3DVGB

Crystal structure of k63-specific fab apu.3a8 bound to k63-linked di-ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEWVAYITPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human IgG1 fab fragment light chain
publication title Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvgB01
1KG0A 2R1WA 4N1HB 5LG1A 1XR8B 1EPFA 2MHAA 2X42A 5L8LB 1A0QH 4Q74A 4EDXA 2ZOLA 5BVPH 3DSNA 3NVQA 4JR9H 3D48R 1C7SA 3NMEA 1FSKB 2UY7A 1J12A 1Q94A 3FJTA 3FMGH 3H9SA 2G75B 5KSAA 1EZVX 2HVKB 4H20L 2D9CA 3VWKD 3UC0L 2VDLH 4HKZB 1QSFA 3MV8E 3MNWA 1A4KB 4KZDH 5AUMB 2QJDA 3RPKA 4CGTA 3AM8A 4XP1H 5ESAB 2I60L 4B7LA 4LCWA 4HLZH 2EH8L 1CD0A 2IMMA 2EECA 3QQ4B 4Y4FD 5J6HB 5D7LE 1UKQA 1VCAA 1MLBB 4I18A 4OFYA 2YSSA 4OT1L 3ARGD 4PJDB 4CMHC 5DDHA 2HFFA 3GIVB 4Y5VC 1BOYA 3RUGA 2A74B 1FNLA 4X4ZA 5EO9A 1E4KC 2XTLA 2OI9B 1HH6B 3EFDH 1YY9C 4AIOA 3GSVA 2X4NA 1TVDA 2HTKD 1AFVL 2H32B 4L3ED 5IF0A 3DUSA 2J1KA 3F7YA 3R0MA 5HPMA 1BQHB 5DEFB 2P5EB 1LNUB 5IEKA 3TESA 2B2XL 4G9FE 1DBJH 1IMHC 1LDPL 4RGOL 4D0DB 1NEZG 2QHLA 5C09B 4XP4H 5F88A 3LEYL 5D7IF 2W9LA 4P9HH 2HN7B 4OI7A 4YX2L 2FBJL 5EU7E 3X3FL 4Y4HD 4GRLA 1DN0A 1DUZA 2ZCKH 1D6VH 5I1KH 1ZHKB 2CO7B 1EHAA 2NY1C 3QXAB 4XPBL 4N8CH 4ELMF 3MFGB 4JJ5B 1MCEA 5BW7C 3DETC 4JO4L 5D1ZD 3NOIA 4NQVA 2VZSA 4HW6A 3IDNA 3RKPA 2XTJB 3BUYB 3NGBB 4YHKH 3UYRH 4JVPA 5I1LB 4MD4A 3ZKMD 1AQDA 3I6LD 3EHBC 1T2JA 3ZKQD 5BZDA 3B2UD 4XP6L 4FQIL 4ODTL 5C6PB 1FBIL 3DRQB 2GAZA 2YRZA 1OP5H 3U7YL 3K81A 5JDSB 2VXSH 2C4FT 3ESUF 4NQTA 3JSSA 4HUXB 2YN5A 1GXEA 2CIKB 3VXQB 5DTFB 4WDIB 4MJIB 2H45A 3VRJB 1FL3A 3TV3H 4MJ2A 1IE5A 4KJQD 5J6GB 1FORH 4XWGL 3FRUB 1AE6L 1FDLL 5E9DA 3UPCA 1PDKA 1TJGH 1A6WH 1RUAL 1WSST 3ES6A 1A7RL 3CVIH 2E27H 2R4SL 2Z93B 4BK4A 2D7TL 3OZ9H 2C3GA 2OTUB 4XPAH 5GZOC 1FHGA 4UV4L 5GGVY 5GGQL 5T1KB 2EYSB 4MNQD 4F7MB 5IVXA 2ITDB 2A83B 3CFKA 5EIQA 5L2KE 2GTZB 5J11C 3GKWH 5K33A 5D70L 2OJZL 3LS4H 4AL8L 3VXOA 4MQ7B 1CFTA 1ZK9A 3HUJB 1CBVL 4WUUB 2EEAA 2P8LA 3L9RB 4R3SB 3PABA 1NLBH 5IB4A 4K2UL 3SGDI 3TA3D 4KROC 5H94B 5FYLL 4EVNB 1M7IB 3MJ7A 3D3VA 4HMEA 1VERA 3BJ91 1I8MB 3OXRB 2GK0A 3LQAC 4WCYL 1I1YB 4F9PC 3CXHJ 2VXQL 1W0WA 4E41B 1BFTA 5B4MC 4JFXA 1Q9WA 5JW5A 5KOMC 3O6MH 4M6MH 4Y5YA 4BFGA 2P24A 4K94C 3AS2A 3ARBC 3QA3A 3PQYA 1JZ4A 1FVDA 3BKCH 4K3JL 5D6CA 2HVJA 1TZIB 4ZFZB 1UH4A 4Q9CA 4FQXC 4OZGA 3X3GL 5IESL 1KLUB 2FX7L 5CP3H 5IG7B 5I16B 2VITB 4ZUTB 1R6VA 4YBLC 1FL6A 4MA8H 3FO0L 3D85B 5B3JE 4UIMA 1TCRA 1VSCA 3DX7B 4QGTA 4AQOA 1CLZH 3ALPA 3I2CH 5HYIA 3TBYB 5HHPA 1HNFA 5I19H 3WS6A 5AZ2L 2AEPH 1SY6H 2W65B 1UEYA 4FQ1H 1VENA 1GZQB 1CF8L 3KPSD 1E27B 3ARED 2IPUG 3LQMA 4ODHH 5D1QC 4ZUVA 4WRLA 5T3ZH 3KPRB 2CLZA 4YEFA 1FZKA 5IQ9A 1DVFC 1RMFL 5DMJB 5HVHC 3VFGL 3PDOB 3EZJB 2IF7A 2DBJA 3SGEH 1FAKT 1OTSD 2O61A 1C5BL 3GRWA 1QNZL 3S88H 2VISA 2LTQB 4U1GB 1QBBA 3BD4A 1CCZA 1S3KH 5L0QC 2C26A 1A0QL 1KACB 5CZKA 3T0AA 1G9NC 3P9LB 1T7VA 5BVPL 4MMZC 4JR9L 1JBJA 3PNWA 3SJVA 4PRIB 1H3VA 1CXHA 4XI5D 4XNYH 3FMGL 1F97A 3S3JA 3CFDA 3WO4C 5F93C 3KYMB 3SDXF 3S5LA 2VDLL 1QUNA 3G5VB 4X6FA 4X4XB 5SWQB 2F58H 3QULA 3OKNA 1CFSA 4KZDL 5HGAB 4XP1L 5DD1H 3NCMA 5EUOF 5IIEA 3SE8H 1N3NB 4TUJA 5F3HA 5JIPA 1HQRA 2CDFA 4K7PH 3K4DA 5HTSA 4G42B 1J1XH 3G6JA 5C6WH 4PPTA 2IADB 5J1AB 2XFXA 3PL6A 4O2EB 4K55A 5C0EB 1HIMH 3LEXB 4PJFA 4RX4D 4PJEF 1ZLVH 3BO8A 1U3HA 2JB6B 1PKQB 5ID0B 4OI9A 5CEZH 5TDNA 4RMSA 5B3NA 4PRHD 4PJ5E 5E00B 4IDLA 1CG9A 3VGAC 3VXSE 2R2HA 1GYAA 5C0BB 3BT2L 5HVWA 3EFDL 5C0GA 2Y7QA 1UB5A 5TE6H 3E6HB 5GPRA 1I8IA 4IRSD 4U1JB 4EZMA 4NQDA 3BKMH 4L29A 5IK3B 5I8CB 4I13B 5A16A 4E42B 1LD9A 1DBJL 2H2PC 4EN3D 1NANI 2QBWA 2BSTA 2X4TA 4F58H 3D2UD 3BW9A 3C9NB 1UJ3B 4XP4L 3GKZA 4P9HL 4FFVD 2CIIB 4PJHA 3FFDA 5I1IH 1UC6A 1YMMD 2NY2C 1D6VL 1Q1JH 2FZ3A 2ZCKL 4J3TA 4C56E 5I1KL 2V2TB 4N8CL 5A3IC 32C2A 5ISZB 3OWEA 2H8PB 4Z76A 1UZ8B 2VABB 4OGXH 3KPPA 1F3JB 3KYKH 4XWOD 4KGJA 1Q9OB 2NYYC 4PBXA 3QCVH 1M6OA 4DEPC 4L8CA 5JHLH 5FYJE 4YHKL 4PG2C 3UYRL 4NN7C 3TBVB 4LPTA 4P4KC 1VB9A 1XF3A 2DI9A 3ARDA 4GW4B 4HS6A 2EDFA 3VD7A 4UOW0 4IRJD 2DIBA 3VXME 4PGJA 2PNDA 2CUIA 2D4DA 3HS0B 1RULH 3RZWA 3WFHA 1M7DA 1PEZA 4Y16A 3I75A 2B1AH 3QT2A 2VXSL 4FQ2H 1KTKE 2IH1B 2QEJA 3UBXB 1YN7B 3AGVA 5HGBA 1JK8B 3OKEA 3MO1A 3BGMB 5GGRY 3F7QA 4MNHA 5BVJA 2C1PA 4WENB 1FORL 2PF6A 4I1NB 1SYSB 3PP3K 1TJGL 1HH9A 1A6WL 1KJ2A 3G08B 4LEXH 3RWGB 1X5YA 2CLVB 3WLBB 5MENB 4ZQKA 1Q38A 4NO0D 2AJ3A 5DI8B 3CVIL 2QQKH 2E27L 4RGNE 1X44A 3CZFB 3OZ9L 4MXQD 5MP6H 4CVZB 5DJYA 4XPAL 2Y06H 1U8KA 3TO4B 2RJMA 4JRYE 2EEBA 4J3UA 1JWMA 3CDGB 5EUOE 4IBLT 4P46B 3ULVE 3LRHA 4P2RE 4RDQG 4HX1B 5D71H 3GKWL 1MSPA 1MHCA 3LS4L 3RY6A 4GRWE 2NW3A 3QO0A 5EN2A 2XN9E 1ZXQA 5FK9A 1NLBL 3U46A 4XGZB 1NBVH 2AJVH 1JYWA 2WUCH 3CXDH 4U6TA 2WBJA 1JE6A 2NNAA 4P4RA 3X14B 1R3JB 2HJLA 3P11H 5DRXB 2GY7B 4JDVB 1ETZA 3O6ML 1BZQK 1ZT7A 1S5IH 3BKCL 2APVA 2P49B 1Y6NR 1T21A 3MRFB 4P5TD 4XBEH 1VFAB 3OAZK 4MLSA 4JPKH 5GGVH 3UAJD 1VHPA 4LK4A 4MA8L 1V3LA 2NY5H 2NY0D 5DRNA 4NRZA 1U6AH 3CDCA 3V0VA 1EHNA 1NCCH 3RPIA 4OUOA 1CLZL 3PGDA 3I2CL 3QFJA 5MHSE 4HG4J 1KB9K 4XNXH 4RMUA 