4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
1UB5A 1M7DA 2N7AA 4M43H 4WI5A 1IGYA 4L3AA 2GJ6D 3TZVA 5ESAA 5FDYA 1WVZA 4TUOB 4WEBH 5INCB 3ZTNL 4PUBL 1MLCA 2AKRB 3IF1A 3M17A 4OCRH 4JRYA 4W81A 4EVNA 2M26A 1CFVH 3N1QC 4KROB 5I1CH 2XWBA 1QPXA 1B90A 2X42A 2V2WA 1WCBB 3L3DA 3MLSH 2CKBB 5E6ZA 3VG9C 4TNWF 5D71H 1FYTE 1TJHH 5DTFB 5MEQB 1DVFB 3WNPA 3GJFH 1BEYH 1A6AB 4N0RA 1HNGA 3V4VL 4H0IA 4ERSH 2B1AL 5J9PB 3G6AB 3MRBB 1T21A 1TZGH 1QSFD 3IU4L 4XXCA 1VGEL 5K9OB 3CMOH 5HYJA 3FRUB 4PRNA 1G6RA 4D9QE 2OQJB 4ODSH 2VZSA 4NQCE 4QRPA 4WDIA 2L7JA 2F5AL 3RTQC 1ZT7B 4G43A 5C08E 4NCC2 1CDJA 4Z0BL 5B38G 1MCHA 3Q2CA 5B4MD 3KYMB 4YAQA 5DLMH 1IAIL 5TQ0L 1A9BB 4XP6H 1C1EH 1DL7H 3MJGX 2RBLA 2AK4D 4UUJB 3FQNB 1JHKL 1FZOB 1RZKH 4R7DA 1CVRA 1JHLL 4MAUL 1JNHB 2WMPA 1DBJH 2EYSB 2QL1A 5BV7L 2XKNA 4R4BA 1BQLL 5CSZB 4ZS7H 5LBSH 3RIFF 3X13A 4LFHD 3RVUD 5DMKA 2DQCL 2X10A 4KK6C 1S7XB 1YNLL 4FG6C 2NY5C 3SBWA 1VDGA 4K9EL 4NZUL 1BGXH 1MFEL 3PG2A 1Y0LA 3ALPA 4LLWA 3KPRE 1W0YT 4Y1AE 4JQIH 4PRPD 5IFHH 2DICA 3MRDA 4J3WA 2GHWB 3FO9A 2XNAB 1R3KB 4PJCF 1P9MC 2CIIA 4DOHB 1H15B 2WSKA 4LAJH 4PJDE 2J88H 4CJ0A 4OI8A 2XKSA 2ESVA 4OFPA 1X5GA 1ITCA 4ELME 3UYRL 3O81A 1YYML 2RFXA 1EVTC 2B4CC 3CDFA 4U6VL 4FQJL 3RI5K 4GRMB 4G6KH 4M1CC 2FEDD 4PJCB 2I9LA 1GZPA 3QHFH 3LHPL 4Y88A 1DE4B 5I1AA 4KVCL 4JVUA 1BF8A 3EGSB 1JL8A 4AJ0A 4BH8A 4I4WB 4LHUG 4UINL 5J1AB 4OAWB 1ZT1A 4OFIA 4XB7A 2AJUH 4XXDB 5TFSH 2CDFA 3OZ9L 4PRAA 1A7BA 3G5ZB 4XZUB 1JZ3A 1AH1A 3GMQA 4ZUWA 2P47B 5EN2A 4BQCA 5E2VL 2HLAB 4FA8A 3HZYB 4F7CB 5CEZD 2PYEE 1VFAB 4ZOCA 5JHDE 4EN3A 4XNZC 5ICXB 3GKWL 3GJFK 4MX7B 4OSUH 2DDQH 5EIIB 5C9JA 2FD6L 5ADPH 3MR9B 1OD7A 4AM0B 1K9TA 5I30L 4PV8B 5JW3H 4HG4K 5I17A 4NBZB 2X1WL 1RZJH 2FHFA 4G5ZL 3EDEA 4TOYH 1JK8B 3NH7H 3I02A 3C5ZC 4I8DA 5D2LF 1QR1A 4X7SH 3QQ9C 3JWNC 1J88A 3RWEB 4OZIB 3MV9A 2EIEA 4K55A 5AYUH 3G9AB 4C56A 1LGVA 2CRIA 2YN3A 3CFKB 3X3FH 4NDMB 4ZFFA 2EDEA 2R15A 2HP4A 4QYOB 5J1TC 1Z9LA 5KSBE 3ZO0A 3CAFA 4HF5L 3FCTB 4TUJB 2HJKB 2CLVA 2EC9U 2WW8A 3MRIB 1JPSH 5D2LB 4JFDE 4PLOB 3BI9X 3BP7B 5GS2H 1I8MA 1QNZL 2VZOA 1HKLH 4IRJC 3GUTA 4FHBD 1L6ZA 2A83A 2I24N 2BVTA 5I8OL 3EOBB 4G8EB 3WO3B 4L4TA 1UCBH 3HB3C 3VMPA 2OTWA 2KUTA 2V7NB 1BVZA 1XIWD 3UZQA 5FO9A 3MRQB 4WTZA 4L4VA 1LEGA 1NH6A 2XN9D 1A2YA 4JPIA 1J8KA 4XNYL 3K2UH 3CIQA 1FL6B 3PV6B 4C83B 2FX8H 3H3PL 3PIQB 4M02A 1YEHL 2DD8H 1NC4B 4YHOH 2R1XB 3ARDC 1CGSL 5I0DA 2E7BA 5DQDH 2EICA 3JWDH 4JQXC 2F5BH 1G7MB 1FC1A 4I18C 2KH2B 3UJIH 1ITBB 1E6JH 1EFXA 4IRSD 2HT3C 2VISB 2VXUL 1IC5L 4OCNC 1S8DA 2BNQE 3BEVA 4YK4B 3DBXA 1I75A 3O3EB 3DGGB 3RQ3A 5IFJB 4M9PA 1QLFA 2LU3A 3UTSD 3IKCB 1U3HA 1CE6A 5FA4B 5T5FL 4JJ5B 2ITCA 5T3ZH 1AHWC 1GOFA 3C2AH 5MP6H 3MV7A 1MOEA 3UJJH 4P99A 1JGLH 5DJ8B 5DC9B 4DCQB 5HHMB 4QO1A 4XAWH 3LEYL 3LVEA 1MUJA 1EHXA 5F8QC 3FN0L 4NWTH 4AY0A 4XCCL 4GW4B 1NBVL 4HX1B 5E2TH 3IXAB 1G9ML 5C07B 1A6TA 4EUPH 2YSSA 1VEMA 3BT2H 5IROA 3SPVA 5B8CC 4JO2L 4X6DB 4LEXL 3TN0C 2FBJH 1KT2B 4F8QA 4J3SA 2HN7A 1OTTC 5KSUB 2IC2A 5IMLA 2DQHH 2C1OB 1MF2L 2AGJL 4X0KA 2DQFA 1SVZA 1NLDL 5LWYL 4I48B 1BF2A 5KTEH 3DMMC 1EH9A 4OLYH 5FUCC 4PJ8C 4LVOB 1MRFL 3R1GH 4CJ1A 3QXDB 2GITA 4EXPX 3VXUD 3VRJA 1JFQH 2HMIC 1XF5B 4OFYA 1KYOK 2YD6A 5ISZA 1GZQB 1DQML 3ILPB 4KQ4H 2A6JA 2X44D 3U7AA 1TFHA 1GAFL 2NY5L 4LSDA 4Y16C 5M7QA 5JIKA 4MD4A 2VWEC 2PF6A 5BO1H 4X98B 2Z8VC 1EEZA 2NY7H 1C7SA 5H94A 3H9SA 1S5HB 3I6KA 4MZ2A 1A7QL 3MQIA 4KQ3H 3BKYH 4HIXL 1MCEA 1QD0A 4D3CH 3FONB 1YNKH 4Z5RB 2VZ1A 4WW2C 5DI8A 5D1XB 4HH9B 5CZXD 4OCLC 2XA3A 4M6ML 4G8GE 2B4CL 3DI3B 2EDDA 1LP9E 2IH1B 1WFNA 2B7DT 5FYLD 4MXVE 4JHAL 1LO0H 3UJTH 4M1DH 4GLRH 2VC2H 3GK8L 2XZCH 2NXYB 2CRMA 3FOLA 3KJ6H 3V5KB 1JBJA 2DM2A 1Y6MR 2Q8AH 4M43L 4KMLB 4X6CF 2YPLD 3ARVA 1JHTB 1HSAB 3PNWA 1QKZH 3R0NA 5IIEB 4WEBL 3X17A 3LRGA 3OJ2C 4Q2ZA 3JWDC 4OCRL 5C0JB 4P46B 1YMHB 5D7JA 3L3HA 1CFVL 5E1AB 1Q0XH 1Z3GH 4HWZB 1WICA 1YC7A 4NC0B 4POZD 3WJLC 3I2CL 3VGGA 4PG2A 3VD4A 2Z93B 4X6CB 2DWDA 4U1MA 5D71L 4G6ML 1TJHL 1RZIA 5DJDA 1J0YA 1U58A 3HLAB 1J18A 4X6EB 2VE6B 1YYLH 4ZOBA 3SDDB 1TZGL 2NY0B 4PJ9A 5EU6E 4LP4A 3VA2C 1I1CA 1T1YB 3RWHB 4PGDB 5HGGS 2BSTB 2ENYA 3NFNA 3O45A 3CMOL 3DO3A 4IMLA 3E6HA 4MJ4A 4ODSL 3DVNB 3MBEC 3QIUD 4NP4H 1DQJB 4OV6F 3IXTB 4UNTA 4M5YH 3MRFA 5GGTA 3ZE2F 5DLML 5I8CA 3BYYA 1QRNA 2B2XH 1RSFA 1A1NA 1DL7L 2BY1A 4Y4HB 5C0EB 1OCWH 5F3BA 1RZKL 3FT3B 5HI4D 3TCLA 3N0PB 2PXYC 3BE1H 2HLFD 1DBJL 3NIDF 3SDXA 5SX5H 2GIYA 3RY6A 4ZS7L 1DSFL 4BQ8A 4B0MM 5LBSL 4RMRA 1N0XH 1VB9A 2BXZA 1WIOA 3PP4H 2AV1A 5T5NG 4HLZH 3V7AG 2OR7A 2GJJA 3RWCB 1D5MB 5I66B 3RFZC 1FORH 4M6NH 1BGXL 5GS0L 4WJ5B 2F19H 4JPKL 5IFHL 4GMTH 2XTJB 2WNGA 2XPGB 2W9DH 1D9KC 5HYQB 1KPVB 1FVDB 3RWIB 2FRGP 1UJ3B 3JV5A 2GAZB 3D48R 1IEAB 1C7TA 3U0PA 4YUEH 1BQSA 3ALWA 3SDCA 3WXVH 3G6DH 4NRXB 3QUMH 4XX1E 3JZ7A 5CMAA 4E41A 1IL1B 2Y07H 5BJTB 5MENE 1FDLH 3AC0A 4H20H 2ICWJ 3ARBA 3QHFL 2H2SD 1AY1H 4NRYB 4EUPG 1KPRB 3R06A 4X99A 2GCYA 1A9EB 1JCKA 3CDYA 3QDJD 3GMPA 4NFDA 3OTTA 4Z6AT 4Z7OF 3ZDXE 5SWSE 2EZ0C 4L8SA 1K8IB 5HYEA 2X7LA 5E8DH 