4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
5EOCJ 1RK1B 5IJKA 1F4WL 5IROA 3V95A 4XP1L 3HRZA 5HI4D 2DQHL 3ZHKA 1KCLA 3BIBX 4TNVK 4U7SA 4ZFGH 1NC4D 5D96C 4GRWE 5EORL 1J1OH 1V7NL 1UZ6F 3I02B 3QUYC 1MREH 1LDSA 3IU4L 4WO4A 2RQ8A 2DQFB 2MHAB 3ULVC 3AAZA 4QCIB 4M4PA 1AO7E 3FO2B 1OLLA 1T0NB 2LQRA 4DGVH 5E2TL 2V5SA 1MCFA 1IC7H 4P4RB 4UQ2A 1G9ML 4GS7B 1UWEL 1NAML 1MJ8H 4XRCA 5EA0H 1A4JB 4HF5L 5HVFB 5JOPD 2A9NL 4PJ5A 5DFVC 2VXSH 2YPKA 4M6ML 1U2HA 4KKCC 5CBAA 4AIZA 4RNRA 3FZUC 2CRMA 1HXMA 2XKUA 1NLDH 1D5BB 1QR1B 1MWAH 2P5WE 2XTJD 3QG7H 1HSAA 2WBWB 4QHUA 4EI6A 1MCPL 3HG1D 5IBLC 4UT9H 2Y5EA 3LMJL 1WWBX 2XN9E 3IXTB 3K74B 4WIQA 2ZNWA 5DJ6B 2WANA 4LARL 5C3LD 5J0BA 4FXGA 4YHYC 4HCRH 5EO1A 4F7CB 3QDMD 1DBKH 4P99A 3DO3A 4LHUD 4KHXL 1MHHB 4JRYD 4PJ8D 3UPRB 3QHFH 3BP5A 2H26A 4HJ0D 4LSUL 1QLRA 5MI0B 3QAZC 3U48A 3FONA 4HWBL 1YPZF 3WNPA 4RISL 2BC4B 1RJYB 3MBXH 3PIQB 3FQWB 1CN4A 3GSQB 4LHQB 2BP3A 3Q6FB 1KCUL 1MCOL 3VI3F 2RBLA 3VXUA 4NNXB 3V5KB 1DVFA 3QAZB 2H6PA 3CDGA 3QIWD 4G6JH 2XZZA 5H2BB 4BKLB 1R5IB 1KF9B 1NCBH 3GMLB 2R0KL 4WNQA 3DNKA 3BPCA 3OGOE 4U4BA 4WV1A 1LMKA 4JY5L 3JV0A 3LRHA 1QEWA 3HB3C 3N1MC 5TFSH 3RAJH 5EOQL 4OLUH 1CFSA 1AGDB 4XC3L 5C2UB 4CVZA 3ARFD 5IW6A 4G9FA 4S10A 1R3HB 1NCWH 3SQBA 3G6DL 3SGEI 2MQ0A 5IMLA 4ONGL 1BEYH 3JV4A 4OQ1A 4KKBD 1PLGL 1KTDB 3QNXB 4ZUSA 3BRDA 5DJCB 3MRQA 3H9SD 1FLTX 2FBJH 4R0LB 3UZEA 1TZIB 4BYHA 1M7IB 3WUWA 1CU4H 4NRZA 1C8PA 1FO0H 1OPGH 1I1FB 2ADJA 1ZA6B 4E41D 4IRSC 5D1ZB 3QCTH 1BQHB 4LBEA 2ICES 2BSTA 2W0PA 4F57H 1C08B 1UVQA 1DL7L 2CIIA 5CZKA 1Z9OA 5J7CC 1UB5B 3BO8B 4OZGB 3E6HB 3BHBA 1IGIL 1DZBA 4Z7WB 1IZJA 1KELH 5DHYA 2CGRL 4YHOH 5D1QD 3FN0L 4QHLA 1HHHB 5IV2A 5GRJL 1V3KA 5GS1C 2IH3A 3NGBC 5DC4B 5BQ7B 1SYSB 1U8KA 4KRNA 5JOPE 3DUHA 2D31A 3ARXA 2J2ZA 5ANME 1M6OA 4NN6B 4RFNC 3DYPA 1W72H 3BPOC 1OTSD 1OP5K 3IVKA 4X80L 4P4KD 3TVMD 5C0GA 2R39A 4JANB 5KS9F 1JWSB 3INUL 4PB9L 2GKIA 5BJTA 4KAQL 1ZSDB 2AP2A 1CLCA 5FGCB 2YUWA 4LNVA 4DVBB 2F74A 4RFNB 3BP6B 4ZFFB 2J12B 4PJBA 5E6IC 3BGAA 4UT6H 3X3GL 5HGAB 4XCCH 4HV8A 1EAJA 4DGYH 3TWCL 1FORH 5ISZD 2FLRT 2F19H 1FCGA 1A4KB 2XQYG 1P5VA 3IU4H 1NSNH 3QFJD 3LN4A 3ILQD 5E8NB 1A0QH 4Q74A 1CL7H 3WFCH 3WUZA 2FWOA 1D6EB 3VFRB 3FT2A 3IJHB 1NC4B 2Q76A 1G9MH 3KPSB 3T2PA 3DX9A 1BZQK 2HFGH 1TITA 1FNEA 1ZAGA 2NXYB 2AV1A 1WZMA 1G6VK 1FNSL 2AJZA 3ZDZF 1UYWH 5CMAB 4WWID 1XR9A 5AD0B 2G5RA 3ESUF 4R4ND 3DIFB 3G5ZA 4XNMB 3D2UB 1DCLA 4LVNB 2VC2H 3MCLL 4X0KB 3O8XA 2D0GA 3WCYA 2XZQL 3QIWA 1YEEH 4KK5D 5HYIA 3VXUD 3ILQC 4PRHA 1RULH 2B1HH 4U6HB 5DVMA 5TDOB 1NC2B 5DD3L 3IDYB 4KKAD 4EXKA 1I3VA 4HK3N 5C71A 4MNHA 5L7XH 2UZXB 1G7MB 4G43B 4WY7H 5E08L 4X4ZA 3U2SB 1VEMA 3GJFB 5SWZA 3BKJH 4GRMB 3FB8B 4LHUB 1J0HA 1BBJB 1ZVSA 4KUCF 2XN9D 4PUBH 1XGYL 4ZUSB 3GMQA 1FRGL 3JXAA 3WE6A 3RVXD 4X6CA 1NFIB 3BFOA 2HT2C 1RIUL 3PL6B 2VXVL 1MFBL 1OL0A 3GSUA 3RGVB 4DW2L 3C08L 2OYPA 2YSSB 5DTFA 1YEGL 1FNLA 1I8IB 2DQDH 2GSGA 4BFIB 3AS3A 3UCRA 2EDNA 2MFNA 1CGTA 3OZ9L 4OF5A 5DJCA 2I07B 2EH8L 3SPVA 3L3KB 3B8YA 5GS0D 1YUHA 3ARFB 2PETA 5L8KB 2QSQA 1AXTH 2BC4A 1AGDA 4MAYC 4OJFL 3SE8H 3OAZK 4PGBA 5A3ID 8CGTA 5CILH 2BVOB 2VLKD 1T03H 3ARFC 3I2CH 3KPSA 3MR9A 1K6QL 4TUJA 1PKQA 1GPOH 1JBJA 3C8KB 2O5XL 5BS0E 4ZUTA 4NYLB 4P9HC 2JK5A 2N1KA 1PY9A 2ED9A 4FQXA 4WGVB 5B39B 3MRHB 1JF6A 2IADB 4M03A 3UJIL 3GSRB 3H3PH 4F7PA 2KZWA 1S7QB 5E24E 2O5ZL 4RNRB 3FO9A 2PXYD 1NEZB 3DGCR 3RWEB 1WK0A 5BO1L 5K9KB 3MBEB 3D3VA 2VZVA 4HUKB 4JCMA 5DK3A 1NBVH 3TBWB 2UZYB 4F2MA 4OFYD 2NY7H 3MRCB 5I1AA 5J3HD 3IFOA 3PQYE 5DRWA 5HGAA 3RWHB 4Z7UE 1WWAX 1M1SA 3U1SL 1EX0A 4K23H 4TULL 1XGUA 1HIMH 3ZL4H 1I4FB 2Y4SA 3VI4F 4KDTA 3D3VD 4DJMA 1I9IH 1KJ2B 2K7QA 5IVZB 4LSPH 3PL6A 3TCLA 5EBWA 3VW3H 5F96L 1KEGL 2KKQA 4M6NL 4KROD 4XVUD 2DYPD 4EVNB 4O2EB 3U46A 1JL8A 4Y89A 1J18A 2VDOL 1IM3A 4PJ9C 3HB3D 3BEVA 3HTLX 4TTGA 2ZWLT 2VDML 1JWMA 5GSRB 4IBLT 4KK9C 1I1FA 2ADJB 4UV7H 5L2KD 3QFDB 1KJMA 1TVDA 3KPSD 5CP7B 2N7BA 5IESH 3QI9C 4KRPD 5HVWA 4NP4L 1ITBB 2A73B 3RIAF 4JO2H 1OD9A 3MV9B 4OCLC 3QUMH 1XT5A 2VRAA 4Y16D 5D1XD 1SY6L 3IT8D 3MJ8B 3PWPD 1NC2A 4WJ5B 3BP4B 1KIPB 3LKPB 3ZLQC 4Q9QH 2ZSVB 5HHME 3P73B 3D2UD 2R4SL 2BCKA 4MS8D 3NH7L 1IC5L 3QO1A 2ED7A 4X4MA 3MA7B 3DV4B 1T7WA 2C5DC 4K3DH 3J7HA 3S3SA 2Q6WB 5TQ2H 2G2RA 4URTB 4WY7L 1DQDL 3G6AB 4O9HL 4G8IB 5I1HL 3G5YA 3HNSH 3PHOB 3QYCA 2HJKB 1F3DH 3T1FA 1ZT7B 3FKUS 1MFDH 4M00A 3TVMB 3B4NA 3QWRA 5C07E 5I2IB 1JHKH 1J0JA 3DSFH 4XNZC 4BJLA 4RIRB 2AV1B 1RAMA 1H0DB 1MQKL 2WWMD 3M8OH 2ITCA 4KKCD 4QXGL 3BPCB 1DQJB 1P1ZB 1VGEH 5EO1B 3WD5L 3CVHB 4X8XA 5J11C 1FHGA 3V8OA 4DW2H 5C07B 5MI0C 1KB9J 1J1XH 1G0DA 1G6RL 4XNZB 2IBBA 2XA3A 2ADFH 5LGHH 5KBNC 2XY2A 3OXRB 4Z5RA 4JAMA 4F9PC 1VGEL 3IKCB 4UUJB 1DBMH 3HS0B 4W81A 1K3IA 2WV3A 4ZFFA 3CUPA 4QOKB 4OF7A 3R8BB 1GRWA 3TZVB 4KFZC 1YDPB 3VFNB 4NHCH 3AVEA 3MUY1 1RSFA 3B9KB 3KHOA 2AXFB 4X7SH 1H3VA 1JWMB 1CBVH 1U36A 5HHVL 4O58L 2HAZA 4OGXL 2BMKA 1BJ1H 1YEHH 1EERB 3EOTH 4TSBH 1K8IB 4Z0XB 1CXFA 2X7LB 1HHHA 4Q2ZA 4AZ8A 1OGAA 3CFCH 1QA9A 3T4YA 4G6ML 4XAWL 5D7LA 4C56E 