4EI5D

Crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
242
structure length
242
Chain Sequence
b'PKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 242
sequence length 242
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei5D02
4NIKB 4HIIA 3ULUE 1AC0A 1J0ZA 3LVEA 3T2NH 4DGVH 3FZUD 3FFCB 4LBEA 4IS6A 3U1SL 5JXEC 4OKVB 1RV6X 5ERWA 3MLPA 4NKMB 3PG2A 5A2IH 1MCNA 5D7SL 1NDMB 3ILPA 4U6HB 4WO4B 1CTNA 5D8JL 1QNZL 3T2OA 1AXSB 3QULA 2Y7QA 4AM0A 4MJID 4XP6H 4NO0A 5DK3A 2FECL 4E5XB 4Y16C 5CBAB 2EDQA 5I76B 2W9EH 3VFGL 3EO9H 3SE9L 2P24B 3WJLC 3MUY1 1FFQA 4EN3B 4W68A 5IBTH 1YDPB 3P4MB 1IM3A 3D39D 4ODXB 1CZ8L 3QB7C 3ZKMD 2KPNA 1DFBH 3CVHA 3H7BA 4IMKA 5F7NC 1YZZA 3FT2B 2VC2L 2FH6A 4DZBB 3VMOA 4CMMA 3ZTJH 2HG5A 4FG6C 4G80A 1GGIH 1DBJL 1NGZB 3HI6L 1PY4A 3WLWC 5LQBL 3PDGA 2GCYA 1IKNC 5IMKA 1FAIH 3BYYA 4NQDA 4YE4L 1WICA 5FHAL 3DBXB 4OZ4B 2CLRA 3QDJD 2DMBA 3CNKA 2CR3A 3FRPA 4TUOB 2IANA 1S7TA 4HUXB 4BH7B 4TTDD 1IEAA 3BE1L 1MHPH 1B0GA 5BQ7B 3FQNB 1IAMA 5K9JL 1UH3A 4ZSOE 1V7ML 1QHOA 4XGZA 4OIIH 3LHPL 4XP5H 3BPNB 3QPQD 5GGRB 3WDJA 3VW3H 3ZTJG 3IDNB 1LO4L 1GVIA 2Y06L 3B2UC 5J11C 2EDBA 4L8BA 5KANG 4X6EA 2BSRA 2HT4D 4MJIB 5C6WH 5C8JA 4O02L 5D1QD 4MA3A 1AH1A 4L8CA 4KJWD 3OAUH 3IJHA 1XGRB 3LN4B 5I8KL 1IILE 4HKZB 2G60H 4N8PA 2EKSA 5ENWA 3SPVB 1XFPA 3K8MA 5DDHA 4X0KB 1G9NH 5F9AC 3CZFB 2N7BA 3WFEL 1K8DB 1AQDA 5I1LA 2JJWA 1JYXA 1G6RA 2Z9TA 3L1OL 5BVJA 5JUEL 1FZMA 5D7SH 4I4WA 3C60A 3O6FD 4XPFH 1NC4A 2XTJC 5DURB 1A4JA 3L6FA 5FYLE 1QNZH 1MJ7H 1RIUL 4HHAA 3RL2B 4LCIH 2IPUG 2WZPD 4BSVB 2IBBA 1PJ9A 1D6EB 1T1WB 1MPAL 3V5DB 2OTWA 5F88A 4OLYH 3AM8C 4HUVB 1T04A 4RGNC 2R1XB 4R0LB 1UZ8B 4L5FL 2YUVA 4POYA 3WUZA 4P2YA 4LFHG 2NTSP 5E6ZA 4HBCH 2DJ4A 3MROB 5FOBA 4I0PC 1I7TA 3DV4B 2M8XA 5D93B 2X70A 1DANT 3STLA 3UMTA 3HNSL 4RFEB 2WBJA 3VXPB 3LEXB 1V3KA 2VC2H 1YPZF 1H5BC 5DJYB 3QAZC 4LLUA 4N0YL 5DQ9A 3UAJD 1DBJH 4KJYA 4GRLD 3HI6H 3BFOA 3VXTA 5HPMB 2N7AA 3QUZA 1KACB 5EU4A 3S5LA 4WHCA 4S1RH 3C2AL 3IJSA 1KCRL 2FRGP 5JW4N 5FHAH 3VWKC 2CDEB 1U8PA 3NCBB 3SQBA 4RGMC 2FLRT 1M4KA 3OB0H 2IAMB 3U4BL 1WFOA 4C83B 5BV7C 3BE1H 3MRPA 5C0CD 1T20B 1ND0B 4MLIA 4PJFF 4CBPA 2R2EB 3E3QC 1JYVA 2BFVL 1I7UA 1V7MH 5GISH 4JFDD 1A9BA 3LHPH 5DT1L 4WWKD 3L7EB 3O6FB 3HUJB 2C1PB 1OQOA 2ZNWA 3QXAB 4U6XB 3FT3A 3DROA 1KTRL 5DRXB 3P11L 1LO4H 4OZIA 3SDCC 4XBPB 1JGLH 1CG9A 2ZG2A 5D2NE 4FHBD 4EI6B 4N0UB 3QUKA 2MPAH 3KXFD 5IHZA 1TIUA 4JRXE 3O9WD 4LL9A 3BP6B 3HG1D 2LVCA 1LEIA 2FZ3A 1P7KB 5KSUB 4PYHA 1M71B 4L4TD 1I9JH 1T7YA 3H6JA 1HIMH 1WAAE 3L1OH 4LP4A 5JUEH 4IOFC 1H3GA 4U1SA 3EOBB 3W9DA 4K94L 3FONA 5MEQB 3T0WA 1CCZA 1T03H 3BP7B 4FQLL 5CEZD 1U8KB 4CL7A 3T4AB 5ILTL 1MFEL 1OP9A 1E4XL 4Z76B 3OKKA 1MPAH 2H32A 3ULSA 5GS0H 1I9IH 1CFBA 3FO2A 1MF2L 5JDSA 4L5FH 2G5BA 4ZXBC 3EDJA 1QTYT 2OR9H 4LVHB 1CVSC 3OSKA 4I48A 4PJ7B 4MNHB 1ZS8B 1E4KC 2IF7A 2VH5L 4JHBA 2W0LA 4WFEE 4LIQE 1T4KB 1EHNA 4MNQE 2CRYA 4WWID 5DYOB 5C0CB 4HUWA 3UJIL 4Q2ZA 4NZUL 1JZ3A 1TZGL 3V6ZA 25C8L 3OBAA 5E8NB 4H25B 1CFQA 4DQOL 5JW5A 4N0YH 1J05B 4WWKB 4F7TB 1XF1A 4S1QH 4L3EA 1KFAL 2V6HA 3C2AH 1YEJL 4UQ3B 3PV7A 1AGBA 4MA7H 1MLCA 4YUEH 5F6HJ 2VABA 3GO1L 2A0LC 2FGWL 2GT9B 3HI1B 3O9WB 3U4BH 1YN6A 4PJIA 3BT2L 3HB3D 4JM4L 4GW1B 1XGQB 3HG1B 4JDVA 1YJDC 1QRKA 32C2A 1SEBA 4IEFB 4FTVA 4PRIA 5FM4A 3QG6B 5EPMB 3QUYA 5SWZA 1ACYL 4JB9L 4PJDF 2BFVH 1D5IH 2BXZA 5CJQL 4OZHA 5DT1H 2DLFL 2QR0B 3NVQA 4HJJL 4LRNL 3MGAA 5IV2B 4EDXA 4MXVE 4K7PX 1B90A 3P11H 3LS4L 4HIIB 1RIVL 2DD8L 1HH9A 4LBEB 1JHLH 4IS6B 2O93L 1P84K 4DZ8A 3NA4A 5ALBH 1RZ7L 3CDYA 3F6IA 4LSQL 3V7AG 5ERWB 1CGXA 3CFJA 4P2QA 4G9DA 4EUPG 5IROA 2DDQH 4UZGA 1GC1L 1X5IA 2LTQB 2XWJA 3QULB 2B8OT 2EZ0C 1BM3L 3RUGE 2Y7QB 3BGAA 4AM0B 4NO0B 2AJYH 4ZFGL 3MODL 4LDLB 3DIFA 4PJCA 1I85C 1IZKA 1MFEH 4M5YH 2VDNL 2OZ4A 4XC1H 3QWQB 2MWCA 1HINH 3MC0A 4D0BA 1MF2H 4U6VL 1IM3B 4BZYA 3N9GH 4ENED 2ZCHH 3K3QA 3CVHB 3C60D 3BOVA 3H7BB 2R2HA 5FB8B 1MFDL 4CMMB 3DMMC 3VWJA 2O5ZL 2HG5B 4G80B 4PJXE 5F3HA 4NZUH 3FOMA 1C5BL 4NKOA 2HT3D 3ZHDA 1DN0A 1RK0B 4BQ6A 2GCYB 5IMKB 2ZG1A 5T5NG 3WFCL 3VRLF 2CQVA 5GSVB 4DVBB 2CLRB 5DD3L 3CK0L 4QNPE 1WZLA 1JPTL 2IANB 1S7TB 5E2JA 2LAGB 1JBJA 3AAZB 2IBGA 1KFAH 3O3BB 1IEAB 4TPRH 3RVWC 4I18B 2DS4A 2WBJD 1B0GB 4KQ4H 3SO5A 4ONFH 4L4JA 5DR5H 5E4IA 4UB0L 1S78D 3BT2H 4XGZB 5L88H 4Z7VF 2L7UA 1Z9LA 3NCYS 1FH5L 1GL4B 2FJHA 5E99H 1G7JB 1U6AL 5HHOA 1V7NL 4CNIA 5I1GL 2G9HA 1BFOA 3MXWL 2LAAA 3B9AA 4L8BB 4X6EB 5CJQH 3U7WH 1JUFA 4QF1A 4BM7A 4LRNH 4ZO9A 5C8JB 4WFHD 3OF6A 1JMZA 2L4OA 4MA3B 5GZOC 4P46A 1RIVH 1I7RA 4Y19E 4L8CB 1MI5A 3IJHB 5LGHL 3RPKA 2EKSB 4OCSL 5ENWB 3FN0H 2E6QA 4LAQH 1TFHA 1AQDB 4LSQH 5I1LB 1G6RB 3S36X 5BVJB 1KIQA 1FZMB 3SE4C 4KTYA 4I4WB 3C60B 3BN3B 1CWVA 4UAOC 1NC4B 3STZB 1ORQA 4HK3J 4YJZL 1A4JB 1FC1A 3L6FB 4BQBA 2UUDH 4HHAB 2JIXA 4OGXL 1BM3H 1CE1H 3PWUA 5ICXA 1LO0H 2OTWB 5F88B 1MWAA 