1QZ1A 5D7LA 3ZKSD 2AJUL 3MJ8B 1LD9B 1MCCA 2LU7A 1AIFB 3TT1H 2VDQH 3PWUA 4GUPA 5DK2B 2QADB 5DMGD 4FQLH 3CFEB 2JF1A 5IR1A 3VFRA 1U8KA 1ZHNA 3VMNA 3U79A 3QEGL 3EHBD 4OSUL 4WI6A 2H26A 5DK3A 4Z0XA 3VFSB 3U6RB 3MYZA 5ADPL 1RVFL 1FO0A 3ZT7A 3BP6A 3VXSA 2IQAB 1EAPA 1NCCH 5C0CA 3RWGB 5JW3L 3TIDB 3MUGB 1P84K 5JA9A 3OAZH 4NO0D 1KPUA 5LVEA 3RDTA 4MAYA 3VFWA 1RZJL 3MFFA 1GJIA 4XB8A 1K8DA 1BOGB 4TOYL 4LGPB 1UGNA 4X7TA 1ACZA 1A7PH 2VNCA 2R56H 4X7SL 2Y25A 4JR9H 4JN2B 3STZB 5DQ9A 5AYUL 4HKBB 4M3KB 3SY0A 1FFQA 4OD3H 1RZ7H 3X3FL 2IPKA 2DQTH 4GG6E 3RJDA 1VSCA 2NNAB 2P48B 3SQOH 3CUPA 3X11A 4WO4C 2C3VA 5SX5K 5BXFA 1P7KA 2VLRB 5F6IB 3OKYA 3U30C 1HKLL 2LV4A 5FUOH 3EYFA 3MLZL 1U8QA 2ZOKA 1Q1JH 4FXLA 3WUZA 4Q0XH 3MRJB 5EIVA 1SBSH 5I1HH 5DEGB 2OBGA 4QHLB 3D85B 3IGAA 4M3JA 1JE6A 4HGKC 1S78C 4RMVA 4AT6A 3E3QC 3TNNB 3IFNH 3K1KC 5E9DE 3K2UL 5HYIA 3IDMB 4LLYA 3I9GL 2VLLB 2DLEA 2FX8L 1TDQA 3LKQB 2DD8L 2E7MA 4YHOL 4YH6A 5HHOA 5F7NC 5AZEL 4OZGB 2FEEL 1Z2KA 5IM7A 1D5XA 1KLUA 2F5BL 4WENB 4RMTA 4HAFA 1PBYA 4F15B 3UJIL 4HZLA 4BA8A 1E6JL 3P4MB 4NC1C 5I75B 5L0QC 3SJVD 1HDMB 5HTSA 4GRWB 4U1IA 1YN6A 4PJGE 5ID0A 4NNYA 3CC5A 3BRFA 4OV5B 3PQYB 2YRZA 4KRMB 4PRHE 2V6HA 3QUYC 5T3ZL 4LNRB 3C2AL 1M71B 4V2BA 5MP6L 5ESQB 4YDLC 3UJJL 3DUSB 4XNQB 2HFGH 2JB6B 4JDVB 2O61B 5E5MB 5IB5B 5GGSA 4M7ZC 3J7HA 5CS7A 4NBXB 1VKXB 4N9GA 2YR3A 5LAXB 2EEDA 2GTWA 2CDGA 4Q9CA 2ARJB 3EDJA 2J1KA 5E2TL 2BVEA 3K8LA 4J1UB 5C09E 1NCAH 4NPYA 1W0WB 3BT2L 1TZIB 4YHKH 5DD1H 1L0QA 4Z76B 4X7EC 2DQHL 2HKFL 3FQWA 3S37H 5CGMA 3OAZK 3VFVA 1GRWA 5TE7L 3JVGC 2LTQB 4QGTA 4JN1H 3SDAC 1T2QH 4N0CC 4OLYL 1PEWA 4CUCA 2UUDH 4OGAD 1UM5H 4IJ3C 4ZPTA 4M93B 4L3ED 3FQTB 1JFQL 2VSCA 3ARFA 2WWKT 1CICA 5IBUG 2WP3T 1FFPA 1KN2H 3K3QA 1AGBB 3MTRA 4DGVL 6FABH 3VJ6A 4XPGH 3RHWF 1B6UA 2UWEA 4XMPH 5BO1L 2WWMD 5I74B 1RJLA 4P4KB 2OS7A 2ZSVA 1MEXH 2VLKA 3K1DA 1E28B 5ID1B 4KQ3L 4MNQD 1EEYA 3BKYL 3VXRA 4MB3A 4GAGH 4XC3H 3QIWD 4H5SA 4D3CL 4YE4H 1YNKL 4Y2DA 3MA9H 4XMKH 1ZWIA 2WZPD 3LRSB 5JW4Q 5EWIH 1YEJH 4FRWA 4LVEA 2W0PA 4N8VG 4XVTH 5DFWH 3VXQA 4HUWA 4UQ2B 1ZS8A 1D5BA 5FUCE 5SWZA 3S4SA 1G7PB 1LO0L 3UJTL 4LF3B 4M1DL 3WIHH 1FFOA 4R0LB 2VC2L 4JZJA 5F88A 3FO2A 4RCAA 2XZCL 2VAJA 4RA0C 5D72H 3S96B 3KJ6L 3QUXA 1KTRL 3THMH 4X4XB 4G8FA 1ZMYA 2EE3A 4P5TA 2Q8AL 4HUNB 3VXPA 1GL4B 2YC1A 4U1LB 1QKZL 4MDJB 2CSPA 4P2OA 4U2YA 2VWEE 2AJ3A 3S5LB 5IB4A 5EOQH 1JYVA 5ABDE 4U33A 3MSPA 2DJ4A 1TVBA 2ITDB 4KJYA 4XBGB 1S7RA 1Q0XL 1UB5B 1Z3GL 5EDXA 2OLDA 1SMAA 1M7DB 3BGAA 5DO2D 3L5XH 4N0UE 1BD2A 1IGYB 5D7IA 3TZVB 5ESAB 1L6XA 2QTEA 1UACH 3V8CA 4JO1H 5GPRA 3TV3H 3MRPA 1MLCB 3IF1B 4WWKA 2L4OA 1NCNA 3M17B 3OPZH 5B4MC 3SGDI 4JRYB 4EVNB 5BRZA 2XWBB 4F2MB 4OLWH 2V2WB 2A6IA 3L3DB 1U3YA 4LQ1A 4GKZA 4KI1A 4PJXF 5E6IA 3MODH 2XYCA 5C3LD 1CXFA 3RVUC 1AFVH 3QNXA 4HBCH 1RURL 3O9WA 4DKEH 4NP4L 4Z7QE 1CQYA 1FL3A 1T21B 4Z7WA 4QRRE 3V6BR 4M5YL 2OTPA 1S5IH 3QDHA 1U8MA 1JI2A 4TULH 2B2XL 5HYJB 5KAQF 1F2QA 4PRNB 1W8OA 1G6RB 3HI6H 25C8H 1A6VH 1OCWL 5IBTH 3BPOC 4QRPB 4WDIB 2R9HD 1IE5A 3UTPD 1BFVH 3BE1L 4FTVD 1ND0A 3W11D 1P6FA 4G43B 1NCDL 5HPOA 5T3ZE 4HCRA 1N0XL 1X5IA 4YAQB 1K3ZA 1I1RA 3F5WB 1NEZA 5JPNA 3PP4L 3BPNC 5DC0A 2FEDC 3CMGA 4R7DB 1C5DA 1FORL 4M6NL 4NKQB 4J3UA 3AXLA 1PW3A 1J0KA 1CLZH 2F19L 2R23A 2X89A 2XKNB 3QDME 4GMTL 4R4BB 4QNPF 4J3XA 1CFSA 2W9DL 5I18L 2PETA 3X13B 1DEDA 5DMKB 2MCPH 3MUZ1 3SGKA 3ZLQC 1HYSD 2AJVH 5EULV 2YD2A 3LS4H 3BQUD 4LU5H 4YUEL 1L4IA 5EPMA 3WXVL 3G6DL 1UH3A 1GGTA 1Y0LB 3QUML 4LLWB 2GW5A 3MRDB 2W0KA 5HI3D 3KG5A 3FO9B 1BOYA 2CIIB 2VIRA 2Y07L 35C8H 5DD5H 4MJID 5JPMA 4Y5VC 1JTPA 4YZFF 1F2XK 1FDLL 4QWWD 4H20L 1JMZA 1AY1L 1M7IA 1YMMD 2ESVB 3AB0C 4K8RD 1XCQA 5I1JH 4YEEA 2RFXB 2NPLX 3MA7A 2W07A 2F54D 5E8DL 3BDYL 1TTUA 2I9LB 1GZPB 1NUDA 4F9LC 5I1AB 3TGXA 1GIGL 1S7TA 1GGCL 3TT1L 2VDQL 1EO7A 2O5YH 3CVIH 3OHXA 1NAMA 5JDJA 2EO1A 2B39A 4BH8B 3RPKA 1U2HA 3DXAE 4F57H 3OJMB 3IFOA 1WCQA 4NQCA 3D69A 4O2EA 2C7UA 1ZT1B 4NQEE 2VDOH 3IDUA 2CDFB 4PRAB 1SYSA 2DOCA 3D6GA 3D3VD 4P2RA 1NCCL 3GMQB 4ZUWB 2DI8A 5EN2B 3HE7A 4WFFD 2YUZA 4FQXA 2PW2A 2ZNWA 2ZKHH 3VI3E 4EN3B 5HYSG 5C9JB 3H9ZA 5HDBF 1A7PL 2PO6A 4TNVK 4JR9L 3GHBH 4NQDD 5J12C 4P2QA 1KB9K 4UIMA 4C4KT 3T8XA 1CXIA 2H2PD 5I17B 1P69B 4OD3L 1RZ7L 1XIWC 4Z7VE 4KRPB 5J11B 3EYOA 5DFVD 3SQOL 3I02B 4WUUD 1JZ2A 1UA6H 1QR1B 2VZTA 3AROA 5LGKA 3MV9B 3GSRA 1N0LA 4PJDA 1OPGH 2E27H 3VDAA 5FUOL 4ZFFB 2EDYA 1NCWH 4WFHE 3C9NA 4WVRA 3D25A 4H1LH 2VABA 4IRSC 3GM0A 5BW7A 4Q0XL 3IDJA 1SBSL 5I1HL 2CLVB 3JTTA 1LDSA 4N1CA 5I0ZA 3V4UH 3IFNL 4AZ8A 1I8MB 4HWUA 1X9QA 3TBVA 2DM4A 3GUTB 2A83B 1U9KA 2X4SA 5HY9B 3OQ3B 1RMFH 1M4KA 4LCUA 4L4TB 3V5DA 43C9A 4LOUD 2OTWB 1JYWA 3D0LA 2I25N 3BMWA 1NGZA 1UB6A 4PJ5D 5FO9B 4L4VB 1LEGB 4JPIB 1A2YB 1RU9H 5FYKD 2P49B 4MXWH 5DHXB 1NGPL 1JTOA 3OG4B 5GRWA 1CGUA 1WZMA 2EXWD 2CIKA 4POUB 2JCCA 5JHDA 5EU3A 1SYVA 4N8CH 2XI9A 5IP4A 5E2JA 5ALBL 3CXDL 4KPHH 2H32H 1EFXB 4KDTC 1S8DB 3P30H 3RNQA 3ZDYF 1MCWM 1UH2A 1FNEA 3BEVB 3E3QE 4KROD 4XCYA 3DBXB 3OBAA 1IBGH 1QLFB 5IEHA 3DNKA 1U3HB 1CE6B 