4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
4PRBA 1BBDH 5IESH 5JZ7C 2BVUA 4JLRA 4Z76B 1PYWB 2VLLA 4OV5B 5GJSL 3TCLA 3BVNA 1J1PH 5JQ6L 3S36L 1QRND 2VL5A 1I8MA 3SBWC 3BKCH 3FQTB 1XCTB 4KXZH 1B4JL 1M6OA 1YY9D 2FJGA 3CZFB 5FKAA 3T4AB 4HFWB 3Q6GL 1I9JH 1H3WM 1FO0B 2YMXL 4LVEA 5CEXA 4HG4K 4KZDH 1A6WH 3QRGL 5INDB 1F11A 1FC2D 4NKDA 2CR3A 3V9FA 1BAFL 1ZANL 4NO5B 4QRRE 2YPLD 4U1LA 2Q87A 1PG7W 4OCYL 2IPKA 4OLYL 1OTUD 1QG3A 4NNPL 2WZPD 3TP4A 5CINL 1IKFL 1MUJB 1MI5A 4OCMC 3MOBH 2NTFB 4P2RE 4ZPTA 5D7LA 4PRDB 5E03A 3SDAC 4JFQA 3G6JA 3LPGA 4DVRH 4GRWF 1A21A 3B6SB 4Y4HB 4G6KL 3MOAL 1IC4H 3C60A 4JFDE 3VFWA 5IFJA 1ZEAH 4QOKB 4KKBC 5T1LB 3TIDB 4Q6IB 1TQBB 3RUGE 4AYFA 1S9YB 1AKJB 1NUNB 5SWQB 4MAYD 4YXKL 2WK2A 2KBGA 3B43A 1IFHH 4PLNC 4Y5VB 3QUZC 1OGAB 3RWIB 4POYA 2PNDA 1DTUA 5HHVH 5C0AE 4XPAH 1G7MB 5A16B 1EHAA 4PLOB 4MJ5A 1QSFA 2X4OB 2CXGA 4F15C 2CSPA 3RIAF 3MRNB 4Z9KB 5K9QI 1JWMB 4YDLC 4XP4H 2PYFB 5CBAB 4OJFH 2XKSA 5LXGH 4PRIA 1TCRA 3RJQB 4A6YL 4LASH 5GSRB 2R1YA 1EXUA 3QFJE 3GMOB 4KK9C 1GRWA 3BPOB 4RBPK 1FCCA 3S98A 3CNKA 4OGYH 1P2CB 1KPVB 1XF5A 4CMHC 5I1JH 4X7SH 1EMTL 3GSRA 3SO5A 2BNQA 2EDBA 3BD4A 3BKYH 4BFBD 1EIBA 1HILB 2IGFL 2ZPKH 3EO0B 4HWUA 4DZBA 4O2CA 4TVPH 2QKIA 3QDMB 2WIMA 3HR5B 1N6VA 2NY6B 4NZTL 4JO1L 2J88L 1RZIB 5D1QB 1KN2H 1S7SA 3BAEH 1FAKT 2R1XB 1LE9A 3I6KB 3QWRA 4JPKH 4GAGH 1YPZB 3V0WL 4GQPH 4BA8A 2FEEI 1CK0L 4LPXA 4QWWC 2GITB 1CICD 5AG9A 1TMCB 1NMAH 4XPGL 3ULUC 4LLYB 3PDDA 4FQHB 3GJEA 4PJAF 2IALB 5CSZB 4PLKC 3C09B 4TOYL 1ZHNB 1U2HA 2EDYA 3MUY1 4PRBB 4QRQA 1ADQL 1NMCB 2VLLB 4HIEA 1TETL 1J7VR 3BVNB 4OD1H 1TXKA 5KVDL 3PE9A 1WT5C 4YJZL 1G7QB 3QHFL 1QLRB 5F7NC 1ORSB 1OTSD 1A3QA 4PGDA 4IIQA 3IKKA 1I8MB 5E6ZA 32C2A 2F5AH 2FJGB 4ZFGH 5FKAB 1E4KA 2ADJA 4OZHA 4I0PC 2VYRE 3CLEH 2P5WE 1LP9F 3MMEB 3EYQC 3OKOA 4I3RL 4JFEA 4JQXC 1MREL 1MHHA 4NM8L 5EDXA 4U1LB 5ADOH 4Q2ZB 2IPKB 3MACH 4MX7A 2A9ML 5HI4C 4FTVE 4KY1L 5JR1H 1TQCB 1R3LA 4ZPTB 4HIIA 3FB6A 4JPWL 3MQIA 1NL0L 3G6JB 2ED9A 5E8OB 3T77B 2DTMH 2E7LC 4F7MA 2NY0B 5DVMA 2G2RA 1WBXA 2EKSB 2IQ9L 4KKCD 2M2DA 3C60B 4CVXA 4N68A 1EEYB 1YNKH 1F4XL 4UMGA 5JHLH 1DBJH 5SWZB 4EDWL 5C07D 2VTFA 4X4YA 4FQ2H 3UTTA 1MY7A 4IJ3B 5MENE 2R9HC 2HRPL 4F57L 4JAMB 3C08L 3VGFA 1DBMH 4JCMA 1NJ9A 2I9TA 4GRLA 3NCJH 4KRMB 3J8F7 2GAZA 3IVKA 1R24A 1QSFB 43CAA 3W0WA 4D9QE 1UH2A 3O3UN 3K0WA 2V5RA 4TUKH 5K93A 3TYGH 3U4BL 3F7YA 3Q3GA 2Y5TB 1GGIL 4LPVA 1Q9LA 4UINH 2L4OA 2ADGA 4KJWC 4J3SA 1DBKH 3LB6C 1T1WA 3O4LE 3ZTJG 1N0XL 3IXAA 3TNMA 1RZKC 4FXGA 1EJOL 2J8UB 4WWKC 2NY1B 1LK3L 2XRAL 4FQLL 5C70A 2OZ4H 3GHBL 4PY8J 4YHYC 4QEGA 3RWJB 1XF5B 3D1MC 2H1PH 2V7HB 1AGCB 2CJUH 3U36B 2VR4A 4MA8L 4FQQA 3RZCA 5HGDA 5J1AB 1ZGLM 5EOCH 2BNUA 5LQBH 5C6TH 2FH6A 1W0WA 1WIUA 4QRPB 1K4CA 4ZTPL 3ABZA 5DDHA 1KB9J 2L7JA 3X3FL 5HHNB 1D9KD 1G9MC 3O2VL 4MD5A 1AGEA 4NC1C 4KZEH 2AW2A 5J13B 2DB8A 2LABA 2VH5H 2NXZB 1UWXK 3E2HB 5TPWL 3GSNH 3WUZA 2YUZA 2F54A 1F4HA 2J3SA 3NVQA 1U8JA 5ANMA 1PKOA 2W07A 5FDWA 1DFBL 3ARFD 1KIQA 1OAUH 3GSUB 4P2CG 1ODAA 3KDMA 2BY3A 4BK5A 4LL9A 4LSSH 2P8MA 1FFQA 4Z7WF 8CGTA 3W81A 1U3HA 1AC0A 2NZ9D 2DBLH 3BIAX 4H20H 1WZ1L 2VLKA 4WTZG 3PV7A 5D70H 4L8BA 5ACZB 2AK4A 5I1CL 3HAEG 1KLGB 3AY4A 4QRQB 3TH3T 4PRPD 4HIEB 5C0DB 8FABA 3T3PE 5H94A 5EH1A 3B9KD 4XX1G 5CEZH 3L3HA 4KI1A 4DKDC 1H15B 3GMNA 2B1HH 1C08A 2V6HA 4KRPB 4U1KB 4IIQB 3PHQA 4DUXA 32C2B 4WI4A 2Z92B 1FV1B 2ADJB 4K2UH 4OZHB 2ZNWA 4CU8A 1KTLB 1RZ8A 2H6PB 4XVSL 2PW1A 4XI5C 2ICES 4ZNCD 4Y16A 4WV1A 4X6CB 4J7RA 1FL6A 3OB0H 1AGBB 1MHHB 2XWBB 1H8OA 1P6AB 5FO9A 1KELH 1AGFA 4MX7B 3S37L 4FA8A 3S8WA 1N26A 5T1DH 2CO6B 3C9NB 1IMHC 3UBXA 2AJSL 3F7VA 4WDIB 3H9SE 4F7MB 4R7DB 1YEHH 1OQXA 1GC1C 1HH9A 1WBXB 5FYJL 3QIUC 5I76B 3F65A 3JXAA 3NGBB 4ALAL 4DKAA 5D9SB 2NX5D 4QXTA 4ZO9A 1T20B 2V5YA 3ARBC 2FJHB 3QBTB 1CFTB 4UIKH 3QDGD 3LH2L 3EYSH 4NC2B 3O11A 3SDCD 1HCFX 4BJLA 1INDL 4PJ9A 3HKFA 4L9LC 5DA0B 3O45A 3SGJA 4YHZL 1D5BB 1HI6A 1MHCA 1JGUH 3U30B 3BUYA 3FT2B 2GJ6D 5DVOA 1EVUA 4YZFF 43CAB 1XH3B 1IBGH 5IR1A 1J5OL 4TSAL 3F7YB 3Q3GB 4DQOL 3ARYA 1RULH 1AFVL 4LDLB 2ADGB 4G42B 4MJID 4HPYH 3IXAB 3PNWB 4PJEE 2PF6A 3TNMB 3T2PA 4JHWH 3KPPB 2FHFA 3GB7B 1UM4L 4YUEH 1S78C 3RA7H 3TF7C 2D7NA 2PO6D 4MS8D 3WFDL 1J11A 1YEIH 4P5TB 2E6JA 2VLRA 5F96H 5HHME 3HI1A 4ELMF 2WW8A 1MCBA 5HGDB 4Z6AT 4XVUD 2WBKA 2IAMC 3UYRH 3HE7A 3UTSD 3B2VH 5INCB 2AXJA 3LN5A 3L7EA 1K4CB 2H2SC 4KUZH 4UV4H 1DN2A 5DDHB 4EI5B 4F7EB 5IP4A 3TA3C 1K4DA 4PJIE 4YBLC 3MX0A 2C5DC 5FK9A 1AGEB 4RGOL 2JK5B 3BX7C 2GUOB 4NM4L 1OGTA 3BZ4B 5I9QB 3RIFK 4AM0B 5JOPE 1BHGA 2F54B 1QBLL 5DVLA 1U9KA 1U8JB 5ANMB 3RHWF 4M7LL 5IVOA 1A4KA 3REVA 2GSIA 5FDWB 1KIQB 5M94B 4U33A 3FOMB 3JWDH 1N0LA 4H8WL 4AEHH 4FRWA 4Y8AA 3TM6A 1TTUA 2DWEB 4GBXA 2FD6H 4Z7VE 1MJUL 4L8BB 4G7VH 2AK4B 5TE7H 2AERT 5IT2H 2Y5EA 4Y88A 1KPRA 4OV6F 4ZS7L 8FABB 1JGLL 2FR4B 1I3GH 3NCCB 3LRHA 4NHCH 5HY9A 1GOFA 4KI5F 2VXUH 4XNUH 4DKEL 3L3HB 2CRZA 3IJHA 3KPSD 2P45B 3QUYB 4PJHB 2FGWL 3NIDE 3PIQA 2GT9A 5J11C 1JTTA 5IJKA 1JBJA 2BK8A 4Q9QL 3BW9A 3IAQA 4KMTL 1GZPA 