4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
1TZIA 1IC4L 3G04B 3KJ4B 2IBGA 2AQ3A 1ZV5A 3KPNA 4YHZH 1UFUA 3ZYIA 4FQLH 5B4MD 4Y4HA 1NCUA 1KELL 5HHVH 1LWRA 3LKSA 1O0VA 5I1EL 3HS0B 5GSRB 5D70L 3V2AR 2MTPA 2J8UB 1PJ9A 3CDGB 4P46A 2VXQL 1FNHA 4PJDA 3TT1H 3TESA 4YXLL 4UTAH 1QSEE 3V79C 1AGFA 4BFEA 3DYMA 5IW6B 3PL6C 2NY6B 3THML 5I1HL 3OJMB 1G7HB 4MXWL 3OR7A 3QCUH 4HJ0C 2VUOA 3ZE0E 3LV3A 2F54D 1EXUB 3FT4B 4LSVH 5JA8B 4LEOB 1YMMB 2FBOJ 4IRJB 2B1HL 4XNXL 3JWDH 1ZT1A 4YBHA 4WIQA 3TJEH 2XXCB 3MBEB 3GMRB 5IJKC 2WINB 4N8PA 2YKLL 4RISH 1MFCH 4XMKL 3IB4A 1KT2A 3QUYA 2JJTC 3O3EB 2E7MA 4TSBL 3KXFB 1LDSA 1MCOL 4PRPB 3VFUB 1A21A 3MRPA 3EHBC 4C54A 1NDMB 1R5WB 1LP9F 3QDGA 1HE7A 3BGAA 1VGEH 5C0FB 2NY3C 4CVXB 4MXVF 1F4XL 4HH9B 1AXSA 1OOAA 3RNKB 4JRYB 5GRUL 3N1QC 2PYFA 3VMOA 2C7UB 1NC4D 5JIHA 5AAMA 4EOWH 4YHYB 5CJXC 3KWWB 4H1LG 5C0DA 1IM9D 4X99A 2Q6WB 2B5IC 4L4TA 4M7LH 1LDPH 5AD0A 2X1WL 4FQIH 2V2TB 2O61B 1K3IA 4XPHH 1Q9WA 3NIDF 1CWVA 3X3FH 1UM4L 1QKZL 1G7JA 5T1LA 4GW4A 1CGVA 3K81A 2BRRL 1SJVA 1IVLA 3H9HA 4FXGB 1IEBA 1NCAH 1NGPL 1YN7A 3S4SA 4K7FB 2VDML 3MXVL 2Q7YA 2NY1B 3BESR 3D18A 4X6DB 2F54E 3U4AA 1R3LA 3SCMC 2A77L 5C08A 2BOBB 3VXNA 4HS3B 3QQ9C 3V0VA 3PDOB 4R4FL 2Z92A 4ONHB 4GKSA 1QZ1A 3DGGB 3RY6A 3JV4B 3SEPA 2A1WH 3MNVB 1F8TL 3UMTA 5FOJA 4P46D 3VFVB 2P24A 4S1RL 3PV7A 1T21A 1I9IL 1U8OA 3O6MH 3WUZA 3W39A 1ADQA 2CK0L 2V5RA 1ZGLM 4Z7UA 4WUUA 3VXMA 3DHJA 4YGAB 2X42A 4O51B 4U1GC 4I9WE 2Z8RA 1Z0MA 3O6LH 3RA7H 5HVHB 3UTPD 2OS7A 3FONB 4W4OC 3V6FA 4CMHC 1D9KC 3WL9A 5D1XC 4L8DA 2FEEL 4UBDD 4WNQB 4G7YL 3MA9L 3VU2A 1HH6B 1Q0XH 2XZAH 3ARPA 5EBGA 4G9DA 1FDLL 4HDIB 4OV6F 4R4BA 4HK0B 1FNEA 4UINH 3W0WA 4RDQG 3WD5L 3NA9H 4XAKD 1T2XA 1A7OH 5E2TH 2H3NB 3RZWA 3TH3T 1BD2D 4Y5VB 4UNTA 4LVNC 1ZT7B 1G0XA 2DRUA 3MV9A 3GJFH 3MNZB 1QR1B 1T1XB 2E9IA 1YEGH 1AHWA 4JG1H 3SBWA 5F96H 1HCFX 1FVCA 43C9B 5F72S 3BWUC 1BLNB 5DT1L 3TO4D 2DQFA 5FYKU 4NM4H 4L4TD 4FQCL 5F7DB 4YDJB 2G75A 5CD5C 2EC8A 3SDXB 1XR8A 1RVFL 4GS7C 1SMOA 5T1LD 2Y5EA 3L7FA 5MP6L 3O9WA 2BERA 3MUJA 1CBVL 4CMMA 1ZA6B 4GRLC 3WHE0 2W59A 2R9HD 4JKLA 4U3HA 2VDRL 3MRGB 4OM1H 4JM2D 3BKCH 3O4LD 1ETZA 1MVFA 3VWKA 4NM8H 5C08D 1HI6A 1TCMA 5KVDL 3U46B 4XI5C 3OTTA 3WXVH 4XB7A 4AEFA 5E2UH 4I0PB 3EOAA 15C8L 4HLJA 5IMKB 4UUJA 1AGCB 5D2NE 5JXAH 5ENWB 4K9EH 1LHZA 3LKPA 3O6KH 5MEQA 5E2JA 1ZLSH 4ZUSA 1ZHKB 5JLZB 4XX1G 3PP4L 4XAKE 5HHNB 3T65A 4YBQD 3I75B 4YXKL 2RCSL 1BD2E 1RHHA 4OT1H 4OZFG 3BDXA 1DUYB 1F4WH 2YPLA 1EFQA 2UWEB 4OLYH 5H2BB 1MCSA 1OSZA 1YECH 2YA0A 1N6VA 2CKNA 4NZUL 2AV7A 1U42A 1DQQB 4PRIA 5DRWA 2HKFL 1NPUA 3L95A 1MHPL 3C08L 4N0YL 1Q38A 1QFUH 3ZO0A 1A2YA 4AENA 3I6GB 2QLVB 4G6KH 4MJ4A 3N85H 1ZWIA 5F7WC 1EVTC 1JNHA 2AXHA 1A02N 4GG6F 5D7SL 2NY2D 2HG5A 5GGSB 5SX5K 1GPOH 5CSGA 1C5DA 2X4PA 5AYUH 1EBAA 2NXZD 3LS5L 2NX5B 2YPKA 2DLFL 4M93C 1J8HE 4XNMA 4YDVA 3E3QE 3O4LE 3C2AH 3HNTH 4Z7OE 2HJFA 2AQ2A 1IEHA 1RZGA 4AEHL 1F3RB 3EYOB 5J11C 3H0TA 4HF5H 4LVOC 1MJ7H 1L7IH 3IDNB 4PGDB 2YPVH 5T1MB 1HH9A 2ARJA 3RTQC 5ITBH 4ETQB 1CICB 4JFFA 1XF2A 2D7OA 2IPTH 3WNLA 5MHSE 2VC2H 3MUZ1 3ARXA 5BRZD 1U6AL 1A6AB 3IJSB 3K4ZA 5C0BA 4EN3A 4R7NA 5D7LA 1WUNT 5GS2H 2D03H 3QDMA 5GGUB 4M62H 3N1PC 3ARGD 3QFJB 5E6ID 5MENB 4KK8D 3EO9L 5GHWL 4L29A 2MWCA 1HYSC 4N0UB 4RAHA 1XIWA 1LE5A 2FH8A 4NC1C 4L8SC 1FNLA 2AV1B 4U1LA 5HHXL 3QUXC 4I3GA 4HT1L 5J3HD 1CGSH 4N1EA 2CIKB 4DQOL 3HUJF 4JO3L 2G5RA 1D5XB 3LN4B 2YBRB 4Y5XB 1W0VB 3MACH 5IW3A 5ADPH 4X0KB 3TBYA 1RURL 1M71A 2X4OA 2HFGH 3BOVA 4EXKA 1K4CA 1RK1A 3C60D 3CFKA 2R2EB 1JPTH 3E6HB 3U0PA 1LE9B 5FDYA 4Q6IB 1P2CA 3TN0B 2A73B 1X5LA 2OJZL 5A16A 4PJAA 1IAIL 1MI5B 4PJIB 4BUHA 1TJGL 1QSFB 3FKUS 2H9GA 5AWNH 1IGCL 4CN4A 2YRPA 4LPTA 1HWHB 1N7MH 1JGLH 2CUHA 3A6OA 4P3CH 2P5ED 3V7AE 2NY5C 5INCA 5SX4I 2F8OA 1F00I 4WI5A 5BRZE 1NGZA 4RWHA 1GGYA 3PIQB 3O8XC 2ICEB 3Q5YA 3C8DA 3I84A 4FFYH 3IDGB 4XP6H 1ODAA 5IB2A 3EAKA 4M8QB 1N5YL 4NOFA 3MMEA 5FYLD 3P4OB 4LRIC 4PV8B 5I18L 3VFWA 5CLTA 1HOCB 1T20B 2OZ4L 2GJZA 4ODXA 5GS0L 1LILA 1ZHNB 4K2UH 4IDLA 4NQUA 5E8EA 4D3CL 4WV1C 5IHZB 2Z35A 1E6JH 2AS5M 4L3CA 3TT3L 2X1PA 5CP3A 1CE6A 5JR1L 2H32B 2PTTA 5I2IA 1L7TH 3PHQA 1BQSA 1QBBA 3KPSA 3QI9C 3FQUB 5D7LD 4P5TC 3KPLB 4HEME 4JZJA 3IF1A 3RFZC 5C9JA 3EJYC 3MCLL 5CBEB 2H41A 5EPMA 2NXYB 1T89C 3IFLL 3RI5K 1TIUA 4J3UA 1ZA3B 2P44B 2R1YB 5KSUA 2IBZY 1AY1L 3GUTB 4U1JB 3B2VH 3PGCB 2CGRH 2V2WB 2BDNL 4Z77A 4PR5B 3QWOB 3AAZA 1H3GA 2P5EE 4Y2DA 2GJ6B 4LQFH 4MWFB 3FRPG 4RMVA 3OKNB 3BYTA 5FCSH 1RJYA 3H42H 5GRXG 4LCCC 2N7BA 1FG9C 3EZ8A 4P49A 2C1PB 3OKKA 3TGXA 4MDJB 2BMKB 2GY5A 4JGMA 5FYLE 5FYKL 5CEXB 3FQNA 2XKNB 4QHLB 3LCYA 4OLXH 2DJ4A 2OZ4A 4HK3N 4MA1B 3ARDD 1B0RB 2HWZL 1CG9A 2JCCE 1JI1A 1RZFL 3WIFB 1U3HC 5TDPB 4WTWA 5DJXA 5DYOB 3BVNB 2HA1A 4P9HH 4Q58C 4YFLF 3F7VA 3LEYL 3VWJC 5I1AA 1BQHB 3HB3D 5CAYB 1MLCB 2QADB 3KYKH 1D5ZA 1HSBA 3TWCH 1OGAB 2EE9A 1FO0B 5EU5A 4JFPB 4MAYB 5CJBA 1ORQB 4D9LL 4JKWA 2X4SA 3CC5B 3K46A 4BM7A 3DRTA 5DJAB 4RRPA 3PJSA 4Q7DA 5FGSA 3R1GH 2Q3AA 3MJ8A 4LSUH 3JSSA 4CAGA 2CDEB 1MPAL 2D9QB 2B0SH 