 3TCTA 3IDGA 2AEPL 3H42L 4XNQB 4DKEH 3ARTA 1BM3L 5KSAA 3CE1A 4MQSB 3VFSA 1BG1A 2FGZA 1XGPA 3ZMRA 5CJXA 3MLPA 1PLAA 2L04A 3CFNA 1OP5K 3QO1B 1USQA 3P69A 5IJBC 4J3OG 4LGRB 5JOFB 4IRZL 1O9WA 3LPPA 4NQED 3D0VB 2BNQE 1TJIL 3GXNA 3RPIB 1SN0A 2XV3A 4K5PA 5KG9B 5J6GA 1UQSB 1HXYB 4WIQA 4NC1C 3IXTB 2C7FA 3WN5C 1I3GL 3GXPA 1F4HA 2LGNA 4KI5C 4RNRB 4AL8C 2UWEA 5AB0A 4F80A 4F7TB 4ZOAA 3N2JA 2P5ED 2LW3A 1D6VH 5D4JA 5E1QA 2ZE0A 5FO8A 4U4IA 1RZ8A 1CJYA 5J11B 4A2HA 1IKOP 1FFPA 4GXFA 5B3JE 5TGBB 4IKNA 5DF0A 1ZGLB 4FLQA 5I74B 4A7QA 3NCJH 1SJEB 2E9IA 5IW1B 1D5BB 4F2ME 4PJXF 1J8RA 1KCSH 1R3KA 3B9KC 4U1MA 3UEZA 3C2SA 5D2LE 4O2EA 3FT1A 1I1AC 3UAJA 2O4EA 4XNXL 1ETZB 4XTRC 1Q94A 1QFWH 3A6OA 4LVHB 3TVMC 5B39A 3K80A 1GKOA 1XZWA 3KD4A 1A0QL 2HJLA 4PV8A 1DANU 3F85A 1F4YH 4AQOA 4XP1L 3FO1A 2RR3A 1KEGH 5CJOL 1I8MA 1R0AH 5L88L 3KL5A 4OQTH 1PZDA 5BZDB 4EN2A 4HYTB 3V0HA 1NMAL 1OTSD 2YS4A 3T2NH 2V7HB 1TKWB 4URTB 2I60H 1AY1H 4YC2C 2LU4A 4A37A 5FEBA 2AJXL 4E42A 4XHJD 5DD1L 5B3NA 3VFWB 1WH0A 4WJ5A 3EJZC 2X0WA 4PPTA 1R5VA 1EAPA 1RK1A 3GXUB 2G2PA 4A1RA 1W72A 4JFDE 1S9YB 5GRUH 3O4LA 1UZ8A 4NPYA 2F5AL 2WTRB 3HUJE 5KS9E 3N0AA 5MEPB 1SY6L 3RZWA 2QVFB 1J8HB 4L48A 1RJCA 2ICWB 1ERNA 4U33A 1KB5A 4MQXC 3TZVD 4R83A 5F72S 2EABA 3MZTA 4X9IA 1F6LL 2XX1A 1L7IH 2P8PB 3OAUL 4E5XA 2BOLA 2VN4A 4M8VA 1CF1A 3CLEH 3QORA 4X8XA 3UYPB 5EUOE 1IKNC 3Q01A 3WHXA 5E1HB 3VFTA 3E3QC 1PKQA 5IK3A 3RGVB 3BWUF 3TCLA 5AAWA 2F5BL 1FHGA 5HI5C 3F83A 5CS7A 3VH8B 4P46B 4Y1AD 1L5GB 4RFOL 3MHZA 4PW9A 5E6IA 4XNUL 3HBZA 4Z7OF 4FFWD 4OKDA 4BFOA 3M7FB 3WO4C 5L8LB 5FB8B 1MY7A 2NXYB 3K72B 5KVGH 2YQBA 1M2VA 1SBBA 3MNZB 2D9QB 4AG4L 5GRXG 5T3XD 1G4MA 1NFDB 1AGEB 4N1CA 3R7RA 1KJVA 4Z7WB 3BPCA 5EULV 1BZEA 1OT4A 5INDB 1YMHB 3Q6GL 3H3PL 