3GSNB 3KYNA 4HJJL 5F1OB 1RZ8B 4AEIH 3O6FA 3IDNB 2PW1B 4NJAH 1LEKB 3WFBH 2A1WL 1MF2L 3EDDA 3KPLA 3DROA 5C3LD 2Q3AA 1P7KB 3EOYG 3T2NL 5F71A 3D3VD 3HZYA 3ESVF 1AGFB 4KC3B 4NNYA 4YDIL 5ENWA 3U1SL 3ESUF 1A7OL 5GGSA 2VAJA 4HHAA 3AVEA 4UUJA 1BIIB 5KS9B 4Y5YB 4XHJC 5DK2A 3SDDA 4A2MA 2J6EA 3INUL 2FATL 4FZ8L 2ZUQC 5ICYB 1V05A 4QXTB 1XIWD 3SCMC 3H6JA 1JZ4A 2HKHL 3IFNH 1AR1C 3KPRD 1EV2E 5SX4H 3QXAB 1A7RL 5F88A 4NT6B 3OKKA 5D96B 2FWOB 3PWPE 3S5LG 4RMVA 3W9EB 3O45B 5GRYA 3VMOA 1U8KB 5D7JB 1HDMB 3KS0J 4WUUE 2AXFA 1Y18A 1HKFA 2DLGA 4XP6H 4UT6H 1T1ZA 2XWJA 3GKZA 1I85C 2E6QA 2O5ZL 3BPCA 1I1FB 2BOCB 3HA0A 5TGBA 1OVZA 4WFFD 5ALCL 1V3KA 4U6HB 3BE1L 4OSUH 1HK6A 1W72H 2Q8BL 4L8SC 4L3CA 3O3DA 5EULV 3WIHL 2HFEB 4G3YH 5C0BA 4MA1C 4M00A 4MNHB 2A6IA 5KVFH 4K3EH 4LCWD 4UV7L 5AUMA 2VLRB 4CJ1A 15C8H 2Y7QB 5GS0H 2PKDA 3HI1B 4NQDD 5DHXB 5LBSL 1G7IA 3ZKND 4O5LL 4PJDA 3FQNB 1ZGLB 2HFGL 3R4DA 3L7EB 2ICWJ 2YEZB 3T0EC 4MCZA 2A77L 3OG6B 3O8XA 3ARDD 4PBWD 4Z95H 5TFSL 3GI8L 2SEBB 4G6MH 4IMLB 5BW7A 4R4NC 5EPMA 1MFBH 1NEZB 4V1DE 3O2WL 1ZVSB 2NY3B 4KQ3H 5F3HA 3QAZB 2Z4QA 3HS0A 4YDJB 3REVB 2X4PA 2GSIB 3AXLA 1MCDA 2NY2D 2EXYC 5KVGH 3IETA 3ME0A 2XQBH 1KN4H 1NCWL 2Z31A 1W72A 3VDCA 3M8OH 4EJ1C 2A73A 2YZ8A 1IL1B 4NIKB 1QFPA 4EN3D 4WENB 3V5DB 2WSKA 1I1AD 2VDMH 4HULB 5DFVC 1UEMA 4PJGA 4O9HL 3DSNA 2V2XA 4JQIL 4PUBL 1OPGL 2AI0L 2IADA 3WSQH 1VFMA 1KPRB 2R0LH 4OZIB 2D0GA 5C0CE 1G6RH 3PWLB 3TNNB 5HY9B 5I18H 1N64L 1T7ZA 1E4XH 4Y2DC 4DVBB 2QSCL 3QUXD 4IM8A 5CD3A 4JFFE 5E5RB 4JKMA 3PIQB 2LU7A 3VFVA 4J1UB 4Y19A 4XPTL 3BW9B 2P47B 3MV8A 1IM3A 2BSED 2XZQH 1OY3B 3UJJH 1G1CA 2IPUG 3RI5F 1A4JB 5EUOA 3ULVL 3NA9L 1TTFA 5GS1B 1RZFH 5IW1A 2CLRA 1DVFD 3HZYB 3MA7A 4QHKI 4P59H 2DQTL 4K55A 4YHKH 4DGIH 4RGNE 1FBIL 5JPMA 5GGSB 3AM8C 2IH3B 1JGDB 4HHAB 5DJ2B 4AY0A 4UUJB 4HUXB 5KVMC 3BP4A 4X7DC 1RIUH 5C08D 1EAPA 4YDVA 4XC1H 3SDDB 4FQ1L 1GIGL 1I7ZA 3N85L 5K59F 2MQ3A 4LSRL 2NXYB 4RFEB 4MXWL 4ODTL 4NCC1 3EIFA 1IGJA 4U3XA 1BIHA 2DQGL 4KJYB 4LU5L 5DJXA 5JIPA 4ZAKC 4LLAA 5JIIA 4JN1H 2J8UF 5BVPH 5EOCJ 2BP3A 4FNLL 4MJ6A 4Q9CA 1P4BH 5L9DH 3X13A 3WDIA 2RFXB 4D9LL 2EICA 4WU5A 3PABA 1Y18B 2XXCB 5TE6H 3P4NA 3ZHKA 3P0VL 2X4QA 5HYIA 1YQVH 1BECA 1EDQA 4YXLL 2QADB 5DHYB 1T1ZB 2XWJB 1BWMA 1F5WA 1G9ML 4UI2A 5T1LD 3V6BR 2Y07L 1OT2A 1AHWC 2AV7A 3BPCB 1AKJD 5TGBB 4HBCH 4R26H 3EO1A 2YD9A 5DJYA 3VGEA 3ZSSA 2DS4A 2AJZA 1OGAD 4TNWF 3O3DB 4HBQA 1U3YA 3NFNA 5CIPA 3IDYC 4MQXC 3STZA 5C0BB 4YE4L 5TQ2H 1YMMD 3NTCL 1VGEH 4D8PB 1M71A 2DI7A 3MBEC 2GSGA 1CDCA 4TQEL 1EGJL 3C8HA 4TSCL 1HIML 4PJDB 1ZAGA 3LS4L 2H9GA 4JR9H 5HHOA 4D3CH 4YX2L 4X6BB 4PTUB 5T5NF 1Q0YL 2B1AL 4N8VB 4N9GA 1U8OA 4XMLL 3BJLA 1LEIA 5KN5A 3LKRA 5EPMB 2VWEC 5CGMA 1U0QA 2YXFA 5JQ6H 3S36H 3AREB 3U7YH 3LIZL 4LLQA 4NBYB 1Q1JL 4J4PD 5JW4N 2X4PB 3AXLB 1T1YB 5FOBA 4IMKC 3Q6GH 3CD4A 4XAWL 3LQZA 1XZ0B 1JNNL 4WO4C 1W72B 2PW2B 3QDMD 3IDUA 1FDLL 4HK0A 2NY6D 3QRGH 2VDQL 4U4BA 3CFBA 4PJGB 1BAFH 2J5LB 1ZANH 3UROR 3DI2B 4NO2A 3N0PB 4OCYH 1PX3A 2PTTA 1Y0LA 4X6CF 4OLYH 4NNPH 4OFVA 4JRXE 2X44D 1GGYA 1IKFH 1JRHI 2NQCA 2AABH 1JZ8A 5F7HA 2EDLA 2IMMA 1ACYL 3MGOA 4NKOA 2YD5A 1GC1L 3HB3D 2UWEF 3VXUA 4G6KH 2VDPL 4Y19B 1H8SA 1RZ7L 4LCUA 3U0TB 1IM3B 1MJJA 3VDBA 3RVWD 1Q8MA 3K8KA 1AC6A 1N2RB 1NANI 4YXKH 3RWGA 6FABL 4OLEA 2IBGA 5IW1B 3MA7B 3AB0B 4JFZL 1ZA6B 1V7ML 1QRNE 1DQJA 2QHLA 5EU5A 1O0VA 3WE6A 3BP4B 1I9RH 1OB1A 3G6DL 3JV4A 1YEGL 1WTLA 3VI4F 3OR7B 4A6YH 2D3VA 3BZEB 4MNQA 3GMRA 5HVHB 3D25A 1MVUA 3R06A 4ZUWA 4HKXA 4QYOA 1NAKH 3DO3A 3ILPB 2APFA 1EMTH 1C1EL 1QVOA 1NCCL 4GT7A 3EBAA 2QV2A 5GRUL 5HVWA 4OFDA 1ZVYA 2FL5B 5GGSY 5I2IA 4B50A 4WGWB 2IGFH 1OLZA 3U2SA 2NY0D 5GIRA 3PABB 3KYKL 5CP3A 3BPLC 3KPNB 4MA3A 1L7IL 4IRJB 5HI5D 4WHYH 4DW2L 2X4QB 3C60D 3OKDB 3BZDA 2Y6SD 3H42H 1RU9L 5F7YC 3KAAA 4JO1H 2J88H 3R0NA 4LKXA 4FOMA 2AJZB 2MHAA 3NFNB 3LD8B 5J6HB 4M3JA 1RY7B 3V0WH 3B9AA 3LPFA 1QSFD 4MQ7B 1CK0H 5HGHB 1M71B 4XPGH 3TZVA 2GSGB 4E5XB 3I6GA 1DQML 1DQDH 2OK0L 4M7JL 5L2KE 2HMIC 3PG2A 2IF7A 4N0FB 1OCWL 3E6FA 4PRID 3CIQA 1J88A 4JDVA 5ICXA 3A6BL 4N9GB 2NY1D 1U8OB 1N3NA 1R6VA 4I48B 1TETH 5D1XC 3LKRB 4NO3B 5KVDH 3ALXA 3UTOA 4ODSL 2BNQD 4PRAA 1NUDA 3QHFH 2F74A 1RMFL 1BD2B 2HLAA 2FO4A 3DV4B 2I07A 4OM0L 4NBXB 4EDXA 4I1NB 1W8NA 1T21B 4N0YH 3VXMA 5D7IF 3MUHL 4PJHF 1KCLA 4YPGA 3LQZB 4UOJA 2R2EA 2OJEB 1FRGL 3MR9B 4HK0B 1MIMH 4PBVC 1DBAH 2DIBA 3R0MA 3MBXL 4MNGE 2EYRA 4EXKA 1T5XA 2A74A 2NXZD 5ILTL 4NM8H 4NO2B 4IHOA 2X2YA 1N5YL 2PTTB 1Y0LB 2A9MH 1IKNC 3QWRD 4G8IA 3MREB 1UYWL 5JQHC 1TPXB 2DTSA 4Y1AA 5GZNC 5KSVA 4R2GB 1MCCA 4DEPB 4NWUH 1JP5A 4HV8B 4JPWH 1NL0H 3KYMA 3UJTL 3FFDA 1H3UA 3BXNA 5DYOA 1ZS8A 3SE4C 1ADQA 1S7XA 3VXUB 5IB1A 5T33L 5KS9F 2ILLA 3SE9L 4OUUB 1A6AB 1MJJB 3RIAK 3WIFA 4K9EL 1GVIA 2FCBA 1OAQL 3LDBB 4Z18A 3D0LB 3DSFL 4EDWH 2O5YL 1GAFH 2HRPH 4U7KA 4F57H 3RWGB 3RRQA 2X6MA 4G80B 3C08H 3MNWB 3QEGL 4WI8A 5DQ9B 4AIOA 2DWDB 3EAKA 3T09A 4PJBA 4EIZC 4X7CC 1D7FA 4P2OC 4KRPD 3L3IA 4QCIA 2FH8A 4PJXB 3U4BH 3RX5A 1GGIH 2F53A 5CGTA 1ZLSH 2GKIA 5HJ3A 1T04B 3L6FA 1AE6L 