3VMOA 4WV1B 5I19L 2AEPL 1SY6L 4X9HA 4FQ1L 4HGMA 5AYQA 4ODHL 3VDCA 4BH8B 4CU6A 5T3ZL 3GSNB 4RAVB 1NDMB 3TVMC 4HH9B 3KWWA 2NX5D 1KPUB 1E0OB 4IOFD 5F7HA 2DMBA 3S88L 5IMLB 5FO8B 1YYMH 5EU5B 1C16A 3QDGA 1S3KL 3QIBD 3QISA 1RPQA 3L3DA 3ARTA 4JRXE 1RURH 4MS8D 1J05A 2IAMA 1CICA 5C07A 3OKMA 4XNYL 4HJGA 5JOPD 3CLEH 1YA5A 3U0PA 1A1NA 1KTLB 1KTDA 4GAYB 1FV1A 5HYSG 2W0PA 1P69B 2F58L 4Y4KC 5GRZA 1MCPH 1NCDH 3VI4F 3CDYA 5DD1L 2FX8H 3SE8L 3ORJA 4BQCA 3BYTA 1TZHB 2BCKA 2E9IA 4K7PL 5EZLB 2CUMA 4Z7WB 1J1XL 3GMNA 4NKDA 3MNVA 2EKJA 1CDGA 3MPCA 1HIML 4G8IA 4C55A 2VYRE 4AIZB 1WFOA 1XZ0B 5D7JD 1NC4A 4KHTH 1QFPA 5CEZL 5DJ0B 3Q2CA 5KVFH 5DJAA 4QRSA 3QUYA 5EPMA 3SKOA 4U6YB 1EIBA 4F7PB 2V5TA 3KPMB 2RFXB 1KIPB 4R4ND 4BUHA 2VLLB 3L5JA 4FZ8H 1A02N 3QUMH 4CDGC 4L3CA 5TE6L 1I1RA 3TEUA 4ALAH 2MCG1 3NFSH 1AKJD 5C3LD 4XBGA 3KPNA 1ADQL 3BKML 4JFPA 5EZIH 4QHMB 5CP7B 1KPVA 5FDWB 4IMKA 3SDDD 4F58L 1WLHA 1CFBA 3ROOA 5I1IL 4JAMA 1Q1JL 3HPLA 5J8OA 3KPQA 4LVNC 1IVLA 3RBSA 3QWRD 4NKOA 1NAKH 4QT5B 5FYKH 4ELKB 4L4TE 3SDCD 2G60H 3OAYH 3CZJA 1NMCB 4K71C 5E5MA 4OGXL 1ORQA 3BHBA 5CD5D 3UYPA 1E4JA 3KYKL 5I1HH 4LF3A 1T1XB 4WO4D 1SEBB 3QCVL 5ESVA 5JHLL 4TVPD 1BD2B 2DRUA 4M02A 3O2WH 5T1DH 2YA1A 3B9DA 2ZKHH 3IDGA 4H0GA 5J12B 3QDJE 3VWKA 2ZNXA 3JV4B 1F5WA 1RULL 5BV7H 1O0VA 4M9PA 4PGBA 3E6FA 1A47A 2B1AL 3VXUB 3O9WB 1JF1B 4FQ2L 1Z5LB 4Y4FA 5L8JB 3RWDA 3V7MA 3MRCA 2I9LB 2EYRB 3O2DA 1FLRH 3V6ZB 4LLDA 4UU9A 4QTHB 2FECI 3CFEB 3C6LB 3ARGA 4Z95H 1P7QD 4LEXL 4PJCF 4UT9H 4WIQA 3OXSB 5J57B 2P5WB 4XNMA 3HG1E 4Z7OF 2IQAA 2QQKL 5DHXB 3CUPB 1T1WA 1YPZF 2FO4A 3LVEA 4QOKB 2BJMH 4B5EA 3VFPA 2A0LC 4NKMA 4P0DA 4PJAE 4BSWB 5MP6L 2VZUA 2XYCA 2Y06L 3ALXA 4KU1A 1OTUD 3QIWD 3KXFB 1OL0A 1YEEH 3JV6A 4L3EA 2X4OB 1RZGB 5D71L 1U8MA 1CTNA 5IMKB 1VPOH 4F57H 2YUVA 5LQBH 2A6DA 3UDWC 4AJ0A 3HCVB 2ZG2A 4LIQE 1Q9LA 5FB8A 4ZTPH 1I7ZA 4ONOA 2A9NH 4P5KA 1T89A 1NBVL 2AJVL 4NOBA 4Y4HA 1X5JA 3BEWA 3OGCB 2WUCL 3CXDL 4PY7A 1KC5H 3BDBA 2ZSVB 2EXYD 1A64A 1C5CH 4O9HH 4A6YB 5D1ZA 5ENWA 2EIBA 4GG6A 2XV6B 3GMMA 2RHEA 5IHUH 2GI7A 4QRPD 2YBRA 1FE8H 1S5IL 3UPRB 5TF0A 3EUUA 4GW5A 3WDIA 4XBEL 1AD0A 2PTVA 3FB6A 4U7MA 1DE4B 4JPKL 2EDDA 5GGVL 2NY5L 1U8HB 4UAOC 1YY8A 5CILH 4XTRC 1U6AL 1ZTXH 2PYEB 3W9DA 1ED3B 3I84A 3QXDA 1J11A 2VIRA 3PWPE 3V0AC 4XNXL 1BWMA 1SYVA 3MLXH 4QEGA 3KLHC 4NM4H 4NC0B 4L8BA 2ZOKA 2F53B 4ODSH 4GQ9H 3CD4A 2GEEA 4O2FA 1U58A 3FO1A 4XMPH 5IOPA 3PIQB 4HQQH 5E4EB 3RVWC 1RZJH 4RFNC 1WV7T 4JKLA 2YEZA 2WLYA 2DLHA 1YYML 3BWAB 4U1GC 2KH2B 4JQVC 3QH3B 1BZ7B 1JGVH 1QACA 3PHSA 4MNQA 5H2BB 4S1SH 1OGAB 2OR7A 3B9KD 3E0GA 3MRQB 3O11B 3R4DA 1JFQH 3TZVB 1RURL 4GKNB 4AM0B 1ZSDB 4PJXB 3CLEL 3LN4A 2C1OA 3IRZA 3LRSB 1HI6B 3O3EA 1J0IA 1PJ9A 1H0DA 3TA3A 4ODXA 5FUCC 1IGYB 1LO5B 3TN0D 1WTGT 1J5OH 3VCLB 1MCPL 1NCDL 3FOLB 2FX8L 3B9EA 5F7NC 2X4SA 1IGTA 1JWSB 3QUMB 3RZCB 3O4OB 1BX2B 5KSBA 4LLVA 3UTTD 5DRZB 5F97E 2EYTA 5EBWA 3TPKA 5H35B 4KHTL 1CDUA 3BGFC 3MGOB 2WAHA 1R5WA 5I73C 1I7TB 5KVFL 5JPMA 5BJTA 5I74C 3T0EC 2OLDA 5I9QC 3FT3B 2NZIA 3HAEA 4FG6D 4OFDA 1G7HB 3F65A 4P9HC 3GEWB 4FZ8L 4EOWH 2Q87A 3QUML 4ORGA 3UTSD 4ALAL 5CHNA 1KG0B 2R1WB 3NFSL 5CJOH 5FOJA 1Q0YH 2MHAB 1D5BA 2B20A 4EDXB 2ZOLB 5GSVA 3KPSA 1QLFB 5EZIL 2F54D 3V2AR 2G9HA 4IS6B 3TCLA 4QRRD 5HHOD 4HCRL 1J8KA 1GL4B 1Q94B 4P2CG 4F9LA 3H9SB 2R1YA 4FABH 5JPNA 4RA0C 2E3VA 3GRWH 2NY3D 4R7DA 5DO2D 1QSFB 1X4ZA 5DD0H 3VFOA 3OAYK 3FFCE 3MNWB 1HCFX 1NAKL 5FYKL 3OHXA 3SGKA 1OAQH 2G60L 5EZJA 3LV3B 4NO3A 2PUQT 4HBCH 2WANA 4LCWB 5I1HL 5E2VH 3TC9A 2ZCHH 2JE8A 5BRZE 5F1KC 1JHTA 3O2WL 4X7DC 5T1DL 4I18B 2ZKHL 2YSSB 4D9LH 4NQSA 3I3BA 1BP3B 3LD8B 5I17B 2DL9A 5DDHB 3U2SA 1YNLH 2HFFB 4XP9H 5BV7L 1NEUA 3T77B 1S78D 3RUGB 4KK8C 5EO9B 5AD0A 3AY4A 1BVLA 1LK3H 2X4NB 5HJ3A 4MQTB 3C60C 1AXIB 3BPNB 4JY6A 2GJJA 5FGRA 5I71C 3Q6GH 3MGTA 1H3PH 5IF0B 1FLRL 3F7YB 5HPMB 4RX4A 4KK5D 1LILA 1XGPA 4Z95L 5E99H 1N26A 3RL2A 3QIUC 3G5ZA 4MA1B 3EYQD 4X0KB 4ONFH 4QNPF 1SMOA 1YJDH 4PRHA 5F88B 1WZKA 1CFNA 4RWHA 1OT1A 2RQ8A 4RRPA 5HHXH 2IBBA 1IAKA 1HOCA 2BJML 4X9BA 1DUZB 4KFZC 1A4JA 5JIKA 5CIPB 4NQCE 1EV2E 2AXJA 1YEEL 3PV7A 5DQ9A 4X5LA 1YZZA 2BVQB 4IRSA 3J7HA 4LSPH 4ONHA 2VTFA 3VWJD 2GJ6D 1VPOL 3C5ZC 2CXGA 4NQVB 4F57L 1ERNA 3HZYA 5LQBL 3IDNB 2DWEA 5ECJE 3D2UA 4K23H 3C6SA 2W92A 3DHMA 4ZTPL 4MD4B 5E6YA 2J6EA 2A9NL 4UOW1 4V1DA 4PJGA 5HHVH 3K2UL 1WTLA 4QY8A 1AQDB 1YMMA 1NAMA 1KC5L 2MKLC 1IKFH 1IKNA 3G6AA 4BKLB 5B39A 2GAZB 5IJKA 2DWDA 4KKAC 4ZPVA 1SMAA 4U0QB 1C5CL 4O9HL 1U8PA 3H8NA 2QSQA 3G5XA 4YAQA 2WBKA 5IHUL 4H88H 2DKMA 4TTGA 1GVIA 3DUUA 1FE8L 4JDZB 1FL3B 5F7WC 2V9QA 3QEQB 1ZLSH 5J56B 5E9DB 3IDXH 1A7BA 2PXYD 5D7LD 4ZG1A 3ES6B 1AI1H 1AR2A 5CILL 1ZTXL 4XAKD 3LIZH 2P46B 2OXHA 4G8EB 4NZJA 1HHIB 3MLXL 2NW2B 5TE4H 4NM4L 3N1GC 2EDBA 5GRWA 4WV1C 5IVXB 3CFKB 4ODSL 5EOCJ 5E56A 4GQ9L 3I9GH 3VFVA 3VXOB 1R24A 4U0RB 1EJOH 1CFTB 2VZOA 3DBXA 1M1SA 4XMPL 4MCZA 4HQQL 4NO0A 4AEIH 1RZJL 5E6ID 4HUWB 3BIAX 3PABB 5IB4B 4YBQC 2BNQD 1V8HA 3FQXA 1T6VN 4YDJA 4BJLA 4S1DD 3MJ7B 3EDEA 2B0SH 2GK0B 1NQBA 3N1PC 1JGVL 1DLFH 1W0WB 2HJKA 4S1SL 1KCKA 4MHHG 