1FORL 1K4DB 3MRIA 5DVNA 4GO6B 4LBEB 2NNAA 5BO1H 4PJHF 5TGBB 1AQDA 3O3EA 4AMKH 3NFPB 1SJEA 1P4BH 5DJYB 4YC2B 3IS1X 4X8JB 1NEZG 2VXTH 4Y4FA 1T5XB 3B9VA 5HHPB 4G8GB 2CH8A 4WUKL 2PXYB 4X7DC 1CR9L 3G08A 2XOTA 4J8RB 3RZCD 4HKXB 3C60C 3O6FB 4GRWH 3OB0H 2VZUA 3PP4H 1E28A 3O41A 3LPGA 43CAA 1RZ8B 3BVNB 4GW1B 4XP5L 3U0PA 4Y5YB 5JQHC 4S1RH 1QFOA 5I66B 5BXFA 4GKZB 5F8RC 4O02L 4M6OH 1IZKA 4KJQD 4TUJB 3P11L 5A2JH 2Y72A 4KHTH 3B2VL 2DQGL 4JFFD 5FF6B 1DUZA 4UTAL 4V2BA 1OARH 5C0CB 1M05A 3RKDD 4P57A 3PJSB 2BY2A 5C07A 1VFBB 5L7XL 4DKEL 5B38G 4UQ3B 1BX2A 4Z7VE 3RL2A 3ZKXB 3AMKA 3SCMC 4TVSa 2ZSVA 4XBGB 2WLZA 4HWZA 5EZJA 2W9EL 3MODL 2ED8A 3ULVE 3OAUH 4OCXH 4I18A 1QD0A 4MXVE 3QDHA 1PW3A 2FSEA 4ETQB 3G5YB 3P73A 1IGFL 3QFJE 1FN4A 3HR5A 4PJEB 3AM8A 2VMFA 5CKAA 4Z77A 4MA1B 1K4CB 2Q3ZA 1A14H 3ESVF 5IR1A 2IPUK 3GSUB 5I1HH 1BFOA 5D1XB 1CXKA 3SGJC 3MLXL 4YHML 1YN7A 4I1NB 5JDJA 1U8MA 4RAVB 3TCLB 4XXCC 5K9QG 5CP3A 5E2VH 5F97E 2RFXA 2APWA 1KIRB 4PV9A 1QHPA 1S7UA 3EHBD 3NFPA 4PB9H 1JFQL 2I5YL 5HY9B 1TETH 3PDOB 3IFPA 1HH9B 1MCRA 3TF7C 1NGQL 4JM2D 2E9BA 3C5ZA 3G5XB 1OP5H 2J4WH 4ACPA 2VQTA 4QRPD 4Y5XA 4HS3A 4JJHA 1JHLH 3KPOB 1XF5A 1AGCB 1DDHB 3EO0A 1P53A 3WFZA 3LSOA 3MNVB 3DMMA 2H1PL 3N9GH 3D3VB 5JHDD 1X6NA 1ZLVK 5C07D 4N0UB 3BRGC 5CKGA 3IFOB 3CFBA 3W82A 3BZ4A 2BMKB 1A9BA 2COQA 1ND0A 5HYJD 5JQ6H 3AFLA 3WMSA 1U0QA 4JREB 2NXZC 1S7VB 2VQUA 5CSGA 5DS8A 1ZGLM 3LDBB 3OAYK 4KI5F 3W81A 3SGEH 4EUPH 1U58B 4KK8D 2APVA 4KVCH 5DEGA 3DVFA 4JVPA 3ARGB 4NN5C 5GGVH 1CIDA 2FX9H 5TDPB 5D7IE 4XTRC 4XCYA 5DDHA 5IB2A 3ROLB 3C8KA 3VFOB 1RIHH 3CCHB 1JNHB 4N0YH 1O7SA 1LP9E 3LIZL 2IADA 2QHRL 3PWJB 3GMNB 2PO6D 2QADB 3C5ZD 3KYAA 2X89D 4HJJL 3V6OA 1QP1A 1KN4L 3ULUE 5GIRB 2Q6WA 5DZLA 1T22B 2VE6A 1T89C 1N2RB 1WAAA 3BMWA 5DHVH 5EO9A 4CU6A 1CS6A 1IT9L 5KS9A 3T1FB 4HFUL 5GZOD 4QNPF 4PJDE 3STZA 1HQ4A 4PJAF 2GJZB 3ABZA 1EK3A 2XWBA 5LG1A 2R29L 3F7QA 4U6XB 1HH6B 1N4XL 5MEOA 1K8DA 4HKBA 3SHSA 3W0WA 5D9SA 1RZFH 5DJZB 3GO1H 3K8LA 1SY6H 4Z0BH 5B21A 3V52L 3Q5YA 4U3HA 5FEBA 4PBWD 3V0WL 1TCRA 1QA9B 4QRPE 1XGUB 4X99B 4G8GE 1TTGA 1KENH 5I9QB 1CLYH 5BMFL 3BKYH 3NA4A 4HLJA 2E9JA 4RDQG 3VFGL 4R0LA 3P4MB 5BVPH 5C0CD 4HC1H 3BRFA 2YPLA 2X9XA 1MWAA 4HIIB 3ZYJA 1L6ZA 2GFBA 3SGKA 1OAQL 3RWFA 3ZE1F 5C0ND 2EE2A 2Q7YA 4OZHB 2AABH 2FIRT 2Z35A 3HG1E 5EU7C 4CBPA 2R0LH 3CU1A 3MFFB 2RHEA 25C8H 4NQDB 3MA9L 3JTSA 1VACA 2ZOKB 3RVTC 3PGFL 5FV1L 3IU3A 3R06B 4JFED 3QCVL 1MFBH 2ZUQB 4NO0A 2HFTA 1NDGB 4HH9B 5EPMB 4UB0L 4UIMA 4P9MH 4GH7B 4X6FA 3NCCB 4JFDA 2CMRH 1S5HB 4ODVL 2K1MA 3PIQA 2HG5A 1QFUH 3HE7D 1RZ7L 2X40A 2XRAH 2ZSWA 3BGFB 4MVBC 1TJIL 5CFHA 1T89A 1AP2B 4P2OA 4PRPD 3ARBC 5E94A 2YN3A 1LWRA 1CG9A 2P8MB 5EO0B 3O6FD 1N6UA 3GSOA 5T1MA 2ZNXA 4I3RL 2GITA 3BQUD 2PTUA 2ZG1A 5EBGA 1CDIA 4OZGF 2PW2B 4UOW1 2M1KA 5LAXA 4QRTA 2XKSA 3JWDL 1CCZA 3NCEB 4EUPG 1WEJL 4OZIB 4JFFB 1BOGB 3I75A 3MA7A 1SBSH 2X5PA 4AL8H 2Q1EA 4JQXC 4P46A 3MYZA 4XPHH 5DR5H 4DQOH 2FX9L 3Q48A 2B2XH 2CDGB 3DUSB 3FQUA 4P5TC 2I60H 3NFSL 2NPLX 2X1WL 3RA7L 3H9YA 2LE9A 5F96H 1KEGH 4AEFA 3VXQB 4N0YL 4C55A 2P4AB 2VQ1B 4OLZH 1J87A 1NLBH 3TYFB 3VXSB 1BQLH 1FGVL 2D31B 2YPLB 4OFYA 4ENEC 2KQNA 3RIAK 1MWAL 4AG4H 3QJHB 1FP5A 3L5WA 4RZCB 2DKMA 3JTTA 1FSKC 3EO1B 1HH6A 2B1AL 5JO5B 5KSUA 4BK5A 5DHYB 2IMNA 5C1MB 3OWEA 3BKCL 4LFHD 1DQDH 3TBSB 5IJVA 2JF1A 3GNMH 1MCKA 3I6GB 3V0VB 3FQNA 5JPNA 3T0DA 5EO9B 2EO1A 2H2SD 3T4AA 3WFBL 5MEOB 4Z7UB 1AQKH 3GMPB 2YRLA 5F88A 2R1YB 1G7IA 1LEIA 4WHYG 5KVFL 3WUWB 4OV5A 2AK1L 4GAYB 1G7MA 2G5BB 4N0CC 2X1QA 1AD0A 1CE1H 1XGTA 1QRNE 3IJYB 2ICWJ 1A22B 3GSOB 4O9HH 4Z0BL 5FO7B 2XXCB 4WV1B 1S5IH 1QRNA 3DRTA 2DM4A 2F5AH 4HPOH 3NBNA 4L9LA 3MCG1 5ETUA 2CRZA 5H2BA 1X5FA 2GJ6B 5D4QA 4GXUM 4XCYB 5T3ZE 4KI1A 4GSDL 2CPCA 2R0ZL 1G9EA 4U1JA 5E1HB 4MD0B 3MOBL 4ODHL 4AQOA 1EGJL 4F15C 5JUEH 2IGFH 3O0RL 2OTUA 1QFWI 2BXYA 4O4YL 5BMFH 5JIIA 1U58A 1MUJB 2BNUA 4RGMC 2CLVB 4WEUD 5IB1A 4D9QE 3A6CL 3ARGD 1A7OH 3HFML 1MHEA 3D0VA 1J8HE 5J13B 3VFVA 5KZCB 3CFBB 3ARBB 3MGTB 3EYUH 5DA4A 5DDHB 3DI3B 4IMLA 4OZHA 5HGGS 3AREC 4PJEE 2ENYA 4YHLL 1S7VA 4WHDA 1G7QB 1FL6B 2BHYA 1NGWB 3MYJB 4GBXA 5F7LB 2J8HA 2HMID 4JG0L 5J89A 4MA7L 4DUVA 5ID1B 5JOFB 2PO6B 2NX5E 4P48A 4GG6B 5C0GB 2H1PH 4LSQH 1UA6L 4OKVB 3BH8B 1QHOA 4MXQC 5T5NF 1X4ZA 5E5UB 5FDWB 1A6AA 1JPTH 1T7ZA 5JPMA 4JO4H 35C8L 2D9QB 1X6LA 2CLZA 1S7XA 2VDKH 3MOAH 1TCRB 3GBNL 1D9KC 1LP9B 3MCLH 4XB7A 4LSRL 1ZLSL 1NANI 4PJFB 3LQAL 4OZGA 1U8JB 4OZHE 4Y19A 3K8MA 1T7YA 4PJAE 1HHJA 4QWWD 4XC1L 3B9DA 3ARYA 1UG9A 1U8MB 2LU3A 4AMKL 2MHAA 1AH1A 1ZLSH 4M1CC 4OD2A 2XXMB 3WIIL 1XF3A 4O58H 4ZS6C 1XH3B 5GJSH 2NY1C 5E08H 1GSMA 2DQJL 4UMGA 4ZUUB 3F7YB 1I3RA 3NIFE 5DJ0A 3K1DA 2NW3A 2N7AA 3DLQR 4POZD 4U6HA 1JUFB 3L3DA 1IKFH 1ORQB 1H9VA 5D9SB 4NRXA 1P7QA 4KK9D 5IBTH 2DJUA 4GKOA 3HNTL 4YUEH 2VXSL 1RUKH 2DTSA 5SV4A 5JW3L 4M7JL 2AQ2A 1JYWA 5J56B 4JZJC 2DQCH 5LAXB 1YEFL 3G5ZB 2DYPA 2IPUG 3B6SB 1JNHA 2NZ9C 1IAOB 5H94B 1LQSR 4FXKA 4MLIA 4UT9L 1BMGA 5JHDE 4MD5A 3ZKMD 4HW6A 2VDPL 5EA0L 2FECI 5HYEA 4DN4H 5EO0A 4NO2B 3FOLA 