4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
4Q0XH 2QHRH 4KUCD 5T1LB 3QQ9D 3UJTH 4R26L 3EJJX 3KPMA 1WT5A 4NDMA 4J3OC 2WBJB 4LAQL 1OM3H 1QLFA 1IGJB 3PWVB 4Z7NE 1MFDL 2D03H 1NFDB 2VLME 5CMAB 3QISA 3VD4A 4NYLB 4XH2B 5GS1C 1JGVL 2FX8L 2VLKE 4PGBA 4JFFA 5I1CL 4FQ2L 5C0BD 3V6OA 1OGAD 5L2KA 4UQ3B 4OT1H 3EDKA 2YPLE 2QBWA 1EAPA 1LP9B 4QOKD 3N85H 5DF0A 4L8BA 1BEYH 3O4LB 4U6HB 4Z7QE 1K3ZA 4YNYA 1J05A 1TITA 4NJ9L 1K8IB 3T4AB 4UZGA 2I07A 4WUUE 3ETBF 2OL3L 5T3XD 3TA3C 4ZFZB 4I3GA 1CR9L 2E9JA 2HLFC 2FATH 3D6GA 3P4OA 3U9UA 3O45A 5DJ0B 3AGVA 5I1EL 1RULH 4XHQA 4PB9L 4LGSB 5SWSA 2W9EL 4M6NL 5KVEH 4P46A 1ZTXL 3QXTA 5FM8A 2VZOA 3GRWL 2CLRA 3MBEB 3PE9A 3C60C 4X6CB 2B1AH 3MXVL 1CFNB 4UOW0 4I77H 1IE5A 4PJEA 3C5ZA 1PW3A 3UTTA 5IM7A 1I8MA 4G3YH 3ULUE 1QKZL 3PWPB 4JJHA 3GGWB 3A67L 5E6IA 2Q3ZA 1IEBB 3CSBA 3TZVA 8FABA 3FHQA 5I8KL 5KSBE 4GJTB 5DURB 1FZJA 5HHOA 3GSQA 5I8EB 3LQZA 3DPBA 1F4AA 1S9WA 1BEYL 2V9RA 1FCCA 2X89D 3GM0A 4H26B 4XCEB 5JO5B 4JQIH 2CGRH 2ESVE 1KFAH 3UTZA 3ARUA 2EIBA 2VDOL 4ISVA 4YFDB 5T1KD 4MYWB 3VWJA 3M8OL 1CU4L 2LQRA 5ESQB 1LNUA 4JQXA 2MFNA 2SEBA 5DMIL 5DJ2B 4TSAL 2HT3C 2QKIA 1JGUL 2EXYD 3RNQB 4JKLA 1S78C 3TBTB 3STZA 4U1HA 1WCBB 3IFOB 5CD3B 4FXGB 5EU5B 1JPSL 3I6KA 4GAJL 1TDQA 4KQ3H 3PP4L 3BP4A 5D2LA 1T22A 4FMFA 1RUQL 3TBTA 3EUUA 2ZJSH 3MRNA 1UZ6E 2QQKL 5DURD 4O2CB 2RB8A 1Z0MA 2MQ3A 3D18A 3KPNA 1PY4A 5FF6B 4C57C 5CEZL 1UACL 4JO1H 4EI5D 4NGHH 2EDFA 4QRPE 3HNTL 3VWKD 2NY3D 3WIFB 3KLHD 1XGTA 4M4RA 3KR3H 1JNJA 2H2PD 3ULUH 2O5ZL 5DEFB 1NLDL 4WHYH 3VXTA 3EYVA 2HFTA 4Y8DC 4ETQA 4HWEL 2DM3A 1IC1A 1DBKH 2YD1A 2Z91A 4C56A 4N9OB 3GSQB 4PJ5D 5I8EA 5JXEA 5GS1A 4UT7H 1P4IH 5MEOB 1C16A 5CJXC 5KTEL 2DQIL 4JFYA 1B4JL 4DW2H 3O2DL 1ZT4A 3IGAA 1KPVA 4WHDA 1U2HA 3C08H 2OS7A 4QLRA 5F7EH 4N90D 3RDTD 2P8LB 3WXVH 3RIFK 4KJPC 3E2HC 4ACPA 3GSWA 1ZHBA 3KXFB 2W9DH 1A2YB 2BNUB 5C0BB 5HYSG 5L7XH 2VNCA 4HGMA 3KYKL 5EUOA 3IDJB 3QI9C 1J8KA 5B4MD 5LGJA 2ARJQ 4QRSB 4V2CB 4XCYB 5BV7H 3WNNA 5T33L 2C7UA 4NFDA 1R3KA 1HOCA 1X4YA 3VXUD 2P5WB 2VDKH 3RZCB 5I19H 4OD2B 3RL2B 2H8PA 4ZQKA 2XRAH 2Y5TB 4R6UA 4F7EB 1OTUD 4F37F 3BEVB 2DS4A 4JDVB 3MRLA 3EYSL 1V7MH 3L3HA 4LHUD 2BVOB 1YEJH 2DIBA 3DROA 3D3VE 5D8JL 5EZOH 5DQ9B 2FGZA 1OD9A 5I1DA 2FHFA 1SJXA 2XTJD 3UJJH 4ZTPH 4M7ZC 2F5BL 1GIGH 2EH8H 4ALAL 2R29L 3K80A 4YDVB 3F7YA 5A2KH 5CINL 3MFGB 4JY5H 4LSDA 3T0EB 4YWGH 2FGWH 2V7NB 1U3HB 4OKVB 3QHZH 1MEXH 2A0LC 4G6AD 4MXWL 5D1ZA 2P8PA 5L7XL 5F3BA 4XPHH 3FFCE 3VCLB 4BZ2L 4LGPB 3RNQA 1T1ZB 3QH3B 3SDCD 5E5MB 4RAUB 1J11A 1OQXA 4RMTA 1QSFA 2VITB 4GXVH 4HIHA 3SO3B 4RX4A 5EOTA 3NH7L 2Q76A 1WBZA 5JW4Q 2N7AA 1A9BA 1J05B 1TVBB 4OI9A 2AV7A 1CDGA 1PBYA 1WZ1H 2V5TA 1TJIH 2WIIB 2E9BA 4NQSA 5DVNA 3TFKC 4Z7VE 4MB4A 2M8XA 4G7VL 4JFOB 3RGVB 3TM6A 4ZFOA 3GI9H 4LOUC 3UTQB 3CGTA 1HQRB 3G6DH 1N8ZA 3VXRD 1YJDH 4DVBB 5EIIA 4XNUL 4PIRF 3ARBD 3IB4A 4NN6C 4RA3A 4MA1C 1XF5A 5HGHA 4HWNA 3CVHB 4XC1H 5DA4A 4CVUA 1FAIL 3SPVB 2F53B 3N1FC 3UTTD 2DBJA 2MCPH 3VFWB 1XGRA 1A6AA 3GKWL 5LG1A 3DX6B 4OFPA 5I9QB 4WTZA 1UH4A 3K8MA 1KJ3L 1X5LA 1ITBB 3E3QE 1ZWIA 4P23D 4OLWH 5GZND 3QG7H 4YHOH 4LHUB 2UY7A 3FOLA 5CD5C 5CJXA 4Q9QL 1NMAL 1XGQA 4HXAL 2EDBA 1LDSA 3PABA 1D5XB 3AMKA 3IDXL 3BGFC 1KJVA 3STLA 4UB0L 4MNQD 4YUEL 1MVUB 1S5IH 5BVPH 4LCYB 3OKKB 2QADB 3KDMA 3T0VA 1TZIA 4BJLA 4YNYB 4ZXBA 1B4RA 4FZEL 4GW1A 1YMMB 5IMKB 4J3SA 2BXYA 2MCG1 3FAXA 3SE8L 2E27H 5H35B 1SY6A 3HI5H 5AG9A 1OAQL 5HHPB 5DZLA 3QHTC 4QNPF 3QO0B 4J12A 2YA0A 1FVEB 3GSNL 4NWTL 2HP4A 1RVFH 2I5YL 3PGFH 4K71C 4NFBA 1LK3L 3Q6GH 4I3RH 4R0LA 2G60L 4KPHH 1EFXA 3QSKB 4G3YL 3W82A 3W9EB 4L1HA 3N1QC 4Q2ZA 2QADD 3MV7D 3SQOH 2IPUK 3ECBB 4WUKH 3T0XA 3NCCB 3U4BH 1DSFL 1HH9B 1F4WH 3QCUL 3OX8A 3EGSB 1NBVH 2EIZA 5D96B 5GGTH 4J3VA 5E8OB 4NN5C 4LSSL 4OCWL 4BFGA 3CFEB 4YHNB 5JW5B 1QKZH 5E7BA 4NN7C 2F5AL 4WWKB 1IT9L 3T3ME 3NN8A 3LPWA 4IOIB 1SQ2N 3FRPG 2K7QA 1EPFA 3QDMD 2OXHA 4M4PA 2CR3A 4HT1L 4D3CH 1URLA 2FO4B 1RFDL 4MXQD 4U1KA 1T5XB 4XNZB 1UB5A 1MHHB 3QJFB 1BF2A 5ISZB 4O9HL 4O5LH 2FDBP 4RMQA 1F4XL 1FL3A 4N1CA 4PJGF 1BVKB 5IVXE 1XZ0A 5B3JE 3I75B 3G04B 5KTEH 4HPOH 2R2BB 4YPJA 3NCBB 3QH3A 4JM2C 5J56B 3ZO0A 4JPVH 4JE4B 1MRDH 4U1SB 3MR9A 2FR4B 1BOGB 4AYFA 1S7WA 1PYWA 3SGJA 3S36L 1U3HA 4JHWH 4CDHA 3PHQB 3WXWH 4JAMB 4KRPB 2F54A 2FJHB 1D9KC 1UJ3B 1U8IA 4O51B 1JWSB 4WV1B 3RRQA 1E4KA 5HHXL 3LRSA 4OCNC 1ADQH 3TBYA 4YDLC 3WFZA 4NGHL 3KXFA 1CXIA 1QTYT 1ZE3C 1W72B 2EDKA 3REVA 1EO8L 5CBEB 1TXKA 1UM5L 2IBZY 3A6BH 3PHOB 3D39D 4IRSA 3HE7A 1KGCE 4JY4A 4NKDA 2HFEB 5LWYL 1DBAH 1P2CB 1T0PB 3MRJB 1U8JA 5TDPB 4MB5A 4YIQA 2FB4H 4ZNCD 1Z3GH 2CRMA 1VFUA 3SQBA 3I02B 4E41E 3HZMB 4CNIA 1S7UA 2CDEA 2XWTB 4JO2L 5IB4B 4X9GA 2EDXA 5EU4B 1LEKA 5JXED 2IADB 1L0XA 5F3HB 2J4WH 1AGFA 2JCCB 4L8DB 1OWRM 5C0DA 2X40A 2AJVL 2H1PL 4R8WL 1IEBA 3K1DA 1R6VA 3RX5A 4UIMB 3BQUB 2DWDA 4KWUA 4APQC 3M8OH 5TDOB 3FRUB 2HJFA 3ZDYF 1VGKB 1RHFA 2QQLH 3CZJA 4DOHE 2CMRL 4OZFB 3BIKB 5IFAL 4CKVX 1TNNA 1EXUB 4PV9B 4G5ZL 1S7VB 3MJ8B 3FONB 3BE1L 1EEYA 4ONGL 5EUOB 1VGKA 1NFDF 4YHLL 3RTQA 2FB4L 