4O02H 1CLYH 3MUY1 4FHBD 1NMBH 1KTRL 1I75A 1JFQL 4JFXB 1Q9WB 5JW5B 3ZDXF 1MI5D 5EU6E 1H5BA 1NFIA 3WO3B 1UXSA 4Y5YB 3MROB 2W0LA 5KS9A 2P24B 3QA3B 3PQYB 1FVDB 5D6CB 1D5IH 2HVJB 2QR0A 3SO3B 4HSQA 4OZGB 2DQDH 5ELIA 4LDLB 3BRDA 1J5OL 1FL6B 1M71B 4Q58C 4PYGA 4QNPE 4MQSB 4ZOEA 5ANMB 2YPLD 4HKXA 4UIMB 1TCRB 2YS4A 1LQSR 4FXLA 4KMLB 3H3PH 2DMCA 2DICA 4ENED 5HHPB 1HDMA 2XA8H 5KVDH 5HHQB 1L0YA 3GHBH 2CLZB 1FZKB 3Q6FA 5DD3H 5IQ9B 4V2BA 4JM2C 5INDA 2UVEA 4OLZH 2I24N 4HF5H 2YZ1A 3VFNA 4XC3H 5CS7A 2O61B 4KKCC 3DO3A 4NP4H 1NCTA 1IT9H 3TFKD 1F3DH 4EOWL 4GKZA 4XCEB 3U7WH 3OR6A 4Z7UB 1Q0YL 1W0VA 3S3SA 1XGYH 4JFED 3KGRA 1D3CA 4APQA 4YPJA 4FABL 4X6CA 3CFDB 4PB9H 4TUKH 2NX5A 2QL1A 1JHLH 3GRWL 3S5LB 5DD0L 3QULB 4G6JH 1M4KA 1HYSC 3WBDA 3OKNB 2IH3A 3QDAA 1NEZA 4JZJA 2EZ0C 4Y2DD 1OAQL 5IIEB 3QIBA 1AGBA 1GRWA 4LVHB 4TUJB 4OV5A 4Q9RH 3FOMA 1HQRB 1G7LA 2CDFB 3QWOA 4HBCL 4FQHA 1RJYA 2MWCA 3ZKXC 4KRPB 5E2VL 3GMRA 2XFXB 3H6JA 3PL6B 1SJVA 2ZCHL 4WTZG 1REIA 5MEQA 4PJFB 4UQ3A 5E7FA 5IKCA 4H1LG 4D9LL 2XKUA 3BZFA 4ZDHA 5SX4I 5FGCE 1KGCD 4TPRH 1YNLL 1FIGH 4XP9L 1NFDA 5A2FA 1CG9B 2E9BA 2R2HB 4WFGD 4TTDD 1K2DB 1AO7B 5C0GB 1JIBA 1LK3L 2K3TA 2Y7QB 3VRLF 1UB5B 4PRDA 2XACC 1BFOA 1P9MA 1I8IB 3Q6GL 3QNXA 1H3PL 3KJ4C 2D7PA 4NQDB 5D7JA 4L29B 1Z2KA 5A16B 5E99L 1LD9B 2E9JA 3KPOA 3RTQD 4Y88A 3BW9B 3C6LC 1MH5A 4HDIB 4ONFL 1YJDL 2R2BA 3BJLA 4K7FA 3UPAA 3L5HA 4OF0A 2QADD 3FQTA 1S7RA 1V7MH 2OMNA 2OX5A 3BD3A 3MREA 2Q6WA 3FFDB 1ACYH 1P4LA 2FZ3B 4MXVF 1PQZA 4YHYB 5KBNC 5HHME 5CGMA 4ZS6D 32C2B 2YWZA 3P4OA 1AKJA 4I5BA 4Z76B 1QO3A 4LSPL 3T2PA 1RK0A 2JF1A 4N9GA 1J8HD 3KPPB 2V2WB 5TE7H 1Z9OA 1M6OB 3SDDA 1FO0H 4K23L 5E1HB 4OFPA 1T03H 5IWLC 4HHAA 5HHVL 5CEYA 1KEMH 1XF3B 3ARDB 4HS6B 5CGYD 5IJVA 2FRGP 1J0KA 3UBXG 3HA0A 3SN6N 1IKFL 3QWRA 1J0YA 1PY4A 3IFLH 1JNLH 4DZBB 3WFHB 2VC2H 1M7DB 3SDCA 2NY5C 4M1GH 2P45B 3I75B 4Y16B 3W0WD 4HUKB 1A7NH 4GAFB 3PUCA 4U49A 4WO4A 5EOQH 4H88L 1F13A 5HGBB 1EO7A 1J10A 3VXRD 3OKEB 2Q1EA 3MO1B 4YWGH 5BVJB 3B6SA 4FFWC 2C1PB 1ZLSL 4GRMA 5FO9A 3DX8A 3IDXL 4FXGB 1HH9B 1KJ2B 5DS8A 1AR1D 5T5NG 1AI1L 4ZQKB 1CIDA 1LP9F 1OLZA 2AJ3B 4XPTH 3L6FA 3P73A 4Q6YA 4D9RD 4NUJA 5GGTA 3MZTA 4HFWA 3LIZL 5DJYB 1PBYA 1U8KB 5GGSA 1QRND 4PJ5D 1U95A 5TE4L 3S34H 3ROLA 1JWMB 2YD7A 2MCPH 5T1MA 3QPQD 3LPWA 5ACMA 4PR5A 1A5FH 3I9GL 1MHCB 1SVZA 2PTTB 1P7QA 1F2XK 2NW3B 4LKXB 1EJOL 3QO0B 2Y4SA 5EN2B 5GISH 5GRUH 4AEIL 1RZIA 3LB6D 3U46B 1FG9C 4UBDD 5E4EC 1Q0XH 2B0SL 2WBJB 5D96C 2NNAB 4OQTA 4P4RB 1DLFL 4W4OA 4U6HA 3SY0B 4O02L 1CLYL 4OLEA 1NMBL 1OT2A 1FZJA 2HAZA 3K8KA 3WSQH 1HE7A 1ETZB 4PJDF 4YUEH 1ZT7B 3BGAA 2NPLX 5B38G 4NN6B 5J0BA 1D5IL 3Q0HA 1FAIH 3ZZ1A 2YRPA 1T21B 2DQDL 3WN5A 1DLHA 4JN2B 1ZS8A 3QI9D 3S8WA 5C0AA 5DRNB 3O4LE 4NRZB 3V0VB 1IJ9A 2H6PA 1H3WM 3V5DA 5FECA 3H9ZA 4MXVE 3BZEA 3H3PL 1EBPA 3PGDB 3QFJB 3PV6A 2X4PA 4G5ZH 1WUNT 4J4PC 4O58H 1DBBH 1MFEH 3D9AH 3QQ9C 5JXAH 2K7PA 3RZCC 1ZOXA 5F9DC 4L4VE 1S5HB 2XA8L 5KVDL 1XCQA 4PRPD 2CKBA 5DK2A 5BZWA 1JWUA 1XGRA 5J13C 3GHBL 1MAKA 1B6DA 1DBAH 1YEGH 1VADA 2MOVA 1FYTD 3BPCA 3FT2A 3KWWB 3LAFA 4MQXC 5DD3L 5HDOA 3WYRA 1K85A 5HI5C 3ZE2F 4OLZL 4HF5L 4XC3L 1NLDH 4X6DA 1D9KD 4NP4L 3UTQA 1IT9L 3T4AA 3S97C 4GAJH 1C16B 4WI3A 3QDGB 4IRZH 3U7WL 2CK0H 3V6OE 5AAWA 3S37X 4Y8AA 3L3DB 3QRGH 5DK0A 1XGYL 5JHDA 3UJTH 1J05B 2IAMB 1RI8A 1CICB 2XTJD 5C07B 3OKMB 4P2RD 3OV6A 3L3HA 4HJGB 3U0PB 1A1NB 2AK4E 1V3MA 4PB9L 4TUKL 3VA6A 1S9YA 1UYWH 1FV1B 5KSAC 1JHLL 2HT2C 2X7LA 4X8JA 4NZUH 4FZEH 4G6JL 1U2CA 3WHXA 1LP9E 3BDXA 1DBMH 2I9TA 2EIZA 5E8EA 1A21A 4Q9RL 4B0MM 1G7JB 2BCKB 3B9KA 3RX8A 5BV7C 4MSWA 3GMNB 1OP3K 4AT6A 4NKDB 1MRDH 1GGCH 3MNVB 4PJ9A 1OAYH 4WEMB 43C9B 4G8IB 2ZUYA 5IQ7H 5T1LB 3IJHA 4NQUA 1NC4B 1NBQA 3T3PE 4TPRL 3TN0A 4NYLA 5DJAB 5KVGH 3SKOB 1FIGL 4PV9A 4Q9BA 3M8OH 1MHPH 4YFLI 3SBWA 4RWYH 4L3CB 4XAWH 4NNPH 2YD1A 3MODH 4OCNC 4JM4H 3UTTA 5JW4Q 4XBGB 3KPNB 2F74A 5C08D 4YNYA 4KMTH 4QHLA 4X9FA 4JFPB 5CKGA 3KVQA 4PJDE 3WNPA 3EOAA 1CGSH 1KPVB 1RY7B 3O2VH 5IJVB 5EU3B 4LLWA 4NNYA 4MA1C 1FVCA 4NRYA 3HAEH 3FHQA 1OAKH 4UTAH 1U8QB 4RMRA 1NL0H 4Z0XA 5SV4A 3ROOB 1V7ML 4WEBH 4JAMB 3HPLB 4HKBA 3KPQB 5E8PB 4GRLC 4AZ8A 2R9HD 1JN6A 1TVBA 4NKOB 3UTSA 5E5MB 1ORQB 3BHBB 2P5EE 4F7EA 2F54A 1U8IA 2RAMA 2F5AH 5TE7L 1EZVY 5ESVB 4QRRA 5HHOA 1FO0L 2AXHA 5C09E 3F8UB 5E5RB 1G84A 1T03L 5J9PA 1A9EA 2H9GA 2JCCF 2NXZD 4GMTH 1KEML 4X4ME 4PRAA 3VWKB 1BIHA 4MWFA 4OUUA 1EJ6A 3UZVB 3ZE2E 1ZWIB 4N90E 3IFLL 1JNLL 1RIVH 2VC2L 3E6FB 1T83A 1T7WA 2ZJSH 1CDJA 4M1GL 1FG2A 1A7NL 2ADJA 2G2RA 5CSGA 3S35X 5EOQL 4Y4FB 3SCMD 3RWDB 1ZMYA 3IETA 4GXVH 1T0NA 5EULV 4YWGL 3BVNA 3MRCB 2FEDC 3P9MA 5IW3A 3GIZH 5IM7B 3H3KA 1WAAA 4LLDB 2VDNH 2W0KA 1KIRA 2DTSA 4UU9B 5FHBH 5C0FA 3ARGB 5JA9A 2VUOA 2R23A 5BOPA 4XNMB 1YEIH 4XPTL 2IQAB 1LGVA 5F6HI 1T1WB 2FO4B 1F4AA 1WCQA 3VFPB 3MV9D 4N5ED 3BH8A 1RZJC 5L6YH 3S34L 3LKSA 4UDTB 3ULVH 4MJIE 3JV6B 2MCPL 3ZTNL 4L3EB 1W72A 2E6PA 2OBGA 4P9MH 4YK4B 4EUPB 1U8MB 1A5FL 1KXQE 4GRWH 5DR5H 1TFHA 1MCJA 2A6DB 4MJ5A 5GISL 1Q9LB 5FB8B 4U0RC 1I7ZB 5GRUL 3T0BA 3GSOA 3QAZB 4LGSB 4P5KB 1HKFA 