1T04B 2DQFA 5I1DA 1R0AH 3MODH 1AIFA 4CDHA 5FO8A 5FKAA 4TNWK 4XHJD 3T2PA 5FOBB 3GUTA 4Y4KC 1I7TB 4YHZL 5ECJE 3RZWA 3GIVA 4YHMH 5IP4A 1WWWX 4XMPL 4OQTL 1YQVL 3GRWL 3STLB 5CINH 1U8QA 2IPKA 2WBJB 3UTQA 2A1WH 1DBBH 4P4KA 1MFDH 4LLUB 2O5ZH 5DQ9B 4KJYB 5DF0A 5BXFA 3HC0A 5E70A 1F2QA 2VDKL 5EU4B 3WFCH 4L1HA 5DD3H 5ADOL 3CK0H 1U8PB 5DK2A 4UMGA 1F3JA 5MEPA 5FUZL 4LSRL 5DMGC 4P0DA 3MRPB 3ARDD 2YHGA 5T3XE 2VXQH 1KCLA 3O4LD 3DYMA 4I5BA 1JTPA 1WWAX 3QHZH 4UB0H 4X83A 1I7UB 4GQ9L 3WHE0 3UP1A 5GSRA 5EUKA 1A9BB 1S5IH 1YY9C 5EORL 1JWMA 4XAKE 3FT3B 3DROB 2NY1B 4OZIB 1U6AH 1V7NH 5C0AA 4OB5L 1CG9B 3MXWH 2CK0L 3V0WH 4U3XA 4BYHA 3FAWA 1KN2L 1SBSH 2IPTL 3QUKB 2YSSA 4DKDC 5IHZB 3T0BA 4CRPA 1JNJA 3G5ZA 1WF5A 2R0WL 2UZIH 5L0QB 1H0DA 5LGHH 1NPUA 3S97C 5F9WC 2B39A 1LEIB 2FZ3B 3AREA 1CR9L 1LGVA 4FTVD 1NLBH 4Y0GA 2YMXL 4YDVB 3U79A 1FVDA 2DICA 4X8XA 3GMNA 1KTKE 4CUCA 1FLRH 3UEZA 4U1HA 4U1SB 3RX7A 4Z6AT 3C5ZC 4E41E 2W9DL 3FONB 2FSEB 3WFZA 3IXAA 1LHZA 5TQ2L 5I1CL 4OGXH 3MR9B 4XPHH 3OKKB 1ORSA 2H32B 4G6MH 3ULSB 2VZ3A 3FO2B 5CJXC 5JDSB 2PR4H 4AL8H 2VXTL 5LGJB 1RPQA 4P2QD 1A5FL 2UV3A 1N6VA 4I48B 3DO7A 3I50L 2FGZA 2VLKA 5EH1A 4N1CA 4YHZH 1A3RL 4HS8L 3SDDA 2YD2A 3OG6B 4HKXA 4XMPH 4HUWB 4OQTH 4Q2ZB 3GRWH 3QDAA 4C56E 3V6ZB 2MFNA 4Q97A 1LVEA 1X5GA 2X09A 2CR6A 4JO2L 2OLDA 5TQ0H 3UDWA 5JW5B 4OIBA 1X4YA 1RUKL 4KK9D 2I5YH 3BPLC 5D1XA 3WS3A 2YZ8A 1GZQB 1TQCC 3OJVC 4KZDL 4L3EB 3MOAH 2VDKH 4P23C 2GSGA 2F5AL 3GSXA 3QQ4A 3BMWA 1BAFL 1AGBB 4NM4L 4GKNB 1MLCB 5ADOH 1RZIA 3MFGB 2VABB 5EOCJ 2P5EA 1N3NA 5E2WH 2SEBA 3VXUD 1I7ZA 1YN6B 3HI5L 4PJIB 3QXUA 3O6MH 1EH9A 4LSRH 4MAUH 3VWJD 4JDVB 3JZ7A 4RGOL 3C6LC 32C2B 1SEBB 4PRIB 4FTVB 5SWZB 3QUYB 5MP6H 4TUKH 5IGXL 4GQ9H 3MGOB 4OZHB 1QKZH 4PP1C 2P45B 1NGXA 4PRHE 4M7KL 1H3VA 3QXWA 4OF3A 4EDXB 1BGXL 4NT6A 2AJUL 3OHXA 2W0FA 5C71A 3CSPA 3GMQA 3P0YL 1UA6L 1HH9B 5CILL 1NGYA 2X2YA 5GRYA 4DZ8B 2IPTH 3PGDB 1YPZA 1T7WA 4YHOL 3FFDA 5IBLC 3AROA 1OCWH 3RWIA 2R0WH 1MFNA 3CFJB 4P2QB 4WI5A 1IL1B 4G9DB 4W6XB 5C92A 3TPUA 3IDYC 5C0JA 3EJZC 2XWJB 4LAJH 4K2UH 3CVHL 3MNWA 5HHOD 1VPOL 3A6CH 1ZTXL 3SGJC 5DEFA 4BUGA 3FQWA 4L4VE 3G5YA 4AENA 3OF6D 5H35A 4M93C 3DIFB 4PJCB 1ZLSL 5I1CH 4URTB 4M7JL 4PJFA 2OMNA 4XVTL 1A22B 2QSQA 4D0BB 2FJGA 5H37H 1HYRC 1Y6KR 4QRRE 5EC1A 3O4OB 2NY3B 4PJGF 5E9DD 2K7PA 3I50H 3TNNB 3MRFA 4HQQL 2E7BA 2R2HB 4EIGB 3FN3A 3R8QA 1MJ8H 3VWJB 1A3RH 4HS8H 1C16A 5F3HB 1XGYH 1KSRA 3ARWA 3FOMB 4NKOB 2O5XL 3I6KA 1DN0B 3BJ91 4S1SL 4JO2H 4CMHB 4P5MA 1UWXH 5IWLC 3QXVA 1MRDL 1RUKH 3DOSA 4LSUL 5TPWL 4XMLL 1ZLWK 4KZDH 4RMWA 3U9PH 1PVHA 4QHNA 5I71C 2F5AH 1I9RL 1BAFH 3LEYH 5TDPA 4U6TA 5J12B 2PTTA 1VDGA 4U1IA 2RHEA 3EJYD 1Q94B 5H37G 2Q7YA 3Q5OA 4HAGA 3VU2A 1TQBB 3ZKND 1CQKA 1H3PL 3NZHL 1G6RL 1UB5A 4AIOA 5FK9B 1BOYA 4M02A 5HHOB 2W38A 2PO6A 4CNIB 1DZBA 5IGXH 2M1KA 1T7XA 1JUFB 4JR9L 4QF1B 3L7FA 4M7KH 1ZT7A 1QSEE 4PRPD 3W11C 5B38G 4P46B 4KK8C 1I7RB 1HILA 1MI5B 5F7LB 1MCCA 3P0YH 1UA6H 3EJJX 5CILH 1T2QL 4KRNA 2ICWJ 3QQ9D 2CLZA 4P2RD 4KTDL 3INUL 4XTRD 1KIQB 3AUVA 2GJZA 3M1BA 2VAAA 1OQXA 3U36A 1WWBX 4JO1H 1ORQB 2C4FU 5LCVL 3PXJA 2J5LB 1U93A 2A6DB 2VERN 5EZIL 4M3JA 3ISWA 2JIXB 5KZCD 1IBGL 2BOBA 3CJJA 1BJMA 2FX8L 3MRMA 3E2HB 3PWUB 3MV8D 5ICXB 1FFNA 1MWAB 2DQFB 2OL3A 5I1DB 2XQBL 2BRQA 4ELME 4JQIL 4LSVL 4JQXC 2X89A 1ZLSH 1AIFB 5FO8B 5FKAB 3ARED 5D7KD 4MQXD 4PJDA 3HNVL 3QIWD 4J23A 3VJ6A 1ZHNA 3GIVB 1JHTA 3TO2A 4JLRA 5E2TH 3QUXA 3LPWA 1J0JA 1U8QB 2IPKB 4HH8A 4NYLA 1A6TB 2Y36H 4EZMA 3UTQB 4NN5B 3ULUC 2V5TA 4HQQH 4WV1C 1LO2H 3V0VA 5KAQG 4P4KB 1S7WA 3B3IA 3PP3K 5ITBH 1KJVA 4K8RD 3HC0B 2O5XH 5BXFB 4Y5XA 1L6XA 4TQEL 5IB3A 4DWHA 2D9QB 4JRYE 4G8GE 2MCPL 4LSUH 5DK2B 3MXVL 1F3JB 4XMLH 5MEPB 8FABA 5J1SC 2VLKD 4PRPB 4NPYA 1I9RH 4ZO6A 1HSBA 2J3SA 5HI4C 3CH8A 4BQ8A 2AW2A 5CZKA 1OAXH 5E1HB 2A2QT 4AEEA 4I5BB 4M43L 1FRGH 2E7MA 1H3PH 1WLHA 4HKBA 5GSRB 5EUKB 1L0YA 2AERT 1QLRA 2HFFA 2PCPA 5D1XD 1G6RH 1WTGT 1JWMB 2Z4QA 2GUOA 4UIMA 4KK5C 5C0AB 5KZCB 5SX4H 5ESQA 4M62L 4KI5C 4HV8A 2OMBA 3BHBA 4JR9H 1A7OL 2YSSB 1T89C 3WCYA 3KPSE 3G5ZB 1L9NA 4Q9RH 1H0DB 4DN3L 4NWTL 3B9EA 4X5XA 2A9NL 3AREB 3LS5L 1X5LA 5HI5D 4XB7A 4RDQF 1MEXH 4JPVH 5KSBE 4FQXC 2AEWA 4KTDH 3INUH 2ZPKH 4JDZA 5IMMA 1FVDB 3GMNB 2VDLH 4Z5RB 4U1HB 3HZYB 1SY6H 2G5RA 2YS4A 5EO0A 5LCVH 3IXAB 2AABL 2V7NB 4DGIL 2HVKB 1D5BB 5EZIH 1IBGH 5GGQH 1TNNA 3C5JA 4XNUL 1OGAE 1ORSB 1TVHA 3PQYE 5JMOC 2PW2A 4Z7VA 3BGFB 4LQ1A 2XQBH 4LSVH 2QEJA 5KW9H 1LK2A 3B5HA 1U8JA 3DO7B 2HWZH 1JRHL 2VLKB 5D5MF 4OLEA 3HNVH 3VH8G 2M2DA 3ARTA 3SDDB 4HKXB 3TT3L 3SQOH 1A6UH 4RRPA 2DAVA 3MRQA 3MLRL 3VXRD 5D1QC 3LMJL 1ZXQA 2BSSA 4KJWC 4ODVH 3K1DA 3WS3B 5D1XB 3A67L 4PJ5D 5HGAA 2C3XA 3WL9A 4RFNB 1DQMH 4M4PA 3MLUL 3WN5A 1YEIL 4U7MA 4N5UA 2GSGB 2ZUUA 4RBPH 5ICYA 4JN1L 3QQ4B 2JB5H 2Y25A 2D7QA 4ZFFA 4J4PD 1RZIB 1GGTA 3MXVH 2GIYA 4WJ5B 3VG9C 3KG5A 2P5EB 1N3NB 4IMLA 2SEBB 