4MDIB 2Q8AH 2NY2C 2BVQB 4JY6B 3RWJB 4MNQA 5F7DA 3FB5A 4O51A 1KACB 1A7OH 1JF1A 2DQFB 43C9B 3ISWA 1RJLA 4OCRL 5DK3A 1QEWA 5C07B 1A7RL 3T2OA 1FSKC 2CKNA 5CCKL 4OJFH 5DJXB 2Y5TA 2DLGA 1W72H 4D8PB 5ADPL 3CMOH 3LHPL 2VC2H 4LASL 5I17B 5AAMA 1U9KA 3IT8D 4O2CA 1ONQB 1ZK9A 4ELMB 1L6ZA 3FO1B 1HNFA 3I84A 1HKLL 1II4E 4FFWC 4M7ZB 2WBJD 1K3IA 1OPGH 3MBEC 4WFGE 4PRHA 3O3BA 4AENB 5F3HA 3SGJC 1EGJH 4O5LL 2Q3AA 5E6ID 5C0IA 4R7NB 1UT9A 1HHKA 1TVHA 3HNVL 3LIZH 5L2KE 3CFIC 5FYLE 4NCDA 3ARQA 2SEBB 4U1GC 1QBLL 4BFIB 2EE9A 2R1XA 2CUHA 2EZ0C 4KJYA 4KK9C 3KPLA 1AIFB 3QFJD 1WQVT 3V52H 3QUXD 3IFOA 2JCCE 1H3GA 1G6VK 1BGXH 1KCLA 1MVFA 4KUZH 3TNMB 1I1FA 5IW6B 3IXTA 2VL4A 4Z7UB 3SDDA 4R2GB 5J3HD 3B3IB 1F45A 5IIEA 3QRGH 2FD6H 1PVHA 5ANME 4OZIE 1B4JH 4KKLC 1IGMH 1CL7I 1FL5A 3NIDF 2JB5L 1LE5A 1TPXB 5HGAA 1DFBH 1MF2L 2J2ZA 5DT1L 5FF6A 2X4RB 3VI3E 4CN4A 2HT4D 5I1JL 4J8RA 2ZUTA 2QSCL 5F9OH 1TCMA 4R90H 1EH9A 3F5WB 1X7QA 2PTUA 1NJ9A 3NIGF 4L9LC 3PQYE 6CGTA 2RJMA 4JFXA 3B5GA 1AR1D 1QBAA 4G6JL 4GAGL 1S5HA 3VG0L 2X4PB 3PV6A 2XFXB 3TH3T 1EAJA 1FPTL 4ZSOB 3MUJA 1S3KL 2Z91B 2RIKA 3CLEH 1KIUA 4NZUH 4XPBH 5I18L 1MHEA 3AXLA 1YY8B 4ZPTA 1WEJH 4AG4H 3AREC 5DQDL 1MNUL 5A3IC 3VGAB 1N3NB 3AY4C 4H8WH 3WD5L 1ZVHA 4HFWB 4MX7B 5AG8A 2G60H 4HPOL 4KPHL 1KPVB 1SEQL 5IESH 4BSWA 1QRNA 2Q7NA 4QO1A 5GRUL 1T03L 4OZGE 3DGGA 4WWKD 5H35A 5JNYA 3LDBB 3CX5J 1ZS8B 1IBGL 2AK4A 3FQTB 3VRLE 4MNHA 5ISZE 1HSBB 4U7SA 4G5ZH 3WIIL 3LSOA 3VXUE 5FM5M 5I71C 1EA9C 3ULVL 1K6QH 1MCFA 1BBJB 3SY0A 5DHVH 3DO3A 3KPRB 4NUGL 2J4WL 5CZKA 1BLNB 3GJFA 3HMWH 5E08L 2I27N 3MV9D 1HWHB 3CPLA 4TSBL 5LGJB 1Q9KA 1LE9A 3DOSA 2X9XA 3FT2A 2R15A 2PO6B 1HH6B 3GI9L 2PCPA 5T3ZE 4M7JL 2OTWA 3WIHL 3O81A 4H1LA 4Y5XC 1CFBA 5K9KA 3W9DB 2P1YA 5B39B 3Q1SH 4O02L 3X17A 4UTBH 3MV7A 5ICYB 3RGVC 4FQ1L 2R0KL 2XNAB 2ZKHH 3KPQA 1A14L 1FYTD 2O61B 3IDYC 3MRFB 5LQBL 1UM4H 1PG7L 3FKUS 5J8OA 4AH2A 2A74A 5ERWA 1WUNT 3W9DA 3F7YB 4JFDB 3G6JF 4ZUVA 5IMLB 4ERSL 1IEAA 2BNRD 3IDIA 3QPXH 3DVGB 1DJSA 1U0QA 1U36A 4PJDB 4PJ7F 1OCWH 4K3JL 3UBXB 1CF8H 3I6LE 5BVPL 3TFKD 1HHHB 3TN0A 4OLYH 5HXMA 1X5KA 4X4ZA 3RWHB 1OAQH 3OB0H 2Y25A 4KRPC 1OLZA 4LCYA 5EU7C 5CWSB 4HQQH 5C0CE 4LEXH 3D85D 3O6ML 1AY1H 3VXRB 4GW5B 5HVFB 3GB7B 3VGFA 1OPGL 43CAB 2LVEA 3TBSB 5IVXB 4HAFA 5C8JB 1SVZA 4AK1A 4MLSA 3V6FA 1KSRA 1JPFB 2PW2B 3EFDH 5JR1L 5T5NF 5A2JH 3UPAA 35C8L 5AZ2H 1CBVL 4BA8A 4ZS6D 2Q8BH 4Y16A 2X4QB 3SDXA 2GEEA 1HDMA 4A6YA 1YPZE 4NN7B 4DN4H 3OGCA 5HVHC 2J6EL 2R1YB 2IQ9H 4FFYL 1OHQA 1Q9WB 4I18A 3REVB 3BP7B 3FFDB 1D5IL 1LO5A 5HSFA 1I9RL 4HKJA 1AO7E 5HPOA 1QBML 3H7BA 4NT6B 2DYPA 1R3KB 5EU6B 5DK2B 5DRXA 2HN7A 3WBDA 4F58L 5AAWA 3EYUL 2JJUA 5I1DB 1QLRB 5CEXA 1U8MB 5F9DC 5IMMB 5T1MB 5FYKH 2JB5H 3DGGB 4ZFGH 1NMBL 4XNYH 1GOGA 1GGUA 2YZ8A 3CDGB 3MA7B 4XVSH 2Z35A 3BDBA 4C4KO 1U8MA 4OM0H 4Y4HC 5KJRL 1YMHB 1YYLL 5FYLL 4X7EC 1I3UA 2R2HA 3BVNA 3HPJB 4KC3B 5EC2A 3WHXB 1AGBB 3FQXA 2CLZA 1CWVA 5GRZA 3D3VB 4MQTB 4PJGA 3X3GL 3O2WL 4KKBC 1EXUA 1MFAL 3RI5K 4DKEH 4PYGA 1NBZA 4P2RE 2FD6L 5I19L 3MROB 5A1AA 4BKLA 1AGBA 3GI8L 3EGSA 1JHKH 3PDDA 5H8DA 3UTSE 4YDLB 2E8YA 4Z95H 1KN2L 1G7LB 1LO4H 2Z0BA 5F6IB 3ULVD 1TVBA 1PDKA 3GFUA 3QAZB 1EGJL 1V7NL 1FL5B 4OLZH 1JZ5A 1UB6B 2DQHH 3KPRD 3SDYH 2WNGA 1AI1H 4WHTA 5T3ZH 4TVPE 1A1OA 3LS5L 1HQRA 4XMPL 5T3ZD 2KKQA 1LP9E 1CU4H 1X9QA 4D8PA 4HG4K 4UU9B 2E9WA 1DANU 4HWZA 2H6PA 4H1LH 4JCMA 3HAEG 1C5BH 2EIEA 5F6HJ 2CIIA 5C09D 4JO3H 4M1CC 4K8RC 4XPTL 5F1NB 3RX8A 1YY9D 3VWJC 2J8UB 5HHNA 4FABL 3OAZH 4HFUL 3SE9H 4XHJD 4OIIL 3RNKB 2XPGB 4OF3A 1XGUB 2CO6B 4WW2F 1LO3H 4FQLL 1KYOK 2NY2B 2DMCA 4UDUB 3LRSB 3KYOA 1C16B 5EUKA 4EN3B 1LO4L 1AR1C 4DGYH 1MWAB 1P7QA 5MHSE 3AY4A 1A7NH 2HYMA 2J8UF 2OL3B 5GRJL 4R4FL 2OCFD 4K7PX 4LLDA 4XC3L 4QRPB 1UACH 1BLNA 3GJFB 3IETB 4OCRH 3OF6A 5B38A 2ICCA 5F97E 1N2RA 1K8IA 3RWFB 4ODHL 12E8L 5DEGA 2HKHL 4ZFOB 2YD8A 1HWGB 5KW9H 4POZC 3K2UL 4ONGH 1UQSA 4PUBL 5HDQH 3GMOB 5IJKC 4JFHD 4JPIA 2E9IA 3EDEA 4Z8FL 4HZLA 2KL6A 3EYOA 3QUXC 3NCMA 1H15B 3R4DA 1NDGA 2VKXA 4OLEA 1MHEB 1HHIB 2Y9RT 3EO0B 5TE6H 1K5NB 3QWOA 1MNUH 3H3PH 3FO2B 3PXHA 1PAMA 3LQAL 3GSUB 3ZHKA 3GGWA 5E6IB 5E2TL 3EYFA 3RVVC 4ODSL 1PFCA 4GAYA 4NQDB 3MLRL 4PJAA 1KFAL 4I13B 3H9YA 5I2IA 1KT2B 4HXAH 4HLZG 5J6HB 3U0WH 5FKAA 2QQNL 4FHBD 1K6QL 4OI7A 1BQLH 1RZ7H 5LGKA 4KJQD 3ARZA 2NCMA 3BPLB 5C1MB 4M7KH 3MOAL 5JLZB 2R2EB 3MLZL 1P84K 1RPQA 3NFNB 3DRTA 4I9WD 4ORZC 2Y07H 2FX8H 1UZ8A 4TVSa 4Q58C 1D5ZB 5C07D 1L0QA 3CFDB 1NCBL 2ADGB 7FABL 3UMTA 4PD4K 2W9EH 2GUOB 4XBPB 3UX9B 1JPTL 3KPQB 4KRMB 5GSRB 3O6FB 2A9NH 3U46A 4HXBL 5D7IA 2DJSA 3D0LB 5F7MC 4HF5H 1YPZA 3V5DA 1FNEB 4JHAH 4L29B 1ZLSH 3IJSA 4P2OD 5IROC 5KVEL 1D6EA 1OW0A 2QEJA 5D1XA 3VXOA 2XIDA 4ZFFB 3GHEL 1BZQK 1OTTC 1XF5B 5HGHB 4NOBA 4Y19A 3IFNL 5H2BA 2IPTH 1ZA3A 3ZL4L 5J06A 1LO0H 1Q0YH 1FZMB 1AHWB 3PIQA 4LSPL 2BDNH 2VE6B 1CGXA 3SCMD 1WAAA 1FLTX 4JO4L 4G9FD 4K3EH 5FUZL 4UT7L 1MEXL 4DZ8A 5D6DA 4MA7L 5C0GB 1QNZL 1LNUB 1CZ8H 4JRXB 2LAAA 1QRNB 1IZKA 1SMAA 3U0TA 2AEPL 3OKMB 5FKAB 4NYLA 4PJ7B 4XH2A 1DUZA 3ZE2E 4X5XB 