5E9DD 2R8SL 4WHTA 2BVPB 4RZCB 1OPGL 4U7MA 3V5HA 5FO7B 3QIWC 4YHML 3FO9B 5CGTA 5L8JB 5DFVC 1OGTB 3I6KB 4G8FB 3ZE0F 3EGSA 2WWKO 4S1SH 4KFZC 3GK8L 3HNSH 2ZG1A 1JUFA 3TV3L 4HPOH 4NHCL 4N1CA 4UT6H 4NWTL 5E4EC 3WUWB 5E2WL 4ZO7A 4GKNB 3REWB 3WFEL 4ORGA 1G9MH 4LPCA 5D7JB 4RIRB 2ORBL 1BVLA 4OF7A 4X9FA 1EAPA 4PJFA 3MV7A 1OAZL 4H20H 3WLBB 4U05A 1LP9B 4HKZA 1AO7D 3CAFA 2FECL 5DJ2B 1JWUA 1UKTA 5D96B 2P1YA 4M00A 5DJ8B 2GK0A 1S7WB 4KAQH 5ELIA 4P23D 3V6ZB 5D1QC 3SO5A 2YK1H 1INDH 3DXAA 1U8KA 2VZSA 1OT1A 2LVCA 1VERA 2YD8A 3N0PB 4ODVL 3SJVB 1P4LB 2VLKA 2YD6A 4Y2DD 3KNBA 3L5XH 3QEGL 4CU6A 3KYOB 4ZS6C 2VABA 3HZYA 3L9RB 2CMRL 1EPFA 1CFQB 1TPXC 4EUPA 4DKEL 1ZGLP 5AAWA 1A3RL 1OW0A 4XWGL 4NKMB 3QPXH 3HMXL 4Q9RL 3KPOB 3LB6D 1ZANL 4V2BA 3T1FA 5BMFL 2OTWB 1RUAL 3OQ3B 5E9DE 3EDKA 4GAGH 4L3ED 4LVHC 3C5JA 4QLRA 3TNNB 3ZT7A 2JJSC 3ECBB 2OX5A 4KQ3L 3TZVC 3D48R 3CVHA 1QA9A 2XACC 3G5VB 3UXFA 3BH8B 2ZUXA 1PG7L 3DX8A 3EDDA 4UV7L 1RMFH 4HIIA 1VCAA 3MJGX 3QNZA 2FWOB 2GUOA 3V6OE 1HIML 2AERT 3JV6B 3SO3C 4YDIH 4F2MB 1XGYH 3IJYB 1ZVSA 1ZTXH 2YSSA 3JTTB 4WO4A 3DECA 3W82A 1RZKH 5E5MA 3C6LB 1QOKA 3LQZB 1NMAL 2Q87A 5C8JA 1GZPA 1A3LL 3SKNB 1BFVL 3FQRA 1AO7E 4UIKH 4G5ZH 2GCYB 2EYTA 3U9PH 1SQ2N 2V2XA 5DEGA 4FTVD 2WBJA 1MELA 4XVSH 4KI5D 1AFVL 4ESKA 3UJTH 1T7WA 1VFBB 3A0OA 5CEYB 4TSAL 4DVRL 3PWLA 1E28A 2BSSA 2E7CA 4GRWE 4YQXH 1R3IH 2UUDH 2IPKA 4QTHA 3S88H 1K2DA 1AC6A 1CGUA 4RGMB 1GHFL 4C56A 4WGWB 5IVXB 1FFOA 1IFHH 2VITA 4JQIH 3BPNC 3MV8A 3HMXA 1KULA 1FL6B 5E94A 3QFDB 5IHUH 1IBGH 3BP4B 1I3VA 1CE1H 1QRNB 3U4BH 5TQ2L 4L3EE 2BHUA 4Y1AB 5C0CD 5HGHA 2EYRA 4JZNB 4ODSH 3HI6L 1U0QA 4P5KA 1RUQH 4PRDA 4FABL 2K7PA 1DCLA 1SJHA 3BWAB 3VXUD 3DXAD 2FLBT 4IRSB 1FZMB 1ES0A 2J2ZA 3ZKXC 4L4VB 2R2CA 4Z7QE 5F6IC 4P4KB 1AJ7H 2E7BA 1UJ3C 2JIXD 3RL1A 3AXLA 4NQXB 1JF1A 3QCTH 3EYQC 4JFXA 5E99H 3JWOL 4U6XA 1ZS8A 2VAJA 3AROA 5I0ZA 4PJDF 1EJOH 4Q9QL 4WW2C 3T0WA 5BQ7B 3MLUL 4AEIH 3V5DB 5CCKL 1LK3L 3BAEH 2YR3A 4FTVE 3L6FA 3DVGB 3QYCA 5HYQA 4KI5E 1F11B 1YY9C 3O6FD 4JQXA 3DMMB 5H37G 3T0EC 3WFZA 1A6UL 2HJKB 1T04B 4N0FA 4AG4L 4H0GA 5KVFL 3BD5A 5L2JB 4UU9A 5TQ0L 1A9EA 4KKAC 3LD8B 1QSVA 3L3IB 5IMLB 4HZLB 2VL5B 1X5XA 2ITDB 1WC7A 3FQTB 4NFCA 3B8SA 4OCRH 4S11A 1FFPA 1S8DB 1YYML 5HJ3B 3F7YA 1XGRA 1DEEB 1FRGL 2OR9L 4JY5H 3X13A 1ORSA 3SY0B 2CDFB 5BXFB 1NAMB 5DTFB 4LSTL 5C0CE 2X4QB 3EDFA 4OM0L 1RFDH 3KPQB 5EC1A 5KSAB 4ERSH 2VDQH 5HGBB 2VIRB 4DW2H 2HLFC 4IHOB 5DMGC 1SJEA 5JTWA 5IFJA 3DBXB 1NCNA 3BGFC 4D0BA 3VXUE 3QG7H 4N8CH 2OTUB 4UDUB 3VMPA 4R8WH 1HDMA 5ID0B 1G6RH 3DLQR 3UBXG 4C56D 2WIIB 5SX4H 4ZPTB 3DURB 3NABH 3IU3A 2EYSB 2HVJA 2R56L 1KPRB 1WQVT 4TYUA 3UJIH 4KWUA 4K8RH 2C4FT 2R0KH 2VZUA 5D2LE 1T22B 4I48A 3FCTB 1GGCL 4M48L 1XH3A 4BK4A 3ARYA 1C16A 4HSQA 4Y4KA 4Y88A 5HTSA 2R4RH 5B39G 4GG8B 2NW3A 4X5WA 5I1DB 4FG6D 1OSPH 2HT2D 4K7PL 1CU4H 1HKLH 4JM2F 5EUKA 2R1WB 3KLSA 3SE8L 2PN5A 2XZZA 3KJ4C 1MIMH 4EIGB 1J87A 2A6IA 5GS1A 5DJ6B 4C83B 2PO6B 2D7QA 2IFFL 3HKFA 5EO0A 3V0AC 1MCRA 4HBCL 1CDIA 5C07A 5I8CB 4N1HB 1AKJB 3T08A 3GHEL 2B1AH 4KTDL 5FK9A 5IK3A 4LSQH 5ISZB 4KKBC 5L2KA 3NMEA 4MJID 4YHZL 3DUUB 2NY0B 2PNDA 3HI5H 2NY6C 4FQLL 5HHVL 3TBSA 1TQCB 4UNUA 3PQYB 3MODH 1MCWW 3BSZH 3BRDA 4PRHB 1FNGA 1H3XA 2DYPB 2W65A 4I1NB 4NO2B 3TT1L 3BW9B 4UTAL 1ZVHA 3HUJB 4JDTH 4KHTL 3HTLX 4P5MB 2EIEA 4IRJC 1K8IB 3H3BC 2P7TB 1TFHA 4NZJA 4LRNH 3AFLA 1IGMH 1NFIA 2JB6B 4FQJH 5BS0D 3CMGA 3QCUL 1JGDB 2OXGA 4GOSA 1LEGB 4LLMB 4CGTA 5ICYA 5HY9A 1NJ9B 3WEXA 3FO1A 4H1LH 4LSVL 3U79A 3BQUC 3EOBA 4OIIH 4X9IA 2BOCA 3QEUB 5F6HJ 1NEZA 3VI3E 3EO1B 5FGRA 4PIRF 3OF6D 4HGWA 3M1BA 4PJHA 3JWDL 4ZOBA 1RUML 3TJEL 4OGAC 2IALA 2IPUK 4RISL 1MFCL 4MYWB 5A43C 2NTFB 4POZD 1X5AA 5D6DA 3SDCA 4YHKH 5JXED 3H9ZA 3G6AB 1BPVA 2R1XA 2QSTA 3LOWA 2YXFA 3WLWC 1UEMA 1X7QA 1J7VR 2C3VA 2EH8H 3MFGB 4MJIE 3AUVA 3QO0B 1R5IB 2BSRB 1VGEL 3RWDB 3RAJH 3OSKA 3SDAC 5D1ZC 4JFEA 2FSEB 1KCSH 4PS4H 1YNTB 5FB8A 3AU1B 1MF2H 1JZ6A 1MHHB 4EOWL 1JV5A 3FFDA 3MZTA 3PDDA 2R2BA 2NY1C 4HJGA 4M7LL 1QR4A 1LDPL 2HAZA 1UADC 1QNZH 3D39E 3TC9A 4FQIL 4JKMA 4ZXBB 3MGTB 4XPHL 2ZG3A 2COQA 3X3FL 5BVJA 1CYGA 4HWEH 2F15A 3RKPA 1B0GB 5SWQA 4NZTH 5GRJH 1NCAL 2YC1A 3GSUA 5BS0E 2E9BA 3FN9A 4DTGH 2A38A 3HAEB 2QR0B 1TVHB 1MCPH 4OKVA 1R3JA 5SWSA 1TTFA 3TVMC 2M1KA 1RK0B 3BIKB 2X09A 2A1WL 3MRBA 2C9AA 4JO4H 1ZMYA 3L5WA 5FO9A 4LP5A 1MFEH 3VD5A 5EBLB 2R0LH 3O6ML 5AG9A 4TQEH 2PYEB 2XRAH 4TRPH 1MHCB 2Z31B 3O3AA 2FRGP 1KJ3H 5HGDA 4W68A 3RJDA 3O6LL 3RA7L 1XGQB 1CIDA 2NR6D 1I1CA 4GKZB 4X9BA 4NQEB 4NO0A 5E03A 3N50A 3U0TA 1NUFA 3SDDB 4G8EB 1KN4H 4O2EA 4IOFD 1YPZE 1MVUA 4DN3H 4EI5A 1Q0XL 2XZAL 4KUCD 3LQAC 4KK9D 4Q6YA 3H9YA 4X6CE 4FOMA 2BNUB 4JPVH 5I15H 4J12A 5EOTB 1P5VA 3IDJA 4N8VG 1BJ1J 5JOPD 4UINL 2RR3A 4GUPA 5I1KH 2EDEA 1FVDA 4FMKA 5D2NC 5ANME 1KNOB 1LNUB 3OGCB 1S9WB 3EZJB 4XP4H 1IGYA 3SDCD 3WIIH 1CN4A 3NA9L 3UEZA 3WN5C 3JUYA 1IKNC 1A7OL 1I7RA 5E2TL 2P45B 4CL7A 1C12A 3QEHB 3VXOB 3BEVB 3LEVL 3AS1A 5D6CB 2CRYA 3RVTC 4F7EA 4ENED 1YEGL 2BNQE 3WXWH 1VFOA 4JG1L 3K3QA 2Y7QB 1TXKA 5F96L 1OTUD 