1I7ZB 4YPGA 3S5LG 2P7TA 1KPRA 5C07D 1IAIL 3KPOA 2CKNA 2JJSC 3O6LL 4KVNL 5JMRA 4M43H 3NCEB 1NBYA 1WIOA 3RKDC 3C87A 3LQZA 3AY4C 1YMMA 1ZVYA 4L8SC 3IDXL 4WEBH 1S8DA 2WUBL 1CYGA 1U8OB 4X98A 3NIDE 5E5RB 1OW0A 4NT6B 3OHXB 2W0FB 1V3JA 2UWEE 2NZ9D 5BRZE 5E00A 3GMQB 1G7LA 2EE9A 1K4CA 2BNRA 1NGYB 4R9HA 3QCTL 3KPPA 1YPZB 1X6LA 4NZTL 3FFDB 4F80A 5M95B 2OZ4L 1AXTL 5DRWA 3RWIB 1HHHA 1KULA 1I1AA 4GRLC 3TPUB 2PUQT 5C0JB 1QSFE 3SO3B 1ZT4A 3V6FA 3MNWB 3QQNA 5J13C 5IJVA 2PO6D 3D85A 4MQSB 5DEFB 1U3ZA 1EEZA 3MLYH 3ZSTA 3FQWB 4D9QD 3G5YB 4OCMC 4AENB 1CLYH 5H35B 5INCA 4YC2B 2IFFL 1CIUA 4PJFB 1NGPL 3KJ4B 5DZOA 4N90E 5ALCH 5GS1A 5CZXD 2FJGB 4J2XA 3C8DA 5C3TA 3FRUA 4PS4H 5EC1B 3JSSA 3B9KC 3GFUA 5AD0A 3MRFB 3FHQA 2R4RH 5D2NC 3FFCE 1C16B 3TT3H 4QRUA 4BK4A 3RDTA 4IJ3B 3RWDB 1RSFA 4P5MB 3P9WB 3LMJH 1CT8A 2VITA 3A67H 1NAMA 1FLTX 1MCWM 1AHWA 3UROR 3VFUA 1YEIH 4W4NA 4QHNB 5I74C 5SWQA 4JN1H 5CSZA 1NLDH 5D2LF 5TDPB 5C0EA 1H9VA 2PTTB 3ABZA 4U1IB 3MLVL 2Q7YB 4I9WE 1OAUL 5TGBB 4GS7C 3OMZA 1CXEA 2XYCA 4KJPC 1UB5B 3O6LH 4KVNH 1IM9D 5B3JE 4U2YA 2C4FT 1AR2A 5I1IH 5CJ8A 1AFVL 2PO6B 3P30H 5DA0B 2VJXA 4PJ8A 3GNML 1VSCA 1HZHL 3L7FB 1IGJA 1ZT7B 3S4SA 4Z7OE 1N0LA 1HILB 3DVGA 1MWAL 3MUHL 4YH6A 4APQA 4JHAL 2F54A 1NAKL 3HMXA 2CLZB 1XT5A 2E9BA 1RUAH 1RULL 5ISZA 2GJZB 3M1BB 4XAWL 3U36B 4XNXL 1OLLA 4OV5A 2VZSA 3IU4L 4G8EB 2COQA 3EFFA 1U93B 3F65A 5C0FA 1INDL 2BOBB 5CHNA 4HKJA 5DVNA 1BREA 2DYPA 3MRMB 3AS0A 4PJHF 5DFVD 1EAPA 5DHVA 4AJ0A 2OL3B 5GGRY 4JN2A 2HP4A 2ITCA 3DXAA 2ZUSA 3KJ6H 3TJHD 4XBEH 1MRFL 2N1KA 4PJDB 3VJ6B 1ZHNB 1JHTB 3TO2B 3QUXB 1TTFA 4MJIE 5IFHL 1GJIA 1I3VA 2G75B 3GM8A 3TVMC 5GGSY 3V0VB 5B8CA 5IHBA 2LU4A 4WNQA 1S7WB 1U3JA 3B3IB 4IHOA 1KJVB 4FFYL 1FBIL 4Y5XB 4FFVC 4BKLA 3O11A 5IB3B 2X1PA 4P2OA 4M6ML 5FA4A 4HPYL 3S3PA 3S34H 2OX5A 2HT2C 1EPFA 4NN6C 1MHHA 4NBXB 2DI7A 3LD8C 4HEPG 1F6AA 2ZJSL 1FNFA 1GSMA 3OB0K 4UT9L 3QDHA 5EU6D 2OSLB 5EUOE 3P0GB 3CFBA 1FDLH 4DUWA 4HKBB 3RPIA 5INDA 2HFFB 1QLRB 2PCPB 1EUUA 2Z4QB 2VL5A 2GUOB 4UIMB 2Z31C 3PDDA 4EI5A 4PJGA 4EIZC 4HV8B 3CXHK 2RCSL 2RIKA 3BHBB 1IJ9A 3Q2CA 1HZHH 1BX2A 3NIGE 3HE7C 3GKWL 2ED9A 1BPVA 3FCTB 2ZUQC 1P4BL 1QBLL 2VL4A 3DX8A 4JHAH 2EYTA 1YNKL 2DQHH 3TT1L 4RZCA 5IMMB 3JV4B 4JDZB 1P7QA 1RULH 3JWDC 1YMMD 3OXSA 1WBYA 2P8LA 4XAWH 4XXCC 4L3AA 3MRNA 5HVFB 5EO0B 4H1LH 3UPRA 2WP3O 4JFEA 4Y4FA 1JPSH 3C5JB 3AGVA 1TVHB 1FE8L 5A16A 4XVUC 4WEUD 4Z7VB 1JGUL 3GGWA 2VAJA 4J3UA 3HUJE 1D6VH 1I1AD 1I3GL 1LQSR 1U8JB 2XXMB 4YZFE 4JZJC 3V0AC 4UV7L 3X17A 4XI5D 4LMQE 2V9QA 3D85D 3SGKA 1MFBH 2NY2C 4RAUA 5ESAA 3MRQB 5EU6B 1VGEL 2E7CA 2Q8AL 5F1OB 3AS1A 2BSSB 1HQ4A 5SV4A 1IGMH 1ZK9A 5F6IC 3I3DA 5HGAB 3WL9B 1FBIH 3DVFA 4LHJB 4YGVA 4XPAL 3WN5B 1QD0A 1T21A 4H1LG 1WFUA 1MQ8A 4QRQA 5E95B 5F7WC 4X6BA 3FQRA 2ESVA 4ZFFB 3MV7D 2R0ZH 4IMLB 1CL7H 4YPGB 2FBJL 3I9GH 2P7TB 1KPRB 1HWGB 5TFSH 2FWOA 3KPOB 4CW1A 5EWIL 4PLKD 2E3VA 4UT9H 3MRGA 3QWOA 4CU6A 2DM4A 2DM7A 1YUHB 1NBYB 4O00A 3LQZB 4DKFL 1YMMB 4PJ7E 3ULVH 1S8DB 5L6YL 3V9FA 3IDGA 5C0CE 2Z35A 5E00B 1R3HA 4HUMB 4ELKA 1G7LB 4NO5A 1K4CB 3ARGC 5CUSL 5C9JA 2RCSH 5DRWB 1HHHB 1I1AB 4NFCA 4NOBA 2H45A 4XPTL 5F8QC 2N56A 1YNKH 2APWA 3V6FB 3TT1H 3P4NA 5HY9A 1L6ZA 4PREA 3O3DA 3D85B 1JZ4A 3PL6A 2R0LL 4HZLA 1IQWH 2IQAA 3LQAL 1MELA 4P99A 3REVA 3O45A 3ARPA 3KHOA 1ITBB 5I1JL 5INCB 3HG1E 5IB4A 4OF5A 2HTLD 5TJWK 2LQRA 1KCSL 3ARDC 4APQD 1KT2B 1FE8H 5GS1B 5HDLA 2VLME 1ZANH 3EFDH 5JW4R 3QIUC 2NY0D 2YN3A 4CU8A 3FRUB 1FN4A 5ISZD 2EDKA 1K85A 3K46A 5E94A 3HPLA 1I1CA 5AD0B 3RQ3A 4ISVB 3JV0A 5JXAH 1EZVX 2WWKO 3IKCA 3TYFA 4QRUB 5FDWA 3RDTB 3T1FA 1A4KA 4DTGL 5IF0B 2Y6SC 3P2TA 1AKJA 1CT8B 2VITB 3CD4A 3PGCA 1G9MC 4Q58C 1NAMB 4MXQC 1AHWB 3VFUB 2Q3ZA 3BPCA 4PFEA 2YXMA 1YEGH 3KS0H 5GRUH 5SWQB 1EHLH 4KAQL 3SCMA 1VKXA 2JJUA 3AB0C 5C0EB 3DWTA 3ECBA 3CSGA 2YUZA 1X5AA 3WBDA 4YFEA 3LY6A 3WO4B 2VDPL 3LSOA 4OFPA 3BQUD 4PJ9A 4XPBH 2ADJA 3RI5K 3TH2T 4LVNB 2XICA 4Z0XA 3Q1SH 2EH7L 3BZFA 3VDBA 3PHQA 4PR5A 1A6VL 1SQ2N 3RIFF 3LPGA 2GW5A 1DLHA 4Q6YA 1GGCL 1AJ7H 5D5MA 3V52H 2AAVA 1UWGL 1FVCA 3R0MA 1F4AA 4HEME 1F4WL 2OL3L 3IDJB 4APQB 3MACH 2F54B 4KMTL 1RY7B 3OX8B 1BD2A 4GBXD 4NQDE 1SJVA 2VNCA 2LABA 4NNYA 4KY1L 2NY0B 1BFVH 1A64A 3OV6A 3TC9A 2C3VA 4HK3N 5ISZB 4XRCA 2IANE 2FO1A 4XPTH 5D71L 1WCQA 2C7UA 2J8HA 3EFFB 5FDYA 5DSCA 5C0FB 2R0LH 1VFUA 4X9FA 2UUDK 3LQAH 5BJTA 1EAPB 1I1YA 1JNHA 1ZKAA 5DHVB 3ZO0A 3ALWA 2YPKA 3GJFA 4JN2B 2FH8A 4BSWA 1OD7A 4NNPL 4YGAB 2N4IA 3RWGB 2ITCB 1L9MA 3DXAB 3V8OA 2EO9A 3O41A 4UOW0 3JWNC 1F3DH 3U4AA 1WZ1L 1EFXA 5EBWA 3S37L 1DQTA 4B7LA 5GS2H 3CFIC 2BVOA 3LEVH 5CGTA 1P2CA 5LWYH 5B8CB 2OBGA 4IHOB 4WNQB 2FX9H 3UTOA 4GFTB 3VI3F 4M7LT 4FMFA 4DTGH 4BKLB 2EC8A 3O11B 4O2EA 5BW7C 1J7VR 4P2OB 4P5KB 4LPYA 3GIZH 1NH6A 5L8JB 4GSDH 3K0WA 4KAQH 1ZMYA 1MHHB 2P8PA 3GJEB 1F6AB 5KS9F 3X12B 2OJZL 4UUJB 3WE6A 1ZE3C 2X40A 3CFBB 4P5TA 3S96A 