5BS0D 2C5DC 2BVPB 5IIEB 2ICWJ 3HAEA 3PL6A 4R96A 5C0FA 1U58B 4P2QD 4M7JH 3RTQB 3U4EA 3OAZK 3VXMA 3G5XB 1ZT7B 3FONA 3WFBH 1H5BC 3JXAA 3MRHA 3BXNB 5I75B 1XF3B 2NY5H 3M1BB 1CXLA 2FIRT 4U1NB 5EBLB 3FFDA 2VZ3A 3SE9L 5FFLA 4HBCH 4NQCE 3V0VB 5LQBH 3BYTA 4X4ME 4HZLB 1FNAA 4RNRB 3P4NA 2WINB 5LCVL 2VLLA 2W60A 4FG6C 4YXLH 3MLSL 2OL3H 4U2YA 1F3DJ 5DK0B 4LSVL 1JMZA 5IMMA 1BQHB 3WIHH 1AGFB 5E4IA 4EBQL 2X4NA 4HCRH 3U30B 1RZJC 3PDOB 4ETQB 4D0DB 4KQ4H 4PREB 1NAMA 3PWVA 4LP5A 5I8CA 3HG1D 5GGRY 4P5TA 3O2VH 5FGBA 3DMMD 4L3ED 4NDMB 2FIKB 1BIHA 4POZD 4NKMA 1B2WL 5TDOA 2Y23A 3BN9C 4GS7B 4R0LC 3LEYH 3HS0A 1FV1A 1FP5A 3EOAA 2HMIC 3E6FA 3FN9A 3QUML 2E6QA 2G9HA 3E6HA 1CDYA 4LLYA 4MD0B 1JYNA 2PTTB 3L3JB 4CADB 3C5ZC 5E94B 2ZP0T 3GSWB 3WO4C 5DUMH 4HDIB 4CRPA 2XQYG 2ESVA 4KTEL 5DJ6A 2NXYD 4JPKH 2VABB 1H8NA 4OF8A 2Z31A 4MD4A 2D03L 4HMCA 5DFWH 1UJ3C 3MO1B 4GW4B 4XAKD 5D7SL 3B9KB 2VDOH 4QY8A 3ROOB 2YEZB 2XXMB 4F57L 1K4CA 3QIBD 4JRYB 1BQSA 4PY8I 3SKUD 1CG9A 4PJCE 3B83A 1YY9C 1CXFA 2PXYA 1P84J 3VGDA 1A6UL 1A7QL 1RZJH 4XP4L 3T4YA 2YSSA 2JTDA 4LIQE 5HDBF 3MCLL 3CLFH 1NCTA 3BZDA 2GUOA 1ZA6B 1UJTA 1T21A 1B2WH 4WIQA 4XPAH 5LGHL 3QQ4A 1U6AH 1T5WB 2RGSA 2YC1A 4IM8A 1A1MB 1CD1B 3FHAA 4XBEL 4PJFB 4P5TC 3ZKXC 4Y4FB 3QG7L 5KAQF 2X4NB 1X44A 1JRHL 1XCQB 5HHXH 3I75A 3FN0L 3TWCH 1ACYL 2VLJD 1OAYL 5E8NA 3RVWC 4ODHH 1I1AB 3ARDA 4UNVA 5HDQL 3QG6A 4HMDA 5F9JB 4JFYB 5EBLA 5TQ2H 2JJSC 5KG9B 4C83A 3ZL4H 2VR9A 1FZOA 3TESA 4PS4L 3RPIA 4WEUD 1Q9LB 4KK8C 4DGVL 3C5JA 5F7HA 5J1SC 3G08B 1C5DA 3U48A 5D5MF 4LEOA 3CFDA 1JF6A 3GBML 1DLFL 1AE6L 1I9JH 2CJUH 3PL6C 3WXVL 3DYOA 1L7IH 5BZDA 3L5HA 1LMKA 1QSED 4LASH 4DCQA 2EO9A 3QQ3B 1G9ML 4N5EC 2AQ2A 4XB8A 3P11L 2VLRA 4KK8D 2C3XA 1NGQL 2VUYA 1DANT 3LKPB 2DQDH 4LVNB 4XCNA 32C2B 2F15A 4HCRL 4PRAB 3MJ6A 3N1MC 1LO0L 3LN9A 1T7WA 3LN5A 4LVNC 4YC2C 4HMEA 3NA9H 3C09C 1WTGT 2D9CA 1ZLWH 2HWZL 1SM3H 3QUMA 3VFRB 3HI1A 3FZUC 4PBWD 3OAUL 4URTB 4M5YL 3N9GL 1R5WA 1JPGA 2PTTA 3B5TA 1CXEA 2P5EB 2FO1A 2CRIA 4HXBH 1P5VA 4S1RH 4F3FA 4PJ9C 4HSQA 3EW3B 3OJVC 5EOQL 2YA2A 1M7IB 4U6YB 1A8JH 1OTUC 1R3JB 4IIQC 2CPCA 1A6PA 5C0AB 3UTZB 4JRXE 1FYTB 2B1HH 2GFBA 1F4YH 3PL6D 5C0CA 2DI8A 1YQ2A 4OCSH 4O58H 3HC3H 4P5KB 3ZKMC 4B53A 3NIFF 2UYLA 4CW1B 4D0BA 2DBLH 1QYGH 1C7TA 1DVFB 4ZNEE 1DBAL 1D9KB 3AFLA 4TVPD 5C09E 3QHFH 2HVKA 4WHTB 4OCLC 3KPSE 2KPNA 4JQVA 4IRJC 2XA8L 5D72H 1FLRH 2CKBB 2YC1B 3EOTH 2WM0A 2NZ9D 5F93C 5HVWA 2HFEA 5IVZA 1CDBA 3VXOB 2VDLL 4HS3B 4KJPD 1FORL 1N6QL 5C08B 2H32H 1JNLL 1YNKL 3C9NB 4RBPH 2WW8A 5JA8B 4NNXB 5DRWB 2CLVA 4WFFE 1QA9A 4AENA 2F53A 1R5VA 3PGCB 5BJTA 4DWHA 3ULVE 5IVZB 4MWFB 4HC1L 2X10A 3OKOA 1T2QH 4MA3A 1MPAL 1QFPA 4Y4KB 3W5NA 1JV5B 5EU6D 3MNZA 1A6WH 4KJWD 2FJGA 1T89C 2H2PC 3TC9A 1TLKA 4LSUL 1DUYA 5KAQG 3PABB 3DUUB 3GMLA 1U93B 3OKDB 1UXWA 2DQGL 5SWZB 1QSEE 4IS6A 5DMYA 4N0YH 1A1NB 2G5RA 4FTVD 1ZLVK 4I48B 3IVKA 3X3FH 5EOCL 2JIXA 2VDRL 2IFGA 4BM7A 2GJZA 4G7VH 2ADJB 1L7TL 3EFFB 4JFPB 3GBNL 2DKMA 1FORH 1KB5H 4HIEA 4P46B 1KPRA 4Y1AD 1FNFA 2XZQH 4RISL 1D6VL 3O4OB 1IKFL 1R0AL 3JV6A 3BP7A 4GXVL 2DQEL 4FTVA 3D69B 4Y2DD 5HDLA 4NOFA 2DD8L 2EXWC 4PV8B 1FVCA 2RCSL 3QEQD 4XWGH 4HUWA 5IB5B 4HUMB 5FEBA 5ILTH 1CTOA 5CP7B 4ZPVB 2BDNL 3VMOA 4YHOL 1B88A 2BP3A 1CDJA 3SPVA 3KPTA 2R23B 2J3SA 3P77A 5ACLA 3PQYA 4G6MH 3JTSA 4LPVA 3BN9D 1HIML 4ZS7L 5SX4I 3LN4B 2BOBB 3FAWA 4NIKB 2YN3A 2HT4C 1KLFA 1MCPL 5FK9B 3T0WA 4PJXB 3RIAK 3JWOH 3BUYB 2VERN 2XN9E 1V3MA 1YPZF 4R4BB 2O5XH 3X12B 4P5KA 3D39A 2HTLC 4IRSD 3VXSE 2AXFB 1IC5L 5DR5L 3WEXB 1BVLB 4LLMB 3QUZA 1CVSC 4LVHC 3Q1SL 1FYTA 3C60A 4WI4A 1BREA 3B9AA 2Z31B 4YGVA 4WJ5A 4EVNA 5AD0A 1NLBL 1RJCA 5CEYB 5IQ9A 1YEDB 3BJLA 3H42L 2WWMC 2RFXA 3WLWC 4F3FB 4GG6E 4KU1A 1MJ7H 3LMJL 1LK2B 4NC1C 1T1ZA 3REWA 1UADC 2GQHA 5DJ2A 3FQNB 1BQHG 1FBIL 3U46B 2YPVH 4PB0H 3TT1H 5EWIH 1HQ4A 1FG2B 2IQAA 4PJFE 4B5EA 5KSBA 4PJ9A 2MKWA 2IH1A 1FIGL 4FQQA 5DJDA 2QSVA 2I9TB 4ELMA 4IRSB 1J0KA 2C7UB 1J10A 3FB7B 4FA8A 3C08L 1U8NB 1GSMA 4LSVH 3MLXH 1KYOJ 5CBEA 5LGHH 1FRGL 1PZ5B 1XCTB 5CZVL 1RUAL 4XI5D 3Q5OA 2AJ3B 3L3OA 4G80A 2LAGB 5F70A 4UT6L 1MCEA 4PJ8A 2BVOA 3SDAC 3QPXL 5GJTH 1E6JH 1HYRC 3GMLB 4QOKE 5C0GA 2Z8RA 1EO5A 2GYSA 5D7JC 3IRPX 3MQIA 1FN4B 2YD5A 3A6CL 1P6AB 1MCBA 2ED7A 4EN3A 2EEAA 4WW1B 5LBSL 1AQKH 1RZGB 2APTA 3DECA 3WO4B 3HI1B 4X8XA 5KSVA 2P8PB 5DJ8A 1FJ1A 4M6AA 3OKOB 4NQCD 1J1XH 4PJCA 4NHUB 4TVPH 4AEIH 2J6EH 4HH9B 4I18C 1F11B 3DRQB 3BW9A 3P4LA 1OAXL 3BVNB 4LPCA 2ICEB 2PUQT 5KS9F 3VG9C 3TO2A 5L0QC 4AEEA 2YUWA 1FVCB 3V0VA 3O4LA 4U6HA 2YBRA 1QR4A 3P73A 2OBGA 1K2DA 2JELH 4MD5A 2VXUL 5IB3B 4OF5A 3BP6A 2K7PA 2YK1L 3DTXA 1ZOXA 1L7IL 1AR2A 4BK4A 1D9KA 4APQD 3N85L 1CGSL 3I2CL 5D4QA 4ZUSA 4G8IB 3IJHA 2EEDA 4XPAL 1M6OA 3SDAD 4EBQH 3MV7E 2OM5A 1TMCB 2BVEA 3HE6A 5EU6A 4Y8AA 4H0HB 1J5OH 1MCDA 4YDKL 1RUPL 5CP3H 5I1AA 3VA6A 4NQCB 4AIXA 4X5WB 5MEPB 4OFVA 3RWCA 4NNXA 2DOCA 3WSQL 1TQBB 3DX6A 3C5ZB 4M5ZH 4ZUTA 3ZE1F 4LPYA 4HFWA 4MX7A 4PJ5E 2NXZC 4KAQH 1R5WB 3DX9B 4LQFL 4YGVB 3NPSC 2AJYL 1YUHA 3NPSB 3HMXA 4UBDD 4Y2DC 5EA0L 2AJXL 