5HYJE 2P24B 2Y23A 4MDIB 1A7QL 5JHLL 2NY5L 3P4NB 4NFCA 5AG9A 1EHLL 3DTXB 4CU7A 1A1MB 1BVLB 2G2RB 4MYWB 2OLDA 3DVNB 5E7FA 4JFDB 4LCWA 3KXFE 3QDME 5T1LB 1MAKA 1G6RB 2HJLA 4ZXBA 4U1HB 3S37H 5D7JC 3BZ4B 1L7IH 3C2AL 1J05B 4BSVA 4GW4A 3OJVC 1SJVA 5IM7B 4PRAA 4QRRB 2X4SA 5BVPL 3U0WH 5DEGB 5TDNA 3U4BH 4U1MA 3C6LD 1CDUA 1MCHA 2X41A 1UM6L 1QSZA 1R3JA 2OS7A 1I8LA 1DN2A 3MODH 4XC3H 2HT3D 2BVYA 4UNTA 4OQTH 4WO4B 4PJDA 1JIBA 3WO4B 4OCRL 4G9DA 4YHZH 1SJEB 5IGXL 5L88L 3VRLE 2LTQB 4R4BA 4HGWA 1Q0YL 4KKNA 2YD1A 2BNQD 5T1KA 1IC4L 4EVNA 2IH1B 3UJJL 3T3PE 1WC7B 4OLVH 3UTSB 1BM3H 3E2HC 4MCZA 3L3HB 3GRWH 2OP4H 4TUOA 3EOBB 4LIQH 1YDPA 3WEXB 3K4AA 4H8WH 4LSDA 4L4VE 1IGJA 3G6DH 1RPQA 5HYSB 1JMZA 5DMIL 3V5HB 1OWRM 1P6AB 1LVEA 3TJEL 2XT1B 2R1XA 1RV6X 1DSFL 2DQTL 3S9DB 3REWB 1UXSA 3GKWH 2WNGA 4NFBA 5I76B 1B4RA 4PJCA 1FL5B 4K3GA 4K8RC 4M1CD 3ARBD 3O9WD 1NEZA 4OGAC 2X9YA 1TQCC 3EW3B 1U91B 2AK4A 2X10A 4D9QD 3CDCA 4G8EB 4LLUB 1CI5A 4LLMA 2FEDC 1A9EB 3GSRA 1FL3B 5E0QA 1L4IA 1WEJH 4OCSH 4WW2B 1PAMA 1B9ZA 2EYSA 4ISVB 5KN5B 4QRRE 4ZMAT 1CICA 1U41A 5FYLE 4K3EH 3CC5B 4PJ8C 3T8XB 3TVMA 1W72A 3EFFB 5C0AD 5IOPB 1QSVA 1DN0B 2JCCE 2OR9L 3IAQA 1OTUD 3D6GA 3FB7B 5C8JB 1GGCH 5DWUL 4X5XA 2NY7L 2FD6H 1EO7A 2AXGB 4ZNEA 3RTQB 2BHZA 2D4DA 5KTEH 3HLAA 4DAGH 2F8VA 3QIUA 3UTTD 3RA7H 4RMSA 1UQSA 4P46D 1FBIH 1DQLH 3DRTB 4P2RE 4K23L 4HLZH 3AROA 3MTRA 2W92A 2BSED 4G8GA 2MSPA 1UJ3C 2FB4L 2GJ6D 4F9LC 1CDJA 4LPCA 2L7JA 4JM2A 3TT1H 3DV4A 4WWKD 4APQB 1O7VA 2HFGL 1OAZL 1RZKL 1KJMB 3DSFL 4CADB 3GSNL 4FZEL 1X7QB 4MZ2A 1RU9L 4KUCD 3OJDA 4IEFB 3WLBA 3H9SA 4PJCF 3QB7C 3B5GA 3ZT6A 3O6FA 4IRZL 1A3QA 2OK0H 3VRJA 1JVKA 5JNYB 1D9KB 5TH2B 3TLRA 1QOKA 5KZCD 1RQ5A 3I85A 4MAYA 4M8QA 5GSRA 1Z3GH 3EYFB 3QFJA 1RIUH 1Z5LA 1XCTA 1IT9H 4ELKB 3QFDA 1FLRH 1ZHNB 4I2XE 4K3HA 1X5XA 1DLFH 3X11A 3KLHD 2PTTA 2JJSC 3NPZB 4NO0D 3KJ6H 3EYOB 4PRBB 4I77L 5H35B 5KG9A 1R3JB 1RY7B 3ULUH 3MOQA 3PGFH 1B0WA 1MSPA 1RJLB 3MMEB 1F00I 3JV5A 1U3ZA 3GI8L 4B53A 1FG9C 1TJHH 4OKVA 1IGCH 4R8WL 1OP9A 4ELMB 5F1KC 5C6PB 5DO2D 4HAGA 4IDJL 3QUMB 1H5BC 2CDEB 4HS6B 4RMUA 3RU8L 3KWWB 2AGJL 4H20H 4L5FL 4YEEA 5ADPL 5D1QA 4KVNL 3MRDA 3QHZH 4GMTH 3BAEH 2APXA 4QRRD 4U6YB 2CMRL 4IJ3B 1DE4A 1FRGH 3ZT5A 1E6OH 4OF8A 4ODVH 3BIKB 5FHAH 3C6LB 4Z7WF 5A2KH 5I2IA 1S9YA 4GRLB 4N5UA 3H9ZA 5EZJB 3V6FB 2E7LA 3C09B 4KK8C 1OVZA 4TOYH 3P0YL 2J88H 1JNNL 3MV8A 3NFNB 3QDGE 1N5AA 1CZ8L 4PRHD 4P3WA 4P2RD 4ZFOL 5INCB 4N90D 1IKNA 4RA3A 2BNQB 3D0LB 2FBOJ 3FHQA 3TYGH 4RWHA 2NY6C 4YO0B 3PWLA 4C56A 1ORQA 3RJDA 2BVEA 1AGEB 2Z31B 4BH7A 1FAKT 4X6EB 5AYQA 1KPUB 5DJ0B 5JMOC 2F53E 1X5IA 1XGTB 3U36A 1RD6A 2V2TB 3F6LA 1PG7L 2DI7A 4Y2DA 3EYFA 5GRWA 1JRHL 4LSPL 5D2NA 3BD4A 1EO5A 3OBAA 2BJML 3HE6A 4O2CA 1GAFL 4Y4FB 2H8PA 3P4MA 4K3EL 1NCAL 3BZEA 5LGJB 4JKLA 4JFDD 3IDNA 3O9WB 1IARB 5F9DC 3HMWH 3VA6A 1IM9D 1W0VA 4UDUA 3GMRA 5E8OB 4IRJA 2P43B 1MJ8L 2RR3A 4M43L 5D70H 1A7PH 5H37G 2VZSA 3THML 2CKBL 3NVQA 2VKXA 5IK3B 4P59H 1ZGLB 3JVGA 4DKFL 4NRZB 3G6JA 2H3NA 1W2KT 4V1DA 2VXUL 3SKUD 4Z8FH 2I9LA 3RWGB 5BV7H 3WJJC 1UACL 4HKBB 1JHTA 1T3FA 2D7QA 5D1ZC 2HP4A 3RTQD 3BEWB 4M6NH 5IB5B 4YZFF 2C1PB 3O6LH 4K9EH 5TDOA 5TPWH 3MV01 4JRWA 1BECA 2R15A 2DQGH 4JDZA 2IGFL 4LPXA 3CPLB 4Q9RL 1SVZA 4NQVB 3QWOB 4JN2B 3G9AB 2HVKA 5ENWB 4NO3A 3RY6C 4LGPB 3QEHA 1W0WA 1IAKA 3SQOL 4JCLA 3D25B 4U1GC 1NGPL 5DJXA 5MERB 3QZWG 4RA0C 2A6IA 2IBZY 1DLFL 4HUXB 3U7YL 1FNEB 2YXFA 5KW9L 4UV7L 4YX2H 4MNQA 4R4NC 3VFOA 4POYA 3Q5OA 1MLCB 2AK1H 2FH8A 2ZSWB 1NBYB 5FYKE 1XR9B 1OQOA 2V2WA 1JMXA 2ORBH 4I5BA 4JVUA 5JTWA 4RGNB 3WHXA 5GS0L 5F7UA 1A4KA 4RIRA 1OCWL 5I19H 1WUNT 5J4MA 5DD0H 3HE7C 4NO0B 3LAFA 4PRIB 3L5IA 3DWTA 4XMKL 5L0QB 3HMXH 4GSDH 1JGDA 4OB5L 1BM3L 3X14B 4LCIH 3RUGE 1CU4L 1A9BB 3ZDXE 2OTWA 3VJ6B 1N59B 2P46B 1WICA 2F53B 2JIXB 3CK0H 3KYNB 3QJFB 4P2RA 4LSQL 5IMOB 1MPAH 4J3XA 1H3PH 3MQIA 3LOWA 5ICXB 1INQB 3S88H 1KYOJ 1FZOA 5TE4L 1YY8A 5BJTB 5IB5A 4OLEA 5DF0A 1HNFA 1ZVSB 2Z91B 1MREL 1V3MA 4PJ7A 1JGUL 2DLFH 2IPKB 5E8EA 1RZIB 5D1ZA 2DWDB 1P84J 5GJSL 4QRRA 3QZWB 3TYFA 1DJSA 3BPNB 1JK8A 3ARDC 1LEKB 3V4PH 2IPTH 3BKMH 5E99L 1M7IA 4DGVL 4MNHB 4JY4A 3WNMA 2AK4E 3KLAB 4HIXH 2BSTB 2H41A 4XT1C 4PJCE 4A6YL 4EI5A 1L0QA 1R3HA 1FC1A 1A0QL 4Y7MA 2IPTL 3BKML 3FRPA 1H5BB 2EEDA 4PRHB 1E4XL 1NGZB 3E2HB 3VXSA 4UT7L 1B0RA 2VQ1A 3GMOB 1TPXB 1ONQB 3PABB 4HQQH 4PIRF 3STZB 3UTSE 5FM4A 3HNVL 3DURB 3S6CA 3NZ8B 4PG2A 4XPFL 3ME0A 2SEBA 2VL4A 3ULUC 1GVIA 5AWNH 3BQUC 5IMMB 5ISZE 2P42B 2CDFB 1GZPB 1BF8A 4JDTL 5I1JH 3T0EC 2BFVH 5HI3D 1LE9A 5HGDA 3UXFA 4FQJH 5DZOA 2C3VA 3IYLW 3PWUB 5AYUH 5BRZD 1V5JA 1TQCB 2YD5A 3LEYL 2VDLH 1HYSC 2VITB 2ADGA 4U1GB 2PW2A 4OGYH 4YR6B 4PRNB 5E2WH 2FX8L 1LO0H 3NPSB 5C08E 1BVKB 5CJQL 2EDHA 1F90H 3CVHL 4LEOA 3S36X 1GL4B 2ZOKA 2XG5A 4LNRB 1WV7T 4XGZA 3FFCE 4JG1H 1JZ7A 2B4CL 2FX7H 5C3TA 5KVGH 5HVGB 1AKJD 2P1YA 5FGSA 4F9PA 2NMSA 1I9EA 3CXDL 5I8EB 1NGYA 2ENSA 4IOSD 5DGQA 1JTTA 4ZXBD 4FXLA 4Y4FC 1ZVYA 4JVWA 4LCWD 1ZTXH 4HH9A 3QIBA 2VXVH 3MXVH 5I8KL 3HRPA 2FJGB 2QQQA 1HK6A 1U92A 3VJ6A 3GI8H 