2ITCB 4DN3H 3MV7B 4UT6H 4YHKL 2XXMB 1DVFD 3MRMA 3UP1A 3B5HA 5DD1L 1NFKA 1MNUH 3SE3A 3O2VL 7FABH 1MUJB 2F53E 3EO1A 4NC1E 4QHKI 1ZLVK 4N8PA 3HR6A 4AYFA 2DL9A 4QXWA 4JN1L 1T2QL 2CR3A 1A6TB 2YSSB 3U9PH 4J3OC 3SPVB 3QSKB 3W0WB 1EGJH 1UM5L 3K0WA 2DLIA 5ELIA 2HN7B 5IMLB 1LE9A 5CZXC 4X0KB 2DQFB 4K3DH 4JQVA 1X5HA 3TPUA 2X1PA 5ITFA 4HWBA 4AEFA 5C71A 4LVHC 6FABL 3PWPE 2NW3A 4XPGL 1P5UA 1KCSH 4RGOH 3BMVA 4JREB 2Z91B 4IIQA 2H6PA 5GISH 4ZFOL 5ICYA 2GITB 4ZUTA 3VRJB 1MEXL 2EC9T 5ISZB 3DV4A 4XC3L 5CJOH 1ZGLA 2A6JB 4YE4L 3IFLL 3Q0HA 3MA9L 4XMKL 3MRCA 4MD4B 4DTGH 5DQJA 5EWIL 1YEJL 4XVTL 3MNVA 3NZ8A 1EEZB 4N1EA 3VGHA 3VG0H 2Q7YA 3ZDZF 5H94B 1YEFH 1MY5A 3H9SB 3I6KB 4POZC 3WIHL 2BNQA 1JN6A 1I8LA 5DI8B 5D72L 3KDMA 3OV6A 3THML 5GGVY 5DJXA 4U7MA 1T5WA 1BVLA 1IAMA 4ONHA 2BK8A 4ISVA 2GQHA 1QR4A 2ADFH 3BGFC 3IDYC 1NBYB 2VLJE 2BHYA 4D0CA 1WWCA 3FOLB 1F97A 1PVHA 4GKNA 5IJKA 5CJXC 2IAMB 4EEEA 2GJ6E 3L5XL 3T65A 3QIUC 5FGCB 4HUXA 4OI9A 4BFGA 3PNWB 2X41A 1UACL 4Q2ZB 4OZHE 1ADQL 2X05A 3TV3L 3DHJA 5D7JB 1ZAGA 3L3HB 5HVGB 3TNMA 3FB6A 4Y89A 5IVXE 1JZ5A 3M07A 4V1DE 4OLWL 5HI4C 3ME0A 1KTLA 2HLFC 1YJDH 1I3VA 5CGYD 4P3WA 2DWDB 4U1MB 3HA0A 3MODL 4F7PA 1NCBH 1RZIB 1QA9A 1QQDA 4PB9H 5DJDB 1AFVL 1CGTA 1U58B 4HBCL 3AM8C 1SJEA 5F71A 5F1KC 1MJ7H 5GGQH 1DN0A 3C09B 2V5TA 5IFAH 2F8XC 2VDMH 3LH2L 5J4MA 1QSFE 4PJ9B 1TTGA 4K71C 1D5ZA 1S5IL 15C8H 1OQXA 4ONGH 3NFNB 4TULL 4LVNB 3O45B 4IMLB 3HI6L 3E6HB 25C8L 3VGDA 1A6VL 3DRTA 5IBTL 3SDXF 1D5IH 1EHLH 4TRPH 1BFVL 5I19H 1L9MA 5H2BA 3OKEA 2ZCLH 1J1XH 3VDBA 3MRFB 3U4EA 5I8CB 4UAOB 5AAWA 5C6WH 1QRNB 3FZUD 5CIPA 2AK4E 1A1NB 1UWXH 4TYUA 1MRDH 4G8GA 5F3BB 4KTYA 4BQ9A 3TCLB 2AXJA 2H2SC 5EG6C 1LP9A 5BVPL 2ICCA 3SDXB 1DBMH 1CLZL 4A2LA 1YEKH 5L8KB 2IFFH 4UZGA 3O2DA 3SEPA 4P2YA 5IK3A 5I6XB 3OX8A 5ERWA 2AV1B 2C4FU 2P46B 1V7NH 3JWOH 4LU5L 4L8BA 1QFPA 2YD3A 1JNNL 3CFIC 2GEEA 4JGMA 5DMGC 2XT1B 1WGOA 35C8L 5DD5L 5EB9A 2JTDA 3VWJA 4MGXA 3BHBA 1EXUA 3GMOA 3EHBC 2V2XA 4OLZH 1NL0L 5D8JH 1CL7H 3U0PB 3SDCB 2GFBB 1NC4D 5CMAB 4E41B 1SBBA 4XPHH 3BH8B 3RGVA 5B38A 3ARBB 3R06B 4X99B 2GCYB 5DYOA 4CVXA 3QXAA 1RK1A 1H9VA 5HHNA 2O5YL 3CVIL 3GMPB 1EUUA 4KDVA 2IBZY 3U46A 1RAMA 4I2XA 5D7LB 4HJ0D 2VDOL 3DSFH 4G6AD 1RUMH 3PWUB 4GUPB 1FGNL 5HHMD 3BKJH 1BJMA 2ZUXA 5IR1B 3VFRB 2J4WH 5D7SH 1U8KB 1ZHNB 3KJ4C 3CZFA 1CXLA 2ZKHL 4WI3A 1YJDC 4JKKA 4WV1A 2H26B 4Z0XB 1X3DA 1X5YA 5C07D 3DYOA 1CDHA 1FO0B 4Y4KD 3VXSB 1KGCD 5C0CB 1EAPB 2ZUQB 1R3JA 4BZ2H 1WAAE 2J3SA 3SQBA 4HWNA 1J86A 1KPUB 3RDTB 4MAYB 4OM1H 3VFWB 2X40A 3MFFB 3MNZB 1K8DB 2GI7A 3N9GL 2OJZH 5D6CA 3FAXA 4NC2B 4X7TB 1AQDA 3V6OC 1UA6L 3IFPA 1F8TH 1CDGA 4KKAD 5DQ9B 1NKRA 3VW3H 3SY0B 3T2QA 2CJUH 1OPGL 2E27L 3I75A 4P57A 2IPKB 1NCWL 1UWXK 3WO4C 1K2DA 5F89A 3CUPB 4LHUA 3X11B 3OR7A 2C3VB 3QZWG 4GKSA 1D6EB 1MWAB 1PG7X 1H8SA 3ARQA 4P9HH 4PYGA 1P7KB 5BXFB 3V4UL 4CDHA 4OIIH 4WHCA 4JKPL 4NM4L 5F9AC 4ZXBA 3EYFB 4PJ7E 5HYFA 1PY4A 1U8QB 2ZOKB 1J5OH 4J3TA 1RMFL 5D1XD 5E00A 1K85A 2JK5A 3W9EA 5SWSA 2YD5A 1VADA 3GSWA 3IGAB 4AT6B 4JY4A 2XN9E 3LDBC 2P5WA 4EOWH 3N1FC 1RU9L 2NR6D 3IKKA 4LLYB 4MXWL 5DRWA 1TCRA 4XNUH 5GRZA 5C0AE 2NXYD 3B6SA 1MAJA 5JORA 3NPSB 1N5AA 1MCWW 1OB1A 5IM7B 1D5XB 1KLUB 3IYLW 1RUAH 4N8CL 2W91A 1ZEAH 2D3VA 5E94A 3GI9H 4G9DA 4KPHL 1NUGA 4P46D 1IGMH 3P30L 3QT2A 4ZPVA 4U1IB 1YN6B 5HDOA 1AJ7H 5ID0B 3UTSE 4NNYB 3CC5B 4OI7A 4CU8A 2ATKA 3CFCL 4DN3L 4UT6L 5GGSY 3ULSA 3O3BA 1MNUL 4HSQA 5GGSB 5JUEH 4JANA 1MQ8A 1OW0A 3PL6A 4N9GB 4QOKA 1LO4H 2WWMC 7FABL 3QG7H 3SDDD 2GTWB 4X9BA 2NY0D 3CFDA 5GS1C 2CDGB 4GG6A 2P7TA 1JYNA 5H8DA 2EDNA 3ULUF 1MH5A 2ED7A 4NPYB 3U9PL 3EZJB 4BFEA 3QIWC 1EGJL 2F74A 3L6FA 1CVSC 2IPUK 1QSZA 3FQWB 5T1MA 3CH8A 4K3DL 3VFVB 4Z7UE 5IESH 1HHHA 5J57B 3B9KA 5GIRA 2DTMH 2LU4A 2X4QA 1YEGH 5I1KH 3MCKA 2G2RA 1A21A 1KCSL 4RGOL 4Y4HD 3VXUE 5GISL 1E4KA 2JJSA 4K8RH 4ZPTB 5E9DA 3S3PA 1KB5H 3ARFB 5CJOL 1CICB 4KKLD 3MUY1 1FFPB 1IQWL 3VJ6B 4OLVH 4DTGL 3HUJE 2UWEB 4U6XA 2WBWB 2XOTA 4TVPH 1RJLB 3GHEH 1I7UA 3VG0L 2ZSVB 1YEFL 5DO2C 2OXGA 2VLKB 2Z31A 1UT9A 4ZO9A 2I60L 2XTJD 3WNKA 1EEYB 4P9HC 3VXRB 1YPZE 1YEEH 4H5SB 4Y2DB 1ZWIB 4IRJA 3P0YH 3F62A 1AXIB 4PRHA 3VXQB 4HUWB 3ZYJA 1BQHG 1UZ6F 1ZS8B 1JZ8A 1BWMA 4M7LT 5HGHA 5SWZB 3S4SB 3EZ8A 3FL7A 1KLGA 1FFOB 2ADFL 4JZJB 2G60H 2C5DC 5F88B 4J2XA 3FO2B 3V0WH 3MOBH 1GGYA 1YN7B 3HPLA 5F9WC 3QUXB 4X6BA 3S98A 4G8FB 4P5TB 5F6HI 3VXPB 1Z0MA 2YC1B 1KELH 1MRCH 2NXZB 3LIZH 5JIIA 2VH5H 4P2OB 5IMKA 1J1OL 2AJ3B 3DSNA 3KNBA 5IB4B 3O6KL 4LLQA 3OMZA 1TVBB 4KJYB 1S7RB 3GB7A 1N7MH 1UKTA 2R9HC 3FMGH 2QADD 1BD2B 5D7IB 4YHYC 2J8UF 3W11C 4JKWA 5TPWH 3L3GA 2VO5A 1A3RH 5LXGH 4WWKB 4PB9L 1BQUA 1MIMH 3UYOD 1AGDA 1N8ZA 1I85C 2VXTH 4ENED 3IJHA 4LDEB 1MJ7L 5GGQL 5BRZB 2VDML 5DHYA 2A6IB 1TQCC 3NMEA 4LNVA 4EI5A 4GKZB 15C8L 4ONGL 4R3SA 5E6IB 1KJ2H 1FFNA 5FIEA 4LSPH 2W0FA 3QNXB 5FHAL 1CYGA 2JJTA 3BPLB 1ZSDA 4HS8H 1EHLL 3O9WB 5DFTA 4TRPL 5TDOA 1HYSC 3QWQB 4LRIA 5L7XH 5D9SA 1MCOL 5I19L 4WGWB 5KAQG 3BQUC 1FL3B 2ZCLL 1J1XL 4UNVA 4Z7WB 1AD0A 1MCNA 5T1LA 3P4LA 2FIRT 1U8MB 3HC3H 