8CGTA 4FQPA 4JZNA 4KTEH 4EIGB 4RBPK 4G8EB 2PO6C 1E4XL 1MJUL 1OT2A 2VABA 3FFCB 1VKXB 5F96H 4KV5F 4U2ZA 3STZB 3QPQC 3NZ8B 4JZOB 4O58L 2GI7A 3RY6A 4OI8A 5F72S 4HKXA 4S0SD 4ENED 5I1GL 4FP8H 4NO0B 5GS0L 1BJ1H 2PCPB 3I2CH 4DUVA 2HFGL 4PJ7A 3DURA 3O6FA 3BDYH 1EV2E 4YX2L 3UXFA 2QQLL 5F1OB 4HIHB 3PDGA 2C1OA 3W2DL 1GGCH 5CHNB 5DJYB 3IDXH 5KBNC 1NMAH 3B9VA 5JQ6L 4XVSL 4Y4FC 4L8SA 3IFNH 5IW1B 1FFNA 1U6AL 1BQUA 1MCIA 3I6KB 4MZ2A 3BEWB 3NZHH 1U8OA 1Y18B 2X09A 2XQBL 3FB8B 1GL4B 1MCSA 1AQDA 3CFBB 3PWPA 3OHXA 5A43C 3DLQR 4L3EA 3RU8H 3MRRB 4F58H 4PRIB 5CP7A 3BP5A 4ZPVA 5KZCB 2V2TA 2ZUVA 3EYOB 1F97A 3V0WH 5IB2B 1KN4H 1RD6A 4B7LA 5BOZG 1QFWH 5E2UL 3N1PC 3BISA 4ZSOA 1O7VA 3HC4L 3D48R 3QXUA 3SJVA 1FJ1B 1I8IA 4ODSH 1KB5B 1X6NA 4FQXA 4P46D 3IKCB 1FNSL 4KVNH 5JDSA 1P53A 2NXZB 1KB5L 4X8JB 4K8RL 1FNLA 2Y1VA 2HJKB 1MCWM 5JHDE 1JFQH 2VB5A 3MRGB 3U4EB 3S35L 3HUJA 3W0WA 5DEFA 4DGVH 1P4BH 2Y6SD 2RCSH 4E9LA 4QXTB 3FRPA 2NY1C 1NANI 3IAGC 3IDGA 4FFZL 2ATKB 1BD2A 3L7FB 5J1TC 1RFDH 1LO2L 1MJ8H 4OQ1A 5IB3A 1I7ZA 4P57A 2A77L 4M7LT 3MODH 5M95B 1NGPH 2EEBA 3W81A 5JW3L 1NMCB 1OSZA 4KTYA 4PJ9D 3AU1B 2ICEA 1CG9B 2AJUL 3IU3A 2VMFA 3L3KA 4KDTA 3VW3H 3VDCA 3BZEB 3UEZA 1H8OA 1JHLH 1CLCA 2BVYA 4J3TA 2F5BH 5GGRA 2G75A 3IDJA 3FL7A 4ELMF 3C6LB 2GY7B 2IFFL 1MI5B 2AQ3A 5IHUL 4ORGA 1JZ8A 3VFWA 2OTUB 4TUOB 5HHVH 5JOFB 1NGYB 2APXA 2W38A 5IFHH 1OWWA 4GKSA 5ID1B 1C5CH 3F12B 1T21B 4KTDL 3JWOL 3VFVB 2PYFA 5IR1B 4R7DA 4BQBA 2H8PB 1OGTA 5T33H 5BV7L 5J7CC 5HYSB 4OV6F 3MLYL 5MEOA 1YEFH 5HJ3A 2N1KA 3ZHDA 4R3SA 5JOFA 3ZKMD 5K9OA 2D0HA 4TUJA 1BP3B 4MQ7A 2HA1A 1A3RH 3Q6GL 2WK2A 2V5RA 1INQA 2W0KA 4OKVA 1T66D 4FXLA 5ALBH 5DMKA 4JFDD 3OMZA 3WFHA 3EIFA 1AJ7L 3LH2H 4JZJA 1T4KB 1A2YA 2BNUA 4IHOB 4QTIL 1NL0L 5I73B 1JN6A 4PLOB 4JFEE 2XZQL 2GTZB 1E27A 2JJVA 3FZUD 1MIML 4NQXB 4LSRH 3QWRA 1B3JA 1RJZA 2M26A 5SV3A 2RFXB 4GBXA 3Q5YA 2AEWA 4QYOB 3FN3A 4HPYH 3RZCA 5F96L 3FMGH 4HX1B 5F7UA 5D2LF 2OYPA 1TTUA 3SGEI 5B38G 1LE5B 4NN6B 5I1GH 2VXVL 2FSEA 1UZ6F 4LNRA 5CUSL 5E9DE 4OGYL 4Z76A 4I4WA 1BM3L 2C4XA 4JANB 1MCPH 2I9LB 3QCTL 1J0JA 1JMXA 5DXWA 3IFPB 4V1DB 5GGSB 5CGYC 4NKIH 2DL2A 1KENH 4X4XA 5I16A 3WS3A 1LEKB 4RFNB 4WUUB 3V6BR 5J12B 3VFVA 3QDGE 4WI6A 1LO3L 3BMVA 3CMOL 4Y19E 2HRPL 2DM7A 2A6KA 4OJFL 5I1LA 1XH3A 2M1KA 4QHUB 3G6AA 5EUOE 4PTTA 1HEZB 4XPTH 3WUZA 2Y72A 1MIMH 1F3JA 3VD3A 2PTVA 3RPIB 1UCBL 3GM8A 4EI6B 2XZZA 5HYQA 3VXPB 4QHNA 5KSUB 3GK8L 3RGVD 4YDKH 1A3LH 1GIGL 1ERNA 2WBKA 1FGNL 4D9QD 3QA3B 2VQ1B 4GMSL 5EO0A 3V5HB 1HK6A 3MJ9A 3GSXB 2AJUH 5GGUA 1GPOL 2A9NL 1E28A 5E8PB 1AC0A 4YXKL 3PXJA 2R29H 3AS0A 1VEOA 2B0SL 4PJIB 4JRXD 4BH7B 3RAJL 3EOBB 1NUDA 5F71A 5IFJB 2AABH 2HKHH 3K0WA 4IJ3B 3MC0A 1W2KT 1KEGH 2EDTA 3U7YL 4YHML 3V4PH 4E41B 2QR0B 4RIRB 1IGCL 3V52L 2XKSA 1ZLUH 1JZ7A 2BJMH 1QQDB 3SKJH 1X5XA 3NMEA 1T7VA 3HMXL 3CU1A 4POUB 3BPOC 2O61A 1GZPB 5SX5H 3O9WD 4NKQB 3CDCA 4J23A 4WI3A 2JK5A 1JRHH 1MJJA 1KT2A 5JPNB 1WBXB 4FG6D 4WWKA 5FDWA 4YHIA 2W0FB 5MI0C 2F5AH 1QNZH 2AXHA 3CDFA 3T1WA 1DBJH 3QZWB 4Z7OF 4K23L 3KYNB 1GZPA 3VFTA 5FA3A 4X9BA 1ORQA 2V7HA 4LKXA 1CK0L 4RCAA 2IH3A 1N6UA 1MLCA 4HLZH 4LNVA 2ZUYA 2J1KA 2NNAA 3X13A 3HUJB 3W0WB 3MBED 3PWLB 2WBJC 1N7MH 1LGVA 2XQBH 4U1MA 2DQCH 3UC0H 4M8VA 3LKNB 2KQMA 4OCMC 3FQWA 1FVDB 3FOMA 3TCXA 1W8OA 5GRYA 3ARRA 4PGZA 3KJ6L 4DK3A 2B5IB 2IPKA 4TN9A 1RZFL 3O8XA 3DMMC 3MYJA 2V2WA 3M17A 5DVLA 5FGCB 1OT1A 4RFOH 1IAIM 3S7GA 1WZMA 4B50A 1QFWI 1WBZB 5I1KL 2X1XR 1PKQB 3OWEA 4A6YH 2P5WE 3K81A 2FGWL 1NCAH 4M43L 3S5LB 4AIZB 3IJHB 1MRCH 2QHRL 5HD8C 1KN4L 5DQJA 1OGAB 3BGMA 1KJ2B 4ODTH 3RKDD 3STBA 1LO5B 1HHIA 3MNWB 3G6AB 4X6DB 5IVOA 3SOBH 1KENL 1R5IA 5F6HI 3WDHA 2HWZH 4ODVL 3LN5B 3L3GA 3T8XA 4WI8A 1JI2A 1W0YT 3OKNB 2IMNA 3T0AA 1QRKA 3BW9B 4ONFH 1IEHA 5T3XH 2Z8VC 3RX7A 5I75C 1YEGL 2UVEA 2DM2A 4L8DA 4EZMA 3SGDH 3BKYH 3IDMB 3C2SA 2J8UE 1WIPA 2I26N 3BPCB 3LQAH 1DN0A 3VXRA 1G6RA 4OZFA 5I1LB 3RWDA 5LVEA 2HFFB 3R8QA 1QSZA 3VFSB 2HJFB 2NW2A 4XCYA 2MOVA 5A16B 3IDYB 1U8KB 3ALXA 5GRWA 5T5FH 3HB3C 3PNWA 2VDNL 3QI9B 3TIDB 4PPTA 4ZAKA 3SCMC 4AL8H 1UH2A 2EDHA 4FQIL 3UTPD 3BKJL 3JTTB 3Q48A 4J3WA 3CUPA 4LCUB 5KSAC 5GSRA 2WP3O 2BVQA 1F4XH 1U8NA 5F88B 2ADIA 1A3RL 4WDIB 4JFDA 1S9YA 3IYLW 3ULVF 3QXVA 4PRHB 5D5MB 2ZUQC 5HYJB 4KMTL 3FB8A 4S1RL 3OTTA 5HGDA 1IFHL 4JJ5B 5C09B 4L29A 5GGQL 1AD9B 2B2XL 2L7UA 3FO1A 3Q3GA 3B9EA 2UZIL 2W9DL 5ANMB 4U1JA 2H3NB 4Z7VB 1HI6B 3H2WA 4OZ4B 4R2GC 1RIHL 4XMKL 2P43B 5KVGL 3O11B 3KNBA 1M4KA 3WS3B 2L0DA 1I85C 1MFBL 3NIGE 4QRUB 4LSQH 3LRGA 1AGCA 5AD0B 1IAIL 1FFPA 4D9RE 4UUJB 1K85A 3MRDB 2WIMA 4MCZA 3EOTL 4PJCF 1F11A 1DQTA 3DRQA 3HPLA 1TTFA 4HULB 4LRIA 4KJQC 1JNLH 1DQJA 1T03H 4M62H 4F57H 4MJ6A 4F8TA 3LEXA 4YEFA 4F7MA 4YIQB 3HNVH 4EQ3A 1J8HD 3EO9L 3WUWA 1IAOA 3QA3A 3TIEB 1JUFA 5FUOL 3CVHA 3O4LD 3RA7L 4XNYL 4X6CE 3QHZL 5DYOB 5HPMA 4YO0B 3S37L 1XEDA 2Y07L 3JV4A 3MXWL 3OHXB 4GKNA 3UBXI 2OZ4L 1KIRA 2ENYA 2P5ED 4NBYB 4OM1H 1NEZA 1OGAA 2HRPH 3BGMB 5D70L 1MCWW 5C6TH 5MERA 1D3CA 1A6UH 1TJHL 4DFIA 1PX4A 2E5EA 1CDCA 5DDHB 2O5YL 4MA7H 4IIQB 