3HI1A 3MLRH 2V7HB 2OR7A 4RRPG 2C7UA 4NJAL 2HTLD 2ZP0T 4PUBL 2OJEA 3BGMB 32C2B 2Z31D 4E9LA 1QBML 4CNIB 2J4WL 2NY5C 3FAXA 4PRIE 4S1QL 5FV2A 3RAJL 3VFUA 5C7XL 4PGDB 4N8CH 4DTGL 2AEWA 2XG4A 4X6CB 5GGSA 5ADOH 4P3CL 5EBMB 4HIIA 4UV4H 4CKVX 4H0HB 3DVGB 4PV9B 1WCBB 4PP1D 2B0SH 3CFEA 3SE9L 4Y4FD 2UWEF 3AAZB 2FHCA 3NABL 1AXSB 3FB8A 4PB0L 5J1SC 1J88A 3OKNA 4G6FB 3P9MB 3P0YH 5D5ME 1ZOXA 4DVRH 5IFJA 3KPNA 4OIBA 1T1YB 4PBXA 1I1YB 5HHOD 4P9ML 5HYSG 2X4NB 3SE9H 3LEXB 4GG8A 4LRIA 1SEQL 1TNMA 4NRYB 1UM4H 4NQVA 4CN4A 4KC3B 4L4VA 5DUPL 3T0EE 3OXRA 5I15L 1HKLH 4WI3A 4I18B 4OCWL 5IMMA 1T0MA 4PJBE 4XNUL 3QI9B 5MEPA 1S3KH 1CFQB 4S11A 2GTWB 2X44D 5ITBH 1OTUC 4KTEL 4XPGH 2ITCB 4CDHA 4XXCA 1NBQA 3LS4L 4JPIB 4H25B 4TQEH 5F9WB 1MY5A 3SDCA 5I6XB 5DFWH 3OJ2C 3GM8A 1FVCA 3MACH 3LZFL 3BE1L 1SBSL 2AVGA 3QUKB 1OAUL 3T4AB 3H42L 1ZGLP 2OMNA 3VFWB 2HVJB 3C6LC 5CEYA 3V5KA 4ZNCD 4GKNB 1QSED 5F9JA 4KTYA 4L29A 3SO3C 4EDXB 5KSUB 5FKPB 4N8VG 2YPVH 3UMTA 2VSCA 5DHVB 3DUUA 4LOUD 5C0BA 4HX1B 5D2NB 4XZUA 3PQYD 2NY6B 5I1CL 3BDYL 4RGND 5IFHL 1D5MB 1HZHH 2IBGA 5E8DH 3V8CA 1N8ZA 2EC9T 5TE6L 5KANI 2IF7A 4FP8L 2VDOH 4NKOB 1UADC 1H3TA 3RFZC 4PRID 1C5BL 4PREA 2EC9U 1HHKA 2R1WA 5HY9A 2ARJA 4PTUA 4ZYKA 1J11A 1NJ9B 4PG9A 5A2FA 3QSKB 3QUXC 8FABB 4LLYA 1KB5A 4PGEB 3OGCA 4HC1L 2F53D 5FA3A 4KK6C 3QRFM 3RUGF 1G7HB 2KBGA 4P2OC 1YN7B 3PGCB 1EEZB 2NYYC 4LVEA 1XF5B 5D93B 5IMKB 4W6YB 4UAOC 4YHIB 5FOBB 1V7MH 3BWUC 5DQ9A 3U9PL 5MP6L 4X7CC 3FO2A 1AGBB 5J6HB 3EIFA 5HDQL 2EKSA 5EIQA 3GSVA 1DVFD 4NHCL 3O2DA 1IAII 3M45A 3O45B 5A16A 3UJTH 1NBYA 3PXJA 2R2BA 5I75C 3PWPE 1T6WA 1ADQA 4KMTL 2P5EA 2XTLA 5HHMD 5C9JB 5C0JA 1MH5A 1DQML 1F4WH 4OBSA 3V5DB 4L8BB 1C5DB 1FZKA 5I0ZA 2F54B 3CXHK 1U93B 4RMWA 4JPVL 2VXQH 3X12A 1E4XI 1XCQB 4LCWB 3QPXL 4EKXA 2XN9A 5EUKB 4F58H 4PR5A 3SCMD 4HUVB 1INEH 3RKPA 4RAUA 5IVXF 3F58H 5CEZH 2JB5H 3SDDD 3MRBA 2W0FB 4WCYH 4WUUE 3WN5B 3LKRA 1XF4A 2G75B 4XBPB 1WVZA 5HHXH 4L8DA 5ANMA 2GTZA 2FO4B 3SCMA 3EZ8A 1QSEE 3VWKB 1ZHKB 3ARZA 3GM0A 3OB0K 5IVXA 4LSVL 4NQEB 4ZO6A 4MAYB 4P57B 3M1BB 3AS2A 3RHWK 2D2OA 1JCKA 1FIEA 3SJVA 4Y16C 2VDNH 3Q0HA 4BA8A 3X13B 1WITA 4PV8B 4FA8A 4JY4B 3STLB 2C4FU 3WJLA 4KGJA 5HI5D 4S1RL 1A7PL 1J8HA 4NPYB 1UXWB 3GI9L 2HH0L 2OSLB 5CIPH 5TGBA 3TGXA 5MEQB 1JPGA 4O51B 1I7RA 2P8LA 5E5MA 3OKEA 5E2TH 1H3WM 3IAPA 3CZFA 5HDOA 1OGTA 2EYRA 2YK1L 1EHLH 3UDWC 1Q72L 4OI9A 5D5MA 5F1IB 1A1NA 2VXTL 4UBDD 4AIXA 2RIKA 1AKJB 1E6JH 2Z8RA 2XWBB 4UOW0 2VABB 2IANB 4F7TB 3QI9D 3DGGB 4ZD3L 2W9EH 4YXKL 5IW1A 1R3KB 3F6IA 3OR6B 4NKIH 3RWCB 2QSTA 2NW2A 3ZTNL 3X3FL 2B2XL 3HLAB 4Z8FL 3HCVB 5C9KA 4PJFE 5GISL 3UYRH 1R5VB 1VSCA 3KPRB 1QUNA 3MRIB 4JY5H 5J9PA 4PRIA 2A77H 4OM0L 1FPTL 3ZSSA 4XP9H 1DLHA 2XZAH 5FO9A 5EH1A 4J1UA 5GJTL 3HC3L 1XCQA 3PUCA 5CD3A 4Q9RH 3SY0A 1AE6H 1R6VA 3VGAC 4PGJA 1AXIB 4XMPH 1UJTA 1T21A 2QEJA 3N1PC 2X05A 2CKBH 2BDNH 1J5OL 1XF4B 4XBPA 2O5YH 4K3DL 2FL5A 4ZUVB 4CW1A 3KHQA 3H7LA 2D7TH 4YE4H 5TDPA 3UTQA 1FE8L 4PLOB 3SO5A 3FB7A 5KVGL 4FFWD 4FMKA 2IAMA 1WFOA 3IDYC 5KSBA 1FO0L 1OPGL 3TIEB 1J1PH 4NC1E 2UWEE 2GIYA 3PQYB 1S9XB 4MQXC 4HPYH 5HHOB 5FCUL 3MREB 1OM3L 3V7AE 5DS8B 4XMKH 4Y4KC 4NZUH 1AGBA 3O6LL 4K9EL 4I0PA 5DJ8A 5C08A 3K80A 2W0LA 2EXWD 1DBBH 2ZCLH 1NFDE 5KSVB 4Z76B 4ERSL 3CK0L 5IJKC 5HGBB 4KUZH 4OZFB 4ZSOB 1KB9K 1SJXA 1B2WH 3MLTB 3KLHC 2Y07L 1NBZB 4TVPE 1DBAH 2D7MA 3RDTD 5L9DH 3RGVC 3RY4A 2V2XA 2ARJB 2GJ6E 1DBBL 3KGRA 1I7TA 3LVEA 3MNZB 1AO7A 3N85L 1EXUA 5F6IC 4CMMA 4HK0B 1JGUH 2DLFL 3QCTL 4GXVH 4Y4HA 1FNFA 1IGJB 2H2PD 4MS8C 1ZHNA 5D5MB 4XP4L 1I1CA 4U1SA 2H2SC 2ZCKL 5IKCA 3NMEA 3UTSA 1XZ0A 4GAGL 3OKEB 4UILL 2HT2D 2R56L 2WBJA 2V7HA 1TNNA 3N85H 4YHOL 4NNYA 1RFDH 3GMPA 3CFDB 1X5HA 5K9QI 5DD0L 5HI5C 1SYSA 5HHMB 5DC9B 5IFAH 4LKXB 2IH3B 4PJDB 1HHKB 4WFHD 2YA0A 2PN5A 1XMWA 1A1OA 3MV8D 3K3QA 3U46B 3ARDD 3TJEH 4OB5H 3TN0B 3EOAB 5IHLB 3MRRB 4OD1L 1BJ1J 4G42B 4YFLF 4XPTH 3ZDZE 1KJ2A 2FRGP 5I0DA 4HJJH 1RZKH 2NTSP 4ALAH 5IB3B 3SCMB 5E5MB 1KJVA 2VLRB 4RQQB 5GRUH 4N1CA 4FRWA 5C0BB 4RX4A 3SDDB 1QBBA 3QIBC 4R0LC 2D4FA 1KV3A 2N56A 1GOGA 3ZTJG 3X13A 2IFGA 5GGQL 3UTTE 3SGKC 2GJJA 4IRSB 4QTHB 3T0VA 3GI9H 3L3IB 1TZHA 3VWKD 4HZLA 4XP1H 5C8JA 2P8PB 5K9KA 4WFGD 2EH7H 5DWUH 3RPIA 5E00B 1EJOL 5E9DA 4I0PC 3QEUA 4NZTH 1A3LH 4KRLB 5C08B 3RUGA 3ZKQD 3NACH 3IDGA 4QRPA 4P5MB 4NBYB 5GS1B 3EGSA 4FQQB 4K7FA 3NIDE 4MJ5B 2O26U 4HJGA 4IRJD 1R5IA 5FGBC 3F7RA 4X98A 2EH7L 1PX3A 2ZCHH 4JB9L 4MNGB 3VXPA 4ONFL 3AUVA 1OD7A 2PR4H 2R2CA 5ACZA 4NZJA 5C9JA 5EU5B 4L1DA 1ZEAL 1YMMB 3CFEB 1Q1JL 4HS6A 1OF2A 4YHIA 4ZS7H 2PYEA 3QWQB 1FNGA 2ZUQC 3HPJB 4DUXA 2NYYD 4Y0GA 3DRQB 5J6GA 1LO3H 5DT1L 5J6HA 4WEMB 4FQXB 1J0ZA 4N8VA 5CP3H 2HYMA 4LDLB 3FQRA 1BEYL 3HNTH 3S37X 1EGJA 4LLVA 4DZ8A 1SMOA 3MR9B 3F12B 4S1QH 5C0EA 4FQJL 4J7RA 1G7HA 3HI5H 1KEMH 5CZVH 1ZLUK 4MHHI 2HLFC 4X9IA 3VDBA 1VCAA 4NKMA 4NM4H 5F89A 3WL9B 4F57L 4NN5B 3P77A 2GFBB 5H37H 2XA8H 4OFIA 4KPHL 1LP9A 4KJQC 1A1NB 4JPWL 3KPRE 4MXQD 5BW7A 2JCCB 4C57C 3FN0H 4JRYA 4PJ8A 3TVMC 4ODUB 1T6VN 4QOKA 2BOBA 3G6JE 1X3DA 4LAJH 4NIKB 