1FSKB 3NPZB 3RPIB 4X4YA 5INDB 2XA8L 3U0TA 4JM2C 1G7PA 1PEZA 5I8EA 2EH7H 4NFBA 2BVEA 3J7HA 7FABL 4LSPL 4EI5B 4GXUM 4PJGB 1GGCH 2NW3A 2ESVD 3QT2A 3KPLA 4HMCA 1BX2B 2PN5A 1UWGH 3ZE2F 5KVFL 3QH3A 5KSVA 2P8MA 3C9NA 3QQ3A 4LCYA 4N5EC 5KSAA 1VB9A 2VZTA 1ES0A 4ZD3H 4AG4L 1DLFL 2EYTB 5D1ZA 4KMTH 4GMTH 4RZCB 4KY1H 1P7QB 4G43A 3MYZA 3E8UL 4Z7QE 2I27N 3OXSB 1WBYB 2P8LB 3I2CL 4ZUTA 1J12A 1T0PB 4YHLH 3MRNB 4LRIC 5D2LA 2D31A 2DQTL 3UPRB 4JFEB 4OZGF 4QT5A 2HKHL 4Y4FB 4C59B 4KZEL 1G9NC 1EXUA 5EU3A 4M1CD 1TMCB 5A16B 4R4NC 4XWGH 4I0CC 1JJUA 2AEQL 3GGWB 4NNPH 4ETYA 1KENL 1A7NL 2H6PA 3M45A 2YPVH 4IIQC 3UYOD 4CU7A 4OZIE 2BY2A 3GSQA 3S37H 5J89A 3MYJB 4G6AD 3PL6D 4MA1B 2GYSA 3OZ9L 4RAUB 5ESAB 2D7OA 3CMOL 3FO0L 3B6SA 4NC1E 5FYKD 3SBWC 3UTTA 3VGAC 5GGTA 1HQ4B 3TIEA 4DEPB 2I07A 2F19L 4YGVB 4X80L 3JUYA 1T21B 2YA2A 4QRQB 4CDGC 3UZVB 1JZ6A 4X9IA 4X6BB 3FQRB 2ESVB 1Z9SA 2WW8A 4G7YL 4M4RA 2D7NA 2LVEA 1OY3B 2F15A 2FWOB 5MEOA 2D3VA 4PJHA 4CW1B 4MS8C 2OJZH 3V2AR 3MRGB 3QWOB 3NIFE 5BZDA 1ZGLA 3SKUD 4EXKA 2Q86A 3QIBA 1CI5A 1AKJD 5EB9A 4YHNA 1CGTA 1LD9A 1YNTA 4PGEA 3QIWC 3G6DL 4OD1L 5LGKA 3IDGB 7FABH 3EW3B 2Z35B 4HXBL 1R3HB 4JFHE 3RHWK 4ELKB 4NO5B 4UINL 1U92B 4GJTB 5C9JB 4S1DD 5C6TL 1JZ7A 4PLOB 2AXJA 4PJ9D 5F7YC 3RY6C 3BN9D 3VRJA 1FL5A 5E8PA 1Y18A 1PKQA 35C8L 1L7TH 4L3EE 4FQ2L 1DLFH 3T3ME 4A2MA 5CIPA 5EU7C 2DKMA 3P4NB 5J1AA 5HY9B 4PREB 3O3DB 3PL6B 4HZLB 2A6JA 2IQAB 4WFFD 3REVB 3O45B 5F9OH 3N85L 1OAZL 4PJIE 1WITA 1WV7T 2DQTH 5IB4B 4OLXL 1V05A 2VZUA 4PRIE 4FTVE 4KZEH 5SWZE 4MAYD 2X44D 3MCG1 2JLLA 4GRWF 1NAML 1BD2D 1XIWC 3O8XC 2AEQH 4OZHE 2YD6A 1FN4B 1S9VA 1LEGA 1A7NH 4MVBC 3HZMA 5E94B 3HPLB 4YDLB 5IVOA 5I6XB 1FCGA 2VB5A 2VLJA 3P0VL 4M6NL 1DUYA 1BLNA 1JWUA 4LLDA 3IKCB 4OGZA 4RWYH 3TYFB 5FDWB 1A7BA 1XCTA 1NUGA 5GS0C 1KGCD 1A4KB 2AGJL 3FO0H 3M17A 5KVDL 3ZKQD 4WHTA 4P2QE 1MAKA 1OAQL 1AKJB 3OJMB 4R8WL 5D6CA 5HHXL 2GQHA 2F19H 1RFDL 5EA0H 1UWXK 4RRPG 5F93C 1X44A 3BPCB 3KYMA 4PBWD 2EIDA 2DMKA 3GBML 1LDSA 3SCMB 1VKXB 1R3JB 1S7XB 3X13A 3QFDB 1EVTC 3VGEA 1NDGA 3LSOB 1HXMA 4OCXL 4PJ9B 3QI9D 4PJCE 3HMXL 5T5FH 2ADJB 3L5IA 5MERA 3I6LD 1WBXA 1WZKA 4LF3A 4Z0XB 1FGNH 3BZFB 1W0WA 3PHQB 1XCQA 4R2GC 3O2VH 1AY1L 2YD3A 5IEHA 4PR5B 3G08A 3O3EA 4OLWH 1F42A 5F1KC 1DLHB 5D5MB 3IXTA 4JKPL 3CDCA 1VADA 1FVCB 4QGYA 1UEMA 4OD1H 3QWRD 5JXEA 4C4KO 4A6YA 4Z8FL 4UINH 1BD2B 2XNAA 3L3HB 5A3IC 4NNYB 4JQVC 3T3PE 1AD9A 2C3VB 1KELL 3B2VL 4XRCB 35C8H 3NOIA 4FQ2H 1NMCB 4GW5A 3S35H 2C7UB 4G6KH 1NANI 3HE6D 1FL3A 5DSCB 1U58A 1CICA 1EVUA 3BKJH 3W0WA 1LO3L 1I1YB 1JNHB 4N0RA 4PGZA 3QUMA 3ARFC 1ZLVH 3N85H 3IVKA 1OAZH 3GJFB 4BSWB 5EBGA 4KDTC 3WJLA 3V4UL 1NEZA 3ZYOA 5KVGL 4OLXH 3O41B 1MCEA 5D1ZD 5HHOE 4XWOC 1EFXB 5EBWB 2EIBA 4BSJA 4UOJA 2J8UF 2J6EA 1F3RB 2BVOB 3TLRA 2L0DA 5HPOA 5J6GA 1ZV5A 4DAGH 2B1AL 3QI9B 1MI5E 1IKNA 3ARSA 3QZWA 5AEAA 3IFNL 1JP5A 2DQGH 3T09A 2WSKA 4OCNC 2A73A 1NJ9A 3HMWL 4O2EB 5KVDH 5HYFA 3BJLA 4R97B 2NY4D 1NMBL 1OAQH 5HHNA 4XCEA 4KKBC 1RMFH 5HHXH 1RFDH 3LKPA 3ZKXB 3MLTA 2AJ3A 2C5DC 2CDGA 3I84A 4UILL 5GJSH 1BHGA 2P8PB 4DVRH 3BKYL 5CLTA 2J2ZA 5AUMA 4HIXH 1S9KC 4F33A 4HWBH 3TO4C 5HVWA 4K71B 1KIPA 1UM4L 5I1KL 3H42H 3WE6B 1NUFA 3VCLA 4EEEA 4NQCA 4P5TB 3S96B 3SY0A 3HMXH 4X4YB 1T1XA 2DQJL 2L7JA 9CGTA 3U0TB 1F6LL 3NACL 1C5DA 1P6FA 5I8EB 4XZUA 1N5AA 5T3ZH 2LV4A 2X05A 2NXYD 5FYJD 2NW3B 1UQSA 2EXWD 2GTZA 2OP4L 3D25A 3KPLB 4JKPH 3QH3B 4HMEA 2P8MB 3C9NB 3QQ3B 4LCYB 1ES0B 5DHVH 5JQ6H 2PXYA 1U8NA 4Z8FH 2P5WA 4QHMA 2YK1H 5D1ZB 1GHFH 1ZGLP 3F58L 3UJTL 1MNUH 2CLVA 5HGBA 4G43B 1UCBH 1J9CT 3BUYA 3S4SG 1AE6H 2ZNXA 1E4JA 4KUCF 4ZUTB 1Z3GL 5D2LB 3QISA 5IBUB 2D31B 3AM8A 4QT5B 4ODSL 4OI9A 2I26N 4JPIA 2WANA 5TDNA 1EXUB 2NW2A 5HYSG 6FABL 4I0KA 3SDAA 4I0PA 4HF5L 2DQDH 4G6JH 1O5DT 3T0EC 3V4UH 1LP9F 2B2XL 4OF8A 1CXLA 2H6PB 5BS0D 4F15B 4FS0A 3PV6B 5C0AE 5JHDA 3GSQB 1SJHA 5IMLA 5D6DC 1UKQA 1OL0A 4BK5A 3B6SB 5J7CC 4J3WA 3RVVD 3TF7C 3UTTB 1K3ZA 2Y07H 2HKFH 3TIEB 4ODTH 2I07B 3LCYA 5D7KE 1D5ZA 3VWKA 1A14L 3BAEH 3HMWH 4KROD 3KLHD 2NXYB 1NMBH 3WHXA 5J06A 5K9KA 4RBPK 3SDYL 2BJML 3NPSC 4NGHL 3DX9A 5LXGH 4UQ2A 2VLJD 1YEKL 2FL5A 4UILH 4MMXC 2NZIA 5EN2B 5MEOB 4PJHB 2AK4A 4F9PC 4K3EL 4OZFA 1UM4H 2ARJA 3O2DA 5F7DA 1N6UA 4XNZB 3VFPA 1ZGLB 1F2XK 2Q86B 3MCLL 3EIFA 5FUCC 1GPOH 2VLKE 3GSUA 4YHNB 1LD9B 1YNTB 4LK4A 4Q6IC 2P4AB 4PGEB 1MCDA 1U95A 1NBZA 1FV1A 3EAKA 3VXMA 4HUKB 3W9EA 1JK8A 3SKOA 5CFHA 3F8UB 3VRJB 1FL5B 1MJJA 5E8PB 4QYOA 3RWHA 1PKQB 2ZSVB 4FOMA 4LOUC 2VZ1A 3UJTH 3MFFA 1L0XA 1LWRA 4X7TA 1XGPA 4IDJL 5EIIA 1CK0L 4LEOA 4F7EB 1NQBA 3DX7A 2A6JB 1E27A 4U1MA 1PG7L 2P5EE 2X42A 1Z3GH 4D8PA 1HKFA 4NNXA 4RIRA 4PGBA 5KS9A 4R0LC 5HVHB 4W4OC 2XTLA 5JXED 4ODSH 1KNOA 2P1YA 1E4KA 4I77L 4E0RB 3LKOA 1S9VB 1LEGB 3GZKA 2D0GA 2VLJB 1F4XL 1DUYB 1CS6A 1BLNB 1JWUB 1T83C 4LLDB 1BBJB 1H8OA 4Y16D 3MUGA 2HFEA 1XCTB 2F58L 1YPZE 3M17B 2VOTA 