1K4DB 4IOSD 4L4TA 4MAYA 4QRRE 2NTFB 3VI4E 3BQUD 4NT6A 2MPAH 5AYUL 2AW2A 5JNYB 4PJ7E 4R7DB 4JRXA 3L5JA 2AS5M 1EHLL 4N0UE 3BKMH 3MV11 1AGDB 4JFFB 1CL7L 4TPRL 3T1FB 4G8GE 1TJGH 3U6RB 1G6RL 1N64H 1NAMH 4HEPG 1O0VA 4Z0XA 1CF8L 1KIQB 5EU3A 4JY6A 1BZ7B 3D9AH 4JB9L 4ZG1A 2FATL 3C87A 4CAGA 3QNXA 1WEJL 3PGDA 1KCRL 4PD4J 1WTLA 1FNGB 3STLB 2VN7A 3CVHH 4NNPL 3M1BA 2OZ4H 5IK3B 3BIKA 4EDWL 2ICWI 1G7HB 1HINL 2Z93B 3JV0A 4YBHA 1WAAE 4BFEA 1DQLH 1AC6A 1FE8L 4CVZB 2WIIA 2XICA 3D2UD 4QRPD 1OTSC 3RL2A 5L8KB 1AD0A 5TGBB 1A21A 2OX5A 3AS1A 4NQEE 4B41A 4E5XA 2ZCLL 1IL1A 4LCWD 3FT2B 1OCWL 1QQDA 4K3JH 3QIWC 2H6PB 4HWZB 3VFUA 4Z7WA 2IBZX 5F8RC 3S36H 1T3FB 2VAAB 4YDIL 5F7LB 4PREA 4RWYH 3JZ7A 4CMMB 2PXYB 2D0GA 1HI6A 3RZWA 1GGBH 2BZDA 3BD4A 4HWUA 3BE1H 2BNRA 5FV2A 4G8FB 4LHJB 3QZWG 2F74B 4Z7WB 1A6WL 5JHDB 3GHBL 4N8CH 3UYRL 3A0OA 2VDKL 1IKFH 4C58B 2IH3B 4G6AC 4L9DA 5EO1B 3QDMB 5I2IB 3HFMH 4H5SB 3D25B 5DD1H 3KYOB 4KGJA 3I3BA 5D6DC 2W92A 1RZKC 1WITA 1HHJB 5I66A 1EBAA 3ARFD 5FGRA 1J1XL 2KZWA 1ZANH 5FDWB 2XN9B 3V6FB 1DQJB 3QJHB 1NCUA 3CLEL 2D31A 1ZEAL 5DFTA 2VZ1A 4GMSH 3GRWA 2HVJB 1CT8B 3VH8A 5IEKA 2DLFH 3U1SH 1A6TA 1TNMA 2HRLA 3H9SD 1VHPA 3NABH 3NIDE 2C3WA 3W5MA 1NAKH 5KOMC 3EKCA 1RZKL 4KV5E 2FX9H 1J8HB 1WAAF 4AL8L 1KLUB 2OP4H 3C6SB 2X9WA 4MDJB 3TPUA 3WFEH 5C9KA 4HW6A 4P57B 2A1WL 3S37H 1SY6H 4C59B 2DBLL 5BCAA 4LARH 4QCIA 2EE2A 4M00A 2YD7A 3D3VD 1DQDH 2JCCA 3CH1B 5E2WH 5IB2A 3AXLB 3SKNB 1FFQA 1KXQE 4XRCA 4G8IA 3U7WH 5IB5A 3KGRA 4I1NB 4UI2A 1GXEA 2J88H 3H7BB 3IKCA 3WSQH 4EI5B 5TE7L 3ZYJA 1HHGB 5MERB 5C6WH 3RVWD 1KJ2A 1F58L 4U3HA 1WWAX 5JOPE 4X5LA 5BO1L 3QUYB 3WUWG 1B6DA 1F3JB 4ZUTB 3MV8E 2BNRE 3KYAA 2Z92B 2F53D 1CICC 4Z0BH 1LDPH 4YHPB 1I8KB 3E1F1 4MJIA 2V5YA 4ODUA 1CFVL 1KEML 5HDBE 4NQED 3I6LD 4PJAE 2DQCL 3S37X 1N7ML 4OZGA 3AMLA 4XB7A 1F8TH 4S2SB 4XPFH 1BFVL 3VXMD 5GGQH 1QACA 3TT1L 2YPVL 4ZXBB 4NRZB 5EIQA 3OQ3B 2ZJSL 4K23H 3OJDA 1H3UA 4YZFF 3QI9D 4Z18A 1QZ1A 3BKML 1UB6A 3QDGB 1RIUL 5L9DL 5GRJH 3NVQA 4LQ1A 2NLJA 5TE6L 5T5NG 1RUKL 1CFNA 4XXCA 3MXWH 4NQTA 4TVPL 4AEIL 4ZO9A 2A6JB 3UTTE 2YPKA 3RWEA 4J2XA 2OTUA 2I24N 4YO0A 4GBXB 5EA0H 3ZT7A 4LPWA 1TJHH 1D6VH 1ZVSB 2Y06L 4JGJA 2BMKA 2JJSA 4FABH 5JPMA 2YUXA 1K5NA 4KUZL 4YHLH 5CP3A 5F1NA 5MEQA 2MQ0A 4LRNH 3ZTNH 3KPOA 5IHBA 1K4DA 4L4TB 4MAYB 3CC5A 2NW3B 5IFAH 3K4DA 1MCHA 2BMKB 4AY0A 3PWJA 1CE6B 2GJ6B 5ETUB 3KLHC 4UQ2A 2DWDB 4X4XB 2NY3C 1OL0A 2WLYA 4EI5C 1BZ9A 3LS5H 3KG5A 4Q74A 3OZ9H 5TH2B 1I1AC 3O6FD 3QCVL 4MJIB 2P5WD 1YZZA 4K9EL 1U93A 5DHVB 5EBWB 2DDQL 5B38B 1KLUA 4I8DA 4X6EB 2EYRA 3CVHL 4PJBA 4BZ1H 4HH9A 3G6JE 4UB0H 1HXYA 1XGPA 3L3DA 4M61B 2HFFA 1Z9OA 1MIEL 2VISA 2AI0H 5JW4R 5HI3C 1KBGL 3C60D 5EPMA 3MLTA 1G0DA 4F7CA 2IMMA 1UG9A 4KK9D 1J1PL 4UBDC 1R3HB 3UPRB 4ZXBC 3WIHA 1HXYB 3L3DB 1AXTH 5KVDH 5JIKA 4ZD3H 5IBTH 1VA9A 4ZUWB 1KNOA 3SKNA 1KIPA 5D8JH 4LCUA 4C55A 1H3VA 4XVTH 3SQOL 3DBXA 4DAGL 1YDPB 5KVFL 5B39A 4UT9L 4DJMA 2MKLC 2Q20A 1TZGH 2A83A 2VDNH 1CXKA 4OGXL 1PGRB 5FHBL 5E2VH 3JV6B 4BQ6A 4K94L 4A2LA 4NSKB 5EC1A 5ENWA 3SDXE 5F1IB 4YEEA 3RBSA 1QFUL 4J4PD 5MHSD 4IMKC 3HZMA 3EYQC 1AGEA 1MFEL 3RHWK 1JWUA 5T1KA 3Q5TA 4RQQB 4Y4KA 3BKYL 4F33B 1M05B 4PR5B 2YWYA 3V6ZA 3LVEA 3BKCL 3BPCA 5E4EB 1RVFL 4KZDL 2XOTA 1KTDA 1U8HB 4K7PY 1ORQB 1ZSDB 3RWIA 3LPFA 5DVOA 1S7TB 3H3PL 3KLSA 3JWDC 5IF0A 2CIKB 4OLUL 2VYRE 3OR6B 3QDHA 3QUXB 5C0EA 1KB9J 2Z93A 4W70A 3MLRH 1XT5A 4PFEA 3LKNA 3EJYC 3MLPA 3HZKA 3H0TA 2EDWA 3GBLA 3LKOA 3S34L 1EUTA 4DVRH 4GOSA 4FN0A 1WZKA 5IROA 3HC0A 4DN3H 3U9UB 5JQ6H 4OD1L 1TQCB 4N0YL 1S9YB 1U3ZA 4EN3D 5CKAA 4JFOA 1XR8B 4TQEL 4UU9A 1TETL 3UYRH 4QNPE 4K7PL 4WW2A 1IM3A 4MJ4A 4XNQB 5D9SA 4D9RD 3ARWA 4HQQL 5JIHA 3QR2A 3HB3D 4J8RB 2R23A 4PRIE 3F7VB 1NCWL 3CCHB 3BT2H 1ZANL 5BXFA 2UVFA 4XBPA 1IAKA 2F74A 4HUVA 4OTXH 1IC7H 1MREL 1LWRA 1ONQA 1IM3B 1QVOA 5GIRB 3CFJB 4YXLL 4PY7A 5DMGD 1L9NA 5DLMH 2CJUL 5TPWH 1FRGH 1ZA3B 5KVMC 4LHUA 4Z9KB 3KPMB 1CCZA 4LLWB 3B2UD 1N3NA 3ZMRA 1WZLA 1G9NC 1A7BA 2ZKHL 3RVXD 4H5SA 1T4KA 5IHUH 1B90A 3B6SA 4BZ2H 3BPNC 3F6LA 1DBBH 3TBWA 1UXWB 1D9KD 1V7ML 3EYSH 1BM3H 4GBXC 3FOMB 1BJMA 3JSSA 25C8H 3ZDZF 3P9LB 3BOVA 2GHWB 2Q6WB 3RDTA 4DUWA 5FO8B 4PTUB 1XGYH 4GSDL 4JHBA 3RUGE 4G6FB 3KS0J 5C0AD 2ILLA 3I9GL 4MJID 1EFXB 1EO7A 2VLMD 4NQEA 5A2FA 1XF1A 4W6WB 1NUNB 3LZFH 3ZKSD 5JXEC 2DDQH 2VLKD 4WI5A 5JZ7C 3IJSB 3BP6B 2ZOLA 1KTLA 1LEGB 1CIDA 1KEMH 1KJ2H 3WFDH 1OAYH 5MI0B 4G43A 4RRPA 5E56A 3H7LA 3R1GH 3L3GB 1ZTXH 1SBBA 5FYLD 4FFVD 5GISL 2DLHA 2E7LC 5J9PB 5DO2C 4AEHL 1QLFB 4JJ5A 4EXKA 3QUZC 4Z7WF 4GG6A 3BZFB 2XFXA 3BKCH 3L5WB 4M1CD 1JNNL 4NNYA 4Y2DB 1DBJL 1HHKB 4PV9A 2YXFA 1EO8H 2FJFA 2YRLA 3AM8A 1FYHB 3T65B 1D5IH 1VCAA 3AREA 5C0FB 2HT2C 2RQ8A 4XX1E 4DKDC 3UYOD 4M9OA 3BIBX 2GCYB 1MQKL 1MWAH 1YECL 3PHQA 1EIBA 3MNVB 1FV1B 2LV4A 3WYRA 2GT9A 1U8KA 3WFEL 2FR4A 4S0TD 2FH6A 3T0EC 2HG5A 4XNQA 5D9SB 4XVUC 1PEZA 4OQTH 1AXTL 2D4FA 1H3PL 4IRZH 4PJHE 1IKNA 2B0SH 4GW4A 2Q8AL 3H9HB 1OY3B 1SJEB 5K59E 3U7WL 4ZFFA 3MFFA 2YOCA 3GSOA 5B3NA 3VD5A 4DAGH 2AXJA 3KPSA 3HUJF 2IGFH 3EBAA 