4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
3MV8A 5KSBA 2EDNA 5E2WL 3VCLB 3O4LB 3BP4B 5DD0L 1MELA 3ARVA 4LNRB 5E99H 4KI5F 3MV8B 3OAZK 5CJOH 1EO7A 3KR3H 4GRMB 2DQDL 4QF1B 5BRZA 5IFAH 5HYFA 4AG4H 4ONGH 4LQFL 1BQHG 1F42A 4BFEA 2WUCL 4FP8H 4NOFA 4JG0H 1Q8MA 1Z5LB 2NY7L 1CCZA 1IGJA 1QSFB 1CVSC 1WCBB 1QP1A 3IF1A 1OP3H 1UCBH 5E08L 2FB4L 1D6EB 1S7QA 2E3VA 5JHDE 3QFDB 4PJ8C 1DTUA 1YPZE 3MCKA 3SDCA 2B5IB 1FV1B 5J6HB 3LY6A 5CEXA 5IOPB 4H26B 4M5YH 1DVFC 3MLTA 4U2ZA 5HGAA 3SKUD 4PJ7A 1CVRA 3HR5A 1ORSA 4ZTPL 2IBZY 1XF5A 1Q9WB 2ZUUA 5DJ8B 3JZ7A 5L0QC 2HN7B 5FDWB 1S7QB 4HWBH 3GSRA 3K2UH 4Y5XB 3EYFB 3QDMA 4GBXB 1CGSL 2CKBB 2OR9H 4MYWB 5C6TL 3HRZA 1PQZB 3OJ2C 4UINH 1QNZL 4FXKB 4P2RA 3TBYA 5TF0A 1J10A 3G6JA 1F4HA 2EH8L 5DJYA 3WO4B 3SBWA 3KXFE 4OCSL 3BESR 3L1OL 4DTGH 3Q5TA 5MEPB 5DEFA 5KTEH 3BZEA 4OFVA 5C09B 3KHQA 1GYAA 2IG2H 3Q6FA 3ZL4L 3MRMA 1HKLL 1JK8B 1J1PH 1OGTA 3EYOB 1G9EA 4ZQKA 1T0NB 1UT9A 3HMWL 3EO9L 3QCUL 3VRLF 3FN3A 3GMLB 1Q94A 2FGWH 4J3VA 4GOSA 1TPXB 2EICA 2AQ3A 4MD4B 4BQCA 3IFLH 4R6UA 1I7UB 5INDB 2B0SL 2VOTA 4OF0A 3VGDA 1Z9LA 5BW7A 2DM2A 2FJFB 3WUWG 2X1WL 3GSNL 2CLZA 1SY6A 4ODSL 1KENH 2ICEA 1KJ3H 2X4OB 1E4XL 3S3PA 1CFQA 2DLHA 5D7SL 1PSKL 1UZ8B 1WWBX 4RMRA 3BH8A 4DEPB 3VFMB 2Z31B 5I6XB 1FO0H 1VADB 4BFIA 1J5OH 4G80B 5B4MD 5E99L 4U1GC 2O5ZL 1EIBA 4X6CB 3RPIA 4JB9L 4WEMB 4RNRA 4PRIB 3A6OA 3EDDA 4NCC2 4P57A 3PF2A 4KJWD 1LO5A 2LABA 2EC9U 4KTDL 4PD4J 4WFFE 2GTWB 4JO2H 3TH3T 3CMOH 3EW3B 5BW7C 1HDMB 2FATL 3SDYL 5EU7E 5ELIA 4M7KL 5IB5B 4Y4FD 3D85A 4LVHB 3S5LG 1ZT7B 5DJ0B 2IPTH 3ULUH 4GKZB 2F5BH 1X3DA 3EDJA 1E27B 4BELD 5D96B 1SJEA 1V05A 1AGCB 3P77A 1QSEE 3RDTB 3MLPA 2BXZA 4YK4C 1NKRA 2R0KH 2W9LA 1HH6B 1J11A 4NKDB 2GFBB 4UTAH 4ZS6D 4YXKL 2ZG1A 1KXQE 3HAEA 5F88A 1T2QL 3WMSA 3SKMB 4PP1D 1CD0A 4PJIF 4PP2A 3L3HA 4DQOL 3WD5H 4LCUB 1U8PB 3QNZA 2XY2A 3WKNA 4P5TC 3C2SA 2R0KL 2NYYD 4KDWA 3LV3A 4JPWL 5F1SA 3RGVC 3OKLB 4P2OD 4PJBE 1T66C 4ZUUB 2ZCKH 3D39A 3T0EE 1X6NA 4WHYH 1AXSA 1I85A 5BXFB 5CILL 5J11B 5DJ2B 1AXSB 1JTPA 3MLWH 4NNPL 1RUKL 1X5HA 4FZEL 4KI5E 3HE6C 3LRGA 3L3DB 1FJ1B 4E5XA 1A1MB 4DKEL 1ITCA 3BT2H 4JQIH 3QG6A 1JNLL 2H3NA 2HJLA 4WUUA 2IH3B 1BFOB 3CNKA 1OCWL 4ODVL 2DF3A 3LKQA 1SMOA 3QDMD 5EZLA 4PJ7E 3UPRB 5JUEH 1NCWL 4LVOC 5F7EL 5L0QB 1KG0A 5HHVL 4FQJH 3NABH 3D3VE 2HMID 5B38A 1MVUA 4FQ1L 4O5LL 1A7PH 3EOAA 3VD4A 5HPOA 1CXFA 4YDJB 4MMZC 2PYFA 5HYJE 1J5OL 3SOBL 1WAAA 1UACH 3ALPA 4OLUL 2D7MA 2PR4L 3V5DB 1Z9SA 2FNBA 4JY5H 1XF1A 1AGFA 4XZUA 3QPQD 4NRYA 4M5ZL 4Y2DC 1P53A 2CLRA 4HJGB 4QRRD 5HI5D 5IQ7L 1XR9B 3KYMB 4KTEH 4IDJH 4IRSB 3WNLA 3C5JB 4KI5D 1N2RB 4EVNB 4CW1B 4GAGH 3R0NA 1D6VL 3MGOB 2A6KA 5FV2A 1E6OL 1S9XB 4CVXB 2F15A 3ILQD 5DD5H 2A83A 3QNXA 1CLZH 3ARED 1HHKB 5F7DA 2ESVE 4Z76B 3V6OC 1XIWD 2IBBA 4KC3B 3RIFF 2Z31A 5CZXD 3CDGB 1OGAA 3K80A 2APBA 4OCSH 3QYCA 4IRSC 3TT3H 1T83C 5EBLA 3TBVB 3BEWB 5LG1A 4MJ5B 4TTDD 2ICCA 4KK6C 3MSPA 4EEEA 5JMRA 1TDQA 3UZEA 1JFQL 4KAQL 4S1QH 3FZUD 4NPYB 1RUQL 4X6EA 2DBLH 1CGSH 5C6TH 2PO6C 5GRXG 3QUMH 3EJZC 3EHBD 1UG9A 2PKDA 3SJVB 2HJFA 5ICXB 4JFHD 1UH4A 4ZFOB 5ESAA 2NXYB 4L3EB 4MJ2A 3ZE2E 1G7MB 5JOFB 3CSPA 1CFVH 3MA9L 1A2YA 2XPGA 2UV3A 4LU5L 3IDIB 4LLUB 3RVTC 1A6TA 1D7FA 1KB5H 4JG1H 3IFLL 4JFPB 4GRLC 1DQDH 1Q1JL 2VC2L 5E08H 5EZIL 5FM4A 3QCUH 2CMRH 3O45A 1KB5A 3C08L 3MMEB 3NVQA 3OR7B 3GBNL 1A6UL 3SE3A 4GAFB 1HKLH 4H1LH 4NNYA 1EBAA 3FQXA 2PETA 3MROA 2IG2L 1A9BA 3OAYK 3L7FA 1JHTA 1K6QL 3P30L 3WLBB 5B3JE 4S11A 5EC2A 4ETQB 4JDZA 4PY7B 3L1OH 3BZ4B 4KGLA 4LLQA 3WHXB 2PO6A 5HYJA 1QSZA 4PJ9B 3DGGB 2OP4H 3UJTH 5CZVH 4XH2B 3MV9D 5C0NC 1A6PA 3U30C 1PJ9A 1X44A 2OJZL 4CUCA 1QNZH 2GTWA 1I8KA 1YMME 5CEXB 1CBVH 4Y8DC 1MHCA 4BSVB 3BP5B 1NDMA 2ATKB 4YHNA 3DX9A 5DFVD 3RWDB 5SWZB 2PO6B 3BRDA 1MFEL 1FZJA 3JTSA 4GBXD 2PN5A 4MQ7A 2Q7YA 1ZGLA 4OLZL 4HGWA 4U6YA 4WUUE 3KS0J 3BWAB 2HFEA 4OTXH 4NC2B 1FN4B 3FO0H 3MV7B 1S7RA 4KRNA 4OQTA 1F00I 2XA3A 4MJ6A 3FN9A 4JQXC 4K2UL 5DS8B 4QXTB 3BH9A 3QSKB 4KKAD 4YX2L 5CHNA 5F7UA 4G6KH 4PR5B 5D5ME 3DXAB 2NY2B 1MI5D 4XNMA 2FJHA 4UMGA 3TJHC 3O3DA 4D2NA 1GC1H 4P5MA 3IDIA 1QFWI 1ZT4B 2X1PA 2YBRB 3HE6D 1JWUA 1ZVHA 1UVQA 3UZVB 5D5MF 1BQLH 4MD4A 3GI9H 2OP4L 4WW1B 5IFAL 5AZ2L 4XTRD 2VR5A 2F8VA 4OKVA 3GO1L 2XA8H 2C7UB 1N3NA 4XHJD 1T5WA 4QRRA 5FYLL 3UJIL 3VRJB 5AUMB 3CX2A 4MNHB 5I71C 5CJQL 3CAFA 4FMKA 5C92A 2EEBA 5GJTL 2VRAA 3S4SB 1XGRA 4W4OA 2OZ4H 4IOFC 3T0BA 3O2VH 4ZFZA 2OSLB 3HZVA 3MRBB 4HUVA 4I0CC 5F7DB 3KLAB 3K0WA 2B4CL 3NCFB 1R3HB 2XZZA 3FQNB 3IDGB 3IFNH 1C5CH 3B9DA 3J8F7 5AYUH 5IR1A 4YIQB 4LMQI 4NQEA 5DJ8A 1QBLL 1HYSD 4OLWL 3QCVH 1S78D 5CINH 5FIEA 5E1AA 1I9IH 5C0AA 4IM8A 1CE6B 4WFED 3RZCD 1RUQH 4W6YB 4UIKH 2ZUWA 5DLML 1DANU 2P49B 2YKLH 5K33A 4HCRA 1UJ3A 3T0EC 1ETZA 3GSOA 1NL0H 5C09E 1CDYA 3F6LA 3P0VL 2Q3ZA 5FOBB 2DM7A 1D5MB 1HN1A 3F8UB 1JN6A 3MV9A 5T1DH 5T1KD 4PJFF 3FFCE 5D72H 1MCSA 2AQ1A 1U95A 2XFXA 5DF0A 5JO5B 1F6FB 5IK3A 5C2UB 1E6OH 3R06A 4KK6D 2UVFA 3GJFK 5I76B 2ZSWB 1DQML 3JUYA 1OB1A 1Z2KA 5C0JA 3DROA 4K3GA 1DLFL 2A73A 2ED9A 4Z7VA 2FHBA 3PWPD 