4H88L 4WHTB 3OAZH 2ZCKL 5D6CB 1A7RL 4JEGB 2V5MA 4F57H 4JY5H 2YPLD 2NR6C 2VO5A 3JV5A 4Y5YA 3KYMB 1OT2A 2GJJA 5DQJA 3BO8A 4HH9A 4LKXB 3X13B 1JI2A 5F9DC 1JHKH 2R9HC 1FNSH 2EH8H 4AIZB 3SDYH 4FG6D 4NGHH 1KN4H 5TH2A 4OZGA 5I1EL 3WLWD 4YXKL 5MERB 1WBXB 3FB5A 4PJFE 4K3EH 4OSUH 4D0CA 1W0WB 3TJEL 1XCQB 5I19L 5CBEA 5IEHB 1NGQH 1BQLL 3G08B 3MCLH 3N1PC 3O3EB 3OQ3B 5I17A 5DGRA 1OVZA 3IXTB 1YNLL 1T3FA 1S3KL 1VADB 4R4FL 3C6SA 2CUIA 3T65A 4OIAA 1JF1A 4XI5C 4ZUSA 4A6YB 3GMRA 1RJCA 4LLMB 1AGCA 1TJIL 1A3QA 3H0TA 5IKCA 2XNAB 1Y6MR 4KKAC 4NQCD 5GS2D 3N1FC 1AD9B 5C70A 2XZAL 1Z5LA 2RFXB 2YRPA 4G8IA 3B2UD 4LLAA 2A9ML 1LDPH 4GW5B 43C9A 3FT4A 4PB0H 2CSPA 4AK1A 1FL3B 1U58B 4LLVA 4NHCH 4NSKA 4Y16B 1CK0H 3L5HA 5FM5M 1RJYA 3RGVD 1QFUL 4AEIL 4FQIL 1PG7H 1UJ3A 1JFQL 3BGMB 3W0WB 3TBYA 1I85A 5A40E 4Z95L 3QUMB 5KN5A 4PP2A 2R69H 1NEZB 2DQCL 2YPLB 1O0VA 2XN9A 4JG0H 4LVHC 5D7IF 5FOJA 3TCLA 4KI5F 3TN0D 4MGXA 1VA9A 2XTJD 4PLJC 1RZGB 1VESA 3DMMA 2AJSL 5J6GB 1F4XH 3QZWB 4HIJA 5IEKA 4RGND 4UNUA 4OFDA 2AI0H 2CRMA 3WYRA 5H8DA 5B3NA 2A73B 1NJ9B 2Z93A 3EYFA 1FVEA 3DETC 4I0PD 1J0YA 2OTUB 3SEPA 5HHNB 1VEOA 4XCEB 1A7RH 4QXTA 3LKPB 1Q8MA 2AJ3B 4XPGH 1W8NA 2JE8A 5FO9A 5AUMB 4F33B 1REIA 5DMYA 1KIPB 1SMAA 4NQEA 4YAQA 3VCLB 4NQCB 3SY0B 5JOEA 1B3JA 1II4E 3IRZA 4YXKH 1IARB 1T1XB 5J11B 1HNFA 1C5DB 4BZ2H 5ID0B 1NCUA 4PJDE 3VWKD 4XZUB 1N5AB 1M7DA 4OF7A 5I19H 2DJSA 2DQUL 3BDYL 1UQSB 2APXA 4TNWF 2GTZB 4RISH 2YKLL 3D25B 1GIGH 1U36A 5IHLB 1S3KH 5A2KH 2Q8BL 5TF1H 1RU9L 4XNQA 1ZA3A 1R3KA 2PXYB 1U8NB 3NTCH 5DUBA 1TJIH 2P5WB 4QHMB 4TSBL 3SE4A 3IF1A 3MOBL 1QBAA 3KLSA 3X11A 1T6VN 2A38A 2XTJB 5J8OA 2E9JA 3BUYB 2XZAH 2XZQH 1F90L 3SDCD 4CAGA 4OTXL 1G7HA 3LB6C 2A9MH 3IETA 4NQVA 5MENA 4RGNB 1D5XA 2K7QA 2ID5A 5D96C 4JPIB 4ZDHA 5TDNB 5GGTL 3S98A 1FGVL 2NW2B 5ABDE 1JFQH 3VXMD 1AGEA 4Z95H 3MJ8A 3BQUC 5DD1L 3SDAB 4Z7NF 1A9EA 4I0PB 2EO1A 2XPGA 1OSPL 2DQCH 4WTZG 1CGWA 2G2RA 5JHDB 5E03A 3MRHA 1SJHB 4IMKC 4HC1A 4R96A 5IMLB 3S88L 1NCBL 3QAZB 2EEDA 2VR5A 3BZ4B 2AJSH 1OAYH 3OKDA 4KV5F 3P3YA 1D5ZB 4ZXBD 1FZKA 3VWKB 4LHUA 5C08D 3VRLE 3QG7L 2ZWLT 4LEXL 4NKDA 4RGMB 1OTUC 3WHXB 2R1WA 2AJZA 3WHE1 5IT2L 5K9KB 4JFFD 2ZKHL 5BV7B 4OKDA 4HS3B 1RZKH 5TE7H 3DX9B 3RBGA 4JZNA 4UQ2B 4YBLC 2FL5B 4IOIA 3C5SB 3FAXA 5C09D 5C0IA 3TBVA 4YHIA 2AK4B 2D7TL 4Y89A 4OZFB 2ARJB 5F7DB 4Z7VE 3VFPB 1BOGA 3MLXL 3TGXA 3SDXF 3SGEI 3W81A 3BX7C 4N0CC 4J6RL 3U9UB 5MI0C 3SDCB 2UVEA 1NSNL 3GSUB 4OD3L 1U95B 3V4VL 2EE3A 3TIDA 2X1OA 1OARL 2A0LD 1FV1B 2J8UA 3VFNA 1KPUA 4MZ2A 3VXMB 3W9EB 1TITA 1JK8B 3SKOB 2Q8BH 4QHKJ 2ICWI 1G9EA 1Z9OA 1MJJB 3BPOC 4QYOB 3GHEL 3RWHB 3MFFB 3MOBH 3BVNB 4X7TB 1XGPB 5EIIB 4LEOB 1IGYA 3DX7B 5DWUH 3L3OA 1E27B 4U1MB 1F90H 2UZYB 5J57B 2BXYA 4OTXH 4PG2C 4D8PB 2H2SD 4NNXB 3B4NA 3VFWA 2OYPA 1J8HA 2Z0BA 4NN7B 4DCQA 5FYLH 4KKNA 4RIRB 5CJXA 5KS9B 3OKOA 2ZCLL 5GGTH 4Q9QL 1L7IH 1OAKL 1MCOL 1FYTD 5DD1H 1KNOB 1YMME 4XP4L 5HGHA 1KJ2A 4PRBA 3ZDYF 3LKOB 4LCWA 1OSPH 1NKOA 5FGCB 1A7QL 2I24N 5GRZA 5DUPL 3U0PA 4HJGA 4LIQL 4U6YA 2BNRE 3MUGB 4FQQA 5EOCH 2HFEB 1U8LA 3QUZC 1R3LA 5FA3A 3ZE1F 3FB8A 1MCLA 5DHYA 4Y5YB 2QSCL 3PIQA 3I85A 5DQJB 5JA8B 3BO8B 4HH9B 5T1LD 2HYMA 3KPNA 5IT2H 2DKSA 1Y0LA 3DMMD 3V5HA 2NX5D 4A6YL 5TH2B 3C6LA 4OZGB 3EYVA 2FIKA 1IGCH 3H9ZA 3VI4F 3FB5B 3NCYP 1A6AA 1P4IL 2APBA 2D7TH 4NRXA 5CD5C 4D0CB 4M1CC 3ZZ1A 1QG3A 1P1ZA 3MLXH 4Y4HA 5CBEB 1XF3A 4D0DA 1LP9A 4FFWC 2FEDC 2NY1C 4J6RH 1TVBA 3BYTA 5FEBA 1RZJH 5CIPH 5I17B 3BIKA 2BHYA 2NLJA 4OD3H 1T3FB 3RVWD 3V4VH 3C6SB 3MRIA 2NPLX 1JF1B 4N8CH 3QUML 1OARH 4ZUSB 1AGCB 2FD6L 1F58L 5IKCB 4NQED 1EFQA 1DP0A 1FYTB 2DQIL 5HHMD 5CEXA 4NRYA 4GAGL 4POZC 2WINA 1Z5LB 4G8IB 3RRQA 3DRQA 2VLLA 4QOKA 3TP4A 3GMLA 43C9B 5K9QI 2J6EL 3FT4B 4LLVB 4NSKB 1CLOH 1RJYB 5GZOD 1IEBA 5FXCH 1UJ3B 3CFEA 3TBYB 2F8VA 1NCDL 3HC4L 4NCDA 2DBLL 1KCVH 3ROOA 2RQ8A 2ZCLH 5DLMH 2F5BL 4Q9QH 2FX7L 2XN9B 1TCRA 5IVXF 1AR1C 1IGFH 3TCLB 1J1PL 5T1LB 1RZFL 1HWHB 4GAJL 5K33A 2JELL 3DMMB 2FO4A 1A7QH 5DUPH 4LIQH 5MEND 1NCAH 4KXZI 3D2UA 5J9PA 2F54E 4U0RC 5IWLA 3ZHKA 3PHOA 5T3ZD 4K7PL 2Z93B 3QDMD 3EYFB 2DB8A 1FVEB 3TWCL 2X10A 4XVSL 5ISZE 3BN9C 2VLRA 4Y4KD 4KFZC 3GMMA 3MRDA 5D72L 4QXTB 4Y2DC 4CVXA 4M00A 1Q9OB 3CX2A 4IOSD 2QSCH 4HK0A 3EKCA 1QRND 4LSTL 5FO9B 1MAML 4N8VA 2RBLA 3MO1A 4NQEB 4UTAH 5ICZA 4JDTH 3DXAE 1WISA 3IS0X 3V4PL 4NKMA 3HAEA 4GRWB 4HXAL 4LHUD 3N06B 1M7DB 3SE3C 1FZOA 2EDFA 3KYKL 5F1IA 2D0HA 3K4AA 1J88A 5DMGD 3V6OA 4LLWA 4PJAF 4HSQA 4XNQB 3SHSA 3QNZA 1ZA3B 3LKQA 1R3KB 2J7LA 1YYLL 5DUBB 3W82A 1F58H 2V2TA 2DQIH 3IF1B 2DTML 4MHHG 4UAOB 4GAGH 3X11B 5H94A 3VA2C 1CE6A 1DQJA 1MRCL 3P4MA 5JOPD 3IETB 4NQVB 5MENB 2J6EH 2ENSA 1A1NA 1D5XB 3OJDA 4JO4L 4ZDHB 3CAFA 4JQXA 3QDMB 1NCDH 3HC4H 4R3SA 1A9EB 4OLUL 4Y4KB 2DBLH 4ERSH 4PRAA 5DD5L 4P2CG 2XPGB 1U42A 3BRDA 2MKLC 3HR6A 2F5BH 3ZT6A 1KTDA 4F9LC 2NY3C 5I0ZA 5BV7L 1J1PH 3C5ZD 