4KV5F 1MCWW 2R0ZH 1Q0XL 2AI0H 2Y6SD 5MEPA 3KDMA 1CE6A 2BP3A 4PY7B 3GI8H 2FO1A 4W70A 3WXWH 3CMOH 1GGIH 1TLKA 2DJUA 2NTSP 4RFEA 3M1BA 3WSQL 1V05A 3K1DA 5D1ZB 3VXTA 3VWJA 5ENWB 3EO1A 4YUEL 4GG6B 3GMMB 3HUJE 3M07A 2YBRB 4WUUE 4ZFOA 4D3CH 1XR9B 5LGKA 3O8XC 2J6EH 4F37F 1DEDA 5GJTH 3W81A 2Z35A 1FAIL 3KYOA 1F45A 4GG8A 4NHUA 3IB4A 4GW5B 1AD0B 3FB6B 1ZHNA 1NAMH 3TLRA 5TF1H 4KK6D 4PJ8C 1K8IA 3RWIB 1FZOA 3QDJD 4E41E 4X9IA 2DQHH 2D9QB 3W9DB 3PWVA 5DF0A 4G3YH 5E5UB 3GB7A 1JUFA 4G5ZL 2EDTA 1SYVB 2ZUWA 2VLMD 4O58L 1DBBL 1MFEL 1G9MH 3FO9A 3D9AL 4L8BB 5JXAL 2ZOKB 5BO1H 1FL5A 1IM3A 3S7GA 4NFCA 2PXYA 4P59H 3WD5H 4O2FB 1U58B 1DBAL 1YEGL 5IOPB 3BP7A 2JCCE 4XVJH 1NLDL 2YEZB 1P53A 2DBLH 1C08B 3ARQA 5D1XD 4GAJL 3H9HA 3QZWA 4IRZL 1IAMA 3IGAB 2CK0L 1TQBB 2NLJA 4MNQB 2P48B 3QRGL 3VFTA 2BHZA 2K7QA 4J8RA 1OB1A 3UJTL 5C0DA 1U92A 3KPRE 3LN4B 2C1OB 4EXKA 1FNAA 1UYWL 4FRWA 3O3EB 1TNMA 5E6IA 3RX7A 3K7UA 3BPLB 2BNQA 2UZYB 4NZUL 1H0DB 2X40A 3TA3B 1QBLH 4ODXB 2CO6B 3BN9D 4N1CA 2AP2A 1X6LA 4DUWA 4RGMB 1DBML 5H37H 3NCYP 2X4SB 1AXTH 1T80A 2YUXA 1MRDL 2ADFH 1GGCL 4YIQA 1MI5A 1IGTB 4YO0A 1OAYL 1F4WH 3PL6C 5IQ7L 3GJFA 2EYTB 3U4BH 5FUCE 1N59A 2VLRE 1QR1A 5JZ7C 1U3HC 4A2LA 1AGEA 5JPMB 5BJTB 5KVGL 5T5NF 1R3LA 2YPLA 3HAEB 4QHUB 3M8OL 2F19H 2VAJA 1MHPL 4Z8FH 3BFOA 1AGDA 4ORGB 4RWYL 4XAWL 2AKRA 4NNPL 2LFGA 5CHNB 3MODL 4JM4L 4RSVA 1UZ6F 4DUXA 1D5BB 4KMTL 4OLVH 5GSVB 3KPSB 3AREB 2G9HB 2H3NA 1CGSL 3TCLB 3O2VL 1PKQE 5I8EA 3MC0A 2R1YB 1DQJA 3HRPA 5JPNB 3IVKA 1OAKL 1PSKH 1LDSA 4UTAL 1NL0L 5GS2D 1P84K 2DI7A 4WEBL 5C0BE 4QWWD 5CD3A 4J3WA 4R7DB 2V6HA 4OD3H 3L5WA 3VFOB 1BJ1H 3G6DH 2W59A 2YRLA 3OHXB 3RDTC 5EZJB 4YHYC 3BRFA 2NXYC 1YECH 4HWBH 4JFEA 3MXWH 2F5AL 2M8XA 3VGHA 2MPAH 4K8RH 1JHTB 5A1AA 2HT4C 4GMTL 1NGZA 1IBGH 4KKNA 4NQSB 2DJ4A 4I48A 4LSSH 3U2SB 2PETA 1AD9B 3U48A 5ISZE 4Y2DA 1RIVL 4ESKA 2ZJSL 4M62H 4KJWD 1KNOA 5AD0B 1UM5H 1R5VA 2WWKO 3QFDA 4LKCA 4JQXC 4Y16C 5HJ3B 4KWUA 4B50A 4PTTA 1X7QA 4GXVL 3ARXA 1EFXD 4JY6B 1G7IA 2VLKE 3MGTB 3BWUC 3GIZL 3BP5A 2VDNL 5TDOA 5FHBL 1QHOA 3AXLA 3RL2B 4HD9A 1RV6X 1YEIL 2NR6D 4PRHB 1CFNB 4PLKD 2DQFA 3VU2A 1IAKB 1HOCB 3MJ9A 4I2XA 3LN9A 1A4JB 5L6YL 1S9WA 5D7IA 1A3RH 2R69H 3ULVL 3ILQC 1O7VA 5DQ9B 1EEQA 5CWSA 1QG3A 4IRSB 2A38A 3PWLA 4P9ML 4ELMA 4ONHB 3DV6A 2Y72A 5DR5L 5TPWH 3HZYB 4EN3B 4LHUD 5MENE 3CK0H 3RTQA 3D2UB 3OPZH 3C6SB 3MCKA 4IMLA 3WHE0 1E4WH 1OSPH 4PJGB 4QY8B 5C92A 3S96B 1B3JA 4MAYD 4LVOB 2R0ZL 2AI0L 4F7CA 1QBMH 1NAMB 2LU7A 2X05A 3GI8L 4J3OC 3WXWL 3G6AB 5B39B 1QFOA 3CMOL 2DWDB 3HE6C 2WBJC 1GGIL 4ZPVB 4OZIA 1QA9A 1BWWA 1J8HA 1U8PB 3CIQA 3G5XB 4YAQB 4DN3H 2VKWA 1RZ7H 5CBAA 1UG9A 1UZ6E 4D3CL 3DUUB 4JM2F 2J6EL 1MIEH 5GJTL 2QQNH 3BXNA 1KUMA 4L4VA 2MFNA 4R90H 4IRJB 1NAML 5TF1L 4PJBA 1DL7H 4U3HA 3MRGA 1EVTC 1EAPA 2DQHL 4JGUA 3WV0A 1LEGA 2ATPA 3W0WA 3NACH 4G3YL 2WQ8A 4NUGH 2VWEC 2HLFC 1G9ML 5EORH 1T4KA 3VXRA 2DD8H 5BO1L 2D7OA 3FQNA 5F7DA 1OD7A 2BC4B 5GGUA 1BEYH 5GHWH 2EKSA 2K1MA 5INCB 4P59L 3VFVB 4LEOA 1R24B 4J1UA 4RZCB 4JFOA 3DBXB 4OZ4A 4MCZB 3LH2H 2F8XC 4NO0B 3BN3B 1OSZA 3K8LA 4XVJL 5GGTH 3TJEH 4PD4K 3VD4A 3FQXB 4YDJB 2DBLL 2D7NA 3P2TA 4LGPB 1QRNA 2FLRT 2KDGA 4MLIA 4JG1H 1AGCB 1YY9D 2RGSA 1WBYA 1XR8A 1FYHB 4WU5A 1HKLH 2GQHA 3QUXD 4M7LT 5F7YC 1NFIB 1UXSB 1S8DA 5F9OH 2BOCA 5KS9B 5TQ2H 3F7VA 1F00I 2HVKA 4PY8J 2QR0B 5F9WB 2BVPA 1QBLL 4HKZA 5ALCH 5C7XH 4WW2A 1CR9H 4OQTH 4XVUC 2NY1D 3BI9X 3RVXC 2ORBH 4HKXB 3S9DB 1AXTL 3C09C 4KKBC 2YXMA 1K5NA 2ADFL 1WFTA 3CH1A 5GRYA 2DLIA 4PJIF 1F4WL 1TETH 1HDMB 1WWAX 3R8BB 3U4BL 2X4QB 4P5TB 1WIPA 3EHBD 3Q6FB 1MFAH 2NY0B 3QI9A 2OK0H 2DQGH 5INDB 4MNGA 3QUYC 3VFNB 3R06B 1OWWA 4M8QB 1MNUH 4Z7WE 2F19L 4PV8A 4Z8FL 4GKZB 1T04A 4QXWA 4J7RA 2F8OA 4YR6A 4P2YA 3OR6B 1W0VB 4JFFD 4OLVL 1OAXH 1LNUA 2CKBH 3S5LG 4PRPA 2PTUA 5DFTA 3G9AB 1T7YA 5F7MC 1FYTA 2NX5B 2HN7A 2WIIA 3TBTA 3WMSA 4JHBA 3A6OA 4HS8H 3B3IB 1D9KA 4OD3L 3G6DL 2IH3B 1NEZB 3SDXA 4JZJB 1HSBA 2LV4A 4P23C 5GZOD 3QIBB 1KB9J 1YECL 4OV5B 4HWBL 1G7LB 1AHWC 1RJYB 2NMSA 3MXWL 3GMRB 5I6XB 3NZ8A 2MPAL 4K8RL 5I1LA 1EVUA 2YD3A 5MEQB 1EH9A 2E8ZA 3QO1A 4UQ3B 3ULUD 5IKCB 1T66D 1RZ8A 1IBGL 5DD6A 3BZFB 1B0RB 4I8DA 3JZ7A 4LSSL 4PJEA 3VWKC 4KHXH 1U3JA 3U7AA 4U1NA 1NFDB 4Q6IA 4M62L 5JDSA 1UM5L 1Z9SA 5H8DA 5K93A 3U30B 2BVUA 2VLJD 4PRDB 1ZLUK 5FO7A 4RMWA 3GNMH 1BFOB 3VXQA 1C12A 1QLEH 1BD2E 1UXWA 3QNXB 4Y4FC 3VRJA 2A73A 4EIZC 5DA4A 5D7JB 1I8LA 5ERWA 3WJJA 3V7AG 4C4KT 3KPOB 4FQXD 1PG7W 1MH5B 1G0YR 2R2BB 3FQTB 3VXUE 1S9KC 2Q6WB 3MREB 1CZ8H 1P4LB 3QRFM 1A3RL 2R69L 3ZE0F 4WFED 3EYSH 3X11A 4PJXF 1MRFH 3P4OB 4JREB 1AKJB 2A83A 5SWZD 4I5BB 1QO3B 4OCMC 1LVEA 1RK0B 4U33A 5C08A 4N9GB 3PGCA 4CUCA 1KFAH 4O5LH 4XPHH 3VG9B 5TPWL 4EI5D 4MQ7A 2YKLH 3CK0L 3SDDB 5D1QD 3OPZL 2P5WE 1E4WL 1OSPL 5CEYB 4PGEA 4QOKE 1T20A 3W2DH 4LSDA 4EVNA 3GSRA 5D7KD 1QBML 4LGRB 3FTGA 3KXFE 4OIIH 4Y4HC 2YA0A 5I18L 1KXVC 4X6BA 2ZUTA 3SDCB 4X98A 3FN0H 3DPBA 4DN3L 3MZGB 1F3RB 3Q1SH 5DK3A 1WZ1H 5J1TC 1RZ7L 4WO4B 3JTTA 4IHOB 1MIEL 5IBUB 2QQNL 3B6SB 4LPCA 5JMRA 4GRMB 2GHWB 4R90L 5FO9B 3DX8B 3K4ZA 4WI6A 2CD0A 5IG7A 4KRMB 