3BQUA 4IDJL 2RCSL 3SKOA 4TULH 1JWMB 3S35X 3OKDB 4Q6YA 4S1DC 2DLFL 4YEFA 3TH2T 2VXSH 3IFPB 2HFGL 3M17B 1T66D 3GBML 3TJHD 4RNRB 1MI5B 3IS0X 4X6CA 4QXUH 1MI5A 2YD4A 2FZ3B 3NH7L 1VADA 4O2EA 3IAGC 8FABA 3KYOA 4K9EL 1ZLWK 4ZTOH 1CFQB 5IV2A 2MSPA 3V0VB 3EYSH 3E6FA 1C1EH 1QPPA 4OQTH 2YD5A 5FGCB 5ISZA 3WFCH 1FCGA 3ARTA 2D0GA 1NCWH 2UVEA 2HTLD 4OFPA 4F33B 5TDOA 1OGAE 1S9KC 2BY0A 2AQ2A 4QHKJ 3ELAT 3HZMA 1H5BA 4R8WH 4XHQA 2VZUA 5GGQH 3DVGA 3PIQA 4Y5VC 2Q8AH 2AK4D 1CFNB 3MV9B 3FOMA 3MNVB 1UZ6E 2ZCHH 3N1GC 4NQVB 1V3MA 4U31A 2H6PB 5GRZA 4NQVA 5H37H 1SJHA 3RZCA 5TPWH 1AJ7L 2VERN 1TXKA 2N56A 5GIRA 2K9UA 2ARJQ 3FN0H 2ED7A 1X5AA 5HHMD 2EDWA 5ADOL 4NRZA 4JO3L 3GMNB 1P5UA 5BV7H 1CF8H 2VLKE 3D39D 1L4IA 3RY5A 3FMGH 1BOGA 5I18H 1R5VA 4H25B 4JEGB 5T3ZH 4X4XB 1U8QA 3QPXL 4MX7B 4M48L 3UTSD 3QUKB 3STLA 3EDFA 4NM8L 1B4JL 1R0AH 3VFMA 4UU9A 1LE5B 1DSFH 1XIWC 4GH7B 3T3ME 2H3NB 1UENA 3ZT5A 3MV7E 1I75A 1AD0A 1R3KA 2ITCB 4PIRF 4LCWB 5IWLA 1JL8A 4ERSL 5C0CA 4FQXA 4PJIB 3FONB 3T8XA 4HIXH 2ICEB 2E6JA 4TTDC 5I1HL 4G9DA 3QAZC 1YEIH 1A6VH 4RFNB 2VABA 1L6ZA 5TE6H 3TZVB 2I9LB 1E4KA 2MHAB 5JOEA 2IQAB 5IFHH 2VL4A 5T3XD 2JB5L 4JRXE 3P2TA 2W92A 4M3KB 4LSRH 1JPTH 4J4PD 4PYHA 5IMKB 3UTPD 1B2WH 3JWDC 3NIGF 3MREA 1IT9H 4HKBB 2UYLB 4JHWL 3UYOD 2D4FA 5H2BA 3RA7H 4U1MA 3VXPB 1KGCE 1U58B 2AGJL 1UQSB 4YGAB 2VTFA 2NY1B 1CZ8H 3B9KB 4RMTA 4Q7DA 1RJYA 4MJID 4NWTH 4P3CH 2KL6A 5EOQL 1ZLUH 2AK4A 2VLLA 3GSNH 1KFAL 5D1QB 4V1DA 4X6CF 1B0GB 5B39A 2AJUL 3BQUD 4NQEB 1ORSB 1T1XA 4HIEA 1BVLA 1ZE3C 3Q6GL 5GHWH 5DK2B 1M7DA 2ZUSA 4IIQA 4OGAC 3MLUH 3OG6B 2VDNH 3VXSD 1F6AA 1EX0A 1Z3GL 4X98A 1BD2E 2NY1D 4POZC 2X42A 5F89B 4AENB 3AS2A 3WIHL 4HSQA 2YD6A 3V0VA 5D8JH 4AEHL 5JQ6H 3TBTB 2DQTH 2AEIT 3HE7A 4POUB 1OTTC 4XGZB 3R8BB 3EO0B 4WU7A 2OR9L 1UZ8A 4G6MH 5I73B 3LQAH 4QRQB 1E28B 2P48B 3BDBA 2A74B 4L8DB 3KWWB 3DVFA 1LILA 5HYQB 4I2XA 3MUHL 4LHUB 4P5KB 5K9OB 1WFOA 4MZ3A 1DBAL 5L2KD 1CGVA 3BD3A 1PKQE 1CI5A 3GSWB 3SDXB 4UOJA 4Z7QE 2VLJA 5IJVA 4JANA 3MLRL 3O6KH 3C5ZB 5CJBA 4M1GH 4JRYA 2CRYA 4N5EC 1HH9B 3UTTE 1L0QA 3S88L 2G2RA 3V6FB 4OCXH 5I75C 4LHUA 4QRQA 4W4NA 5HXMA 4QXTA 3WXWH 4JFYA 4EDWL 2LE9A 3VFPA 5IW6B 4HFUH 4XNUH 5IVZA 5F97E 5F93C 5JW3H 4XAWH 3HE7C 3TN0B 1TTGA 3WBDA 3MR9A 1BIIB 1FDLL 1Q9LA 5ERWA 3CDGA 4G8GB 1ZT1A 3DIFB 2BNQE 5DGQA 4JM4L 4ZAKD 1A1OB 2O61A 1NDMB 4LHQB 4RAUB 2HJKA 2FR4B 4IIQB 1PEZA 1DQQB 1MWAH 2ERJB 4HIIA 1P7HL 4GBXA 4CVXA 4J1UB 1U41A 2BVEA 4JPVL 5AG9A 4NC0B 2PXYA 1JF5A 1BLNA 2ATKA 3RWDA 2ZCLL 1CICD 4OIIH 1H9VA 1HXYB 2A77H 5FK9A 1JRHL 2VAAB 3V5KA 2VUOA 5ADPL 4FFWD 2EC8A 4U1IB 4HBQA 3VWJC 1OTUD 1ZMYA 5C86A 1U93B 2YEZA 4RGNB 1MRFL 4TSBL 3SE9H 1TVHB 3QXDB 4CN6A 4X99A 2P46B 1X5LA 2VKXA 1T1ZA 1KN2L 3OR7A 2SEBB 1IAKA 5AZEL 3A6BH 4JFOB 2QV2A 3MJ9L 4L3EA 1OY3B 5HGBA 4QHMB 2PTVA 1Q9KB 3ARPA 1VA9A 5D7KD 4KJPC 4WW1A 2PXYC 4TPRH 3RTQC 4LLUA 4UIMB 4MJIE 3GM8A 2EDXA 1F90H 3GFUA 5KANG 5ADOH 5IJVB 2EYTA 1U8HA 5JNYA 4L4TE 4PJXF 2AABL 1KGCD 1IKNA 1RZ8B 2WWMC 3UJJL 1SJXA 2C3WA 4Y5YA 2BNQB 4L8SA 5EZOL 3I6LE 4MA7L 4RQQA 1KELH 3HE7B 4YHKH 1ZVSB 4NQED 4JRXD 1AKJA 1UM5L 4DFIA 5DEZA 2Y07H 1C5DB 4UOW0 4M61B 5KSAD 3IVKA 2NW3B 2NXZD 4N0FB 1U3HA 1JV5B 1U8OA 4M9OA 1L7IL 1MHCB 3LN5B 5E8PA 3AVEA 3U36B 1PG7X 3P73A 5C0GB 3VFOB 2F54D 1WAAF 4QRTB 5KANI 3C8KB 5DRWB 3KJ4C 3DUUB 3TBSB 1UM4L 1YYLH 5DJCA 4Q9RL 2DIAA 2X10A 5B21A 4I8DA 3SCMC 5JIKA 4MNGE 3NH7H 4P2OA 3QQ4B 4XCNB 2Z8WC 3VFGL 3ULVD 4WGVB 1QFOA 3S35L 1BF8A 1IEBB 1OT1A 3BOVA 5DZLA 4PGEA 2VLKA 1LQSR 4EN3D 2X4NA 5IB2A 3HZYB 3T4AB 4CU6A 1U3YA 4LCYB 3I84A 3SGJC 4PGDB 5HHNA 3MLYH 3V0WL 4WWKA 4QEGA 4ELMA 4ODHH 4L3CB 1F4WH 3NFSH 2DM3A 2H2SC 3HAEG 1KJ2B 5GS3A 3H9SA 3CJJA 4GW4A 5TQ0L 3L3DA 3NCCB 1CTNA 3AREC 1DBJH 5TFSH 8FABB 2J7LA 2Q1EA 1SM3L 3ARXA 4WVRA 4Y8AA 1JF6A 3OXSB 5A2FA 3OZ9L 5I8OL 4O2FA 3HFMH 1FNSH 4JO4H 2F8OA 3M17A 1XMWA 4OZFG 2YKLL 1OGAD 3O6LH 4PLOB 2FJFA 2P7TA 3T2NH 1I9IL 3S96A 1OWWA 4JFFA 4M43H 1NCAH 1SYVA 1RZKL 3FQRA 3KPOA 4UT7L 5CP3A 2MMXA 5IFJB 4E41D 1HSAB 5A3ID 2GJJA 4LEXL 1PKQA 1UWXK 4QHMA 4PJFA 2FIKB 2VE6B 3ZTJH 1GZPA 1U91B 1NGWB 2XT1B 5JHDB 1ADQH 3TYGL 4I0PC 5C09A 1ZTXL 5FKPA 3S97C 4Z77B 5JR1H 3RKPA 2FJGA 1IRAY 4RWHA 3K2MC 4V1DE 1YEJL 3P77B 2R0WL 1FL3A 3VXOA 3GO1H 4ZUSB 5SWQA 4OD1H 4NN7C 5I75B 4AQOA 1GZPB 1LD9B 3QXAA 3STBA 5K59E 2QBWA 3LEXA 3V5HA 5KG9A 5EH1A 1BQLL 4NC1E 3PG2A 3EGSB 3T0AA 4NJAL 4YDIL 4HBCH 2AV7A 4XVTH 4XXCA 4FZ8L 3V8OA 3EOYG 3PWJA 4L4VB 5HGHA 5GZOD 4OF7A 4RGMC 1JNNL 4ELKA 1TLKA 4G6KL 3FONA 3T0WA 4YH6A 5FO8B 2D4DA 1D5BA 4HWNA 1XR8B 3BDYL 4O00A 5HI5C 4Z95H 1ZGLM 4QGTA 3TT1L 5IVOA 4RAHA 4ELMF 2FLRT 5CSBA 2XQYK 2GK0A 1Q38A 4QHLA 3VXNA 1VSCA 1QR4A 2DM4A 2D7TL 2FWOB 5K9KB 1IKFL 2AK1H 3ZDYE 3REVA 3STZA 1LP9E 5JW4N 4YFEA 3EYOA 4KPHH 3OJDB 4PJ9D 1FZKB 4NRXB 1A4KA 3ROLA 2ARWA 3UJTL 4NZTL 5DEFB 3MRQB 4M7LT 1EXUA 1P4BL 3V79C 1K6QH 1ZA3B 2DQEH 3BP7B 2DI9A 3MNZB 4WO4B 4OCWL 5C0EB 5EUOB 3CLFH 2HA1A 1Y6MR 5I8KL 1FL3B 3VXOB 3RUGE 4RISH 3I50L 3X3GL 3GK8H 1PX4A 1YPZB 1MY5A 4ZYKA 1WAAE 2X6MA 4X7SL 3O2DA 