3CXHK 3P73B 1A1OB 2XKUA 4HMEA 5EBMA 5FOBB 2BVQA 4NQDB 1NCTA 3EJZD 4OZHA 5ETUA 1TVDA 3UTZA 2EDFA 4NM4L 1AQDB 1NLDH 1R3HB 4JLRB 3TYFB 4LHJB 1K9TA 1QFHA 2BNRB 2WQ8A 4CN6A 3QNYB 4I0PC 3PHOA 4G8GA 4R4NC 5CIPB 1K4DB 4OZFH 4GMTH 5IVNA 3EJJX 4PJ5D 4CUCA 1PY9A 4IOSD 3HE6A 5E8PA 5KW9H 3E3QC 4OM1L 4PPTA 3BKCL 3VRIB 4F37F 4NM8L 3RZCD 3S8WA 2XN9B 4RAVB 3WXVL 2R69H 4MX7B 5JOPE 1WZKA 1DJSA 5E2UL 3ZSSA 4C59B 2E7LA 3LKRA 1JPFA 3Q6GH 5CZXD 2DM4A 1UZ6F 4U0RB 2OI9B 3LVEA 5JXAL 3FL7A 4MA8H 3MRQB 4H5SB 3TNMB 4BQBA 4K9EL 3O6KL 4YHNA 1ZLSL 5B8CB 4YBQC 3B9KA 4OFPA 4DOHB 1FO0H 4RFEA 3LSOA 2Z9TA 1BIIB 1AP2A 4OT1L 3DX6A 1F4WL 5F44A 3MRMB 4LF3B 4OLYL 2OQJB 1PX3A 2ADIB 3SPVB 1YECL 1NGYA 3RUGE 5K59F 2VLLA 5DMYA 1PYWA 1NQBA 2P8LB 2ZCHH 4EI5D 4HKJA 1FFNA 5TJWK 2CLZA 3DX9B 4NQCB 4P2RA 2IBZX 3PV6B 3PABB 1QFUL 5TF1H 4U1HB 4K23H 3ARFA 3MRIB 5T5NG 1CS6A 1PKQE 2HFFA 4G6KL 3D25B 3ARVA 3N85L 1BP3B 4WU5A 4M61A 4PJ5E 2NY2C 3V5KB 4LLYA 4E41A 2Z0BA 4K55A 4WEUD 5AYUL 1RJLB 1XCQA 1C5BH 5GGRA 2C3WA 5C0AD 1KIQA 2EDXA 4IOIB 1U8HB 4HXBH 4HXAH 4JCMA 3C2AL 3HNTL 1A9BA 4RAUA 3LKOA 3B9EA 3K1KC 4PD4K 2B8OT 1LEIA 4XB8A 3CH1A 4HF5L 1MJ7L 1L7IL 5D5MA 2YPVL 4APQC 1NC4B 5ITBL 4KI1A 4WWID 2IPTL 3MO1B 4GRWF 1IM9B 1MJ8H 1HXYA 1FL5B 3ULUD 1MRFH 1S9YA 3X11B 5DHVH 2D03L 5E6IC 4M62L 5DK3A 2MKWA 5GSVB 4Z0XA 4RMRA 5JDSB 1QBMH 1TJIL 3FJTA 4S1DD 2ZNXA 1G7QA 2XA8H 5DD1H 3HE6D 5ESVA 4JDVB 5IM7B 4I8DA 3OJDA 4GW5B 3QIUA 3CPLA 3TN0C 1TZIB 2Q86A 5HI4D 4YFLI 3REVA 3KPNB 3RIFK 1RI8A 1CGSL 4YHPA 4Z7WE 3D5OF 1XF3A 4U1NA 3BGMA 2ZOKA 4Y4HB 3LKSB 3MACL 2AJVH 4P46B 3RP1A 4LPVA 4TUOA 4IEFB 1A14H 2D0FA 2HFGL 2NY5H 4PJDB 5C0AE 2JTDA 1JPTL 2QHRH 1KN2H 2VMFA 1AGFB 2MQ3A 3LEXA 1YNKH 3QPQD 3VGAC 5FEBA 4U31A 4GLRH 3ZTJG 3P4LA 2EEBA 1OTSD 4UT9H 1N7ML 3OR7B 5HYJE 1JGLL 3T3ME 5I1CH 1ITBB 4P3CL 5C0JA 1F5WA 1DBMH 3LV3B 3UAJC 4WWKD 3WMSA 3AM8A 4NBXB 1TCRA 5IG7A 3IFOA 3ULUE 2ED8A 4FFYL 4QEGA 4XP6L 4I18A 1A6VH 1ZT1B 3SGDI 4JFZH 4E41D 3QUYB 1KT2B 4Y16D 3GO1H 3HR5A 4KDTC 4PTTA 5DFTA 5JW4Q 4OLZH 3MRPB 2V5TA 1KOAA 1LGVA 4GT7A 1F4YH 1WAAA 3QDGB 1BX2A 1C08B 3K4AA 3VRJA 1E6JL 1AXSB 2NXYC 35C8H 2D0GA 2GYSA 2PYFB 4WTXA 4HD9A 3TO4B 5C0DB 1L7TL 4X99B 4L4TB 4MD5A 5AD0B 4OCYH 1N2RA 1KJMA 2GK2A 3I3BA 1LD9A 2FB4H 4R0LA 3U36A 4F15B 1Q9WB 2IH3A 2NZ9D 1Z0NA 1I7TA 5T1LB 1G7JB 3MLYH 4GW4B 1NDGA 1Q9OA 1D5IH 4LMQE 4NQSA 3AC0A 3H9HB 1EA9C 2IGFH 1IEBB 1YN7B 3S4SB 3B2VL 3B3IA 2CGRL 2Q7YB 1OF2A 1R3LB 3CH8A 4LQFL 5C08B 1ZLUH 3VXNB 3V0VB 3H42L 1MRDH 1U2CA 3B9AA 1UJTA 1J10A 1WWBX 2Z92B 2WUCH 3I9GH 4I3RH 4GKSB 4AMKH 1CK0H 1I3UA 4Y8DC 3WS6A 4JHBA 4XCCH 4LIQE 1CCZA 2QADC 1DN2A 3K8LA 4QXWA 4PGEB 2P24B 4OLUH 3RWJA 4OLXL 1T21B 3W9DA 4LGPB 3VJ6A 1NAMH 3W39B 4Z7UB 1A47A 3RVXD 4MAYC 7FABH 3I3EA 4S0SD 4P9HL 1M7XA 1F42A 3V6FB 4XAWH 1DDHA 3WL9B 4L8DB 1T6VN 3KYKL 4LLDA 5F7HA 2IH1A 4PJ8D 2MOVA 2K3TA 5DZOA 3TWCL 4NYLA 1EMTH 4NRZA 4G9DB 3UZVB 3S37H 2ICWI 4QCIA 4R4BB 3RX5A 4U1KA 2MFNA 4OBSA 4YC2C 1X4XA 4HWZA 3R1GL 4G9FD 3NCBB 3W0WB 4NGHH 4LSUL 4WCYH 3MLSH 1T5WA 2XT1B 1CXHA 4XGZA 4BFIB 1N3NA 4BYHA 3ALPA 2B0SL 4P2OA 1WZLA 2NXZB 3O11A 5JW3H 4J4PD 4LAJH 4FQXD 1JNNH 3GJFK 4WUUE 5DD3H 3E6FA 3MV9B 5IBTH 5I16A 1A0QH 3E1F1 4NN6C 1AHWB 1KCRH 4S1SL 3HNSL 5FCUL 5D96C 5SWZE 3RWCA 1FVCB 1MCCA 3F8UB 4HPOL 1IZJA 4UT6L 2DQFB 3WO3B 3RNQA 1D7FA 2IAMA 5C7XH 1ULVA 1G9ML 1V8HA 3LN9A 4Q97A 1CQYA 2G75B 1XR8B 4MA3A 3ES6A 5JOEA 4WHDA 4H20L 3SGJC 5DXWA 4MNGA 1OP9A 1G6VK 4Z9KB 5E6ZA 4CMMB 4P23C 1DVFA 5I66A 4OKDA 3T4AA 4KAQL 2YK1L 1INDL 4BUGA 2EDNA 1N6QH 1ETZB 5J12C 3L5XL 1HI6B 1WWWX 4JRXA 4QT5A 4HKBA 1E4JA 1KLUA 4R3SA 5DK0A 1QBAA 3GHBH 4R97C 1CLYH 3EOAB 5DC4B 4G9FE 4UUJB 1R24B 2E27H 4ZAKA 5AEAA 2CO6B 1IGJA 5A2JH 3QPXL 3OJ2C 3LKPB 5DA0B 5MEQB 1WFNA 4NFBA 4ZUSB 2NY7L 4GAGL 2D9CA 3T65B 1ACYH 4KY1H 1RHHB 5C0IA 4NO5A 1U3YA 3OAYH 2YPLB 3UDWA 1J5OH 2VZTA 1OSZB 2AEIT 1IC1A 1GIGH 1C8PA 1T83C 3NTCH 1NKOA 2K1MA 1RMFL 2AV7B 2VE6A 3DV4A 2C3GA 5GGQH 1BM3H 4O2FA 4WHCA 3LIZH 5E4IA 4PRIB 4YDIL 5DRWB 1XGYL 3L95B 5EZLA 1ZTXL 4U1MA 1T66C 1RZKL 1A2YB 3BP5A 1YEKH 1QYGL 4QRPE 4UOW1 4AENB 1FNSH 1BFSA 1ZWIB 2X6MA 3BDBA 1PQZA 1JNHB 4G5ZL 4PLKD 5CFHA 3U9PL 1XF5A 2HG5B 4KI5C 1P1ZA 4FQPA 3TYGH 2X4PB 3EYFA 5DC9B 4XVSL 1JI2A 1FYTA 2YPKB 4AM0B 4XNMB 3UJTL 4YDVB 4YZFE 3T09A 4Z0BH 4KZEL 4YQXL 1MCEA 3S88L 5EUOE 1R3IL 3OL2A 1YPZF 5T3ZH 2AQ1A 2HJFB 3ULVD 1S9KC 1RZGB 2HTLD 3BRFA 1I1RA 1MHEA 1IFHL 3H0TB 2FJHA 4JQIL 3P30H 3ZKNC 4DK3A 4YO0A 1HH9B 5BZDA 1EHAA 5IHUL 1IBGL 2IAMD 4JFFB 1XF2B 4ZTOH 5DRZA 2AK4E 1CE1L 1YEIL 3U4BL 4GBXA 5ILTH 2DLGA 4P4KC 1SHMA 1JMXA 5C0BB 4EN3B 2LV4A 4R7NB 5D7LB 4M5YH 1WZMA 4J6RH 3QDMB 1RUQL 5H37H 1OAQH 1BBDH 4XPTL 3HAEH 4RMUA 2DI9A 1WWAX 3VRLE 1YMMA 2IWGA 3T1WA 1Z3GH 5EIIA 3GIZH 4L29B 3GM8A 2EDDA 4LSDA 1ACZA 1FJ1B 3DMMC 1XIWB 1LE5B 2QQNH 3GMRA 4JRXD 4JDZA 5E1AA 1AJ7L 4UDTB 3F12A 5E99L 3QCTL 5I71C 2UZIH 1EJOL 5IWLC 1NDMA 1R5WA 5DS8A 4IS6A 5IUSA 4ZAKD 1NFDA 4QRQA 4AEIL 3BAEL 4M6NH 5IP4A 4PTUA 4G6FB 4Q2ZA 3TBYB 4D94A 4N5ED 1M71B 5LBSH 5FGBA 2WLYA 2X4OB 