1U8QA 3BRGC 1A1MA 2XKNA 4JFED 4ONHA 1CFBA 4TUJB 1JWSB 1QRKA 3GMRB 3QPQD 2XRAH 4FQLH 3DUUA 3GHBH 3R06B 1KB5H 4QYOB 3FOLB 5ALBL 4MA8H 4L5FL 1UEYA 5HI3C 4PJFE 3QDJA 3GIVA 1VEOA 4CN6A 5I2IB 4IOIB 3TO2A 5EU6E 2YKLL 5IBTL 4B53A 2PXYA 3H0TB 2YBRB 3P9LB 3U2SB 2A6KA 1BOYA 1J05A 4NQEA 4KKAD 4MA3B 4F7CB 4JKPL 1CE6A 3X3FH 3QNXA 3O2VH 1NCBL 4APQA 5I71C 5C07E 2ZUWA 5CZVL 3UTTD 3GSQA 1DCLA 3KYOB 4LKXB 4G9DB 3G9VA 3QFDB 5BS0B 4W4NA 1EH9A 5JOFB 4PB9L 1KLFA 1C7SA 1DFBH 3D85A 3W0WD 4A6YB 3GMMA 5BJTB 2CO7B 3STLA 4MXVE 3KWWB 3RGVB 1RUAL 2E9IA 3SOBL 1T4KB 2MTPA 2VR5A 5C0EA 3E6FB 3HNSH 3DX9A 4JDVB 5ICXB 3TVMA 5I1CH 3MFFA 1MFAL 1LEGB 1BQHA 1CGWA 1I1RA 3BMWA 3OHXB 4LVOB 4ODWB 4O00A 4P5TD 5EC2A 4GRWE 3RZCD 4OZIF 4XNYL 3G5ZA 2I07B 3QUMA 3DVNA 5A2FA 1IQWL 5BVJB 4YPGB 2MQ0A 2W9LA 5IW3A 3HNVL 4XVSH 1P1ZA 4PRHB 1D5XB 4J3OC 1MAKA 2APWA 4X6FB 2EYRB 5DJDA 1T5XB 2A74B 4MVBC 1SEBA 4WUKL 3UO1H 2VDKH 2Z8RA 4AQOA 4IHOB 1A7QH 2VITA 3CFKA 5IV2A 4OIAA 4XCYB 2F54D 3S37H 4O2FA 5IB4B 4M6NL 3WD5L 3E1F1 5IFHH 4Y1AB 3ZHLA 3RL1B 5KSVB 1FZOA 1OD7A 3ROOA 5I1LA 2XT1B 5KSAB 3QI9B 3A6CH 2AJSH 3BXNB 2BZDA 3MCKB 5DYOB 3QUKA 1U3HD 1DQTA 1CDBA 5IB1B 5HHPA 4LIQL 1AXSB 3TO4A 2QLVB 4YNYA 3L5WA 1I1CA 2VLKD 3WIFB 5C0FA 2HG5A 2WBJC 1U8LA 3LH2H 2AK4D 3PGFL 4UIMA 4L3EA 1WWWX 2EE6A 2Q6WA 1INDH 4LF3A 3BYTA 5FUZH 5L0QB 3HTLX 3KPQB 4YHZH 5J6GB 1H3XA 1LNUA 5J8OA 3LHPH 3P9MA 5GS2H 1MIEL 3MYZA 3L3IB 4QCIB 4UBDD 3VXOA 1J5OH 4KVNL 1DQQB 4IOSD 4C55A 1VDGA 2W91A 4DQOH 1F3JB 5T3XL 1MJ7L 2F53B 3O3BA 3FKUS 1AFVH 5E2WL 4Y5XC 4M1DL 4D0BA 1NFDA 3SGEH 1U8QB 3F7RA 4Y16D 1A1MB 4W81A 2X1PA 4Z0BL 2VE6A 3JWOC 2XFXA 4F80A 1UM4H 5IW6A 3WLBA 1Q9KB 4XNQB 3PGCA 3WFDH 5FECA 2WANA 2OP4L 1JMZA 4MGXA 4R4FL 2BMKA 4PJAE 4XH2B 3QDJB 4KH2A 3DETC 1FVEB 3A0OA 4B5EA 4HKZB 2PXYB 4CVWA 3ECBB 2A6KB 4NQEB 3L7FA 3QEHA 2P8LB 3EJJX 3OAZH 3DMMA 2NX5E 5AD0A 4BZ1L 4PJ7B 3UTPE 5KW9L 4APQB 3QDGE 4RGOH 3EYFB 1WFTA 3GSQB 1U6AL 4NM4H 4JPIA 5AZ2H 4PJ9D 1ZA3A 3V6ZA 2UWEA 1P4LA 3SE3C 1QBLH 1TZIB 2VXSH 4ZG1A 4Q0XL 1MQKL 4U1IA 1XT5A 2VXTL 4M7LH 2EH8L 2GJ6E 4UQ2B 2NTSP 5FUCC 4F7PA 5A1AA 4G9FA 4BSJA 2BVYA 3GM0A 4NSKA 1GGUA 1KV3A 3AU1B 1V3MA 3ILQD 1LP9E 2Z91A 3C8DA 4H8WH 5DZLA 3T8XA 2VO5A 1KCVL 3MUGB 5HPOA 4CNIA 4OZGA 2JB6B 3DRQB 5C0EB 4MJIE 3DX9B 1MJUH 2WNGA 2AKRA 4E0RA 1BQHB 4ZS7H 1JGLH 3SQBA 4G8EA 2YSSB 5ID0A 5JLZB 4PGCA 2X4SA 4DKEH 2VLRD 3BKML 3MRGB 2L0DA 3CCHB 3PHSA 3DVNB 2FGWH 3HE7D 4QHNB 5D8JH 4S1RH 3UBXG 1NBYB 4FFYH 3D0VA 3I75A 4HJJH 1J0IA 4LEXL 1JRHL 1RHHB 2JCCF 4OTXH 1F00I 2A1WH 3ULSB 1MF2H 5E9DA 1P4IL 3SBWA 5DJDB 2ITDA 3T2NH 2YUXA 1SEBB 3L9RA 3BEWA 2WAHA 3DHJA 3FN3A 1GSMA 1PVHA 1QSEA 2VITB 4P9HC 4KGLA 4MWFA 3U1SH 4YDIH 4O2FB 2E7HA 4NN7B 4PJCA 2V5TA 5IBUB 1A7OH 1W0VB 2DM7A 3NCBB 2OQJA 5TF0A 4HXBL 2MQCA 3HUJF 4LARL 3CC5B 3QUKB 1DN0A 3QEQE 3IDGB 3INUH 5I1IL 4EI6A 1TNNA 4NZUL 4FZ8H 5A40E 3B2UC 4QRSA 4N0UE 4GBXD 2UZIL 5EB9A 5C0FB 4NPYA 3SDAA 2Z9TA 3MOQA 4UIMB 3FQUB 3F7QA 1A7RH 2Q6WB 5HDBF 3D39A 1NCNA 5IUSA 4OCXL 1FYHB 3KPSE 1OF2A 1C5CL 1NGXB 4LGSB 3QCTL 4HWEL 3NH7L 1CU4L 3QQ3A 4XVTL 5GGUA 3MLTA 5IB2A 1CF8L 5DRNA 3BUTA 4O2EB 2XQYG 3VXTA 3B5GA 3DBXA 3QUZA 4FQIL 4G6JH 3NFSL 1CD1B 2VLMD 1ERNA 1NFDB 5EU4B 1FLTX 1TENA 4HZLA 1KG0A 4KJPC 5ALCH 3C5ZC 2V9QA 3E8UL 2Q8BH 4B0MM 2XFXB 4TVSa 3OR6B 4H0IA 3D3VE 4JB9L 4MD4A 3K8MA 5F21B 5I1DB 3PGCB 1NBZA 4RGNC 2XN9E 1GXEA 3DUSA 1QEWA 3GJFK 1LO5B 2KQMA 1CLOH 5LBSH 4O5LH 5AEAA 1MELA 4JHZA 4YIQB 2YRPA 3SDDD 1SEQL 3RHWK 4P23C 1A3RH 2HFGH 2R1WA 2GQHA 4ZYKB 4P3CL 3VI3E 1NSNL 1XMWA 3KPMB 2NXYD 2A77H 3ZKMC 5IB5B 1ZSDB 1LK2A 4J12A 2E9JA 4OZFH 4WEUD 5TFSH 4M1CD 5JHDA 4L4VB 3HC3L 3OX8B 2XZZA 3L1OL 4AH2B 1SJHA 4JPIB 3U0WL 3O2WH 3V6ZB 1ZA3B 4NQCB 1QBAA 4AENB 1YEFL 5FYKD 4K7PX 4U1IB 3P73B 4KROB 4ELKB 2DKUA 1ZK9A 4OI7A 2KDGA 2QTEA 1AP2B 1U8NA 3PP3H 3HPLA 1NCWH 3WN5C 1KC5L 2BCKB 3GSXB 3KJ6L 2QADD 2D7PA 5E2VL 3WIHA 3PQYA 5E99L 2CKBL 4K94C 3BT2L 4D94A 3I6LD 1J8HB 2XY1A 4WFFE 3RX7A 4O9HH 4ZXBB 5B22A 3WHXA 4JQIH 3TBYB 4PUBH 1OPGH 4RFNC 2A38A 1OD9A 2G75B 3DIFB 1KB9K 4G8EB 5C0BD 5ID0B 4W6WB 4LCWE 1C16B 1T1XA 2QSCH 1ZLWK 4WEMB 3RVTC 4NQDE 3GBLA 3EJYD 4MXQC 5GISL 2X5PA 1YNLL 1PY9A 1TVHA 1OARL 4XPTH 4I5BB 5EU3A 1BVLB 1KNOB 4IRZL 4L4JA 1WT5A 2A2QT 2OJZL 2IFGA 1IM9B 1LDSA 4JM2F 3ULVH 1I8IB 3MJGX 3NA9H 3KLHD 4OCRL 1JV5B 3QCUH 4G8GA 3MV7B 1D6VL 4KTYA 3N9GL 4D9RD 3DO7A 1DSFL 3HR6A 4JANA 4I0PA 4YZFE 2ATKB 2X9XA 3TFKD 1NLBH 4ODVL 1FBIH 1FORL 1F6FB 2H8PB 4JQXA 2OQJB 3O6ML 5BRZA 4X9HA 4HJGA 4UNUA 3C2AL 3RWEA 4DOHE 4HQQL 2Z31D 4FQ1H 3V52L 1S7VB 3O4OB 3N85H 4PJXF 3MRRA 1K5NB 4EI6B 2P1YA 1I3RB 4LSRH 4JKLA 1H0DB 4MXWH 4ODTH 2VXQL 4JGMA 3EFDL 3MRQA 5H37H 4NPYB 3UXFA 2AS5M 2DQGH 2E7LA 4P2QE 4X0KB 4C56B 1I9IL 2JIXB 4ELME 3MNVB 3D39B 1UM5L 2C1PA 4NUJA 3L3KA 4FNLH 1TVBA 3VXQB 3LKPB 4D9LH 1FVCA 5KAQF 3QQ3B 5IB2B 3MLTB 2OXHA 4AMKH 4RA3A 2PR4H 1YDPB 3P0VH 1SVZA 4Y19D 1CFQA 3QUZB 4YXLH 3LCYA 3Q6FB 5D93C 1G9MH 2GK0A 5FO7B 3WEXB 5CLWA 1T0NB 2Q20A 4AZ8A 2E3VA 3RDTB 3GI9L 1VKXA 3G5VA 1KG0B 4Q74A 3DX8A 