5HI3C 3ABZA 1W0VA 1OTUD 1I9JH 1MRDL 4PJAE 5EO0A 1G0DA 4LPVA 3WJJC 4J23A 4QWWC 2OK0H 1GVIA 3S36X 1ND0B 1DBML 4XAKD 1ZLSL 4K8RC 4U3HA 2IFFL 1PZ5A 3ZKXB 4Y4FA 1KCUH 3IDIB 2VLRD 4RMWA 2WINA 1A7RL 1MI5A 1TMCB 5GHWH 1NEZB 1EHNA 5CGTA 5JPNB 5DDHA 2HJLA 1SJHA 3JWOL 1HHKA 5HVFB 2A77H 1C5DB 3MUJA 2VKXA 3AXLB 4DWHA 1UEMA 1AGFA 2R23B 2BNRE 3EOTH 3D85D 1CFSB 1PAMA 2CKBH 2A9NH 3EJZD 1U8PA 5ITBH 4B5EA 3BX7C 3PV7A 2K3TA 3FJTA 4JFHD 4N0UA 4OLZL 3B9VA 4DEPB 5KVGH 4RX4D 5D8JL 1CL7L 5EPMB 1XGRA 3NABH 2VSDA 3ALXA 3BZEA 1UZ8A 4ZNCD 2VIRB 1WUNT 5JPMB 2ADIA 2CK0H 1PSKL 1M7IB 1VACA 3S8WA 1VPOH 3OKOA 5J89A 1XCQB 4LMQI 4UT7H 4OF7A 1ZKAA 3PQYD 3MA7B 1F13A 2H2PC 5D7KD 4LQFH 4JRXA 3MXVH 3WHE0 2HTLD 1RFDH 2M8XA 3DSFL 1S7TB 1RPQA 4MD5A 1RUML 3PABA 4HUMB 1WFUA 5DFVC 2FGWH 1NAMB 3OHXB 3BKJL 4EDXA 5I1LA 2J4WL 4K07A 3IFOB 5KVFH 3P9LA 4NQCB 1FNFA 3D69B 4JFFE 4O2EB 2C7UB 4HEME 4P48A 3TVMA 2EDLA 1SYSB 3BIBX 4PTTA 4P2RB 5FGBC 3WYRA 4MQ7A 4UOW1 3HE7B 2SEBA 2QQKH 3QULA 4FQXB 2PW2B 1E27A 3B2UD 2OJZL 5IVZA 2PO6B 2WM0A 4GAJL 4MCZA 4PJDF 4URTB 4P2QB 4EUPA 4G8IA 4UIMB 3WNNA 3VW3L 3T8XB 3T2PA 5KSVA 2CJUL 3T0EA 1HK6A 4LOUC 1SQ2N 3V95A 12E8H 4LCWA 3EYOB 4W4OC 2N1KA 5F21B 4P4KD 4O58H 4NQUA 3GSRB 2EXWC 4KKNA 5MHSD 4PJDB 4OIIL 3QWRA 1NANI 1OAUH 1VERA 3OKNA 5TDNA 1QFUH 4C54A 3C9NB 3KYKL 3D25B 4ZS6D 1CFTA 3QH3A 2VABB 1G1YA 2NY3B 3IDJB 2VDKH 4JHBA 3RGHA 3JTTB 2P44B 4KROC 5DUPH 4NN5B 2FX9L 3I6GA 2JJVA 2Z35A 3RVTD 3GSXA 3TBVB 4EOWL 3OG6B 2R39A 4K3GA 4XNUL 4PJFA 2CXGA 3HNTH 2X4SB 1K6QL 2JCCF 3T0DA 1DVFC 4LCUB 1KBGH 3ORJA 3V5DB 43C9B 4MHHI 1LO2L 2XWTA 3MRNA 3D0LB 1P53A 1RUAL 1UB6B 5GZND 4NQEA 1ZEAL 5FB8B 4RAVA 5AEAA 5D6DC 3GI9L 5JDSA 3SJVE 1SJVA 4P2CG 2H9GB 3WUWG 1OAYH 4TNWK 1IGML 4WCYH 1AJ7L 2CIKB 2JCCB 5E4EB 5JHDB 4TTDD 5EU3B 1SYVB 3TZVD 4HKZA 2BMKA 1NC2A 2FH6A 3NIGE 4C55A 1JMXA 5GRVL 4JRYD 1XR8A 3RNQB 5JUEL 3RX8A 1FNEB 2ED8A 4XCYB 1J05A 1LO4L 1O5DT 3QG7L 3PE9A 2BSRA 5IEHB 1RUQH 5I1DA 2JELH 2PNDA 2HWZH 1G7QA 3MRMB 3U0TA 3PHOA 3QCUH 1OAQH 3TT3H 3IAQA 4GKOA 4WHTA 4QTIH 3WNMA 4ZTPH 5TJWK 3EO1B 3HZMA 5IESL 4NJAH 1T4KA 2LABA 4HJJH 2DTML 5HYJD 5I1KL 1AKJA 3RIFK 1F58H 3QXTA 2GK0A 4UBDD 3K46A 2E7CA 1FIGH 3KYNA 4QRPD 4K8RL 1AC0A 1RJZA 5EBWA 1GHFH 2P5EE 1IEHA 2O5XH 1LE9B 4NN6B 3D0VA 3NA9H 4JPWH 2OI9B 3TPUB 3QEUA 5LJYH 3MO1A 5ITFB 3CVHH 3QI9A 2NW3B 5A3ID 4OLVL 5JOPD 5JOEA 1B4JH 4PGJA 3MXWL 4TVPL 4IIQB 3DPBA 4MYWB 2H6PB 5ICYB 3IS1X 3GHEL 4ZUTB 2D7QA 4BFIA 2LE9A 3KXFA 4MNQE 4Q74A 3TJEH 4EIGB 2QSCL 1I1AA 3DV4B 1U42A 4JFPA 4UNUA 2OL3H 3PP3K 1NUNB 1ZGLB 1YEEL 4KY1H 1WLHA 3GI8H 3MRCB 4QCIA 1KIRA 4KV5F 3P0YL 5DQJB 3MBXH 4X4YA 4JFEB 2C1PA 3MNVB 3NZ8B 2IPTH 5IT2H 4OCSH 2Q7YB 5HDQH 1MCSA 4Q9QH 1DANU 2QLVB 4NO2A 3WXWH 4LGSB 1WBYA 2BNQB 4WFED 2G60L 1JN6B 5CGYC 5HGDA 3V0WL 3MOBL 3UBXG 5I15H 3KDMB 3P0VH 1E4XI 2ESVD 4F7TA 1ZVSA 1OARH 2DKUA 5DJXB 1FE8H 1IKNC 1T5WB 5DEZA 1MRCL 3LIZL 4ONHB 4ISVB 1A22B 2VH5L 4M7JH 1EDQA 1VFBB 1JGDA 4Q6IA 1ZLUH 1JVKA 4NQVA 1EK3A 3QUMA 1DBAL 2EH8H 4CVWA 4D0CB 2E3VA 2VDRH 1V3JA 4GKNB 4OLUH 3FMGL 3T65B 5FHBH 4HUXB 3DVGA 1QTYT 5E8OA 1KULA 5TPWL 1A3RL 5F8RC 5I73B 2FCBA 1MIML 4H88L 4R97B 3QWOA 3FZUC 2VXTL 2Q1EA 3TNMB 3FB6B 3WS3A 1T7VA 5F7DA 1KTLB 4YXKL 3B9EA 1A6WH 4QHMA 4N8VA 4QGYA 1KJ2L 4F7PB 3OGCA 2XY1A 1QA9B 1QQDB 1DQDH 4LSPL 4U49A 3ZSTA 4EN3D 3F7QA 4HS8L 1SJEB 3CX2A 3Q6FA 1DN0B 5L7XL 1CGVA 5ETUA 4YR6A 4NUJA 1T83A 4M6OH 4HK3N 5BMFH 1W2KT 3LD8B 4CU7A 3HC3L 4X9FA 2JB5H 3KPSA 4Q6YA 4P9MH 3VFUA 5J1SC 1I9JL 4KRPD 1LP9F 3DRTB 4KGLA 3UTPE 3MOQA 4MXVF 2OK0L 4FTVE 2CO7B 2A73A 4NNPH 3QQ3A 5EUKA 5H2BB 5LCVH 1U8OA 3OKEB 2P42B 3B9AA 4HFUL 1KCUL 3MV9D 3EKCA 3U4EB 3T0BA 3WN5A 4OLXL 5CIPB 3GIVA 4KTEH 3EYVA 2IANA 2P8LA 2ARWA 4G8GB 1H3GA 3WIFA 1LP9B 1S7VA 2R2EA 1MHPL 1VESA 4YHLH 1G1CA 4BUHA 4YK4C 3EOTL 4OM0H 1TXKA 2E7HA 5CSBA 5IK3B 2CKBL 3B5GA 2VLJA 3ZHDA 4FABH 2EDJA 3OX8B 5ERWB 2A9NL 5ITBL 2FO4A 4U0QB 2EEAA 4HDIA 5KVGL 4HJ0C 4L8BB 3SCMA 3VGEA 4FQPA 4G6AC 3NABL 4L4TD 5E2WH 3Q1SH 2CMRL 3RUGA 4L4VD 5INDB 5B3JE 5IVXA 3VWJB 4V1DA 2CK0L 3BHBB 1EXUB 3GMOB 5HHQA 2V2XB 1KUMA 4YHPA 1WIUA 2ITDA 2XZQL 1VPOL 1FYHB 4UT7L 3FN3A 2F54E 4NKMA 4LQFL 5FM5M 3RGVB 5B38B 1FRGH 3MXVL 1RFDL 1EFXD 1YEIH 1T0PB 5DYOB 4CVXB 3QXAB 1CF8H 2UV3A 1RK1B 5HHNB 4PBWD 2FGWL 4FQQA 4LVOC 5DVKA 1XR9A 3WHE1 4R4ND 3U46B 4KKAC 5KVFL 1U3HD 3H7LA 2QR0A 4I2XB 4GS7B 3D3VE 3HHRB 1Q9LA 3MV7D 5GZOD 5C0IA 2GKIA 5F1SA 5F1IA 3BZ4A 2EE9A 3UPCA 4WFFE 2BC4A 1NFDE 3CLEH 4HKXA 3CZFB 1LO5A 1Q94A 5JHLH 4WV1B 1AO7A 3VGBA 3HNVH 4NQDE 4ZAKA 3W0WD 1PKQA 5IOPA 1R3JB 5D1XC 3GSOA 5CEXA 5GRUL 4Y5XA 3TFKD 1CDUA 5C92A 5JNYA 2Y72A 1FJ1A 1G9EA 5EU4A 4WUUE 2NR6C 5D6CB 2N4IA 1AQDB 3IFPB 4K94H 4R7NA 3FB8A 4RSVA 2UZIH 1SEBA 5EOCJ 2NXYC 4O58L 1KEGH 4X7DC 4O9HH 4OFYD 3EYSH 2Z8SA 1OAUL 3RWJA 3I75B 4L3CA 4P57B 3VGAB 5ISZD 5E7FA 1QFUL 5EUOE 3P3YA 4M4PA 3UTOA 1K2DB 4GBXA 5F89B 2C4FT 2Z9TA 4Q7DA 4LHUB 3ZDXF 5JTWA 2RHEA 3OR7B 4P46C 1AE6H 4GKSB 5FYJU 1HEZA 5I8EA 1I9IH 5DUPL 4BFBD 1PYWA 4PBVC 5F70A 2XA8H 3A6BH 3H9SD 3GBLA 