3MRHB 2P47B 4R96B 4PJGE 4WV1A 4DKEH 4GAJH 3HCVB 1N0XH 4ZQKA 5E2VH 3F5WA 2IJ0C 1J8HD 1QBML 3G04A 3O2DL 3CXDL 3IB4A 5IIEA 1FZKB 4LHUB 4XC3H 2F9BT 5IQ7H 2EIEA 2BSED 4NKDB 3TWCH 3D69A 3H3PL 2R1WB 1G1YA 3PWPA 1EEUA 3UBXG 4TSAL 3CDFA 5DRZA 4YLQT 3JTTB 2BMKA 3F12A 2OM5A 3D1MC 4FXKA 4Q0XL 3S36L 4JFEE 3ARRA 4IOIB 1IMHC 3HE6C 4HLZH 1TQBC 3KVQA 3RNKA 5IB2A 5C0IB 3TBVB 4YHIB 5DVKA 5T3XL 4D9LH 5DQDH 4P23D 5T1MA 5DJ6A 4XXDA 1C5CL 3B9VA 3D39A 3O81A 5D7IA 2VDQH 2E6JA 4HXAH 3TIDB 4UT6L 1T89A 3KYAA 2J8UB 5L9DL 1NCCL 2VN4A 4CN6A 3KYNA 5GHWL 1CLZL 2FB4H 2KH2B 5F9WB 3QNXA 1HHIA 2HLFD 1D6EA 2BNUA 1HK6A 3U30C 4FQXA 4WTXA 1YYLH 1YEEL 1Q1JH 3QDJA 2DTMH 3C5ZB 4MB4A 3FMGH 4HLZG 2NY4C 2O26U 2ESVE 4HMDA 4QRPD 1N26A 2C1OB 1IGYB 1MRCH 3L3OB 4B41A 1PZ5A 1J8HB 3LEXA 4PY7A 3VXPA 4DCQB 3UYRL 4TUJA 4D94A 3OKOB 3LV3A 5IBLD 4JO4H 1X5KA 2BNQA 4F37K 4M7LL 5HGHB 1GYAA 1JI1A 1KJ2B 4PRBB 1ETZA 4LCWB 5DD5H 3EJZD 4RA0C 2BCKB 5F1NA 5IW1A 2GK2A 3U0PB 4HJGB 5D1QA 5DC4B 1YJDL 4U6YB 5TE4L 2W9LA 1OWRM 1TJGH 4P4KC 4MJ5A 1Z9MA 1U8LB 4X6DF 5KANI 4JHWH 1VFOA 1QBMH 4S10A 5FA3B 4JZOA 2CMRH 3IFLL 4DGYH 3FB8B 5DJ2A 4X7SH 3PIQB 3L7EA 4CJ1A 4LPWA 4V2CB 4XNYL 3QXAA 3KPNB 5ADPH 4HFUL 4XHQA 1Y0LB 3V5HB 4WI9A 4WVRA 1G0DA 5CKAA 3O6KH 4Q0XH 1T22A 2JJSA 3C6LB 3QHFH 4N0UA 3S36H 2XKSA 4EI6A 3O3UN 2FIKB 5DMKB 2BVUA 3D2UD 5JR1L 1A6AB 4NRXB 4L8SA 1KB5H 5T3XH 3BP6A 2HJLB 1P1ZB 4Y4HB 1XF3B 2YZ1A 3OL2A 1LP9B 1P7KA 1TVBB 2LU7A 1JNNL 2IGFL 1C5CH 2QLVB 3BIKB 4DN4H 2NLJB 1MCQA 4UDTA 3MRIB 4UT6H 1QFWH 4MD0A 1NCCH 4JPKH 3LAFA 4OCWL 1CLZH 3T4AA 4GRLA 4NRYB 3RVVC 3FO9A 3EZ8A 3ULVC 2WINB 3GSVA 1P5UA 5FO7A 1F4HA 4OI7A 3DRQB 2VLLB 4MYWB 1YEEH 4QOKB 3PWLA 3GMLB 3LDBC 2BRRL 4KROC 4OGAC 2BC4A 1ZS8A 5DMIL 4M93B 4NZRL 4N1EA 1IEBB 3PABA 3CFEB 3WLBA 4JM2F 3UYRH 3ROOB 3RVXC 2YA1A 1ZLVK 1I8LC 4L1DA 3NCJL 4RWHA 5DO2C 2DLTA 4JFDA 1MCBA 1TCRB 3SDXA 3X14A 5B39A 3B9KA 1KBGH 4X7EC 4WFFE 5M7QA 5D5ME 3SDDC 1ZT1A 1WFTA 2FO4B 3GB7A 4GXVH 4OT1L 3U7AA 4JGUA 3E6FA 4YK4C 3KPRD 4YIQA 3KXFA 1YJDH 3D2UB 4M1DH 4RAHA 3IKKA 4LSDA 5J9PB 1BD2E 4TRPL 3PHOB 1MCIA 4AEHL 4L4TA 1EERB 5I71B 3MRDB 4XP1H 4CVXB 3WUWA 5F7MC 4HK0B 2QR0A 1AQKH 3V5KA 3ULUD 4JREC 2YD5A 5IFAH 1P9MC 4MLSA 2C26A 4N8VB 5E8OA 3FJTA 3MO1B 5ICZB 3CDGA 3AS2A 3ESVF 4MA8L 4HWEL 3H9HA 4ODHL 1BBDL 5JR1H 4R90L 3HAEB 5TDOA 3ET9F 2MKWA 3VD4A 3Q5YA 3CUPA 3NABL 1FZOB 3ILQC 5F1IB 4XNMA 1JNNH 2IGFH 3PWPD 5JIPA 3WIFA 3HKFA 4LLWB 5HI4D 3I6LE 3BEVA 3QNZB 1G7MB 3LKQB 2IWGA 4OFYA 4OCWH 5I8OL 1QFHA 5IK3A 1JCKA 2V2TB 3WMSA 5I15L 2IH3A 2F8OA 3ES6A 5H94B 3NGBC 1MFCL 1CE6B 1DQJB 2VXUL 2XKUA 4HC1L 4KK5D 2HRLA 4YDIL 4KI5D 2D7MA 1WWCA 2ICWA 4OGYH 5AYUL 1QYGL 3L3KA 4LGPB 1MCJA 4FZEL 1A1NB 3TH4T 3OJDB 5FB8A 3TM6A 4ZMAT 2OR7A 2EDWA 4LARL 2ZUTA 4R3SB 4BUHA 5HDQL 1RK0A 4PRAB 4FQXD 4MD4B 1NCTA 3WV0A 1KTDB 5GSVA 4DVBA 3TVMA 4LVEA 4GAYA 5HYJA 5JPMA 3MZGB 4WV1B 3AAZA 3BZEB 1WEJL 2VWEE 3LQAC 3O3BA 2C4XA 5DD0H 3SE8L 4ZQKB 2YOCA 4I18A 3F5WB 4K3DH 4RAVB 3G04B 4LQFL 5IIEB 4TRPH 1DSFL 3DUUA 2J4WL 2BNQD 4MDJA 5E8DL 1T1YA 3D69B 4K3HA 1GZPA 3MNZA 1G7JA 3GSRA 4LHQB 1MHEA 3PWPB 2CJUH 1IGIL 4NJAH 5DRZB 5D2LE 2BMKB 3F12B 5DJCA 4FXKB 3ALPA 1SJEA 1UM6L 4ZOCA 3RNKB 5IB2B 3RGVC 4WTWA 1D7FA 4QRTB 3T0AA 3WNLA 4EOWL 4MA8H 3U1SH 3EOTL 3P40A 2ATPA 2V2WA 5T1MB 1I1FA 1BBDH 4XXDB 5DJ6B 2Z31A 3D39B 4R90H 5D7IB 5IVXA 5JIIA 4O9HL 3NABH 3TN0C 2HA1A 1JN6A 5D8JH 3STZA 3WIHA 2BY1A 3HE7A 3QFJA 1LILA 3KYNB 4FFZL 4GLRH 4QWWC 3BP5A 3UTTE 3QNXB 1K4DB 1HHIB 3LIZL 3QPXL 2BNUB 2D03L 3GMPA 4FQXB 4NM8L 1B4JL 1MCWW 2HVJA 3F7RA 3RKDD 1ZEAL 1CBVL 1MFAL 1BQHA 3QDJB 3UO1L 3VFGH 5ESVA 5I15H 2PKDA 4HGKC 4XXCA 3SE9H 3WFHA 5E5UB 1NEUA 3DTXA 1BWWA 2X6MA 2VXUH 1PZ5B 1V3LA 1I3UA 4WI4A 1CZ8H 4YDIH 1LE5B 3RWJA 4FA8A 4PY7B 4B50A 2NYYC 1U3HC 1QYGH 4PJHE 4TUJB 4FZEH 2PYFA 4K23L 3LV3B 4Q9CA 1LO5A 2BNQB 1Q0YL 3ME0A 4TVPD 3OTTA 4YXLL 2Q87A 4LGSB 4JZJA 4L9LC 4NC0B 5LQBH 1ETZB 4ZTPL 3E1F1 4YE4H 4ZUUA 5F1NB 5IW1B 4K7FA 1T2XA 1IVLA 3EO0A 1LNUA 1OB1A 5D1QB 1GGBL 1IQDA 4MJ5B 3F7YA 4K55A 3SE8H 3PHSA 4RFOL 5A2LH 1J11A 1PKQE 4JZOB 3JBG7 3OAZK 5K9JH 2VXVL 1DSFH 3D0LA 5DJ2B 2CGRL 2J4WH 3B9KD 3VG9B 2ERJC 3K4ZA 4P49A 3ZL4L 1OP3H 2Y06H 4RMVA 2BZDA 1ZVHA 2F8XC 1T22B 4JRXD 1KB9J 4O02H 1T6WA 2JJTC 3NMEA 1KEML 5DXWA 3WNPA 4L8SB 5T5NF 4HIHA 4MJ4A 5I8KH 3EOTH 5EZOL 3WFEH 1GAFL 4YDVA 2VLJE 3GBNL 2X7LA 1FNHA 2J1KA 2W1NA 1SBBA 4UDTB 1U41A 4R7DA 2DL9A 2FSEA 4MD0B 5HI3D 2X9WA 3NAAL 1CVRA 4FFZH 1RK1A 4M7ZB 4Q9BA 1X5XA 2H2PC 4GRLB 1RIUH 4WI8A 5LBSL 3MR9A 4KJPD 4F8TA 3FO9B 1KJ3L 3QPXH 1JE6A 5CMAA 2IBZX 2D03H 1HHGA 3GSVB 4NM8H 5FO7B 1NANH 5J13B 3KLDA 4Z7UF 3GEWB 1YC8A 1DQLL 3IFPA 5C0NC 5LGJA 5E2UL 1CBVH 3PWLB 4WFED 4BZ1L 3UO1H 4MNQD 2BC4B 5H2BB 4H5SB 1B88A 5F96L 4XH2A 3PABB 3ARDA 3WLBB 2V5RA 5DZLA 1SJXA 3QSKB 3THML 3HNSH 3O4LA 2DI8A 5DVOA 1FL6A 1AC6A 3HZVA 4FQPA 5D7LD 1GCFA 