1N0XH 5IM7B 3FN0H 3TWCL 3ZKNC 5BVJB 2BC4A 4K7FA 5I1IH 3HMXH 5DT1H 5C9JB 1AQDB 4MAYC 2FNBA 2Z31C 1IT9H 4K9EH 3TH2T 3DV4B 1HKFA 3DETC 2X4OB 3I85A 1YEIL 4AEFA 3BSZL 1N26A 2R1WB 1BJ1J 2NZ9C 3H3BC 3QUKB 4IIQA 4IRJD 4Y4FA 1CFQA 4HIJA 3MCLH 3EYVB 3MLSH 4WU7B 4F9PC 4QRPA 3CSPA 4HK0A 4WO4A 4LLQA 5E94A 3WL9A 4ERSH 1DVFD 4MNHB 5A2IH 5HHOE 3GBMH 4AM0A 4LSSH 3HC4H 4GRWH 3RIAF 1MY7A 4QWWC 1A6ZA 3G9AB 3SE8H 2UWEF 3O3EB 1JCKA 1OLLA 4L3AA 2V9TA 5EO9A 3MLVL 4GKOA 4N9GB 4LDEB 1HCFX 4QRQA 3U9PL 1R24A 2XQYK 4MNQB 4WCYL 1Q0XL 4CJ1A 1JL8A 3QXDB 3FB6B 4YR6B 3LKOB 5D2LB 1ZMYA 2IAMB 1P2CA 5BV7C 1Y18A 5DJAB 1G7QA 1S5HB 4X80L 4HS8H 3O3UN 1WWWX 4NQVA 5JOEA 3ZDXE 5F89A 1YMMD 3FFCD 3IU3B 1H5BA 2R1YA 3SKMB 4QTHA 5ICXA 5IHZA 1IL1B 3ARBC 4TNWF 3X11A 5D7SH 4YHKL 5JHDD 4KK5D 1FH5H 4YBQC 3JBG7 3TEUA 1AFVL 1JIBA 4GQ9H 4QKXB 1T66C 4JEGB 2YHGA 5CKGA 3VXSB 5ID1A 2MPAL 3SCMA 1MI5D 2VLKA 4PJDA 5CMAA 3VFMA 1VESA 2ORBH 3R06B 4GG8A 2BFVL 4ZMAT 1IGJA 3N50A 2GJJA 3GO1L 1CDIA 3ARVA 2BERA 4PJ8D 3VI4F 1FG9C 5GGVL 4WRLA 2HG5B 3VXSA 2DRUA 4KK5C 3DX7A 1HILA 5FA3B 1Q9OA 1YUHB 1FGVH 2W65B 4PJDF 1RURL 2YN5A 1GAFH 4IJ3C 3S4SB 1QO3B 1VGEL 1I75A 4OZHE 1JPGB 4HAGA 1QP1A 5FV1L 4JDZA 3PWPE 4K3HA 2CH8A 4U1MB 3WLBB 1GCFA 5ESQA 3SO5A 2W65A 3MLTB 2H1PH 1JYVA 1GJIA 1U3HD 5HBBA 1B0GB 1FPTH 1U8IB 2XWBA 1ZT7A 3QO1B 4PP2A 5CD3A 2O26U 2OR7A 3S96B 3KLAB 3G5ZB 3NH7H 2DQJH 3ULSA 1D5ZA 3FT4A 4XP1L 4ELME 5GHWH 3TYGL 2VXQH 1XF2B 4UNTA 5D7KD 2EC9U 1NCCH 1N8ZB 2D3VA 5L88H 3QIUD 5E6YA 1QFUH 2YRPA 2DKUA 4ODXA 2BY2A 2X4OA 3V8OA 4LVOB 5D1XD 1RMFH 3MV9E 2Z8SA 5JIPA 4J1UA 1DQQB 3K74B 3MXVH 3RZCD 4AEHH 2CDEB 1T5XA 2I9LA 5C0JB 3IU4L 3SHSA 3KPSD 2VXUH 2BSRA 2VO5A 3BP5B 4H1LG 2AJSH 3O41A 1OB1B 1WWCA 3VH8G 3NTCH 3WO3B 1BFOA 3QIBC 4X7DC 5SWSD 5FYJU 4YAQA 2Y36H 5C0RL 5J4MA 2R1WA 3SJVD 2FCBA 1NFIB 3T0DA 4Y1AE 5ADPH 4PGEB 5A2LH 3TBWB 2AI0L 4OM1L 1I9JL 5D1QA 4JLRA 4HUKB 2NXYC 3THML 1UJ3A 5HHMB 3L7EA 5DR5H 4F80A 3MNVA 3U9PH 2IPKB 3MGTA 4M93B 1C12A 1RV6X 2AJYH 3CH1A 1RHHA 5EU6E 3IDGB 3ARGC 4KKAD 2K3TA 5D7IF 4M6OL 2PXYC 3TZVD 2AKRB 5IW1A 1T22B 1NJ9B 3BRGC 4KMTH 4GUPA 2Q6WA 3RDTB 3CMGA 3VWKC 2WSKA 4BH7A 2VDRH 2VC2L 1FO0L 3IF1B 2Y7QB 4MQSB 1PG7W 4Q9RH 1MREH 2NY3B 5TGBA 2WV3A 3BAEH 1P1ZB 3QB7C 1FYTE 5I76A 4K3EL 5FUZH 4MXVE 5CEZH 2ERJB 5GS0H 5DLML 5TPWL 4GQ9L 2OI9B 3LAFA 1YEIH 4YWGL 5ID0A 1SYSB 1MFBH 5F89B 4UAOB 4PYHA 3Q3GB 2JJTC 4LVOC 3MRMA 3ULUL 1MLBB 5I76B 1CDHA 1S7TA 3UTSD 3P30L 3B5HA 4M48H 3QULA 2V5SA 4XGZA 3RVXC 1RU9L 3WJLC 4U7KA 4HS8L 1A7QH 3IGAB 3T0EA 5DD5L 4MNGB 3V6OE 4P3CH 1VENA 4R4BA 4F7PA 4GG8B 3JUYA 3R06A 1BBJA 4K2UH 3SY0B 3MUZ1 4OV5B 7FABH 4E41D 1H3TA 5FK9A 4P4KD 1XMWA 4OD1H 3E6FB 2XY1A 3QDME 4YPGA 2DN7A 3RY4A 1I7ZB 2O5XL 5DHVA 5EBWA 1HILB 2CDGB 3ZYOA 43C9A 3FQWB 4TRPH 2VQ1A 1A9BB 2B7DT 4U3CA 5EZLA 4U6YA 1N2RB 5B8CC 3G08A 2YSSB 4OLVH 5D7IE 1T2QL 4KROB 4E41A 2P8MB 4HUWB 1UVQA 4TNVF 3EOBA 5DJAA 5DMIH 2NY2D 3PGCA 1B0GA 4NO3B 5EORL 4HKJB 4HJJL 4X98B 3E2HB 3QT2A 4RAVA 5DI8A 4PB0L 5ELIA 1A4KB 1AXSB 4W4NA 5D6CB 4I18B 1MCCA 3QQ9C 4QGTA 1RZ8A 4Y7MA 5CJQL 3LRHA 5IBUG 5ACZA 1YDPA 1LP9F 4Q9QH 4YDVA 2BRQA 2J8UA 5BVJA 3P9WB 5CEZE 1FIGH 3BRDA 4UILH 3MUHL 4X6DA 2EO1A 2X4TA 4PB9H 4P5MB 1S7QB 1NLDH 3HFML 4EQ2A 1DBML 1M7DA 1JHLL 4S10A 2QQQA 4J6RL 4OB5L 4YAQB 4XCFH 1F6AA 5CBAA 4Y88A 2A9MH 3TV3L 2BJML 5GRVK 43CAA 2DQTL 4KY1H 4XVUD 4RGNB 1U58A 2BSRB 3U30C 5F8QC 4LLDB 2DMKA 1AIFA 3ARGB 3CSYB 4X8JA 1JRHI 3TO4B 3LD8C 4MSWA 5EFIB 4UTAH 4WUKL 3O6MH 4BK5A 4LLAA 5DRZB 3HZKB 5D71L 4S2SA 2VXTH 4BH8A 4NQXA 1A1NA 4DGYL 1FIEA 2X4QA 5HPMB 3MRKA 2AEPH 2YEZA 5K9QI 3BH8A 5FB8B 3H9SA 5ICZB 5DTFB 5CJBA 3RVVD 1C08A 4K71B 3HC0B 1SJEA 5F7EL 3U2SB 1IGYB 2F19L 4P4RB 5DSCB 3LS4L 4HFUH 3VFNB 4RA0C 3B2VL 3VDBA 4Y5VA 3WLWD 4GXUM 4NPYA 4HEME 4OD3L 3DX9A 5DQJB 3S3SA 1SYSA 4KHXH 5C9JA 4JR9H 1ZT1B 2EECA 1QLEH 3D87B 1EHXA 1LD9A 4XP5L 1MELA 4OAWA 5EOCH 2J8HA 3NZHL 4ZUUA 3HS0B 1ZSDA 3VU2A 4JHAL 1TJGL 3O8XC 3X11B 4MCYA 4GG6F 5JA9A 3RFZC 2YUZA 1NDMA 3K4AA 1MHCA 1HYSC 3NCEB 1JTOA 4QRUA 1RIUH 1DN0B 2GAZA 4JFQB 1N59A 1WF5A 4FFYH 1J1OL 1IC4H 4GBXD 2YMXL 4PLJC 1GAFL 3FO0H 3O4OC 3THMH 4E0RB 1QSEB 2YD4A 3LV3A 2OR8A 3RJQB 4XAWL 5K33A 1WK0A 5KSBB 5L88L 2ED9A 3P0YH 2G2RA 1KCRH 4CVWA 1RZJL 4XP4H 3DUSA 4PJBB 1ED3A 4MVBC 4POYA 4M48L 2J8OA 4KVCL 3Q0HA 4G42A 3SGEH 1N6VA 2A6JA 1JGUH 3L9RA 4PLKC 2LABA 3IU4H 1TJIL 1NC2A 4QHLB 1ES0B 3HE6B 4I4WB 4R4ND 1DZBA 2X7LA 2EIZB 4YGAB 4MQXC 3FQUB 2BNQD 3PUCA 5E2TH 4JHWL 1IQWH 3QDAA 3U83A 1IGIL 4HK3N 4XWOC 4WUUD 4N5UA 4OCSL 4D2NA 1FSKB 2I60L 4X7FC 5IVNA 3GMNA 1IC7L 3TJEL 1F58H 4OFKA 1KTLB 4XBGB 4KZEL 3OKLA 3NA4A 3VXME 1UWEH 3NACH 1QRNE 3FO0L 1YEKL 5C0DB 1YJDC 4U1KB 4W81A 2ITCA 3ZKQD 3W11D 1HHJA 1IAII 3GMRB 1EJ6A 4MJ5B 3VG0H 3DGCR 3DUUA 1WSST 1XGRB 3MRRA 2Q1EA 4JKPL 3VXNA 4N1EA 3FFCA 2L4OA 1DLHB 1GVIA 4RGNE 1VEMA 3BZFA 2UZIH 4ZD3L 4IMLA 4NQDA 1Y6KR 4M1GH 5EUKB 5CGMA 4GH7B 4I0PD 4MJ6B 3MRIB 1VFAB 1Q9LA 4KI5F 4LBEA 3AVEA 3HHRB 1IM9D 2AAVA 1QG3A 3G5YB 2A6DB 4XNZC 4HKZA 5D2NC 2IAMD 3X3GH 4OCXL 