3ZKMC 2VITA 5DS8B 4ZUTA 1DL7L 4EIGB 3D85A 3B2UC 3B9VA 4NWUH 3L6FB 4D9QE 5DJ6B 3P73B 2ERJC 4PUBH 5F89A 4NUJB 4RAUA 3U83A 3NACL 3O6KH 4NUGL 5GGSB 3UJJH 1U95B 5DWUH 3ROLB 3SCMA 1JPGB 5EORL 2DD8L 1FFNA 1JGDB 3KLDA 5T1MB 2VR5A 1E27A 1BEYL 4PR5B 1BQSA 1A6AA 5GHWL 4JKWA 4LCYA 4N0UA 4GW1A 1P7QB 2ENSA 3WE6A 2X4RA 1JYVA 4M7ZC 2ZSWA 4AMKH 3LH2L 5DZNA 2PYEE 3DJ9A 1RZIB 3MLRH 5GS1A 1F4HA 2HFGH 5GGTL 3IDIA 3TJEL 3MV9A 4XBPB 1NGPH 3MBEC 1DP0A 1RJCA 3EAKA 3QIWB 4JG1L 3HR6A 2H2SC 1BF8A 2F53E 1SHMA 4RAHA 1I3UA 1T1ZA 4OD2A 4U6HB 3P9LA 1HKLL 1TQBC 1G7MA 3EOBA 5F3BA 1BM3H 4PRIA 5F9OL 5KTEH 1FVEA 5TQ2L 4EQ2A 5J3HC 1JGUH 4GKOA 1MUJA 1CXLA 5DJ2B 3WN5B 3NIGF 5ALCL 5C7XL 1DLHB 3VW3H 1CR9L 3TA3C 3BQUC 2NY2D 4M1CD 4OQTL 5GXBB 3NIDF 1OGAE 1X5FA 2H6PB 2ORBL 3V5DB 1JTOA 5FECB 3BZEB 2GSIA 4F3FA 3PV6B 2X4PB 3ZE0E 1TQCC 4PJXE 1TETL 4LPYA 4QRPB 1FC2D 2N7AA 4LAQH 3V0WH 5DMGC 1S7VB 5DK2B 5ITBH 2AERT 4P4KD 4I9WD 1QZ1A 1JWUB 4XZUA 4L9LA 1XGRB 1YN6A 2P42B 3FT2B 4YQXH 1VADB 2OK0L 1MFAL 3BPCB 2XNAA 2DQGL 4KK9C 4H1LA 1X5HA 4X6DB 1FNHA 1MNUL 1FN4A 3UTQB 3T4AB 2ILLA 4G6AC 1BBDH 1VFBA 4OLUH 3JWNC 1CD1B 3SOBH 2XZZA 5C70A 2DKUA 1OAXL 5CJBA 2CKBL 4Z7VB 5I8CA 3NN8A 2JK5A 3HHRB 1GSMA 5F21B 2FIRT 4P3CH 3L3HB 3P3YA 1NC2D 1DJSA 5J89A 1S9YB 1T22A 1FGVH 4F9LC 1L7IH 4HS8L 4X8JB 2NCMA 4GSDH 4MA7H 3UX9B 3W9EA 2V2TA 3T65B 3UP1A 5D1XA 3WHXB 1JZ2A 2CRYA 2JJTA 2ZPKH 5JXED 5D2NA 2I9TB 2EIZB 5E8EB 1UZ8A 4PP2A 5C9JA 3B9KB 4MSWB 4AT6B 4WTXA 1GOHA 4X7SH 3MV7D 2BFVH 2CXKA 1UADC 3H9SE 3HE7B 1J9CT 4QO1A 1MVFA 3WIHA 4U1LA 3IJHB 3QNZA 4GW4A 2XXMB 1QSFE 4MX7A 4JJHA 5BXFA 1G9EA 3TN0B 1UQSA 4NYLB 4U31A 3HS0A 4KHXL 4LBEA 4PV9B 3IJYA 1Z9LA 5IVXF 4XNUH 4LCWE 4RGNC 2IH1A 4UINH 1YN7A 4WNQA 3GNML 1QLEL 1JK8A 3IF1A 3UTTB 1GCFA 1A2YB 3GJFH 1MCNA 4QHLB 3ULVC 2GK2A 2IEPA 3EOAB 4Y89A 3C2AH 1UKTA 2CLVA 4LLWB 1GAFH 3E1F1 4NCC1 1CFVH 2VAAA 3PDDA 4NNYB 1FVCB 1NJ9A 4NRYB 5CLTA 5DI8A 3RUGE 4CW1A 4Z0XB 3H0TA 4GO6B 3NIGE 1CZ8L 2JIXD 3GJEA 4HKBB 4LLYA 5B8CC 1JN6B 3UTSB 3EYSL 3NIDE 2Y5TA 1MRFL 3VA2C 1A6PA 1H3XA 2FH6A 5E94A 5F6IC 2JJSA 3MV11 4F7EB 1KFAL 2F54B 4O5LL 4XPHL 3OG6B 4XXDA 4QRRB 3GUTA 2YKLL 4YDLC 5HHOB 4OCXH 2BSRB 2KZWA 1I9RH 5J9PB 4OLWH 2FJFA 4L8SA 3W2DL 4PRAB 4CADA 5TFSH 5K9KA 3ECBA 1XF5A 2NY3B 4MWFB 1K8DA 2BERA 4OUUB 4OIIL 2DM4A 3L95A 1TDQA 4JB9H 3ABZA 3FN0L 1FG2B 5IJKC 4CAGA 2ADJB 2G2RB 3QPXH 3Q1SL 1B88A 1WZ1L 3IS0X 2HG5A 3SEPA 4XWOC 3IETB 3VDBA 1T0NB 3EO9H 3EYOA 1CL7I 3GMQA 3P9MB 5JLZB 5IW6A 3CU1A 2WLZA 1G9MC 3A0OA 4G6MH 2W60A 1KIRB 5C0FB 3CFJA 4XP5H 4YC2C 3ZHDA 2R23B 2M1KA 5B38A 1SVCP 4Y4KD 4NWUL 4PJCA 1SJHA 4NN5B 1QVOA 4PUBL 4EUPG 4DGIH 3O6KL 3BH8B 3UJJL 3M17A 1S7WA 1YPZA 3LKSB 5DWUL 1A3QA 1EFXA 4I4WB 1JRHH 1W72B 3QEQE 3AUVA 4CN6A 3EZ8A 5E9DE 3HI6H 5GS0H 1GZPA 1U93B 4MJ5B 2CJUH 4HH9A 3T4YA 4AMKL 3GSOB 3MLRL 2HFGL 2ESVD 3CVHH 4WFHE 5EUKA 4CN4A 4LP5A 1NGPL 1QEWA 3G6JF 5EU5A 5MEPB 3KDMB 1CE6B 2OQJA 5CEXA 4KQ4H 1INQA 5IVXE 4KDTA 3NCBB 4M7KH 4XX1G 4PJFF 2LVEA 3EOTH 4RFEB 3M1BB 3DV4A 1BM3L 3VXTB 3VWJB 2GJ6B 3EO1B 2IGFH 4LHUA 3NIFF 5KTEL 4ZFOB 1H5BC 1JGUL 5HD8C 4GAYA 2VO5A 2Z35B 3KYOB 4GG8B 5F9WC 4MAYA 1ZHNB 3D3VE 4O00A 3VW3L 3AS3A 1K8IB 3MRRA 1Z9MA 1FZOB 4RMTA 4ZO6A 5FGBA 2ZWLT 3PWVB 3MA9H 5EA0H 3NH7H 3GB7B 2IC2A 1JUFB 1AY1H 4P2QD 3FO9B 3PQYE 1QSVA 1LK2A 4LAQL 3V0WL 4UZGA 1FL5B 1IM3B 4S1RH 4OZGE 4WWID 4ZSOA 1FNGA 5ITBL 4OBSA 4PJHF 2PXYB 5D7LB 1UACH 1KB5A 3SDAC 1CE1H 5DJ0A 4YQXL 5ANME 1YUHA 3BP7B 1FZMA 1JF6A 2QHRH 4ZXBC 3UAJC 2RFXA 1KIPA 4U2ZA 5A43C 5IFAH 2Q7YA 4PB0H 2FGWH 4BQ9A 1BBDL 3H9HB 2CRZA 3QZWB 4OLUL 1T6WA 2NLJB 3ZYJA 3SOBL 3VFTB 4TQEH 2R0WH 3P0YH 1TTGA 4J8RB 1OB1B 5CP7A 2P8PA 5C0DB 5FDWA 3O41A 4S11A 1U92B 4WU7A 4APQC 4P3CL 1G6VK 4W68A 4HAGA 1FGVL 5E6IB 1L7IL 1HHKA 4MDIA 2BNQB 4MA7L 5GJSH 4Y5VA 5IROC 3OF6D 2A0LD 3LMJH 3C8DA 2ZPKL 2P1YA 5IVNA 2YHGA 4ELKA 1I9IH 5DHVA 5FYLD 1ZGLA 4YPGA 2HP4A 1T3FB 3SJVE 4X7SL 3QUXA 5ITFB 1MI5B 4YO0B 2BFVL 4WWKC 1S7SA 5I6XC 3RVTC 1T5XA 2WSKA 2DDQH 1N59B 2ATKA 3LOWA 1YNTA 1QR1B 3SKJH 1AGEB 5D2LA 4RMVA 3OJDB 4HXBH 4LMQI 1R3LB 2YPLB 2E7HA 1WISA 3HMXA 4XNUL 1JF1A 4RMQA 3G6JE 4POZC 3AROA 1HINH 1A22B 2QLVB 4UINL 1AGDB 1ZANH 2AKRB 2IG2H 4HULB 3LN5A 4U1KA 4PJFE 1P9MC 4LQ1A 4Y8DC 5IFJA 4QTHA 3CFEA 2H3NB 2HTLC 5D7JC 3VMPA 1J1OH 3C2AL 5I8EB 1GAFL 2J5LB 4RIRA 1A8JH 5LCVH 4WFFE 5DURD 3IVKB 1T2QH 4JKMA 1AGFA 1SM3H 5FCUH 4BFBD 5CD3B 4BSWA 4KI5C 1AO7E 3L5WB 2VL5A 2H32H 4R4NC 2Q86A 3WNMA 1KSRA 2CSPA 1NH6A 3D25A 1X5AA 4NQDE 3KLHD 4HUMB 4JFFA 3MGAA 4JFEB 5IMKA 2DM2A 4CVUA 2CUHA 5LBSH 3JVGC 1CGUA 4OCXL 1I9RL 4OLWL 2AV1B 1RUQH 1NGZB 4PJHE 3ZYOA 4TN9A 5TFSL 3RVWD 3V7AE 3IXAA 4I48B 3U1SH 1D7FA 1OQXA 3L3GA 3L5IA 4JB9L 4Y2DB 1WIOA 3KYNA 1TNNA 1OM3H 1KNOB 4LKCB 3QFDB 3QNYA 3SDCC 3GBLA 3QPXL 4WI7A 5CD5C 4MXWH 1MY5A 3CFBA 4PTTB 1X7QB 1KYOK 3EO9L 3V5HB 4WO4C 1G7IB 4BQBA 5FM5M 5AAMA 4RRPG 1A7OH 4WI5A 3BP5B 4G6ML 5TDOB 3T1WA 4G8GD 2VJXA 3AB0B 4XP5L 3AXLB 1MREH 1N5YH 2R0LH 1WWCA 5EO1A 4HIEA 5F7EH 4U05A 4HC1H 3RFZC 4H5SA 2DQFB 4GJTB 4I2XB 4DGIL 3L3KA 1LO2H 1FFPA 5D7IB 3DYOA 