4JFDB 4OFYD 1I8MA 2GFBA 2JJVA 1Q0YH 3SDXB 4MDIA 3X14B 5B39B 4YXLH 1GZQA 3B9KB 5B4MD 1C7SA 3O0RL 3UPAA 1VHPA 4BA8A 4ZTPH 1ZT1B 1KCRH 3GB7B 4RMRA 4GKNA 3E6FB 4JRXB 4YIQB 3KXFB 5HD8C 4HDIA 4FNLL 5CWSA 1FQ9C 2GY7B 4G8FB 5IHUL 3MBEC 3U7YL 4RFOH 3RZCC 4L4TB 5I74B 2IBZY 5E7BA 2FR4A 3MGOA 2CGRH 3WUWB 5IFJB 3TVMD 2Y72A 2BOCA 3V5KB 5HYJD 3F7QA 2Z8SA 5E8OB 3MRKB 3W0WE 3IAQA 3PWJA 1MCKA 4GS7B 3CDGB 3DVNA 1H3UA 2H2SC 1PLGL 1YECL 4ZS7L 2F53D 3H9HB 4FFVD 4GXUN 3PGDA 1U8IA 1UZ6F 1KEMH 3TEUA 5TDOB 1IL1A 2D7PA 2DKUA 3CUPB 3N1GC 3VD7A 3SGDH 3TV3L 2HT2D 5E56A 3VDAA 5E4EC 1OW0C 4O58L 4XNMB 2E9WA 4W6YB 1DVFD 3WIFB 5I75C 2E8YA 3GBNH 4QHLA 4KHTL 1A7PL 4P48A 3BEVB 4K94H 5D7LB 1QFWM 1RVFL 4FQLH 4X6DA 5IK3B 1ED3A 1LK3L 5ILTH 2NCMA 5C0DA 1E4XH 1ONQA 2IH3B 3ES6B 1KJ3H 1S7QA 1TDQA 1NMAL 3RJDA 2Z31D 4PRDA 4UOW1 2Z91A 2IQ9L 4BZ1H 3HZKA 2ICWB 3TNNA 1A02N 3L3KB 1CD8A 3VXUA 2VH5H 3I6GA 4K7PY 3HE7D 4X99A 3QFJD 4IRZL 4Y5VC 3EGSB 1QFPA 1QLEL 2J88L 4NQCE 3UJIH 1KIUA 1TZGH 5IB5A 1IT9L 25C8H 4LSSL 1ZLUK 4NRZB 3Q6GL 5GS1C 4O5LL 4U4BA 4DQOH 4IRJC 2JKXA 3RTQC 1RURL 1VFAA 3TVMB 3EO1A 4GAYB 2UY6A 4ZUVA 5HYJB 4C58B 5JPMB 3CU7A 1FYHB 1YEJH 4H0GA 3ZTNL 3QEGL 2F53B 5GPRA 3GO1H 2EKJA 5DMJB 2FGWH 1Q94A 3ZDZF 2P5WE 4XVUD 4E9LA 2AKRA 4JM4H 3DUUB 3S3JA 2A77L 2W65A 4MDJB 2XTJE 4PRNA 1T1YB 3U7YH 1JV5B 1GZPB 3MNZB 5FK9A 1ACYH 3GSRB 1MHEB 4JB9H 1KJMB 3LD8B 1BZ9A 2ZP0T 1HHKA 5DJCB 2DLFH 2NY2D 4RGNE 4HJJH 4Y19D 3NN8A 4LU5L 1SJEB 4P4RA 3LS4H 1DE4A 1MY7A 4JM2A 4ORGA 2DD8H 1YECH 4RA3A 1PBYA 4U33A 1YEHL 2ATPB 3QO1A 2V2WB 1RZ7H 1I1FB 1W0YT 2Z31B 5IVXB 1P5VA 5JHDE 2E27L 4PJ8C 5E9DA 4PJXB 3TA3D 1JN6B 3TV3H 1GC1H 4KH2A 3K1KC 4KJQC 4O58H 4XP9L 3HE7B 3QFJB 5BO1L 3OWEA 2NMSA 4AZ8A 2ZUQB 2A6DA 3BP5B 4ZOEA 1F45A 4JANA 3WIIL 2BSTA 4KHTH 1A7PH 1CDIA 3GMPB 2HVJB 1V5JA 4ZFGH 1IC1A 1BQHB 2AQ2A 1KTLA 3U46B 5ESVB 2VDNH 1HDMA 3WFHB 4LCCA 3DTXB 1NMAH 4U6VH 4DK6A 3ARGD 3RWJB 1A6TA 3E3QE 2AK4E 2PYFB 5FYKU 2CIIA 2WBWB 1A6ZA 4M1GL 5JW4Q 1LO5B 4IRZH 4Y8AA 1QLEH 2J88H 1C5BH 5JZ7C 4JZJB 1KG0A 1BIIA 3MLSL 4IIQA 3Q6GH 4O5LH 4OCYL 4ZUUB 3TPKA 4K7FB 2NY2B 3EO0B 5C1MB 4Y19B 1LNUB 4KKCC 1OB1B 1D5MA 1JPTH 1TENA 2VKWA 2V7HA 4PRPA 3SBWA 4JY4A 1IQDB 3VXME 3GKZA 3F7YB 5F6IB 2ATKA 4PJAB 1WBZA 4ONGL 3ZTNH 5HYEA 3QXDA 3PWNA 4P2RA 1Z2KA 3VI3E 3RHWF 3B5GA 3FQTA 3QIUD 3D0LB 2A77H 1FH5H 5FFLA 2XIDA 2XWBA 3TZVD 4UI2A 5I1GH 5J1TC 4GQPH 1OLZA 2R2CA 3MV8A 5KS9E 2Y6SD 4EBQL 2KQNA 2PNDA 4XVJL 2X9XA 4HIHB 2DLGA 4MXQD 4OCSH 3QCUL 3DSFL 1QQDA 1JTOA 1A0QL 3QIWA 2WLYA 4OUOA 5FGCE 3QA3A 4EI5C 3LKRA 4E41D 4Z5RA 2E27H 2X7LB 3HZYA 4I2XA 4R7DB 4XP9H 3T1WA 5DEGA 5BO1H 3ZE2E 2V7NA 1BEYL 1RK1B 2HVKA 1D5BA 4WI2A 5ELIA 3MJ6A 1F4YL 1HEZA 2V9TA 3OXRA 4I3RL 5GGVL 3WIIH 5CMAB 3WJJC 1HHGB 2ZUWA 5CSGA 3IFPB 2NXZC 3TBSA 2XT1B 4OJFL 4GG6F 4OBRA 1MIML 3P73A 2K3TA 4OD2A 2VE6B 4XH2B 3ARDB 1YQVH 4OZGE 3ZMRA 1MCSA 3O4LB 1QUNA 1FL6B 3HZVB 1EO5A 3QIUB 1EGJA 4M1GH 4ODUA 3SOBL 1I8MB 2GFBB 4Z9KB 4MDIB 5L8LB 3MLSH 3WD5L 2CRIA 3VGBA 1KXVC 3BWUC 3SKMA 4OCYH 3GHBL 5CEZL 2JK5A 3KNBA 4HDIB 4WJ5A 2IMNA 1RUQL 5EC2A 5CWSB 4BFIA 3L5XL 3I75A 3WNOA 1FYTE 5FUZH 1AGFA 1E6JL 2HLFC 4S0SD 3TESA 3UJJL 3N1MC 3UZQA 1PSKL 1KYOK 3AB0B 2FR4B 2Z92A 2O5YL 2MQCA 4PRHD 3K2UL 3OGCA 1U8OA 5EORH 2BOCB 4ALAL 4XX1G 4KDWA 3RWEA 2YR3A 2QADD 1EMTL 3PWJB 5KAQF 1VCAA 3DVNB 4H8WC 4OB5H 4F2MA 2CK0H 4S11A 1TZIA 4G3YL 4U1LA 1KN2H 5TE6L 5CJOL 4WHYH 1JNLL 1U8IB 4X4XA 4EBQH 2XN9E 3S3SA 3BUTA 4EUPA 2BHZA 4TVSa 3QJHA 1CR9H 1NL0L 4XMKL 1T0NA 1J86A 5SX4I 1FO0B 1S7RA 2YMXH 4POUB 3DHJA 4L4VD 4QHLB 2VTFA 3VXRA 4PGJA 1CF8L 2W9DH 1N6QL 1FIGL 2B0SL 3F62A 4X6DB 4PJ5A 4PJEF 3NZ8A 1ED3B 5TQ2H 4JM2D 1Q38A 5C0DB 1ONQB 4WW2F 5GGVH 4GO6B 1L4IA 1S7QB 3RKPA 4I1NB 3WNMA 4QRRD 4TULL 1AO7A 2VXTH 1J8KA 3MLZL 4PRDB 2Z91B 4J4PA 5CP3H 5FV1L 1A5FH 1MCPL 3MJ9A 3HZKB 2NY5L 4WHYG 3ARFA 1P69B 1QBBA 4QCIA 3TBWA 3VXUB 1R3IL 4RMQA 1FORL 4NQEE 3I6GB 5C07A 4KDTA 4N5ED 4X99B 4TTGA 1T2JA 5IB5B 3L3GA 3RWDA 1J0KA 2AEIT 4WI7A 4GRWE 5DZNA 2EDJA 3GI9L 3JWOL 4YX2L 3SOBH 4WUKL 1VFAB 4A2LA 3EO1B 4LFHD 3WD5H 4ZUVB 1XGUA 1SYVA 2Y23A 1JMXA 5LKNA 4X5LA 1T0MA 4NM4H 3CX5J 4LCUA 4QEGA 1RUQH 4R4ND 3DGCR 2AKRB 3HI5H 1RUPL 3QNYA 1KYOJ 5CGMA 4KPHL 5TGBA 4MB5A 2W65B 1E6JH 1F02I 4PRNB 4RGOH 5GGUA 1R6VA 1OTTC 1PSKH 5E0QA 3RY5A 1J0HA 4Z7UA 4WU5A 4L4VB 4XB8A 1MQKL 3WIHL 5FYJU 5I18L 5MENE 1BZ9B 3K2UH 1HHKB 3TO4A 1QSED 4IBLT 3NN8B 3IRPX 5L8KB 4ALAH 4OAWA 4P4RB 1BGXH 2AJUH 3QDME 5D9SA 5GRXG 2KBGA 4PGDB 1DE4B 4JM2B 4ORGB 3JWDL 3RA7L 1ZHBA 2ZUYA 1UXWA 3QO1B 5TE6H 4QRRB 5CJOH 1JNLH 4YPJA 2A6IA 4YHOH 1X7QA 3ZYJA 3VDCA 1N4XL 1MJUL 4OFVA 5E9DB 2AV1A 4M6OL 4MX7A 4G8EA 4XMKH 3CVHH 1VPOH 1ZTXH 4JANB 4MS8D 2BSTB 1CGSL 4M9PA 1CF8H 4J8RA 1FIGH 1FFRA 5CKGA 3BSZL 4O2FA 1HYSC 1KTLB 3W5NA 1NCWL 3I02A 1HDMB 4M7JH 5BVPL 4XVTH 4LCCB 1CFSA 1PQZA 2PTUA 3MLZH 2DTSA 3RAJL 5M94B 