3DVGB

Crystal structure of k63-specific fab apu.3a8 bound to k63-linked di-ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEWVAYITPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Human IgG1 fab fragment light chain
publication title Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvgB01
3AUVA 3D3VD 4L4JA 1HDMA 2HH0L 1OSZA 4JQXC 4F3FB 2VB5A 4HFWB 3NA9H 1TVHA 1U8OB 1JGEB 1L7TH 4WFGE 2I5YH 1IQWH 3MNVA 1BZ7A 5FUOH 4APQD 2XWTA 3LV3B 1U42A 2B1HL 8FABB 1WUNT 3ARSA 5F93C 4P4RA 1QNZL 3T2QA 3IF1A 3EO9L 2D7OA 2ZUSA 2C26A 1PQZB 1RK1B 4LFHD 3NCBB 4X9HA 4PGEA 4JDTL 1LO3H 4D9RD 2VAAA 1WK0A 4GLRH 3MRMB 3F62A 3AS2A 3PNWA 2PO6D 1N2RB 3HRZB 4AENB 3HG1A 5JORB 1KGCD 2A73A 2O5ZL 3TBSB 4TNVK 3WFHA 2R56H 4L4TD 2FH6A 1KCSH 4LK4A 5B39B 5INDB 5E56A 3HE6B 4YC2C 5E00B 3OKOA 5E70A 2NYYD 5T1KA 4KKCC 2F74A 1RIHL 1TZIA 1BECA 4BH7A 5HVFB 1YEIL 1QR1B 1A7NH 2CIIB 3CK0L 4FXGA 1AD0B 4ZXBD 3U82B 3O81A 1MVFA 3KWWA 3D39D 1S7RA 5D5MA 1K4CA 2AJVH 4HUXA 3QUYA 5MHSD 2MCG1 5JDSB 1OSPH 5CJXA 2EXWD 4YGVA 2YPKA 4AIOA 1ZTXL 4KHTL 3RWHA 4HQQH 3CUPB 5J1AB 4ODXB 5SWQA 2X4OA 2R2CA 1S9YB 4RIRA 2VR9A 5BJTB 2XKSA 3CIQA 3BW9A 1A6UH 3KPSE 3W5NA 4YDIL 3ZTNL 2X89A 4HWZA 4IIQC 3VXME 1GGTA 2K9UA 4YWGH 5L2KB 3QJHA 4XTRD 1PG7X 4GRWH 3LKOA 4NT6B 3SCMD 5F89A 2NY1D 5I71B 3UPAA 5C3LD 3NZHH 4KY1H 5ACZB 4ODWB 2QR0B 4L8BA 1JK8B 3D3VE 1S78D 4WIQA 4DZBA 1X6LA 2IPKB 3RZCB 3WMSA 3P4LA 5ADPH 5I1EL 5DMKA 5FO8B 3BT2H 3VFWA 5MP6L 1H8NA 4ZAKB 1GGBL 4P3CH 1MFBH 4RX4D 4KKAD 3GSWA 3EDKA 3N50A 4MQTB 1T80A 1H5BC 1YN6B 4AM0B 4HJJL 3VXUA 4PJ7B 3WO4C 4D9RE 3G6DL 4NRYA 5HPOA 1FAIH 1OAQL 2VDMH 2WP3T 3WV0A 4EQ2A 1DUYB 3DYMA 1E6JL 4IRSD 1KGCE 3MUZ1 2C1OB 3H0TB 1NCAL 4I0PD 3BISA 4L4TE 4N8PA 3L3GA 2OBGA 3QQ3A 1UQSA 4M93C 3IAQA 1P7HL 5J89A 5DT1H 3ARDA 1T5WA 3FOLB 4CADA 3FOMA 4OCYL 1DEDA 4ZUSA 2VISA 1WBYB 4JJHA 2DS4A 5D96C 3R1GH 3U7YH 3D39E 1N7ML 1DQDL 4HK0A 1WWWX 5MHSE 2DQFA 1N5AB 2Y4SA 4UDUB 2FJGB 3DSFL 5TPWL 1JZ8A 5C08B 3TEUA 3INUL 3QXAA 1OLZA 1WISA 1YY8B 3MNWA 1UM5L 4HIJA 2IH1B 3DXAB 3EO9H 4M9PA 3SE4C 5ERWB 4Q97A 2BSSB 3EOYG 4GG6F 1MQKH 4OT1L 4NKOA 3GMLA 4MA3A 4JDTH 5CP3A 3JZ7A 2ICWI 4PJCE 1FDLL 2O5ZH 3DO7B 3OMZA 1BD2B 4ZS7L 2B8OT 5ICZA 1T20B 4XNQB 4OZ4B 4FNLL 2ZNXA 1IM9A 2WUCL 1KIUA 1R3JA 3GSQB 5HYSG 3BRFA 2ZUQC 5IP4A 1ZVSB 5FM5M 1JIBA 1RIHH 1PSKH 2F54B 5J3HD 4I1NB 1NBVL 5DD3L 3E8UL 1OQOA 5EU4B 3DX9B 3CK0H 3C5ZB 1ZVHA 1EGJL 4PJ8B 3CDFA 3D3VA 1EAPA 1J86A 3CLFL 1BHGA 3VFUA 1LMKA 3LPFA 4DKDC 1HNGA 3BIKB 4NQXB 5JUEL 3V6OC 4PJEF 3RRQA 3DGGA 3MV8B 5BXFB 1ZTXH 3TBYB 1RFDL 4DVRL 2NY7L 5I66B 4HBQA 4APQA 1MCRA 3QG7L 2YD1A 1A9BA 1JE6A 2VE6A 1CE1L 1G7LB 5AWNL 1D9KC 4LVOC 1B0RA 2VDPL 5IEKB 2O5YL 4F8TA 4ISVA 1QO3B 4G7YL 4N5EC 1KJ2H 3CXDH 4XMKL 4OQTA 5FGCE 4LP4A 4JM2C 2PO6A 4LSTL 5DK0B 3RGVC 2BVQA 4WTZA 4IHOB 2A9NH 3STZB 1JGLL 3TVMA 1U8MB 4CU6A 4X80L 3KPRA 4JFFB 4AJ0A 1YUHB 5C0ND 1PVHA 2VXTL 1H5BA 2AV7A 5I1EH 2AJXL 2OMNA 2VRAA 5MP6H 1OD7A 5ENWB 4R7DB 2P7TA 4OV5B 1DEEA 3M1BB 3PWLB 2AJSH 3L95B 3BGFC 4DK3A 2FNBA 2VIRA 1ZHBA 2GQHA 3K8MA 2Z8WC 1QRNB 4HJJH 4EEEA 1ZHLA 4WW1B 4GRLC 4G9DA 4GFTB 3QAZB 2UWEE 3D39A 5IHZB 1OAQH 3SE9L 2DL2A 3UPRA 2H2SD 2WK2A 3IETB 4QTHB 3ZL4L 3WXVL 5L9DL 3WDIA 3KHQA 3QEHA 4HIEB 4PJDA 5FEBA 1NCAH 3WS3A 3OSKA 1D5XB 2X7LA 1HILB 1HIML 3T2NL 3VFVB 2VLJB 1YPZB 1R3HB 3JVGC 2G75A 1ZT7B 5EC2A 1OD9A 4M1DL 4R90L 4PB0L 1X5XA 4EI5D 1KELL 1I1YA 5C0AD 4OCYH 5ADOL 5FA4A 2RQ8A 3QA3B 3F58L 3MROB 3SCMA 2LU3A 5AUMA 3C6LD 5HJ3A 5JXED 4O2FA 2BNUA 5FDWB 5IJVA 5EULV 1N7MH 3BWUC 4Z18A 1X5JA 1IQDA 1DQDH 2AQ1A 2XTLA 2YBRB 4X6BB 2A74B 2Q76A 5J12B 3H9SA 3SE4A 2ZOLB 5GISL 5INCB 1TVBA 3DSFH 5TPWH 3PHQB 3MLZL 1VADB 1S7XB 1K5NA 3INUH 1ZXQA 2P5WD 2Z91B 3GJFB 4WW2F 2VH5L 3GUTB 5CJQL 3PWVA 4TSAL 5BVJB 4N8VA 35C8L 1SJHB 2J7LA 2ADIA 3MRNB 4HV8A 3QUKA 4J6RL 3T4YB 3JV5A 2MNUA 4HZLA 1Z0MA 3NCFB 3GEWB 4UU9A 4HJGA 3LKQA 2BXYA 1QKZH 1PJ9A 3QDGD 3K8LA 1S5HB 1ITBB 3E6FA 4QHMA 4ZS7H 5BW7C 1WBZB 2EYSA 3AREC 2AABL 4LASL 2AAVA 1QR4A 2P42B 3B6SB 5J9PA 4FNLH 1AGDB 2J8HA 4B7IA 3NCYS 3VW3L 4JRYD 3TPUA 3QIUD 4KWUA 1KXVC 5LBSL 4WI9A 3MUJA 3NIGF 4Z7QE 3O4OB 2IAMC 3L7EA 3H3BC 3HS0A 5HYSB 1NBVH 5DD3H 3E8UH 3MJGX 3BMVA 4OKDA 3PWJB 4S1DC 2R0LL 2IH3B 4OI9A 2MCPL 2YD4A 3X13A 3MRIB 3MRLB 3E2HC 3U9UA 4I0CC 5D6CB 1G7IB 3IKCB 2HVJB 4FQJL 3TH2T 4J2XA 3VRJA 3CJJA 3GSVA 5DUML 1GSMA 1WWBX 2YZ1A 3CDGB 3QG7H 4MAYD 2LTQC 5D1ZB 2ICEA 1TPXC 1CE1H 2MHAA 5AWNH 5C0AE 2VDPH 5EO0A 2O5YH 3LIZH 4LU5L 5TE6L 4OZHB 5I18L 2UWEA 2G5BA 1P7QA 4G7YH 4WEBH 1ULVA 4NQTA 4QHUB 3I2CL 4XMKH 5EZOL 2XZAL 1EX0A 1TJHL 3V6ZB 1U8NB 3TO2A 3GI9H 4FXLA 1QD0A 1GOHA 1VFBB 4HWBL 2DTSA 1GC1H 1T3FB 2NY6D 2RJMA 4EUPG 3HCVB 4XBEL 4JY4A 2YRPA 3T08A 4JFPA 3RUGE 5B22A 5AD0B 2VXTH 4JFQB 4YHIA 3DUUB 2MQ3A 2AJXH 2XT1B 3DX6A 4GRLA 3S88L 4GXUN 4RMRA 3L5IA 2P5WE 5JIKA 4P2RB 5F9JB 4B53A 3O3BB 3OXSA 2ESVD 2ORBL 3H7LA 3TFKC 3TT3L 1Q9KB 3MMEB 3OG4B 3S8WA 1Y0LA 4Y4KA 3B9VA 3VMNA 1U58B 2HMIC 2EIBA 3SE9H 4HXAL 3FZUD 3ZL4H 1LP9A 3WHE0 3QDGE 1EEYA 3GMPA 1T7ZA 2ADGB 5ICXA 5E8PA 3UTSD 5CGMA 3PABA 