3OPZL 4R9HA 5J12C 1FZJA 2CGRL 4YDLB 4GG8B 3EHBD 4OD2A 4U6XB 4YE4H 1R5IB 3N1GC 1NBZB 3NTCH 1E27A 1WAAF 3OG4B 2V9TA 4UNVA 1BFVL 4WWKA 4TQEH 1EGJH 1O7SA 2CUHA 4TSCH 3LS4H 4BFEA 4LCYB 4CMHB 1T6VN 4HC1L 1S8DA 2R1WB 1WZKA 2X4NA 2PCPB 2DIJA 3RWFB 3JWNC 3LEVH 1LK2B 3RVXC 2B1AH 3VXSA 2GIYA 1Z0MA 2QQKL 4ZUSB 4XMLH 2IMNA 4KI5E 4XBGA 5BV7C 2ARJA 3MXVL 5D5MB 1UWEL 1NQBA 4XP5L 3X12B 3LIZH 2WQ8A 1Q1JH 3G5YA 3RWDB 1CT8B 5DJ6A 3NZ8A 2E7MA 4M1GL 4EQ3A 4XAWH 4JHBA 3VXNA 1FDLH 2A0LD 4QOKE 4FXLA 1N8ZA 3GRWA 3PQYB 4TNVK 1L7TL 5CKGA 4F2MB 1JZ2A 3CFJA 5I19L 3NFPB 1CVRA 3E6HB 1PEWA 3MV9A 4U1SB 3RI5K 4J3TA 1WCBA 3N50A 3LZFL 3BWUC 1TTGA 5BO1L 1K3IA 4GAJH 1U3JA 4OLWL 4W4OC 3KPOA 1G7HB 3AAZB 1YYMH 4OZFB 1GC1H 2VDPH 5HGAB 5GGVL 1HHIB 1HXYB 5HHOD 2Y9RT 1QHPA 1RZ7H 2YN5A 1G7PB 4U1NB 3JVGC 1JHTA 2F8VA 4FFWC 5CWSA 4M7ZB 4LLMB 4GO6B 1FL3A 5BOPA 3S96B 3RUGF 4CUCA 1FN4B 5IEHA 4A2LA 3SKOA 2YA1A 5ERWA 2D9QB 1YN7A 6FABH 1HYSD 5LAXA 3I02A 4FXKA 4JANB 3LAFA 1E6OL 1E6JL 4JFZH 4FQPA 1V7MH 1DQLL 1HE7A 5TJWK 4MB3A 1VERA 1ZT4A 1NAML 2FLRT 4Y4KB 3C8KA 4LPUA 3VFUA 1S7QB 3CSBA 3G6DH 3RWEB 3VFRA 1L4IA 5D7SL 1YEGH 4BH7A 4E41A 1CLYL 3QDME 5C7XH 1OAXH 2VKWA 3TIEB 3UJIH 3P0GB 1BJ1J 3G6AA 3MRQB 3V6OE 3JWOL 1FVDA 5GRJH 4LGPB 4I2XB 4JO4L 5HYSA 5K9KA 5TH2A 3OKEA 3WXVL 3V8OA 3QIUA 1C1EH 1NCCH 3L3KB 3QO1B 1YPZE 2BSRA 3N1QC 1CXKA 3ARBA 4R2GD 4XWGL 1AJ7L 4YLQT 3DJ9A 4TNWK 2G5BA 1R3HB 1FVCB 4GOSA 2HTLC 3KYKH 2QSVA 1NLDL 3BQUC 4ZUVA 3VXUD 4QHUA 4L9LA 5GRVK 1CXHA 5DD1L 1VFBA 4GH7B 4EBQL 3U9UB 3FZUC 3TYFA 1MCWM 4H5SB 4KRNA 1G7JA 3G5VB 2AXGA 1H8NA 3DX8B 1J0HA 1G0DA 4PJ7F 3QRFM 4OB5H 1M7DA 1FZJB 4DKFL 4QXGL 2HN7B 1G9NC 5B39B 5HGGS 3U7AA 1E27B 1S7RB 4XCEA 3H3KA 2DL2A 1RI8A 1MRDL 1N4XL 1DQMH 1SY6L 3MV11 4YHYB 2OK0H 5EZIL 5D1ZC 1XGQA 3RWHB 1PSKL 1DL7L 3LV3A 5E1AA 2X4NB 1UC6A 5GGTL 2CD0A 2IAMA 3VXSB 2F5BH 2WINB 2PUQT 1GJIA 5EO1A 5ESAA 5HYJB 1F6LL 2ARJB 4KQ4H 4JY4A 3KHOA 5D2NB 4ODSH 5C6WH 1CIUA 3LN9A 2BVPB 1T0MA 1RMFH 1HWGB 1IGTB 3MJ9L 3TA3A 3G5YB 2GTWB 4DTGH 4H1LA 4OM0H 3G6JE 3K81A 3MRIB 2VB5A 5DVNA 3BZFA 4Q6YA 4R4BA 4LQ1A 4OF0A 2GY5A 3VXNB 4F3FA 4S1DC 1FRGH 4M7KL 2Y06L 4KTDL 5JW3L 1KTDA 1I9EA 5TDPA 5K9OA 3VW3L 1JNHB 2OM5A 3TBVA 5SWZE 4XWOD 3MBXH 5FUOL 5ILTH 4P9HL 2YC1A 1N5YH 1IEHA 3AROA 3VFOA 4LCCC 1A7NH 1UYWH 1QSFE 2UY7A 4RGMB 3TZVD 3F5WA 1XR9A 4WI3A 3RGVD 3T0XA 3ROLA 4L4TA 5EBWA 1F4WL 5KBNC 4HS3B 2I9LB 5T33H 4ETQA 5H2BB 1UWGL 2R2BA 5DMJB 2ERJC 4K9EH 4TSBL 3DSFH 2J8UE 1SMOA 2O5YH 2BSSB 2C3XA 1SM3L 1YN7B 1A6UL 3QEGH 1OW0C 1Z3GH 5LAXB 4PV9A 1IAOA 5DSCA 2CQVA 3SKMA 3CUPA 1CXIA 1RZGB 3LQMA 1HYRC 1FLRL 1EJ6A 2VDOH 1ULVA 4KVCL 2X89A 4PJ5A 1ZT4B 3JTSA 2ZJSH 3S3PA 2OYPA 3VXMD 1HOCB 4QRPE 3VFUB 4CADB 5E2UL 4E41B 3Q1SH 4GRMA 1AE6H 4RWHA 4KK6D 3CJJA 1D9KC 3C2SA 4WCYL 4NQVA 1FVDB 1D5IH 3BN9D 4IOFC 3MLUL 4K23L 1VACB 5DMKA 5IMLB 3BGMA 5F6HJ 5DQDL 5ALBH 1ZLUH 4L5FH 4Y1AD 1IC7L 2J8OA 4K71B 3I3DA 1ZHBA 3SCMA 5EFIA 1FNSL 5EZOH 5MEQA 2YKLH 1YNTA 3SE8L 3RVVC 5L2JA 4ZUVB 2R39A 5C09B 2XG4A 4L9LB 1KT2B 5JXED 3HRZA 1VFBB 4JKPH 2OX5A 5EN2A 4ZUUA 4EZMA 1IEBB 1NCBH 3H7BA 5J7CC 2ARWA 5CZVH 3BIKA 1RHFA 2C1OB 2OTPA 2DI9A 2AXGB 1KENH 3UC0H 4Z7OF 3V7MA 3QWOA 1LWRA 1QQDA 4TVPE 2Q7YA 1I85A 1IAII 1T3FB 1XGTB 5F1NB 4XCEB 1F02I 1CGTA 2ZCKH 1LE5A 2LU4A 5LGHL 4L8SA 1T7XA 5EU7E 3SOBH 2F53D 4OZHE 3EUUA 1XGQB 4RWYL 2J7LA 4HH9A 5C9KA 3TLRA 2AGJL 2FBJL 4ODUA 4JZJC 5D4QA 4WJ5A 5EZLA 4X6CE 1WC7B 2IAMB 5CILL 2CRMA 4HIXH 3T3PF 2EDOA 5EO1B 1FYTA 5ESAB 2VL4A 1EK3A 3EJZD 3UAJD 3T0EA 4HEME 3FO1B 3QDJD 5E94A 3QQ4A 4XNYH 3TA3B 1J0ZA 4P4KC 2AK1L 5MI0C 2PXYD 4M48H 3BZFB 4NQED 3P0YL 4R4BB 2MCG1 4OCWL 3ZTJH 4F3FB 3HNVH 1PEZA 2NPLX 1KTDB 3NPSB 4JRWA 5L6YL 4APQD 2AVGA 4GS7B 4RQQB 3SDCC 2KKQA 1KPUA 3NIFE 3VFPB 1D5ZA 4G43B 1PLGH 3T2OA 2P4AB 1H3VA 5CGYC 5F7DA 4LKCB 1WLHA 1ZMYA 3D85D 3F58L 1SQ2N 3CXDH 3B5TA 3HC0A 1KXVC 2B39A 4ONFH 3ROLB 4L4TB 4KTEH 3UTQA 2HTKD 1YQ2A 4ETQB 4JREC 3UYPA 4LIQH 2ZUYA 4Y2DA 4L8DB 5F8RC 2GJJA 2RCSL 1CG9A 3CPLB 2F58L 5EBLA 3PGFH 2DL9A 2NNAA 4LLUA 3VGHA 3JBG7 3AS2A 5DVKA 3OB0K 3IXTB 5C2UB 1EFXA 2B0SL 3VFMA 3GEWB 3VXRA 3SKMB 5E4EB 3CUPB 5IG7B 2Q76A 1V7NL 3QP3A 1GGBL 3O9WC 5AAMA 1MIEH 1TZHB 4PJ5B 3P11L 4KVNH 1DDHA 1X4YA 3QULA 4WW1B 2DLTA 1MJ7H 2B4CL 1MAJA 1MWAL 3VRJA 5I8EB 5E2WH 4M1DH 3QIWC 3THML 2YPLB 4GRMB 1G0YR 2HFFA 4PP2A 4ZFOL 4Z0BH 3AM8A 4QNPF 3HAEH 2DD8L 2EDQA 2YD8A 3PDOB 5F6IB 1S7WA 2FX7L 2H2PC 5DMKB 3BGMB 3GSVA 1VENA 2H32A 1LD9B 4R4FH 3KJ4C 2ZUQB 1ZHBB 5FB8B 4OFYA 4HDIA 2C3WA 3SCMB 3IYLW 1BFOA 1K85A 5EFIB 3SN6N 5MEQB 4QRRA 4ZAKA 3JV6A 4ZUTA 2PETA 2HJFB 4MAYB 2J8HA 4HT1L 3HZKA 4PJIF 3TO4D 4P2RA 4BZ1H 4ZUUB 5C2BL 5KW9H 3H7BB 3O2DL 4L3ED 4JRYB 3MLYL 2G9HB 4BSWA 4LPYA 2ED8A 3WBDA 1WVZA 4JZNA 4ZFZA 2OR8A 5LGJA 1J18A 4RDQG 4PY7B 1BQHG 4Q0XH 2Q7YB 2VXTH 2D7MA 2EH8H 5D5MF 1AHWA 1KXTB 5D7IE 4PJHE 5DJ0A 2EDWA 3QQNA 1V8HA 1LE5B 2FYYB 1N6QH 2C9AA 5I17A 4O51A 2M1KA 2R4SL 1KCVH 3PWJA 4Z7VF 1FNEB 4YEFA 2X41A 4LFHD 4ODUB 4Z78A 3MBEA 5EZLB 2O61B 3WO4C 5LJYH 1QP1A 1S9WB 3HLAB 2W1NA 