2VLJA 4Q9QH 4UB0H 1VESA 3VFRA 4HKJA 5CWSB 1F4XH 3UTOA 1JRHL 5FUOH 3PWLB 3IFOA 3HI1A 2VN4A 4ELMB 2OL3B 5DZLA 4V2CB 3DV6B 3HI6L 5GS0L 4MZ2A 4FQXA 3RTQB 2CJUL 3MCKB 5B39G 4IMLB 4DGYH 2QADB 3T0ED 3CVHL 2WM0A 4NSKA 4F7CB 4FQCH 4KQ4L 4XCYB 3ZYIA 4M7KL 1F90H 5SWZA 2EIEA 4OZIB 1QA9B 1FPTH 3EOTL 2W07A 1J8HB 2WP3T 3TZVA 5LJYH 4JCLA 3QHFH 1URLA 1S7XA 3CSGA 4EI5A 2IGFL 2HWZH 3FAXA 2AEWA 5D1QA 3BXNB 2XRAH 2HMID 4DQOH 1HN1A 4PJBB 4LLUA 1MCOH 3O3BA 5D72H 3IYLW 3FOLA 3MRGB 4JANA 2JJWA 4GBXC 3IKCA 1EAPB 1UCBH 4XCCH 3MA9L 1LEGB 2ATPB 5EA0L 3W0WB 3NH7L 1WBXA 1UCTA 4KXZH 5I75B 1DANU 1AY1L 3RWJB 1T4KB 4G7YH 3VXRB 3FQNB 5F7DB 4UV7H 3G9VA 5GGUB 4S1RL 2EKSB 4I0PC 1N6VA 3U9UB 1UACL 4LEOB 1KPRA 2VLKD 1I7TA 5T3XE 1CE1L 4J1UB 3NPSB 4Y0GA 4JFOB 4OZ4B 2BNUA 1IARB 4OGYH 1FLTX 1F6LL 3WFEH 2QHRL 1OSZB 4YFEA 5CCKH 5IFAL 3TH3T 3QFJE 4HJJH 3HFMH 4PB0L 4XNZC 1QRNB 2Z9TA 4PJ5B 3C5JA 3RNKA 2AGJH 1WBYB 1CU4H 1U3ZA 5MI0C 3C60D 4WU5B 2EDHA 4TQEL 2R0WL 3P0YL 1QLFA 4CMMA 4CNIA 4OBRA 4IS6A 1MAJA 5SV3A 1RHFA 1S8DB 2JKXA 2BOCB 5M95B 3MNZA 4X7FC 4L5FH 3F7VB 1DQLH 1HHJA 2WBWB 2BVPB 3LZFH 5GJSL 2ITCA 1IEBA 4WW2B 3LMJL 2VZ1A 3QDGE 2V17H 1QR4A 1JMZA 1X6NA 3LV3A 1I9IL 2AS5M 4HK3J 1UH3A 1K5NB 2UWEA 3CH1B 1AJ7H 5C07E 4JFYA 3C5ZD 5I0ZA 1EDQA 4PJ9C 2APXA 2DDQL 1R0AH 1IQDA 4NGHH 1K3ZA 2FWOA 5I17A 3DNKA 3SKJL 1RQ5A 3QI9B 4Y1AD 2FATH 3T77A 2L7JA 5I76A 1F58H 3TN0C 4MNGB 4F8TA 3IDMA 4CJ1A 1DSFH 1HINL 3UTPE 4PV8B 4KKAD 1T04B 2P4AB 1ZANL 3LQZB 2IG2L 4QYOA 4YR6B 3SBWC 4P2OC 3QDMD 5EBGA 2ZUUA 1S9VB 4PG2A 1RFDH 1SBBA 4PRPB 4ETQA 4P4KA 2XWBA 1J1OL 3GSUA 4X0KA 3T2NH 4LL9A 5LCVL 1IAIM 1FYTB 1KCLA 1QKZH 2WIIB 4H1LH 1SM3L 2BZDA 3TBTB 4HH8A 5B3JF 5FCUL 3OGOE 4URTB 5T3ZD 3ARFC 1D9KB 5F6HJ 5CIPA 5SWSD 4GG6F 3MJGX 3SDXB 1HSBB 3V4PH 5A40E 2APTA 2BVQA 3HZVA 4GAGH 3WS3A 4ONGH 4TRPH 1U8JA 4MB4A 2DS4A 1PKOA 3H7BA 5EUOB 1QFWI 3P30H 5LBSL 4P2RB 1KOAA 3NZ8B 3QXVA 2FNBA 2WWMC 2YUWA 4ZAKC 1NC2A 3QO1B 2C3WA 1RUQL 2GITA 1RZ8B 5DD6B 1ZVYA 4JFQA 5JW4M 4YBQD 3ZT6A 3U1SL 3CPLA 4PJEB 4JFHE 5GQBA 3L3IA 4U1NB 3WIIH 5JXEA 5E7BA 4Q6IB 4BKLA 2OJEA 2WNGA 5LKNA 1OM3L 2UZXB 4J3SA 2VNCA 5JDJA 1X5XA 4MXWL 1F8TH 3QXWA 5FO7B 3U0TA 3MV7A 1C12B 5D5MA 1UXWB 3DUHA 2AEIT 4JDZA 3WIHH 1RUMH 1A7OL 2A73B 3QEQA 2ARJA 5ERWB 4UUJB 3QUZD 4X6EA 1MREL 5D9SA 2X9WA 2R0LL 1N5YL 2KL6A 5F7EL 3L1OH 4HC1L 4AH2A 1E4XI 2BVEA 2ZG3A 1VA9A 2R2EA 4PRNA 4G8EA 5CEZD 5I2IA 4H0HB 2E7CA 1LO2L 3DX6B 1HHIA 2FHBA 5CMAA 2NW2A 5DQJA 4Q9QL 4UB0L 3X11B 3TIEA 1F4XL 2NZ9D 5FUOL 2ADIA 5C08B 3PGCB 1IGJB 1LMKA 1TCMA 3V52H 2VDMH 3SQOH 1I9EA 2H26B 1L6ZA 3P77A 4OFKA 4UNTA 4DGYL 2Q3ZA 2Y1VA 4HUWA 3EYQC 4FQLH 4PGEB 1QSZA 1T20B 2EDNA 1K6QH 1U36A 4JM2D 2D0HA 3FO2A 4WHYG 2JIXA 3GSRB 2ZUXA 2OYPA 3FTGB 3F58H 4FQCL 3DMMC 4OZHA 4X6BB 5F44A 4U3CA 5IBUG 3WDJA 4L3EE 1QFHA 5C6TH 5KSBF 1F90L 4X98B 4HPOH 1FPTL 4JY5H 1DANT 4WGVB 3QHFL 3F7PC 4L1HA 1JNNH 3B8SA 4N9OB 3VRIA 1LE5A 3MROA 3JTTB 2HWZL 3OL2A 1XIWC 2XRAL 3DXAD 5CJ5A 1P1ZA 2NXZB 4DQOL 3GDBA 1CGVA 3QEUA 5JQHC 1M71A 3UZEA 1TTFA 1MCOL 4M6NH 5D72L 5ANMA 4TNWK 1HYSD 1UCBL 4J6RH 5F89B 2EZ0D 2PN5A 4RAUB 4XCCL 1KF9B 2IBZX 4GG6E 1IC7H 5FV2A 3OX8A 3SCMB 1BBJA 4JO2H 1Z3GH 1EGJA 4G7YL 1FFNB 3KG5A 5FFLA 3MUGA 4UV7L 3GZKA 4XX1E 2V7HA 3Q5OA 1A6AB 4LCYB 5HHQA 4N0UB 3I6LE 3O6FD 4GW1B 1MHHA 1QFWM 1ZA3A 3WE6B 2X4RB 2PXYC 2ZSWB 4G8FB 4OGYL 3UTZA 4Y4KA 3WFEL 3MYJB 5GS1B 1A6ZB 3IDIB 5CCKL 3MV9B 4HJJL 3Q5TA 3HFML 3U36B 1AH1A 4XCEA 2LQRA 3F5WA 5E4IA 2F15A 1INEH 2AGJL 4XC1H 4Z7UA 1CU4L 1YYLH 4ETYA 1T1ZB 4OD2B 1G7MB 3EOBB 3QJFA 3TNMA 5F3BB 2EXWC 5K9OA 5MERA 5BS0D 1JTPA 1QSED 3GSNH 4OV6F 3DECA 4ZUSA 1FVEB 4L5FL 5L8KB 2FIKA 1DQLL 2WW8A 2ZUVA 4KH2A 1MUJB 2ESVA 3BAEH 3LZFL 4FXKA 3MRHA 5I66B 4XMLH 4JDTH 1Q9KA 2V17L 5C3TA 4S1DC 4MNQE 1JNJA 3CCHB 3ULVF 2SEBA 2GKIA 2UV3A 2GSIB 5GZNC 4F3FB 2FX9H 1AJ7L 4GRWF 1MIMH 3D69A 4LLMA 4ZYKA 5I30H 1G0DA 1R0AL 1C5DA 4NGHL 3S4SG 3GMLB 3CU7A 4GLRI 4XZUB 1NGQH 4L9LB 1J7VR 5K9QG 1YN6B 2QQLH 4N0CC 2Q8BH 2DM7A 2XNAB 2FATL 3WNLA 4F15B 3W82A 1F58L 4JRWA 1QBAA 3QDJB 4H1LB 2VRAA 1PW3A 3DOSA 1K2DA 1DSFL 1AO7A 1FN4B 1VFBB 2W38A 4D9QD 5KSBE 4NQED 1RHHA 4P2QA 4HWNA 3JUYA 4M5ZH 4F37K 1RFDL 3VD9A 1N6UA 3EFFA 3NN8B 4FFWD 2JK5B 2Y07H 4GS7C 4YHNA 5FKPB 4HDIA 3T2NL 1QKZL 3RGHA 2J5LC 3BKYH 1T22B 1CYGA 1L7TH 3W9EB 1J0HA 5D1XB 4BZ1H 1F11B 5F9AC 3V4PL 5D2NB 1Y18A 2PW2A 4GAGL 3REVA 4PP2B 3IDYC 5C9JB 3KPSE 4ONGL 4TRPL 1HWGB 1X5IA 3I6GB 4X7EC 3VFWA 1WBZA 3EJYC 2V2WA 3LKOA 3P30L 4MMXC 3DROB 1ZT1B 4U1LB 3WIFA 2FEEL 3BPOB 3QNZB 4L9DA 5JOFB 3V4UH 1GIGH 4MX7B 1JGLH 3OF6A 5BXFB 3HNVH 3GFUA 2J8UA 1OP5K 1UQSB 2DIAA 1HCVA 2X9XA 3WIIL 4LBEB 4DZBA 4U1SB 2C7UA 3VH8A 3IJYB 3RGVD 4KDVA 3D6GA 5HYFA 4PTUA 1F8TL 5IHZA 4WNQB 3IF1B 1HQ4A 4WI9A 3WIHL 1RUML 3TV3L 5HYJD 2AAVA 3GO1H 1Z0NA 3NCJH 1OHQA 4FXGA 3S37H 3CSPA 5EIIA 5DT1H 4J12A 5GS0C 2VAAB 1DUYA 1NJ9B 3L1OL 4CW1B 4S2SA 3H0TB 2P7TA 1R3KA 5A2KH 3GJEB 4LLYB 2Y5TB 5KS9F 4J4PD 4Y19D 5E94B 3QQ9D 5E03A 3V52L 5E8DH 2VDML 2Q76A 3SQOL 2MKWA 2PTTA 1BZ9A 4XXDB 4HS3A 2R29H 4LKXA 3GUTB 5DMYA 4R97B 5L7XH 4PRHE 