1TIUA 3U79A 4P9HL 1F8TL 5B38G 2R15A 3QI9B 4I77H 4R90H 4M1DH 2E7LC 3QH3B 3EYUL 4YBQD 3UMTA 1I7RB 3QRGL 2GJZA 4NQCE 4PB0H 3PWUA 4JRYE 3QPXL 4JY6A 1OAZL 3TT1L 5IW6B 2FIRT 3RWGB 4P5TA 4TSCL 3V5DB 3FB5A 4NNXA 3RGHA 3F58H 2BOBB 4NP4L 4WUUD 1JFQL 4OGAD 5DMGC 25C8L 5CEXB 4LVNB 2AXFA 4J3WA 3HR6A 1ZT4A 5GGTA 4PJIE 4XAWL 5GS2D 1XGPB 3ETBF 1VFAB 4HWUA 4QHLB 4DVBB 1UWGL 4X9FA 4MXVF 4RMUA 3U4EB 1BFVL 4OD2B 3MLZH 5CD5C 2MKWA 3VXSD 3EKCA 5KG9A 2JKXA 4FZEL 4L8CA 1EO5A 2JJVA 3SGEI 2VH5H 5CJQH 3I02A 1CLOL 35C8H 4UBDC 4MVBD 4YDJB 3MV9B 4LCCB 4J6RH 4RMSA 2WWKT 4F2MA 3LKRA 4PPTA 2PTTB 2YD8A 2ZSVB 4AG4H 1A7BA 2FD6L 1GGUA 4CVXB 3EJZC 4C59B 4TNVF 1E28A 2ZUWA 5FCSH 1F3JA 3P73A 5ESQB 2AABH 4LASH 4B5EA 2HFGH 4MNQD 1J8HD 4OCSL 1MVUA 3TBVA 4F9PC 3VW3H 2CDEB 3V9FA 3ULVF 5LBSH 4XZUA 1CDGA 1H15B 1A7OL 2ESVE 4I3SL 2M8XA 4X8JA 3C6LA 5I75B 5JXEA 1NBYA 4NO2A 3NBNA 5EZJA 2R0LH 3CFKA 3BZFB 2CLVB 2MCPH 2YS4A 1U3YA 4Z7WA 2VC2L 3GKZA 1MJ7L 5GSRB 4FN0A 1JN6B 4X98A 5SWZB 5LCVL 3K4DA 1AXTH 2JCCF 4YPGA 4QRSA 3UTSE 4FQJH 3MRCB 4PBVC 5DUMH 5HGBA 3MRJB 1MNUL 3BPLC 5GJSL 1UB5B 1AHWC 2HRPL 1BFOB 3ROOB 1NUNB 3MJ9A 1P6AB 1IGYB 2OLDA 4ZPTB 1I3UA 1K2DA 3WLBB 1DQJA 3P11L 5I18H 5IHBA 3J8F7 4OI7A 5D1QC 3I2CH 4WUUE 2BVPB 4NZJA 5EZOH 2XZAH 1FFPA 3P4MA 3FQTB 1RZIB 1TJHH 3V5HB 3OXRA 3FFCE 4KKNA 2KL6A 1NC2A 4BQ8A 2IBBA 1ZLUH 4XGZA 2X4NA 4XBEH 4KK6D 3LH2L 2XN9B 1YEDB 3L3OB 4NQCA 3WIFA 1UADC 4JRYA 4EUPB 3VXSE 5FF6A 3S88H 3EFDL 2HTLD 3SDDD 5I15L 4MX7B 1CXIA 2I07B 3FT3B 4PLNC 2ORBH 2CJUH 2H2PD 3QHZL 1YECL 3L5WB 4G8FB 3MRKA 1NANI 3U1SL 3T0EC 4HXAH 3T0DA 3NH7L 3UYPA 4NQDD 4MA8L 4PV9B 3REWB 3HPLB 2DTML 3QUZA 4J3SA 4U1MA 2AJUL 2EDNA 5DUPL 3UTTA 5BZWA 3EJJX 3NZ8A 4P9HH 2ATPB 3BEVA 4PY8J 3JV4B 4MNQE 1J8HE 3TJHC 4OAWB 2HTKD 2JIXD 1R3LB 3QRGH 4KAQL 1MREL 5E4EB 5K9OA 3QPXH 1BOGA 5ECJE 5B38B 1OAZH 3TT1H 1BBJB 3A6OA 5IMMB 3VD3A 5FYJD 3HI1B 4TSCH 1OTSC 1NH6A 1QQDB 5E1AB 1XGUB 3P9MB 2NY3B 2HG5B 2X2YA 4NP4H 1TVDA 5DHVH 25C8H 3WNLA 4Y19B 5HHVL 1GC1C 3VWJD 1WVZA 2DBJA 3NCYP 1UWGH 5KN5B 2N4IA 4P0DA 4P49A 3HUJE 3BRDA 4ALAH 1BFVH 4LRNH 4HEPG 3CXHK 3GRWA 4W4NA 4FZEH 4BM7A 3VWKD 3SY0A 3TNMA 1BJ1H 1FHGA 2ESVA 4FQPA 4Q7DA 1CLOH 1T0NB 3CFEB 1U91B 1P2CB 1VGEH 2N56A 1T7XA 5I0ZA 4HMDA 1MJUH 4MB5A 5C07E 1CDHA 1A1OB 2B1AL 2FD6H 4F9PA 1UA6H 3MRHB 1EHAA 3NCEB 2CRYA 1HH9B 3WJJC 1WIUA 5ID1B 3MCG1 3KYKL 3LPGA 5ITBL 1KCUH 3ARWA 1ZGLP 2VOTA 3EW3B 4DAGL 3PG2A 3VRLF 4OCSH 2NXZB 5SX4I 3MFFA 5C0FB 3P40A 5DRNA 5BRZB 2YUVA 3TBWB 1B9ZA 2CDFA 1A7OH 4FQHB 3C09C 3TA3D 3IXTB 2BNRD 3U36A 4G8GD 5DMYA 4S1RL 4GBXD 3RVXD 2QKIA 5F7DB 3FFCA 2VZSA 1P9MA 2W0FA 5SV4A 1BP3B 5ID0A 4NQDE 4HKZA 5ANMA 3CX5J 3PV6A 4TTGA 3M8OH 4X4MA 3TBTB 5LCVH 1TQBB 5IBLC 3O9WC 1EVUA 1U6AL 3P9LB 4JN2B 4MSWA 4QRRB 2Q6WB 3RWJB 3W11D 2DLHA 3CH1B 3VXSA 4M43L 3T3ME 4XPFH 3CC5B 1MNUH 5GJSH 4JKPH 2HRPH 1F6LL 2C3GA 3BP6A 1YNLL 5JO5A 2HN7A 1XFPA 4KQ4L 5FYJE 4O02L 1S9VB 1CICC 1MUJB 4I2XB 2W60A 1AO7B 4KUZH 3GJEB 4L3CA 3LEXA 5CSBA 3QQ4A 4OF0A 3ZE0F 1A4JB 1FNAA 3TM6A 5KAQG 4R3SB 5IMOB 1A22B 4JZNA 5GRUH 4POYA 3B9DA 5FM5O 3A6CL 5I74B 4N0FA 3HZVA 1HXMB 1J8HA 3LH2H 4GLRI 3SKMA 1ACZA 2AEPL 5DA4A 4PS4L 2ZUVA 3MBED 4H8WH 2XXCB 3BQUB 3P3YA 2IF7A 4ELMF 5MEND 3OTTA 4DN3L 1VERA 2DBLH 5I15H 3C2AL 1EHLL 4KC3B 1XCTA 3SKOB 4GUPB 4F7PB 1OLLA 4LHUG 1FBIL 4JDVA 3ZKNC 3CVHH 3G6JF 4R8WL 3WO3B 3QHZH 1YECH 4P4KB 5J11B 4X6DF 2A6KA 3GJFK 1DE4B 3U1SH 2MOVA 3MLRL 1OGAB 3GNMH 1CDBA 3NH7H 3Q6FB 5DJ6A 3IS1X 3OKKA 4MA8H 4X4XA 3D69B 1NAKL 2Q8BL 4GG6A 3HUJA 1ZLWK 2AJUH 5C2BL 5DUPH 4OBRA 3SDYH 4FXKB 3RP1A 4NQVA 3HLAB 1G1CA 4WW2C 3RKDC 4Q2ZB 2EDFA 1DBKH 3NACL 5DWUL 4P2OD 1MREH 2C5DC 4RISL 3VDCA 1U9KA 1UWXK 4NN5C 2IC2A 2NZ9C 5C07A 3SDAD 2BNRE 1NUDA 3U83A 4XWOD 2UUDH 4G8GE 1S9XB 3BE1L 1U8QB 3U7WL 3KPPA 5EC1B 3SKJL 3U6RA 3CH8A 3T3PE 3T77A 4HIHA 1I9RL 4RAVA 3C87A 5HHVH 5LGJA 4L3EB 4QRPD 4KMQA 2W9EL 3FN0L 3EYVB 1KCLA 4N0CC 5BCAA 4LF3A 2O5XL 3QQ9D 2VLKB 3SDDA 1NGZB 3KDMA 4X7EC 1MHHA 3NAAL 2D7MA 5CJ8A 4OZGF 3GKWL 5DEGA 5DJ2A 4Y4HB 5DDHA 1HSAB 1K8IB 3P30H 3ZDXE 3ARBC 4NQDA 3T65B 1SY6L 4OFDA 2BY0A 3MV11 2FCBA 3KPQA 4HUWB 3BZ4A 4YDVB 4XNYL 1KIRA 4YNYA 3KYKH 4PJAE 5ITBH 5EZLB 3QBTB 5DFVD 1B90A 1JPFA 4DAGH 4F57L 4MHHI 4QXWA 1XIWA 1CTOA 3P4NA 2Y06L 3DX8B 1F5WA 1X5ZA 3E0GA 1HQ4B 4LCWB 3CVIL 3CSYB 4HUVA 3IU3A 2FX7H 5A3IC 2YA0A 4GW1A 3FFDA 4S1RH 4M48L 3TZVC 4PJ5B 3RTQD 4JFOA 4IDLA 4JREC 2XOTA 1QBLH 3M17B 3VCLB 1Q1JL 1U6AH 4OZIB 2D3VA 4KKLD 4GKSA 3H2WA 4RGND 4XC1L 1T66C 5JLZB 3F7YB 4XXDB 5CEZL 3MRDB 2A38A 3MJ7A 4MNGB 4O02H 3DRTB 4XHJC 2FJHA 3HR5B 5LVEA 2GJ6A 4LGSB 1NDMA 4Z7OE 2CK2A 2XYCA 3WHXB 3RWIB 2CIKB 4U1JA 3T1FA 2EKSA 5JNYA 1QG3A 1FN4B 5KSAD 1C5CH 1KIQA 4WO4A 4B50A 4Y5VB 3CXHJ 2AEPH 3HTLX 2EC8A 4U6TA 3HPJB 4PS4H 2IBZY 2E27L 4XBGA 4KK9C 3K4AA 4DN3H 1EFXA 1XGQB 3VXPA 4X83A 5BZDB 1R0AL 4OF8A 1EHLH 3TA3A 3LOWA 2Q8AH 2BNRA 4XX1G 2IGFL 4R8WH 3D0LA 4LPYA 1BX2A 2NY2C 4XP9L 3VJ6B 4PJGE 3WFDL 3MLRH 1IAOA 1T03L 3HN3A 4WW2A 3D18A 2J6EA 4XCCL 1NAKH 2Q8BH 5FV1L 3LQAH 4P2QE 4WHTA 3I6GB 4AIZA 5TJWK 1N6QL 4QNPE 3FQWB 