4XP5H 3OJVC 1K4CB 1RK1B 3CFKB 5T3XD 3U0PB 4ETYA 1P2CB 3ILQD 5KSAC 5A16B 3ULVE 4H8WH 3W9EB 3H9SA 4L9LA 2H9GB 2O61A 1OT2A 4OCRL 2Y36H 3QB7C 4QRTA 1EEYA 3S3PA 5DEFA 3FRUA 5FKPA 4JY5L 1DANU 5INCB 1G7MA 2NCMA 2WANA 1AGEA 1JL8A 1F58H 1NGZB 4OF3A 1IAMA 4GW1A 4PY8J 5B38G 1RFDL 4PJEA 1UXSA 4OFIA 4H26A 4ERSL 2VDQL 5JORA 4XVUD 5IB2B 4DW2L 3MMEB 4HS3A 4OCXH 3VFWB 2FEEI 2PF6A 3QG7L 1NCCH 4N8CL 4ODXB 2GJZB 2P5WE 3ZHDA 3GIVB 5IBUG 3SDYH 1U95A 4R8WL 5E8EB 1G6RL 3VFVA 3TA3A 1T7ZA 3F7RA 2Z35B 1D5BA 3NABL 2BP3A 5DJCA 1P7KA 4L3CB 4XVJH 3UJIL 3ARUA 4K8RL 2R0KL 2VISA 1CE6B 5J56B 4NRYA 2PTTB 4JFQA 4N5UA 5KAQG 3P4MB 3SGDH 5I2IB 2BSTA 1RU9H 2AKRA 3PHQB 4GSDH 5KN5A 3KPSB 2DKSA 3WHXA 2OK0H 1ZT4A 4I2XE 2BC4A 3U2SA 1A1NA 1OSPL 2QV2A 1SBSH 4JZJB 3IF1B 4YX2H 5C9JB 1CU4L 1HH6A 1HKLL 5T1KD 5IFHH 1EHLH 3U9UA 1AO7B 5EPMB 2GFBB 2PW2A 4TULH 3EDJA 5JMRA 1N0XH 2UVEA 3H3KA 4TUKH 2O5ZH 5KSUB 1MIML 2AJSL 4N9OB 2APBA 1GC1H 4Z77B 2X70A 3AAZB 2DDQH 5JW4R 2NY0C 1G7IA 4Y2DB 5EU6A 1TQCC 4J1UA 5MERA 1RJYB 1HXMA 3QUZD 4F9LC 3OKKB 1YEHH 2B1AL 5EWIH 3PWNA 1EVUA 1C7TA 4LSQL 4JEGB 1FC2D 3FQNB 4U7SA 5HVWA 4ZSOA 1UENA 3OKEA 3HI5L 1CG9B 3L3JA 1G6RA 4GXUM 1SBBA 4KGLA 5FM5O 4ODTH 4MS8D 5DJXB 3MODL 2JK5A 2Y1VA 3F7VB 4Z5RA 5I1AB 2A2QT 4KMTH 4JDTL 5CJQH 3WJJC 3A6BL 5JUEH 4WEBH 5IBLD 4KKCC 1U8IA 4QXTA 4Y19D 2N4IA 5I76A 5EU5B 4LRNL 1IGML 4JR9H 4FQJL 1U8JB 3DRTB 3T8XA 4D0DA 3PJSB 4NQVA 1I9RH 3MJ8B 5IW1B 2FJGA 5KZCD 3HRPA 4YIQA 4WHTB 4LCYA 4BH8A 4PJBE 2P42B 5JPMA 4NO3A 5CGYD 3TA3D 4CN1A 3VH8G 3T3MF 4H25A 3BE1L 3KGRA 3EGSB 4XP9H 2R0ZH 3HC3H 1NUNB 4YHKL 3PWVA 1JUFB 3ULUF 1HHGA 4J3TA 4TNVK 2EH8L 1DBJH 5J6GA 1U8PA 5IEKA 4ORGB 3RAJL 1BVLB 2QSCH 1KCSL 3PL6A 4PS4L 1EAPB 4PJFB 1MF2L 3TBTA 3MV7B 5B3JE 2HRLA 2PW1A 3FN3A 3JBG7 4HUXA 4HKZB 5F7NC 1JWUB 4PP1D 1QNZL 2GK0B 1A7QH 1INQA 3ARBC 3DXAB 1U8KB 4QOKD 4WHYG 2VLKB 1II4E 1UCBH 4Y19E 4HWUA 4CJ1A 5IJKA 2VABB 3HZYB 2JF1A 4NZTL 5GRJL 2DQGH 2QSQA 1PZUB 3CMOH 4EUPB 4OFVA 4LOUC 4DTGL 4XT1C 1MCPL 4CU7A 4H1LA 5CJOH 1M6OA 4JN1H 2DQEH 4O2CA 1ND0A 3C5JB 3O6FB 3HFMH 4RA0C 5EU7E 4PGDA 3S5LG 3IU4H 1U8LA 4MNQA 1PKOA 1WJ3A 4JO4L 3CVHB 3X14A 1QA9B 3SDDC 1A7RL 1ONQA 2VLJE 1MFEL 3E2HB 4Z7VE 5CJXA 2R0LL 5CP7B 4YUEH 3DX8B 4TQEL 4HIIB 2XRAL 3QNZB 2GUOB 4TRPL 5K9JH 1F3JA 4QWWD 5HD8D 1HEZA 1KJ3L 1J0KA 2YSSB 5DD6A 5E5MB 1RZJH 1X6NA 2ITCA 3T2PA 4RGNB 1BZ7A 3MGOA 4JKPH 1L6ZA 5C2BH 1GZPB 1BGXH 1C5CH 4KXZI 2OSLA 1KN4L 3FQRB 4KTYA 4KJPC 1AD9A 4U33A 4NN7B 2EYTB 5EZOH 5DEGB 4JPVL 2WBJB 4HCRH 4P48A 3TH4T 3BZFB 5I15L 3DROA 4LLWA 3HPLA 3ZDYF 4QOKE 5D5MF 5I1KL 3BPOC 1E28B 2BSSB 4PRBA 4QTHB 2IPKB 5TGBB 3ZLQC 1K2DB 1P7HL 4PGCA 4YPJA 4XP4L 3NPSB 3SGKC 4PD4J 4C56B 4DJMA 1BEYH 4ZODA 1FFOB 3WIIL 2VITB 3MV8B 3QH3A 4WFHD 2RB8A 1FNAA 2WV3A 1V3MA 5E94B 3T2OA 1Z9LA 5KSBE 3P9LA 3DYPA 4PJIA 4KRNA 2WSKA 4NOBA 3RGVA 1H3TA 3WXWL 2EYRB 3IS1X 1Y18A 4P5KB 4S0TD 3DUSA 4PRDB 4ODBD 1V3JA 5K9QG 1I7UB 4HJ0D 5BW7A 5HBBA 5EOQH 1NLDL 1MH5A 1SJHB 2J4WH 5HYSG 1GGBH 3QDJD 4LK4A 4GAJH 3S34H 1J0YA 4OIBA 4BQ6A 3MGAA 3D0VA 1ES0B 3MRDA 4ODHH 5GXBB 2OJEB 4GMTL 5C71A 1CIUA 4U0RC 3MRLA 1N4XH 3AXLB 3OXRB 1JF1B 2EO1A 4JFXB 3X17A 4DCQA 4U6XB 4DK6A 5IB1B 1LQSR 5I8EA 1ZS8B 2Z8VC 3VXTA 2WNGA 5B8CC 3VG0H 3WNPA 1RZ7H 5KW9L 1ADQH 5A40E 5TE7H 3EHBD 4JPIA 3QRFM 1LMKA 4ALAH 2EDBA 3L6FB 3WE6A 1H0DA 5HYQB 2R69L 4OQ1A 4MQTB 1QLEH 3RI5F 2ZSWA 4EXPX 3MRHA 3FFCE 3Q6GL 4N0FB 2EKSA 4UV4H 3O45B 1CZ8H 3NCYS 4UU9B 1KJVA 2CRIA 4MA8L 1A9EB 1O7SA 4OLVH 3LRHA 5FUZH 1D6VH 4XPGH 4G8IB 1FO0L 1WC7B 3OX8A 4WFHE 5E56A 4QRUA 1K8DA 1FFPB 2WUBH 4G6MH 2D2OA 3F7YB 1B2WH 1XGRB 2N7AA 3S7GA 2HTKC 1ORSB 1T4KB 3HRZA 4CDHA 1UG9A 4YEEA 3MRCA 2R1YA 2ICCA 3UTSD 4NKIH 2A6JA 5EC1B 4GRLA 1ZEAH 1J1OH 2ZCHL 3ZKMC 3IDUA 1WAAF 1ZE3C 1YN6A 3VG9B 1SVCP 1SJEB 5IFJB 4M7JH 3SCMD 3QDJE 4D0BB 5TF1L 1P84J 4K23L 3V8CA 4DUVA 4OZFA 4IMLB 4CNIA 1U2HA 4KJQC 4RMSA 2H8PA 1HDMB 4PG2A 4LNVA 5LGHH 2XKNA 3IU3B 2HVJB 3GMQB 2EXWC 3BDYH 5LG1A 2VR5A 1C5BL 5DRXA 2XI9A 3I50L 1KYOK 3VFRA 3F62A 4NCDA 3AB0B 4HXBL 3OKOA 4HXAL 5E8DH 5I19H 1XH3B 2F19H 1CFNA 1C16B 5EZIH 4OF8A 4Y4KB 1FIEA 4F80A 4X8XA 3P0GB 4X5WB 1D9KD 5D1XD 5DJDA 2E6JA 3BPLB 4PJ9A 5E08H 5EUKB 4YZFF 1YPZB 3PWJA 1FO0A 1UCTA 5EUOF 3WFHA 2VQTA 1MJ8L 3M8OH 4PYHA 4JCLA 1MRFL 5D7IE 3FO2A 4DUWA 5IOPA 5GS1B 4PGJA 1I85C 5KG9A 1QBML 4Y4HC 3RVUD 3LH2H 1N59B 5C07B 2XA8L 5DD1L 3UTSE 4EDXB 3ARED 3FB6A 1CDCA 4KHXH 5FK9B 1JYNA 5IK3B 2JLLA 4ZNEE 3RBGA 5L2KB 4ELME 5F1KC 2FR4A 1G9NC 2VLRD 3VRLF 3KAAA 5EU4A 3FB7A 4X7TA 1AI1H 1NMCB 4D8PA 3TBSB 3QZWG 2DIAA 5C09E 3N06B 1HHKA 1MAMH 3HZVA 2AJVL 3HCVA 1DQJA 1OHQA 1XFPA 4MZ3A 1M05A 5F1SA 1G1CA 1FNGB 2W65B 1A14L 3I02A 1EFXD 3HG1A 3OZ9H 1Z5LA 2QHRL 1LP9A 1JGEB 1D6EA 1KN2L 4K94C 5CWSA 4MB5A 3TFKD 1YNKL 3U7YL 1KIUA 4QGYA 1NFIB 2ZOLA 4MQ7A 5FYLH 3ZL4H 3QUYC 1F6LL 4GRLD 4YGVA 3WO4B 1V05A 5HDLA 3UYPA 4UT9L 5I1CL 4C4KT 5ICYB 3WDJA 5HY9B 3WEXB 5MEOA 1JGUH 3VDBA 3ULVF 3FO1B 3OKLA 3EOBB 4XI5D 4B7IA 5DHVA 2BOCB 3QUXA 3ZT5A 3T0VA 1NEZB 3B9DA 1NH6A 4HGWB 3F58H 3M1BB 4PJHB 