4HJJL 4F3FA 1CXLA 3LQAC 1NC2B 4TQEH 1QSFE 3Q5YA 3QJFA 3INUH 3V2AR 1IGML 5IROA 3BZDA 4HLZH 2XRAH 1EEZB 1JI1A 3DVNA 3FAXA 4TRPL 3L3IA 3ARYA 2F74B 4ELME 2YPLE 3RKDD 1XCQB 4KJYB 3QUML 2VLRA 5EO9B 5C9JA 4NQXB 3C60C 1FZOA 2HRPL 5HGAB 5IHUL 1R24A 4U49A 5BRZE 4ORZC 3GHBL 4PJXA 5C2BH 2PYEE 4PB0L 4U6XA 1JF1A 4DW2L 2BJMH 5IGXH 1FAKT 3LKSA 1LK2A 4MXWL 3TT3L 1NCTA 4GG8A 3I3DA 4QF1A 2VDLH 3NCJL 1HILB 1OLZA 3T0EB 3U83A 4IHOB 4DZ8A 5C07E 1PX3A 3NIGE 1G1CA 1UYWH 1KV3A 4XC3L 4R4FL 3TA3B 4GAGL 1SEBB 1S7VA 1PKOA 4NZUH 4LNRA 5DA0B 4PRNB 1P4LA 1ZHBA 1LEKA 2V5TA 4ZQKB 1MHEB 1OLLA 5TQ2H 5IQ7H 4Y5VA 5DQDH 2J88L 2IAMD 3OKKB 4YFLI 3C6SA 3JWNC 1J0HA 2E7CA 1QSEB 3TBVA 3S37H 3THMH 5HD8C 4I3SH 5DRXA 4F58L 5I1AB 4S0SD 1KYOJ 3LVEA 4JPIA 5GSRA 5L2KB 5T33H 4Q6IA 4BFGA 3LKRB 2D0HA 2VAAA 3V5KB 3UC0H 1RQ5A 1KJ2H 4APQC 5CAYB 4F37F 1A6ZB 2PXYB 2IANA 1HQRB 5F7EH 3C2AH 4WW2C 4KZEL 3MLXH 4JZNA 4FTVD 3QDGD 4DKFL 1BM3H 4OCNC 3OWEA 2LU3A 4Y4KD 1OL0A 4XP1L 2NY0B 3HG1A 2D03H 4U1LA 3VG9C 1ZS8B 5D7LD 5D5MA 1H0DB 3IFOB 1Y6KR 4XH2A 1V8HA 3GB7B 1RZ7H 1AKJB 1H3XA 1IGFH 3HUJB 5BV7C 4GRWF 5EU6B 4XVUC 2OM5A 3ARWA 1VPOL 1BZ9B 4Z7QF 3CVHB 1QFWM 5D7IA 3LB6C 5KVDH 4LLWA 2JIXB 3WFZA 3PNWB 5H94A 3EZJB 3O3AA 4BKLA 4YFLF 1E4KC 2QLVB 1U8HB 4XNZB 2HFFA 1BBDH 1JCKA 3WL9B 2YPLB 1CXHA 4U1HB 1P9MA 4MVBD 4YXKH 4U1KB 3U82B 3EOTH 3HC4L 3QUYD 1JE6A 3V6ZA 1KCKA 4HHAB 1IGIH 5DUBB 4U7KA 2IADB 2ZNWA 4WV1C 3DMMC 2AXFA 4ZFFB 1EVTC 3TN0C 1GL4B 3PHQB 1ZHKB 5HHQA 4JFFB 5F9WC 4PJ9C 4DN3L 1U9KA 2BNQA 1QLRB 1JWSA 2FECI 1WLHA 3MXVH 3U9UA 4P4KC 4OZHB 5FEBA 4BZYA 1NEZG 4U1JA 5DK3A 1U2HA 3TO4C 5JXED 4YUEH 5DQ9B 1YQVH 1YZZA 1PLGL 2KBGA 3V7AG 1KCUL 3FQTB 4HS8L 3GRWA 2EE6A 4P3DB 2NYYC 3K81A 1UEMA 2WBJD 4XPHL 1HXYA 2X4TB 1FYTB 1MLCA 1RJCA 3EHBC 3IJYA 3L6FA 3R06B 5FYJD 3TF7C 1QPXA 3R1GH 5IUSA 5I1GH 1F13A 2JCCF 2VLMD 4JVWA 1MCDA 1FO0L 4S2SA 1TZHA 3GMOB 4OD2A 1JZ6A 4HIHB 5KAQG 3LEVL 1BECA 5E94B 4HWBA 4YDLB 4QXGL 3VA6A 1QEWA 4YWGL 1FL5B 2QADB 5D7LA 3SDDD 2YUXA 4GKSB 3BN9C 4Z78A 5IIEB 1KENL 1XGTB 1B9ZA 2ZUVA 4M4RA 4KH2A 4OAWB 3V5DA 4ODXB 5ANMB 3QA3B 4X4YB 3FB7A 2EIBA 3TVMD 3NAAH 1ZWIA 4Z0BL 4IS6B 4ZUVB 1GOGA 1I9RH 1OARH 3G6AB 4ZFZB 1F97A 4DTGL 1YYMH 3OJVC 5C6WH 3N06B 5MEQB 1AHWB 1UEYA 4JKPL 1DEEB 2WINA 4O2FB 5IV2B 5IVZB 5DUPH 3OKYA 3G6AA 2EYSB 2Z0BA 2X09A 2YMXH 3O2WH 2XWJB 4HWBL 1T0PB 3OR6B 2Y5TA 1HQ4B 4M4PA 3CFKB 4M7ZC 1A6AA 1KLUB 4D94A 1J0JA 1NGZA 4ESKA 1BOYA 1QKZL 2NW2A 4P2YA 4GS7B 3IRPX 2DYPA 1RK1A 1OM3L 2X89A 5LVEA 5L8LB 1JMZA 3HI5H 5JO5A 2NY7H 4NT6A 4JG0L 5DRNA 2XTJE 3Q3GB 1MCLA 5FFLA 3RDTD 4YBQD 1FE8H 3OAUL 5JXEA 3HLAB 5DWUL 1YJDC 3CCHA 2H41A 4M00A 1T1WA 1AD9A 1AY1H 2P43B 4PRPB 1VCAA 2W60A 3C6LA 2HKHL 4GLRI 3AU1A 2HP4A 4JN1H 3BD4A 3QI9B 3B2UC 4P3DA 5D2LF 1NEUA 4JFZH 1LO5B 5DR5H 1MQKL 3KXFD 1KEML 3MXWL 3CH8A 3ARUA 5DD1L 3BRGC 4NBZB 2MHAA 5F6HJ 4M1CC 4XPFH 4LLYA 5GSVB 4NWUL 2EDFA 5SX4I 4NBYB 2Z4QA 4G9DB 2VDMH 4M6AA 2OI9B 4E42A 3D0VB 5D96C 3LV3B 4MAYD 4M93C 4H1LA 1F3JB 1NGPL 4JFPA 3VDBA 4KMTH 1ZLSH 3HN3A 2NMSA 3TBWA 4UNVA 1T80A 5D70H 3U0TA 3O4LA 1N59A 1JYXA 4P4RA 2A6DB 3X14A 3NFPB 5DFVC 1UA6L 4URTB 1MLBB 4K94L 4P99A 2GFBA 2W9DH 4OZGF 5LWYL 3NGBB 4JFOA 5F9OH 4WO4D 4NHCH 3OAYH 4NN6B 5D7LE 4QTIL 5EO0B 3HMXL 5TF1L 2CJUL 5FYKL 4A6YH 3S6CA 2P1YA 2F58L 1GXEA 4F37K 1KF9B 3C9NA 4B53A 2CRMA 5ILTL 3HZYA 1SJEB 3Q6FB 4UV4H 2DQHH 4JFED 4P2OC 2QSVA 3H7BB 4DGVL 3KWWA 5I6XC 5D2LB 1BWMA 2FLBT 4JCMA 3TVMA 4PV8A 4XCCH 4S1SL 5KSAA 3F5WA 3O9WB 4WHCA 3QIUA 1J0IA 4OI8A 4HGWB 4K71B 4MX7A 3S8WA 1LDPH 5D5MB 2FX7H 4KWUA 4LVOB 4NUJB 4H20H 2XN9D 3QH3B 3GSRB 5BS0E 4HUNB 1I8MA 1H5BC 4PRBA 4RIRA 3VGHA 2VR9A 3KLAA 3RPIB 3ULUC 4OUUA 3HS0A 5TDOB 5DUML 4JZNB 5KSAB 1E4WH 4P3WA 3IYLW 4Y89A 1YEDA 1MJ8L 1ONQB 5SWZD 4TN9A 3OTTA 4FRWA 2N1KA 2CD0A 2ZUXA 1WT5C 5SWZE 4LSPH 3F65A 1ZHNB 4XP9H 4EI5C 2F54A 4O4YH 1M71A 4IMLA 1KTLA 3PV6B 1IAIL 2EECA 1F5WA 2DTMH 3FB6A 4Y4FB 2XN9E 1XGUB 4GQPH 3RI5K 3T4YB 3PWPB 3EOAB 1KPRA 3IGAA 2BMKA 2XXMB 2WV3A 3RJDA 4YJZL 5AWNL 1MLBA 3TA3D 4OZHF 4F7PA 5T1LB 1PD6A 1T3FA 4O51B 4HWZB 4M1DH 3U0TB 5F96H 4BSWA 4LPCA 3V95A 1NCUA 4YDKL 1QLEH 4PJEB 1R3JB 4MVBC 3OKNA 1YN6A 3RU8L 2N4IA 4KRLB 2BMKB 3MRFB 4PJ7F 4ZUTA 5F3HB 3QCTH 4CN4A 1J05A 2V5RA 3VRIB 1MH5B 1QRKA 3ARGD 3GRWL 1OAKH 3GMPB 3HG1E 4IRJD 1I1YB 1BAFL 1XF3A 2CR3A 1FBIL 1KTDA 3ZYIA 3BEWA 1AQDA 3OKEB 1A5FL 3P4NA 4PJCF 4N5ED 2R0LH 5D2NB 4YHNB 3LN4A 2F19H 3DPBA 1U93A 4IDLA 1UM6H 3MBEC 4XWOC 1N7ML 2QQNL 4Q9CA 2YD1A 1P7QA 5CEZD 3WUZA 2EIDA 1LE5A 2FL5A 4XBEL 4KKNA 5EA0H 5J12C 3K7UA 3SE8H 2FBJL 4YE4L 1JZ7A 1XCQA 4LOUD 1H3TA 5EO9A 5TH2B 1Q9OA 1U8KA 4AQ1B 3X11B 4NQSA 3QH3A 1IC4H 4PY7A 5DC9B 4KVCL 1W0VB 2ICWA 1ZLVK 3L7FB 3AC0A 4RMVA 1AGCA 2K7PA 4JM2C 4HS3B 2GY7B 1WIOA 3PDOB 1IQWH 3L5XH 1U58A 5GS0C 1IC1A 2AVGA 2FBOJ 3H7BA 4RMWA 3TWCH 1FHGA 5C0IA 3MREB 2H6PA 4WU5A 1LHZA 5ISZE 4F7MA 1WIUA 1IILE 4PBWD 3REVB 4NKOA 2Y23A 4PJEE 2RIKA 1ZK9A 4AL8H 2XTJD 4LSSL 3TNMA 5EBWA 1EMTL 1MFNA 3KLHC 4XMKL 1OPGH 3PL6C 1BJ1H 2XKSA 4K8RD 2EDKA 3QQ3A 4YZFE 4ACPA 