4ZFOA 3V6ZA 1FPTH 4RNRB 2GTZA 4ZXBB 3HTLX 1WZ1H 2HT4D 5CAYB 4PY8I 1L7TL 3HNTL 5FUZH 1FBIH 1MFDL 2VR9A 5E00B 5HYSA 2JK5B 3UTZA 1KBGL 5SWSB 4XNXL 3TO4A 3W9EB 2O93L 1KCRH 1VADB 3GSWB 4PJ5E 1HH9B 4JY4B 3TWCH 4C57C 3SDDC 3DX7A 2P5WB 3VXMA 2MPAL 2NY0C 2LFGA 5IKCA 4PLKD 1OAYL 5DRWB 2CLRB 3RI5F 1TCRB 4LLUA 4WCYL 5FEBA 1F6FB 3WIHA 3B6SB 2IAMD 1CQKA 4Z95H 5JORB 1OSZA 3PXHA 3CX5J 1N5AB 3VFMA 1OB1B 1RUKL 4GW5A 4XWOD 4L9LA 3UBXI 1VFUA 3LKOA 3RWFA 5E94B 3G5YA 4G9DB 1OOAA 3BUYA 4Y0GA 5DVLA 3T4AA 5JXAH 3L9RA 4I9WD 4ZPVB 5D7JD 3VI4E 5A2IH 1BECA 1WAAA 4HUUA 4Y4HC 4HD9A 1F90H 4GG6F 1Z6JT 4LSTH 1RUQL 2ZUTA 2ATKB 2JELL 4OFVA 2HWZL 3ZL4H 4WU5A 5IHZA 3QCUL 4KKLC 1OAQL 3TT3L 3ULSB 3O3BB 4CDGC 4C59B 2R0WH 4JANB 1V5JA 1ADQA 3PL6B 4QTIL 4QOKB 4ZTPL 1PX4A 3CFDB 4PJ9D 5I1IL 4NJAL 4TPRH 4GG6B 2P7TB 2FR4A 1HXYA 4JEGB 2WWKO 2XTJC 5IEKA 1MH5B 2WP3O 4EIZC 1F58L 1A7OH 3VFTA 4AENA 5LKNA 5EU7C 1KTKE 2D4DA 1FIGL 2YPKA 2LVCA 5DRZA 3L6FB 4U6TA 1UJ3C 1GHFL 3RBGA 5AD0A 2O5XL 3NA9L 4RQQA 4JPWL 5T1MB 3SE4A 1HHHB 3W2DH 3B9KB 3HB3D 2K7PA 1QRND 1CLOH 1T6WA 3CVHL 5GIRB 2X4QB 4M5ZH 1QYGL 1B4JL 3MCKB 2G2RB 5AUMA 1CD9B 4HWEL 1C5BL 3QO1B 4GRWH 5DS8A 4XNMA 5K33A 1HNFA 3DURA 2AK1L 5E9DB 4K94C 3SGJC 5K9QI 3TJEL 4YHNA 4RZCA 4B41A 2OL3L 4U31A 1BZ7A 5A2KH 4PJGF 4EI6A 4KY1L 4M1GL 5C0AA 3GI8L 3IB4A 3QRGH 4NWUH 4U7KA 1YNTA 3MBXL 4QXGH 4U6XB 1T80A 5JR1H 3ZYZA 4HC1H 3GRWA 2IPTL 5IT2L 1I7UB 4OCSL 4ONOA 4U7SA 5E0QA 2Z31B 3WXWL 2QADC 4S0TD 4DOHE 1UVQA 1A7NH 3VE0A 5I15L 2EH7H 2EKSA 3MGTA 1DQQA 1JPFB 3WCYA 3P0VL 4ENEC 5EIQA 1OARL 4PRHB 4LLVA 3SDCD 1PG7H 1FE8L 1FZJA 4GT7A 3MUHL 4M7JL 5HGHB 4ODVH 4KUZH 4E41D 1KLGB 2D03L 1KENH 2BJML 3C8DA 2J5LB 2EH8L 3F58H 2WQRA 3ARBD 2VDRL 3HPLB 4ORGA 5J06A 4X6BB 1RZGB 2BHZA 4OLUL 1IAKA 2BERA 4MCYA 5FHBL 2WBJA 4F9PA 1S9VA 4WRLA 3TA3A 1J10A 3WS6C 5IMKB 3DX6A 2B0SH 1ZTXH 2YXMA 5EOTA 3KNBB 4YJZL 1ZA3A 1EO8H 1P1ZA 4LLQB 2YUXA 3O6FA 5D7LD 2J12B 1OTUC 4I0PA 4MJ6A 3GB7B 3IT8D 1P7QA 1OWRM 5DJ6A 5EC1A 2Q3AA 5KS9E 1A6WL 3PHSA 1INEH 4I0KA 3L3GB 2E9WA 2DIJA 2FLRT 1DQDL 5F6IC 1JWMA 1AGDB 1N8ZB 4M48H 3MRHA 3IJHB 4R4FH 3WHXA 1HHJA 4LAQL 3RNKA 5A16A 4NM8H 5DHYB 3VXSD 2Y6SD 1MPAH 4IDLA 5C0CD 1I3RA 4EI5B 4M6OL 3GO1H 4F7EA 2YD7A 1DDHA 2JB5L 4R3SB 1FFNB 4MAYD 3RDTD 4P9ML 2FL5A 1G6VK 2XACC 2W0FB 4FFVD 5GGRY 3EJZC 3KAAA 3NCEB 4XMLH 1MHEA 3FTGA 3FN9A 5TDOB 5D9SB 1DZBA 3FHQA 5LCVL 4OZIE 4BSWA 1TNMA 1YPZA 1AD0B 1T03H 5T1LB 4QRQA 1W0VB 2DLGA 2APWA 1UG9A 4KTEL 3LDBB 4HW6A 3LKSA 5EO0B 5AWNL 4F15C 5I75C 4YHLL 1CT8A 1PZ5B 3B83A 4AQ1B 4OM0L 4ACPA 1IGIH 4FABL 2WINB 1MI5B 3BUTA 2KQMA 5DDHB 2HJLB 3V2AR 3VFPA 5FFLA 1DTUA 1SJHB 1HHKB 2HTLC 3O0RH 1AGFB 5E2WL 4YXHH 5ALCH 1F4XH 3Q1SL 4ZQKA 3GIZL 1U8PB 2DIBA 4N0UB 3W82A 4X83A 3M1BA 1XGRB 1ACYL 5EORL 3NIFE 3BZEB 3Q3GA 1UZ8B 4Z7QF 5C0BA 2W60A 1H0DA 1FRGL 1HIMH 4I3RH 4HHAA 2ADIB 1G6RH 5T5NF 1YEIL 2LTQC 3ZTJH 3TF7C 4OKVA 1VACB 1CF8L 1R3LA 3OKOB 3SO5A 4KK9D 4ZG1A 1JF6A 2KDGA 4YBQD 3HN3A 4M93C 4D0DA 3EAKA 3IAPA 5E03A 5GRYA 4JRXB 4MD5B 2R2CA 4PRIA 2ZUSA 1HI6A 3PABB 5HHME 3STBA 5LQBH 3UTQA 2H32A 1VA9A 4EDXB 3RKDD 1WITA 5I74C 5JQ6H 4P4KC 5FA3A 4C4KO 1QBAA 3WE6A 3P9LB 5C07E 4RFNB 1SY6H 5JHLL 3HNVL 4X6DE 5DK0A 1KGCE 3TVMB 3LB6D 5EH1A 4ZS6C 4PTTB 1JNJA 4MQ7B 4NNXA 5HGAA 3RHWK 1H3TA 2SEBB 3QULB 2D7NA 1E27B 4NZTL 4OF5A 1JWSA 2R0LH 4ZD3H 3QIBA 5IVZB 3RVTC 4PLJD 1F5WA 4R0LC 2BNRA 2Z92A 1FZKA 4MCZB 5E08H 2UZIL 3QJFA 3S6CA 3B9DA 4EUPB 4G8IB 4N5ED 1KEGL 4NZJA 4O9HL 5KSVB 3EYSL 3T0EB 5JMRA 2NYYD 3ARFD 3ARRA 1CICD 4DKAA 3GSUA 5GZNC 5HD8D 4LCWB 1KB9J 4RBPH 4NO5A 2BSSA 1UJTA 5T3XL 5JW4M 1I9IL 4FQHA 1AD9A 2XA8L 3BD4A 3A6BL 4K7FA 2VLKD 3DUUA 4JRWA 3OKNB 4TTDC 4PJFF 5TDNB 3TZVC 3VXRD 1FPTL 4ZODA 4Y2DD 5FUZL 3WD5L 1CFTB 3QH3B 4U2ZA 4MSWA 5DEFB 1FBIL 4HH8A 3S36H 1F4YH 3VXOA 1PZUB 1INQA 4F33A 1KCRL 3U36A 3O4LE 5GJSH 3IJYA 1UM6H 3V7MA 3FB5A 3I6GB 5SWZD 2Z35B 3GSXB 3I50L 4PJFB 3QUXD 3B8YA 3FOMA 4YO0A 4Z95L 4P5TD 3AS0A 4RMQA 3D39A 2XWTB 3MRNB 4JFFA 4PGBA 2NXZD 4NQEB 5TGBA 4P2OD 4RAVB 5CLWA 2D7OA 5JDSB 2W9EH 2VOTA 3HAEG 4XXCC 2ZG3A 2CXKA 1IEBA 2QEJA 3BAEH 4ZSOA 1X44A 4Z7VF 4UBDC 1F90L 4LSTL 1BD2D 3BFOA 4HKZB 1VCAA 2BMKB 1NC2B 3QZWA 4MA3A 2DJUA 4WWKD 2WUBH 3ULVH 4KJPD 1XR8B 2R0WL 5BS0E 3DIFA 5BRZD 4ODTH 1J05B 2BSRB 1YDPA 4RRPA 2F8VA 5HVHB 3RZWA 5MERA 2AAVA 3AAZA 4LCYA 4TPRL 4LSVH 5I1DB 4U05A 5E6ID 1G7QB 1A7OL 4MNGA 1LDPH 2JJWA 2WK2A 3U0TB 3PHOB 4ZO6A 4JG1H 4HXBH 2VDNH 3BP5A 3O9WD 4WHTB 2EDBA 3SBWC 2RJMA 5BQ7A 2MQ3A 3UO1H 3OF6A 3HZMB 5D96B 1ZHBA 4FQCH 4UILH 3W2DL 4IDJH 5JOFA 1T4KB 4CN1A 4TVSa 1CLOL 4M5ZL 2FJFA 4YBLB 1AKJB 2VZVA 3EOYG 2GK0B 3KYNB 3C08H 1NBQA 1RJZB 1T7XA 5EBWB 4KHXH 3VFNA 3D0VB 3BD5A 3KHOA 1CG9A 5DZNA 4ZTOH 3QEUB 3MO1B 2WUCH 3AU1A 1QBML 3HZKA 5GSRA 2ZUUA 1CXHA 3MX0A 3QI9B 3QRGL 4RBPK 1CU4H 4GH7B 4QXGL 4W70A 4TN9A 5JR1L 3ZTJG 1MAKA 4HC1L 2Q86A 1SEQH 2NY2B 2XTJE 4BFIB 3KXFB 2X09A 2X89D 1G7IA 5FF6A 4R96A 1I1AB 4JCMA 4JFPB 1A7NL 5EU7E 2JJUA 3MGAA 2HFTA 1XAUA 2DWEA 2EH7L 3O3AA 1A02N 1R5IA 4QCIB 1KIRB 2DQGH 2V5MA 