1AHWA 5K9OA 4MXVF 1F2XK 3RWJA 4XNXL 4Q6IA 1PYWB 4PV8A 3FAWA 5F1SA 2BXZA 4JM2F 3DROA 2EDOA 3GJFK 5TQ0L 5C0IA 4M3KB 2QSCH 3TBYA 2P45B 1PQZA 4XHQA 1JYNA 3U4BL 4U1NB 4IIQA 2HRPH 1FIGH 1MHPH 1MFCL 2AERT 5DO2C 4JGJA 1CIUA 3CFIC 2OP4L 1MIML 2YUVA 3R4DA 1GGYA 1BFVL 5ADOL 2I60L 5MERA 1UB6A 2DM2A 1PSKL 4HDIA 1KBGL 2MJWA 1Y6KR 1D5XA 1OGAE 4KKBC 4EN3B 4POZC 4J4PC 5CJ8A 1MY7A 4CGTA 5D7LD 1BVZA 4XB8A 4GAJH 1RHHA 1N3NB 5FK9B 1U8QA 4LIQL 1RZJC 5J1AB 3C6SA 2PW1A 4LLMB 4UBDC 4BKLA 1KIPA 1P69B 4ALAL 1I1AB 3LZFH 4L8BA 4X0KA 5D71L 2Y06L 4FZ8L 1NCDH 3BEWA 5I9QC 3L95A 2P7TA 1NL0H 5A2IH 3JWOH 3DO7B 1OAZH 3VFTA 4IMKA 5JORA 1I3GL 3H6JA 2GK0A 1M7DA 4X7TB 2YD3A 3T77A 4FP8H 4JEGB 4TVPL 3N0PB 5F9OH 3KNBA 3VWJD 4DN3L 4S1DC 3D69A 5C0BD 2WQRA 2AI0H 2YEZA 3FZUD 1XGRB 1YY8B 1KCRH 1ES0A 4K7PL 1CK0H 4LGRB 4MA8L 3WL9A 3NCJH 1M4KA 1WCBA 2YD9A 3MUGA 3ZE0E 2CLZB 4JQXA 1SEBA 1CYGA 4EBQH 1AHWB 1LEKA 4OZIA 2AJUH 1EO8H 4FQHA 2E6PA 1AFVH 4EOWH 1HYRC 5JOFA 1BIHA 1DBJH 1ETZA 2D7TL 4OT1L 1BJ8A 1MVUB 4GLRI 3S8WA 4N9GA 5DMGD 1GHFL 5DT1H 4BH8B 3TESA 3MGTA 3ARBA 1P4LB 2DL2A 4G3YL 4P23C 2DD8H 5I8OH 1NAKL 5ESQB 1YMMD 2BSSA 5I16B 3NAAH 1OB1A 1U3JA 4BZ2L 3BHBB 1AY1H 3QG6A 4NHUB 3FFDA 2OK0L 5HI3C 2Y5TA 3TN0D 5EB9A 1A6TB 1KPRA 2IALB 4YPGA 2DLEA 3T2NH 2UZIL 3S5LA 4FG6D 3PWVA 1ZA6A 4WI8A 1FNGB 2DQDL 4HWEL 3WHE1 5DI8A 3TZVC 4MA1C 4I5BB 5HGDB 1BVKA 1J1OL 1F6FB 1KCSL 4NQCD 5E70A 1F3JA 5D7LE 5SWQA 2ADGB 2XNAA 5ABDE 1JGLL 5BV7C 4LPTA 5IMLB 4I77H 4MWFB 1F4XH 1Z9LA 4XWOC 1NUNB 1KJ3H 4EN3A 3LEVL 4YNYA 3QDJD 2MPAL 3E8UH 5E00A 3VG0H 3DVIA 3RWGA 2XICA 1N3NA 5FK9A 4KJYB 1V7NH 4KVNH 3LQZA 3GFUA 1QEWB 4HQQL 4RQQA 3ZE1E 4F7MA 1G0YR 1MPAL 2HKHH 3DROB 5C08D 3SDXB 4Z7UA 3KYOA 3O2VH 1MRCL 7CGTA 2VZ1A 4M1DH 4P49A 5JW4N 4X7SL 4E0RA 4IRSA 4NWTH 4XPTL 2QHLA 1MQ8A 3H3PL 3NIDF 2BOBB 2XTJB 3QP3A 3WV0A 4PJ7B 5E8EB 3I50H 1HWHB 4AM0B 1HHJB 3B5HA 1IGML 1YEJL 1XIWB 2PXYA 1DVFC 4NNYB 1RUQH 2GUOA 4GBXC 4OGYL 3GJFA 1T5XA 2DWDA 4YBQC 1A47A 2YK1H 1MF2L 4X8JA 2QADC 1B0GB 3H2WA 4XCFH 4M43H 3BJ91 3AXLA 4FQXD 2P5ED 4M5ZH 4ENED 2R0WL 5JW5B 1I8LC 5CLWA 1T0NA 3MV9E 4I3RH 4WUUB 5GIRA 3N50A 4Y4HB 1A6AB 2NNAB 2R8SL 1RZIA 5JHLH 2DMKA 4ODUA 4ZOAA 4I9WE 3RWIA 4EJ1C 2VB5A 5IKCB 1QLFB 1CT8A 5IBTL 2H9GA 2CKNA 4UDTA 4HF5H 4XPBH 4J3VA 1XGQA 3VH8A 3WFHB 5J6GB 2A77L 4OM0H 3ULVF 3BX7C 3L3GA 2V2XB 5FUZL 2OZ4A 3QH3A 4I3SL 1GIGH 1RK1A 3MV7E 3STBA 2LTQC 1BREA 4BZ1H 4HXAH 1SJHA 5HHOE 4KXZH 1KCRL 4JGMA 2BJMH 3X17A 1YNTB 2CIKB 4M6OL 1D5ZB 4LSTH 2KZ1B 1ZANH 3LN5B 1MCIA 4EN3C 2P7TB 3QUML 1J8HD 4J23A 5GS1A 1RJCA 3IDGB 2RAMA 1M71A 2ZJSH 3KWWA 5ALCL 3RNKB 4YXLH 2E27H 3TIDA 4HEPG 4A6YB 3CPLA 4TTDC 1QBLH 4L8SA 1S9YB 2CDFA 4LCUA 4LCWE 5EU5A 4I8DA 3GRWL 2VDMH 1BQHG 1IVLA 2CGRH 5CSZA 2NX5D 3KPOA 5F7EH 3EDFA 4PJGF 5F44A 4U1KA 3ZYZA 1GYAA 5D1QB 4IM8A 5BV7B 5F7FA 3GDBA 4P2QB 1F11B 4XMLH 1JHKL 3SDDA 5EU6A 3UX9B 5F1OB 5GGTH 4X80H 3UAJD 1U42A 4LFHG 3JV6B 2DN7A 5DJAA 3ZO0A 4QHNA 3EYUL 2AXHA 3NIGF 4NJAH 4P4KB 5L8JB 1J86A 5GGTA 5FYKH 4PJGA 1J1XL 2JE8A 1AKJA 1PLGH 4JM2C 2H9GB 2OQJB 1R3IL 4M9OA 5D7JA 1XGPB 2BVTA 2XPGA 3O3AB 1R3KA 1OLZA 4WTXA 2W9LA 3VRJB 3GSNB 3G5XA 3MUZ1 3S35H 3WKML 2P44B 2IBZX 3PWNB 1HH9A 4L4TB 4DGIL 5AZ2L 2QKIA 1PJ9A 4YX2L 3ROOA 3EDEA 5MHSD 1XIWC 1KJ3L 2EYRB 4LASL 3QFJB 4U31A 1P7KB 4ODWB 4DWHA 1KTDA 3VA2C 4K7PX 4C4KT 5EIVA 2XQBH 1KOAA 1LP9F 1LO4H 1HQ4B 4ETYA 5IHZB 1ZHKA 3S4SG 1DANU 3LIZH 4TSAH 3IDMA 2JJTC 4XNQB 3T0ED 5K93A 1JPGB 4O51A 3SDYH 2PO6C 5C0FB 3UPAA 3DETC 3VFWA 5DUMH 4ELME 5ERWA 2BZDA 3ZE0F 1XF2A 4FFZH 2ICEA 3QQ4A 2VJXA 3LKOB 3GB7B 3QUKA 5HDBE 3SJVB 4PJDF 3M17A 4F3FA 2XKNB 5I66A 4L8SC 3V7AG 4HFUH 4ZTOL 2ADIB 1JPFB 1A8JH 1UQSB 4LHUG 4XP5H 3EKCA 4DGYL 1KG0B 4M48L 3O4LE 5KANG 5JIHA 2Q8BL 1N4XH 1G9NC 4LSSL 3MLTA 4ZPTA 4Y5VC 5DK0A 4R26L 1LO3L 1KJ2H 2UY7A 4FQLL 4PBVC 1IILE 2AXJA 4L4VB 2F9BT 1NKRA 4RGNE 4M9PA 5SWZE 1F90L 4FS0A 2A9MH 2GY7B 4WUUD 3D9AH 1TZGH 1A2YA 3ARDA 4M93B 3FFDB 3SDCD 4G6JL 4YLQT 5J12B 1MLBB 1EEYB 2XTJC 2MQ3A 4B41A 3REWA 1CGVA 4OUUB 4WHYH 4ELKA 3BPLB 1XCTB 2BNRE 3MGOA 3T0BA 3MROB 2B7DT 3ARFA 4XPFH 1J12A 2PR4L 4LL9A 2VZOA 3G6JB 1JI2A 4UIKL 1XGQB 3CJJA 1Q9LA 1YEDA 5DQ9B 3RWCA 1ZE3C 1UFUA 1SY6A 1JWUA 5EZLB 1QFPA 1IGFH 1D5MA 3PGCA 2R1WB 4YH6A 5K59F 4RGMB 1UGNA 3HS0A 4KTDL 1X5ZA 4HX1A 3MV7D 4CN1A 3O6FC 4LSUH 2PO6A 4KKLD 4CADA 4RMRA 4YHZL 2AEPH 1W8NA 4BFGA 3RWIB 1K8DB 3O8XC 1T2JA 1FL6A 1CICC 1GC1L 3HE6B 5AAMA 4OSUL 4IRJC 4K07A 4FN0A 5CEYB 1DQQA 5GPRA 5C0BE 1KYOK 2HFEA 4XNXH 2HWZL 4PJAA 5GZNC 4H8WL 5FYLD 3MJ7A 4GG6E 1I7RB 2P8LB 2V6HA 4NGHL 4QYOA 4X6EA 1BPVA 5DXWA 2D3VA 3VXTA 1FJ1A 1PG7H 4D3CH 4G43A 3MBED 2W0FA 4DTGH 3MNZA 2EO9A 2G9HA 3RVUD 5KSAD 2J88L 4U1KB 4H26A 3DXAB 1CFTB 5AUMA 5IGXH 5L88H 5HYQA 1FGNH 1OW0C 3QNZA 3QIBD 3ARRA 3SDAC 4A2MA 5IVXB 3VRLF 1OP3K 4OFKA 1QSFE 4NN7B 5DRZA 4A6YA 3JWOL 4L8DB 4H5SA 5ANMB 5I1GL 4B50A 2X1PA 4K8RD 1ZKAA 2Q86A 4JJ5A 4LCCA 1CFVL 1FPTH 2D9CA 2IALA 1S9XA 4YPGB 4U6YA 5ALBH 4YNYB 2JELL 3BT2H 1NCCH 5CJXC 1MRFL 4DKFH 1LEIB 4X4YB 2YXMA 1K9TA 2ESVA 