4K7PY 4N8CH 3CK0L 2IEPA 4R4BA 3AM8A 1Q0YH 2D3VA 1G9MH 3BKJH 4FABL 5SV4A 1FRGL 4WU7B 5DK0A 2AJXL 3QUXA 1EEUA 4C56B 1G6VK 2IPKB 4Z76A 3LEYH 2I07B 3UEZA 1GSMA 5T3ZD 4EIZC 1I7UA 3MV8D 2X9WA 3EOBB 1G7HA 3LS4H 5TDNB 3GSQB 2KUTA 5I1EH 5SWZA 4FQHA 4XPTL 1DVFB 1K8DA 1GHFH 1BF2A 5HHOE 3SE4C 2NX5D 4XMLH 1A7RH 2HT4D 4ZPVA 3KPSA 3L95B 3VWKC 1ACYL 3BP6B 1LO0L 1JJUA 4OV6F 1C5BH 4JZOB 2CH8A 4JPKH 3WXVL 3DRTA 4S1RL 4GQ9H 1X5KA 3BXNA 3VRLE 4TNWK 2XFXB 4X4YA 4N90E 3PWLB 4OZFA 4U6HA 3V4VL 5AEAA 3WFBH 4XHJC 2CRIA 1F4YH 4JZJB 1QBMH 1DDHA 5SWSB 4NQTA 2YPVL 3HRPA 4YHMH 1VFUA 1RK0B 3H9SE 2XYCA 3UAJC 4EI5D 4D0BB 1ZA6A 5KAQF 2DYPB 4H88L 2O5YH 1NC2D 4GRWE 3MLTB 4NQCE 4CAGA 2XZAH 1UGNA 2BSSB 4UUJB 5DQ9A 1ZOXA 5E9DE 3BO8A 3FB8B 1DBBH 4KDTA 12E8H 3EFFB 1MNUH 2X40A 3P9LA 3DRQB 4ONFH 3VFWA 2V2TB 3RBSA 1ZGLP 3VXUE 1INDH 1X9QA 4FA8A 3BGMB 2NZIA 1Z9MA 2K3TA 2OSLA 3HZVB 2P5EA 4MNGA 4OLXH 4BUGA 4PJIA 3T8XB 4WY7L 1IL1B 5EU5B 5I8CA 2BOBB 3DGCR 1R3LA 1OF2A 5IMLB 3EFFA 2R1YA 3H9SB 4GW4B 3DO3A 1ZLVH 3JV6B 4PTUA 1RIVL 1MFDL 5TE7L 3REWB 3OGCA 2VH5L 1F8TL 1HIML 4PRPD 3N9GH 4HWZA 2DYPD 1WVZA 2Q8BL 1QLFB 1M6OB 3VCLA 5KVEL 4OLYH 1JZ2A 3KJ4B 4ZD3L 3HAEB 5F88B 1TCRB 3ARFD 2ADJA 3CZFA 1J8HA 2Y9RT 4MNQE 2B7DT 3VD9A 1ZWIB 2X44D 4OZIE 1JGVH 4AT6A 1WCQA 2DDQH 4DKAA 1EAPA 1GZQA 1DZBA 7FABH 1IEBA 4LCYA 4L8CA 4P4KB 4LAJH 3IB4A 5IB2B 4OZFB 4I5BB 1EO8H 4OAWA 3X13B 1LEGA 3HUJA 2EDDA 1IJ9A 1RUMH 1KCVL 4NYLA 4PLKD 2X9YA 3QEHA 2C4FT 3SY0A 3FFDB 2FYYA 4J4PC 3DLQR 4X9GA 1MHPL 3IT8D 1TMCB 4YR6B 3HNVH 2A0LD 4TVSa 5FM5M 3LMJL 1I4FB 2Y25A 5C0GA 1XF5B 4YXHL 2VISA 3QUZB 3ESUF 4ZOCA 2ZUQB 4L4TD 5DHVH 4F33A 5KW9H 1SQ2N 1FFOA 3MLZH 4JHAL 4XPBL 4GXUM 5ESQB 1A3RL 2A38A 1A0QH 2CLRB 5E6ID 4D9LL 5CLWA 2BNRA 1YEFH 4HPYL 4J3SA 1KPVB 1BD2B 4FMFA 3DTXB 4PJDB 1FJ1A 1EGJH 5ID0A 3FHQA 1QHOA 5HI3C 4RBPH 4RA0C 2NXYD 3BPCA 4Z7OF 1A7QH 1NEZB 4Z5RA 1RULH 2Z93B 5EO0A 1AXTH 4PRDB 1UKQA 4MAYA 3O8XC 3VWJB 1FGNL 1E0OB 5CEZH 3CGTA 2EDOA 4WWKC 4JANB 4LSUL 1CK0H 5JLZA 3TIDA 3RVXD 2A6DA 4APQB 4BSWB 4FFZH 4N8PA 4PRAB 5T1LA 3SO5A 5JORA 4Q0XH 2E27L 2XKNA 1LO2H 2ZSWA 3UZQA 4KUZL 2Z31C 1JZ4A 2QHRL 4M8QB 4LPVA 1RZJH 2KQNA 3T4YA 3JXAA 4OGXL 4OT1H 5IKCA 3EBAA 4JQVA 4JQXA 3TYFB 2XZCL 1U8MB 3Q48A 4Z0XA 1EHLL 3TJEH 4DGYL 3G08A 4PREB 4DZBB 1MRDL 3GI8H 4HT1L 1ODAA 5EBLB 5C07B 2MJWA 1JF1B 5EOCJ 1FNEA 4IOSD 1NMAL 2OJEA 1TPXC 4P9MH 4DVRL 3DUSB 4I4WA 3AGVA 1M4KA 5TGBA 1WFUA 1NLDL 3DETD 4GMTL 3QEQD 3MBXL 1FZOB 2XQBL 2BERA 4OUUB 3DHMA 2Y36L 3HCVB 1IVLA 5GGTH 2WWMD 4OCYL 1T7WA 3SGKA 3MRPA 4J8RB 5A2JH 1I8MB 1RIHH 9CGTA 4HPOL 5LXGH 4M02A 4TUKL 2ATPB 1YY9D 5FF6B 3KPLA 1A9BB 1HI6A 3QRGL 5LAXA 1D5IH 1PG7L 2R0ZL 2LFGA 4NZDA 5L2KA 3MMEA 2ENSA 2X7LB 3S4SG 5HHXL 1U92B 4GAJL 2MFNA 4ZYKB 5BMFH 4TOYL 4XP4H 3D3VA 1VEMA 3EYUH 2NQCA 4LSQH 5IB5A 1BREA 3I9GL 25C8H 3N85H 2XN9B 5EUOA 5F1IA 4HZAA 5D1ZC 1KBGH 3CVHH 1UADC 1MIEH 1ZHBB 4XCEA 3VXRB 4NCC1 2FEDC 2B1AL 1DL7H 3IETA 1J1XL 2C26A 5CD5C 1P84K 3GMLA 4PJ8B 1BD2D 4FQIL 3SEPA 4PGBA 3SQOH 1NLBL 2MNUA 4G80A 5L6YL 4D9QE 4I48A 4LBEB 4QCIA 1UWEH 2FDBP 5C0IB 4XNMB 5EWIL 4L5FL 1VGEH 4UTBL 4U4BA 4AENA 2IANE 1AGBB 5BVJA 5C08B 2ADGB 2APXA 3JWOC 4QHLB 1T7YA 5GS0H 5KOMC 2P45B 4G6JH 4P59L 2PXYD 1AE6H 3H9HB 1OSPL 4IRJA 3C6LC 5D71L 3JWDH 3BPNC 2ATPA 1UKTA 2DQUH 1KXTB 3IAPA 3P4MA 2G5RA 3P0YL 4KY1L 3SKNA 2E7BA 3T0DA 1U8KB 3DMMD 4XNQA 1X5FA 1F3DJ 2JJSA 4GMSH 4EVNA 5CIPA 3MRMB 1NMCC 2PW2B 1QOKA 5F7HA 2C4FU 3KPRA 3MJ7B 1RZKC 1XGTA 4LMQE 3TZVC 4NP4L 4Z7UB 2IBZX 3OB0H 3W5NA 1NAMA 1U6AL 5E8OB 5KS9B 4O2CA 1V3LA 4LKCB 2JB6B 4WJ5A 1BFVL 5E8EA 3WKML 3TYFA 2R2HB 1QRNE 2PYFB 5DZNA 1DN0B 2EE3A 2RQ8A 2CLVA 2DQFA 5F3HA 4JDTH 3W39B 5F9DC 4N5UA 1KB5B 4K7PL 4NNXB 5HVWA 3VXPA 4BA8A 1A14L 1FYTA 1R3JA 1JZ5A 4JZOA 2GCYA 2WLYA 5F1NB 1KIPB 3IS1X 3TEUA 4CVZB 5EULV 1MAMH 1NC4B 3EJYD 4G7YL 3VI4E 4Z7OE 1A4JA 3EYVB 4J2XA 3SJVD 3U1SH 2WIIB 3PQYB 1NSNH 4HWUA 1A1MA 1CGTA 2NY5H 4X5WB 4K3EL 1FNGB 1G7LA 2EH7H 5J9PB 1XF3B 1QACA 1GGIL 3P11H 5IFJA 1KN4L 3AFLA 2XWJA 1RIUH 1TZGL 3TLRA 1CDJA 1T1YB 2G5BB 1WV7T 5DDHB 3FQWA 3NN8A 3TVMC 1KJMB 3FT3B 3VW3H 2XZQL 1Y0LA 5E8NA 2CK0H 2W65A 3O3EA 2AAVA 2I5YH 3GJFB 1S9WA 3ES6B 3I2CL 5KSBB 5HHPA 3OKOB 2UZIH 3ETBF 4RIRB 4AEIH 3QISA 5BVPL 4ALAL 2YOCA 3FT4A 3WHE1 3QO0B 4EIGB 4LQ1A 3CCHB 4MD0B 4PY8I 2R2HA 1R3IH 2VL5A 5DT1L 4OF5A 1B4RA 4M7LH 2GSIA 3GEWB 1YPZF 2IMNA 3IJHA 4F9LA 2H26A 2Z8VC 1AFVH 1HNFA 1WFNA 2MOVA 4IJ3C 2G60H 2H26B 4R4NC 3VFVB 1XFPA 1S9YB 3U7WL 3N1QC 3BDXA 5D1XC 1GIGH 5HDLA 4UV7H 5C0RH 2XTLA 1NFKA 1T5XA 4TVPH 1FVDA 4G6AD 3TO2B 1FSKB 1GZQB 4PRBB 3LIZL 3LH2L 1A64A 2AEQL 3W2DH 2VXTH 4MZ2A 4YXLH 2HN7A 3OMZA 3P73B 3EFDL 3MGAA 3HZMB 5T5FH 3ULVE 5J6GA 5LCVH 3EO1A 1LEIA 4OI9A 3RVUD 2PW1A 3FQRB 4WHTB 3VXTA 1GH7A 2JELL 4NC1C 4I1NB 1HEZB 1N64H 2VB5A 4P9HL 3SPVB 1XGPA 4Y4FC 4K94C 5EU5A 4F9LC 2VDOL 5B4MC 3L3GB 2J4WH 5FUCE 1OQOA 1N3NB 3KYKL 2AJYL 4MS8D 2OS7A 5LGHH 3BD5A 5DFTA 1MJ7H 1MHHB 5C0FB 3SGEI 3LDBC 1H8NA 2RHEA 5GRJH 3MRCA 3OB8A 4KK5D 1DBKH 3IETB 4R26H 2E7LC 4XX1E 1WZ1L 