4JM4H 4X4YB 5E99H 2C1PB 1MHHA 1IAOA 4GSDH 1EZVY 2BOCA 4ODVL 4KUZL 4NO2B 2DKMA 1H5BA 4XP5H 1GOGA 1WBYB 5F9OH 2FNBA 2AEPL 2YPVL 4GXUN 5HGDB 1HQRA 1NEUA 3F58L 4XP9H 4EN3C 1UM4H 4EXKA 4F7TB 1ZVSB 3AREA 3MLUH 3RY4A 1ORQA 1U41A 3ZE0E 4LKXA 1CD8A 4ETYA 4BZYA 4V2CB 1JGDB 4Q6IB 4JFQA 2B0SL 4NQVB 1V3LA 1ZTXL 3QUMB 1EO8L 1BBDH 2IQ9H 4JO3H 2J7LA 4RIRB 3VRIA 4LSSH 1WWAX 4KRPC 2FX7H 5J11C 2IBBA 5DA0B 3LOWA 2IEPA 3DVGB 1O7SA 3E0GA 5E8OB 1FFRA 3EBAA 3EOAA 4NQCD 1CDBA 1DBKH 1PJ9A 3QWOB 5IMMB 2YEZA 4R4FL 2P5EA 5M94B 4HKJA 4J4PA 1IAIM 5HVWA 4KMQA 1DUYA 3WS3B 4NM8L 4P2RD 4XP4H 2MSPA 2YUVA 5BZDA 5F7DB 4B53A 3HE7D 3GO1L 4G9FA 1MCLA 4QHMB 4N8VB 4TSCH 3U4BH 1VGKA 4FQXD 3MCLH 5F9DC 3OGCB 1BQHA 2HA1A 2EIZA 5L9DH 4OIAA 3MJ6A 4TUKH 1I7RA 2Y4SA 2C3HA 4WFGD 3Q6FB 4DFHA 5FOJA 1I8IA 4O51A 5ETUB 2PO6D 4YR6B 3ARWA 2Q87A 4H0HB 4PD4J 4NUJB 2X4TA 4P2QD 1T03L 3MPCA 4HGWA 3KPSB 4YLQT 3S3JA 4KI5E 3VFUB 2BFVH 3ZZ1A 4RWYH 1H3PH 4XAKE 4WWID 2A73B 3WFCL 4BH7A 3QQ3B 5HGBA 5EUKB 1NDMA 2D31A 1U8OB 2VLRE 1FC2D 3QO0A 4P5KA 3U0WL 1YEDA 2XZZA 3HZVA 3WN5B 1AI1H 3GIVB 3VD7A 4DZBA 3GEWB 3EYVB 3SN6N 2IANB 2P8LB 5F96H 3O6LL 4JDZA 3WIFB 4D8PA 1JRHH 2NY3D 1S7VB 3ARSA 2R2EB 3O0RL 1HWHB 4BM7A 4JAMA 4YXHL 3LN5A 3REWA 1F4XL 3RUGF 5ANME 1EHAA 5IVXF 5H35A 4PJXA 2VLJB 2ORBH 1DANT 4R4NC 1KJ3H 4JFHE 2FO4B 4EQ2A 1U3HC 3FAWA 1ZVHA 4HDIB 3ZHLA 3SCMB 1WSST 1OAKH 5GZOC 4OZGE 4ZNEA 1KTDA 1AXSA 1FN4A 3HG1A 3RKPA 4KXZI 2NLJA 3ZMRA 5DJAA 3RUGB 4CW1A 4KUCF 1I4FA 4I3RL 4QXUH 4V1DB 4GRWE 2AJSH 5HHQB 1OY3B 4YHPB 1X5JA 3BW9A 1AGEA 1KACB 4KK8D 4LMQE 5IROC 3AMKA 3K80A 3PQYE 1NGYA 2GSGA 2ADGA 5JHDD 4X7CC 5C0RH 4CVZA 4O5LL 5GGTH 3ARTA 4NKMB 3TFKC 2G9HA 1OAZH 2NZ9D 1FSKB 2MMXA 1S3KH 5E5UB 3SGEI 5LGJA 4ETQA 3NN8A 5LQBL 1OTSD 4FQQB 1U6AH 4YHIA 4JREC 1XR9B 1J0JA 5JQ6L 1IT9H 2QR0B 1SY6L 3VWKA 1Q9LB 5C0IB 4HIJA 1NMCB 1MFAL 5F1IB 3BZ4B 2BC4B 2YS4A 4HKXB 2XZAH 2FJGA 1CCZA 2FJHA 5EA0H 3WDIA 1LO5B 1Q94B 2UYLA 3BH9A 5SX4H 2R0LL 4ZD3L 4XGZA 1AO7B 1OLZA 1F6LL 4FFZH 4EQ3A 5A1AA 4X5WA 1UWEH 2HT4C 2X70A 4ZAKB 5E08L 1PKQB 2VXSL 1KC5H 3VCLA 5IOPB 4XX1G 1BIIA 1G7LA 4QRTA 3GSOB 5CEXB 4NSKA 4FMKA 4Y5XB 2CUIA 4DVBA 4UDUA 1CBVL 5JNYB 3BISA 5F7WC 1FJ1B 5EU4B 1XGYH 3GSVA 5CD5D 2BZDA 4PLKC 3EFDH 3QDAA 4YQXH 4R7NB 3FB8B 5EZOH 1SEBB 5MHSE 1MVUA 1CIUA 1ROWA 2IAMC 2R1YA 2YUWA 3RWJB 4L3CB 3P11L 4DN4H 3MNWA 2W59A 4XWOC 4P23A 3PF2A 4IRZH 3AVEA 2QKIA 4Q9BA 1RJYA 4GBXB 4KJWD 1IAII 3S36L 1HEZB 4JFED 3EFFA 5D7JC 5I8EB 4RWHA 1PYWB 2RAMA 5GJSL 3ARYA 1UM6L 1AR1D 4U1SA 4ZFOB 1DFBH 3V6ZB 3W9DA 2X2YA 5DWUH 2BNQD 4PG2C 1P4BH 3T3ME 1CXKA 5C6TH 5E8EA 5C7XH 1DLFH 4Z8FL 5HYSB 1FO0H 1OGAB 5CWSA 3UTZB 3TO4B 4K3HA 3L7FA 3C09C 1V3MA 4ODWA 3DX7B 3VXMB 3RZCA 4PJ9C 3QHTC 2W9EL 4AEEA 5CJBA 3QEQA 2QJDA 1WAAF 5IKCB 1KLFA 3ESUF 5IBLD 2H3NA 4LLUB 4LVNC 4QT5A 1NFDA 3BAEL 2DMCA 1J0ZA 2BDNH 1OSZB 4P4RA 3VFMB 3T2NH 1FNSH 4GW5B 3NTCH 4L9LB 3LKOB 3RWFB 3G5YB 1BJ1J 3BUYB 3T4AB 4F58H 2YZ8A 2WUBL 3ULVL 3L9RB 3B4NA 4UAOC 4HUVA 1HILA 4JB9H 4XI5D 4HUUB 1LE5A 4ODTL 2O5ZH 2CGRH 4AIOA 1MWAH 4CADA 5ESVA 4LSVL 5HI5D 4YHZH 3RY6C 1U3JA 3HPJA 3LKNA 5D70H 5FGRA 4OZ4A 4WU5B 5IHZB 1LDPL 3C8HA 5I6XC 4JG1L 4HXBL 1U0QA 2VDNL 3M8OL 3SE9H 3W81A 3V9FA 3GFUA 4TNVF 5C0FA 3FO1A 1ES0A 4FQCL 4UILL 2FR4B 4IDJL 1HXYB 2H1PL 5HYJE 3H3BC 5IEKB 3O8XA 5I9QB 4QRPE 3VFTB 1A64A 4AENB 2ICEA 4E42A 2YPKB 3C08L 2AI0L 5DRZB 1KJ2A 1LQSR 3WUWA 5AD0B 3BDBA 3NOIA 2D0GA 4RQQB 3WIIL 3SDCC 2XXCB 5DUML 4ZTOL 2WUCL 4MB5A 5I8KH 4MMXC 5JOPE 1EX0A 2NZIA 1SHMA 1T89A 3TP4A 4Z7NE 4CMMA 1L0XA 1T2XA 1LILA 3DYPA 4BKLA 5AUMB 4G8GD 3ARBC 4XNMB 3DURB 4WY7H 2D9CA 1SEQL 3P40A 5CUSH 1XF2A 4YHNB 1F3JA 1T04A 4MLIA 4RZCB 1NSNH 3UPAA 1BZ7B 4EI6B 2EECA 2PR4H 5C0AB 1QPPA 3PGDA 2XFXA 2DKSA 1YNTB 5C6PB 2DQEH 4JM4L 1L7IH 3TBSA 5KZCB 4LEOB 2X1OA 4OLEA 3L5JA 3EJYD 1NMBL 4K7PX 4GSDL 3QR2A 4WFEE 5GRJH 2VMFA 1UVQB 4XP5L 3VE0B 5F9OL 3E8UH 2EKSB 3MGTB 3VWJD 4XP9L 1DQQB 2YBRA 1QFWH 5FM4A 2AQ3A 2ESVE 1UM4L 1QRKA 2X5PA 3MFGB 4LLVB 4RGNE 1FZJB 2D9QB 2Y6SC 3MV8A 2ZUQC 3E1F1 3GSNL 2BY3A 4NUGH 1BBDL 2IQ9L 4JO3L 3RGVD 4YZFE 4Z7UF 4MAYC 3RDTC 4ORGB 3D87B 4LSSL 1K5NA 2DM3A 2FX7L 4FFVC 1IAKB 3VDCA 5T1DH 4MCYB 2WBJB 4IOFD 1S9VB 3KLHD 3TA3B 3DX6B 2IGFH 5EOTB 3ROOA 1ZA3B 1DBKL 4ODUA 1P1ZB 3O6FB 4I0PB 4MJ6B 3CDCA 4XP4L 1IVLA 4JVPA 1P7QB 5DJ6B 1CE1H 1F4AA 2Q76A 5CILH 5EC1B 5CZVH 4TSCL 3U4BL 5D2NA 4F7MA 1MHCA 2H8PA 1UFUA 1JWMB 5L9DL 4TUKL 3FT2A 1SMOA 3MRHB 3WHXB 1HHJB 1YPZF 4KC3B 1KXVC 3RNKB 5A16B 5AG9A 32C2B 1IM3A 1WTLA 4PP2A 3TH4T 3UBXA 1I3RB 1S7XA 1W72H 1J0HA 1DDHB 5I1CL 2BFVL 2FL5B 2FZ3A 4RWYL 1H3PL 1MHEB 3MLSL 3FTGB 3P77A 2FB4H 1AGCA 1UEYA 3TEUA 4BSWB 3JXAA 1YPZB 3KPMA 1T7ZA 1R5WA 5IW1A 1BEYL 3QNZA 3NPSC 3R8QA 5D5ME 1AI1L 2IH3A 4QRQB 3ULVE 4ERSL 4KJQD 4O4YH 5F7KC 3DO7A 1QBBA 3LKSB 4MQXD 5F96L 1A4KA 1TITA 4LHUD 1JRHL 4XC1H 2P43B 5KG9A 5C86A 4KKBD 3MLYH 5KW9H 1CT8B 1OP3K 5EO1A 2GK2A 4KK9C 2ORBL 1NCUA 4YBQC 4IOIA 1KJ3L 4XBPA 4ZXBD 3VFPB 2AV7A 3FQUA 5GSVA 3RL2A 4L4TE 1OAKL 3SKUD 3H9YA 3DV6A 5SWSD 3L5IA 4XP6L 