4HUUA 4LLMA 1V7NL 3DGGB 4MCMA 4Z7NB 1IQWL 4PJFB 1UXLA 4DPRA 2HKHH 4JRXA 2OX5B 2I9LB 2Q7AA 3IKCA 3D4GA 4M4PA 1LP9B 4C4KO 3UPRB 1NANH 4CMHB 4I13B 5I0WA 3SDDA 2HG5A 4G8EB 4GFTB 3D06A 1VFBB 5F88B 1QW9A 3TM6A 4TOYH 5BV7C 4CN6A 3QXDB 4OD1L 4BHUI 2VO5A 4MQ7B 1BQLH 2L7UA 4TSCH 4PGZA 3UTQA 3ZDYB 5C0DB 1UM4H 1RPUA 4LCCA 1U3NA 5I0ZA 1UOLA 2HPTA 5FUZL 3S5ZA 3GJFK 3TLRA 2WQSA 2MPAL 2VLKA 4WWKB 4ZFGH 4DEPB 2QPEB 12E8H 3HPJA 4N0UE 4G9FE 4WTZA 5I76B 2B3RA 3OTTA 4GNKB 2FSDA 3MN8A 1SDDA 1ZT1A 4TM9A 3TBTA 4GG8B 4XVSH 5ACZA 1IC5H 4BGLA 2WY3B 5EBWA 1AIFB 3KH3A 2P52A 2YD3A 3H9SA 2VZSA 1CU4H 4AGLA 1T1ZA 1CG9A 2V2XA 4CU7A 3ES6B 2IADA 2GJZB 3SGJA 1HSAA 1T83C 2DYPB 4C4KT 1JNJA 4KY1H 2EDJA 4FZ8H 2NY4B 2Z8VC 4MX7A 2O6PA 4WI0B 5I1KH 1KIRB 4Z76B 2OMYB 2ZPKL 3B2MA 1T0NA 3QEQE 1NFIA 1XB8A 4Q6YA 4D3CH 1BV8A 3FUMA 4QY8B 5JQIB 1JYXA 2BNRD 4TSBH 4AIOA 2KBGA 1T1WA 2VW4A 1QLFA 4XBMA 3BUTA 3WKQA 4JFEA 4FFZL 4KROD 4HKZB 4Y5YC 3EYFB 3DIFA 3C6LD 1YY8B 2PWFA 2BS71 4KK5C 2ADJA 3K1DA 3KYOA 3C8DA 5F9AC 3KWTA 3AACA 3VXUE 1JTTA 3MLYL 5H37H 5EC1B 1A2YA 3Q0HA 3V0EA 3DLQR 2FH6A 2HRPH 4QXWA 2FHBA 3AAZA 3FTWA 1AC6A 3WY4A 2C3HA 2A73B 1KYFA 2PABA 3FCUB 3QJTB 4HSAC 5K1JA 3BO8B 1WC7B 3UTTA 3FQXB 3PQYD 3VYNA 5F3HB 1NM4A 1CFBA 3RI5F 1X9LA 1P5VB 5IJKA 5BV7L 5ILTL 1NUDA 1G5AA 3KYMB 1SF5A 3L2LA 4EI5D 2ENYA 3NN8A 2UXGA 3CX5J 3L3DA 1NLDH 1ND0A 5I1AA 2DKMA 3ZE1E 2EXYD 3SPIA 3VI3E 4LL9A 3T0ED 2JKXA 1IJ9A 3HE7D 4NRXA 5C70A 2XFGB 2UY6B 1RFDH 2E7MA 2FHCA 4X6DA 3KS0J 5T33H 1T7ZA 3PUCA 4I2XE 4XP4H 4G6KH 3IDIA 2N01B 3NJVA 1BQRA 3WTWA 3FBQA 2CKBH 4N0CD 2JKWA 1ZD6A 3D4ZA 5HYSA 1FQ9C 3F62A 1ZA3B 2V17L 4NZJA 3DGDA 3L3KB 2LR4A 2VDRL 1TVHA 4B6ZA 2K9UA 1IVTA 2EIJB 1A4AA 2F08A 1E3ZA 5DXWA 5GHWH 4MYPA 3O9WA 3UGEA 5F9WB 