2HKFH 4Y19B 5I1LA 1NUFA 5DURB 3X12A 2HWZL 1T0NA 5BVPH 4U1KA 3IXTB 4KJPD 1P84J 2YPLA 4PGDA 3O3DB 4KROD 2E7MA 4X99B 5MERA 2OZ4A 2V7HA 3VD7A 1MCPH 3VW3L 4JFDE 1FYTE 4D0CB 3IDYC 2P8PA 5SX5K 3WSQH 4KQ4H 3MRLA 3VXRD 1LP9A 1VEPA 1PYWA 2DJ4A 1QA9B 5D7KE 5FUCC 4M6MH 4QY8A 5FGCE 4AMKH 1HINL 3MGTA 4D8PA 3T77A 3D85B 5FAAA 5SX5H 4WUKH 3MTRA 1KPUB 1MVFA 3V9FA 1FFOB 3U9PL 3RBGA 2H32A 1AQKH 4JO1H 2EYRA 1P7QB 2VISB 3L3OB 5HDQL 1I9EA 2HTLC 4YHOL 4HUVB 4LPTA 3CX5K 3MGTB 1JPSH 5GGRY 2FSEB 2ZOKB 2RBLA 2WP3O 5HD8D 2X41A 2YA0A 2R15A 5FB8B 1AH1A 5D1XD 2WBJB 4M93B 1RD6A 4UAOC 3F6IA 2VXUH 4Y0GA 1N5YL 3C8DA 5KSVB 2VXVL 1HOCA 4RWYL 2P5WA 4XMPL 2FO1A 4AEFA 2VDKL 1WTLA 4G3YL 1WC7A 4YHLH 5FUZH 5ACZA 3TIDB 1X7QB 3DJ9A 1U3JA 2VXQL 4LKXA 2IQ9H 4RDQG 3O3AB 3CSYA 5CSZA 4IIQC 4BM7A 4LKXB 4XBPB 4NKOB 4BQ6A 1XAUA 3G5YB 4RMQA 3VXNB 3IAQA 5I1DB 3QUYB 4D3CL 4FQXD 6FABL 1AKJD 4ONHA 1X5IA 2XIDA 4PBXA 4KV5E 4WGWB 4P5KA 4HJ0D 4G43A 1FQ9C 4G6JL 4YQXH 1DEEA 2BRRL 4E42B 2FCBA 1CQKA 4M8VA 3E2HC 3EO0A 3UX9B 4OZIF 2VIRA 1EK3A 1MFCH 3TBTA 4L4VA 2GIYA 3ZHLA 5HGHB 5LQBL 5L2KE 3E0GA 1C08A 4KKAC 1DBML 1ZANH 2KQMA 4M62L 5BZDB 3O4LE 1IGCL 2DQIL 5F72S 2YA2A 5T3XH 1DL7L 3WS3A 4OZGB 4UUJA 1XF4A 5GXBB 1T2JA 4QHKI 5IMMA 1SY6H 1D9KD 2YWYA 5IMOB 3UCRA 1J18A 1NFIA 3N85L 1AIFB 2DD8L 1KOAA 4FXLA 1INQA 4MB4A 4EBQH 1A3QA 2W38A 3VXSE 5GRWA 4JDZB 1KC5L 3O41B 4O58H 5IG7A 4XP4L 2WLZA 4TOYH 5D1QA 2QQLH 1DCLA 4G8IA 4JZJA 3E3QE 4WTXA 4NQDD 4P2QD 5F7YC 1JGUH 1WGOA 5DJ6B 4L9LC 3BIAX 4X7CC 3I02A 3GKWH 4HCRH 1D5IL 1G6RB 4HXAH 1U2CA 3WFDL 2YUZA 3MFFB 4EI6A 3GSUB 3G5YA 1ZSDB 1S9VA 3RWHB 3HPLA 5FKAB 4PJEA 4XT1C 4ZDHA 1HCFX 4YO0A 2ORBH 5TDPA 2V9TA 1CXKA 1MFBL 1A7NH 4FG6D 4WFGE 3PWUA 4MD5B 4DCQB 1RHFA 2BHZA 3PE9A 2NTSP 1L6XA 4KXZI 3KPPB 1A8JH 3EDKA 1RUAL 1GAFH 1W72H 4PYGA 5FV1L 3MBEB 3NIFE 3FRPG 4E0RB 5ESVA 3O3BA 4PGCA 4KHTL 4OM0H 3V52H 5I15H 4HQQL 3KPMA 4BZ2L 3SDAC 1S7SB 3AMLA 2QADC 4QOKD 3IDJB 2QSCL 4N0CD 2P42B 5C7XL 3HKFA 5GS1C 4KJYA 5C9JB 2DJUA 2R4RH 3WDIA 2WK2A 5KVGL 3EYVA 5JTWA 1T6WA 5HVFB 4PUBH 1MOEA 5DJZA 3FO9B 4R7DA 4DAGH 4HXBH 5B3JF 4RGOH 2C1OB 1AP2B 1G7PB 3WEXA 2H2PC 3CVIL 3LSOA 4G9FE 1JGLH 1CK0L 3IKKA 4E41B 3UROR 5GZNC 4L4VE 3D9AL 3PNWA 4U2YA 8CGTA 2X4QA 4NCDA 1B0GA 4Q9QL 4P46C 1OAZL 4WI2A 2EDYA 3N0PB 1RULL 4BH8A 4IRSA 3K1KC 4V2BA 1IC5H 3GSNB 4YPGB 1FLRL 3TPKA 4F7EA 3HA0A 1IE5A 1SBBA 4X9IA 3RNKA 5DRXB 3QFJD 1YECH 3QDAA 2BY2A 1CU4L 4H8WH 4CMMB 5GS1A 2IPUK 1IBGL 4GW1B 2NX5B 4KVNL 5EU3A 3MLZL 5HHME 1B6UA 3SO3B 4PRNA 1MAJA 5MEND 2NCMA 1NANI 3WIFA 2I9TB 4G6AC 5TDNA 4KK9D 4N0YL 3D0LB 1S7XA 2V7NA 2A0LC 1CL7I 4J6RL 1CICC 3RL1A 5C0DB 3MFGB 3LKRA 4R7NA 1KACB 1WT5A 3FQTA 5F9JA 1LO4L 1I3UA 4R2GD 5F6IC 4L8SB 1FIGL 1OSZB 3ZTNL 4OM1L 4QYOB 3BKML 1P4IL 4PJ8D 4X7TB 4IRZL 3SPVA 3CXDL 1I3RB 2DN7A 2E9WA 4R3SA 1RZFL 3MNWB 1QSED 2AJVL 5CLTA 2CQVA 1S7VB 2Y1VA 4NKQB 5E95B 3F58H 4XPAL 3RHWK 3NCEB 1DLHB 1QUNA 2P8LB 5JXAL 4PV9B 4WFHE 3L9RA 3BISA 3IU3A 4O51A 5ACMA 5E5MB 3VH8B 5I0DA 1ZLUK 1CICA 4ZFGL 1CIDA 5FHBH 3QIWC 1WBZA 3DI2B 5GGSY 1KJVB 1O5DT 5HHOD 1PZ5B 4R0LC 4L29A 4U1GB 5I1CL 5F3BA 4TSAL 1NAKL 1GCFA 3BPOC 3MV8E 2MKLC 4RA3A 4DN4L 2HT2D 4HKXB 3HRZB 4UDUB 3PGFL 2H2PD 3WS6A 3FFCB 3LZFL 4JFXB 4EOWL 5IR1B 2AJSH 3IJSB 1IAIM 5IESH 2E8YA 4J1UA 4FHBD 5EUOF 1HE7A 2APFA 2FL5B 5E1AB 4EJ1C 1A6WH 2OJEB 3Q1SH 4PJ5D 1NGXB 2MQ0A 5I16B 5JMOC 2NW3A 3OKEA 4PJHA 1HQRA 1R5WB 1FORH 2LQRA 1YY8B 5HVHB 1JRHI 1QYGL 4K8RL 4FQ2L 2YPVH 1CWVA 2D7OA 5CSGA 1MRCH 3GKZA 3QEGH 1CG9A 5FUOH 1OQXA 3FQWB 3C09C 1KIQB 1JHLL 2ADGA 5TE4H 4ODUB 4PJIE 2QQLL 3LQMA 3CFCH 4CADA 5DMKA 4XBPA 3LHPH 5MEQA 2WBKA 1U36A 3OHXB 1FC1A 1N6QH 4G5ZH 1X7QA 4KDVA 4A2LA 5LGJB 1OTUC 3KXFB 2EO1A 4Z7VB 2JE8A 1ZT4A 2QHLA 3DROB 3NACL 2CGRL 3C60A 2VDPH 3FRUA 4RFEB 1FNFA 5DMKB 2V5SA 1V7NL 1NANH 5KVFH 4HUXA 1GOHA 4ODUA 2P5WB 2GK0B 5KZCB 4FS0A 4R96B 3O6MH 1RHHA 4KKBC 4X5XA 1INEL 3GGWB 3DSFH 3WNNA 1T04B 3TN0D 3UPCA 4MB5A 3QJHB 3M45A 1EEQA 1TFHA 4HEME 5F89A 1VEOA 4MCZB 4QRTA 4WEBH 5GJSH 1CLYH 3FKUS 4N8CL 1B88A 4PP1C 4BZ1H 4JDVA 4LCIL 4GKNB 2DQJL 3LN5A 3HG1D 3VA2C 4LLYB 2H32B 2DQJH 5GSVA 3EYFA 1U91A 1M05B 2R1XB 5IHZA 4WEBL 3KPRD 2EKSA 2WUBL 5C8JB 4TUOA 1BLNB 4PB9L 2DWEA 5HVGB 4MLIA 2NY2C 1KNOB 1I7TA 2P5WD 4OUOA 1R5IA 1J7VR 4LCCC 1CL7L 1GRWA 3RVTD 2VAJA 2W60B 2X1OA 3UPAA 3OX8B 1CR9H 1DFBL 5ALBL 2FX9L 3NCYP 4NJ9L 2GT9A 4HDIB 3DYPA 3CU1A 4Z77A 2V7HB 3BKCL 1HXMB 4B41A 2A9ML 3Q3GA 4YPJA 2Z35B 5FCUH 4APQA 1U42A 1MEXL 1MJUL 3HE7D 3P40A 4F57L 4FQLH 1TQCC 1ITBB 4RZCB 3HPLB 5F7KC 5FKAA 2XKNB 4RZCA 1RK1B 5L9DH 4F7CA 3GDBA 3NIFF 2B4CC 1S8DB 1HZHH 4LP5A 2NY3B 3PABA 4KDTC 3IDXH 3T65B 1MAKA 3T1WA 1NMBL 2HLAB 4HKJB 4PJGF 2VLJD 1RFDH 5EFIB 3P3YA 5E2JA 4GLRH 1GOFA 4WDIA 2VZSA 3D3VB 3GNMH 3RZCC 1OAUH 4XCFL 3QHZL 2ICES 3CFIC 1ULVA 1MWAA 3GRWH 4GRLB 1A6WL 1RU9H 2XXCB 4JFHE 1NQBA 4OBSA 4ZXBA 4GS7C 1ADQA 1HWHB 1MCWW 3QZWA 1AHWA 1MCPL 1M05A 2VDQH 1RJZA 1JVKA 2ZG2A 1TQCB 4M7ZB 2AV1B 15C8H 1TQBC 3H0TB 4KKBD 4P23D 1JHKL 1U3HB 1U8OB 5ALCH 3VGAB 3MRJB 1EVUA 3QZWB 