1A0QH 2FJFA 5KVEL 5FYJD 3BKMH 1YECH 3S9DB 1MCQA 3JV0A 3QDHA 4WW2B 3QFJA 4PGBA 5KS9E 2NY7L 1OL0A 3H2WA 3HMXA 1B90A 4LEXH 1JRHH 4N5EC 5FYLD 5CEZE 4CGTA 1P4IH 4MMZC 4ETYA 1A64A 1EAJA 2FX8H 3FQXB 4IMKA 4MQTB 4K8RD 1KPUB 1CICB 3WDJA 4WO4A 1D5ZB 1AY1L 1N5AA 4K7PL 1SVCP 4KROD 4CMMA 5FGBC 3RNKA 4G9FD 4HXBH 3RP1A 4LARH 1SYSB 5EWIL 5I1IH 5ID1A 3K8LA 3NCMA 4RISL 5I75B 1DJSA 1NGWB 1J8HD 2UZIH 4ZXBD 1QLFA 5L7XL 2BHZA 5E08L 4LFHG 4DN3L 1WUNT 1HQ4B 4RIRA 1X9QA 4YC2B 3GO1H 4OCXH 5KSUA 1FZKA 5DK3A 5F9JA 1QR1A 5FO8A 2VLRE 1QNZL 1C5CH 4HLZH 5JNYA 2OMNA 1CQYA 3QCTH 4HWEH 3NH7H 4ODHL 5JZ7D 2EDNA 1CF8H 3V7AG 1ZHKA 4G6AC 4OGZA 1A1OB 3VRJB 1KEML 1I3UA 4N1HB 3NFSH 3OTTA 4OQ1A 3D18A 3ULVF 3ARDC 1RUML 1UB6A 2HFFB 4GSDL 2YPKA 3GNMH 1Z5LA 4NQUA 5BQ7B 1OQOA 1UVQB 1F90L 4GG6B 4BFGA 4UT9H 4JB9H 1QSED 1LO0L 3NA4A 2RQ8A 4FQJL 4C83A 4ZOAA 2P5WA 1G9NL 1UACL 4S11A 3GSVB 4LQFH 2VN4A 2OI9B 3M17B 5GGRA 4HDIB 2NY2C 1SEQH 1W0YT 3KPTA 4ZAKB 4P3CH 1NSNH 4ZUTB 3PHOB 3V5KB 4WHDA 4BQ6A 3HZKB 1I1AC 1NFKA 1BM3L 3SDAD 3EGSA 3QJHA 4RMRA 3DPBA 2BNRB 3HC3H 2IC2A 3GDBA 4WFEE 3U0WH 4BSWB 4OLXL 4OZIE 3D39D 3RL2A 4ZFZB 3EYUH 1YEFH 2HVJB 2QJDA 3C6SB 3QIBB 4KKBD 4YAQB 5ITBL 1EZVY 5M95B 1AHWB 4LMQE 5DJ0B 3HZVA 1Q38A 2MWCA 1RJYA 5MENA 2JJTC 1XGRB 2R8SH 3HAEB 3PJSA 1J87A 1KC5H 3QUZD 4ZMAT 3KJ6H 3D9AH 5E2VH 3IDYB 2ARJQ 5E99H 1EEZA 2CKBH 4XRCA 3P30H 3BT2H 3QPXL 2VJXA 2IANB 3NCFB 4Z78B 2DQIL 1H5BC 3G5XA 1CLZL 1PKQE 1A9BA 1VGKA 1HSBA 4PY8I 3V4PH 3UX9B 3WJLA 4X5LA 4V2CB 5GISH 4KK9D 4PGBB 2XPGA 1YNLH 3CFEA 1NGYA 3LEXA 4RZCA 1I3VA 1OARH 3WFZA 1EPFA 4IRZH 2OJZH 3S35X 1SJEA 5DJAB 4HFUH 2P7TA 4G8FB 4KHTL 5M7QA 1AO7A 4OCRH 4KI5C 3PGDB 4KHXL 1D6VH 1MCLA 3N9GH 1DSFH 4OLUL 4LRIA 1GZQA 1URLA 3S3JA 4MQSB 1N5AB 4ODVH 5FYKE 1WSST 4HKJB 4U6YB 1FORH 4P3DA 1RVFL 4XP9L 4C54A 1GHFH 3O6MH 1I7RA 4Y4HC 4ZTOL 1MCKA 3C2AH 4HQQH 1BZ7A 2EZ0C 3V52H 4X9IA 3VDAA 1IKNA 1M05B 5ID1B 3MV01 3O6LL 3PQYD 2VXQH 4PRPB 4Q6IC 4LSTL 5L8KB 2HP4A 4QWWD 5FEBA 5IFAL 1IAKB 5DLML 1JWUA 3SE4A 1I9IH 2CXKA 2P49B 4RIRB 1UM5H 4PLKD 5I1EL 5E8EA 5I1KL 3PL6C 5KSUB 1QR1B 1HEZA 2AJ3B 5FXCH 2X4TB 3ARSA 5HVGB 5K9JL 4PJDE 4PV8A 5FYKU 1T22B 2J4WL 2AJUL 1ZHKB 3IDJA 3SGKC 4HUWA 2OL3H 1BLNA 5CJBA 4X9GA 3VFNA 3D18B 2XTJC 5K9QG 1UB6B 1KJ2H 4P2OA 1R3IL 2YPKB 4KK8D 2HKFL 2YR3A 3VWJB 3G9AB 3WMSA 4G8GD 3OPZH 4D9RE 2CGRH 3IT8D 2AEIT 4I0PD 4NO0B 2AQ3A 3EYQD 1BFVH 4WY7H 5GGRB 5BRZD 4YWGL 5LVEA 4AIZA 4KJQC 4P5KB 2CLVA 4HC1H 1IGIL 1MCOL 5HI4D 1JN6B 3BI9X 3ES6A 5IQ9B 4OI8A 2J6EL 5IMKA 3T65A 3V6OC 3UP1A 1IAIL 3VU2A 3OXRA 4PJGE 2QQKH 5D1QC 1I4FA 4MJ4A 5JDJA 3MXVH 4QRUA 3VE0A 5J9PB 1UWEH 4XP5H 5CHNB 2YA0A 1YEJL 5KZCB 1XGPA 1AXTL 2BY1A 3O6KL 5KSBB 2OS7A 1RJYB 4M1GH 4PBXA 3HB3C 3FONA 3DGCR 4ESKA 3PJSB 4AJ0A 3C09C 3ELAT 1K6QL 2NYYC 2APXA 1SHMA 4LP5A 2QR0B 1JGVL 3RVWC 2Z8SA 1L7TH 3JTTA 1U2CA 4XPHH 1UKSA 2VC2L 3OKMA 4MDJA 5I19H 4ENEC 5CP7A 3EOAA 3QQ9D 3G5XB 4X8JB 5I15L 3MODL 1R0AL 3LZFH 3ARPA 3SDXB 1A9BB 1VGKB 1IC5H 5BO1H 2OSLB 3UTSB 1QOKA 1SJVA 3LB6D 1MRFH 1S7UA 4MCYB 2VAAA 1XF3A 2VN7A 1DEEB 4PJEA 5MERA 5A3ID 5D2LB 5FM5M 4WWKD 4C58B 4HGWA 1X7QB 3SEPA 2XPGB 5JW5A 3PWUA 1NGYB 1QTYT 2HWZH 1PG7X 1F4YH 1LO3H 2VZTA 3VXSD 3BWAA 1U8HA 1K8IA 1AO7B 5CJOL 2FBOJ 1QA9A 2Y4SA 1E6OH 5TDNB 1GZQB 3UEZA 1E6JH 3TJHC 4X7TA 3LS5L 4EUPA 1DQLH 1H3GA 1T66D 1INQA 2CKBB 4KXZI 2IEPA 4JY5L 1NAMH 2NY0C 3T04D 3OKLB 2VZ3A 3UPCA 2EC8A 1VSCA 5D7SH 3QA3A 4ZO6A 3S34L 1CLYH 2YOCA 4FZEL 3S5LB 5KTEL 3JWOH 3V79C 2KZ1B 4XB8A 4CU6A 4H26A 4JO4H 4J3WA 4K7FA 3QZWA 4X83A 1EBAA 5HHXL 4PG9A 1WTGT 2NW3B 5FKPA 4XWGH 1HEZB 2EYSA 2WBJA 4P3WA 1MLCB 2YUWA 1NLDH 1KF9B 4M8VA 3IDJB 4YHPA 4HUWB 1QFHA 5C71A 1BLNB 3VCLA 2B5IB 3VFNB 2HH0H 4BQ9A 1B3JA 2NR6C 4P2OB 2F19L 1M4KA 2NY1C 5TE4L 5C9JA 3CSYB 4XNXL 4DKFH 4QXGH 3LQAL 3T08A 3ZO0A 2A9NL 1BD2E 4XI5D 3FO0L 5ETUB 5DJZB 1RIHL 3RY4A 2YK1L 3LKNA 1MRDH 1N4XH 1LILA 3K7UA 1SY6H 1XIWB 2Q3ZA 4OLZH 5EZIH 1FG2B 5MEPA 3BRFA 4E41D 2DYPA 1PSKH 5HHQA 5IMKB 1E28B 3S6CA 2D4DA 1B0RB 1WZLA 5GGTH 5J13C 1QFOA 2NXZC 2FIRT 1I4FB 3E2HC 5HDQL 5I30L 1Q9OA 3VE0B 4NQSA 3QIUD 4RMUA 1CN4A 2H41A 3DVGA 4JJ5A 4HWBA 5DO2D 3MRJA 1HINL 3ARBD 3MJ9H 2A83B 1XGPB 2VIRB 5EO0A 3H9ZA 5DMIL 1CDIA 5E1HB 1KJ2B 3CSGA 4JN2A 3IDIB 3FONB 4WW2F 5BOZG 3VXUE 1UZ8B 5JA9A 1WZMA 3PWPA 4KAQH 3SE3A 4KU1A 5JW3H 4M7KH 2Y06H 4KTDH 4LHUA 4WNQA 3VW3H 3U7WL 3KLDA 4GW5B 5MP6L 3O41B 4BYHA 4POZD 5GRWA 2FO1A 3V2AR 4WUUA 5FUOH 4ZFFA 2P5EA 1RPQA 5ABDE 4MDJB 4HPOL 5CP7B 1JE6A 2EIZB 4YHIB 3U48A 4LRNL 3NIGF 1QLEL 4YHNA 4NNXA 3AUVA 5I8OL 4ZD3L 3MLSL 4UT7L 3T4YA 5DC9B 1K9TA 4FABL 4XZUA 1SYVA 4IIQC 4DN4L 5MERB 4PJXE 5GGTA 1G84A 5JW5B 1Z9SA 4WI2A 1S78D 2DQDL 3PWUB 4WGVB 2G60L 1WBZB 5IROC 3HC4L 5DEGB 3DV6B 3VGAB 2ZSWA 1JPFB 5I8CB 1NDMA 4PD4J 3CK0L 5JXAL 1F3DJ 2ICWI 2IAMD 1SM3H 1U8HB 1K8IB 4X5XA 5IB3B 2ESVA 1QFWL 1A6UH 1XCQB 4YHOH 4QLRA 3B9EA 2H2SD 1IGMH 2NZIA 1OM3L 5HYSG 4X7TB 1FLRH 2BVOB 3TA3D 4KVCH 4MAUL 3V6FA 4FMFA 3QNYA 5E8NB 4EN3B 2QQNL 4KKAC 2VDNH 4V1DA 2CK2A 5E2UH 3HI6L 12E8H 4U1JB 5SV3A 