4FTVA 4AVHA 4JGJA 4NZFA 1S9KC 3CLFH 3BEVB 2RQ8A 1QOKA 3G6AA 4APQC 5MP6H 4F8PA 1ANUA 5C0EB 3F7QA 1NGZA 1QA9A 1WFTA 2VQ1B 5DZLA 5BW7C 4YHNB 3QYNA 1TT6A 1XCQB 3U82B 4JDVB 2FJFA 1TG8A 4L1DA 4PJHE 4ZDHB 3B5GA 2FQEA 4NFDA 1HS6A 2OJZH 2OCFD 4PRID 5JW3H 5L2KD 3EZ8A 2DD8L 4ZFQA 5GSRB 5JHLL 1WZKA 1N0LA 4B27A 2IDCA 2IGFH 3CDGB 1J18A 1YUHA 2X1OA 4YL4A 2X6CA 5TE7H 3LNGA 4TVPD 4PIRF 3DJTA 2VN3A 4HCFA 4R7DB 2IANE 1UD2A 5A2BA 4DVRH 4HK3J 5CZXC 4HGMA 3C8KA 1CD0A 5I6OA 4DZBB 3FQ2A 4CW1B 2JTDA 5BO1L 4FQ1H 2BC4B 2Z8WC 2FJUB 2WD0A 4HC1H 4NQDA 4OFPA 5AQ0A 2FHFA 3HLKA 3LQAC 3QEHA 2YGOA 5GGSB 3GHEH 4QOKA 2BERA 5GIRB 1KCUL 3KPMA 5HDRA 1GJIA 3NZ8A 4PJ9D 5K9OA 4BZ2H 2VDPL 3WS3B 3CN3A 3PWNB 1A14L 1OF2B 1UJ3C 5SX5H 1UACH 5G5DA 1CL7L 4WK0B 1WDAA 3KLLA 2AS5M 1VACA 3SCMD 1YMMB 3UDWA 5IBTL 2WXQA 4B9ZA 2XNAB 1LMKA 4L8DB 3OKKB 5DZAA 1FORL 2O30A 4K3HA 4GAYB 4XZUA 5L8KB 1MRDL 2IMNA 2G3XA 3KPLA 4WJG3 4X2UA 1HI6A 3JWNC 3NJXA 4NNYB 3NQIA 5F7FA 5JPNA 4Z78A 4JO3H 3BDBA 2HRLA 3EYOA 4ZAKA 2DI7A 1R9FA 1SUHA 2PCYA 4IIZA 3ZE0B 1BGXH 3U46B 1F2QA 3W9EA 3FUNA 4J8RB 2EXSA 1C12A 3UEQA 3HAEH 3KMDA 4HIHA 4Y4HB 2VM3A 4WV1B 4V1DA 1JGDB 4C56B 3CN4A 4IRSA 5F6IC 3UC0L 3MYJB 3VRLF 2L0DA 3Q5YA 3D3VB 3T8XA 2R83A 1GSKA 3RWIB 5LCVH 2ZOUA 2WXKA 1FDLL 3BKCH 3RJOA 2WTPA 3MMEB 1CYXA 1SYVB 3K2UL 5B1AB 1BVOA 1A3LL 4FULA 4R4FL 1JZ2A 1YN6A 2YJLA 4HMEA 2DQHH 1QLEB 1HESA 2I9TA 1PJWA 2ZYIA 3QDGB 3EYUH 2CG9X 3FU8A 4I3RL 5EO1A 4WEEA 4WHYG 3MKGA 1WHOA 1MCEA 1UT1A 4KFMA 1UA3A 2GJRA 3KXFD 4OZIE 2WCSA 3B9EA 1OOAA 2ZNWA 3D05A 3ULUC 4CVZB 3GXMA 4IIQA 3V9EA 1MOEA 3IGUA 1ZLUH 2YXMA 4S0HA 4AW4A 4GMSH 4MD4B 3RIKA 2QMKA 2ZNXA 3ARFC 4A63A 5LN8A 3GLDA 4LESA 3H2QA 4PJ6A 2YARA 3GZQA 4G72B 1A7OH 1FGVL 4PRHE 1WUZA 5DTFB 2BY3A 5L0QC 