1A6VL 2DJSA 4DEPB 2IALB 4JFZL 1MOEA 3DWTA 3UO1H 2L0DA 3GO1L 3SDCB 4JRWA 3MOQA 4OLZL 1S5IH 2R1XB 3PGFH 4L1HA 3VI4E 1X7QB 2C3VB 1F4YL 3RWGA 4G3YH 3L3KB 2P43B 2VLRE 2DQTH 4XBGA 4HKXA 4HUVA 35C8L 4JFEB 5FB8B 4O5LH 4ZOAA 2K9UA 3RPIA 1JV5B 3FFDB 3KYNA 4F2MA 3IJYA 1CFTA 2R2BB 4HJGB 3EDEA 5ACZA 1URLA 4L4JA 2FB4L 5KVEH 2H26B 3MCKA 5FGCE 5BVJB 4WDIA 3RY6C 3MLYL 3SQOH 3VFOA 2F8XC 4BZ1H 1D5IL 4PJ5B 2IGFL 4PJGA 4JPKH 4ZUTA 2YC1B 3GSUB 4KV5F 4YDLB 3LQMA 5JIKA 1OB1A 2J7LA 4OKVB 5JHDD 2YXMA 1JHKH 1R3JB 2OMBA 4X98A 3BD4A 5SWSB 5DVLA 1MRDL 4OUUB 3D1MC 3TBWA 2FYYA 1PG7X 4UILH 2WUCL 3I9GL 4I3RL 4AMKL 3FHAA 1CK0L 4G7VH 4KVCH 3MRBB 1XT5A 3BP4A 1CDYA 5FO9B 3RTQD 4XCCL 4EJ1C 2RFXA 3C8KA 1MWAH 4OLUL 1GOGA 4HC1H 5C3LD 1NAML 2GY7B 1EK3A 4Q74A 1EHNA 2VERN 7FABL 4P5TA 5D4QA 1YEDB 3O3AB 5A2IH 4L1DA 3FRPA 2F53A 5HGDB 4M1DH 4QYOA 2AI0H 1FN4B 4XAWL 2YRZA 4F9PA 3QEQA 4JFDA 4IRSA 4NO0B 3U0TB 3MQIA 1YJDC 1HYSD 4O2EB 1I3GH 1MVUB 5IKCA 4EI5B 2CDGA 1BWMA 2R2HA 3K0WA 2X10A 5J13C 1EMTL 3ALWA 5CS7A 3S37L 1SY6H 3KLAA 3QUXD 3IDJB 1AHWC 3INUH 3L5HA 4LCCA 4GUPB 5GRVL 3SBWC 1FVDB 1FZJA 4LLAA 1FE8H 1NGXA 2W0FA 1KLFA 2AK1H 4NGHL 4WCYL 3MLSL 4XC1H 1IGYB 4HPYH 4W6WB 2DAVA 1HYRC 3ZZ1A 2WZPD 1T04A 3NCFB 1I7RB 1G0DA 3MCG1 4KXZH 5JW3L 2CLRB 5EB9A 1C12B 2K7QA 2PXYA 4XRCA 2VDKH 5J1AA 5JHDE 1JNNL 1U3HA 5DD3L 5IBTL 4QHKJ 4HZLA 1A0QL 1E4KC 2LU4A 4F7EB 4PJXA 1FFQA 5F3HA 4KH2A 1JFQH 1KCRL 3NIGE 3O9WC 3G6JE 1SM3H 5EBMB 3DETC 2VLMD 1HNFA 2BVQB 4OZHB 5ETUB 2CDFA 3UTZB 1CGTA 3TO2A 3VWKC 5C7XL 4EBQH 4GRWH 3STZB 3KPQA 3O8XD 4NFDA 5HGBA 2F58H 2VIRA 1G7PA 3QQNA 1NFDF 3CUPA 3PHOB 4G8GB 3BZEA 2X4NA 1I4FA 4PLOB 4BFBD 3HE6B 2DM2A 4P3WA 4KRPB 5E8PB 3VXSE 4R26H 2QEJA 2UZYB 1N6QL 4NC1E 5D9SA 1HZHH 2W0LA 2BCKA 4G42A 1T80A 1KPRA 2APVA 4TVPD 3GHBL 3LKRB 1CLYL 1JPFB 2Y07H 4M8VA 1DLFH 2E27L 1O7VA 3BYYA 4YPGA 4I4WA 3X12A 4GG6A 2Y72A 4YHNB 3NIFE 4CVUA 3B9KB 1U58A 2BVEA 3QI9D 4RFEB 4PJEF 1ACYL 4KY1L 3LSOB 3AY4A 5FDWA 1AP2B 2BVUA 3DX6B 3KDMA 1NGWA 2F53D 3EJYD 4NN5B 4EI6A 4EIZC 5DHXB 5J1TC 1J5OL 4X7FC 3BMVA 1GIGL 2NZIA 1NGYB 3QEQD 3NTCL 4UMGA 2ZG2A 1U92A 1PYWB 5GGQL 1BM3L 3LIZL 4HKJB 3VGDA 4OZIA 2XQBH 1FFNB 2CLZB 4U2YA 4P2RB 4YDKH 1DQLL 4Z7VF 1YEKL 2OR8A 4XH2A 1FNSL 3ARFB 3L3OA 5IB3A 2HFFB 4NJAH 1KUMA 1HSAA 2HKHH 1UH2A 2PR4H 4M61B 4WU5B 3EYVB 5GIRA 5FA3A 4LLYB 4E41B 1X5IA 3TYGL 4Y16B 5IQ9A 1XCQB 5J89A 1I1AC 1MCLA 1KIQB 4EN3C 3QXUA 4P3DA 4Z0BL 1U3HD 2X9XA 1A9BB 5T3ZL 3TZVA 2A0LC 4RAUB 4V1DE 3LKOB 5I8OH 4AT6A 4XXCA 4TVPE 2DYPA 4LCWD 2BRQA 1LEIB 2AJYL 3CH1B 3VWJD 3HUJA 2VYRE 3P30L 5HHOD 3R0MA 5D5MB 3UTTD 5GZOD 3P9MA 4ZTOL 2EE6A 3RX8A 1XIWC 2L7UA 5ILTL 5KS9E 1HXYB 3CJJA 1HILA 1S9YB 4LSRH 2AVGA 4M5YL 3D3VE 4J6RL 4XVTH 5FM4A 3SN6N 3T3PE 4Z0XB 1UWGH 1G7QB 5DQJA 1Z3GL 1SEQH 2Q8BH 1R0AH 3GIZL 1FORH 5ESVB 3TLRA 1NMBH 3OJDB 2XICA 5CKAA 2QQNL 1U3ZA 3QIUB 3QIWD 3CPLB 1F13A 3OAZK 3CVHH 2Q86B 1LO5A 2NTFA 3REVB 2EIZA 4YHPB 3U4EA 1XF3B 2UZIL 4U1NB 1KEGH 3BGMB 4QRRE 2ZOKB 4Z8FH 3LRSA 4C55A 5HI3C 1JJUA 4X7DC 4U6YA 2IAND 5DD0H 4M6NL 3ZE1E 3J7HA 4M7ZB 5LBSL 4TUOB 4FFWD 4XP5L 5EA0H 3GJEA 4RGOH 1TQBB 4ZOCA 4LLQA 3BP6A 1ZVYA 4BFGA 4HEPG 2W60A 4U1SA 2GTWA 3BIBX 5ALBH 2FX8H 1CI5A 1CTOA 4XPAH 3LEXB 4H8WL 3C09C 4LCWE 4GXUN 1JYWA 5HHOE 1YC8A 5D1QD 4UI2A 3UTTE 2Y36L 1YC7A 1NCWH 5C0JB 3MV01 1ED3A 4OBRA 5EN2A 3VD4A 1DSFH 2DWDA 1TCRB 1F58L 4ZS6D 1UJ3A 5IG7B 3IFOB 4QXGH 2D4FA 4YR6A 1WT5A 4I18B 4WW2A 2A83A 4YFEA 2ESVA 4N90D 1I9JH 4FS0A 4QRSB 3BIAX 3KPRD 2MCG1 1VACA 3TBVA 3HR5B 3O2WH 5CINH 1ZK9A 1WISA 4PTTB 4OCXL 2IEPA 2CO7B 4LFHD 1GZQA 4MSWB 1M1SA 3SDYL 2ZUVA 3TZVD 3V4UH 3P9WB 4U0QB 1BX2B 4FQXB 4PFEA 3C6SB 5FIEA 3VXRA 3VRJB 2HN7A 2FGWH 4XVJL 4QKXB 1GOFA 4LHUD 4XBPA 1J18A 2IANE 3LHPH 4OAWA 1RU9L 4GSDL 3ZHKA 2J6EA 4MD5B 2OK0L 5GGVY 1N2RB 1KJMB 1T1YA 1NC2D 4R0LB 1SBSL 4YX2L 3U36B 4QGTA 5IFHL 2IH3B 1S9VA 4S2SA 1I7TB 1EHLL 3ARTA 3UBXA 1NDGB 1Q9OB 4NQSB 1PY4A 4TULL 1KLGA 1KTDA 1N0XL 4TUKL 5KANI 5IGXH 3DSFH 4LMQI 2O5ZL 1FHGA 4GMSH 1A7BA 1IGTA 1GC1L 2DDQL 2ERJB 3T04D 4P2QD 1S3KH 1OF2B 3NOIA 1JZ4A 4XPFH 2J5LB 3QUZC 3QWRD 5B39A 4OZGE 1EGJH 1BQLH 1YEHL 4RCAA 1WTLA 5EWIL 2W9EH 4PB0L 5D7IF 4NNXA 4Y8AA 5DSCA 3GMNA 1QSEA 2HP4A 3KPRE 4ZO6A 3VCLA 3BKMH 3R06B 1X5HA 1A6TA 3VJ6B 4LDOB 3W11C 2A74A 3QXWA 4PY7A 4NKOB 1DDHB 1LO2H 1G7LA 3QNYA 4KMTL 5CJQL 5AZEH 4LLDB 5JUEL 2IH1B 4URTB 4WEBL 1JYVA 2B4CH 4U49A 4HWBH 3CNKA 3DSNA 4NYLB 4NRZB 2H6PA 1SEBA 3EYQD 2VKWA 1AE6H 1Z6JT 2Y23A 1AR1D 4QCIB 4MMXC 4BJLA 4JR9L 4H88L 2ZCLH 1KB9J 4UQ2A 1IZKA 4GQ9H 4HWZB 1I9RL 2KQNA 2NY4B 3KYAA 4JVPA 2FLRT 4OD3H 1T5WB 4XGZB 1N3NB 3I6LD 3LPGA 4P2OB 1WV7T 1YY9D 5EU7C 4ZYKA 3O11B 3PDGA 3T0ED 1Y6KR 4P2QE 1YNLH 4GFTB 4RDQF 5I16B 3E6FB 1J1XH 3EW3B 4KKAD 3VXRD 4XP9L 1EUTA 2R0ZL 3IYLW 3HC3L 2KDGA 3RWCB 2FGZA 4CDGC 4CKVX 5HHMB 3NZ8A 3MUGA 2HYMA 4KZDH 3NFSH 1DBJL 2IAMB 1A8JH 3SPVA 1RUPH 1JYXA 2QSCL 1P9MC 4DZBA 5FYJD 5FECA 1DQDH 4MA3B 3F6LA 2Q76A 3ES6B 4ISVA 1BQUA 2YZ8A 1OW0C 1MAJA 1FYHB 4MNGB 2F54A 1OAXH 2HLFD 3QCVH 4OLWH 3PABA 5DMGD 1QLFA 