1ORQA 3LSOB 4NC1E 4LLYB 2Z4QB 3UAJC 4DFIA 1RHFA 5DWUH 3NACH 4LQFH 4F9LC 5J13B 3KPOA 4RISH 1JGUL 4LSUL 3ZZ1A 4DEPC 4JFYA 4JKLA 4A6YA 5HDQL 2QHLA 2VN7A 4FQLL 4JO3L 5HPMB 4LCUB 4X99B 4IBLT 1U92B 1C5DA 3BE1H 4Q74A 3U7WH 4J4PC 4KKCD 5IB3B 3KXFD 2DOCA 3CFIC 3PDOB 1FCGA 1XR9B 1NCBL 3JTSB 1I9RH 1U3HD 1J0JA 4NHUA 5DSCB 1U8HA 4GW4A 4OTXL 1JNHA 4GKZA 4Y5YA 3OR6B 2W9EH 3FN0H 4WFHD 5HHPB 2O5XH 5GRZA 4TVPD 4H8WC 2OX5A 1MFNA 1NGYB 1Z9SA 2B5IC 5E6IB 4RGNE 3R0NA 3NAAH 1RU9H 3DRQB 2CO7B 5TQ0H 2ICCA 4UDTB 1BQHA 1CGVA 2WUBL 3GKWH 2L4OA 3L3KB 4UTAL 5IB5B 3CSPA 1SY6H 1VFOA 4U3HA 5K9QG 1MI5A 5C9JB 5EFIB 3BO8B 4Y16B 3AY4C 5T1LD 3EJYD 4ONHB 4XNYH 4EOWL 3UBXG 1WZKA 3O3EB 5L8LB 3DV6A 4WCYL 5I9QC 2OJEB 5FGRA 4PRPA 4AT6B 3IJYA 3S98A 2O93L 5TDOA 1DCLA 3O8XC 4YHNA 1LEKA 3TZVA 4R96A 4U33A 2FRGP 3SDAA 5B8CA 3CVIH 3AM8C 3G04B 1CCZA 2Q7YA 3AVEA 3RVVD 2QTEA 1M7IA 4Z95L 4JN1L 2W65A 5HVGB 3MODL 4AEIL 4P3DB 4ODSH 4XPTH 4PJ7F 4J1UA 3U0TB 1IEBA 1Q1JH 1TCMA 4B7LA 4CJ1A 3GK8L 1A3QA 5F7KC 1KLGA 4OLYL 2ADJA 5TQ2L 3WD5H 3UZVB 4RA0C 1C08A 3BPNB 5CEZH 2DIBA 1M6OB 2HAZA 4I48A 3WUWG 1XGRB 2QSVA 1DBML 4PJGA 3JUZA 3T8XB 3CFBA 3O11A 1G9EA 1MF2H 4P2QA 4N0UB 1KENL 1BAFL 5EO1A 1HCVA 2X42A 1NGWB 2X4RA 2XWBB 1BJ8A 4WFHE 3UTPD 3P4OA 4I0KA 1T7VA 4TVPE 5IB2B 1WZLA 2E27H 5T1MB 1IGMH 4IJ3B 3NFNA 4LFHG 3BN9D 2UY7A 5C0JB 1OP3H 5CEYA 3O41A 4K3DH 4P23B 4XP9H 3PHOB 3FB6B 3KLDA 1KG0A 3WFDH 1T1YA 4FQQB 1T03H 3QFDB 3IDUA 4HIIB 3D2UA 4XCCH 1JF1B 1PEZA 4HLJA 1G6RA 2G5RA 2K7PA 1KTDA 4OF7A 4WV1A 3UTZB 4I3RL 2AGJL 3LKNA 4DFHA 3MJ8A 2R4SH 4G43A 5T33L 4X6FA 5GRJL 3SO5A 3SBWC 5D1XD 5CWSA 3UDWA 1JGUH 4LSUH 3MRPB 1SQ2N 4FQLH 3BKMH 1B6UA 4F7MB 4BH8B 1F4YH 4YHLH 3Q5TA 3D1MC 4PUBL 1YC7A 1EJ6A 1S9KC 4F7CB 2ARWA 5D9SA 3PP3H 2OYPA 3DX7B 4RMVA 1KTLA 4O2EA 2Z93B 3EYFA 1NCBH 4MXWL 4X5WA 2J8OA 1EXUB 3LB6D 3S4SG 3REVB 5F1OB 4OTXH 4LDOB 4FTVD 3QFJD 4PGDA 1I1FA 5F1KC 4PGZA 1NFIA 1GHFL 2M1KA 3MRRA 3OJMB 5CP7B 1GVIA 4ZFGL 3S7GA 3PWPB 4WI8A 1EJOH 3C2SA 4LLDB 2EIEA 4FFWC 5DLMH 7FABL 4ZD3L 1VCAA 2WUBH 4IRJC 3EDDA 2YZ8A 1NBQA 3C08L 3FAXA 1I1AA 3OAZK 1SJVA 3U0PB 4L8SB 3SDCC 4UTAH 3RDTB 1KPUB 4H1LA 4NCDA 1D9KD 4RQQB 4MXQD 4HH8A 3TC9A 2A6JB 3BDYL 1RZGB 3ARGB 3LQAC 4M7JL 1MHCA 3G5XA 5HGHA 4JM2D 5IVZA 1LK3L 5C0DA 3RGVD 3EGSA 2X41A 4P9ML 4HAGA 3UBXB 3UTPE 4U3CA 1INQA 1UVQA 4NQSB 4TN9A 4QRTB 4NQUA 3D48R 3TN0B 1OF2A 1YMHA 2VO5A 4JRXD 5BV7C 4NN6C 2JELL 4Z95H 4JN1H 4ZUTB 4WWKC 3MGAA 3RWDA 4ZYKB 3ZKMD 4BKLB 4WVRA 3MODH 5C0RL 3WN5C 5E9DB 1XAUA 2FSEB 4Y4FC 3GK8H 1QFPA 5I76B 2N1KA 1BF8A 5IK3A 4P57A 3F12A 1RJLB 4ZOCA 2OQJB 2DKMA 2EDRA 4PRIA 4M5ZL 3L7FB 1DBMH 1FZJB 5FKAA 3VXMB 2WINA 3IVKB 2HT3C 1GL4B 3TGXA 3WUWB 1ZT1A 1C12B 4LAQL 5D71H 1KIPA 2NMSA 4V1DA 5C0IB 3HE7C 3HAEA 1RJZB 1QVOA 4RFOL 1V3MA 4FTVE 3O2DA 3QFJE 4PREA 2BY1A 1LO5B 5TF0A 2UVFA 1I85C 2E6JA 4U7KA 3U30C 4LSVL 5C9KA 2ARJA 1NMCB 1CFSB 3QIWC 3V6OE 3MA7A 1A3LL 1JWMB 2AK1L 2GSGA 1G7JA 3BH8A 1I8KA 1X4YA 4ZQKB 3VXTB 3AFLA 3HZMA 2FATH 1NPUA 1TETL 3S5LG 1EUTA 3OL2A 3SGKC 5JHDB 2YC1A 3DBXB 4R97C 2QADB 4L9DA 1VB9A 1J0IA 3SBWA 2C3VB 4N1CA 4UQ3A 5TE7L 4K94L 5L0QC 4L4TB 3VRIA 3VFPB 2AGJH 5IEHA 4P2YA 5T33H 1JUFB 2P45B 5GRJH 1EEQA 1RI8A 3TV3L 3OKMB 5F88B 3VFMB 1M05B 4JZOA 2YR3A 4JRXE 1FNEB 1XGTB 3L3DB 4G6KH 4ZXBB 1A3RL 1R24B 2IAMD 1U8IA 3D85B 3IJHA 1YEGH 4MXWH 3IDGB 5DQ9A 1AFVL 1YEHL 4E42A 3EDJA 4BSWB 4DGVL 1U95B 3IDJB 4S1DD 1J87A 1JZ6A 3S4SB 4NUJA 1R5WA 4KTDL 2X4TA 3UTQA 2X4PA 1GHFH 4ZTPL 2EEBA 3CCHB 3DVNB 3NFPA 5DUBA 4ZFGH 2HFFA 1I7TB 2DI8A 7FABH 4ZD3H 3Q0HA 5JQ6L 5DURB 3C08H 1YYML 5I17A 4TQEL 5DC4B 3QWQB 3CNKA 2DDQL 5GGRA 2NY1B 1ZSDB 4OZHF 3JWNC 3C60C 4PJCB 4O58L 4M7JH 4YUEL 4CW1A 1A02N 4MD4A 5LGHL 4EQ3A 4GRWE 1S9WB 1INDH 1LK3H 1QFWH 1CLYL 4OZFA 3MXWL 4P9MH 4FS0A 2EE6A 2ZCHL 4PJHB 5D1XA 3WL9A 2VL5A 1WAAE 3QNZB 2CMRL 5A16A 4JHWH 3HFML 3WLWC 4HLZG 1A6TA 2Y25A 3LD8B 1T7YA 4Z7NF 2AEWA 3FQXA 3VD5A 5GGUB 3HZKA 3DECA 5A1AA 3OQ3B 3TFKD 4ZO8A 4N1HB 1QLFA 4PY7B 4FTVA 4E41D 2F19H 3QFJA 4IRSB 5GPRA 5KJRH 2HMID 2P47B 4X6DA 4D9QD 5IHUL 4I0PB 4OCWL 4PTUA 1J8KA 4QKXB 2DQHL 1T22B 1EDQA 4NZDA 2VLRE 4L4VD 4Y5XB 4JZJC 5CJ5A 4NWUH 5GS0L 3LDBB 1H3TA 2DB8A 3O6LH 5L2KD 5F7UA 1ACYL 2OSLA 4PLJC 4M5ZH 4KDTA 5JR1L 1ZHNB 4Q6IB 4U2ZA 1Z3GL 5ACMA 4IMKC 3QUMA 5ITFA 5FGCB 3GSXB 2B39A 1HHHB 3O45A 1I85A 4LAQH 3QJFB 2F58L 2OI9B 3RZCD 1UC6A 1KTRL 3AXLA 5TH2B 3QIWA 3EOBB 3QHFL 4KRNA 5DMGD 1I1CA 2VLLA 4I4WB 2GI7A 5J1SC 1JYXA 1QSFA 4M6MH 1I8MB 2NQCA 3WFEL 5AAMA 1RZFL 4Z5RB 5J7CC 3S96B 3C8KB 3C5JA 2W0PA 4RZCB 1AP2B 2ITDA 4PGBA 3PP3K 3IFOA 4Z76B 3QXTA 3UYOD 4NIKB 4G42A 3RPIB 1MCOH 5EUOE 1J1PL 3HMXA 1TETH 1U8PB 4QYOB 4OZGA 4TSBH 4LCYB 3ISWA 5FUZL 5DJXB 5IROC 3MFGB 1JJUA 5TE7H 2ICES 4K94H 5BOPA 1IGJB 4OF5A 5GGSB 2C9AA 5IBUG 1FL3A 4YZFF 1P5UA 4JFZL 3RI5F 1KJVA 4JVWA 5F72S 4YK4B 3EJZD 4OGYL 1IGIL 2ERJB 2V2WA 1ERNA 1KCVL 4LNVA 5DK2A 2HWZL 3IB4A 4U1LB 3LEYH 5D8JL 1CFNB 2W9DL 5KSUB 1UXSB 3PGCA 4ETQB 5C86A 1SM3L 1AE6L 1FZKB 1P5VA 2R2HA 1XF1A 3BYYA 1J18A 1KACB 1NJ9B 2AKRA 1AFVH 1YEHH 2KKQA 3HC4L 3ULSA 4E41E 