5I1CH 1CXEA 3TN0A 3IU4L 4JKKA 1LEGB 4CGTA 5FHBL 3GSNA 4YPGA 3MBED 3ZYOA 2O5XL 2IJ0C 4JFYB 3RFZC 2VLLB 5F44A 5IW3A 1NGQH 2AJYH 2I26N 3FOMB 4HJGA 3OQ3B 3RY6C 4ZG1A 1OAQH 4LPUA 1RJYB 5FUOL 5E2TH 4JFDB 1EXUB 4M6NH 3IDMB 1TJGH 2QSQA 1W2KT 1SMAA 5BJTB 4FQ2H 3BPLB 4PJGE 2DQCL 2DAVA 2HT4C 2QTEA 3VWKD 4I0PD 1S5HB 2BC4B 3RWFB 3IDUA 4NKIL 4QRRE 5JPNA 1WFTA 2EZ0C 5CEYA 2R23A 5GISH 3MRKB 4NO0B 4C56D 5MEOB 4JM2D 5KJRH 5K9KA 5ISZB 1I1CA 4ZPTA 2R56L 4PRHB 3TP4A 1P4IH 5E2UL 3JTTB 4CMHC 3LIZH 5CBEB 3LZFH 3N1PC 2XG5A 4EOWH 3CPLA 3S96B 2IGFL 2JJTA 43CAA 4H1LB 1RJLA 1KEGL 1TCMA 1CLCA 1N4XL 4E0RA 4UILH 5A2IH 4XWGL 3DTXA 4OJFH 4ELKB 3H3BC 4QYOA 4X80H 4F8TA 3UTQA 3A67L 1M7DB 4UQ3A 4MQXD 4GSDH 3RY4A 4MAYC 2XTJC 1VESA 4ZFGH 3CUPB 1KIPA 2F58H 1KNOA 2LU4A 1WBYB 1W0WB 5AYQA 3RL2A 3RKDC 2Z8SA 1NCBL 2HH0L 4KK8C 2N7BA 2FH8A 3DUHA 2DLIA 4ALAH 4OB5H 1MSPA 2H8PB 3IDNA 2BVPB 3CC5B 1G6RA 1RZGB 2ILLA 1FVEA 1WIPA 1NKOA 2XI9A 4HKXA 4UDUA 2XACC 3VD5A 3G6DL 3HI1B 3M07A 5EU7C 1ZA6B 2ZSVB 3UTSA 2IFFL 5F3BB 4PY8J 4Y1AE 4GKZA 3LS5H 4U1SB 5F9WB 3UTSB 1KJVA 4FQCL 4JFDA 1EZVX 4HMCA 4YAQB 3OGOE 2VDML 1IAOB 5EUOE 1N0XL 1N5AA 2JJWA 3QWRA 2XWTA 4P5TB 3MNZA 1RIUL 5B8CA 3CC5A 4DAGL 3B3IA 3C5SA 1CE1H 4MJIA 3WIIH 2Q76B 4GG6B 2OL3H 5KVGH 3ILPB 4TTGA 2YRPA 4P2RE 3TZVD 4Y4KA 3MXWH 4XNZC 3H42L 1FFRA 4LSTH 3WNOA 4I77L 3IDGA 5CBAA 4LRIA 4UNUA 3RTQB 3B6SA 4LIQE 4IRJB 3BZFB 3OJMB 4Z7UF 3SQBA 4OZ4B 4QTHB 3NTCH 4U6VL 1YEEL 1Q9LB 5ERWB 1G7HB 5JHLH 4HK0B 1CGXA 1MJUH 1GAFL 1T0MA 4JVUA 1E28A 3I85A 2CDGA 3SDXF 3ZYJA 1YECL 4IJ3B 4X9HA 3MRHA 5IB3B 1FAIH 2H32H 1H3PL 3T3PF 4JREB 1SVCP 4KFZC 3VG9B 1RVFL 3RWEB 1L7TH 5A2LH 3OKMB 5D1ZA 1FNGA 1I9JH 2VLRE 5J9PA 5L88H 3ULUD 1S78C 4LRNL 4HXAL 4OD3L 4Y1AD 2HFFB 4Y4KC 4HEPG 3QNZB 1NC4A 4PJCE 1JGUL 4M6OH 5BOZG 4PS4H 5C0JB 2VLME 3I75A 1H3GA 2CPCA 2ADFH 3WFHA 3S34L 5CFHA 5GRYA 4NSKA 3QP3A 2R4RL 5DHXB 3O0RH 4F7EB 3ISWA 2XWTB 1DUYA 4KZDL 1T22B 1MPAL 4LCIH 4XBGB 5GZOC 1J8KA 1FGVL 4P59H 1SY6L 4ZO7A 5ITBH 1AO7A 5FYJL 2GW5A 5I15L 2Q7YB 3QDMB 1K8IA 3KPNB 1I8LA 4OFKA 4X7DC 3BXNB 3G6JB 3G5XA 1DBMH 1BVKA 2VDRL 5EPMA 3D25A 3LPWA 4PJXB 1I8KB 4WCYH 1FO0B 4XWOD 3PGCB 4FQIH 1XF4B 4JHZA 3DURA 3ESVF 3PGDA 2VO5A 3IJYB 3L6FB 3FT3A 3QHFL 3E8UL 5IHZB 3L3IB 5F8RC 4R97C 4X6DE 3TZVA 1MIEL 1X6LA 3CVHL 1QD0A 1JI2A 3KLSA 4NM4L 5EBMB 3RAJL 5H35A 4G5ZL 4MHHI 3VMOA 4NN7B 2DQGL 1JNHA 1KCSL 2AJZA 4PG2A 1A3LH 1NBZA 3BIKA 3MRDB 4Q9BA 1PZ5A 3CFCL 3ARSA 2W59A 2V17H 4P0DA 5I66A 1DUZB 5GRVK 1J8HD 2KKQA 1I8LC 1JGDB 1P4LB 4PJXE 5GRUL 2BFVH 3VFRA 4YO0B 1KTKE 1XGYH 1NCDL 3X12B 1YY9C 3E8UH 4L3CA 1SEQH 1RVFH 1IGCH 5D1XB 1BOGB 4XPHH 3VXRE 1U8JB 4MMXC 3U4BH 5IBLD 4N0UA 4JFDD 5BQ7B 1KCUH 4HS8H 3SDDA 4WI6A 2RFXB 4D9RE 4FTVE 2BSTA 3AAZA 4DGIH 1XGPB 1FNAA 4MDIB 1V7ML 1N0LA 1EFQA 3F62A 1WZMA 2ZJSL 5CUSL 2HVJB 3TJEL 1OWRM 3RL1B 3MNVA 3QUZA 2DWEB 4FXKA 4OZGA 5FB8A 3HC3H 2CKBH 1CYGA 4NQCA 3AREB 3X17A 1AO7D 3DUUA 1RPQA 3G9VA 4HF5H 4QOKA 4PJHB 2Z31D 5E2VH 3HI6H 4XPGH 1G84A 4PJDF 4L3ED 3D25B 1AI1H 1K85A 2VLJE 2DL2A 3I3EA 4N0FA 4NGHL 5JDSA 4IRSD 1SYSB 3DV4A 1BX2A 3MCLH 5MP6H 5CKGA 3AREA 3B5HA 3F58L 4YEEA 1M7IB 3UTTB 3HLAA 4Y1AB 3VI4F 3ZKQD 1DUYB 1BGXH 1CGUA 2WQRA 4K3DL 5C07D 5FA4A 5FOJA 4XP5H 4WTZA 3QO0A 1FP5A 3G5VA 3DYMA 3QIUC 1N8ZA 4TNWF 3U2SB 1L9MA 4OM1H 3RWJB 3HNTH 3WJLA 1YUHA 4HK3N 2YXFA 1KG0B 3DOSA 2W07A 3KXFA 4HC1A 3RX7A 1RV6X 2BNUB 1KCLA 3OXRB 3OSKA 2IC2A 5LBSL 1HNGA 3BKYL 3OHXA 1GGCH 4LVEA 2FIKA 2J4WL 1F58H 4QRPA 4WUKL 2GKIA 2OL3L 4KK9C 4OLEA 2QKIB 2D0FA 2ITDB 2Y7QB 2YPLD 4KKLD 3K8LA 5I19L 3BJLA 1JYWA 2J5LC 3GIVA 1HILA 4ZOEA 4D0DA 4AEEA 3F7VB 4TYUA 1FFPB 1PW3A 2V2TA 1NBZB 2Z91B 4S0TD 3DXAD 1EO8L 2AEQH 3W2DL 5HI3D 3L3OA 2F5AH 3QT2A 4YNYA 5TQ2L 1WBXA 7FABL 5E0QA 1YNLH 4F9PC 1XGQB 2GJ6B 3MLVL 1F02I 3TM6A 3GSUA 2O93L 2HWZH 4ELMB 3WNKA 1G6RH 3MGOA 3QWOB 4LAQL 3W39A 1RAMA 3ORJA 3G08B 4PREA 1IAOA 4CW1A 2NY6D 4MXQC 5DHVB 1OTTD 2HJKB 2FR4A 4GSDL 3EKCA 4CRPA 1AC0A 2UZYB 2L7UA 5KS9A 1ETZB 3SJVE 3S4SA 4N0UE 2BNRE 4Z7UE 4LAQH 5EU6E 3CLEL 5D2LA 4MA8L 5A2KH 5JW4R 2W0FB 4I5BA 4X83A 2H1PL 2JELH 4RGNE 3T0XA 4L8CB 1V7MH 5JOFA 1UZ6F 5E00B 5IHUH 3WUWB 4PJGB 4FQHB 4JY4B 4OLVL 4P57B 5EBGA 3UTOA 5BZDA 4JN2B 5B3NA 2IAMB 1DBBL 1QRND 3QG7H 4ZOBA 5C0BB 2X70B 5FO9A 1SYVB 3KPOB 1MCOH 2XZAL 3OJDA 3QDJB 4LASH 5KSUA 3O2DH 4HH9A 3NFPA 5DJXB 2C1OA 3GM0A 5C1MB 1KSRA 3GSXA 3QHZH 4U3CA 4PJ5E 4M61A 3IVKB 5I19H 2P5ED 2Y5TB 4I2XB 3IDYB 2EH7L 5BCAA 2R1YB 1FG2B 3U0WL 3WDHA 2CIKA 1HOCB 1F58L 4J7RA 2Q87A 1XT5A 4WHTA 4O02L 1YDPB 2V17L 5CMAB 3ZKXC 3BKYH 1E6JL 1CDIA 5LBSH 1YEHL 5DA4A 2WZPD 5E5RB 1RMFH 1WZLA 5SX4H 3H3PH 2R9HD 1JPGA 1WZKA 5D7JA 1NCNA 2BVQB 4XCEB 3WFEH 4EDXA 3PXHA 2R4SL 2BSSA 3KPTA 3PWUB 2CXKA 4Y19E 4KI5C 2FIRT 3V7MA 1ZVYA 2GCYB 4L1DA 3RWGB 1Q72H 3E1F1 3ZKXB 2I5YL 1H8OA 1U6AH 2YRZA 3U7AA 4U1SA 5K9JL 4HKZA 4NP4H 3AM8C 1N5AB 2VYRE 1FPTL 4I3RH 2WQ8A 3ARBB 3FO1B 1MJJB 2XKUA 5I73C 5DD6A 1BEYH 3EDEA 1OAUL 1AI1L 1FFNB 4Y5XA 4Y16B 2AEWA 5J4MA 5FM5O 4HF5L 1TJIH 3HCVA 1JNNH 5J06A 4BK4A 1HDMA 