3TPUB 2NY4D 5HSFA 1KXVC 1SJHB 1GGBL 1MIEH 3LCYA 1BGXL 4YHPA 1A6VL 4YHKL 1UM5H 4RMVA 1DQLL 4YJZL 1JPFA 1RK0A 4YE4L 4JHBA 5F7MC 4YBHA 1NUGA 5IQ7H 1VEOA 2R2EB 4HBQA 4KRPB 1ZS8A 4NZRL 5DRNB 3KYMB 3RX7A 3EO1A 4C58B 1Q72H 4M93C 2VN4A 4U1IB 3WFDL 1OY3B 3LH2H 2DBJA 1MFEL 3PWPB 2R29H 2ESVD 2NX5B 1KT2B 1IJ9A 4O5LL 3O11B 2X89A 3VXRE 3UPCA 2HT3C 2VLMD 4X9GA 4P2QD 3P2TA 4N0CD 3OXSA 1CD1B 4LRIC 5D2LF 3SJVD 4WHCA 4R4FL 3DGGA 4O2EA 4L3EA 4F2MB 2R4SH 1T4KB 2X4SB 3UYRL 3M07A 1JV5A 2GQHA 4H8WC 4L1HA 3WFEH 2C3HA 4KQ4H 5LKNA 2R9HD 1NMCC 3NAAL 3HI6L 3KYNA 3VFNA 1XFPA 2JIXA 1T5WB 32C2A 4M8VA 2EIDA 5IFHH 4AEEA 1PGRB 3I6LE 3MX0A 4L4TA 4S1SL 2BNUB 3T0AA 3DTXA 4XCEA 2NY2D 3NTCH 1V3JA 4HWNA 2YPVL 2DOCA 3O3AA 1C5BH 2V7NA 2WWMC 4NO2A 5T3XD 5I17B 5FFLA 1B4JH 4PJEF 1RUPL 2FLBT 4NSKA 3OPZH 3MPCA 4FQ2L 4YK4B 3SDCB 1KN2H 1HCVA 1BWWA 3H8NA 3C6SB 3VFMA 4ZPVB 2EDLA 4Z7QE 4AT6A 5FA4A 4PJXA 3RU8H 3ZKNC 4JFYB 3B9EA 4L8CB 1NGPH 3ETBF 4HFWA 3ZSTA 4X4YA 3TO2A 3CX5K 15C8L 4G7VH 4O4YH 2ICWI 4GMTL 3QHZL 7FABL 3OJMB 4OI7A 1GZPA 2D03L 1YEHL 4JJ5B 4LCCB 2Q86B 4G8IA 3PHQB 1KCVH 3GMOA 5DURD 1S8DA 3PP3K 5CSZB 2VIRB 3QBTB 3IAGC 3QI9A 2OL3H 4ZUUA 5HGHA 3C8HA 1BWMA 3ARVA 4ORGB 3I6GA 4HKXA 2C1OA 3MV7B 3BP4A 2BVPA 1F4AA 2SEBB 3K81A 4HUMB 5A2LH 3VXSE 3DBXA 3EOTL 3CH8A 3MV9A 3FQWA 4JFHE 4JPVH 1YECL 4OLXL 4TSBL 4OCNC 4JGUA 5SWSB 3BPLC 1FNAA 4D3CL 5CIPA 3EDJA 4BQ9A 3L5WB 3KPNB 4M7KH 3SKJL 4XVJH 2AABL 4XAWH 1JK8B 1MCWW 3AB0C 1JGLH 3JUZA 1PG7W 2WIIA 3NIFF 1EJ6A 1DQMH 4JFEA 2NY1B 2WW8A 4JRYB 4PJ8B 4U1NA 5DD6A 4MGXA 2DICA 4G8GD 5FM5O 1WLHA 5EZIH 4AH2A 1MCPH 1FZOB 4JHWL 3REVA 3LQAH 2C7UB 2HLAA 3G5VA 3TT3L 1RURL 1QTYT 4M7JH 1ZHBA 2Z91A 1L7TH 3MRJA 1CQYA 4Y19B 4R97C 3QIWB 4PJHA 2DLTA 4WW2F 4WFED 5GGSB 4JHWH 3DIFA 3D18A 5DQJB 4XBEL 4D0CB 5GGQH 1CDCA 5HVHB 3VGBA 3BZDA 1N7ML 3HKFA 3OXSB 3L9RA 5FUCC 4QCIA 3CVIL 4Z7NF 3S4SB 1QFWH 2E9WA 2DMBA 2QQLL 3FQTB 5FUZH 3SDXE 4NKMB 1QFWM 3SGJA 3VFTB 3W5MA 3MUGB 4XBEH 4P2CG 1IM9A 4IOFD 4HKJB 4AEIH 4L9LC 3VXNB 2A9NH 4M7LH 2VLJB 5MHSE 2CK0H 3HRZB 5JW4R 4X6DE 1YJDH 2Y7QB 3SDAB 1TZGL 3RI5K 3TA3A 1I1AA 1KLFA 3HE6D 5JZ7C 1FFNA 4Y16A 5ETUB 3R06A 4YHPB 1CE6A 4R4FH 2PNDA 3I84A 2WIMA 1LD9B 2L0DA 4ZS7L 3PNWB 5A43C 2GY5A 1QBLL 3PHQA 5JORB 1OQXA 5TQ2L 5E2VL 1D5XB 2JJTA 2XZAL 4Z95H 4EZMA 1BQLL 1D3CA 1FGVH 1P9MA 2E5EA 4KROC 5EZOH 4CVXA 3TO2B 2NLJB 5GS2D 2VITA 1ONQA 4C56D 4QY8B 5KSAB 1M6OB 2BVPB 3QUMA 3S37L 3VXRD 3DURA 5EOQH 5A40E 1AR2A 2BCKB 3AMLA 1B6DA 1SQ2N 2Z92A 2I9TB 3EO0B 3PV6A 2ERJB 5DJDB 1MELA 3E6HA 5AUMB 2LVEA 1B4JL 5I19L 3C60A 4N1EA 5ITFA 4OZIE 5AG8A 5D7SL 2AV7A 2ICEB 3QQ4B 2NY4C 1QBMH 5EN2A 1BLNB 5JXAH 4OF0A 5FXCH 1F13A 5H35A 4LASH 3TNMA 3TO4C 2PYFB 3MLZH 1A6UL 1G9NL 2HWZH 3W39A 1C1EH 1A7OL 3HFMH 3G04B 4NC1C 1S7UB 3BUTA 3K0WA 2NY4B 4JZOB 5FGRA 1E27A 1S3KL 1F02I 3U0TA 4LF3A 4XMLL 4YHLH 1Q38A 3P77B 4D8PB 1YYML 2NXYD 3FO0H 3QJHA 1RJZB 4MAUH 4NNPH 5K9OB 3RVUC 3DX6B 4X83A 1PDKA 4OIIH 4CN6A 4LGSB 1A6PA 4OM1L 3HZYA 1HEZB 2I26N 5FECA 4BK4A 5BZDA 3CDYA 5D6DC 2BY0A 1VPOH 3VXUB 3MYJA 4XVJL 1JV5B 4LAQH 3IXAA 4G6KL 2R2EA 5DRNA 5D2LE 4RSVA 3O2WH 5MENB 3ZHDA 4BQ8A 5BOZG 1NC2D 1T2XA 4GLRH 3BXNA 5IVOA 4OIIL 5TE4H 1H15A 2V5MA 5SWSD 3GJEA 1LDPH 3MCKB 1FYTA 1ZLWK 1GGBH 4FNLH 3O11A 4B0MM 1NDGA 5EPMA 2AEQL 3VFRA 1GH7A 4JFHD 4LQFH 1PKQB 2DQCL 2NY1D 2FGWH 4UTBL 3TP4A 5C6TL 2XN9B 3Q6GL 4H1LB 4WWKC 4GRWF 1UKSA 3TWCH 3ET9F 5KSBB 5DJ8B 2HJFA 3PL6D 1U8LB 1QLRB 3RGVD 1BBDL 4G6AD 3JTSB 3QQ3B 4PD4J 3F7VA 1NMBH 2FL5B 2NY5H 5DJXB 2R1XB 3RX8A 3OKKA 4X98B 5D72L 3KPRA 1BAFH 1F6AA 3RJQB 1HSBB 2I9LB 2GT9A 3CVHH 2EXWC 3MRNB 2V5YA 1FZJA 1OAQH 3CNKA 4E42A 3SE4C 3I6KA 5DVKA 1EUTA 2ZG2A 5DURB 4HIEA 1Z6JT 4TUOB 3DOSA 5IW1B 4ZAKA 3SY0B 4EXPX 3RGVA 5D72H 5I1IH 2YPKB 1P4BL 2W07A 1TIUA 5JLZA 1ZEAH 2ITDB 3MA9H 4RCAA 2B20A 4GUPB 3KS0J 5JW3H 3RZCC 2DTML 1JNLH 5HHNB 4X4ME 4MLSA 3GK8L 5EBLA 4KRPC 3QUYB 3QT2A 3PV7A 2KQMA 2OL3B 1P7QD 3PP4L 4KJPC 5LWYH 1A6ZB 5D6DA 3DHJA 25C8L 2D0HA 3WYRA 5HI4C 1Q1JH 3STLA 4CRPA 1MAML 4F7TA 3ZYIA 4U1SB 2VLJE 5JIPA 3F7PC 4X6CF 2FBJL 1AC0A 3KPMA 1A7QH 3QEGH 3EYSH 3QCVH 1ED3B 5F9WC 4L4JA 1F4HA 5MEQA 3IDXH 2OSLA 4R8WH 2EDXA 3FO1B 1CD0A 4MDJB 4EUPB 3OMZA 3LKSB 3HZMA 3CZFB 3EYVA 5E1AB 1U2CA 4LPVA 3RDTC 4HWEH 3HPLB 5FOJA 2Y25A 3BSZL 3M1BA 2AXGA 4Y19D 3KPPB 5JW4M 2WP3O 3IDXL 5GS0C 2NXYC 1EV2E 2LABA 3CD4A 4YHYB 3ULSB 4GKZA 2G75A 4HFWB 1DFBL 2IJ0C 4WW2A 5EORH 1AI1H 2Z31A 1N5AB 2HT4D 3EYQD 1M7XA 1PG7X 4JPWH 3OKDB 1DN0A 4KROB 2DYPB 1JNNH 1S9WA 3T08A 4PTTB 2F5BH 2J5LB 1HDMA 3MV11 4Z7NE 4XNUH 4YK4C 1CDHA 1CFVH 4OTXH 4ZPTB 1T66C 3HUJA 1MCQA 3SDXF 3MSPA 2Y6SC 4NZRH 5ACZB 3C5JB 4RX4D 5F72S 1QYGH 2HRLA 3SDAD 5L2KB 1VERA 3QUXB 1AC6A 1MH5B 5L8LB 2JB6A 2C4FT 3IF1A 2Q7NA 3BIKA 3TNNB 4DEPB 1FDLL 3X12B 5HTSA 3GNML 1NLDL 4W6XB 5T5FL 1PKQE 4NHUA 4P0DA 1U3HB 2FJFA 1YC7A 4M61A 4YZFE 4YIQA 1ZT1B 3EYOA 4MHHG 4OFPA 1S7RA 2V9QA 2DIAA 1NCAH 3L3OB 1WFUA 1T04A 3KYKL 4PJBF 2AAVA 1ZHLA 2X4UA 1CQKA 4LPWA 3VXRB 5ITBL 1HHIA 4G80A 5T33L 5B3JF 2A6JB 3UBXB 1FH5L 4UDTB 