4HC1L 4XBPB 2Y6SC 3RIAF 4HG4K 5F1IB 4XCFL 3TNNA 4FQIL 3VH8B 1RULH 2H26A 1TJIL 5E8NB 1WAAA 4GKNB 4KTDH 3DXAD 1CIDA 3DROA 1DVFB 1X5YA 5SX5H 4YHKH 3SJVD 2BNQD 5GS1A 1LEGA 5TFSH 1CBVL 2A0LC 5IR1B 5L2KE 3QXWA 3DV4A 5JQ6H 2OCFD 1YYMH 2WWMC 4LLVA 1U8KB 4S10A 3WJLA 2DDQH 1TZGL 2ED7A 4PRAB 1KEGH 2AXJA 4OFYD 1MFEL 1BD2D 1JP5A 3MZGB 1WT5C 1AGBA 3VI3F 4YUEH 4G8IA 3EZ8A 3MTRA 5D1QD 3FTGA 5LGHH 3AU1A 2VLRA 5B4MC 1CLYH 3IDXL 3GHEL 5JA9A 3MXWH 4LEXL 3L3HA 1LD9B 2ZCHH 5F6IC 5DVOA 5I1AB 1CZ8L 3S3PA 1CXHA 4LPCA 3ARFA 4J3OC 5FECA 2FR4B 5JW5A 4GAFB 1GZPA 4J8RB 4PJ8D 3SGJC 3WNOA 2GCYB 1WEJL 4MCYB 4F3FA 3RWEB 4HFWA 3IFLL 3ILPB 1U8OA 5DRZB 5CBEB 1P4LB 3MV8D 1JGEA 4JZJA 4M5YL 2F53D 5F6HJ 4F7EA 2LAAA 4Y8DC 4F8QA 2R23A 1AC0A 3LV3A 8FABA 5LKNA 1S3KL 3FT4B 2Y07H 3T0VA 4OCWH 1WJ3A 2C7UB 1QYGH 2DQHH 5IQ9B 5DI8B 4G9FB 1RK1A 4DOHE 5GS0H 1QBML 1XH3B 5DZLA 1EHXA 4EI5B 2JB6B 3KJ4B 1ACYH 3MRMA 5C0AB 2GK0B 2CKBL 4C83B 5JR1H 3VU2A 1N2RA 4FQXC 3HRZA 5ALBH 1Z3GH 3EBAA 3TJHD 4AENA 2VQ1B 5B3JF 5JORA 3TBSA 1TLKA 3QWRA 1MY5A 1ZV5A 5B39A 5INDA 3HE6A 2RAMA 3CFJB 5FGBA 1FC2D 3GBML 1R3IL 5E00A 2JTDA 5C08E 3OBAA 1MCIA 3GBLA 2B0SH 3QHFH 1IC5L 1X5GA 2CLZB 2CKBB 3DYOA 2XZQH 5C7XL 1K3IA 2ZP0T 1DL7H 4Q9CA 3RUGB 4PR5A 1PLGL 3DXAE 2YKLL 2CIIA 1QR1A 3WFEH 3SJVE 1YA5A 5I8EB 1AD0A 1KV3A 1RZFH 1N4XH 3WEXA 5F96L 2F5AL 3GSRA 2I60L 5JDSA 3LN5A 1D7FA 2EIZB 4PJFB 1L9NA 1FJ1B 1J1PH 4OQ1A 1JF5A 3CUPA 3IFPB 4ODXA 5J1AA 1BD2E 2P8PB 1H9VA 5I1IH 2WBJC 2YD7A 5GRXG 3QDGB 5FUZH 1S9YA 5BJTA 4OLXL 4M7LH 4BZ2L 5EU5B 5IFJB 1QACA 4MNHB 2PCPA 3EHBC 1V5JA 4JFZH 2FBJL 1IGIH 3MUY1 5FAAA 5IBUB 3IDIB 1NAMH 2X9YA 3IJSB 3QIUB 3MXVL 4NT6A 2UYLB 1A14L 2VLMD 2FDBP 1KCVH 1T1WB 5ACZA 4ODWA 2QR0A 4PBWD 2VSCA 4HKBB 1UXWB 1JK8A 1H3UA 2W9DH 2VR5A 2F8VA 2NY0C 5IWLA 1SM3H 1BVZA 2VDNL 4UNVA 4EVNB 2IPKA 3RZCA 1G1YA 5DD6B 5F3BB 3MV8E 1RIUL 1Q94B 5E5MA 5FO8A 3HC4H 2GSIB 4ZAKA 2F53E 1YJDL 4X7FC 3U48A 4XCFH 2X70B 4FQIH 1TJIH 2UVEA 1LDPL 1P1ZB 1HK6A 4RFEB 1WBXB 4AM0A 1YN6A 5EG6C 3K1KC 2W91A 3HNVL 2PYED 4MAYB 4PJ7A 3K0WA 1CBVH 3O9WD 3RY6A 4D3CL 5ETUB 2ZWLT 4I13B 3FMGL 3UZEA 1CE6B 1DUYA 1GIGH 2EE3A 4ODBD 4GXVL 2C1OA 1JPTL 3H0TA 2YPVL 3BDXA 1TZGH 3QAZC 3DI3B 6FABL 1X5IA 4QTIL 2HKFL 1CICD 4W6YB 5F1SA 1OT1A 3FOLA 4P46C 4P99A 2E7HA 2Z92B 4XP1L 4U1GC 1FIGL 3GHEH 4LEXH 2BY3A 3SE3C 5HHQB 4M7LT 1RUKH 5EB9A 1WBYA 1JYNA 1QRNE 1CZ8H 3RVTC 3B9KC 3WDHA 4RFNB 1DJSA 1T83C 2YD6A 1LWRA 4KV5E 3B9AA 1WEJH 4NFDA 3TO4B 1N5AA 1FFNB 3IFLH 4UDUA 2FJGA 4BUGA 2HJFB 3U2SB 4XCEB 5C08A 4WI7A 4G6AC 3HZYB 4GAYB 4JCMA 4M5YH 1YPZE 1YY8A 1RUQL 1S3KH 5I8KL 1B6DA 2P46B 4BUHA 4GQ9L 2IH1A 3DXAA 3UTSB 2I27N 5ERWA 2BSSA 4HULB 1QBMH 4LSPL 2FHFA 2GAZB 2J3SA 3EOAB 4TNWK 2VLME 4NDMB 2CKBH 3RKDD 3I75A 3G6AB 1QFHA 1EK3A 4ENEC 3ARZA 1HSBA 2BOCB 4WUUB 1BD2A 2I24N 4FG6D 1T20A 5IUSA 1PFCA 4OZ4A 5D2NC 1JNNL 1O7VA 3GBMH 1R3IH 2NZ9D 4QGYA 3GSQA 1IC5H 3WS6C 4UQ2B 5C7XH 3QIBB 1ZVSA 2F54A 1Q0YL 4XP4L 2WNGA 1KULA 5I73B 5EU4A 1FZMB 3DX9A 4MS8D 2PYEE 3C5ZA 2UV3A 4OFKA 3W39B 1FSKC 4S1QL 3BWAB 4PJ8A 1YNKL 4XAKD 3ARYA 4CKVX 5F96H 2F5AH 2NPLX 2AQ3A 2I60H 1JV5B 3BIKA 4NQXA 1CXEA 5BXFA 4LLWB 3TBYA 5I66A 1AGEB 3QUXC 4MJ6B 2NW3B 1EGJA 2DI7A 4OLXH 3QQNA 4WFFD 5D70L 4BZ2H 3NIFE 1J1XL 1G7LA 3Q1SL 4KTEL 1IC1A 5IEKA 1T0MB 2Y72A 4MNQB 2V5MA 3BAEL 1QO3A 1YQ2A 5FO9B 5GS0C 1ORSB 2FBJH 5FYKL 3MXVH 1A14H 4G8EB 3L9RB 2HLFC 4IHOA 4UNUA 3STZA 5EPMA 2GHWB 3GMMB 5IF0B 1U8MA 1WICA 3QB7C 1BGXL 4JFFA 2VDNH 1DFBL 3GMOB 5F7FA 9CGTA 1YUHA 2OP4L 4X7DC 1RIUH 4XT1C 3GSNL 1OTUC 1GGCL 2WQ8A 5A3ID 3KPLB 2XWJB 5MEOB 5ENWA 4R7DA 1PX3A 2J12B 2DLTA 1PX4A 1YJDH 4OV5A 3ZTJH 3M1BA 3UYRL 2M26A 3L95A 2O61A 1LDPH 3K8KA 5F7HA 3IFNH 1QRNA 2J8UF 1YEKH 1SVZA 5F7WC 3MV9D 3HNVH 4WW1A 3B8SA 2BHUA 5IHZA 3IKKA 1Z0NA 4M1GL 5FYKU 1LO2L 4LNRB 4D3CH 1EV2E 2D31B 3IETA 3WNMA 4QTHA 1JZ7A 5HHMB 1YQVH 2VDLH 3FMGH 5T3ZL 3FO0L 4HIEA 4G80B 5EBLB 1SYSB 2VZUA 2YPVH 1OHQA 2ZNWA 3RVUD 1J0HA 1HILA 5K9KB 4PRDB 2VLJA 6FABH 1R3HA 5FFLA 3PHSA 1H3PH 1ZT7A 4QTIH 2HKFH 3V7MA 3VMOA 2R9HC 1A7RL 5JOPD 3SGDH 4Z7NE 2LVCA 2AEIT 4XP1H 2ZPKL 1WFNA 4NNPL 3MOAL 3QA3A 3MROA 2FZ3B 3BIAX 2Z31C 5KAQF 4LIQL 3ABZA 1S7VB 1BQHG 4KRPC 5FDWA 3QWOB 4XAKE 1J05B 4BZYA 3PQYD 4KK9D 2YBRA 4X6BA 2A74A 4DN4L 1IGTB 2ZOLA 5INCA 3BKYL 3CAFA 3PHQA 1G0YR 2ICWB 5IB4B 4NHCH 1L4IA 1S7XA 3T09A 2CDGB 2Z91A 3GJFA 5I8KH 3GUTA 1CR9L 3GGWB 4GQ9H 2ITCB 3QDMB 4M8QB 1JHKL 5BVJA 2Y23A 5F7LB 1SJHA 4X7SL 1NUGA 1KLFA 1U2CA 3MRNA 4LSPH 3T4YA 4XMLH 1IKFL 3O0RL 2JIXB 4OCNC 2XPGB 2R4RL 4I9WD 4LMQI 3UAJD 4PBXA 3WS6A 2EE9A 1S5HA 1UCTA 2CKNA 4R0LB 3QXDB 1VEPA 5C8JB 5IB1B 1F90L 3B6SA 4IRZH 4TTDD 1FORL 4ETYA 1JNNH 1IZKA 1AGDA 2WP3O 3RL2B 3CMOH 3VWJB 4RCAA 4W6XB 4LCIL 2VZOA 3QISA 2IAND 2D7TH 4YGAB 1Q0YH 5HYSA 4XP4H 3MV9E 2IMMA 5FV2A 4JRWA 5DJZB 4PRBA 3VWKB 3PWJA 4S1QH 3VGFA 3VMPA 4XVTL 5IMLB 3MRIA 3MRLA 5KOVC 1CFQB 5CIPB 4NM8L 4NRXB 1XR8A 4MCZB 5D6CA 1KB5L 1G7IA 2GEEA 1IEAB 4MB4A 3IKCA 2HVJA 5C0EB 3ES6B 5KS9F 3E3QC 1W72L 3U9PL 3CDGA 1MCWW 1CT8B 2YOCA 4J23A 4DW2L 4NOBA 5D1ZA 4HFUL 5D70H 4F37F 1J1XH 