1DVFB 5I66B 3T4AB 3OG6B 1A7QL 3MRIA 3BQUA 5C0NC 1BF2A 4JRXB 1ROWA 1UCBL 2G9HA 4AL8H 4EUPG 4QT5B 2A9NH 1RJLA 5I30H 1KLUB 2DQGL 4R3SB 4Z78A 3CMOL 4NNPH 4IBLT 4B53A 1FLTX 1QSED 3G5YA 1H5BC 4ZAKB 5LKNA 1IGJB 4Y5YA 1I7ZA 2ZKHH 5CJOL 5IV2A 3MLTA 3I6LE 4JN1L 3WNNA 1DE4A 2DQEL 1HINH 3GKWH 3F7PC 4JQVA 2IPUG 1B4RA 3HFML 4WO4C 1KTLA 3T0EE 1RIHH 1MCJA 3JTSA 1S5HA 3HE7D 4NO5B 4RGNC 2CPCA 2ICWA 1TZHA 1RZIA 4HIHA 2HJLA 5D71H 3P40A 1J11A 4YUEL 4CADA 2VE6B 3DV4B 2L7JA 2WBJC 4OSUH 4NBZB 3QUMB 4O2FB 2XQYK 3STLA 5K9JL 4NDMA 3GSVA 5EZLB 2X4TA 1RZJL 3BP5B 5FYJE 1MY5A 1L6XA 4JKPL 4JDVA 4QHMB 1DBAH 5ESAA 5C2BL 1BGXL 4ZUUA 4DAGH 4OQTH 1PQZB 3P0VH 4BH7A 3ARRA 3UC0H 1P6AB 4KKBD 4PJCE 5EZOL 4X5XA 1XF5B 1P1ZB 2F9BT 3ESUF 3EYFB 2YMXH 2OYPA 4ONGH 1KYOJ 2BY0A 1FYTB 1OARH 1RJCA 3V0WH 3ZE2F 3TVMA 2NY6D 2QKIA 4FFZH 1DZBA 1GJIA 1A6PA 3QG6A 2GJJA 1WBXA 4LL9A 2V5YA 3QXTA 1BEYL 4X8JA 1J05A 1AIFA 1MHEB 5DQDH 2FJHB 1WIOA 4YO0B 1T5XA 5BZDB 3VE0A 4R90H 2CUIA 5DRZB 5JPNA 4IRJD 2GI7A 4WI6A 4GBXB 1I1YA 4K3DH 4RMWA 4N8VA 1Q0YH 1KB5H 3MRFA 2C1OA 3MLXH 12E8L 4HUUA 4JREB 3U6RA 4CW1A 5T1KB 3KXFD 4PRPD 5EOQL 1IQDA 5EOCH 1I9EA 3GSXA 1GGBL 4KDWA 5EIIB 3BQUD 2CRMA 4GAJL 3S34L 4ZQKA 1K5NA 3NIGF 4HS8H 2R15A 1KACB 3G6JF 4JQXC 5JDJA 2C5DC 2YD3A 4ODHL 3EFDH 4JDZB 2DKUA 1XGTB 5E1AB 4OGAD 4JZOA 3F12B 1N4XL 4KROC 5L0QB 4QTIH 5FV2A 2KKQA 2EECA 2A6DB 2J8UE 3WDHA 1X3DA 3VG0L 2G2RA 2R23A 1BJMA 1RZ7L 3FOLA 4U6HB 5DS8B 4IS6B 1ADQL 1BD2A 5TE7L 1NFDB 4QRQB 3UPCA 3WLWD 4I9WD 4YLQT 4HCRA 3ZKSD 4ALAL 1C08A 4PTUB 1Z9OA 4Q2ZB 1I8KA 2PCPA 5GGTH 3SDAD 1ZHLA 1QLEL 5D1ZD 5KVGH 2J88H 2XFXA 4UV4L 2XIDA 4K3GA 3TO4A 1CZ8L 4OLVL 5FUZL 5HGAA 4DGVH 1D6VL 4XPGL 2NY1D 3VG9C 1JIBA 3H9SB 2ZP0T 4L9LB 4L8CA 2WUBL 4G6ML 4QRTB 2PETA 4Q9CA 1EEYB 4FQ2H 1B2WL 5DEFB 3FRUB 5FKPB 5IT2H 3FAWA 3T4YB 1G7MB 1WLHA 1AGEB 3QAZC 3S3SA 1L4IA 3JWOC 3D2UA 3NIFF 4GW1B 2AJUH 4PJEB 4JKKA 1FGNH 4NKIL 1UXSB 3RJQB 4H26B 2ADGB 3MRKA 2P4AB 2LFGA 5JORB 1J8HA 1ZEAL 1J1OL 4JM2A 4KUZH 3VD7A 3KXFE 4HMDA 1QUNA 3O4LA 4PRPE 4ZUWA 4OTXH 1NANI 5KZCB 3AB0C 4M7JL 1T7XA 2BXZA 3TVMD 4Y4KC 5C6TH 4JRYE 2HFTA 5CLWA 3OB8A 1U95B 3RX7A 4PGEA 5LGHL 3TA3B 3O3DA 3GSRA 3BPLC 5DI8B 1D5BB 1YEJH 5DJCB 5IQ7H 1P7KB 5DURD 1OD9A 3CSBA 2WBWB 4Z7VB 3BDYL 5EO9A 3KS0H 2VISB 3NGBC 2X1OA 3MROA 1CL7I 4NRYB 4P57B 5CILH 4JFQB 2O5YH 3ULUH 2PUQT 1WFOA 5E8DL 5I19L 2BSTB 3SGEI 2AKRB 4NQTA 2F19L 2R4SL 3LN5A 5KN5B 4PJGF 5EZIL 3WHXB 1CDHA 1Q72H 4HH8A 1ZT4B 2BC4B 3U2SB 1A1NB 5H94A 1KBGH 5SX5H 5E08L 1BHGA 3CDCA 3IS0X 5FHAH 3U9UB 2PW2B 4X6DE 2C3XA 3KPMA 3M8OL 1FZOA 3C8HA 3DX7A 1E27A 2X70B 3UTQA 2ICES 2V17H 3RVUC 1G7IB 1U41A 3G6DH 1WGOA 4BFIA 5EU6B 3LH2L 3AREC 4J1UB 5MERB 2AXGA 3TJHC 3UROR 1HXMB 8CGTA 5KS9F 1BZ9A 4F8TA 4KHXL 3MLZH 4YXHH 1QFWH 3BHBA 3PWNB 3CFEA 4AIZA 5JHLH 5E1HB 3MOAH 3RVTD 2VXVH 4LBEA 4ZSOB 3RHWK 3OKEB 1AI1L 3L3JB 1G6RB 2VRAA 3IKCB 3Q6FA 4FRWA 3KLDA 4APQA 1MAML 2EXYC 1XF1A 2JK5B 4F7MA 1KF9B 4UB0H 3HNVH 5BRZA 2RAMA 1JZ5A 4OI7A 4R9HA 4Z5RB 5GRWA 2E7HA 2ZUYA 3OZ9L 3KHOA 4MB4A 2IJ0C 1EJ6A 1JTOA 3ARGA 4I0PD 4NUGH 5E6IA 3TFKC 1U8IB 3QRGH 4R4ND 4M5ZH 1GH7A 2H2PD 4QXTB 5I76B 3NACH 3D2UD 3ZE1F 4LIQH 5FYLL 3ZL4L 1J8HD 4WFGE 4ZUVB 3T8XB 4D0DB 3VGEA 4I5BB 4NQVB 2FJGB 4G6JH 1JGUL 4PJXF 4M3KB 4YIQB 4LCYB 4BH8B 5C9KA 5IFAH 4KKLC 4LEXH 1R24A 3U83A 3F58L 5JPMB 4NO3B 4HAFA 3NH7H 4ZOEA 4JAMA 4H25B 1UXWB 2DQHH 5MHSD 3UO1L 1F45A 1EO5A 3PG2A 2XY1A 3PWVB 4GAFB 3C60A 3BZ4A 3P77A 1HHGB 1P5UA 3PGFL 1WIUA 5INDA 3SDXE 3MOBH 1VB9A 4HUWB 5J6GB 4G3YL 4HW6A 1U8PB 2EZ0C 5IEKB 3NCCB 3BX7C 2DQTL 2VZVA 4D9RD 2VO5A 2G5BA 3PL6B 4O5LL 3TBTB 1OAUH 5HYIA 2PW1B 4JO2H 3C5ZC 3PWPD 4HUXB 2P5EA 3MPCA 3PP3K 2BZDA 4YDLC 1A4KA 3BJ91 3QIBC 3RWIA 2ID5A 4BZYA 2EKJA 5BCAA 1T6WA 1INQB 4JHZA 5KVEL 1WCBA 3JWDC 5EIQA 3IXTA 5D93C 4FN0A 3SQOL 4BZ1L 3WNKA 2P8MA 1CICD 4X9HA 4AM0A 5J7CC 3OKDA 3RGHA 1KXQE 2WW8A 4KDTA 1P53A 2JCCA 1H3PL 4RSVA 4H1LB 1M6OB 1JHKL 1Q9LB 4S1QH 1YMHA 4MHHG 4O2CB 2UWEE 2WIMA 1ND0B 3QFJD 5MEND 2NY3B 2FZ3A 3CFBA 4ZFGH 2BJMH 1U8LB 4MNQB 4G7VL 4KVCL 4OZIF 4JFOA 1T1ZB 3GMLA 4APQD 3X14B 4MAUH 1ONQB 3BEWA 1YJDH 1MWAL 3BKYH 3MXVH 2ZNWA 3AS0A 3JVGA 3UYOD 5D8JH 4EQ2A 1F3JB 1W8OA 1T2JA 1HEZB 5H35A 1HQRA 4M1DL 2AI0L 5DD6B 4D9RE 5JW5A 4OD2A 1F8TH 2ITCB 2E8YA 1OAKH 1BZ7B 3MGOB 1FJ1A 3L5JA 2OSLB 3PWPE 1I3GL 1KPUA 2NX5E 1AD9B 4W6XB 1DQTA 1F4AA 3M17A 3QHTC 4UDTA 3ROOA 5FM8A 3CZFA 3TN0D 4FP8L 1KCLA 2YEZA 1EZVY 1SY6L 1ZLVH 5BVPH 3DROB 4IIQC 3HPLB 4LLWB 4OV5A 1B0WA 3INUL 1MI5D 4NC2B 1QSFD 1WBZA 4LPUA 2D7TH 2AK1L 4PRBB 1KXTB 1E4WL 2FHBA 4PGCB 4XC1L 1JNLH 4LLUB 1LO3H 4HPYL 1FPTH 1QO3B 4X6BA 3ARDA 1GAFH 3QH3B 1NCDH 3ELAT 4LPXA 3P9LB 4U1GB 1I3RA 2WWKT 3W9EA 3QFJE 3RGVB 3S36H 5MENE 1F6AA 1FL3A 4AJ0A 5F88A 5I74B 4CMHB 1SM3L 1Y18B 3DUSB 3B5TA 1UM5H 4KRPC 1MWAA 1MUJA 4HC1A 4N0UE 5F9WC 3Q0HA 4NZDA 1WBYB 1MH5B 3DTXB 3KPTA 3UAJD 4EBQL 2AEQH 2VR9A 3LS4H 1U36A 5EIVA 2F58L 2YWZA 3LRGA 2E7LC 3D0VB 1FVEA 3MRDB 3NAAH 4XCFH 6FABH 1T0MA 3MRLB 3KHQA 4DCQB 2A9MH 2XTLA 5I8EB 3IKKA 5ALCH 4YHOL 