4CRPA 2FJFB 4L8SB 2M2DA 4FQLL 3UO1H 2IPKA 4LLQB 4MQXD 1K6QL 3FQWA 3SKNA 5DFVD 2DMKA 4U2YA 5HI5D 3ARRA 4CADB 3ECBB 1XF5B 4DKFH 5K9KB 1K8DB 2B5IB 3F58L 5KANI 3AFLA 2VR9A 3ARWA 2ZUSA 4L3AA 1N5AA 3L95B 3WL9A 5C6TL 2VZ3A 4R9HA 9CGTA 3SY0A 4HPOL 4M93B 4ZS6C 4JY5L 3C2SA 3HMWH 3W11C 1JNNL 3CDFA 4M6ML 5FYKD 2HG5B 4A2MA 4OZFG 1QOKA 3EYOB 3GMQB 5IW6B 4V1DE 4PJGE 3AU1B 1UEMA 2W60B 3CFJB 5D6DA 1YMME 5KSAD 2HT2D 4JN2A 1P84J 5C0ND 2LE9A 5B38B 4M6NL 4J3VA 1MCBA 5J7CC 3UROR 4PJCB 1SJHB 2J2ZA 1QVOB 4J6RL 5JA8B 4A6YH 4TSCH 1I1AD 5EB9A 1IC7L 5IVOA 1S7WB 3M17B 1YPZB 4M4PA 4JO2L 5E2WH 1Z3GL 2I07A 1EFXB 2FR4A 4C83A 3ULUH 1CD9B 4X6CF 1S5HA 4Q0XH 3V6OC 3OKDB 5ICYA 1K4CA 4G8GA 1GZPB 5T33H 2BNRD 3SE9H 2F8VA 2D7QA 2HKHH 4OCRH 3T4YB 4XCNA 1XH3A 2VL4A 1AR1C 3KS0J 1I1FB 5C0IA 5EUKB 3S36X 1XAUA 5JQ6H 1QEWB 4U6XA 5D8JH 1Y6MR 1INEL 2GT9A 2OQJB 5IMMB 5CEXB 5FKAA 1OF2A 4XC1L 1INQB 1YYLL 1OTTC 43CAA 4LSRH 2GJZA 4PYHA 4TUOA 3DV4B 1UB6B 1NMAH 5E2TH 3GSNL 4WI2A 1RAMA 2RB8A 4LHUB 1FSKC 1SQ2N 3C8KA 3S35H 3VJ6B 3TWCH 3T0EA 3BAEL 3MRMA 4MAYB 4XMLL 4PJAF 2Z8SA 4JDTL 2R15A 1VDGA 3GBMH 5KG9A 4XPFH 1KULA 3MRRB 4IOIA 2IPTH 4OB5H 3D5OF 4LDOB 4GRLD 3ZSSA 1JCKA 3B5TA 3BP4A 1G7JA 4PP1D 3FFCB 2FX9L 2YPVH 5M94B 1ZLVK 43C9A 5KS9E 1MIML 1RSFA 1G1YA 3CX5K 5T1LA 1LK2B 3F6LA 2RR3A 5I30L 4JPVH 4KI5F 1S7TA 4NT6B 4ZSOB 1FNGB 3KPTA 1NGQL 1KB5B 1P4IH 2QQLL 2Q8BL 4E9LA 3QZWG 1YUHB 3UYOD 3L7EB 1SJEA 2ZNWA 1IAIH 1FZMB 3QI9C 3ESVF 5HHNB 5LWYH 4KRNA 2Q7YB 5IB5A 4NBYB 1UM6H 3KAAA 2OI9C 1JHKH 3OKOB 2IJ0C 4M5ZL 2FEDD 3MRIA 3RHWK 4MD5A 5DC9B 4DK6A 2P8PB 2W1NA 2Y07L 4HWUA 2MQ3A 4PY8I 5EU3A 3O41B 1FC1A 1MJJA 1H8SA 4WU7B 5EWIH 5C2UB 2E6JA 1KT2A 3BEVA 4CMHB 3W5MA 3DX9A 5B21A 3BKYL 1U8QA 1HHKB 5IB2A 1L7TL 3DLQR 4MDIB 4PGDA 4Y5VB 3EIFA 1D5ZA 5E8PA 3HNSH 1D9KC 4BZ1L 4UILH 3MRPA 5IW1A 3ZL4H 4LCCA 1XGTA 3O45A 5DHVB 1ZGLB 4YPGB 3QUXB 3OB0H 1S7SB 1MQKH 4EDWH 4X6CE 2XTJC 3NGBC 2NX5E 1T5XB 5E2JA 2Z31D 5IB1A 2ATKB 2AXGB 4DK3A 1YNTB 3V4UL 1GIGL 2D2OA 4N1EA 1JGLL 3HNVL 1MWAA 3AMKA 5D2LB 1LEKA 4PD4J 1IM9D 1ZWIA 1KJVA 3FN3A 2NY1B 5EOTA 5FOBA 3D3VD 1JP5A 2L0DA 2FJGA 4ZNEA 1Y6KR 1DQDH 5JOPE 1AIFA 3C5ZA 3LN5B 1BVKA 4M5YH 2PCPA 4U1KB 2X44D 5DHYA 5E95B 5FM8A 2IAND 5IM7A 2DM3A 4LOUC 3GO1L 5IFJB 3RX5A 1CLOH 3O8XD 3NCJL 1T7ZA 1H15B 3S37L 1KENH 4HFUH 5DT1L 3WJJC 2R8SH 2DF3A 3RI5F 3PXJA 4RIRB 3RKDD 1NFDE 4Y1AA 5L9DH 2DI8A 4PJ8D 1AGFB 5LGJA 1SEQH 4G6FD 1H3GA 4XB7A 3MBXH 1MOEA 1NCBH 1P2CA 3IXTA 2VL5B 4YLQT 4YXHH 2Q86B 4UDTA 4M4RA 3D25B 3QDMA 3TH4T 1NCUA 4JFFB 3FQRA 4EUPA 4FTVD 3LKPB 4YEEA 5E8DL 1OARH 5DYOA 1XMWA 2R29L 1SY6A 4Y5XA 5L7XL 2JLLA 3SQBA 4UOJA 4KI5E 4NZTH 4HWZA 4EI6A 3UO1L 2D31A 1I7UA 4DKFL 5CIPH 3IXAB 4XXCC 3VE0A 3L3GB 1ZAGA 2OM5A 2R9HC 3P11L 3KYNB 1B0WA 3MMEA 1WT5C 3PHOA 2MNUA 1UT9A 2YD8A 3HMWL 3QNYB 3IAQA 2XWTB 3CFBB 5J11B 4OAWA 3U6RA 1XR9A 3SJVD 1PZ5A 1JTTA 4DVRH 2KQNA 5FA4A 1XF2A 4ZNCD 4X6DF 1OVZA 5HI3C 1PVHA 2ED7A 4W81A 1QFWH 5EO1B 3RWIA 3QJHA 3EYFA 4HIEB 3QHZH 1NCCL 4H5SB 4AEHH 4A6YL 1X4XA 3L3KB 1VEOA 4JFDD 2YD5A 1Q8MA 1BHGA 1FFPB 1XFPA 1RK1A 2VLJB 5E2WL 3INUH 4TVPE 3VFRB 4HKJB 3ULUL 2X4UB 4Q0XL 3IFOB 3HI1B 1NBYA 3QUZA 2DQJH 4PRBA 5T33L 1BPVA 3IU3A 4FQXB 3SE9L 2HKHL 4OCRL 5JZ7D 3VXPA 1U3HD 1U3YA 4YBLB 3FT4A 4TSAH 2OXGA 3JUZA 1C08A 5JQ6L 4NSKB 5D8JL 2LTQC 3QYCA 4BA8A 3IGAA 5ALBH 5SWZB 4LSRL 1E4XH 1NMAL 1IC4H 2UYLA 5E2TL 1S7XB 4EI5B 4NCDA 3HE7D 1CI5A 4C59B 5D1QB 1ADQA 2WQRA 3S35L 3N1FC 4NJAH 3TWCL 1I4FA 1DVFB 4N0FB 5HVHB 2E7LA 4HZLA 4JM2A 5JNYA 3GBML 3WFBH 4LLUB 4XPFL 2IPTL 4KMQA 3O3BB 2Y6SC 4OB5L 3MLPA 4JANB 3IKCB 1N64H 3CC5A 4R96A 3SGDH 2OP4H 3RDTD 1WBXB 2NXYD 3FQUA 2YPVL 4W6YB 4MDJA 1RJZB 1MJUH 4GFTB 3KPLA 4QHNA 2W0FA 1NGYB 3DXAA 4JPVL 3MCLH 3WO4B 4HK3N 4UIKH 1KPRB 1P4IL 5FXCH 3KHOA 5C0AE 2BNUB 4JN1H 1IAIL 2EO1A 4QHUA 1KCVH 4TULH 5LWYL 4D2NA 5F7KC 3HC0A 3RWCA 1UM6L 2X1PA 1EGJH 1WCBA 3C5JB 3RNKB 4QRPE 3O0RH 1JHKL 2IFFH 3MLSH 5JMOC 4RDQF 3OMZA 4LHJB 5IVZA 4CMMB 3AREA 1SJXA 4CNIB 3MA7A 3JWDH 1IGMH 3O6FA 5EWIL 2RBLA 3MNZB 3T04D 3PHQA 1HHJB 1UJ3C 4DAGH 2EH7H 3OG4B 1YQVH 4X6DE 3TGXA 5C0CD 2ITCB 1IEBB 5ID1A 3HNSL 2HT3C 4UILL 3KLAA 2JJTC 3PJSB 5D2NC 2HLAA 4Z7VE 5JHDE 1ES0A 5BS0A 2UWEB 2V5YA 4Y7MA 1QSEA 3BX7C 4JFYB 3WNNA 1MQKL 4EDWL 1WGOA 3ZDZF 1GOGA 4MCYB 5F7LB 4Z7NE 2X89D 4PJIA 3D0VA 1IQDB 3FCTA 2FWOB 3D39D 3RU8H 3I3EA 1AD9A 4P48A 2ED8A 4YHIA 2YPKA 2NY2B 4YX2H 5I76B 1UWXH 5E08H 4NPYA 3EKCA 1MQ8A 4F2MA 3IDMB 3HE6D 4JGMA 1I3GH 2BX5A 5F72S 1DQDL 2C3HA 4QYOB 4M5YL 3HC3H 2Z4QA 3SE3A 4DEPB 4ZUWB 1CLOL 4NN7B 4ETQB 5IWLA 2OTPA 4UT9L 4P4KB 2XWBB 3P4NA 2Q3AA 3QP3A 1KENL 3GSUB 4HFUL 2R8SL 4HGKC 1CN4A 5L9DL 2EE9A 3KYAA 1SEQL 2Y9RT 5CBEB 3V6FA 3ZHLA 3MBXL 1NCBL 5FGSA 4YXHL 4UDUA 3TO4C 4NQEA 3UTTE 3HZVB 3WS3B 2HLFD 5HVFB 5ACZA 4P46C 4NC1E 3TH2T 4ZD3H 1U8JB 1OARL 4UTBH 3H7BB 1X3DA 4EN3A 2JJSC 4D94A 4ODVH 2XQYG 3VGGA 1NC2B 4NZTL 4CVXB 4R97C 2GITB 3S96A 1BQLH 4L8SC 4NKIH 4JFQB 5EDXA 1IQWH 3CPLB 1NANH 3MUZ1 1PG7X 3L3IB 3UTSE 3NA9H 1MCCA 3EGSB 3B9AA 2OJEB 1R5IB 3MV8D 2G5BA 2F54E 4WHTB 2CDEA 1S7UA 2KUTA 