3P0VL 4HX1A 5JOPE 3Q1SH 5J8OA 4Z6AT 2FEDC 2K1MA 4OZHA 1KB5B 3DETC 4QHUA 1NEUA 2NY3D 5FYKH 4IDJL 1GGIL 3V6ZA 1U8NA 2PXYB 3KPNB 2BRRL 1T3FA 3PQYE 4Y19D 3RPKA 4G8GB 4GBXB 1BGXH 1J0ZA 1MRDL 1DFBH 3O8XD 1IMHC 2OP4H 3NMEA 1G7PB 1EUUA 2E6PA 3TLRA 5AD0A 4JFQA 3GSNH 3DUUA 1QEWB 1GGCH 1YN7B 3WE6B 4HT1L 4P2RA 1FO0A 4HWBA 3UYRH 3O3BA 3SOBL 1TTUA 2A6IB 1Q9KA 1D5MB 4AY0A 1U58A 3MUGB 5K9JL 5E5RB 1KB9K 4KI5C 1LO2H 1EZVY 1C16B 2RFXB 2NNAB 4Q0XL 5T3ZH 1UKQA 2BP3A 1FVDB 2ADGA 1T1ZB 5IMKB 5EU3B 3CSBA 3QI9A 3QH3A 1M7XA 4L5FL 2MJWA 1I7RA 5I8CA 1NLDL 1A7RH 2NXZD 1SEBB 5C0CD 1D5ZB 4PJAB 2IANE 5IW6A 5JMRA 2ZPKH 3RWGA 5L6YL 4NNPH 1KYOJ 1ZLVH 3V5DA 3MOAH 3MBEB 5HGDB 1RJYB 1IILE 2BOBA 3IDNB 3O6FD 5IV2B 5MENB 3SKUD 4FP8H 4XVSH 5CEXA 1MRCL 5DXWA 1HHGB 1WTLA 1XGPA 1IL1B 1VFAA 4U4BA 2BDNL 1UWEL 4QHLA 4DN4H 4Y2DC 1DUZB 1G7QB 2NY4C 1V3KA 5D72L 3ULUF 1QHPA 3U4EA 3BKYH 3K4ZA 4ODHL 1YZZA 1YEFL 4OD2A 5AZ2H 4WI2A 3QXVA 2IADA 3IXAB 4HKJB 1YJDC 1CR9H 4G7VL 3L1OL 1ZVYA 3MV9A 4LCCA 4OF3A 4X7SH 4YDJA 3VFSA 4M1CC 1Z5LB 5DJYB 4HXBL 3VGDA 5D7IB 2R4RH 2PTTA 4KMTL 3N85H 3I50H 2ZSVA 4WEUD 4CVXA 1MIML 4Y19E 4XI5C 5ESQA 4GAGL 2IBZX 4WNQB 1I7ZB 43CAB 3HNSL 1F90H 3MNZB 1FORH 4L8DB 3FCTB 1LNUB 2CDEA 4LCIH 3BQUD 4QRPB 1AXIB 5CIPH 2Y36H 1I3VA 1H15A 2C1PB 4JQVA 4X6EB 4HH9A 2FH8A 4I18C 2XNAB 4JO2H 3OKEA 4XVTH 2CLVA 3RA7H 1QFWI 1OGAD 1TCRB 2V17L 5GSRA 1FFOA 4X7TB 1JN6A 5SWZA 3U7AA 2V2TB 3MRGB 1KB5H 1QTYT 1SYVB 4YDLB 1UJ3B 3MRCA 1S7UB 4QXGL 3R0MA 1W72H 1RZJC 4IRJD 3RWHB 5CJOL 3MRJA 2D2OA 1UB5A 4HFUH 3SDCD 3SKNB 1BFOA 3P0VH 4OCRH 5C0CE 1IGYA 4ZPTA 1LO0H 5EORL 3WLBA 2FL5B 2IPUK 5H37H 4MJID 4UT9H 1MCPL 2BVPA 1GGIH 3FQTA 1RZIA 3V5HA 2F9BT 3VI4E 4YXKL 2BRRH 1HN1A 3Q6GL 1MRDH 2VKXA 4L3ED 2XN9A 1YEDA 5I1GL 4PJXB 3L3OA 4KK5C 3W0WB 2G9HB 1IM3B 4EUPA 3RTQB 2ZG3A 4OIIL 5TDNB 2DD8L 4MX7A 4HT1H 5DMJB 1AD9B 3DVIA 2I07A 3FT3A 3SOBH 1F3DJ 4O2CA 2AV1B 4PGCB 3L5WA 4QHNB 2BJML 4G8FA 4RBPK 4Y4HD 4NZTL 3WIIH 1FNSL 4Y4FD 4XCYB 4OLEA 4Q0XH 5IHLB 1V3LA 4NRYB 1ITCA 3HPLA 4PV9A 3REWA 2HJLB 4ZG1A 3S37H 2IQ9L 3RNKB 2ATPA 15C8L 5D7JC 3JV4A 2YEZB 4OAWA 4L5FH 3QQ3B 1NCCL 1NLDH 1R3LA 5D7LD 5B38A 2NXYB 1QPXA 1BBJA 5IMMA 3L6FB 5L6YH 3IAPA 3HI1A 2OM5A 5E1AA 2DM3A 4LCWD 1XGUA 3P9MA 1JPSL 2HG5A 4KDWA 3HE7D 4W70A 5IG7B 4Z0XB 1U8JB 4JKMA 2DAVA 4DGIL 4Y19A 1OGAE 4R4FL 3VFTB 1UWEH 3RVWC 4M7ZC 4HK0B 5DFWH 4J7RA 1F58L 1JMXA 4U6XB 1YEFH 3OPZL 1QA9B 3F7VB 4HPYL 1RMFL 4L9LC 2Z9TA 2KPNA 2H45A 4OZFG 2PF6A 3FQNB 1Q9WA 1T0NA 3CFEA 3L1OH 1U91A 3F6LA 4NWTL 1P2CA 5I30L 1OARH 4LVHC 4ZDHB 1MFAL 3CFCL 1HWGB 4HXBH 4TNWF 3FO2B 2CQVA 1Q9OB 4KMTH 4UOW1 1W8OA 4PJ9C 1MIMH 4R2GC 4YC2B 1HH9A 4M62H 4B0MM 2OXGA 5ID1A 1BQSA 2VL4A 5CEZD 5IIEB 4GAGH 4L3EE 4R9HA 3HNSH 2QEJA 3KXFB 4YFLF 4DCQB 1IZJA 2VUOA 4UUJB 1U3HB 1A2YB 1YEJL 1L0QA 4NO3B 5C0FA 2VLKE 2KQNA 5BRZA 3ZKXC 3TBWA 4EDXB 1MIEL 2EO9A 4MA7L 1ZANH 4FQHA 3IXTA 4QOKB 3BESR 4RSVA 5F7DA 1DBAL 3PUCA 4LBEB 1REIA 3J7HA 2V17H 4M61B 5T3XL 4KJPC 2R69L 3TBTA 1QLRB 4UAOC 3W9EB 3F5WB 3BD4A 2Q6WA 3RWJA 3P9LA 2E8ZA 4JN2A 3WIHL 2NW2A 4QRRA 4QXGH 4IIQB 5CJOH 4HUUB 4RNRB 4HBCL 1QFUL 3EO0B 1RVFL 3LHPL 2NX5D 1FGNL 4PJCF 1A9BB 1WV7T 4OI8A 1FP5A 1S9VA 1MUJA 4LCWE 4I2XA 5AAWA 1AO7A 4M02A 1MCPH 5ICYB 2ADFL 3GJEA 4CRPA 1XMWA 43C9B 4YXKH 4FQ1L 4R3SA 5IMOA 1S7WB 4PRHD 4DKEL 5F3HB 5EOCJ 3Q6GH 1HXMA 1CD1B 1W0VB 2DQIL 1B4JL 4FFZL 5E7FA 4Z0BL 4OIIH 1RY7B 3T0WA 1HYRC 4KJWD 4OZIE 3WO4B 3OKDA 3SKOA 4GUPA 4RGOL 1BQLH 4NPYB 4F7PA 4Y89A 1GZQA 4P4KA 1F45A 2YD5A 2BJMH 1DE4A 4XB8A 5D2LB 5D93C 4NZTH 2X4SB 3Q6FA 5SV3A 3BZDA 3D69A 1MJ8L 2CRIA 3QHTC 3PL6C 2YN5A 4M93B 4Y16D 4JKWA 32C2B 1K6QH 2IQ9H 5CEZE 4PJDB 4XPHL 1UM6L 1GGYA 4FXKA 4PLJD 3WS3B 15C8H 3HLAA 4URTB 1GOGA 4Q2ZA 2EDBA 4U49A 2FO1A 3N1GC 4N9OB 3CZJA 1DZBA 5D96B 2YN3A 3RFZC 3TCLB 1Z2KA 4GJTB 4PG9A 1OPGH 1JPSH 5FA4B 1S9XA 2H32B 3ILQC 1U8QA 4XPAL 3ZE1E 4LP5A 5EC1A 3OAUH 4DGIH 3OV6A 1QBAA 4TOYL 5JW4N 2V7NB 4R4FH 4L3EA 2KZWA 3EZJB 5DRWB 2XZZA 2WQRA 4WU5B 1F58H 1K8DB 3EYVA 3ZT5A 2Q76B 4DQOL 2R1XB 4O4YH 3OPZH 4HPYH 2VLKA 5CP3H 2DWDA 1NGZA 2UWEF 5SWSD 3QCTH 3WXWL 3V8OA 3QCVH 3MACL 3U0WL 2XICA 4EN3C 3STBA 4DUWA 5I30H 1YYLL 4Y4HA 4N8VB 1MFAH 1HSAA 1K8IA 3CFCH 5EOTB 1ZEAH 1IBGL 3T65A 5DVLA 4HKXB 5BQ7B 3OKNB 1CL7L 4HUWA 1FCCA 3PWNB 4YDVA 3PXJA 4F15C 2ZUQB 5EZLA 3NA9L 1UEYA 3GFUA 4W4OA 1JNJA 5CHNB 2UZYB 3DX8A 4X0KB 3DNKA 5DEZA 5BO1L 5IOPB 1I9IL 1IQWL 1Z9OA 4LPTA 5FUOL 1HQ4A 4M3JA 1MIEH 4MA7H 2FWOB 5H35B 3CSYA 4XVUC 3GHBL 5IESL 4P23D 5GIRB 2Y6SD 3MLYL 1DBJL 1DBAH 4AZ8A 4YAQB 1LO3L 4HS3B 2Z0BA 4PJ5A 1JPST 5T3XH 3IYLW 3X13B 3U4AA 2AERT 3U9UB 3VCLA 3M17A 2A0LD 3WIHH 4HZAA 1D9KB 4LVOB 5CMAB 4OZIA 2R56L 1YY9C 2DJ4A 4UTBL 4OQTH 3QNYB 4ZOEA 1O5DT 4HBCH 1QFUH 1VHPA 4Q58C 4LLAA 5GRVL 3LHPH 5JLZA 3F7YA 4XXDA 5CGYC 3MRDA 3DPBA 3V5KB 4JM2B 4MNGA 2ICEB 3RGVB 5ESAB 3DRTA 1L6XA 3HR5A 2CUHA 2ADFH 3WHXA 4X9BA 5B4MD 3RWIA 2CIKA 1CXFA 1SBBA 1YEEH 1FN4A 4JRXB 4WGWB 4EIGB 1PGRB 4DKEH 4Z7QF 2EXYD 2AJVL 2DQIH 1B4JH 1VEMA 4K3GA 4Y5VA 1OSPL 3FO9B 1ZHKB 3BGFB 1F4XL 3HPJA 4Z0BH 4JFPB 2YRZA 