2CDEB 5IGXL 3N1MC 4HMDA 3MLUH 4K23H 3QUXB 1JUFB 4UQ3B 1MNUL 3QZWB 4R0LB 5BS0E 4GG6F 4LLVA 2VXVL 3RAJL 1WIOA 2FEDC 2AEQH 5FKPB 1T80A 2WBJB 1FNSH 3SE8H 3OWEA 4L4TD 1U58A 4NKQB 1ZE3C 3SY0A 4QHMB 5C0CA 3HCVA 1ES0A 1HZHL 3VCLB 3C6LC 1OAYL 1DVFB 3W39A 3Q5OA 1EHLL 1HHGA 3U0PA 3MRFA 5I16B 4MD0A 3BFOA 5C9JB 3L95A 1NAMB 3RVUC 4X6DA 4P5TC 5EUKA 5C08B 2XNAA 2X89D 4PJ5D 4MXVF 3C5ZA 4GAYA 5LGHH 1PZ5A 4H1LG 4JFYA 4U05A 2CLZB 3BP6A 4HUVB 5MEPB 4RWYH 3DECA 4DGYL 4OBRA 4S1QH 4EI5C 4PRHE 2AGJH 2FBJH 3QCVH 3RJDA 1YY8B 2ATPA 5CILH 2CKNA 1X5LA 2K1MA 2OTWB 3F12A 4LEOA 5I9QC 4XHJD 5J1SC 2LAGB 2PTVA 1BMGA 4P23A 5F9OL 3K4DA 4EOWL 2Z35A 1GGCL 3DVGB 4PR5B 4Y1AE 1B0GA 1VFAA 4JJ5B 4ZQKA 2VQ1B 2F15A 3SCMD 2R0ZH 1P9MC 3GUTA 1AR1D 2AK1H 1FQ9C 3QG6A 2D0HA 1FO0L 4YO0A 3P0YH 2XIDA 3QG7L 3H9HA 4OCWH 1A6TB 4OAWB 3DTXA 5LKNA 2EDFA 4RAVA 3C5JA 4LHUB 5FA3B 1UXSA 4E42B 3VRLE 1NGQL 2R2CA 4ZFFB 4JY6A 1NC2A 2P5EB 3GZKA 4JRYD 3AY4C 1YMMB 5IVXB 1JFQL 5IOPA 3WN5A 5IVNA 1S3KH 3HNTL 5DJCB 1F8TH 2LTQC 2HT4D 3QUYC 4RMTA 4PB0L 4ZODA 2HVKA 4TPRL 3MYJB 4Y89A 1SYVB 1OP5H 1R5WB 4ISVA 4L9DA 3WKML 4JEGB 4LDOB 2F53E 3K3QA 3L5XL 4W70A 2BVQB 4X4ZA 1FSKB 2RCSH 1JHLL 4Z0XB 4F8QA 3X17A 2ESVB 4ODXB 5DFTA 1WISA 4M02A 3W82A 1FNAA 1V7NH 1GGBH 3QDJE 4Z7UA 3X14A 1T03L 3P11H 2VMFA 3V6FB 4Y5YC 5I73B 3QNYB 4M5YL 4ERSL 2B4CH 4NQEE 2DJSA 2EE2A 2UUDK 1MWAH 2A6DA 2EEDA 2X70A 3ZT7A 5J3HC 3THMH 2QHRL 1ZLVH 4PJ7E 5E6IA 4OGXH 2V2TB 3OXSB 2DD8H 2V17L 3GBNH 2BFVL 4LNRB 1WF5A 4BSVA 1LDPL 2EXYD 5I0DA 1CI5A 2GCYA 1JZ6A 5C8JA 3S7GA 4GKNA 1M7IB 4I0KA 3ETBF 5D7JC 2VQTA 3DGGB 3WFEL 4HAGA 5CJ5A 1BVZA 1UQSA 5FM4A 1U58B 3SY0B 4JRXA 4JLRB 5C0CB 3RKDD 3EDJA 4HT1H 3K1DA 3TCLB 4Y2DD 1JIBA 5C2BH 3W39B 3PDGA 4ACPA 3U0PB 2MFNA 4CW1A 1BOGA 1RJLA 5D7KE 2VL5B 4EXPX 3X3GL 1MHPL 3IU3A 4XBPA 4X6DB 3VXRD 1B4RA 1M6OB 1MWAA 1ZKAA 2WWMC 1CFNA 3RNQA 4CJ0A 2HFTA 5EUKB 4XHQA 5GGVY 3B4NA 2IH1A 3DHMA 1RK0A 2XNAB 4ZFOA 1UZ6F 4OFKA 3C5ZB 3OKNA 4F58L 5CEXB 4GAYB 3ZDYE 4OF7A 2LVCA 5GZOC 5MEOA 5GPRA 1PZ5B 1F11B 1U93A 3DOSA 4NKDB 5J57B 5KSBF 2R4SH 1Y6KR 2IFFL 2APTA 1UH3A 4DUWA 3OAZK 2RIKA 3L3JA 4NJ9L 3S4SA 2ATPB 1MI5B 3WS6C 5D7LB 2NY3C 3QH3A 4R6UA 3QAZC 4JFQB 1KGCE 1YZZA 1AD9A 5KVEH 1B0GB 1VFAB 1ZVHA 4Y7MA 3SDXF 4HUUA 1IGCL 3HFML 5IFJB 3VFWB 4R7NA 4LPWA 4HS6A 2NY4B 3CMOL 3O2DA 1FPTL 3MRPA 4TULH 4ZAKD 1A7BA 2NY7H 5D2LF 3NCYP 1L0XA 3H9HB 2EXWC 3DTXB 1U91A 2DQHH 4LMQI 1VFOA 4RAVB 4P2RD 1J1OL 4WHCA 3LMJH 3LSOA 3NZHL 5J4MA 2I24N 4JY6B 1MHEA 1NC2B 2BNRD 4K3DL 5E24E 5D71L 1WEJL 4MJ5B 4AK1A 2BX5A 3WN5B 5I74C 1RZJC 1AY1H 5T3XD 5F9DC 4I8DA 3QIBD 3EKCA 3EYOA 3RPKA 2ID5A 5DI8A 3RY6C 1WCQA 5IESL 1Z2KA 4PGEA 1C5DA 3L5HA 4PRIB 1TCRB 4YBQC 1BQUA 1HSAA 2R1YB 4HIHA 4ISVB 1DLHA 4F33A 1EXUB 4YHLL 5EWIH 4S1SL 4QHLA 2IPTH 4RISH 2OMBA 1NFDE 4W4OA 2IAND 4WI5A 5SWSE 2ZUXA 3MBED 2DLEA 3GSRB 2O26U 2BNQB 5L7XH 4LGRB 5GS1C 5E08H 4DN3H 5EO9A 3QDAA 3BGAA 3JUYA 1AQDA 5L2KA 1I9JL 3EOTL 3JWDC 2DAVA 3JVGA 5FYJE 4W68A 2ZCLL 4DZBB 1U8IA 4O2CB 5ISZA 4GUPA 2X7LA 4Z7UB 4O58H 3QFJD 2HT3D 2QKIB 4EKXA 4MSWA 3QUML 3BDYL 2IWGA 3UDWC 3SDDC 3N1PC 1MY5A 1YMHA 5E6YA 5ICZA 1KEMH 1VADA 2VSCA 4R90L 1J0YA 3S35L 1S7SB 3MOBL 1GL4B 3SKUD 5E6IB 4Z7OE 1X5JA 4M1CC 1LE9B 4L4VE 4HF5H 1F90H 4BSVB 4L8CA 1DE4A 4FQJH 1LO0H 5EIIA 4NQCE 2XWTA 1IC4L 4WO4D 4ZPVA 5EBMA 1G9NH 1ED3A 1MCJA 1PX4A 3ZSTA 1UACH 3QSKB 1KUMA 3IFOA 3GJEB 2H26A 1EZVX 4MNGA 3P4OA 5FV1L 1LVEA 3GMLA 4NQXA 5FYJU 1UQSB 3VI3F 5ECJE 3VFSA 4XBEH 2QADC 3WS3A 4HCRL 2YUVA 1XR8A 5E70A 4PIRF 3FL7A 1J8HE 3FAXA 2I60L 5SX4I 2JB5H 3RY5A 4KKLC 1XGUA 5DRWA 4CW1B 3BQUA 4OLXH 2R0KL 4PGDB 3U4EA 3W9DA 1OTTC 5D93B 1MWAB 5ITBH 3OZ9L 1FNFA 2BOBA 2VZOA 2IH1B 4ZFOB 1CDYA 4OGYL 5JUEL 3OKOB 4JFEB 5I1JL 1FFOA 4X7SL 1MFEH 1F3RB 3VXPA 5IMOA 2Q86A 2EDEA 3QPXH 3D48R 1YC8A 1JCKA 2DQIH 4PGZA 1AI1L 3L3JB 3VWJD 1P6FA 4AG4L 5BW7C 3MV7E 4XTRC 1A8JH 1R3LB 3WDHA 1DBBL 4HIIB 4M9OA 4XGZA 3FB6B 1XGYH 4NO0D 5D1ZA 3AREC 2V7NA 1J1XL 2VABA 5CCKL 2G2RB 4HUUB 4Q9RH 5DUPL 2YRZA 4R7NB 4CVXB 1KN2L 2CMRL 4HS6B 3MRPB 1JNJA 4ORGA 1BREA 3PP3K 4X4YB 1QR4A 1EEQA 3MO1A 3UTTB 5AYQA 1VPOH 3CVHL 4PJFA 4NRYA 2AEPL 1Z9MA 2J5LC 3LSOB 1NJ9B 1NMAL 4GRLB 5EU6A 5FYLL 5GS0C 2I9TB 1MHEB 4KHXH 5ADPH 4C56E 2GAZB 3IVKB 1R24B 1RFDL 3W0WB 3D39E 1AIFA 3V8CA 4K8RL 5EA0L 3BGFB 5FHBL 2RJMA 5KZCD 1Q9LB 1RVFH 3V0AC 4XP9H 4KDWA 5MEND 1T1WB 2XOTA 4ZTOH 2YN3A 3DNKA 1YEEL 4HH8A 4FXGB 1D3CA 1JHKL 4QNPE 3WJJC 4QHLB 1CE1L 3O6LH 1CD8A 4LSTH 3Q0HA 3TPUA 5IFAH 1NCAL 3KVQA 2F5AL 3DXAA 5I6XB 2W9DL 2WLYA 3MRCA 4FQQB 3RZCB 2NY5H 5EO9B 3BP5A 1AQDB 3CLEL 1S5HA 4JKWA 2HMID 2BNUB 3ARWA 5I1EH 1E4XI 5I1KH 3SPVA 1W0WB 3Q5YA 4RAUA 2Z93A 4NUGL 5ISZB 5DC0A 4MLSA 5EORH 5K9JH 1BBJA 5CFHA 4FMKA 1M1SA 2J4WH 3MRBA 2AJUH 4R97C 4HUNB 1OP9A 1OW0A 4JFOA 4N0CD 4MD5B 1PG7L 5BZDA 5ICZB 1GCFA 1VADB 4HIJA 3OJVC 1R3IH 1CQKA 4QY8A 2HKFH 3L3OA 3HE6C 1HNGA 4HGMA 1AO7D 1J0JA 4N90D 1BX2A 5D5ME 4L8CB 4HLZG 3RU8L 2XWTB 4ZPVB 3KDMB 1PD6A 2P8MB 1YNKL 2H26B 1U3HB 3K4AA 3P4OB 3GMLB 4YWGH 4IRJC 2VLKB 3P3YA 4P46C 