1A21A 1GGYA 4PV9A 1WTGT 1C5DA 1S7TA 5DVKA 2QQQA 3VXME 3PQYD 3T77B 4QO1A 3LN4B 2IQ9L 3NA9H 4LOUC 4M6OL 1VFOA 5AD0A 4KUCD 4FQLL 2XG4A 4CNIB 4HV8B 4DGIL 4PRHE 4HWEH 5A40E 1EFXB 5L88L 2VDKH 5D1QC 3QUXB 2V5YA 2O61B 1YDPA 3ARDA 4GXUN 3U4BL 5C0CB 4MA1C 1V7NH 2CKNA 3HPJB 4Q2ZA 3VD3A 4OFIA 1J1XH 5GS0D 2YSSA 2D7QA 1A4JB 4MAUL 4KHXH 1Z0NA 4LCUA 5AUMA 3O6FD 1XGYL 4PJCB 3C8HA 5F9JB 3WFEL 4F7PB 4F15B 4MNQA 1TTFA 3NA9L 4NKDA 3NTCL 5HDBF 3K8MA 4HGKC 3IDMA 1GGBH 5EUKA 5TE4L 2JTDA 3S5LA 5FGSA 3UDWA 2MCPH 3BGFB 5DD3H 2CDFB 2N7AA 4BZ1L 4CMMA 5FYKE 4MJ5A 1CE1L 5J1AB 2ICWI 2DLGA 4G8EA 4L9DA 2MCG1 3BH9B 5ETUB 3N1MC 3W5MA 1BZ9A 3OZ9H 3QEQA 1IC7L 2YN3A 2FO4B 5EB9A 5C08D 2J8UB 4LASL 2X4RB 1C8PA 4TUOB 4RCAA 1PY4A 5FK9B 2J8HA 1I8IA 1MQ8A 3I6LD 1NLBH 2CKBA 4Y4HC 1PZUB 2EDBA 1FZJB 4PRID 4YHYB 5L7XL 4C83A 3C6LD 1FZMA 2VDPL 1Q72L 1EUUA 4RSVA 3GI8L 5TH2A 1UCTA 4M1DL 1BQHB 1OP9A 1MFAH 3U0PB 4P46A 1DE4A 4WFGD 4WV1A 5J6HA 4KZDH 3QEHB 2FX8H 3O11B 4LSDA 3QJHA 4MQSB 2BRQA 4NO3B 3W81A 4GO6B 3VXMA 3X13A 3I6KB 3S34H 2J3SA 4FQPA 4UZGA 5CJXA 4XVSL 3C9NB 1IAIH 5C70A 4HUXB 2P8PB 5A3IC 2R0ZH 1PG7H 3TFKC 4NQDE 4P2QE 3WYRA 4P9HH 5CEZL 2G2RB 4GJTB 3V6FA 1KEGH 1YEGH 5LKNA 4C55A 3AS1A 4OF6A 2RFXA 4MNQB 1I9JL 4Y5VB 3UO1H 2NY2D 4GRMA 5FXCH 5BQ7A 5M94B 1P7KA 4I9WE 5D9SA 4PJFE 3CU7A 3O2DL 5E2UH 1ORQB 1D3CA 4DUWA 1FAIL 3DBXB 3QG6B 4YXLL 3PHOA 2AXHA 3ZMRA 3MYJA 4HFWB 1I1FA 4OLVH 3VG0L 1CFTB 4WI3A 3ZO0A 3MV7A 4ZNEE 1YMMB 1EFXA 1HXMA 4XCCL 1JPFA 5CWSA 2R29H 1G1YA 1G7LB 4BQ8A 1HCVA 1NAKH 3DRQA 1R5WA 3CLEH 4Z7NE 4BUHA 4U7SA 2BNQD 3W9DA 1NGXA 2AJ3B 3K4AA 4U1LB 3O8XA 3RUGB 2YHGA 1LO2L 3WIIL 3U0PA 5JDSB 1CE6A 5DT1H 5DI8B 3IU4H 1LEIB 1F90L 1VDGA 3HMXH 1N0XH 5JXAH 2OBGA 2OK0L 1G6RL 5C8JA 4TPRL 4LRIC 5ALCL 5LWYH 4YHPA 4MCZA 1VKXA 1R5VB 4ZUSA 4PRIA 3UTTD 3I2CH 2IFFH 2E5EA 2A6IA 1F3DH 1Q0XL 5E8EB 1ROWA 2BSRB 1Q0XH 4P49A 3VI3E 4NT6B 1OAZH 3VFUB 5C08A 2EDHA 1YN6B 1MIMH 2L0DA 3MCLL 3LCYA 4W4OC 5MP6L 1DQTA 4OB5L 4R97B 3WFHB 2DTSA 2HT3D 3GBLA 5HGDB 3OKKA 4R96A 1FIGH 3QUYA 4JLRB 3GMQB 4NZJA 1TJHH 1F4AA 1EH9A 5CZXC 3LKPA 1JRHH 5ADPH 3UXFA 2A77L 3D69B 3U1SL 4DK6A 4ZMAT 3GMRB 4UDTA 3SGKC 4UILL 1NUGA 5E4EC 4X4ME 5IJKA 1AGEA 3MODH 5L9DL 4OM0L 3V52L 4IHOA 4DZ8B 2CDGB 3S36L 5MEPA 4F57H 5FCUL 1YEKH 5E6IC 4YFDB 5HDBE 3QDJE 1VACA 4LFHG 4MNGB 5I30L 5JW3L 1LK2B 3SKJH 5CGTA 2WBJA 2PYEB 1BGXL 1G0YR 4IEFB 5INDA 4HAFA 5SWSD 3D39B 4WWKB 1JGVL 4TNVF 1YEGL 3V5HB 2BFVL 4HK3J 4X7FC 4M1CD 4EQ3A 4M6NL 3ZDZF 1IAMA 1RZIB 4UQ2A 1GJIA 3MYZA 3KAAA 2AV7B 4PP2B 2WUBH 4XPGL 1TNMA 4XVSH 1YQ2A 4ZO6A 5IIEA 3UYRL 4PUBL 1KTRL 1V3KA 5GIRB 3ARGB 1OT2A 5D6CA 1DBAH 4G8EB 1A3LL 3HC3L 3P4OB 5B8CB 1CDCA 1N26A 4QY8B 5E6IA 4DEPC 2AK4B 4Z0XB 1MFAL 1ACYH 2A6IB 4GAYA 5GJSL 5E6IB 3RIFK 3FO1A 4U6HB 1T22A 2ZJSH 5CUSH 1QFUH 3BEVA 4KROB 5T3XL 1WUNT 4IRJC 5B38B 1HYRC 5EWIH 3BHBA 3WLWC 2P4AB 4ONFL 1INEH 2AKRB 1HSBB 2BHUA 2Q7NA 5E4EB 4XX1G 5LQBH 2VSCA 1GPOH 2VDRH 1BFOA 1ES0A 1EUTA 1RU9L 4OI7A 5KVFL 3RX5A 3SHSA 5ESAB 1CTOA 4KKCD 3QI9C 1JNJA 3P4MB 1R3LB 2EXYC 1WBYA 2E9JA 2VABB 5F7MC 3GIZL 3SN6N 4HCRL 3B43A 43CAB 1OSZA 6FABH 3OXSA 2ARJB 1OPGL 2BX5A 1UFUA 4EQ2A 2VLKD 3NZ8A 3ZKMD 1H3UA 2ITDA 4X7TA 1I1AB 5AG8A 2ADIB 3UYRH 5CZKA 4GAJH 5KSAC 4NFBA 5BRZB 2DQGH 4XTRC 4G9FA 3WXVH 3DXAE 3M8OL 2ZNXA 4RAVA 3RAJH 3RWFA 3ZT6A 4LLVB 4K8RH 4IOIB 2E7HA 4HPOH 1VHPA 5CS7A 1HH6A 4H25A 3ABZA 1LWRA 4OZFH 4PTTA 3RDTA 3QNYA 3VXRA 4HUKB 3LS4L 1RI8A 5DJ6A 4GMTH 5DD6B 3SKJL 5IEKA 4G8GE 3GMNA 3W0WB 3M1BA 5I71B 1F4XL 4HWEL 1XR9A 3KYMA 4ZOAA 5BJTA 5L2JA 5D4QA 5ID1A 4FQXC 4Z7WB 3MUZ1 4HT1H 5D6CB 3T08A 5I1KH 1QFUL 1YEEH 1FCCA 2DMKA 4UNTA 1QSVA 4DGYH 4DN4H 4KJQC 4JFEA 1I3GH 1BIHA 3ARZA 4KTYA 3TV3H 4TSCL 4DVBB 4OGXH 3SE8L 1AQKL 3QO1A 1RZJL 4TSAH 4I77H 4XNQB 1EMTH 1ZGLB 5DJZB 4C83B 1F45A 2X9XA 3PXJA 4GRWB 4NQCB 1HINH 3G6JF 2CSPA 1OAXL 4K8RC 5L8JB 3WNPA 3PWVA 3NZHL 3NPZB 1PY9A 3DUSA 4OD3H 1BVZA 4YNYB 3KPMB 4LRNH 5M95B 3D5OF 5JA9A 1FPTH 3DGGA 2J8UE 4CU7A 2HG5A 1T89A 3JV0A 3VU2A 3RY6A 3ZLQC 2EO9A 2OTWA 3JV4A 1A7QL 1T5WB 4JGUA 4WI8A 4RMUA 2VXUL 2ARJA 5HYSG 3FFCD 5HHQB 5I2IB 2ESVA 3SDCC 1YEFL 2Q8AL 1REIA 3CSYB 3D69A 3S36H 3TNNA 5C09D 3IXAB 4PJBB 3QIUD 4LHUD 1RMFL 4F7MB 4XP1H 4QRPD 1ORQA 4WEUD 2D9QB 1RSFA 3MRGA 2W0FA 1B3JA 4YHYC 2A6JB 4OJFL 5HPMB 4XBEH 3MZTA 4XWGH 5HYQA 2YPKB 2LTQB 2F19L 4PD4K 1C1EL 5E7FA 2JJTC 3U46A 1V3JA 4PG9A 4M6ML 3E2HB 5T33L 1PQZA 3MRIB 3NFNB 2KDGA 3THML 4HKZB 5J13C 1MIML 1NAMB 5E8OA 4QNPE 3PP3K 1F2QA 4Z7UA 5GISL 3RU8H 4XVUD 4WV1B 1XGQA 2GJ6A 2E7LA 1LMKA 2NXYC 3PGCA 3G6DH 1W8OA 3RGVB 5IMMB 2R1WA 4S1SH 4ISVB 2DDQL 2OXHA 4MA3B 3VXUA 4KK5C 1OP5H 1FZMB 5EIVA 1RJZB 2R2EB 4L4JA 2W0LA 1U8LB 2OK0H 3WV0A 1AD9B 1D5XA 1YNTA 4BJLA 4WW2F 4AIXA 2I07A 2HRLA 4UBDC 1UH2A 1F8TH 1HIMH 4KROC 4M7LL 4N0CC 5E7BA 2FYYB 4ZODA 3BSZL 2IALA 2CIKB 5TF1H 1BIIA 1BJ8A 2IADA 3RWCA 4NYLB 1G0XA 2VR4A 3QUXC 2R29L 4QT5A 4DW2H 2IGFH 3MRGB 4R4ND 3L95A 4XPAH 5IF0B 1QZ1A 2E8ZA 3PUCA 1MHEA 5D70L 1S5IL 5K9QG 1W72L 2NY0C 2VZOA 5D7JC 2X70A 4LIQH 5DYOB 3PDDA 