5SWSE 5BZDA 4GRLB 4JGJA 1JPGB 5IFHH 4LOUC 4PLKC 4RGOH 3PWPD 3QUYC 3KR3L 1ND0B 1A6UL 4UV7L 5DD0H 3VJ6A 3K7UA 1T0PB 2R0WL 4YWGL 1KLUB 3V52L 3RDTD 2HFTA 3AB0C 5DEFB 1MEXL 3IU4L 3OB0H 3I6GA 3ULUC 3NZHL 4GW5B 5JIPA 2X1WL 1SJEB 3MLTB 4XPHH 3LSOA 4LLYA 1UM6H 2Z4QA 5ICXB 4FQXD 1PYWB 5JW3L 1B88A 5ADPL 1OOAA 3GB7B 4GRWB 4HGKC 2GJZB 1PDKA 3BT2L 4YE4L 2A1WL 2KDGA 4ZFFB 4P3CL 4LCUA 3TN0D 1U92A 3QPQD 3OHXB 4XPAH 5CINL 5KANI 3VFOB 5HI4C 3RUGF 5IB3A 3PDOA 4GS7B 1XR9A 4LRIA 4TOYH 3JTSA 1FAIL 3RHWF 2RCSL 5E9DD 2Y1VA 3MV7B 1E4WL 4G6FD 7CGTA 4CU7A 3SPVB 3OR6A 1G7HB 2XV6B 5HHPA 2CLRB 3S35H 3ARUA 5DJCB 5CD3A 1FE8H 4PJFF 1NGYA 5E6IA 1G0XA 1LEIB 3WXWH 3DRQA 1WC7B 5KG9B 5DT1L 4UDTA 3MACH 3TH3T 4BSVB 3U0WH 2DQTH 5KS9A 3L3KA 2WBJD 1Q72L 4NZRH 5IB5A 5C9JA 2DQDL 3AREB 1I8IB 5EFIA 3BO8A 2YUWA 3ARDC 4Y16A 1CL7H 1AGFB 3R1GL 1YNTB 4ONHA 3C6SB 3VGGA 3N0PB 2J2ZA 1F2XK 4XP6L 5L7XL 2IAMB 1NKRA 4QCIB 2OJEA 4RDQG 1XGYL 4AT6A 4U2YA 2VITB 5BO1H 4WU7A 2ICWJ 2NY0D 4HJ0C 3TBVB 1I9IH 1BQUA 1T7WA 4PJIF 3PWPE 1XF5B 3QEQD 5JPMB 3G04A 2XKUA 3GHBH 3E2HB 5KSVB 4UT6L 5IESH 5F1NB 1MQKL 3MLYH 1DBJH 4CMHC 4MQ7B 3SGDI 2MQCA 2OR8A 4P3DA 3FQRB 5JHDD 2AJ3B 1V3JA 3DHJA 3MJ9L 3U0TA 2QADD 2LTQB 4NRZB 4NJAH 5EUOB 1TPXB 2X1OA 4EDWH 4I5BB 4UTBH 1A4KB 5JHLL 2YD3A 1M6OA 2CD0A 5E94B 3HMWH 3ZYJA 1XGRA 3PGDB 3BPOC 4N0YH 3T8XA 1K2DB 1NCDL 2XFXA 1UJTA 2X4UB 1PSKL 1QOKA 5H94B 2APWA 1X4XA 1KNOB 4GAJL 4LSRL 4N0UA 5KW9L 3DSNA 1XF2A 3ZKSD 3I6KA 3D85D 1CLCA 5E9DE 1NCNA 1VFMA 2WIIB 4JPIB 4CJ0A 4NGHH 3B9KD 4EI6B 1NGWA 2XWBA 4FQCL 1F4XH 1IRAY 1RZKH 2ATKB 2WBKA 2R8SL 4JPVL 5E7BA 5IB2A 5T1MA 3G5ZB 4E41B 2P5EB 5D7KD 1IGCL 3PDGA 5F7YC 5C0JA 3KR3H 3GMNB 4UV7H 1HH6B 4LKXB 1ADQA 5DURD 4L4VB 3PHOA 4X6CB 3FB6A 3B8YA 4NQED 2G60L 1NMCC 2R0WH 4APQC 4FQQA 3FB7B 3H7BB 3SDXE 3QFDA 1KJ2L 3CXDL 4HIIA 3V52H 2YRLA 3PJSB 1JF1A 2EH7L 3BJLA 1MEXH 3IU4H 3MZTA 5A2FA 2A9NL 5CJBA 3MOQA 2XIDA 3UX9B 2JF1A 4GMSH 3UTZA 2IFFL 5J06A 4V2BA 3SE8L 4LEOB 5F7EL 5JW3H 4OLWL 2PO6C 1QFWM 4X9IA 1KJ2B 5GGTH 3MRPA 1WITA 4YE4H 2A1WH 1KT2B 3S36L 3TVMC 4AK1A 4F7MA 4BH8A 2AJSL 3DLQR 3K81A 5CINH 4F7CA 3IDYB 5KVMC 3DX7A 5CKGA 2Z93A 3P0YL 3G5YB 1HXYB 2NYYC 4K3JL 1MSPA 2RCSH 4TPRL 1EXUA 3D0VB 5JHDE 3REVA 4PD4J 1RIVL 1E4WH 4P5MB 4G3YL 1FYHB 3QDJB 3VG9C 3HNTH 3RAJL 1BJMA 2D4FA 3PWPA 3FRUB 3LRGA 1CDCA 2VNCA 5J57B 2EXWC 1J10A 4DOHB 2X10A 1EEUA 1Q72H 3U0PA 4L8SA 4M6AA 1KPUA 4RQQA 4KVCL 2DQDH 2APFA 2A6JA 1RZGA 3ARGA 4LPXA 4N90D 5GS0D 1WGOA 4CUCA 4DZ8B 4XTRC 4XP6H 5L7XH 2ZCKH 3GSUB 4JJ5B 3SCMC 2QQKL 3UBXA 1XGYH 2Y5TB 3EYOB 5JOFB 2AXHA 4QRTA 5D7KE 3VD9A 1S78C 2BMKB 4UILL 4C56B 1K85A 1TFHA 5TE4L 2BSTB 4UT6H 3T2PA 4ZUTA 4JKKA 4UZGA 5MEPB 4C57C 5I2IB 3SJVB 3HUJF 4FQ2L 2BNQB 4WEMB 4NQEE 4ZYKA 1HE7A 4BKLA 5KVDH 1INEL 4LKCB 3I84A 2FSEA 1M4KA 3MJ9H 1TDQA 3BPLB 1AHWB 5EIQA 1QKZL 3KS0H 4G5ZL 4RMQA 5I76A 4K3HA 2VAJA 1I3RB 3BPCB 1A1MB 2SEBB 2DI9A 3UO1L 5D1QB 5JHLH 1RJLA 2DMKA 4PJHE 2OQJA 2E6QA 4OCXL 4ZODA 3RWCB 3KPSA 1T2QH 1U3JA 4KROC 2FX8H 4PRNB 3L7FA 1FZJA 3VXMA 1NCDH 4XH2B 4FRWA 3IVKA 1A9EA 4Y5XC 1N59B 3WUWA 4JHBA 1C12A 4K23L 5I1JH 1YMMD 4GAJH 4LSRH 5KW9H 4PP1D 5C0IA 2Z31D 4LLUB 1M71B 1RJZA 4EZMA 1EMTH 2FHBA 2AJYH 1CU4H 4FQCH 4KRPD 3WKML 5DRXB 1U2HA 3B83A 1LO5A 2R8SH 4JPVH 5JXAL 3HKFA 2F53B 1CFSA 3H42H 1DVFD 1IGCH 3T0EB 4LHQB 3MRFB 3KLHC 1JWMA 1BPVA 2PR4L 3WHE1 1HYSD 4ZQKA 3VXTA 3LIZL 4RWYH 5IFAL 2G60H 5C6TL 4WEBL 3H6JA 3T3MF 4BZ1L 5JHDA 3TYFB 2EH7H 3HI6H 3DBXA 1BLNB 1EHNA 3OKKB 3GI9L 2C3VA 3B2UC 1Z9MA 3DURB 2R1WB 4XWGH 1GC1L 4OJFH 5EU6D 3JXAA 4L4TA 2IFFH 3VFPA 4FOMA 1PKOA 3SE8H 5F7EH 4OLWH 1JUFA 2WIMA 2BSRB 3RJQB 3OKMA 1X5KA 5F88A 4WDIB 3S36H 4QXUL 3VFMA 1M05A 1FNEA 3L3DA 3DVFA 1TJGH 2KH2B 4ZXBA 1R24A 1VACB 3GRWH 3P0YH 3KPPB 4K3JH 1RHHB 3D85A 3RU8H 3IDGA 4TPRH 3ORJA 4BSWA 1RIVH 3DARA 4MJ5B 1ZGLM 4Y4KC 2FYYB 1RZKC 1EAJA 4G3YH 5DTFB 3S4SA 4XVJL 3RAJH 3CCHA 4G9FD 3DVNA 4MJ4A 4I77L 1I7TA 3LN9A 4BQ6A 3QEUB 4PJEB 5DJ2B 3OAYH 1TNMA 3RY4A 4KVCH 1ZSDA 4XPGH 4K9EH 1YMME 2OXHA 4PJCA 2IG2L 2FEDD 2HJKB 5GHWL 5DHYB 5HHOD 4MWFB 3TPKA 1S9WA 4P5TC 3VFNB 5HYJD 2IEPA 2XA3A 4MQXD 2QQKH 5GRVK 3C09B 1FYTB 4PJHA 4LPUA 1JPFB 3G08B 1OL0A 2BCKB 3QNZA 3ECBB 2E9JA 4XPBL 2R39A 3T3PF 4RX4A 4UILH 5C2UB 1FAKT 5C0NC 5TE4H 3LN4B 3NPZB 4HUVB 4GG8B 4FQ2H 2PYEB 3RWFA 2Z35A 1EO8L 1INEH 3O9WB 3O2WL 2CR6A 3EIFA 4IRSA 4AG4L 2BVOB 1KJ3L 2AXGB 4G5ZH 4KI5D 4I0PA 5EU6E 4Y1AB 1NKOA 2QSTA 1T22A 3OX8A 4Y5XA 3DYPA 1D6VH 4JE4B 3ZDXF 1CICB 1ES0B 2HFGL 3UO1H 4DWHA 4OCXH 3CZFB 4YPJA 4ZUUB 4BQBA 3Q3GB 3A0OA 1ZHNA 4Q6IA 3VXOB 4NC2B 2MKLC 5J6HB 4PJAF 3AS3A 4E5XB 3OF6D 1HHHA 3KJ4C 4K23H 3QJFA 2ILLA 3KYAA 1NL0L 3RBSA 3T1FB 2Y7QA 5TH2A 2XTJC 2HLAB 3EOBA 3B3IB 4K7PY 4ZOBA 4I4WA 4NCC1 3C6LC 2V9TA 3WKMH 5JXEC 1KXQE 4N0RA 3V4PL 1EA9C 1AXTL 1L0XA 4HGWB 4HW6A 4QRUB 4YXLL 1I8MA 5JXAH 3BP4B 4G9FE 2J6EL 2NY4D 3U4BL 5I6XC 2A6DB 1EFXB 3S96A 3C8KA 4K7PL 4RZCA 1AP2A 3E6HB 4NN7C 1HOCA 2PR4H 1FGVL 2G2RB 5DJ0B 2VABB 4Z76A 4Q9QL 4NNYB 5FHBH 5IFAH 3RPIA 5C6TH 1PD6A 1U8PA 3BD3A 4BZ1H 4QYOA 4M1CD 4WW2B 4CU8A 3D18B 4LCYA 