2GK2A 5KOMC 3VFSB 4NZRL 1QHOA 2A0LC 1MAML 3NCJL 2J6EH 3WS3B 4L29A 4S0SD 3PQYE 1ZV5A 5GZND 3ZDXE 1XR8B 4P5MA 5H94B 3CFCH 3A67H 1MCSA 1KCKA 3A6OA 3GMNB 3BQUB 1C08B 4OKVA 2VSDA 3PHQB 1L0QA 1ND0A 3BN3B 3MLXL 4LVNB 3U4EB 3BDBA 4UDTA 4KV5F 1YEJH 1CCZA 5FYKH 1EO5A 3O6KH 1Q9WA 1L0YA 4UU9A 5A43C 1X4ZA 1YC7A 4Y16B 5J0BA 2Y25A 1IEAA 4WV1B 1K6QH 1FL6B 2CJUL 3NN8A 2Y36L 1PDKA 3ARVA 1F4AA 3L3DA 5IMOB 4H0GA 5FO9B 1FG9C 1B9ZA 4P2OD 4UNTA 5EOCL 9CGTA 2FRGP 5C6TL 5I15H 3MODH 5I1AA 3BPNB 1R0AH 1FZMA 4XGZB 3UBXB 4M7LT 2WQRA 5BCAA 3F7VB 2V7NB 5IVXF 1I7UA 1T5WA 1KJVA 1OP3H 4JZJA 4LBEA 4U0RB 1HH9B 3JSSA 5JMOC 1AH1A 2X40A 4Y8DC 4NHUA 3O11B 3FFCA 3VG9B 5JW4M 4OKDA 1AD0A 3LKQA 5HI3D 4PJAA 2D7TL 4PJ9B 5ESQA 2C3GA 1JK8A 1HI6B 1MHCB 4P4KA 4X4MA 1XAUA 4I2XE 3BUYB 3QO0A 1TPXC 5IR1B 4NGHL 1G9EA 4R2GC 5B38A 3O3EA 4JY5H 4UDUA 4KK5C 1BVKA 5DD3L 3SDCA 3ULVE 5IM7A 3S34H 2W0FA 3JUZA 4HKBA 4JM2C 3U6RA 4BUHA 4FZEH 1I75A 5T3ZL 3LDBC 5IK3A 1NBQA 1A1NA 3HI5H 4DK3A 2BSTA 3LEYH 4V2BA 2W0PA 3DXAB 1LP9A 3I2CL 4JFXA 3UZEA 3K2UL 3ULUL 3C5SA 1RV6X 5C0NC 3BP5B 2WUCL 1S5HB 1YPZF 2YD3A 3HE7B 5HHXH 4N8PA 1MSPA 1ZT7A 4ONGL 3LN5B 2ERJB 3SPVB 5F7EL 4LVHB 5DWUL 2FDBP 1MFCL 1QFWM 3EYVA 3IDMA 4ZOEA 1K4DB 1KELL 3MRBB 2FEEL 5CJ8A 5EG6C 4JFOB 5FK9B 4JVUA 3BSZL 5FAAA 5HHMD 4TRPL 1OGTB 3O9WA 3VXSE 4QY8B 1V3LA 5JORA 5HYJE 4F7TA 1YEHL 25C8L 1A4KB 4XNXH 5D2NE 4YEEA 1X5ZA 5HYQA 3LQAH 1CL7I 3QIWA 5IEKA 2A9NH 1XF2A 4GKSA 2NLJA 1RIHH 5JO5A 4FFZL 4MVBD 5EZJA 3HZMA 4GBXB 5JOPD 4HJ0D 4UOW0 3IGAA 2JJUA 1JGUL 4OBSA 1U3ZA 3VJ6A 4XWOC 4GXVL 2VLJE 4OCLC 1IBGL 1JPSH 4K7PY 4U1HA 4X80L 2FX9L 2JTDA 3G04A 2R56L 3BH9A 5E2TL 5HDQH 3IJHB 1CD9B 5I30H 4D2NA 3QEQA 2IQAA 1JI2A 4LSQL 4OKVB 3IAPA 1ND0B 3BJ91 3UZVB 4TNVF 2GT9B 3NCEB 5BMFL 4N0UA 3G6JF 2WBJD 4D0CA 2GJZA 2Q8AH 2X1QA 1GZPB 5DMIH 3RGVC 3KYNB 2HJKA 4UU9B 3O6FB 5HGBA 1KULA 1KSRA 2W60A 3KPLB 3FO2A 3DROB 4YDKL 1C12A 3ZYZA 3U7WH 3L3DB 5F96L 5MP6H 3QISA 1GPOL 4JGJA 3T1FA 4NNYB 1RSFA 5ENWB 5C0RH 4HPOH 4PP1C 5FFLA 1UH4A 5IIEA 1RZJL 4LRNH 1QLEH 2WM0A 4LVOC 2EIDA 3OSKA 3MLSH 3PWVA 5CIPH 5DK2B 1I7UB 5DGQA 5CEYA 1KJVB 4JZJB 4LBEB 2H45A 4O4YH 4G7YH 4EUPG 1RZKL 3PWNA 1KJMA 4GQ9H 2G60H 4TTGA 4OF3A 4E41E 5IHLB 2DYPD 3FFCB 4KK6C 2XN9A 1OLLA 4PYGA 5JXAH 4Z7WA 3CSPA 5F88B 2WWKO 1K3ZA 3OKKB 3U82B 1JK8B 2EO9A 2DQFA 4WFHE 1QFWH 4NC0B 5JMRA 3QO0B 2VERN 2UVEA 2AXFB 1UCTA 1OM3H 2VISA 3QZWG 4FFVC 5KSAC 5CSBA 2FD6L 3WHE0 3O3EB 3QI9C 4MAUH 2ZZUT 4UDUB 1BVKB 5C09E 3RTQC 5IM7B 4NHCL 5JXEC 1FNHA 3PWPD 4BZ2H 4HKBB 3U6RB 4LHUD 4BELD 4I77L 4L3CB 3GRWL 5FGBA 3DYMA 2P5ED 4NRZA 1A1NB 3BMVA 1NKRA 2A6IB 5AUMB 2BSTB 4JFXB 3C5SB 5L0QC 7FABL 3BP7A 2ZOLA 4NP4H 1G7IB 2VXVH 3RX8A 2FZ3A 3V95A 1IQDA 4S2SA 1ZT7B 3WFBL 3Q2CA 3PXHA 4UOW1 3KXFA 4H25A 5DS8A 4MCZB 3VD5A 3EYVB 3O8XB 4XXDA 2MNUA 1DUZA 3FRPA 4BZYA 1HZHH 5GJSH 1EHLH 5F3HB 4AEFA 3RPIA 2Z4QB 5HTSA 2FHCA 3HS0B 2ESVD 3U9PL 5CJXC 4RRPA 4I9WE 3UAJC 2EDKA 1B4JH 1JI1A 3IETB 3QIWB 3ARDA 1XF2B 2Z31B 5B8CC 1ZLUK 2YMXH 1I7TA 4C4KO 2A73B 5JO5B 3U46A 3SO3B 4XAKE 3E3QE 4OZHF 1JVKA 1KLUA 2V2XB 3GSOA 3IGAB 4WEBL 4TTDC 5CBEA 2IADB 3E0GA 3VJ6B 4LHUG 2NMSA 5CINH 2AEWA 1YUHA 4HW6A 4U1HB 3V4UL 2ICCA 3G04B 1FFNA 4R96A 5CD3B 3BKJL 1IE5A 1NDGA 5F9OH 2IQAB 4EOWH 1GGCH 35C8L 1OSPL 3B2UD 3VFVB 3MOAH 4JFPA 4LDEB 4N0UB 4NDMA 2AQ1A 3I3BA 2R23A 3MV8B 3FJTA 2YD4A 4OSUL 5F3BA 4P2QA 5JA8B 4L4TE 2EDRA 3QG7H 4GKZA 5HGBB 4ELMA 5CP3H 2FECI 1T2XA 5EUOB 2JJWA 4KDVA 5C0CD 3UTZA 4S0TD 3FO2B 4P57A 4Z7QE 3X11A 5F44A 2D31A 2CLRB 4Q7DA 5GS0L 1NGQH 5F9WB 1SBSL 2XICA 2JJTA 3MGTA 3NIFF 5JPMB 1JFQH 4HEPG 1PFCA 3WHE1 4GMSL 5IIEB 2AV1A 2AJXL 3HNTH 1IILE 3PWVB 4YR6A 1EAPB 4TPRH 4YDVB 3VG0L 3GJFA 5CEYB 1I7ZB 4PJ5E 1Q72L 4KJPD 1PYWA 3C5ZD 3U4AA 3JZ7A 2Y72A 4Z76A 1H5BA 3WKMH 1IGJB 4JVPA 3L5XH 5D6DC 1I8LC 2YPLE 5DJXB 4ZS6D 2DLFL 4Z7WB 1P7QA 3FQTA 4YQXL 1XCTA 3Q5TA 3CZFA 1MI5D 3GGWA 3T4AA 4MJ6B 2DQFB 4M61A 4HFWA 5D7LD 1KN4L 3X13B 2BRRL 4P23D 1FO0A 1AGDA 4XMKL 4WU5B 3VGDA 3P4NB 1Z9OA 1NH6A 2VDML 4HUMB 1T03H 3ET9F 3BD3A 1ZT1A 1IGFL 2NY4D 2X9WA 3GFUA 4QRTA 4M5YH 2AV7B 4NZTH 3P77A 2IBZY 3EO1B 4P2YA 1G6RL 1MUJA 5I18L 4RAHA 5DJYB 3ZE1F 2QHRH 1E4XL 4LK4A 4OF5A 4LSPL 5HYFA 3QXDA 1EA9C 5CIPB 1WBYA 3STZB 4C59B 1NC2D 4ZDHA 2BFVH 4NRZB 4JRYE 3B6SA 4QF1A 4Y4HA 4JO2L 4WI9A 1LDPH 3TJEL 4JG0L 1CGSL 3CDCA 2ZOLB 2XZQL 4QOKA 5EIVA 2WWKT 3JV5A 3MJ8A 2H9GB 4Q6IA 3PUCA 4S2SB 1S9YA 1AKJA 5HHOB 4TOYH 3KXFB 4H25B 5E5UB 3WFEH 4K3GA 2P8PA 1QSZA 1RZFL 1DUZB 1TNMA 1KYOK 1ADQH 5A16A 1LEIB 5KN5B 2YHGA 3PL6A 4U49A 3RVTD 4MLIA 2X4OA 4MXQD 4GMTL 3MRNA 5DR5L 5GHWL 2JF1A 5JIKA 4F9LC 3VWKC 4LLQB 1RIUL 2I27N 3X3GH 3SGKA 1MHPH 2PYFA 2OTUA 1VEMA 5FOBB 1JF5A 2VUYA 2X09A 5GSRA 3GMOA 3DX7A 4X4XA 2J2ZA 1P2CA 4I3RH 4N8CL 1MREH 3AS1A 3CFBB 3SGEI 2IFFH 3GIZL 5FCUL 5CBEB 1P4BL 4J6RL 5E6ID 3NIGE 4NJ9H 4KY1H 4M6AA 3ZZ1A 1YUHB 5FHAL 1A3LL 1A9EA 4R96B 1YQVL 3MGOB 1JPTL 4NKOB 1NDGB 2DRUA 3QDMA 3V6OA 2IQ9H 3HFMH 4PLJD 1MH5A 1MOEA 4FP8L 2R23B 1RZIA 4LCUB 5D1QA 2RAMA 1F4XH 1FPTH 2R1XA 2EIBA 1QBML 