5IV2A 4GRLC 1IAII 4M3KB 5DC9B 1G1OA 4UINH 2QSVA 5HHXL 3LQAL 4G8GE 3L45A 3MV7E 1IM3D 4KVNL 3KZ8A 1T0PB 1P6AB 3CK0H 3DETC 4L3ED 1C9SA 1AIZA 3TCXA 3QG7H 4P5MA 1C5BH 2Q86B 3FO2B 2WOYA 4L5FE 3V4VB 5E9DD 1GAFL 2EKSA 4L0ZA 3UBHA 3O3BB 1FYTB 5E6UB 3MRMA 4PTUA 4L4TE 4WW2B 1WD9A 1D5IH 4MWFA 4ORGB 3IDYC 1NAML 1KZQA 2IMMA 4J3SA 3HNSL 3BSGA 1LO2H 2XYCA 1ZV5A 3L1OL 5C0GB 4Z8FH 3NCXA 2DQMA 3BHBA 5K93A 4P59L 4PRDA 5HGDB 3STZA 2QFPA 3BP4B 2QLYA 3FT2A 2UXVA 3E2HB 2HUHA 2YA2A 3GBEA 3SKOB 1ZV9A 4DPAX 3D69A 4BK8A 1ZGLP 4HOMA 4KZDH 1A6UL 5H4YA 3PP4L 5F1KC 5T1MB 4W6WB 2DLHA 4JJHA 3FFCB 1MWAA 1M7UA 2FJHB 4PRPD 4U3XA 3MRKA 2G4EA 3A0OA 4POYA 1MNNA 5AOMA 4GBXD 2R9HD 5SWSD 4LPTA 4DN4L 1HWGB 5F7BA 5C07D 4WK2B 4OLXH 3TGXA 4E9YA 3UAEA 3BPOB 1BF5A 5D1QA 4IYKA 1KTLA 4K23H 1S7TA 4NNXA 2X6AA 4U6HA 4OT1H 1USZA 3T3PE 2F7PA 2VUYA 3FT3B 3P3RA 3HZVA 2V9TA 1U91B 4U2YA 1E8XA 4CMMA 1MXDA 1KJ2B 4FEIA 1EIBA 4DNLA 3AADB 3RVTC 1M4KA 1YPZE 4DEUA 3S4SG 4R2GD 1LK2A 3TC9A 2JIXA 3QG6A 3ULUL 1B4JH 3LN4A 4F9LA 4JFUA 3EO9L 3SDCC 1Q9KA 3IT8D 4LARH 4MTMA 3SKJH 2VISB 4P2YA 4KKQA 2R29H 1LE5A 3J27A 3FCSB 5ICYA 3UZVA 5LXGL 3ZMEA 2A74A 5CSZB 3HZKB 1SYSA 2PO6A 4UT6A 5EB9A 1GOGA 1HYSD 1FZOB 3ZN6A 1XF2A 4KUZL 5I8OH 2FVNA 4R0LA 1KPVB 4RSVA 2VUKA 1GJUA 4OZFH 2J1KA 4Y1TA 1SN5A 2CJSA 3S5LG 4HKBA 4F20A 3UG4A 3LQZA 2ESVA 4OZGA 3QNXB 4LK4A 4X7SH 2P49B 4P3CH 2RMNA 3BEWB 4NP4H 5IMKB 1XH0A 3V4UH 5J13C 2F0CA 3CDYA 4K7FB 5F0JB 4Q6KA 4DH2A 3L3HA 2WWKO 4FXKA 2A9ML 3FU7A 3W1ZA 1HTYA 1RCYA 4HUWA 1NGPL 3FRUB 3ZPDA 2CKNA 3KCPB 2FIKB 3WNMA 2Q7NA 3C87A 2VZ3A 3DKHA 4P3DA 1FNHA 3KPRD 1PLGL 1NM9A 3ESNA 5DO2D 3PUUA 4X99A 1ASQA 2R69L 4XVOA 5HI3D 5K9QG 3TOPA 3QUML 3L4UA 1YEWA 2Y9RT 3IDUA 4GRMA 4E41E 5BS0A 1IGJA 2ATPA 4G5ZH 5SWZA