4CADB 4WW2B 3D2UA 3A0OA 2FX7L 2CK2A 3TPUB 2EYSA 1IC7H 1JK8A 4TVPL 4H88H 3UO1L 3ARRA 4UV7L 3MLSH 4HG4K 3QEQE 4NWUH 4YDLC 1UB5B 4XPFL 1KN4H 2BNRB 2VSDA 1OF2B 4J6RH 2ZOKA 2M1KA 3MV9E 4ZSOB 1T7ZA 4DGVH 1SYSA 2P5EB 1YEDB 3DV4B 1C12A 1KT2A 2PW1B 2HVKB 2L7JA 5DVLA 5GGRB 2VZ1A 5I16A 1MAML 3BWAA 1GGBL 4JFQA 1JP5A 2VLRD 5EBMA 2EYRB 5H35B 4IS6A 4PPTA 5FHAL 1P4BH 4QOKB 2IANB 2FX8L 5FECA 2VUYA 3HNTL 3ZSSA 1A9EA 4JKWA 2OL3A 1LO0H 1DN2A 4XP5L 2BY3A 1KIRA 5ABDE 3QA3A 4R2GC 3TA3C 2O26U 4KHXL 4KPHL 3LAFA 3RGVA 2F53E 5CP7A 3TH4T 3BKCH 1SHMA 2QQKL 1I1AC 3K3QA 4GKNA 1FV1A 4GKSA 4Z78B 3C09B 1ZANL 1Z0MA 2JJVA 3I3BA 5IM7B 2VN7A 4Q9QH 3SDAA 1CL7H 1Z5LA 4PJBF 3OAZH 3NZHH 1U8MA 3VFPB 3IU3B 1OAXH 4D0CA 3QDGB 1CFTA 4XVJH 5GGSA 3BDYH 1NBYB 1XZ0B 5E2VL 1WBZB 4HIJB 4GBXC 1KUMA 3JWDL 3C60B 3FRUB 2YA1A 2CKBL 2V2XA 1QRNB 3VXQA 4PRAA 5C7XH 4K71C 1CBVL 2IH3A 4TSCH 4BH7A 1I3GL 2P7TB 3DETC 3TV3L 1G9NC 1FSKC 3RGHA 2EXWD 3VWJA 3O9WD 3NN8B 5I1KL 2BOBA 4TVPE 1N8ZB 2V2WB 4W70A 1ND0B 4PRDA 4L5FH 1KPRB 4C4KO 3KYOB 3AUVA 1CLOL 3ZSTA 1P5VA 1QLRA 4F8QA 1XCTA 4R0LB 4JCLA 5K9JH 4N68A 3G6JE 4MDJB 4Y2DA 4ZUWA 3O6FA 4U0RB 1EEYB 5JPMB 4ZUUA 5HTSA 4N9OB 4RWYH 2X4OA 1KJ2A 3DSNA 3GMMA 2X4PB 5JA8B 1YY8A 5F7NC 4Z7WE 1NCDH 4DUVA 2AERT 4K07A 4HS6B 5GRUH 2BOCB 4B5EA 2BVOA 4LU5H 5KSUB 3D0LA 4HZLB 4NO0D 4NNXA 4WRLA 3JVGA 5F7FA 3V6OA 2DQUL 1E6JH 1O7VA 3WUWA 3B3IB 3C5SB 4MNQD 2NY5C 1KCSH 1IKNC 1JZ8A 4ODBD 5ANMA 3VGEA 1N7MH 1I85C 2DBLL 1TJIL 3GIZH 3ZE1E 5I1IL 2BCKB 2EIZB 2GUOA 3TGXA 4MDIA 1BWWA 1T7VA 4YGVA 2XQYG 4Y16D 4U1MB 3MBXH 4I3RL 2X1XR 5FKPB 2UYLA 3AXLB 2NY6C 3QNYB 4P9ML 4QHUA 1PAMA 4YDVA 2CXGA 2RJMA 3Q2CA 3T0ED 3U48A 1PKQB 5B22A 2B1AH 1AR1D 5FYJH 4GRLA 5DVNA 1MCKA 3PQYE 3VXMD 2AJ3A 3RUGA 25C8L 1DBKL 1JGEB 3DX8A 2NZ9D 3WLWD 2V2WA 1YEHH 4P46D 1VENA 1VFAA 4XRCA 3S35H 3QDGE 1AD0B 5I74C 5JNYB 4PS4L 1G7JA 1P2CB 4O02H 1UACL 4XP9L 4NKMB 1MRCL 3BIBX 4N9GA 1S8DA 3U0WH 5DYOA 3PJSA 3BYYA 4G3YH 3B2VH 1QYGH 1S9VB 3CH1A 3OKDA 3MUY1 4WWID 4CVZA 3I02B 4XNXL 1UH3A 5JPNB 2VXVH 1H3PH 4ZDHB 4FG6C 1HSBA 5I30H 2UWEF 3FO2A 5ITFB 3G5XB 3C6LB 5IESL 1ZSDA 5M7QA 3VFTB 4H20L 2GSGB 3BW9B 5EOTA 3RWJA 1YEKL 4YUEL 1D5ZB 3CFEA 4HC1H 5IVXA 3LD8B 5GGSB 5T1LD 4L4TB 4D9LH 1T83A 1A3RH 1BQUA 4LPYA 3VFNB 4OFYD 2J2ZA 4U6VH 3MJ7A 5T3ZE 1UB6B 3MLWL 4U6YB 5HDQH 1KTLB 3PV6A 3GSVB 4NQXA 4NQSB 2I27N 4X6DF 3QUMB 3H42H 2ZCKL 3SKNB 4KUZH 1W0WA 3QDHA 3RL2B 1TJHL 3EOTL 1A47A 2CJUH 5FYKH 4DQOH 4FFZL 3AS0A 3E3QC 3UBXB 1HHIB 4ORGB 2R2BA 3O8XD 4HJ0C 1NFDE 2W1NA 4W6XB 3OKMA 4LF3A 5D1ZB 4Y2DD 4CJ1A 3MLVH 1XH3B 4PJAA 1YNLL 2P5WE 3JSSA 5BRZD 2QADD 4Y16C 5DQDL 1T04A 2CK0L 5ISZD 1S7UA 5C0EA 1QR1B 1VACB 2ZWLT 4NZUL 1WICA 3O3BB 2DMBA 3BKMH 3MRQA 2IPTL 4NGHH 2Q3AA 2A6JA 1WZ1H 2HKFL 1EAJA 5EU6D 3RI5F 5JOPE 2Z92A 3QFJA 2G9HA 4RGOL 2D03L 1QSFD 3HI6L 5EN2A 4KV5F 1GGIH 4FQQB 4L8BB 3UYPA 2L4OA 5GZND 1W8NA 4XB8A 3TNNB 6CGTA 3MLXL 3BN3B 2IAMA 2UY7A 4FFVD 5FA3A 4G7YH 2ZUYA 3MFFA 4EI6B 5K59F 4HQQH 3UC0L 1CQYA 4LHJB 5F8QC 2HFEB 2J6EA 1IARB 3VG0H 5CJ5A 4HC1L 3BGFC 5E1HB 5CEZE 3VH8G 3O11A 5FO8A 4G6FB 3JTSB 4MLSA 5E94A 5JHDD 1JNHB 1FE8L 1KJ3L 4K3DH 4XNXH 1OD9A 3HS0B 3HR6A 4MS8C 4NKIH 2VKWA 5ICZA 3KHOA 4P23A 2APTA 4GRLD 1GIGL 1U8LA 2DIBA 2DQCH 1EDQA 1MCHA 3B2VL 5IBUB 4G42B 2FECL 2OL3B 2NR6C 1NJ9B 2XNAA 4G42A 1W72B 3TIEB 2R1WB 3CVIH 3PWNB 4WWKD 1NPUA 3BUYB 3MC0A 3FFDA 4HXBL 3BYTA 3P0YH 4CU8A 3OL2A 4YAQA 1LGVA 1QQDB 1RIVH 5J1SC 5J1AA 1EO5A 1XGRB 2UWEA 3CFEB 2DD8H 4AM0A 4EBQL 1IMHC 5H37G 4JPKL 4MWFB 1WSST 1AO7B 4NM4H 3HI1A 4RRPG 4N0UB 3K74B 1MCNA 1LEKB 5GS0L 4BZ2H 5EUKB 15C8L 1U8JA 1II4E 3QHFH 1VGEL 2OTPA 2W0PA 5L7XH 2ZZUT 3OKNB 4WW2A 1F6LL 1FVCB 5HJ3A 1RUAH 3HAEH 4LLVA 2VDNL 3BVNA 2VWEC 4ZS6C 4Y2OA 3IXTA 1A22B 1MFCL 3REWA 1X4ZA 1NGZB 1MFBH 1IGMH 4X6EB 3DX6B 2CO6B 1TZGH 2GT9B 1A6AB 1IL1A 5I8CB 1CDBA 2Y4SA 1EHAA 5ITBL 3KDMB 3ROOB 3RNQB 5I1IH 4HUWB 5CHNB 1HEZA 5DD3L 4EUPB 3CVHA 3SCMB 3V6BR 2EDJA 1A1NB 5EU6A 3V4VH 4AL8L 1FG9C 4BK5A 2Q86A 3RWIB 1FG2A 1JUFB 4RDQF 4X4XA 1H0DA 1BX2B 2VXQH 3NCYS 3RA7L 3ZDXE 3BJ91 4JFEE 5FUZL 1P9MC 4YHLL 4ZAKA 1B2WL 3T4AA 3TCLA 43C9A 2A9MH 4TUKH 4IBLT 1A1OA 4JM2F 1N6UA 4LSRL 3C5ZC 5DC0A 2DICA 3CX5J 2OXGA 4QNPF 4XMPH 4NJ9H 5DSCA 1WK0A 1VFMA 5IFHL 1BZ7B 4PJ9A 1LD9A 2D7TH 3QXAB 5L2JB 3EJYC 4ODXA 5K93A 4X6FA 1CLOH 1IEAA 4AK1A 5I1HH 1JPSL 1P7QD 4ONOA 4GMSL 2BRRH 3BWUC 3PIQB 4WI9A 3WN5A 3I75B 4JRYD 4Z95L 4YQXL 4HG4J 4YHOH 3CK0H 3MZGB 1FGVH 3C60D 1MPAH 3SDDB 4YC2C 2V6HA 4DJMA 4ENED 1T7XA 4HKBA 4NM8H 4CMHB 2OYPA 4PJAF 1JV5A 1EAPB 3ZKSD 3U79A 1AE6L 3IDNB 2VE6A 4HBCL 2ADFL 4UOW1 3VGBA 2ADJB 4XVJL 2PTUA 2A74A 4L8DA 1CXIA 5HYEA 5ENWA 5HHPB 1BEYL 4P4RB 4LSUH 3MRHB 5IB3A 4KQ4L 3DSFL 3ARFC 4R3SB 3BGMA 4JO3H 1XCTB 4CJ0A 4AZ8A 4AH2A 5EC1A 2OTUA 5DJDA 5GGUB 3B9KC 2QQKH 1IQWL 2ENYA 3QULA 2GTZB 4NOBA 1B0RB 1OOAA 5DK2A 4UU9B 2AXJA 1WWWX 2VMFA 5IVXF 3VGAC 1N6QL 1J0KA 1A0QL 5JHLL 3MJ9A 3H3PL 3V4UH 4G8FA 5FHAH 1TQBB 4GFTB 4LSQL 2P8MB 4MHHG 2B1HH 4YE4H 1X5GA 4DKFH 1JHLH 5JW5B 5HGDA 4LFHD 3RVVD 3LMJH 3QEGL