5E9DA 3VXTB 3OWEA 4MMZC 4U2ZA 3B9KC 3GIVA 1VFUA 4HIEA 4R26L 4JPIB 1JZ3A 1YYLL 1HZHL 4LVNB 1NAKH 4LGRB 1SY6A 1MEXH 4PV9A 1H0DB 3WE6B 4NN5C 2VN7A 4XNUH 1A64A 3PXJA 2NXYD 1DBBH 4OIAA 1L9NA 1MI5E 3MRHB 2Y07L 2ZSWB 3I2CH 4HX1A 2EKSB 5IROC 5IVZB 1QSFE 1UYWH 4XZUA 3EYUH 3IFNH 3P4MA 1DLFL 5LXGH 2QQQA 3V6OA 5GZNC 5CZKA 4HULB 1KJVB 2YUZA 4DKAA 3C87A 5E00A 2GJ6D 3OX8B 1CGXA 5L88H 4QRUB 1K8DB 1AQKH 3MR9A 3NVQA 4WW2F 4YFDB 3ARFC 4JANA 1AO7A 5DJ0A 2GFBA 3HRZB 2DTMH 3FZUC 4J3WA 4OCWH 1ZLWH 3SGJA 4X4YA 2C4FU 3MRCB 4NT6A 4F57H 4MQSB 1PVHA 1A1MA 4P23A 2A6JB 4Z7NE 5ESQA 4GRLB 4Y7MA 2ZJSH 4PB9H 2XQBL 4FZEH 4M1CC 4F3FA 1PX4A 2Z93A 1UWEH 4XCNA 4PRAA 1YN6B 2I9LA 4L8BA 2ATPA 4YDKL 1R5VA 5BZWA 3ULVH 3MYJA 3SKMA 1XR9A 2XTJB 3UX9B 2FJFB 4OZFB 4J8RA 4NJAL 4CNIB 3CSYA 1QG3A 5K33A 4MA7H 1OM3H 3NN8B 2H8PB 4ONOA 2PR4L 1L0QA 4PP2A 4WI7A 2QADD 3BUYA 4WU7A 1GGIH 4L3EA 5E24E 4MJ5A 1MFBH 1OGAD 1MCHA 5DRXB 3I3DA 5F7KC 1Y6NR 4MAYD 3VFRB 3OKOB 3RDTC 5EU3A 3QSKB 1NANH 4FNLH 3OXSA 5I8OL 4NRXA 1CFNB 1V3LA 3LKQA 4DUXA 1CXIA 4OGXH 5BV7H 5DJDB 5GZOC 2I9TA 3CX2A 4UAOB 4L9DA 4PJ9B 1KCKA 3PWJB 4KC3B 2ENSA 4PLJC 3WFHB 1IAOA 2GJ6E 1W2KT 1T3FA 1U8JA 4LP4A 3IAPA 4LSRL 3EBAA 3FO2B 4XVTL 5IOPB 2VWEC 1CL7H 4Y4FC 5IW1A 5CMAA 5KG9B 4KK6C 5F8RC 3SGEH 1UWGL 3DVFA 5IB4B 4LKXA 4FTVA 4TNVF 4RQQB 3FB6B 3K2UH 5A1AA 1SEQL 2Q8BL 1R0AL 3OB0H 1FORL 1VFAA 5I73B 5HHPB 1NMBL 4WFFD 5T3XH 4RNRA 1BOYA 3DNKA 5DK2A 3CVHL 3D6GA 4WI8A 3LDBC 5DUPL 2FR4B 5EU4B 3FB7B 4X7TB 5ID1A 1KEGL 4Z8FL 3LPFA 3G6JB 4D8PB 3FB5A 4LVOB 3QUMH 1HHKB 2CLVA 3HZVB 3HCVB 1DQJB 4X4ZA 5DD0L 5HPMA 3SJVD 4FFWC 1OD7A 1M05B 1OGAE 5C0CA 1S9XB 3AM8C 3V52H 3I02B 3HG1B 5EA0L 4RGOL 1Z5LB 2J8OA 2J8UF 5ICZB 1D6EB 4DZ8A 5CWSB 4MB3A 5ALBL 2FX8L 2KL6A 1RJZA 1XAUA 2ZOLB 4MQ7B 4HG4J 5D72L 3VXUA 4YGVB 1KCVH 1NL0H 3RVVC 4RWYH 3VGHA 1NCWL 3DV6A 1DSFL 1KJ2H 2JIXA 5MEOB 3OKLB 1JPST 5DHVB 1RIVH 2F5BH 3S35X 4QXGL 3QUXB 2UV3A 3FT3B 5D2LA 5IWLA 1I9JL 5JZ7D 3T77A 5I75C 1OCWH 4XHJC 5CINL 3O2WL 3O6FA 2VOTA 1KGCD 3FOMA 4WFFE 1KCUH 4C4KO 3C6LD 1IGIH 1JN6A 4R0LC 3V4UL 3RWGB 2DM3A 3W5MA 3OAUH 3IVKA 5CP7A 4XBGB 5B38A 4HKXB 4JB9H 4HUVB 4DFHA 2O26U 4MXVE 3RPIB 5GJTH 3KYNB 4LFHG 5GJSH 3DJ9A 3ULSA 4L3AA 1CFTB 3LHPL 3SJVE 2MJWA 2ERJC 3QHZH 1IILE 2LAGB 1T66D 4JG0H 1BFOA 5ACZB 2YS4A 2J5LC 3O8XB 4R96B 1UB6A 4LHUG 1LO0H 4WUKH 4DVBA 3MCKB 2UY7A 4WDIB 3VFOB 4BZ2H 3BZFA 4PJGB 3KLHC 4ZUTB 4ZDHB 5IGXL 3DSFL 2QSVA 1QRND 1QACA 5J0BA 4GMSL 1DLHA 1OB1B 1P4IH 3VW3H 5TGBA 3TH2T 4B0MM 1S3KL 2AEWA 2VZ1A 4XPFL 4X98B 3RWFA 2XWJA 2YD1A 4X6DF 1PDKA 1XGPB 2ZWLT 1EGJL 2FYYB 1BQLL 3TBWB 5HHQA 3ET9F 3ZKND 1FLRH 3EYSL 2AJ3A 4PGZA 2GKIA 1MQ8A 2WBKA 4J2XA 1NFKA 2XWBA 4Q0XH 2RFXB 3C8KB 1NSNH 1MJUH 1KGCE 4L4VD 2DBLH 1E4XI 1YQVH 1Y0LB 2O5XH 3QI9B 4P4KD 3WIHH 1J9CT 3ME0A 4P5TB 1I7UA 2VDLH 2XKSA 5HDQH 2F53B 1EEQA 3RKDC 4QYOB 5J6HA 2VXUH 4F7PA 2LTQC 4GO6B 4F7CA 3QEQB 4JFDB 1LO2L 4P2OC 5AZEL 1IE5A 1OQOA 2Y6SC 3DMMD 2OJEA 3D87B 1IT9H 2CDGB 5IKCB 4NKDA 2B4CL 3CLFH 2R2HB 3OXRA 5IB1A 4HWBL 2XOTA 1AR1C 3ZMRA 2X2YA 3KLAB 4LARH 1AE6L 2N56A 4J3VA 2ADFH 2ZCLL 4LCCB 5IVXE 3BO8A 4GQ9L 5F9JA 1FZJB 3GBMH 1CVSC 4KGJA 1NGXB 2W0FB 4OD3L 4MJIA 4X5LA 2P48B 2YD2A 3SOBL 4G43A 1QRNE 1Q94A 3ZT6A 3UYRH 3T0BA 4Y1AE 4LNRA 3O45A 2L4OA 1JPGA 3IDXH 2PXYB 4XRCB 5LWYL 1YNLL 2P49B 5KSAD 5J1AB 3ALXA 1U3HB 3IFPB 5DQ9A 1J1XL 4NUJA 4P9HC 4G8IA 1EGJA 1OLLA 4O58H 4PJXB 5F3HB 1MJJA 4NBYB 2AP2A 4LCWB 2PKDA 3D39A 1DVFC 4WFED 1CLZH 3QP3A 2DQDH 3B43A 4G80A 1T4KA 4KZDL 3NFSL 2FO4A 4E5XA 1B3JA 5F89A 3TO2B 2R29H 4W4NA 2HT3C 3V4VH 4L4VE 2D0HA 4FQHA 1CR9H 1RUPL 2X4UA 5BS0A 3DGCR 3QWQB 1DQDL 2BFVH 1G7PB 1AH1A 5GGVH 3Q48A 3CUPB 5C2UB 4PJ7E 3BZEB 3VH8A 3SDXF 2HT4D 1OAXL 2X4NB 2KZ1B 4OLWL 5LQBH 4BSWA 1V7NH 5JNYA 1I4FB 3JXAA 1OWWA 4AEEA 4UOW0 4IMLA 3OF6A 4HWBA 5J8OA 2ARJQ 5D9SB 5MEPA 4X83A 2BCKB 4G42B 4AL8L 3GMQA 1JHTA 5LGKA 2A9NL 5I30L 5I1LB 2IBBA 5JXEA 2ZPKH 5GISH 4NNPL 2LQRA 5ITFB 3DI3B 4OF6A 4YPGB 1J1PH 2KH2B 3QXAA 1OP3K 4I4WB 3X12B 4GG6B 2ZKHL 1FCGA 1F2QA 2PO6D 1HINL 1U58B 3GKWL 1KENH 4R2GB 3HE7C 3JV0A 3GMPA 1RIHL 5FDWB 3KDMB 1AKJD 1NGWB 3BH9A 1YPZA 2CKBB 4EI6B 1IC5H 4Z7OF 4X6CA 3ZDZE 3I85A 5ISZD 5D71L 4DKFH 3QBTB 1U92B 2UWEF 4WFEE 4RBPK 4U1IA 4OSUL 1A7NH 3C5SA 5F70A 1X5YA 4OZIB 3ARBA 5ANMA 5GS3A 4X6FA 2NY0D 1N59A 2F8VA 4EDXA 1VPOH 5K93A 2GT9A 4XH2B 3S5LA 3VD9A 2Y25A 3L3OB 1DBAL 5IB3B 4DAGL 4X7SH 1YDPA 1HSAB 1EAJA 3VFMA 3P0VL 3CD4A 5GPRA 2FBJH 1NKRA 1UH3A 5GIRB 3UC0L 5FA3B 8FABA 2ADJA 3VDAA 1RIUH 4GLRI 2BNQA 2VKXA 5IQ9B 2YMXL 4GBXC 4ONGL 4L5FH 5E8NA 5T5NF 1OARL 3V0WL 1PEZA 5CEZD 3WYRA 3RVWC 4FFZL 25C8H 4P3DB 4R6UA 3TZVB 4JREC 5JQ6H 1A3LH 4AH2A 2ENYA 4AT6B 4M02A 3DRQA 3D39D 4RMQA 5DQDL 5IHBA 5DD5H 1JGEA 1J8KA 4MJ2A 5M94B 3P9MB 4R90L 4KKCD 1DFBH 5FUCC 3MBEC 4K3DL 3BT2H 5F3BA 1RZKC 1PSKH 1Q0YL 1HILB 3MLXL 1X5FA 5LAXA 4W81A 3FTGA 4M6AA 5ERWA 3DPBA 5EOCL 5ISZE 5DQJB 1FP5A 4WVRA 5E95B 4HS8L 4A6YA 5TQ2H 3T2NH 3VFGH 3EFDL 1QVOA 4P2QB 4H0HB 4YHYC 5T1DH 1FV1A 4MD4A 3PQYE 3S35H 1LO5B 2WWMC 2Z8SA 