5GGQH 4QRRE 3U0TB 5HHOE 3MV7B 5D5MB 2GFBA 2ARJB 2R39A 4DVRL 4XHJD 4LSUH 4K3HA 4X6EB 1DDHA 4IRJA 5D9SB 3CLFH 1P5UA 4M6AA 1QFWL 4G7VH 4GUPA 2V2XB 2FDBP 3QHZL 3PE9A 5E0QA 4ISVA 4AH2B 4AEHL 4G6KH 3ILPA 3Q3GA 4XVUD 2X1XR 3RGVA 4PRNB 2R2EB 4R2GD 2IQ9H 3RVXD 5I2IB 2HRPH 4QHKI 5CMAB 4KKBD 4I0CC 3INUL 5DQJB 1BVZA 3TIEB 3WJLC 2BC4A 3RY4A 2ADIB 1WAAE 5HYJA 2BY3A 1KJ2H 3K80A 3IDJA 4X80H 5INCA 4CL7A 2DQJL 4I3RH 3JV5A 3STBA 4RZCA 3T1FA 1T0PB 3ZDZE 3P77B 3HZMB 3VXNA 4G9FD 4X99A 5IESH 2CR6A 4TSAL 2NR6C 3FO2B 3QUYD 4PLKC 2JIXB 4NRXA 5B22A 3LKQA 1AGCA 4OZHB 3LHPH 5ALBL 3GM0A 1KIQB 1U42A 2PO6D 4Y19A 4L4JA 3MACH 1E4XL 1IC4L 4H26A 3VRIB 2VB5A 4RFOH 1LE5B 4B41A 5DVLA 4BZYA 4NJAL 1RVFH 1P1ZB 4IIQA 3TVMB 3QEUB 4HCRA 2Z92A 4JLRA 4AY0A 4LSTH 4BM7A 3MRDB 1N64L 4P23D 5FGBC 2OP4L 1LP9B 1PX3A 3ZSTA 2FLBT 4QTIH 3OX8B 1BBJB 4KJYA 1MJUL 4HGWA 5SX5H 2BY2A 3MUGB 5EC1A 2V7HB 3MCLL 1A1OA 5CJXC 1QPPA 4DGVH 2X4QA 4P5TA 1MHHB 5T3XH 4UIKL 3DVGA 1ZA3B 4PREA 3H9YA 1U2HA 3FHAA 4JN1L 3UTZB 4Y4KB 4DKAA 4NOFA 2NY6D 3R06A 2A9MH 1KCVL 4M8QA 4GXUM 3DHJA 4TULL 5EIVA 1I1AA 1IILE 1RUKH 3F5WB 4U1HA 1EGJL 3EW3B 1BAFH 3O0RL 2J4WH 2UZIH 2X70A 5CJOL 2IFFL 3MLSL 5D93B 3RIFF 1EEUA 4KQ3H 3QJFB 4MD0B 3TNMB 5K9OB 5MERB 3JWDL 2C5DC 1IGML 5K9JH 4KUZH 3DSFH 2BNRA 4ZUSB 5L2KD 2EDYA 2FIKB 4LU5H 3D0LB 4NQXB 2PYFA 2EH7L 4DAGL 1I7RB 3B83A 1YQVL 2X09A 2ESVB 4FXKB 4XAKE 3B3IA 1OGTA 3MRHB 2OTWA 3DARA 2AJYH 4OF5A 2DQUH 2D0GA 5CAYB 2CRIA 3P0VH 1Q9KB 4QLRA 4RCAA 3FZUC 3QR2A 5JW3H 3BT2H 2SEBB 4M7JH 1NMCC 5E1AA 3C08H 3GSXB 3QUXC 4LLMB 3D69B 5HDBF 3D1MC 4ZYKB 2Z91A 1C5DB 2BNQE 1B0RA 2VSCA 5J12C 3RU8L 1UWXK 4XMKH 3WKNA 4ZS7H 4I77H 2LABA 4KC3B 2OMBA 2N7BA 4LVNB 4NIKB 5E08L 4YDKH 1JV5A 2XXCB 4JKPH 1JPFA 5IBLC 3ZLQC 4FNLH 4K71B 1MI5E 2XA3A 3BUTA 1I3GL 5GGRA 3O9WC 4XRCA 5JTWA 2IFGA 1RHHB 3W5NA 3BRGC 4P2QB 1KJMA 1UKSA 3HC3L 4FQJH 1HXYA 1EHLH 1ZLWH 3EFFB 4FFZH 4OLYH 4F33B 1XF4A 4YHNB 4JG0H 2FB4H 2YPLE 5HHXL 2BXYA 3PP4H 4OZIF 4LLAA 4MA3A 2FGZA 4WY7H 4WJ5A 1Y18B 3HPJA 2PW2B 3REVB 3RRQA 4Z9KB 1MJ7H 4ZD3L 2E6QA 3VFWB 4UTBL 1WBZB 3LKOB 4JVUA 3P0GB 4ODVL 4PJBF 3X12A 3GSQA 2O5ZH 4IEFB 3WIFB 5EO0A 4FS0A 1BQLL 3TNNA 2BK8A 4NKIL 3PP3H 2X9YA 1IQWL 2J8UB 3V5KB 1RZKH 3MBED 3NA9L 5KVEH 2C7UB 2ED9A 3VH8B 2H2SD 4HBQA 4JFEE 4PTUB 2FL5A 2HRLA 1MY7A 2ICWJ 2VXVH 5IHZB 4OF8A 2D0FA 1EO8H 4IHOA 4PBWD 1HQ4B 3QG6A 3RIAF 3BZ4A 1OP9A 2J88H 5D4QA 5F8RC 4OTXH 5EZOH 2Z31A 1DQQA 4PS4H 3RWHA 4AYFA 8FABB 5J3HD 1JVKA 3ULUC 2V9TA 4LSUL 4DN4H 1T66C 1MWAH 3TYFA 5EIIB 3CLFL 1HK6A 4G7VL 4XVSH 4G43B 1IM9A 1DUYB 5DJ6A 3BQUD 4S2SB 4G6KL 1AXSA 2P7TB 1D5XB 1R3KB 2IQ9L 1NPUA 1A1MA 2HRPL 1OW0A 1A9BA 1WK0A 1JPGA 3SKUD 3VXSD 2F5BH 2EDEA 3O2DH 1JGDA 4ODBD 3RVVD 2IANA 4QXTA 1KJ2L 3E3QE 3O8XA 2Q76B 1GHFH 1R3HB 4X80L 1JZ8A 1BZ9B 5DMGD 4HS3B 4I3RL 4LPUA 3T8XA 1KGCE 1A7PH 2DQEH 5HDBE 3T3PF 4WW2F 3X17A 1UJTA 5DURB 2MMXA 4PJ8A 4D0CA 4RBPH 2IPKB 4WFGE 4UAOB 3FQWB 4I2XE 3SKNB 4CN1A 2AJUH 4XBPA 4KK9D 1BFVH 4NCC2 5D7IE 3OAZH 2JCCB 3QIWA 3MSPA 3LHPL 1N5AB 5DJ8A 3BISA 3WL9B 4G6AD 1CXIA 2VE6A 4C56D 3MACL 5DUMH 1YEDA 4EUPH 4ELME 4FTVA 3UCRA 4L8DA 1H3UA 2YMXH 2RIKA 4RFOL 1A6TA 3TZVC 5DLMH 3QXUA 1HILA 4EI5C 3JXAA 1RVFL 3I02A 4TSBH 5DJ2A 2VQ1A 3ZDYF 2J8OA 1AC6A 5FYJD 4LSTL 1SBSH 4RFNB 5FAAA 5I1DA 3FB5A 4CJ0A 1U41A 3K46A 2YK1H 3DYPA 5ADPH 4OZIE 3VXMD 1J8HE 5SX5K 4QTIL 1HSAB 4X8XA 2NTFA 3SKMA 4QRPA 2I07B 2FR4B 4C83B 3O4OC 1GJIA 4KY1H 5F1IA 1S7VA 4DGVL 3M45A 5ICYB 1K4CB 4G8GB 4PJ7A 4YGVA 5K9QI 5T3XL 4X7TA 1MEXH 4PJBE 4HK0A 1I3VA 4XCNB 1XH3B 4EKXA 5A2JH 2J7LA 1DN2A 2ICES 2VLRB 2A9ML 5C0IB 4K3EH 3W0WE 3S4SA 2XY2A 3R1GH 4JFDA 4U6XB 1RUKL 2LAGB 2GT9B 4LHUG 1BAFL 4RGND 5FKAB 5F8QC 3VXRE 2J4WL 2UZIL 1OF2B 3GSWB 4DW2H 1CD1A 43CAB 3QCTH 4KQ3L 3P4MA 1I8KB 1WFNA 2GJZB 4Z7VA 4JRYD 1KYOJ 1ZVSA 4TUOB 1EEYA 3IFPB 3TJHD 2HFTA 5K9JL 3WFCH 3ULVD 4KUZL 3DSFL 3QUKA 1YQ2A 3BGFB 3C8KB 4LU5L 5I73B 2FYYA 3ZE1F 4D9RE 5I74B 2AABH 3T0EB 5FM5O 5ICZA 5I9QB 4LCUB 3MRMB 3T65A 2OCFD 1OOAA 2AJYL 2DQUL 1QRNE 2WIMA 2XN9D 7FABH 5KG9B 3P0VL 4IOIB 5JW3L 3BP4B 4M7JL 1HEZA 4FFYH 3AM8C 3NABH 4PFEA 5IHBA 3EYVA 3C08L 1ADQH 3HE7A 4GXUN 2CMRH 2CLRA 1S7TB 3HR5A 5FA3B 4I18C 3O3AA 2EICA 3A6CH 4XMKL 4V1DD 4ZS7L 4I77L 3LD8C 1P7KB 1YC8A 3N50A 3I50H 1SJEB 3RWEA 2V9RA 4M1CC 4YDKL 4B7IA 4JKPL 3RDTA 4FNLL 4OSUH 4YHLH 5DFWH 5IB5B 3PWJB 3UEZA 3HUJF 3MUHL 1ZLWK 4BZ2H 5CZVH 1A2YA 3BPNC 4FQJL 5MHSD 2GTWA 1NCNA 1EHLL 3MRIB 4FFZL 2ZCLH 4MD5B 4OLYL 2P47B 4JG0L 1MJJB 2VLKB 4HEME 2GCYB 5C2BH 1KT2B 3BEVB 2FB4L 3DX9B 3OKKA 2GUOA 3RVUD 4MNGE 5GS3A 5DQDH 3ZDYE 5IB2B 4PGDB 1ACYL 3PP4L 2FCBA 1X5KA 1D5ZB 4JHWH 4WY7L 4TNWF 12E8H 1X5LA 5C8JA 3MLTA 1UM4H 3MRPB 4BQ8A 4JQXA 5IW1B 4N0YH 4LCCB 1XGTB 3O45B 3C60B 1JZ6A 1MJ7L 4LQFH 5I71B 4PRPE 2XOTA 1G7PA 4P57A 1PYWA 2BSRA 1JJUA 4MJ4A 5J4MA 1FYTE 2O5ZL 3STLA 3QIUB 4NZDA 4JRXD 5CINH 1CT8A 5FEBA 2H1PH 5IB1B 1YEKH 1C8PA 5C0CA 2HKFH 4ZUUA 5BCAA 1A14H 1MWAB 1RZKL 3RWFA 3LS5H 4Z77A 1LEKB 2EEDA 3NAAH 3SDXE 4KKLC 1KJVB 5KVEL 4PG9B 5EOTB 5FOBB 1OCWH 5JXEC 2FJGB 4LSVH 3JV0A 1CFQA 1VGEH 4H25A