4I2XA 5HD8D 3C5SA 4M7LL 4ZQKB 2EYTB 2WUBL 4L3AA 3B3IB 1NCTA 4YAQA 3WFEL 2VDQH 4P59L 3L7EB 4EIGB 3IKKA 4A2LA 1HN1A 1T80A 2CJUH 4WENB 3TN0A 2J8UA 1PKOA 4UU9B 3MLPA 2ICCA 1N6QH 1G7PA 4XNQA 2FJGA 1FN4B 1KNOA 4I4WB 3NGBB 1KN2L 4KU1A 5DFTA 2VOTA 2Y36L 4LF3B 4N1HB 2X9WA 4UNUA 4FTVE 3LQMA 3MRGA 1SBBA 4PTTA 3BH9A 3DX8A 1FCCA 5EULV 4CVZB 1KENL 3C9NB 3LN9A 5IQ9A 4LLQA 1NMAH 2E9IA 4L4TE 1IRAY 3WLBB 2ILLA 2A74B 4YDVB 1N64L 3ULSA 3OAYH 4B7IA 5GRZA 1KLUB 4GAGH 2KL6A 3PHOA 4QT5B 5HYJA 1JPSL 1ODAA 3ECBA 1N26A 2CO6B 1LO4L 2D0FA 3MZGB 4PRDA 2A83A 1NDMA 4W70A 1HDMB 4IOIB 4L3EE 4L9LB 3KLDA 1OM3H 1DQJA 1P1ZA 4FXKB 1C16A 3UZQA 2UUDK 1MAMH 2X70B 3ARSA 4X6BB 1IEHA 4UAOB 4RRPA 3CSPA 1JPSH 4PY7B 3N1QC 3FCTB 4QY8A 3T65A 3UTPD 4AY0A 2VZ3A 2LAGB 1FL5A 4MMXC 3QUYD 5D7KD 1YN6A 4P2QA 2A73A 1ZT7A 1P7QB 4QTIH 3LPWA 4EIZC 2AK4B 3QEQA 3PABA 1G7IB 1CFQA 1F58H 4K94H 4ZTOH 2DWEA 1EMTL 4XPAL 2AKRB 5CZXC 2CDEA 3SE3C 3BIAX 3BKYL 1A7RH 1LO5A 3DI2B 3U4EA 3UTZA 3RZCB 2I25N 3KPMB 3KLAA 5JLZB 3OB8A 2J6EL 3QXWA 4JLRA 3U30C 4BM7A 1P9MC 2WUCL 3BP7A 4YUEL 5BOPA 4I2XB 2YS4A 5FDWA 2HH0H 4M6MH 3MRNA 2JJSA 1JPTL 4K3JH 1CD8A 3IFPB 5DGRA 5IVXE 1ZHLB 2X4UB 5HHQB 5HXMA 4HBCL 3MO1A 4R4BB 1T66D 4FFVC 3T4YB 4D9RD 5JPMB 4RGNC 3T2OA 3VD9A 1NKOA 3WXVH 1WC7A 2R4RL 3F7VB 2ITDA 1UYWL 2W9DL 4Q58C 1U3HA 3SO3B 2CUIA 2OCFD 1NFDA 4LLYB 3RWDB 2ZUXA 4H88L 4XC1H 5DVLA 3ZL4L 3BYTA 2VXUH 2EICA 1BJMA 4PREB 4GRLC 1OARL 4XP6H 2GT9B 4PP2B 4PJEA 3GHEL 1U92B 4GG6A 2VUYA 3HR5B 3VW3L 1CTOA 5D70L 2WQ8A 4Q6IC 5SWZD 1JZ4A 3KNBB 2A0LC 4JB9H 1HI6B 3KXFA 5ELIA 5KSBF 4D0BB 1G7LB 1LO2L 2P47B 1YN6B 5C0RH 4U33A 2LU4A 2HTLC 4XPBL 1UACH 1U3HD 2P48B 2E27L 1RUKL 2J5LC 3BISA 3ZKSD 3EJYD 1WBZA 4X5WA 1S5HA 2O5YL 2X4TB 1WWCA 3W0WD 2CRYA 5DJ2B 5LXGL 2VDQL 1QKZH 1I7ZA 2R8SH 2ZCHL 3P9LB 4X7FC 4E0RB 2YA1A 1EZVY 3ECBB 4G9FE 3O8XD 4YR6A 1G84A 1U8QB 1FFOB 2E8YA 4GAFB 4KJPD 4LLWA 4BELD 4WO4D 4Y2DD 1KLUA 4QRPB 1FVDB 4FABL 4DEPC 4AK1A 4XP9L 5AEAA 3MFFA 2DMCA 1CVSC 5DD5H 3LB6C 2JLLA 5K33A 5E1AA 5JHDB 4LVOB 3HC3H 1XF3B 4WU7B 1C5DA 1FZKB 1JJUA 5DMIH 3F7YA 4Z78A 1T0MB 5D5MF 3UTOA 5D6CA 5ICYB 1P4IL 4R96B 2L7UA 3OAUL 4FQ1L 3FB5A 1G9MC 1UB5A 2ESVE 3QUXD 3QNYA 4WWKA 3S34L 2CO7B 1AJ7H 4W6WB 4XVTH 4Y4KB 3WDJA 4CDGC 5DC0A 3OKOA 3VFUB 2EYTA 1T1YA 1BQHA 2BNRB 1JYVA 5ECJE 4WU5B 3S35X 3U9UB 4HXBH 5C09B 3ZYOA 3IDJB 1L0YA 3C2SA 5T3XL 5JA8B 2NY2C 2NY0B 4AYFA 4DOHE 2IH1A 3CLFH 1G7JB 5EOTA 4Y1AA 4Y5VA 2VKWA 2NY3C 1UJ3A 3MRKA 3V4PL 4JFFA 1WFNA 3VWJC 1VA9A 4NKDB 5C0AB 4PB0H 6FABL 2EDQA 4OLVL 2Z4QA 2Q20A 4OFDA 1OOAA 1II4E 2MCPH 4HXBL 2CD0A 2DLGA 3S35L 1KXTB 3MLUH 4Y5YC 3DPBA 4KMQA 2VH5L 4IDLA 2YRZA 4LKCB 1N2RA 3WNLA 1T22A 4NZDA 1LNUB 5IF0B 1BOGA 5B3JE 2RJMA 4R7NB 3SKMA 2XWJA 1AHWC 1CLOH 3BH8A 2AK4D 4LCUB 3L7FA 1FFOA 4LLVB 1KT2A 1I8KB 4P23A 1CWVA 2VSDA 1U8NB 4C4KO 4PRNA 4Q9CA 3T0EA 3VXOB 2CXKA 5CEXA 4QRUB 2VISB 4PJIE 5I1KH 4X6DB 5CSBA 4HMEA 12E8H 1KB5L 2E7LC 5IB4B 2FCBA 4LMQE 4QRQB 5E8PA 3T3ME 5L0QC 4ZFOB 4IRZH 5IB2B 1MCCA 2XWTA 5DA0B 4JFOA 5JQ6L 4OLWL 3MJ6A 3HZKB 4LLDA 2HG5B 2WBJD 3RNQA 5C6TH 4LK4A 3WXWL 1EA9C 1RHHB 3S4SA 1M7DB 4X7TA 2XZQH 1IKNC 1FVCB 1MHHA 2OZ4L 2A6IB 4HHAA 4HUWB 4MA3A 1F45A 3RY5A 5C0DA 5B38A 2LVCA 2WINA 4H88H 3O2DL 4OV5B 5T1DL 1LDPL 3WFDH 1ACYL 1BF2A 1EVTC 3VH8B 5F7DA 1U8HB 2DD8L 4AENA 4EDWH 5CWSB 2Z35B 3QEHB 2A6KB 3VD3A 1KJ2L 2YD6A 3MC0A 2BVUA 5E4EB 1YQ2A 4M62H 1Y0LB 1PD6A 2CKBA 4NZTL 4D9RE 3DMMC 2VR9A 3U30B 5C0RL 4UT7H 4N0UE 1FG2B 4KQ3H 2Q7YB 4G5ZH 4JANA 1NFIA 4BQ6A 4LHUA 4JFEB 2GSGB 2NXZD 1MNUL 1Y18A 3IFNH 1TJGH 2XZCL 3VXMA 5AZEH 3PE9A 2R0LL 3OR7B 1HXYA 4KQ3L 5I6XC 2HLAB 3G5VB 4UDUB 1W0VB 2VWEC 2XA8L 5EC2A 4BZ2H 1UM6H 4KDTC 5FYLL 3E3QE 5DJZA 4F37K 2XZCH 3O3UN 3LQAC 1A14L 1BLNA 3W0WB 1FLRL 1C08A 1UVQB 3B2UC 1EEQA 3QNYB 1Q0XL 3QCUL 4HUUB 4KXZI 3BQUB 4PJ5E 3KJ4C 4F7MB 1RZJH 4QRTB 4KI5C 1DFBH 1ZLUH 1X4YA 1UZ6E 1J10A 4WCYL 4YO0A 1TVHA 5SWSA 5FGCE 4QXTA 3W9DB 2FX7L 5F7YC 4PJXB 3D2UA 1CG9B 1FGNL 4XBGA 4CVXB 5F7WC 2WINB 3LEVH 3NFNA 5DLML 1CD9B 3MXVL 3PNWA 4QRQA 5IHUH 4PRDB 2LFGA 4ZO9A 3TN0C 1SVCP 3GMMB 1OAKL 2DIBA 1YEKH 4QRUA 3F58L 1CE6B 2Z8WC 3VXSD 4RFEB 1RMFH 4HV8B 1F4XL 2DQHH 4ZFGL 4MA3B 3QG6B 1T1WB 4HZAA 2A74A 3L1OL 4YDVA 3C6LA 1HILB 1VACB 1U6AH 2WMPA 4MJIA 4DQOL 5FA4B 4JY6A 4S0SD 1OAKH 2XTJE 3VXOA 4WTZG 5CEXB 4NOBA 3QEUB 5F7NC 3G08B 1H15B 5FYJD 1H8SA 3CXHJ 1NFDB 2O5XH 3D5OF 1QRNB 2EDFA 4U7KA 1TZHB 3MRLB 5DQDL 3LKQB 5IQ7L 4D0BA 2V7NB 5D71H 4LDEB 4ZO7A 3ISWA 4Y8AA 1L6XA 4MNGA 1MCEA 5FHBL 3G9VA 5FECB 5I75B 1JZ2A 4LU5H 1I8KA 4P23B 1EEUA 4Y1AB 5CD3B 5DQJA 3QA3A 4GAYA 2HN7A 1T1XA 4ZFZA 4NDMB 3P0GB 1QSFD 3BKCH 9CGTA 1IGMH 5C0AA 5F88B 3GSWB 1K4DA 4MQSB 1D7FA 5SX5H 3RWDA 5IHBA 5CBAB 5E4EC 1ZHBB 3V6ZB 5GJTH 4XP6L 3E6FB 5D7KE 4D8PA 1MIEL 1HZHL 3RWFB 5I1GH 4O02H 4JRXE 2NY0C 5C6WH 4MCYA 2XFXA 3P0VH 4AL8L 3L3JB 4OD3H 1YY9D 3MO1B 2A6DB 3O9WA 4KHXH 2NY3B 4ZOBA 3BT2L 1H3XA 2VAAA 3BJLA 1GGTA 3UBXG 3MRQB 1YNLH 1T20A 4JRXB 4U6XA 4YC2C 1N6QL 1S9VA 2X4PA 2WBJB 4KDWA 4MJ6A 1PFCA 3SE3A 1XZ0B 1TVBA 4ZTPH 