4QTIL 2EIZB 3U4EB 1A6ZA 4OQTA 1MIEH 4W70A 4PRHE 3LRSB 4L9LC 1J86A 3BPNB 4YNYA 1JMZA 1T2QH 1P7QA 3L3KA 1QQDB 4U6YB 4ZXBD 5HYSA 1LO4H 5GGTL 1DN0A 3RUGA 2HLAA 3DOSA 5KVGL 3GJEB 2J88L 5CEZE 4X4XA 4LLQB 3BP6B 2VL4A 1FG2A 2W60B 4U1SB 2GTWB 1MAKA 5I1IH 1XMWA 4DGVL 5LGJA 1PFCA 3SE3A 4MQXC 1D3CA 4OFDA 1QPXA 2H26A 2VDPH 1PKQA 3ARBD 4FQ2L 3VDCA 4P0DA 5IT2L 3TEUA 5EN2B 1ED3B 4PJ5A 3ZKXB 1UM6H 2DWDB 5F6IB 1KB5A 1BOGA 1UJ3B 1W0WA 2AJUL 1EO7A 4QF1B 1FGNL 4YR6B 4OCSH 4JHAH 4KUZL 4LOUD 2Q3ZA 4WW2B 2A83B 5TE4H 1EEZB 2ESVB 3RZCA 4OTXL 2ICWJ 5EBWA 1VACB 2Z31D 3TBVB 5C0EB 1YYMH 1MLBA 2BNQD 4OUUA 3LMJH 5HVHC 4POYA 1HKFA 2CK2A 3HI1A 1BAFH 1VESA 3QXDA 5C6TL 5DC0A 4Z7NF 1GZQB 3NBNA 3VXQA 1CLCA 2EE2A 4NQED 4U3CA 3DVIA 5L7XH 3SDDD 3H7BA 4ODWB 5EZJA 1YEJL 3VXRB 5IQ7L 1BJ8A 2HN7B 2IG2H 4YE4H 2OL3H 1JK8A 4XBPB 1YEDA 1EX0A 5CILL 2O5YL 3ULUL 3QO1A 4OAWB 5GGTA 1FN4A 3ILPA 1T03H 5TPWH 4JHWH 4B7LA 4NP4H 3L3HB 1Q72L 3H6JA 1T1YB 1PGRB 5EULV 3BN9C 1M7DA 5JO5A 2JCCF 1R3KA 1KBGL 4XPBH 1S9VB 4S2SB 1J0IA 3HN3A 4KJPD 4Y5VC 3UBXB 5FHAL 3EUUA 3P11H 3BPCA 4KVNH 1KLGB 1KTDB 1U91A 4J23A 3BGFB 2P8PA 4Z7WA 1IGTB 2VUYA 4XCYA 2V17L 1IKFH 3N1GC 4QHUB 3G6DL 5CHNA 3HHRB 2FHCA 4K7PH 4NQDD 1VKXA 5B39B 2Y06H 4K8RC 4DN4H 2BVYA 2UY6A 2CLRA 4YXHL 5C0AA 2HVKA 1JHLH 2Q8AH 2BNRD 4NNXB 1P7QD 5D7KD 5DSCB 3GMNB 1QSEB 2PYEE 3MXWH 2MHAA 5JHLL 3VCLB 5DUBA 3MOAL 2N1KA 5IMMA 1A6TB 2J3SA 2A74B 5AUMA 4PY7B 4NQEE 5HYJA 2XG4A 4HAGA 4UB0L 1YEFH 1SMAA 3STZA 3HNVL 3S37X 3VFTA 2XN9D 1G7LB 4P99A 4YHLH 2EH7H 2H2PC 4WI9A 1FIGH 4NUGL 3QRGL 1I85A 1TITA 4M5ZL 1SYVA 5FO8A 5DMKA 2H6PB 3NACL 1SEBB 4LIQL 1IRAY 1E4XH 3LAFA 4BQ8A 1AGBA 4UQ2B 3QZWA 5I6XB 5IEHA 1FC1A 3K80A 4S10A 3GRWH 4G6JL 3VGFA 1CLOH 4KHTH 4XWOC 4MCYA 2DBJA 5HSFA 2APXA 3GSQA 4HZAA 5E2VH 4U6VH 1H15A 4ZYKB 5DJZA 5IFAL 4LEXL 5DR5H 3HA0A 3NH7L 3G5XA 3MRJA 4NQDE 2DQHL 4O02H 5T33H 4WI4A 1X5GA 4NQCD 1KIRA 5F7EH 2BNRE 3RWEA 5D7KE 3NZ8B 3ZKQD 3CFJB 3MUGB 2Y5TA 3MOBL 1FZKA 1AXIB 2HTKD 4UIMA 3HMWH 4TSCH 1RUMH 4DZBB 5FECB 2V7NA 2Q76B 1OAUL 2D7NA 3WS3A 4ISVB 4JO2L 3ZKMD 1M7IA 3A6CH 4IRZH 2F54B 4WWKA 1AGDA 1QLFB 4HIJA 2BXYA 2XN9E 5EFIA 1U8QA 2SEBA 4LSSH 3BQUB 5E5UB 1P6FA 1GGUA 5K9OA 3EYVA 1XGUA 4KJQD 2G9HB 5HXMA 1CICC 1GPOL 2NQCA 3CFDA 4Y16A 2RIKA 2EXWD 4Z78B 4DOHE 1U8MA 1WCQA 3G5YB 4Y5YB 1ERNA 1I7ZB 1C1EH 3QJHA 4JY6A 5IV2B 3MLTB 1DE4B 4S1QL 2ZZUT 1P4BH 2VDOH 3ZSTA 5T5FH 1KTLB 3SDAB 3JTSB 5D1ZB 4ZFGL 2BJML 1S5HB 3STBA 5HYJD 1N0LA 2ICWB 1TZHB 4MAUL 1RZIB 2VC2L 4HIHB 3V8OA 1EIBA 2HJLB 7CGTA 1YJDL 5BOPA 3BKYL 4NQCE 2RGSA 4KJWC 4CADB 5JA9A 1CFSA 3STLB 2PTVA 2YA1A 4NDMB 3GSVB 5D8JL 4Y5XC 2F74A 4Y4HD 1BECA 4X4ME 2X4TB 2YWYA 5JW4M 1OAKL 3QQ3B 5ESAB 4ZUUB 5I0DA 5E6YA 2VDNH 4BH7B 4Q6IC 3GI8H 5F7FA 2XWTA 5FFLA 3F6IA 3UBXI 4X5XB 4LU5H 1FSKB 4LKCA 5M7QA 5BVPL 4C57C 3RGVC 3FQWA 5SWZA 3TVMB 2IADA 2QKIB 5I74C 4TNWF 2D7TL 3PHSA 3QG6B 4RFNB 1WBXB 5ADPL 4Z7QF 1JNLL 3QULA 4X8JB 3LY6A 3QISA 1J05B 1LO3L 1AIFB 5BW7C 1FPTL 5DURB 1KSRA 2D31A 2FEDD 4PGBA 1GYAA 1GAFL 4NKQB 4NNYA 1T5XB 1NCDL 2DMKA 5IVXF 2UZXB 3VE0B 2GAZA 2DKMA 4BK5A 5JPNB 2B2XH 1I1YB 1VEMA 3S36L 3VXPA 3L3GA 3VGGA 4N8VB 4KI5F 5AWNL 4K71B 1TJHH 3MRFB 3QUYD 2C1OB 4HUUB 1S7TA 4XHQA 2MPAH 1UM5L 4PJ8A 1SYSA 5GRYA 4CW1B 4EDWH 3U6RB 5F1NA 1UVQA 4CJ0A 1IQDB 4ZD3H 5A3IC 1QTYT 5K9KA 3GSXB 4LCIH 4XMPH 3QDGD 2AEQL 3LS4L 5DRNA 3LEVH 5DUMH 4YWGH 4ZQKB 43CAA 1K5NB 1I8IA 1S78C 4N9GA 4TVPH 4XNQA 1A3QA 2VXSH 1YUHA 4G9FA 4QRSA 3KPPA 3NAAL 5D2NB 4XCFL 6FABL 4JZOB 2A9ML 2EDTA 5ALCL 4N0CC 1BBJA 2XXMB 1P84K 2G2RB 2R23B 3FOLB 4QNPE 3WN5B 4MSWA 1BD2B 4IJ3B 4J4PA 4K2UL 4PJDE 3ZTNH 4FQXA 3C6SA 1NAKL 4PJ7F 3VFNA 4QO1A 1MEXL 1I8KB 2PCPB 4XNUL 2BK8A 1E4KA 1ZHLB 5FKAA 1DBBL 3I2CL 2XFXB 3UTPE 2XYCA 1UYWL 3EYUL 3IFNL 5LXGL 2GQHA 2IQAA 2DIBA 5LCVH 2OP4H 5TDNA 5HGAB 4YK4B 3NFNA 5L88L 4QRPA 4L8CB 5E70A 1AQKL 4OB5H 5D2LF 2XTJC 2MNUA 2DTML 4XBEH 4OCWL 3BISA 4F57L 4PG2C 3D2UB 4E0RA 3EO0B 4LCUA 3W81A 4NHUA 2EDRA 4MA1C 3MRKB 2ZJSL 1J8HB 3TIDA 4JM2B 4PB9L 3O4LB 4FZEL 4IM8A 5IB5A 4ZUWB 1UWEL 4TOYH 4WUUD 4ZTPH 5EUOA 3VXMD 2I60H 3QDGE 3IETA 4WTZG 3ZDZF 4MDIA 3ULVL 2OTPA 2EIDA 5SWZD 3MJ9H 5J4MA 4YAQA 3WNOA 4MA7L 1OM3L 4UAOC 3O3DB 1RZ8B 2AXFA 3GSRB 3R06A 4PJ9C 2AK4A 1GGIL 4KJYA 1MFBL 5E8OA 5EO9B 1REIA 4FQQA 4L4TE 4NCC2 3MROB 1X4YA 3NCJH 4B50A 5C6WH 2EDJA 1QPPA 1BIHA 1BQHG 2LVEA 4NKOA 3B9VA 3SKUD 4FNLL 3LN5B 4NPYB 2AABH 2GW5A 3W0WD 3F5WA 4OGXL 5BV7L 5H94B 4U6TA 4A2MA 5KAQF 5I73C 3LZFH 3PWPB 1F3DH 2NPLX 4UT7H 4M43H 3P4NA 3KPMB 1CT8A 3ROLA 3V6BR 5C08E 4F58H 1FZOB 2EC9T 3DX7B 1E27B 3MV9D 3C9NA 1EH9A 5JOFA 1CL7L 1UA6H 3UTQB 3F7QA 2VQ1B 2AXGB 2NY2B 3O2DH 3P2TA 3T0DA 2D3VA 3K2UL 1BZ9B 4PG9A 1CTNA 5D7JC 2EEDA 1O5DT 1HWGB 3BHBB 2ED7A 1I1AA 3CFEB 4Z7UE 5T3XL 3VXME 4BKLA 4AIZB 1LVEA 1YEEH 2CKBH 5E7BA 3R4DA 2M8XA 1B6DA 4LBEB 3WUWG 3O9WD 1TJIH 3WJLA 3B6SA 4P9MH 3UTOA 3D85A 3Q6FB 3VI3F 3DETD 4HWNA 3QUML 4APQB 4F7MB 1VGKB 5DHYA 5F1IA 4TUJA 3WFCH 1E6OH 3VWKD 5BRZB 5GQBA 4QRPD 3V52L 3CDFA 1BWWA 1DTUA 3U82B 3ARGB 2WM0A 5E6IB