3GEWB 2XG5A 4O00A 2YD9A 4WGVB 4QXGL 1G9MH 2BVTA 2FEDD 3T4AA 3ET9F 3HRZB 4M03A 2PO6A 3OR7B 3WNLA 1FVEA 1TIUA 3QQ3A 4U6XB 1PLGL 4NO0D 1RMFL 5EIIB 5IB4A 3CD4A 1UWEL 1JGVH 3PP3H 4WU5A 4NO5B 3FB7A 4WFHE 1MI5E 3O0RH 2R69L 4CN1A 4HS6A 2OQJA 4NSKA 3UZQA 1S9VA 4GG6B 3FQUA 1YYML 3SDCC 1T3FA 1U2CA 2VAAA 5KN5A 3MJGX 1F6FB 1OQOA 4U6XA 3QQ4B 1E4WL 1AE6H 3MOBH 5J6HA 2A0LD 1HE7A 3MRQB 4Y19D 3WKMH 1GOFA 4TUOA 4BUGA 3AREB 2IC2A 4Q0XL 2BOCA 4NJ9H 3NZ8A 4JZOA 2PF6A 3I6GA 4OLVL 2ZZUT 3LKQA 3QDMA 4ZS6C 4YXHH 5TJWK 3JWDL 1MJJB 5JPNA 2UZXB 3GIZH 3RJDA 1ZGLM 4H0IA 3OKEB 3DVFA 3MLWL 3WMSA 5E9DD 3JVGA 4R96B 4U49A 2R0WH 3BT2L 1SVCP 2A2QT 3CK0L 1DVFA 5CJQH 3OKMA 5EO9B 1OAKL 4X6EA 3MCG1 2W07A 1EJOH 1F02I 4P2CG 3SDXF 1H3XA 2GJZB 3QEQA 2MTPA 2ZSWB 5E8EA 3QAZC 2VDLH 1CQYA 3NAAH 1T20B 1W0WB 1JNHA 1QFWL 1J18A 5HGBA 1NCCL 4HKXB 1I9EA 3CU7A 1WIOA 2HJLB 5KS9B 1MUJB 4QRTA 3CFKA 5D1ZC 1F90H 2MNUA 4PTUA 3HKFA 1PEWA 1BX2A 2VDQH 5IBUB 4LMQE 3L1OH 2VLJB 3K7UA 1QOKA 4JQIL 4B7IA 4K3GA 5IG7B 2EE6A 4Z7UE 3KPOB 4JR9L 2DLIA 4M7KL 4ZDHA 1QHPA 4JFED 1JJUA 4WW1A 4XZUB 4YFLI 3F5WA 1IRAY 4NFCA 2EDNA 3MJ9H 4LU5H 4WY7L 5DUML 1EHAA 1T0MA 5HHME 3DV6B 3HR5B 2YWZA 5B3JF 4LAJH 4RGNC 1XAUA 1NCBH 4IDJH 2YPLB 5IUSA 4KRLB 4JN2A 4R90L 3O2DA 4LCCA 1CE1L 4GLRH 3V6ZB 2OSLA 5J11B 2AV1A 5HHPA 4BZYA 4LL9A 5GGSA 5IEHB 1IQWL 1AO7D 2ITDB 3OG4B 4HJGA 4Q6YA 4G8EA 4XTRD 5E24E 4OV5A 2VZUA 1W0VB 3ARDC 3GHBH 4N8CL 2OP4L 4NZRH 2B4CH 5CGTA 5GJSH 3HRPA 2HKFL 4N0UB 1MOEA 1JWMA 4XPGH 3MV8B 2FHBA 4LSUH 1C8PA 5IBTL 3REWB 4YH6A 5C0BA 1Z5LA 2VZVA 4PJ5B 4P59H 3IDUA 5JXAH 4YHZL 2VH5H 1EGJA 2W59A 1SYVA 1W72L 3GRWH 3CJJA 1TQCC 3FO9B 2IBGA 3N0PB 2NY0B 5DI8B 5F7FA 3OX8B 1IC4L 3U2SA 2EICA 1QFHA 5D1ZD 2QJDA 4DW2L 2KH2B 3QULB 4XGZB 4HGKC 3ARXA 3G5VB 5DZNA 1I3RA 4QXGH 1BVKA 3QFDA 1TENA 4ETYA 2OJEA 5K93A 4GSDH 2R8SH 3MYZA 4PJGE 1MFDH 1T6WA 4LLYB 4JFEB 1KCUH 2A38A 2WLZA 1HYSD 3BEVA 4UTBL 4RWHA 4UQ2B 3DXAE 4O4YH 1I3RB 4FQ2H 1FL6A 4NRYA 3KPRA 5GSVB 4JREB 4JFHE 4NRZA 3E0GA 4HLJA 3RVTD 2EDQA 3RU8L 4FQIH 5H94A 4R2GD 4BFBD 5LXGH 2FBJH 5E1AA 1K4CB 4JRYA 1VDGA 4YK4B 3X13B 3MACH 1ZHKB 2YRZA 5ESAA 1IKNC 1T89A 4PLNC 4BSVB 4NUGH 1SEBA 3H3KA 4S1DC 1RHHB 2EYRB 4Y5YA 4LGRB 2DLTA 1A5FH 1X5FA 5TF1H 4KZEH 4ODTL 5FHAL 3DJ9A 4JDTH 5HTSA 4TTDC 2V2WB 3MBXL 1E4XH 3C5SA 3GIVB 4YHNA 3MNWA 3HNSH 4OTXL 3D0VB 1FZKB 3QNZA 3UTSA 1NH6A 2WZPD 2R0WL 3UP1A 4DVBA 4OZIF 1JGDA 2BX5A 2NW3A 3VXRE 1BF8A 4YHKH 3T2NL 3RHWF 4P48A 4C56B 3N9GH 4HWBA 3QIWD 2VE6A 1FFRA 4Q6IB 3FT3A 2A9ML 5DFVD 2AV1B 4X9IA 2WWKO 2R56H 2D7PA 4DEPC 4FXKB 4DUXA 3F12A 1UM6L 3TZVB 8FABB 3ME0A 2IF7A 4MA1B 4R4NC 2E7LA 3T2PA 3QUYD 4ZAKD 3PP3K 3QG6B 3MLWH 5E5MA 1J87A 1S8DA 4AIOA 4YFEA 1BWMA 1X5HA 1U92B 5LJYH 1T0NA 3IETA 3VWJB 1CT8A 3VH8B 5IEKB 2PW2A 3H6JA 1PKOA 4P2OC 4IMLB 3JWOC 4Z78B 2QQNH 3MMEB 5DWUH 5C8JA 4LSTH 1Z2KA 4JG1L 3RWDB 3RQ3A 4CW1A 1JGLH 3OR6A 3W11C 4D0BB 4G9DB 3NOIA 3QWRD 2VLRE 4YK4C 5C3LD 1AO7A 3BWAA 4AMKL 2Q8BL 1JNHB 1O5DT 3TIDA 3O0RL 4JZJC 4XWOD 2R4SH 2C4FU 4PJEB 4WV1C 2N56A 5CSGA 5GJSL 1P5UA 1NGYA 1AGEB 2DQEH 4G80B 3FCTA 4P4KC 4PJHF 5C6PB 2WQ8A 1T7YA 3CFEA 5SWSB 2WP3T 3EJZD 1FL3B 1RK1A 4MWFA 3O9WB 4JM2B 4AH2B 4Y4HB 3EDFA 2R1XB 3GSNB 3S5LG 1ZHLB 3RWGA 2V6HA 4YHPA 2X05A 1ACZA 2VITA 3V4VL 4KI5D 1T1XB 4KXZH 1RQ5A 4R4FH 3AAZB 5E00B 4IS6B 5FAAA 1ZGLB 1EVUA 5BW7C 3TO4A 3OPZH 2V7NA 5INDA 3B43A 1LVEA 1NSNH 4NKIL 1JWMB 1NUGA 3BHBB 3S96A 4LIQH 4HKBA 1JGDB 3ES6A 4CMHC 4OCYL 3HE7C 5DRWA 1FBIH 3C6SA 4MDJA 4V1DA 3SBWA 3IS1X 1F4HA 2HFGH 3RUGB 2IAND 4N68A 1HOCB 3WUWB 1RZ8B 2D7MA 3P3YA 1A0QH 4ZPTB 4QT5B 3SDYL 1YC8A 1AHWA 2P47B 3SGKA 5L8JB 1MI5A 4DGIL 4G8FA 5F9OL 3MRJA 1NPUA 2A73B 4JN1L 1IC5H 1BQHA 2ORBL 15C8H 5KSAD 3O6KL 1NEZB 4YXHL 3PV6B 4RFNC 2X1QA 3LZFL 5ITFA 3C8HA 5C6TL 5L9DH 4XHJC 2BOCB 3LH2L 1PQZB 2FX7L 4P9MH 5CJOL 4HIIB 1UH3A 1K8DB 5EZJA 2XPGA 5HJ3B 4NZUL 1ZHNB 1AGDA 1EFXD 4Z6AT 4L8BB 4WUUA 1M05A 3PNWB 5C0AE 2O5YH 5GRXG 2WAHA 1H0DB 2BNQE 1HXMB 1RJYA 4JO2H 5JTWA 3UJJL 3HTLX 5J1AB 4Z7UA 3SDDB 2YZ1A 3E8UL 5E2WL 5DRNB 4OGAD 2E8ZA 2R2EA 4JHZA 1HXMA 2XYCA 2VIRA 4ZTOL 3H9SB 5ICZA 1ZAGA 2B1AL 1KCUL 4N8PA 3O6LH 1KIPB 1Z9SA 3QFJA 2R4SL 4LF3B 3SBWC 5JPMB 3K4ZA 1I9IL 5ICXB 2VLRB 1CI5A 2B4CC 4Z7VA 4M62L 2V17L 4GMTH 1DL7H 1NC4D 1UYWL 5BZWB 1INEH 1ZHLA 3MLYH 2VXSL 4HC1A 3GKWH 4EI5A 4LCIH 4K07A 2OTPA 4FOMA 4O02H 5HD8D 3VFOB 4KKCC 2NR6D 2G75B 4XMPH 4Y4HA 3L5WA 3QWOB 3QWQB 3W39A 5FGCE 1N59B 3ZSSA 2QHLA 4WEMB 3CVIL 4XMLL 5IT2L 1FCGA 4RQQA 5T1DL 1H8SA 3BO8A 3RUGF 2CKBH 1V5JA 1KLGA 1EEQA 5CWSA 5A40E 5CGYD 2X9YA 2PXYD 1NAKL 1ZS8A 2AK4B 3TJHC 3AC0A 4L4JA 5DC0A 5IB1B 2P46B 1OGTB 4GT7A 4JDTL 1FO0A 5ETUA 2ZUXA 4J4PA 1C1EH 2V2XB 2DQUH 5C92A 3EYUH 3T3PF 1CD9B 3IFLL 4DZ8B 2NPLX 1EZVX 3NFSL 3WCYA 4XCCL 3AUVA 4K94H 1U95B 3RWJA 1S7SB 5DJCB 3IJYB 4QY8B 3ROOA 1G0XA 3T09A 4CU6A 1EVTC 1ODAA 1I9IH 1ES0A 4IOFD 4PP2B 1NGZB 3G5XA 3U79A 2MWCA 2X44D 1UXSB 1T7XA 4NUJA 3V5KB 5AYUH 4XX1G 4AIZA 1S7SA 5DJCA 5IG7A 1QBBA 1MY5A 4OLXL 2ZCHH 5D7LD 5BRZB 1J9CT 1BHGA 2AXGB 3RVUC 3O9WC 