5DJXA 3S5LA 5HVHC 5HHOE 2NTSP 4A6YL 2VDOH 4WHTB 2ZZUT 5JQHC 1IGJA 5GGSA 5HYJE 3SEPA 3TIDB 4WUKH 5HD8C 1JZ3A 4KZDL 4NN5B 5HGGS 1NFDE 1TZHB 4Z7OF 1K9TA 2L0DA 2XXMB 4XI5D 5JOEA 4PYGA 4QXUH 1HKLL 4Z7VE 4U1LA 3DOSA 1CFNA 2CJUL 1UXSA 2QV2A 5IKCB 4ETQA 5KOMC 3ZDZE 4PJFE 3TO4D 3KYMB 3QIUC 1WFTA 5CSZB 1NJ9A 5FOBB 1CGXA 4XBPA 1QUNA 3MBXL 5F1IA 3VH8A 5E8NA 4GKNA 4QY8B 3FT2A 4PJGF 1CVSC 2FLRT 4XVJH 1VPOH 4OM0L 5IR1A 4D8PB 1ZA6B 5BS0B 3ARBB 5E8DL 3QUZC 1GRWA 1CGWA 4HC1A 1RZ8A 4NKIH 1XF3B 5CKAA 2AK4D 1U8KA 4QNPF 1JYVA 3STLB 3ARVA 2NTFB 2P24B 4PRAA 1NEZB 2IG2H 1MI5B 5DC9B 5GHWH 1JVKA 2P8LB 3R06B 4XXCA 1IC4L 1AIFB 3OB8A 4LGPB 1OQXA 1SEQL 4LPVA 3QIBD 1LD9A 4ALAL 5GZND 4DKAA 5AYUH 2VXVL 5I1AA 1U0QA 4LRNL 2NY6C 4XPBH 1X44A 5DHVB 2P4AB 2FR4A 3BI9X 4ZNCD 4J8RA 4KK5D 2GCYA 4MCYA 4JREB 3HHRB 3RWEA 3MLWL 5IM7A 1VGEL 1EO8H 5K9QI 3ILPA 3BUYB 3O2WH 5DRZA 1P4LA 3GM8A 2W65B 5CBEA 1MJUL 4JLRA 1KJ3H 1UA6L 4R4BB 3FT4A 3LEVL 3QG6B 5MERB 4G6JH 2C7UA 4OFIA 5IQ9A 2BZDA 5DI8A 1F6AB 1KLGB 1VESA 1KCUL 1XH3A 4JANB 4OCLC 2JK5B 2JB6A 4EI5A 1C08B 5C0AA 2GK0A 1XZ0B 4C83A 5D7JD 4HS6B 2VQ1A 3O3DA 3IGAB 2UZIL 1T04B 5I1DB 5FO7B 2IALA 4K9EC 1OAKH 3CFJA 1HEZB 1NL0H 5HI3D 3PQYB 5HVWA 2CLZA 3G5VB 5FYKD 2CKBA 3M8OL 4OGAC 2D7NA 3RUGA 4U0RC 1HHIB 5B3NA 3V4PH 4YXLH 2VWEE 3OJDB 1P9MC 3P4OB 2NY2B 4CVUA 4UMGA 5M95B 5I8EA 1EZVX 2J6EH 4XPFL 2MMXA 2P5WA 3U4BH 5KZCB 4JKPL 2ZG2A 4K7PH 3NFNB 2DKSA 4BFEA 4N8CL 4JCLA 2Y5EA 1FGVH 5FUCE 5HHMD 1HQRB 3VFGH 4PJFA 4M00A 3RX8A 4Q9QH 2AK4E 3N1QC 3T4AA 1FJ1A 4KMLB 4KUZL 1T89A 1IAIH 3KPTA 2P8PA 5DVMA 4K3EH 1WQVT 3BP5B 3QDGA 4MVBC 5EU5A 4A6YH 5IFJA 5E8EA 4MNHA 5GRUL 2EECA 4DEPB 4KZDH 2J5LC 4PJ9D 1ZE3C 5T3ZD 5DA0B 5HYQA 1QBBA 3TESA 3ULVL 3IDIA 4H8WL 3IJSA 3N1MC 3QIUA 2UYLA 5DK3A 2IANB 4MA1C 2DBLL 1T1WA 3O4LD 2HT2D 1HKLH 2D0GA 1ZS8B 4HKBA 1UXWA 3CVHL 5D7SL 4EVNA 1CFTB 2DRUA 1ZK9A 5DD6A 5F3BA 4PJIA 1S7QB 1Q94A 3GNML 4FFVC 3GM0A 1FG9C 2GSIA 2B5IB 4MZ3A 2ID5A 3MBXH 4YFEA 2X70A 1A6VL 1E4JA 1X5HA 3CVHB 3NPSC 5DJDB 3QDMD 1P1ZA 4RFEA 1WBXA 2P1YA 3SDYL 2YPLD 4MAYA 4OM0H 2PETA 2FX9L 1DBKL 2AS5M 1X7QA 5E2TL 5E8DH 5ETUA 3QEGH 5F9WC 5C1MB 1CE6A 1KBGH 2JCCB 3QR2A 4MDIB 3QO0B 4CNIB 5I9QB 1AQDA 2F5BH 3AMKA 1ZLSL 2B4CH 1XF4B 4IOFD 3X3GL 2BHYA 5FHAH 5FYKE 4NJ9H 3VG0L 1IC4H 3O8XB 1H0DB 2Z92A 1SEQH 3DTXB 3KJ6L 1JZ4A 5HHQA 3ZSSA 4ORGB 2VXVH 5EUKB 2JJSA 3V6BR 3ZT7A 2HT4C 4KUCD 5IGXL 2VTFA 1CGUA 3DO3A 2DQJL 5HHME 1NC4D 4JY5H 4L3AA 3TO4A 3MLWH 1FFNA 5DVNA 5C92A 4UOJA 3SDDC 2HJFA 3P30L 3PP4H 3U2SA 1KN4H 3UJTH 2OL3A 1HHKB 2EO1A 3HZYA 4GAYA 3BH9B 2H2PC 3UROR 2LFGA 2PKDA 4NM4L 3LEVH 2EYTB 4TRPL 3UTSA 4PJBB 5DD5L 2IMNA 3KAAA 5T3ZE 3NA4A 4P48A 5JZ7D 4OB5L 4GH7B 5EH1A 2GAZA 4GO6B 1RJCA 3EOAA 2ZSWB 5C0CB 4OKVB 2CXGA 4NDMA 5J6GB 2Z8VC 2ZJSL 3O4LE 4XNZC 4CN6A 2PXYD 3G6AA 4HS8L 2UZIH 1CN4A 1SBSL 4HMEA 2BOCA 4WUUA 3O6FB 2FX7L 5CILL 1XIWC 5E0QA 2YK1H 1UCBL 5E24E 5KSBE 4YBLC 1UKTA 1I8LA 4LIQE 3ILQD 4QEGA 4UQ2A 1CQYA 1I7UB 2RGSA 3QIBA 5HDBF 4QRQB 1QBLL 3NCJL 5BVPL 1F2QA 1CL7I 3QDME 4JAMB 3MLVL 2YPLE 1FZMA 4ERSL 1A6WH 4JM4L 3W39A 1HNFA 4ZSOE 3BWAA 3RZWA 3KHOA 4N8CH 1G6RH 1FLRL 1JV5A 1EPFA 1AGEA 2QSCL 2P43B 4MJ6A 5FK9B 2FEEI 2NW3A 5C0BD 1C5CL 1T0MA 4LLMB 4D94A 4W6WB 4MNQA 1P7KB 5FYLL 4KFZC 5FO9A 5EN2B 5HYEA 1ORSA 2GIYA 3ULVH 2V2XB 3DMMD 2VZTA 4G8EA 4KJQC 3K2UL 5LQBL 5TF1L 3L9RA 3BSZL 3C5SB 2DMBA 4WO4C 3BEWB 2Q8AL 5MI0C 3GMMA 3BP7B 5IF0A 4JZOB 5D7SH 2EIDA 3VGAC 3X12B 3GMOA 1OB1B 3GSOB 3GMRB 4XVUD 5GGRY 2UZXB 3KPLA 2XWJA 4ZUWB 3TA3C 5MEOA 1G9NL 2CUMA 1UYWL 1ETZB 3LQAL 4K71C 2EZ0C 2DYPB 3RVXC 1A6VH 4NKDB 2QLVB 4HMCA 4IRJB 4W68A 4H1LH 1A6ZB 4X5XB 1RUPH 3TP4A 5HXMA 3SDCB 2FX9H 4LNRA 5E2TH 2D31A 4LQFL 5EU7E 3W11C 3FN9A 1LVEA 4MJIB 4G80A 4TUOB 5EBLA 1SYSA 4ZFZB 2BC4B 4JM2F 5BV7L 1FNHA 5K9KA 4PRDA 1ZLSH 2CGRH 3X3GH 1HZHH 2CK0H 2FIKB 3VG0H 1ROWA 4AH2A 1PBYA 1QRKA 2W38A 3KJ6H 4U1IB 3QULB 2OZ4A 3QYCA 2FZ3A 4NN6B 5BV7B 5T1KD 3C8DA 4GRMB 4WWKB 1S7VA 3WL9B 1WCBB 3QWOA 3WN5B 1J05A 5IGXH 1RU9L 2VJXA 5TQ0L 4Y5YC 2DQJH 4TVPH 5DS8B 1IGTA 2ZUYA 3HZKB 4Y4FB 3RY5A 1KPVB 3QUYD 4ELMB 2YMXL 3GZKA 2ICWA 4FA8A 5IB4A 1IKNA 2CDGA 2Q1EA 3EAKA 3G6JB 4NM4H 3GGWA 2ITCA 3QDMA 4TRPH 2WLZA 1OW0A 4POZC 5DD5H 3C9NB 1TQCC 2J88H 4OB5H 1WFUA 2JIXA 2X89D 5D7LB 5EA0L 4RMTA 5MENE 2ZJSH 3FONB 2VQUA 3CPLB 4Z7UE 3HAEH 1CG9B 2RIKA 4HS8H 4GRWF 4M03A 3FQUB 1SBSH 4R0LA 3QXDA 3HE7B 5CILH 4LQ1A 4P2OC 5C8JA 5IB1A 5ITFB 3VA2C 3ZO0A 1UCBH 3LRHA 1WAAF 4ZUVB 2B4CC 1ZLUK 3U30B 3VWJA 2R0ZH 3W0WD 4GXUM 3SDAC 5B8CC 4ODSL 5E1HB 1V8HA 4XPTL 3MLUL 3AXLB 3B9EA 3NCJH 5BVPH 2GUOB 3MLVH 4ERSH 5DJZA 3WD5L 4JM4H 1G9MC 3VWKA 1JHTB 3SQOH 2DICA 1U93A 4JGMA 4FFYL 5IMLA 5D7IE 1CFQA 5CIPA 2ZUUA 4R97B 4ZO9A 5C09B 4NRXA 1DTUA 1FLRH 4MCZA 5GJTL 1MWAL 3IFOB 3L3JB 1BMGA 1IEAA 2DL9A 5C0EA 2APXA 5L0QB 2QSCH 3ES6A 3LQZB 3EYQC 5JPNB 5HGAB 3V0WL 1GJIA 1MF2L 1CT8A 3T1WA 5FGSA 4OZGB 4OLZL 4DGYL 1FZOB 1UFUA 1UT9A 2NXYD 4QRPE 4RGMC 1UJ3C 2D9QB 3ARDD 1UM4L 5FYLH 1FL3B 3VDBA 1KB5A 4WI4A 2JJTA 1MWAB 3TIEB 1HHJB 1KJVB 1NDGB 3K2UH 5LQBH 1IGML 2BHZA 3AAZB 