1ZANL 4APQA 5CEZD 1QKZL 1NFDF 3KG5A 3H42H 2RCSH 3C60B 5ITFB 5CJXA 5GS0H 1AQKL 4JM4L 4OCXL 1A1OB 1IFHL 4H5SB 1EUUA 3W11D 1KC5L 5C09D 1QLEL 2WUBH 5ISZA 3KJ4B 4Q97A 2W38A 2EEBA 1PZ5A 2H32H 2YUXA 3BGFC 2A1WL 2X09A 4Z9KB 3DXAA 4FQXC 5CLTA 1ZT4A 5J11B 2XIDA 3OX8B 3TJHD 3NH7H 4N9OB 1F6LL 2VE6B 4YXLL 1H3GA 1SM3H 3P9LA 4WGWB 3TBTA 5EU6B 5DJ2A 4NZUL 2A1WH 4PYHA 2AGJH 5ACLA 4MA7H 3F65A 2YHGA 4TNWK 4ZPVA 1LE5B 1KCKA 1KUMA 2GSIB 1KGCE 5D7SH 4FFVD 2HT4C 5EUOE 2OI9B 1A7BA 3WDHA 5IUSA 4L8SB 3VGFA 1RJYA 3RIFF 3EFDL 3ZTJH 1S9KC 4P5TB 3F62A 4UZGA 1M71B 4GXVL 3DMMB 3MJ7B 1HSAB 4KKAC 5AZ2H 4L9DA 4PJ7E 3BUYB 4IHOB 2R2BB 4MJID 5ACMA 4ZQKA 4FXGB 2BHUA 3MBEC 5CD5C 4KV5F 1MRCH 2VL5A 4P4RA 4J2XA 1S9VB 1H8NA 4PJIB 3SDDC 4YHNA 3WHE0 4PJ5B 2Z4QB 4KMTH 1LK3L 4HIXL 4JFXB 4NNPL 5IFAL 5I71C 3O3EB 1AQDB 1CD1A 1OGAB 1I1AC 2CSPA 4GQ9H 4P2YA 5D2LA 2XY1A 5C09A 2AXFA 3GGWB 1K8IA 3KPTA 4F33A 4KZDH 3D48R 4S2SB 4Q9BA 1MVFA 5AYUL 5IR1B 1BQSA 4F8QA 4QEGA 3HE7A 2X7LA 4UUJA 3QRGH 4IS6A 2NXZB 5L2KA 5TF1H 2FO1A 5EU4B 3MRCA 5I1AB 3I02A 2J7LA 1LO0L 2EIZB 2XACC 5T1LA 1E4KC 4BUGA 2IG2H 5F6IB 5DK0B 1VFMA 3A0OA 3JV4B 4H0IA 1A1MA 3ZKND 1WBYB 5CD5D 4YBQD 1S7QA 3CMOL 4KHTL 5KS9B 1ZWIA 4HJGB 1MF2H 4U1LA 5IB1B 1K4CA 4BZ1L 2IG2L 3FCTA 1OAYL 3IKCA 3ORJA 3VWKC 2YD7A 3LKOA 3ZKXC 1MI5A 2CR3A 1IAOA 5H94A 1G6RA 2HJLB 4ZXBB 3GIVA 4R26H 3EFFA 3ZHLA 3SBWA 3WLWC 3I3EA 4RFOH 1YNLL 1DEEA 3MCKA 2ZJSL 2GSIA 4JFYA 4NM4L 4G5ZL 3O41B 1KG0A 2C9AA 2G9HB 5IQ9B 1GAFH 2HJKA 3KVQA 2VR4A 1YQVL 3FO1A 4H1LH 4XWGL 4HAFA 3K2UH 3G6JF 3WN5A 3OX8A 5I1LA 4HXAL 4QT5A 4F7CA 4JRXD 3HG1B 1U9KA 2ZUTA 3VCLA 1C7TA 1CDGA 4WI7A 5FYLH 5DVOA 2EKSB 1T20B 2MWCA 4ZDHA 5HYSA 3HPLA 5MENE 1AR1D 3QDMB 3C9NA 2DB8A 1IL1B 1W0YT 2OJZH 4TNWF 4OTXL 4LP5A 4KUZL 4XP4H 5IWLC 2APFA 2KPNA 2NTFB 4J3WA 1QRND 3E6FA 6FABH 4YAQB 1MJUH 1NEUA 1XH3A 2HKFH 4NBZB 2A6DA 4WI6A 4HGWB 4DVRL 2E7BA 3UBXA 3RIFK 5J57B 5C09E 3OG4B 4JRXA 2IQAB 5IBUB 4NDMA 3CFKA 4P23D 2OL3A 1ERNA 3FRPG 2PTTB 5FAAA 1N0XH 1QSFB 3WEXA 4DZBA 3EJZC 1QG3A 1AD9A 2FH6A 2RFXB 3UTTB 3GGWA 4N5ED 2GAZB 3FTGB 4ZSOE 4JREC 4P46B 2CK2A 1JFQH 2I5YH 4XZUB 2ARJQ 3S36H 1T1XB 3CLEH 4ZFZB 5IVZA 3BZFB 2GEEA 3MGAA 3JWDC 3MV8E 3VI4E 5DMKA 3NIGE 4JO4L 4IHOA 1AI1L 4MNGE 3C5JA 3DYOA 4L29B 2NY3D 1XEDA 3F5WB 1Z9MA 1C1EL 3VRIA 4YDLB 4FFWC 1AIFB 1MEXH 2W65A 3GSXA 4P5TD 1QSEB 4Z5RB 5T5NG 2ARWA 2DDQH 1MHEB 3LRGA 2K7PA 3EJJX 3IDIA 3MRLA 4FOMA 5DEZA 4QOKE 2F8OA 1ITCA 4IMLB 2DQTH 3QUXA 4RFEA 2FWOB 5E8DL 2CXGA 1LE5A 1BP3B 4PJ5D 4C59B 3LD8C 4EDWL 4WVRA 3KPSE 4TVPD 1HILA 4M02A 5GGVL 2DL9A 2Z8VC 5M7QA 1PVHA 1F3DJ 3OQ3B 1CFTA 1MFAL 3ELAT 5JXED 1NL0L 3WS6A 3OSKA 3C87A 3OKDA 4DUWA 4HCRA 3HZMB 4ZS6D 3BP6A 1A6VH 4YHKH 1CICB 2C4XA 4PFEA 2B8OT 1OT2A 2PF6A 3L9RB 4ISVA 4TVPH 3TBTB 1PZ5B 1NSNL 3D1MC 1BIIB 2OR9H 2IANE 3GZKA 1EZVX 2ZUSA 5HPOA 3I3BA 4ODTL 2YRPA 1C5CL 5KOVC 1EDQA 5HPMB 3RBSA 1BZ9B 3OV6A 4LRNH 3LPFA 1URLA 4K7PH 2VDPH 5CJBA 5DYOA 1FBIL 4U6VH 1P7HL 3ULUL 4Y5VB 4WDIB 5KVEH 3BWAB 1KTLA 2YBRA 5EU4A 1UEYA 2B4CH 4HULB 3TH2T 5EUOF 3B2VH 2PYFA 1HE7A 1CGYA 1PBYA 3QULA 4ZAKB 5LVEA 4S2SA 4LVHB 5FDYA 4W4OC 5DSCB 5J06A 2F54D 3SDXA 3HNVH 3GEWB 4MSWB 1KULA 1I1RA 4GUPA 4PJ7F 1HHIB 5D6CB 4BUHA 4P4KA 2O61B 2V5TA 2VLLA 1I4FA 1L9MA 3ZMRA 5J3HC 4O2CB 2NQCA 3LRSA 1AXTL 1E6OL 2DS4A 4ZNEE 3HC0B 2PCPB 5SWQB 3ARED 4AQ1B 5JHDA 4G7VL 1YEKL 4UIKH 1UZ8B 2HKHL 2UWEB 3QWRD 2AJZB 2VIRA 3KS0H 1S8DB 3MXWH 5CJOL 4KJYA 2HRPL 3V9FA 5BZWA 4LLWB 4OAWB 4NQED 1I8MB 5EZIL 3SE8L 5ID1A 5HJ3A 4RMTA 3WIHA 3LDBC 1NQBA 4L8CA 3V5DA 4WFFD 5LJYH 4ODXA 4XI5D 2XNAB 2GHWB 2FR4B 4U0RC 3TA3C 3L5XL 1GC1H 4WW1B 5DZNA 1NC4A 2Q76B 1IM9B 4JFOB 1D5ZA 1U6AL 3RBGA 4I9WD 4G9FD 4R7NA 3SKMB 1DQTA 3AS1A 1AP2A 3BAEL 3N9GL 4K55A 2O5ZH 5TJWK 1FFNB 4Y19E 2VLME 2EDYA 4KZEL 2IAND 1YUHB 4ONOA 1I8IA 4BFIA 2IC2A 2WLYA 1FZMA 1PEWA 1HXMB 3I50L 2GJ6A 3JUYA 5IT2L 1Z0NA 1MEXL 4BZYA 2DQJH 4JDZB 3FL7A 4ZUWA 1LGVA 1JZ8A 5IHZA 2WWKO 4HBCH 3VE0B 2AJSH 5CBEA 2IAMC 4KZEH 2GAZA 3FTGA 3L6FB 4PJXE 4WUUA 3OKLA 4PD4K 1GOFA 3ULVL 3HZYB 3R1GH 4JZOA 1B0GA 1CK0L 5C86A 2VLKB 5EIIB 1QBAA 2Z0BA 3NN8B 4QHKI 4EBQL 1SEQH 2F54E 4K8RH 4YWGL 1MFAH 3BEVB 5EN2B 4ODSH 4FQPA 2VTFA 3IDJA 1MFNA 3EOAA 5J12C 1Y0LA 2OR8A 5JO5A 4N8PA 1D9KA 4FHBD 3NCJL 1EBAA 5LGJA 3KYOB 1CDYA 1NCDL 2AKRA 1CDBA 4XPGL 1C12A 1T83A 3JV6A 4QHKJ 1WZLA 2FATL 1RUML 2VDRH 5DJDA 3N1FC 4DKEH 2FZ3B 3VXQA 2IPKA 5A1AA 4O5LH 4HPOL 3UROR 4EOWL 3RWHA 5DRWB 3U36B 2ORBL 1YMHA 3ARGC 4NM8L 1HINH 4HUWA 1YEIL 2CKBB 4GBXB 4JO1L 5IROC 1OCWH 1DEDA 5GRJH 2YZ8A 2X4TA 3ZE2E 4ODBD 1WBZB 4X5WB 3RWEA 3PWLB 1NANH 1BD2E 3LD8B 3I75B 4JKKA 3AGVA 5T1KD 1QO3A 3RL1B 4HHAB 4WW1A 1DEEB 3S3PA 5IB4A 2AQ3A 1LK2A 4HUXA 1FVDA 1JGDB 1G7LA 4JM4H 4WW2C 3FO0L 2VH5H 2Z31C 1VFUA 2YD4A 4Z76A 2EIEA 1OSZB 1Q9KA 3BMVA 1BFTA 2LV4A 5CMAA 2WZPD 5IFJB 1KCVL 2Y7QA 1MAJA 43CAB 2VXQL 3QXVA 3IDIB 2WBKA 3WHXB 4KI5E 4L5FH 4MQ7A 2CUHA 2DKUA 1LNUA 3EZJB 5IF0A 5FKAB 1CBVL 3GJFH 1DQQB 5IW3A 4CJ1A 3IXTA 1A7NH 4NKQB 5BVJB 3F5WA 2EDRA 1ZLVH 3SGDH 1IAMA 3CSYB 3JVGC