2PR4H 1OSPL 2IG2H 2OR9L 1KTKE 1INDL 35C8H 2C3HA 3L6FB 5AZ2L 4NNPH 4TNWK 1NUFA 3MYJB 4A2MA 2FX9L 3TA3A 4ELKA 2E27L 4MNQE 2ITCB 5I1AB 4YHYB 2WANA 4HIIA 1XCQA 5D1XC 2K1MA 5GGTA 3MOQA 3DVGA 5FCSH 2QSQA 1DVFC 3B9DA 2FSEB 3QCVH 3PDOA 1NDGB 4HJ0C 1E0OB 1YMMA 1FZJB 2HJKA 5HHOB 3JTSB 3SCMB 1X3DA 3LSOB 1XGTB 1MVUA 4LMQI 3QEGH 4CL7A 4M7LH 2Q7YA 4JRWA 2FYYA 4A6YL 5EN2A 4G8GA 4NKOB 3OKEA 1UWXK 3G9VA 2XWJB 3WS6C 2BK8A 1WT5C 5KG9A 2E7MA 3E6HB 1YNLL 1I8LA 5IW6A 3MROA 1GH7A 4L4TE 4QRRA 4MLIA 4Y5VC 3OJMB 4X7TA 2PR4L 2VIRB 5DGQA 3CPLB 3WFBL 5GXBB 5HHMD 2MMXA 4WGWB 1CXHA 2ID5A 3WDIA 5BS0A 4I3SL 4V1DE 4OFYD 1KC5H 4PG2C 2CK2A 1X6LA 1U8QA 4PGDA 5DK0A 4GAFB 5MP6H 4TUKL 3QI9A 4Q7DA 4HWEH 4Q6IC 1HKLH 1YEFL 3VW3L 2FECL 3VD7A 5I73C 2FHCA 1P7HL 2PYFB 3L6FA 1QLEL 1JGEB 5IHZB 3CX2A 4PGDB 2R8SL 4NM8L 2V2TB 1XF2A 5E99H 4JG0L 4XNMB 3LKRB 1AI1L 2A1WH 3TT3H 1JWUB 4G7YL 3QDJB 4MHHI 1Q0YL 1A47A 4LSPH 4WVRA 2VXVH 4FFZH 4PRPE 1U3HC 5IV2A 4OZIB 4WWKC 3NN8B 4IOIA 3TV3H 2W1NA 4WEBH 5D1XB 3QJHA 2AEQH 5CIPA 4KQ4L 4X0KB 5I74C 5TE4H 3QRGL 4X7SL 4YHYC 4L9LA 1WISA 1S7QA 4M1DH 3K2MC 2C3VB 1OB1A 4S1QH 3IJYA 5FA4B 2OMNA 5D2NB 1ZLSL 1FN4A 3Q6FB 2R2HB 1WBXA 3EOYG 3SDAB 4KUCF 3QUXA 5C0EB 2XTLA 1EK3A 2GTZA 1ZGLP 5C0IB 1IFHH 3WNMA 1KIQA 5D71H 1B6UA 1JGLL 4APQB 1V3LA 2HT3D 2C3VA 3WV0A 4KRNA 5D7KE 2WUBH 3L7FA 4PGBB 4G6JH 4GAGH 4ZOCA 2HLAB 5FCUL 5IJVB 3KS0H 4Z77B 4OCXH 3RTQD 1AJ7H 3TJEH 1FFNB 2UV3A 4WTZG 5L2JB 1EHLH 2VQUA 1EBPA 2LE9A 2VISB 4U0QB 1U95A 4L8CB 2VL5B 4LEOB 5J57B 4KKLD 3MOAH 4NZJA 5E8PA 1IGML 5BRZE 2AERT 3RIFF 2J5LB 2X6MA 4J3UA 3TA3B 4ELKB 5DGRA 2EDDA 2OK0H 3PHOA 4EJ1C 4IDJL 4G9FB 4CGTA 4ONHB 1VADB 5DD0L 3JV4B 2PYED 4GKNB 4NQVB 3G5VA 5F21B 4PRNB 1FFOB 4G6KL 3MJ9L 4LU5L 5DJZA 3V0WL 1ZKAA 5CUSH 5DD3L 3O41B 1MLBA 1Q72H 3WHXA 1IGTA 1IGFL 1RAMA 5E6IC 4D9LH 1A9EA 2AJXH 4P3DB 4QWWD 3OG6B 4N0CC 5FYJD 5I1IL 1WFTA 3INUH 2D0FA 4Z5RB 5FYJH 3N1GC 5JORA 5DRZA 1DTUA 4UV4H 3KPRE 5E2JA 4HGWA 1RJLB 1S3KH 1BD2B 3BPOB 3I9GH 3MRBA 1UWGL 2ZCKH 4JFDE 1EERB 3V5HA 4LEXL 1CK0H 3KDMB 1NKOA 4ODUB 5KSBF 1GRWA 2AQ1A 4LVEA 5DMKB 4QOKB 1EJOL 3SO3C 3DXAD 2ZNWA 1OP5K 2D7TH 4PG2A 3IKKA 3BWUC 4P46C 3B4NA 5J1AA 5IFJA 1QBLH 4K94C 1B0WA 3FQRA 1SBSL 5IK3A 2NY6D 3VFNA 4K3DH 2B2XH 1GGTA 2Z31D 5EBMA 4L4TD 4MAYD 2F9BT 4BZ1L 3GIVA 2VXSH 1OAUL 3ZKND 5E5UB 1UEYA 3MV9A 5T1LD 3V6OC 4R7NA 4XCNB 2DQDL 2AABL 5EBMB 1KEGL 3CFBA 3GSUA 5CIPB 4HS3A 4LPTA 4NP4H 3HE7D 5JUEH 4XBGA 3HI6H 1G84A 1INQB 1F3DH 1MRDL 3G6JA 3LD8B 3WE6A 1FNHA 3FT3B 3C6LC 2JE8A 3GSNH 3W39B 3F58H 2HTLD 5C0JA 1KELH 1KV3A 2DM4A 4P3WA 5D7LB 5BRZD 4W6XB 1KJVB 4MB3A 3O3EA 4YE4L 4CN6A 5FM4A 1YN7A 4TULL 1Q94B 1WCQA 2GCYA 5TFSL 2EKJA 1V7NH 3NFNA 3O6KH 3ZT6A 4C56E 4WFGD 2UWEE 1GGBL 2P42B 3U7YH 3SDXB 2ZSWA 1E27B 4U6TA 3RKPA 1IAIH 5I8OL 5I1HH 3JVGC 5D70H 3QUZD 4U1IB 4RNRA 4U3XA 1QFOA 3KPPB 2AXGA 5F7WC 5DO2D 3P9LA 5FECA 2X4PA 2FEEL 3NPZB 4LK4A 4F7MB 1RK0A 3GIZL 4FFVC 1JE6A 1S9XB 4ZXBD 2ADFL 2NXZD 4I2XA 4OF0A 5GZOD 3WNPA 3AU1A 4LCIL 2EDEA 3K8KA 4DQOL 4LHQB 5L2KD 5D72L 2AJVH 4JFFD 5DMGC 2ATPB 4Y16B 3C9NA 3VFUB 3D5OF 3MOBL 5DD6A 5F7YC 4KHTL 4Y16C 1BVZA 1KELL 1L0YA 4IRSC 4JKWA 4NKMB 5KZCD 3SE3A 1KTDB 1I1AD 2LTQB 2VSDA 3EHBC 5E8DH 4E42B 3I50L 5JORB 5E0QA 3IDIB 3LCYA 1DUYB 4XP1H 3AS3A 3PHSA 5CBAB 4P2RB 2FJGB 5JLZA 4DTGL 3VRJB 5EC1B 3D3VA 2KBGA 4PJGB 5ENWB 5HYSA 2FLBT 2GT9B 1CFSB 4MXQC 4BFIA 1MLCB 4RMVA 2DQHL 2IJ0C 1T1XA 2VDML 3FB5B 1JNNH 5F1KC 4C54A 1VACB 1I3GL 3B2UC 3MRKB 1HIMH 4ZS7H 1YEDA 1WVZA 3E3QC 3SDDD 1JWSA 4YBLB 3KYMB 4WJ5B 4WWID 3D69A 1F5WA 3X14B 4UNUA 2IG2L 2IALA 1IILE 4PJEE 4P23A 1F4WL 1YJDL 4ZQKB 5D5ME 5HYJE 4KHTH 4PRHE 4HUUB 4RGOL 2D7OA 5C07E 5GGVY 3H0TB 4WEBL 4CVXA 5C70A 1PKQA 1ZV5A 5IWLA 3BDYL 1J0ZA 4RIRA 4G43B 1DQQA 1DEEA 1F8TL 3HAEH 1D5BA 3PWUB 4H1LB 5E99L 4OZHA 4P23B 4HUNB 2R0LH 3LKPA 5IJKA 1VEPA 2DICA 1NC2B 1U3YA 3ARFB 1UB5B 1GC1L 3KPNB 1IVLA 3C09B 1A3LL 2AGJH 4WW2B 1KLGB 1WV7T 4LLVA 2ICWA 4N0CD 2D4DA 2G5BA 2H45A 5DD6B 3GMNB 1UA6L 1YYMH 1CE6A 2GJ6A 3HI6L 3EFDL 3PV7A 3K3QA 1E6OL 3D2UB 4XP6H 3B2VH 3CXHK 3LQMA 4M6OH 2DWEA 3ZDYE 3UAJD 4W4OA 1QSVA 3EJYD 1D5XA 3KWWA 1MCRA 5I9QC 1KB5A 2AK1L 3LV3B 1I1YA 4J3XA 4MA3B 5ITFB 4M5ZL 1CLOH 5DA0B 4BSWB 3U82B 3VRJA 5LXGL 5TF0A 1TVHB 4M61A 3D2UA 5JW4N 5BMFL 1ACYH 3QNXB 3VGEA 2CR6A 5HHNB 1P9MC 2UZYB 5EC2B 1JFQL 4HF5L 4NM4L 3ZTJG 1Q38A 2ICES 3L3IA 3HG1E 1KNOB 4XC1L 5D7LE 3H42H 3T04D 5GPRA 1NEZG 3U0TB 3GMQA 4P59L 3CFCH 3T77A 4X9HA 5H37H 2QQKH 4M1GL 5HYIA 4FQJL 1I1FB 1R3LA 5FO9B 1EMTL 1RUMH 5LAXB 4HKZB 2JJWA 4GQPH 1U8QB 5FIEA 5F1IA 3VMPA 1G0YR 1T83A 2HN7B 5KANI 3QNZB 5KJRH 4D0DA 1OW0C 2EYTA 3ORJA 1OAXH 3NTCL 5C2BL 2DB8A 1NAML 2OXGA 3MACL 3MBEA 2VDQL 4WDIA 4H8WL 1JPST 3ULUF 1VPOH 1OD7A 1JZ3A 3GMRA 4MJ5A 5E8DL 4QGYA 4RSVA 4G9FA 1RZIA 3O3BB 3MRQA 4DKFH 5DHYB 2OMBA 1ETZB 5E95B 1O7SA 3PWPD 2DF3A 5I0DA 1RZGA 4PJEF 5EORH 2XKNB 4MS8D 1W0VA 2FEEI 1J7VR 4PJXA 4P5TB 3ZKXB 1OAUH 2V2XA 1G6RB 1DDHB 2CRZA 2NMSA 3G04A 4JFZL 5CSBA 1MF2H 4JQVC 3LHPH 3TVMC 5HY9B 3I3EA 3U0PA 1Z0NA 3L3JA