2PXYA 2V2WB 3KPNA 3BSZH 3MYJB 5TF1H 5DJAA 4NC1C 5DFVC 4ODTL 4OLUL 4G8GA 2V9RA 4HJ0D 4K3DL 4GBXA 5D5ME 1N3NB 4XHQA 1F3RB 5DQDL 4Y2OA 1G7PA 4U05A 2DM2A 1PZ5B 2FGZA 1QEWA 2EDWA 4GKOA 4JB9L 1G9NH 1YN7A 3WE6A 1UYWH 4EBQL 4R7NA 2A6IA 3X14B 1D5MA 4M4RA 3MUGA 5EUOF 2R4SL 3VXNB 2NX5B 1C16A 2RFXA 4U6YB 1FL6B 2NNAA 1F11B 3O3UN 1UZ8B 3C60B 2AJZB 1LDSA 1KN2L 4KKLC 4WV1C 1A5FL 1FVDA 3BKML 1T1ZA 1F4YL 5IMKA 4YHLL 5BV7H 4RGNC 5EU3A 1Q9LB 1RPQA 4YR6B 5C0GB 1OAYL 1DP0A 4PJXE 3UDWC 4PRHB 3W0WE 1UB6B 1SEBA 3X11B 1D5ZA 4PJAA 2VYRE 3NN8B 2OR9L 4AEHL 1Y18B 4KVNL 3FJTA 3MBEA 5HGDA 1RJYA 1AXSB 3IDNA 4BFBD 3ULVC 4QOKD 5IV2A 5I16B 5MENA 5KSAC 1IAMA 3MRBB 2RB8A 4K8RL 4X4YA 3JWDL 1HHGA 5D6DA 1EJOL 2CH8A 5DLML 1IL1A 1WZMA 1JGDB 1DUZA 1G7QA 1O0VA 4RRPG 1KCRL 2YMXH 3WYRA 4X6CF 4LHJB 2YWYA 4JZJB 1KUMA 3IXAA 4HKJA 2WSKA 4G6ML 4F7EB 2R23B 1KPRB 1I1AC 1LGVA 2E5EA 2GFBB 5GGQL 3QUMH 5T3XD 4M3KB 1MCHA 1Z5LA 5DJYA 4HSQA 4P2OA 4ODUB 5D7IA 4HK3J 5EA0H 1L7IL 4A2MA 3V2AR 5A2JH 5KTEL 3F6IA 1KC5L 2X9WA 1IVLA 4X7CC 4J3VA 4ZS6C 3MCKB 1N5YL 4WNQA 1JWSB 1I7ZA 4K55A 43CAA 3MNZA 3TVMD 4L8DA 3FCTA 1LNUA 2A83B 3FRPG 3KPRD 1OP5H 4QRPA 3MLUH 4WHYG 1FRGL 1P6FA 5EBMB 2C1PA 4X6EA 4PR5B 2L7JA 3HMXH 1U3HC 2MTPA 5SWSB 5LWYH 2XNAA 1JI2A 3HRPA 2LE9A 4FFYH 4UINL 1TCRA 4NBYB 1UEMA 3WEXB 3EDFA 4X7TA 2I25N 2V2TA 3GSRB 3MRGA 5GJTH 1MHEB 4EJ1C 1MWAH 5CZVH 1SYVA 3LN5B 1DSFL 1HI6B 1UJ3A 1J1OL 1S7UA 3V0WH 2QSQA 3UZQA 3KXFE 4YHYC 5D71L 3SKNA 4OLZH 1TNNA 4DGYH 4YHOL 3ZT6A 2FO4B 3JTTB 2P8MB 2FL5A 2PCPB 1UM4H 1M7DA 2ZUXA 3EJYC 4QOKE 4LDEB 2CRMA 4WRLA 3VXRB 4ODTH 4JPWL 4KTYA 4OLUH 2UUDK 4RDQF 3EFFB 5DQDH 5A2KH 1X9QA 2QQLH 4PJXA 2FLBT 1I9EA 2FATL 3RBGA 3W0WA 2G9HA 1IM3A 5GGVH 1K3ZA 3DJ9A 3BOVA 3H9SD 3PIQB 4HCRA 4JB9H 2GTWB 5TDNA 3RTQA 3BZEB 1KF9B 3RVVC 1AD9A 4EBQH 5E5MB 3NOIA 3V7AE 1SMOA 3W2DL 2AV1A 4PGCA 4QHNA 2ZOKB 2R2EB 2BVYA 4U1HB 5T3XE 1JTOA 3NIDF 2XRAL 1PKQB 4PG2A 4P59H 5TGBB 3QZWG 4XCYA 2BRQA 4KGLA 1PEWA 2HJLA 2ZG1A 1UKSA 3NGBC 1KN2H 4OM1L 3RJDA 1A5FH 3JV0A 4B41A 3RNKA 1NLBL 2QHRH 4G6KL 4KROD 5AG8A 4U6HB 3UJIL 5H2BA 2YEZA 1OAYH 1E4XL 3W9DB 3KPRE 1E4KA 5KSAA 5F6IB 2DJUA 1YEGL 3O3AB 1AJ7H 3L6FA 4YLQT 2OR9H 4AEHH 4KVNH 3BJ91 5C6PB 5IG7A 3WNNA 4JQXA 4Z0XA 3L5HA 1U8JA 4K8RH 3JWDH 1IC7L 5D2LE 3ZDYE 3B5GA 3K2MC 1G84A 2X1XR 2X1PA 3VFTA 4JVUA 2HH0H 1S7TA 3I6LD 3QSKB 1KCRH 4U6XA 2DKUA 3KLHD 1QA9A 3BN9C 3F7VA 4PJDE 2WMPA 4S2SB 2E9WA 1G9NC 4G6MH 4UT7L 1GCFA 4N5ED 3FQNA 2CPCA 5T1DL 2B1HH 1QNZH 5GGQH 1INDL 2GITA 4FQXB 4ZDHA 1QFWL 5DHXB 1IJ9A 3B2UD 2D0FA 1LE5B 3FO2A 1Q9OA 1L7IH 4ZFOL 1MCCA 1P7QD 3Q48A 4JHWL 3FL7A 2OMBA 5KTEH 4AL8L 1KC5H 3S6CA 4EXPX 3I75B 2R1YB 5HDBE 4JG1L 1N6VA 3MUHL 5IIEA 1N5YH 5F9DC 1HSBB 5D1XC 2DIAA 4ZPVB 3KXFA 4N1EA 5DZOA 3KLAB 4DCQA 4UUJA 1U3HA 1A2YA 2EKJA 3H9SE 4NO3A 4YEEA 4ZFOB 5HY9B 4G6FB 5E4IA 5ACLA 3VFRB 1FRGH 2F19L 3CLEL 1D5BB 2X9XA 4GRLD 4EDXA 5KJRL 4KV5F 3BHBA 1BJ1J 4QOKA 1JZ2A 4ACPA 1YEIH 3LB6C 4NWUL 4LBEA 1CFVL 4UINH 4Y4KD 3O6LL 4M61A 1YPZF 2OTUB 1IARB 2WBJB 3JV6B 2H6PA 3S36X 1QLRA 3W9EA 5DC0A 3F5WA 5IBTL 1DSFH 1N8ZB 3LRSB 2IPTL 5K59E 3SDXB 1J1OH 2A9ML 4KHTH 5E6YA 4F58L 4IIQA 4HUUA 4RNRA 5T1LA 3TWCL 4YIQB 3EO0A 1X5LA 2DN7A 2R0KL 4KDTC 4YHOH 3WSQL 3ARRA 4YDIH 4MXQC 3ZTNH 2LVEA 4KXZH 3WIHA 5ICYA 4JFDB 1MHPL 2NY0B 4P5TD 4M6ML 1Q8MA 5DF0A 3LAFA 5E95B 1ZA3B 2DM7A 4PV8B 43C9A 1QSVA 1S8DB 3QEQB 4JPWH 1S7WA 3WNPA 4LLQB 5JIHA 5EPMB 5F3HA 2XQYG 1CD1A 3SO3C 1W0VA 2PYFB 2GT9B 3I6LE 3MV7D 5T5FL 1MCOL 4MD0B 2D0HA 4V2CB 4TSBL 4NPYA 1GGBH 3W2DH 3ZKMC 3CFDA 2LU4A 1EBPA 4OUUB 2ED9A 2O61B 1BWMA 1RURL 2XRAH 5D2LA 1QHOA 3P77B 2X4SA 1TTFA 2B2XL 3G6DH 4JDZB 3ARED 4OM1H 3NIFF 32C2A 3QZWB 1LQSR 1E6JH 3L3IB 1NLBH 3LEYL 4P46B 2W92A 4U1GB 3UJIH 1E4XH 3BVNB 4QXTB 1MCWM 3LS4L 4YX2L 3QNXB 3VH8G 1C5BL 3B9KB 2NR6C 1RAMA 3THML 1IAII 4E0RB 5GSVB 2COQA 3TCLA 1RULL 2E9BA 4NYLB 2H32A 2XTJD 2RHEA 4K7FB 3W82A 4XNMA 1DQQB 1J88A 4YHKL 1IC7H 4LDLB 5TFSL 4JO1L 4GMTL 3RQ3A 2EDTA 2V7NA 1FVEB 5DRWA 1LE9B 4CMMB 4NQEB 1LP9E 4WU5A 1K8DA 5MEQA 1OP5K 3GI8L 4YHPB 2R1XA 3H9YA 5GS1C 4PIRF 3OGOE 4GS7C 4MD5B 1KEGL 5HDLA 1J0YA 3ARTA 4UT7H 5T1DH 1UM5H 4BFGA 2X1QA 3RNQB 3WJLC 4Z78B 2WANA 5ESVB 5EOTA 4OT1H 4O5LL 4LL9A 1E0OB 4A2LA 4HKXA 5HD8D 5BQ7A 3OKNA 5D2NB 3PWNA 4AL8H 1N6UA 1ZOXA 3CGTA 3VD7A 3ZYZA 1FDLH 2EDEA 3NTCL 1T1XB 4JG1H 1R3KB 1NC2D 3MV7E 4CN1A 4L29B 5CHNA 1SVCP 4X0KA 3ZE2E 1Z6JT 2GY5A 3ARFC 5IOPA 2WUCH 4NQCD 3QCUL 1FSKB 3CLEH 2P5ED 2FWOA 5H35A 2Y07L 4H5SB 4F7TB 1QYGL 3UP1A 2EICA 5GIRA 2YSSB 4LSSL 5EO9B 3V6OA 4YAQA 4K8RC 1CFVH 1OP3K 3JWDC 4PRBB 4HS3A 4M6NL 3ZHDA 1EGJH 5DQJB 1NUFA 3QUXB 3V95A 1V7NL 2CR3A 1ZGLB 3CLFH 4P5KB 3TCXA 5ALBL 1EERB 5IBTH 1XR8B 2IPTH 3B2VL 3QUZD 5JUEH 5CS7A 1D9KA 2A9MH 5CMAA 4F58H 1RFDH 4DVRH 2NY7H 3QNYA 5L2JB 3UTTD 4XCNB 3TWCH 1XEDA 2R0KH 3WSQH 1CDUA 3V5KA 4JM2A 1A6PA 2B0SL 3RGVA 4HX1B 5ESAA 1IE5A 2XZQL 1VKXB 1MFCL 2X09A 1NQBA 3V0VB 3WBDA 1DL7L 2XTJE 3HE6C 1MHPH 4PTTB 3QDAA 5FGBC 1RK0B 1DDHB 3BIBX 4LSTH 1I9JL 4JRXA 1N4XL 1FO0L 1JGLH 5CD5D 4S0SD 3MGOB 5FXCH 3MYZA 4ODVL 4Z7WE 3FO9A