1C1EL 2AVGA 4JGJA 4ZQKB 3RKDC 3CK0H 3LZFH 4JG0H 2P5WD 1FV1A 4QXUL 4XZUA 4YC2B 1WJ3A 4PJEA 2AJSL 1FH5H 4M7LH 3VH8G 1OGTA 3M1BB 3QBTB 3P9MA 5KS9A 3LB6C 1CD0A 3T77A 1BWWA 4U6HA 3Q3GB 5C0RL 3UTTE 4Z77A 5C0BB 2W60B 1H0DB 4MS8D 4HHAB 4JFYA 1OAZL 5KVMC 4JQIL 1S3KL 4OKVB 4DQOH 1R3LB 4PLJC 1U6AL 2YK1H 3OWEA 4PJAF 4DVRH 3RBSA 2J88L 4D0DB 1IT9L 4N5EC 3AFLA 2NYYC 2V9RA 1WV7T 3ARFC 5FAAA 3FKUS 5CHNA 1CICC 5IVNA 2P45B 5HD8C 2P4AB 4PRIB 1HI6B 3KHQA 3PL6D 4X4MA 2YA2A 4G6KL 3UTQB 2H32B 4QOKD 2XTLA 2XZAL 2FIKA 1X6NA 5FA3B 3WE6B 5DD3H 2D7PA 5EU5A 1T1ZA 5CP7A 2VERN 3W0WE 5DK0B 1MFBH 1UWEL 5L2JA 4Y2DC 1C08A 1CDCA 5AZ2H 1KC5L 3O41A 4NNXB 5HGAB 3AS3A 1ZV5A 2AABH 5JIHA 1KV3A 5TFSL 1PX3A 3S3SA 3B9KD 4B50A 1JWSB 1F42A 2VR5A 3QIBB 4JFXA 2AXGA 1XGYL 5BCAA 4JZJC 1WBXA 2BNRB 2Z92B 3KLAA 1EA9C 3WDJA 3EFDL 4YQXL 5CJQH 1FZKB 1OL0A 1EEUA 5EZOL 3QJFB 3QUXC 5E9DD 3UROR 2NY1B 3H2WA 3L3OA 4P5TC 2DDQL 3C60A 3EDKA 4KTDH 4DN4L 2NXZC 1NQBA 3GSUB 4P2OC 4PJHA 4IRZL 5IHUH 1YY9D 3HE6A 3T3PE 4NO5B 2BSSB 3QCVH 3QFJA 4FQHB 4NFCA 5CKAA 3CVHA 3U83A 1AD9B 1JF1A 1NAMH 3K81A 4K7FB 3DUUB 2Z31D 3NH7L 1DFBL 5HPMA 5DWUL 1P4BL 4PJBA 1KFAH 4QRUA 5C6TL 5C7XL 1DLFL 5J13B 4MSWB 4WWKC 2OL3A 1QO3A 1FO0L 4KJPC 3VXOB 1M7XA 1INQB 4H0GA 2XWJA 4PRHD 4F33B 3U36B 3PDGA 3IJYB 3MZTA 4WTXA 3VFGH 3FB5B 3OAUH 5ACMA 4LSRH 5GS0D 4LRNH 3BOVA 4UIKH 1S9KC 5E6IC 1JPSL 4OQTH 3BPCA 2R2HA 4Q9RH 1U8JA 1L0YA 2BDNL 3ARXA 4KGJA 2JE8A 3BPLC 4YO0B 5FGCE 3O9WC 3D39B 5HHVH 3T2NL 1FNSL 4JFFB 4XCEA 1S7WA 3CXHJ 4Y4KA 2HVKA 4F58L 4I9WE 1UCBL 4P5MA 4JB9L 1IEBB 4E5XA 4QHKJ 4ZSOB 1G9NH 2X9XA 2CGRL 1MWAL 3CX5K 2YRLA 1DBBH 4EDWH 4W6WB 4QY8A 4YHZL 3QZWB 5CSGA 4ZMAT 3I6LE 3ZKXC 4MA3B 3ZT5A 1QFWM 1WC7A 1JZ4A 3SKJH 5J6HA 4GXVH 2GT9A 5DQDL 3JWDL 2HRPH 3UDWA 3DIFB 3SE9L 4BZ1H 1O7VA 4HZAA 4U1GB 4PJIA 1I7ZA 1YDPB 3U48A 5DR5H 5MERB 1GOHA 4EI5D 3AAZB 4LCYB 3SKOA 2COQA 1CZ8H 2KPNA 4X98A 4MNGB 4IMKA 3E2HB 1WT5A 4FNLH 3SGKC 4OUUA 1LK2A 3K4DA 3L7EA 5BQ7B 4DEPC 4U1JA 1ZHBB 2YMXH 5I8KL 1JGLL 5T1LD 5JOFB 3QCTH 1HN1A 2FJFB 3T0XA 4XAWL 3Q5TA 1P7HL 3O4LA 5EBGA 3SDXE 4NWTL 4WY7L 4OFKA 4Z9KB 3DECA 3VFNB 1CG9B 3VU2A 5CKGA 5HSFA 3AU1B 3HZKB 4JFZH 5GSRB 4HLZG 1MI5D 2FBJL 2PR4L 1N3NA 1UKQA 2ZUVA 4NT6A 2DQEL 3GMNB 5IB1A 1FVCA 3NIGF 2WBKA 1WFTA 2Q86B 3SOBH 5KTEL 1G7IB 5FF6B 4R96B 5GRJL 4YIQA 5CP3H 2DQDH 5D1QA 3RVXD 3R1GL 1J8HA 1MFNA 4XHJD 3AGVA 4DAGH 3O3AB 1R5IB 1QFWL 2HG5A 3MJ7A 3GGWA 2G5BA 1G7HA 1MHHB 3QYCA 1IAOB 4KQ4L 2NX5A 5IV2A 4E41E 4BJLA 2BOCB 2KZ1B 3HE7C 3OKLA 4XVSH 3U9UA 4NUGL 1HQRB 4FQXC 5BS0A 2DAVA 2NY7L 4Y19A 1MY7A 1BZ9A 1GH7A 2QQLH 5T1DL 3AREB 3TIEA 1C12A 1ORQB 2PO6C 4LKXB 3B5TA 4KZDH 2JIXA 3BEWA 4X8JA 4JM2A 4U6YA 3L5HA 2IGFL 4JFQB 1Z9OA 1FCCA 5D7LE 4HWBH 2FEEI 2HJFA 4JRXD 1FP5A 1QSEA 4NGHH 2DLHA 3VRIB 2BX5A 3L5WA 5CEZH 5L8LB 1VGEH 1CE1L 1G9NC 5CILL 2ZCKH 5CZVL 3CNKA 4Y7MA 3MC0A 3EOAB 3V79C 1UXWB 2YEZB 2P5EB 3VXSE 4HKJB 2MTPA 4ZUVA 3TVMD 1U95A 1DUYB 2X4RA 5BZDB 1DP0A 5BW7C 2NY3C 4ZFZA 1ZT4A 1W72L 4G9FB 1BVKA 4OF8A 1VGKB 4NN5C 1H3XA 2FECL 1BQHB 2M2DA 2EIZB 1TIUA 5H37H 5JA8B 3O3DA 1I7RB 2FB4L 3P2TA 1I8IB 4O51B 4NOBA 4M7KH 2X4TB 5KVDH 3T0ED 4EJ1C 4HGWB 2YA1A 3ZSSA 1IGTA 4YWGH 4O4YL 4KFZC 4K9EH 1H8OA 1OM3H 1YYLL 5JXEA 1FG2A 1PKOA 2ARJQ 4LCWD 1IZKA 2DN7A 3KYOA 4XC1L 2W65A 4BH7B 2UZYB 1NDMB 4DGIH 2D31B 3MLYL 2J8UA 4KK8C 3QO0B 4P5KB 1YEDB 4PIRF 5JW5A 4OQ1A 4OUOA 2V9QA 1KIQA 3QWRD 3HZVB 5E4EC 4IS6A 4NHCH 4DZBB 2HFFA 1JV5A 1UWGH 5DZOA 3HS0A 4JDZB 3AY4A 2NZ9C 1S7QA 3EDDA 1BLNA 4Y5YA 3MZGB 4BQ6A 4AMKH 3L95A 4JAMB 1OTSC 3LN5B 3REWB 5H35B 3CK0L 3LHPH 3HI5H 3LZFL 4PJXB 4KVCH 1FAIH 2MHAA 3G5XA 4JG0L 1XGUA 3I3BA 5EBMA 2YOCA 5DURB 3TYGH 3LEVH 1FH5L 4M00A 2BXYA 1N4XH 2AS5M 4UINH 3H3KA 1KTDB 4MWFA 4PY7A 3ZKMD 1AXSB 1FN4B 1XMWA 4RAUA 3HG1B 3SE3C 1R5VA 5KOMC 3IVKA 4D94A 5L2KA 1MCPH 5FXCH 2NLJB 5DJAB 4NQED 3OZ9H 4CW1B 3CDGA 2OTUA 1SJXA 1I4FB 5E2VH 3QDGA 4OIBA 4DQOL 1AGEB 4GLRI 5D1ZA 1TJIH 3JUZA 4BK4A 2YK1L 1JTTA 3OKKA 4DVRL 1NGYB 2GSGB 3BXNA 3GKWH 2ADGB 4QF1A 1T7YA 2P1YA 4CVZB 3U2SA 1NC2D 2RIKA 4NN6C 4JQVC 2OI9C 2WLZA 5CIPH 2G9HB 5I30H 3GJEA 3STLA 5LGJB 4ETQB 3NN8B 1D6VH 5CD5C 4ZO7A 4YHIB 1IM9A 4LFHG 4IIQC 1UQSA 3KLDA 4OT1H 3O2DH 1YY8A 3H7BA 4LHJB 1ZE3C 3FFCE 4DJMA 3VWKB 2HFEA 4ODHH 3BYTA 4HIJB 1FYTA 4KJWC 3KPQA 1A0QH 1N26A 1A4JA 2AABL 3C5JA 2FJGB 2FJHB 4X80H 2UYLB 3BH9B 1AR1C 1BZQK 4XGZB 3VRLE 3LKPA 1AKJD 4FQLL 4X5WB 1I8LC 2X70B 2HYMA 5CJQL 5B3JF 3VCLB 2BP3A 5ANMA 3C6SA 2K9UA 1BIIB 3QEHA 4QRTB 2E6PA 4NSKB 2AJYH 4KTDL 5C08A 4DVBB 4UDUB 5IHUL 5K59F 3QI9D 2UWEE 3GSVB 4K9EC 5TQ2H 5CBAA 1E4JA 3QCVL 4L29A 5IBLC 3DGCR 1ZLVH 3PGFH 2PW1A 4N9OB 4I77H 4PR5A 1NAML 1T2JA 2P8PA 5IJKC 2NY2D 5HJ3A 3KXFD 1N64H 2R1YB 3VXRE 1I1AD 1Y6KR 5F72S 3MNWB 4P23B 1JJUA 1KFAL 2R56L 4LCCA 2QKIB 1RJYB 1MJ8H 1A3LH 1N2RA 5I73C 1S9YA 4R97C 5I1GH 3EFFB 5FYLH 4XI5C 2PUQT 4DW2H 3CH1A 5SWZE 1CDIA 5GQBA 2DQTL 3VFGL 1IC5H 2DI7A 4NBYB 4U1SB 3KPRA 3W9DB 3OAUL 4Y1AA 3ARGA 1NFDF 5HI5C 5GS3A 4LRNL 3VFOA 5E8EB 4UIKL 4APQA 5D4QA 4OQTL 4C56B 4Q9RL 