3I6KA 5C86A 4JRXD 5KANG 3MLVL 1YPZA 3SGDI 1J1OH 3VGGA 1OAKL 4C4KT 2D31B 2GITA 4ZXBC 3CX2A 3CLFL 3W5NA 2XV6B 4FQHA 4K3DH 3TH2T 5D71H 1B6UA 2IALA 1DQJB 1L9MA 5EU5B 4UAOB 1ZHNA 1FNGA 3WE6B 5T1KA 1OB1B 3OAUL 4U31A 4QGYA 3GJFB 3JV4B 3W11C 1N0XH 4RMWA 3B3IA 1H5BB 4MNQB 1EJOH 3B9DA 4YHLH 4S1SH 4KDTC 1LK3H 1F2XK 3D25B 4XT1C 1G7QA 1MVUB 1QLRA 3U7YL 1ORSA 4JE4B 4ZUWB 4HKXB 5E8DL 3ZL4L 1WICA 1P7QB 4X5WA 2EIEA 4NOFA 1QVOB 4GG6E 3GGWB 2HA1A 4M61B 1FJ1A 4Q58C 3EOTH 1AGDB 1ZTXL 4H8WC 5GIRB 3MMEA 5C0JA 2ZCLH 4LIQE 1EBPA 4ZTPH 3RVXD 2GYSA 3FO9A 1T6WA 1ZT1B 3BDYH 1CFSA 3QUMH 4QRTB 1S9KC 1CGUA 1MRCL 4Q2ZA 2ZKHL 3O4OC 3P77B 4R90H 3S35H 5TPWH 2AABL 5GGQL 2MHAB 4JM4L 1UCBL 5E8OA 3QXDB 4GRLD 3T77A 1WBYB 2BNRE 3LRSA 4ZDHB 4QF1B 1KBGL 4FQXA 2EKSA 1CLCA 4PD4K 5C3TA 4LAQL 3TN0C 5T3XE 3TZVB 1EEYA 4NN6B 3I6GB 2XTLA 1FFRA 3MJ8B 5SWZA 3MCLL 3KLSA 1NGPL 3ZKXB 1WZ1H 4BQ8A 4JAMA 4ZNEA 1MLBA 2P8PB 3MLZL 4DK6A 1N3NB 4K3JL 4HCRH 1CL7L 3IJYA 4XX1E 3RDTC 1BF8A 3PL6B 2E9WA 4P0DA 2IANE 1X6NA 1GOHA 2I60H 3OKYA 1E4WL 2D2OA 2Y5TA 4PRAB 1P84J 2F74B 1I9RL 2HLAB 2R0KH 2FO4B 3CX5J 3S4SG 5L2KD 3B9VA 4JDTL 4EDXB 2OTUB 4FFWD 4GLRH 3OZ9H 3VXMB 5ISZD 2XTJB 3H8NA 2DOCA 2J8UA 3DX7B 4X4XB 4BQCA 2R2EB 5B4MC 5JUEH 3RWJA 2B7DT 2V7HA 1NAKL 2VWEE 1AGCA 3LY6A 3U36A 4FG6D 5J1AA 3K1KC 4CAGA 1ORQA 4G8IB 1AI1H 1V3JA 1OWWA 2OR9L 2BRQA 4AG4H 1KTRL 5CKAA 1DBBH 3KS0H 1A9EB 4QRPA 3KYMB 3DRTA 1J1XH 3FFDB 3KYAA 5DT1L 3H42L 5CCKH 5HHNA 1ZS8B 4KUCD 1S7XB 3TESA 4HCRA 3EO9L 5DD5L 5FYJH 5F6HI 3RBSA 4M6OL 5DUPH 4ALAH 4XNZC 1MH5B 1YJDC 2CMRH 3MRMA 1NCTA 1QKZL 2VZ1A 3CVHH 4PRPE 5C0IA 3F6LA 2AEPH 3GSUA 4W6YB 3ZKSD 3RKPA 5FYLH 2P46B 4PJBB 1FNLA 5E56A 2HTLD 2MKLC 3BQUD 1DQDL 1RFDH 4K8RH 4TSAH 5EA0H 5FHBH 3AFLA 1FNGB 2YWZA 5T1KB 3FZUD 4IDJL 5ACZA 4JGUA 5HJ3B 5JTWA 1KLGA 3L6FB 2O5XL 5C0DA 3B3IB 1YEEH 2XKNB 3F62A 4ONHB 1JHKH 4M7ZC 1CE1H 3CDYA 3DUUB 1H15A 4U1KA 3QXUA 4KK8C 1UFUA 1NCAH 4X5WB 1KTKE 2W9DH 2Z92A 1FV1A 3GIVB 4LSVL 4N0YL 4OIIL 5F7KC 5IROA 1FJ1B 1KCUL 5D1ZD 1KTLA 2H6PA 3ARGC 3TO2B 4YFLI 1MIML 3G08A 1J05B 5C0JB 1DBAL 4NUGH 3CVHA 4X6CA 4HUKB 4PJDF 4YXHL 1AGBA 4Y4KC 2XWBA 3FO9B 3ZHDA 1U8PA 1CE6B 3TV3L 1CFSB 3QNXB 1PG7H 3TWCL 4XCCL 3HMXL 2AXHA 3C9NA 2EC9U 4NWUL 3DARA 4KFZC 5DGRA 4WDIA 2IBBA 5EU6D 3LRSB 1WWAX 2ICWA 4R7DA 2DMBA 2C3VA 5E2JA 2HAZA 3R1GL 3D85B 4FQXB 3RU8H 5I76A 3GMMB 1P5VA 1UZ6E 4S1DD 5D9SA 4M3KB 3SKJL 3STLB 3T0WA 1ITCA 1T20A 3MRHA 2FJHA 3BISA 1CFTA 1CDHA 5KSBE 1GAFL 4XMPL 3ULVC 5A2JH 4QT5A 1MLBB 3ARZA 4NZRH 3TVMB 5KG9A 1D5BA 3MFFB 1JF6A 1MAMH 3FT2A 3IJYB 4XVJL 4JQVC 4PJGF 2MPAL 1XH3A 3ZTNL 3DXAD 3QQ9C 5EC2B 5DC4B 5F7MC 1ZLSL 3SDXE 3G5ZB 4IRSC 5DMGC 4K07A 3QUMB 5K33A 3UTSE 3MLXH 1JNLL 4CN1A 3C6LA 4G42A 3PNWA 4Q9QH 2AJYL 5D2LE 5A3IC 4KMTH 3KPPA 1JZ5A 3GB7A 1P1ZB 1Z0NA 1KB5L 5AYUL 2Y36H 4P5TA 1BEYL 3CFKB 5EUOF 2IPUK 5IV2B 1UB5A 1ORQB 1AO7E 5INCA 4N90E 1NEUA 5D2NC 1FZOB 5I1LB 3ROOB 3CXHK 4X7FC 2FECL 2MOVA 3DRTB 1RUQL 4F7EA 4P99A 4EI5A 1T66C 3CZJA 3P4LA 1OSZA 4HGKC 2JK5A 5HHPB 4KMQA 2GUOA 2FATH 4IOFD 1E0OB 4OIBA 4OGAC 4YK4B 3TO4B 4YNYB 3BZ4A 3L5WB 3OJDA 4AM0A 2HKHH 4LOUC 1U8MA 2HG5B 1CTNA 1U8LB 3MRMB 4L3EB 5C0IB 1AQKL 2D7TH 4LF3B 5FGCB 1T89C 3FOMA 1P9MA 1LNUB 3F6IA 3LPWA 1JZ3A 3P9MB 3RVVD 2BY2A 4TN9A 2VNCA 2OZ4A 5AWNL 4NGHH 3VXOB 1TDQA 2V5MA 5T5FL 5HD8C 2DWEA 3HNSL 3O3BB 4RGMC 4D0BB 5DD3H 2O5ZH 4LLDA 3O6FD 2FR4A 5JW4Q 3BE1H 3MZGB 2VE6B 1IGYA 4M93C 5DTFA 2B2XL 4GJTB 4X9BA 5IW6B 5T3ZH 1VHPA 1IT9L 3WLBB 3WIHH 3QUYA 4H88L 5D7IA 2EC9T 4PJHA 3F8UB 5FECB 4UV7H 5ACMA 5B3JF 4NZJA 3I2CH 1CD0A 3K2UH 3ULUH 2BMKB 4IS6A 3EDKA 2WUCH 3GSNA 3SDYL 4BUGA 3IDNA 3RWCA 3FN9A 1LEKA 4ONGH 1F58L 3G08B 5F7EH 3L7FB 3QEHB 5DWUH 3CVHB 4OCSL 1P7KA 1MFCH 3QWQB 3UO1L 3REWA 3DMMB 5HSFA 1U8PB 2VDKL 5AD0B 1A7QL 3EOBA 3GI8H 3KPRE 3BSZH 1PZUB 5CS7A 3FFCD 2UVFA 5F93C 4TRPH 5IFHL 3EDEA 5B3NA 2UWEB 1P4LB 1BIIA 5H35A 5KS9A 3A6CL 4P4KD 1Q0XL 4Y5YA 3EW3B 3WNOA 2ICWB 25C8H 2ZP0T 2C3VB 3U83A 5KANI 4F7PB 2ZOKA 4G9FB 3ZE0E 4NSKB 1PY4A 5DO2C 4K71C 5ICYA 2VRAA 2Z91B 3MRHB 5FV2A 3UTPD 5F72S 3T8XB 3BESR 3T0BA 4FFZH 3QXAA 4CNIB 4MB5A 4OZGB 3IFLL 4FQCL 4QT5B 5CD5C 4NT6A 1KEGL 2FWOA 5FUZL 3W9EA 2GW5A 3MJ6A 5KG9B 2AI0H 2AKRB 4E0RB 1U8KA 5D7JA 2DQEL 3GHEL 3LHPL 4POZC 5CGYD 4JHAL 1HDMA 2HLFC 4GXVH 3AGVA 4B41A 1N64H 4DFHA 4PGCB 4X80H 2FX9H 5CZXC 2X4SB 2R56H 5E2TH 1RUKL 1A14L 2ADFL 2BJML 4TUOA 5I66A 2AJVL 4LSQH 5BMFH 1TLKA 1I1FA 2BOCA 3C6LB 1R3JA 4U6HA 3CAFA 3UPAA 3D0VB 3I75B 3O8XD 2HFEA 3P2TA 5E9DB 4MNHA 3HHRB 4YDKH 2ITDB 4Y4FC 3L9RB 2Y7QA 3BEWB 1QSEB 3O9WD 5SX5H 2XA8L 2DQTH 1WQVT 1GPOH 1UB5B 4MWFB 5IJVA 4PJCB 3FQNA 3T2QA 1RUPL 1ZGLA 1RZJH 1UENA 2BVEA 1XF1A 2YEZA 3QIWD 4M5ZL 5ACLA 5F7LB 1GIGH 2SEBA 1DN0B 1OSZB 4G6FB 4IMLA 3WNMA 4MYWB 1RZKH 5B38G 3E3QC 4HMEA 3WS6A 1QSVA 2YD1A 4QRSB 1NEZA 5AZ2L 4L3AA 1ZVSA 3OJDB 3NABL 2CH8A 3SDAB 1U8MB 2H2PD 4LU5H 2VXSL 3NPSC 4L1DA 1UGNA 1NCUA 4YDJA 4GS7C 5L88L 3FMGL 1MCNA 4IEFB 4PJ8C 1OF2B 4U6VL 3QEQD 5GGUB 1IL1A 5DRNB 1TFHA 3V5DA 1T83C 3VXTB 3DBXB 3MV8D 1BPVA