5CWSB 4E0RA 3L7FB 2AXFA 4G7YH 5HHVL 4F8TA 3LN9A 4ODWB 4ELMA 1OWWA 3RZCB 1Q1JL 5T1KA 1IC1A 5DJCA 1ZHKA 5TDPA 3QEQB 3MLPA 3LD8C 4H8WH 5CJ8A 2H3NB 4QT5B 5H37G 2R69H 2XG5A 1NFDB 3FN0H 4GRLA 4CL7A 3IAGC 5D7IE 4N90D 4P4RB 3GMMA 2NMSA 4NCDA 1F4WH 1R0AH 5CD3A 1DBBL 5E70A 1X4YA 4HGMA 1CS6A 5DVOA 4DK6A 3BJLA 1I1FA 3UMTA 3QXUA 3SKJL 4GXVL 1RIUH 4HUVB 5BRZE 4HIHA 2HRPL 4BZ1L 1ZXQA 1LE5B 3OKDA 4UMGA 4U0RB 1BX2A 5DR5L 4CADB 2HVJA 5ESVB 1MRFH 3HPJB 3LKNB 4UB0H 1CFNA 1EBAA 4OZ4B 2PYEA 1H8NA 3KVQA 2NY6B 3O4OB 3MGOA 4Z7WE 1Q9WA 4QRSA 5FGSA 3D2UA 4AEHH 5C0FB 3EJYC 1EV2E 3FO1B 2YMXL 1ES0B 2HFGL 3N1MC 2FO1A 3KPSD 3O8XB 4WNQA 2ICEB 4W6XB 4E42B 1A7QH 3VWJC 2E7LA 2XQBH 1KJ2B 3HAEA 1GYAA 3WUWB 4D9RD 3IETA 4HK3J 3SKNA 3DOSA 1NCAL 3ARZA 2R0ZH 4JFZL 1KEMH 4CMMB 4LPWA 2AJZA 2GJZA 4BKLB 1GGBH 2IAND 3SKMA 3S37L 3EO9H 3RGVC 1Z0NA 3K7UA 2OSLA 2FBOJ 4LSUH 5KSBA 3SOBL 4LL9A 1XF2B 1XF1A 1F3JB 2R4SH 1T04B 3GK8H 3WKMH 4IOFC 2DQDL 2LQRA 3KLHC 2VLJD 4JFDA 3JV6A 4DAGL 3PGDB 2XFXB 5F6HJ 1MCFA 3TBSB 2H41A 2GUOA 5EZIH 3SCMD 4ZDHA 2WV3A 4GS7C 3NACH 4JZNA 1KN2L 2VN4A 1QSVA 3CZJA 5IW3A 4M61A 4XMPL 4XVSL 4F2MA 2YBRB 4V1DD 5F7YC 3I2CH 5DSCA 4WV1C 2QQLL 3ETBF 4GAGL 4G6MH 1CR9H 2ADJA 3MV8B 4KZDL 5IWLA 4HWBL 4HUKB 4NGHL 1KCLA 5IF0A 3GZKA 4H8WC 1K5NB 4KUCD 5CEZL 3HRPA 3L3IA 2ZCKL 3LN4A 2YKLH 1G9MC 2GY5A 3KYAA 4XH2A 3T09A 3ROOB 4S2SA 4ODUB 1DR9A 3VGAC 4KJQC 4P2RE 1N5YH 4MQXC 3F5WA 5EOQL 2Q76B 3ET9F 4MZ3A 3A6OA 4KKBC 4A6YH 1NCTA 2A6KA 5D2NB 4F7MB 1MHCB 4UOJA 4R2GB 2H8PB 2D7TH 1Q38A 4GO6B 4WFGE 3FT2B 2NW2A 1AO7D 1NGWA 2BHUA 1B88A 1DSFH 4ZXBC 8CGTA 2Y06H 5LG1A 4ZAKD 4M7KL 3V0VA 1IM3B 4P2QE 4PP2B 1SY6A 3UBXB 4JO1L 4YXLH 3M45A 2FDBP 3OPZL 4LKCA 1MLBA 1OSPH 4YFLI 2DS4A 5KVDL 4MJ2A 3T04D 3QUZA 4E9LA 2X4UA 4YWGL 2OMNA 1OM3L 1P4LA 5GS0H 2FZ3B 4JPKH 3B3IA 3BIKA 3IS0X 2OXHA 1NFIA 3P77B 1AGCB 4N0YH 4DGIL 2ZG2A 4NFBA 3KPMB 3AMLA 4PD4K 1R5WB 5IW1B 1TZHA 1JGUH 3QNZB 3GMRA 1T20A 5CBEA 5T33H 3FB7A 4DKEL 2IH3B 4H1LG 4NHCL 3DO7B 4NYLA 3UZVB 5FOBA 5I1EH 1UCTA 1UWGL 4MS8C 2Q3ZA 4GBXD 1A4KB 4B7IA 4ZUSA 5KG9B 4AMKL 1NBZA 1VFOA 4U1HA 1E4WH 3RX5A 4LBEA 3OSKA 1RUPH 5EO1B 2Y1VA 3HI5L 4PJEF 1FAIL 4RAHA 5J3HD 4IOIB 4XBPB 3ZE1E 3TYGL 2CO6B 3LEVL 5KS9F 1WIPA 2AV7B 1XH3A 4IOSD 1QBLH 3FQUB 5GSVB 3EDFA 5C0DA 3RL2B 1N4XL 4KMTH 3DV6B 1OGAD 3TO4D 5KSAA 1OW0C 3C6LA 1HXMA 3PL6C 1MCPL 1HH6A 4ZFGH 2OCFD 5C70A 3VXMD 1FV1B 4PJEB 3RRQA 1FCGA 3NPZB 5JZ7D 1OGTB 1UYWH 3P9MB 4AL8H 1TJIL 4ALAH 5KS9B 3BJ91 1D7FA 4K7PH 2JCCE 3QEGH 2X6MA 2Y36H 4QKXB 3T77B 4U6HB 3SO3B 2MCPL 4GQ9H 3OJDA 2AJVL 4Z77B 3LS4L 4MA1B 4OZIF 1RVFH 1U8HA 4JHZA 3QB7C 4PRPE 4JFYB 3B9KC 3OB0H 1F3RB 5DVNA 1T22A 1D6VL 4HS3A 4PG9A 4Q58C 1CD1A 3LMJH 4XBEH 1E4KC 2JJSC 4XPTH 3W5MA 3GM8A 4OT1L 3O2DL 4I0CC 5DHVH 3QJHA 2YZ1A 3FHAA 4ODHL 1BJ1H 5CHNB 5I1JL 2CLZA 3HC0A 5DMYA 1YY9C 3VXTA 1ZGLP 1A0QL 5D5MA 3MRLA 1YQ2A 3RAJH 2FIKB 3BDXA 4X80L 5EU5B 5EU6A 2Z31C 1T1ZB 5CP7B 5C9KA 4RDQG 1RZKC 1UENA 4XT1C 5FO7A 2WANA 5L2JB 2QSTA 1C08B 4F57L 3O41B 3HMWH 4L8SB 4JHWH 1G7JA 3TYFA 2IF7A 2X7LB 4JLRA 2AJYL 1KF9B 3MLZH 4PJHF 5EBLA 4PRDA 2ENSA 5HY9A 3LKRA 4P3DA 3NIFF 2BCKA 4DUXA 5KANG 4JFXB 2AXGB 2CRZA 4AH2A 4HFWA 3BGMA 5TQ2L 5CEZE 1WBXB 5GS0C 3KLAB 2ZUYA 2J5LC 1F6AA 3DI2B 1V3KA 3PGFL 5SWQA 4I1NB 4I77L 1N64L 1R3IH 3I9GH 1NKOA 3L3OB 4PJBF 3C60B 2DRUA 4NRZA 2FATH 5F93C 2WLYA 3BP6B 4PJHB 4KK5D 3GHBL 5C0AD 1OF2A 5IW6A 2APFA 1MJ8L 3HE6B 5AZEH 4JFEE 1A3LL 1A3QA 1CTOA 5I1GL 5KZCD 3MJ9H 5FYLL 3QFJB 3UTTA 5J7CC 3CVHB 1JF1B 4DW2L 1BFTA 4YHMH 5HPMB 1PDKA 2D0FA 4PJBB 4QRUB 1MAMH 5E2UH 3F65A 4PRBA 4Z18A 2OL3B 4KV5E 1QO3B 3RTQA 2XWJB 3B43A 3CJJA 4X6DF 4G7YL 4Y8DC 5MEPA 1OQOA 3MROA 4D9LH 4EI5C 4Q97A 4H8WL 5EO9A 1FLRH 5DC4B 2N7BA 2PKDA 2R69L 5MENA 1JF5A 5I71B 3CU7A 3BPCB 3X14A 2R2HB 2YD1A 1U8JB 2JJTC 3S7GA 3MMEA 1F4WL 2WBJD 4LRIC 4XCEB 4BUGA 1R0AL 1S7WB 1PGRB 3TA3D 3W0WA 4Y4KB 2HVKB 3SGDH 4X9GA 5FYJD 2XG4A 1KJMA 3OB0K 3P73A 3MV01 4LDLB 1RIUL 2B8OT 3O6FD 4P5MB 2HKFH 5ENWA 4LLDA 4PJIF 4E5XB 4I0PD 1V8HA 3GSNA 4LLAA 5TE7H 4XVUD 5F9JA 1P7QD 3OXSA 1RZJC 1P9MA 1TETH 2E8ZA 3CLFH 4QY8B 4CN6A 3CFJA 4UB0L 2Z91A 4Y4FC 5MEOA 1WC7B 5J6HB 5HHOB 4TTGA 2GT9B 2EE6A 4PB0H 4UTAH 6CGTA 3U7WH 2BVYA 4PJIB 1I7ZB 4AEHL 1DQTA 4HZLB 3AS1A 3RJQB 4DGVH 1LWRA 4JE4B 3SKOB 2EKJA 1B3JA 1IJ9A 4BSVA 1A14H 3KR3H 1QFHA 3RVXC 4XHJC 3PWLA 1IBGL 4N0FA 2XQBL 2FGZA 4HPOH 4X6FA 4OUUB 1LK2B 3L7EB 3QFDA 5AYQA 3CD4A 4U1JB 5K9JH 2R0ZL 3JV4A 1KEML 2L7UA 1GGBL 3T0AA 3EO9L 4GW1A 3O4LB 5EC2A 4MD0A 1MCJA 4LSUL 2OMBA 3QUKA 1T3FA 3DARA 1JZ7A 1NBYA 2R4SL 1Q0YH 3TBTA 3WKML 2IMMA 2YD9A 3QHZH 3HKFA 3Q6GH 5DD6A 2IAMA 1N3NB 4NT6B 1HZHH 4L8DA 5FECA 5IB1B 1FVCB 3GJFA 5EZIL 3F7YA 3NACL 1YA5A 4EZMA 1GC1H 5DJ0A 4YIQB 5M95B 5D1QB 1J8HB 1QVOA 2A0LD 5DZLA 2HG5B 3HNSH 3MJ7B 3C5ZA 3GGWB 4RFNC 3KPLA 2G5BB 1G7HB 3KWWA 2NX5B 4JM2F 3TVMC 1TTFA 4QXTA 1CR9L 5IV2B 4ONFH 2E9IA 4YDKH 3V5HA 2DIAA 3BRGC 4JY5H 1T5XA 5C0BD 3OKLB 3U9UB 3J8F7 3X3GH 5DA4A 5BS0B 3OKMA 2GSIA 3DVIA 4Y19B 1AC6A 2ERJB 1LK3H 1BZ9B 3C2SA 2YHGA 3L1OH