2G75A 3RIFK 2NY5H 3IAGC 1ZHLA 2CIIB 1A6ZB 1FORH 2JB6A 1CDHA 3T0EA 5K93A 4YNYA 3V7MA 1HXYA 1IM9A 1BIIB 1KG0B 4IIQB 4S1SH 4JRYD 5JOPE 1Q9WA 1EK3A 4HBQA 2ICES 3GI9H 3WS6C 3JWOH 5AG8A 1MRDH 1YMHA 2J8UE 1D5MB 5TPWH 2I9TA 2V7HB 3VGAB 5FCSH 4JY4B 2Z8VC 4ZPTA 1M7XA 2ATKB 1WBZB 1FAKT 3QXDB 3PWNB 4P2RB 3FRPG 1XIWD 2OSLA 3O8XD 3FQTB 3HFML 1U8HA 3B8SA 3NZHH 1CGUA 4J12A 2VZVA 4MVBD 2HJKA 3V8CA 3ZKXC 1CN4A 2XWBB 3TYGL 4P9HL 1RJZA 1MQKH 5IMOA 3WIHH 1J8HE 1BVZA 3QBTB 4F9PA 4K71C 3MV8B 1E0OB 5GS0D 5CZVL 4YXHL 3FCTA 1OTSD 4LNVA 4JY6A 3V79C 4YHYC 1T2QH 4LCWE 4Q6IA 3Q3GA 1S7UA 1QQDB 3QIWB 4DW2L 4TSCL 4U1NA 1PKOA 3JV4A 3EDFA 3QA3B 4U1GB 1BZ7A 1RZKC 3LKRB 3R06A 3W2DL 2QV2A 3WFBL 4PB9L 1N4XH 1MJUH 3HS0B 2VWEC 2B1HL 5EBLB 2XOTA 4I2XB 4M6OH 5E7FA 2QQLL 5KSAC 5DEGB 3QCVL 1TTGA 1OGAD 3PQYD 1HEZB 1PEWA 3OXRB 2FX8H 4DOHB 1CGSH 5SX5K 4R2GD 3NH7L 2CXKA 4O4YL 3WXVL 1TTUA 4JQIH 3TBSB 4GMSL 1K6QL 5ANMA 1NCWH 1OT1A 3CH1A 3P73B 5BVPH 5IJKC 2R29L 4OD2B 5I8CA 3BD4A 3FQXA 2GAZB 4QLRA 4UV4L 3UTSA 4NHUA 4PBVC 3PGFL 2AJVL 2FHFA 4IRSC 5EU6A 5A3ID 3O8XB 2VR9A 4ZTOL 3OPZL 4JJHA 4ODUB 2AEPL 1LP9E 5I73C 4F15C 1JVKA 4TQEH 1Q72L 5E08L 3BKCL 3SKMB 1T83A 3J8F7 1AO7D 2MCPH 2JK5B 3KNBB 3DUSA 2VSCA 1IC5L 3ARFD 5EC2B 4BFIB 4KRPC 2Y5TA 3I75B 1WT5C 3OKNA 4ONHA 1AGFB 2VDOL 4ZG1A 4P3CL 2WNGA 4XWOD 1YUHA 3EBAA 4K9EL 4QOKE 2Z92B 4PJBF 5HHQA 1YEDA 2MQ3A 4XBGA 3OGCB 3N0PB 1IC7L 5BRZD 4D3CL 5J4MA 2LFGA 3HRPA 3RWEB 3TYGH 4P9HH 1H3XA 1PD6A 3QDGA 1OOAA 3T8XA 4F2MB 1DUZA 2XV6B 4M62H 2CXGA 1TZIB 4U1LB 3VFOA 2VQTA 1A7OH 5CZVH 4JKMA 4YXHH 2Y4SA 4X4XB 3D5OF 1DQDL 3QIBC 2H32H 3JTSA 4HIEA 4TNVK 4NWTH 4DN3H 2NTFA 3D3VA 4KKBD 3T2NL 4DGVL 4EUPB 3QJFA 2A9NH 1KIRB 2PW1A 3LS5H 3QJHB 3FL7A 4PBXA 1T0NB 3W2DH 1S7RB 2ICCA 4PB9H 1ZSDB 3TO4D 2XA3A 3VXRB 1QR1A 2HFGL 1UWEL 2H3NA 1CXFA 3DHMA 2Q3AA 2AABH 4DGIH 4QHKI 4WI6A 4PJ5B 3NZ8B 4N90D 3LN9A 5DHXB 2VLRE 4XNUH 1KT2A 2DL2A 3AFLA 5L7XL 1RZJC 5EIQA 4XP6L 3NH7H 4O4YH 1AO7B 1AD0A 1OPGL 3MV7A 4WI3A 4GMSH 4ZFZB 4UIKL 3EO9L 1JRHH 3ARFB 4QCIB 3TBWB 3FFCD 1MCRA 4ISVA 2IG2L 2WWMC 5C07B 4JFXB 1MCHA 3L3GB 3VGGA 2XWTA 3MLRH 5IF0A 1DFBL 4WO4D 4U0QB 4ZTOH 2ZUXA 3OPZH 5SWSA 3MSPA 3DJ9A 1KEGL 3OKYA 1JPST 2QHLA 1GGIL 4MD5A 2UWEB 3MLUH 1XGUB 1GH7A 1SYVB 1Q72H 3BKCH 1FAIL 3ELAT 3V6OE 2WM0A 1T0MB 2XG5A 4I9WD 2GEEA 3N1QC 4LCUB 5EDXA 5JDJA 4P3DA 1H8NA 5HI3C 3HPJB 4AQ1B 8CGTA 3BEWA 3QNYB 4EN3D 1IAIH 3T0ED 1X5ZA 5LVEA 5DRNA 2VDOH 5GGUB 3KR3L 1MHPL 1MLBA 2DJUA 4Z7UB 4K9EH 4WU5B 4WUUA 3TO4B 3UTPD 4GG6A 3IDXH 2WUBH 5KVEL 1XF5A 1IC7H 4XP5L 1CL7I 1G1CA 3HC3L 4NQTA 4OAWB 4Z18A 3VW3L 5B38A 5D9SB 2AQ1A 4AT6A 3IDJA 3HTLX 2CH8A 2DM3A 1ZHBB 1WQVT 3OX8A 1DN2A 1UXWB 4V1DA 1GOGA 4X6FB 3QCTH 4NZTH 2A6IB 2W0KA 2JF1A 1AXTH 2OZ4H 1X7QB 2AVGA 4UDUA 5CGYC 5LG1A 4ZOBA 3OAUL 1F11A 3IDIA 5B4MC 4H0IA 2G60L 2AV1B 3H9YA 4MX7B 1N59A 1G9NL 2QTEA 2HFGH 1UWEH 4XPFL 4J8RB 1FFPA 4ZAKC 3L5JA 4O2FB 3RWGA 1AXIB 2IFFH 3I3BA 3T0VA 2CD0A 1MJ7L 3I02B 4U2ZA 3OB8A 4LCIL 1GRWA 5L7XH 1NGPH 3PWPE 3ALXA 4OLYL 1CFSB 1LE9A 1PQZB 1CICC 2XFXA 1DQQA 1OPGH 2DLHA 4UIKH 2ARJQ 3S8WA 1ZHLB 4HBCL 3BQUA 3OR7A 2IG2H 2JB6B 3T0EB 4YNYB 3P4OB 1HXYB 4X4MA 3WFDL 1IM9B 4LOUD 1QP1A 3D39E 1Q9WB 5GRVL 1R5IB 5D7IE 5DURD 4KI5E 1M05A 5FHBL 1KEGH 1YMHB 4P5KA 4BFGA 2XZCL 4ESKA 2I9TB 2ED7A 4YO0A 4S1RL 4ZPTB 1FJ1A 5K59F 1DVFC 3GJEA 3ULVF 3UTSD 3X12A 5HVGB 4UUJA 5IM7A 3DO3A 4GBXA 4N0FA 3MLVH 4JVWA 4PY8I 1U8HB 1XMWA 4PJEA 3VXQA 3QDJE 1OAUH 4WW2A 3VE0A 3Q5TA 3NPSB 2HJKB 3KR3H 1D9KC 1AFVH 1RJZB 5IMOB 5GISL 1K3IA 4Z7WF 1OP3K 5KVEH 3GNMH 2J12B 3HC3H 4K8RL 2BNQE 5I30L 4JHZA 1JGLL 1MWAH 4JY6B 1EJ6A 2NR6D 1NAKH 3Q3GB 1S7UB 4Q6IB 3STBA 1HI6A 2MPAL 3JVGC 4U1NB 3WEXA 1BZ7B 3R06B 2IAMD 2YD8A 2R9HD 3VXOA 2ZOKA 4XNXH 3AXLA 3DLQR 5GGSB 3MA7A 3IU4H 4JGJA 1BQUA 1I9JL 4DUXA 1HIML 2PXYC 2VUYA 3QDGD 4KK6C 1INDH 3A0OA 1EGJL 4XX1E 4C57C 3SKNA 2XZZA 4NCC1 4KMQA 2CKBA 1HQRA 3BW9A 4QHUA 1RI8A 1T03L 2XY1A 5ANMB 3D3VD 4M61A 3CH1B 4PG2A 1MRFH 3C8KA 5I8CB 3FQXB 1I9IL 5GS0L 3VH8A 3MYJA 5F7KC 4LP5A 2EC9U 3UTSB 4ORZC 4N0UE 4MQ7A 4NHUB 1HSAB 4P3WA 5EUOB 5IFHH 2OR9L 1HH6A 3N50A 3TCXA 3EDKA 4KKAD 3CU1A 1B6UA 1RHHA 3SDAC 4Z7NE 1MH5A 4LGRB 1SY6A 4FFYH 3WFDH 4F8QA 4HWZA 4QTHA 4Q74A 3C8HA 4X7FC 4M6MH 3NFPA 5JIKA 4HPYH 5FHBH 2DQEL 2XZCH 2D4DA 4DJMA 3TA3C 3DUSB 1INEL 4S1QL 2Y5TB 4TVPE 3OKNB 1JZ8A 4ONHB 4KV5E 2ZJSH 4MA7L 2A74A 3U82B 4KU1A 2ADFL 4YUEL 1XEDA 5ID1A 4JFQA 5SWSD 5HHQB 1YEDB 3E6HA 4XBGB 4PLJD 4Y2OA 3QXTA 3G9VA 4UNTA 4QY8A 2VKXA 2ITDA 3QDGB 3T8XB 5GGVY 4Z77A 1MREL 1DUZB 2C3HA 1U92A 1D5IL 3VFOB 3CLFL 4K8RH 5FIEA 4AH2B 4JFDE 4HPOL 3DETD 3W39A 1EAJA 4W6WB 3GKWH 3SDXE 3ZDXF 1UJTA 3JTSB 4HIEB 5I30H 5HYQA 2NTFB 1P4BH 3D3VB 3HNTL 1QBLH 3BMVA 3QJFB 2PW1B 4U05A 5CEYA 1JHLL 4NQSA 3MJ9L 5ALBL 1YA5A 3DSNA 4WUUD 3C2SA 4YHKL 3KXFE 2R56L 5IB1A 2DDQL 1ADQA 1QR1B 2H3NB 1XH3A 1UXSB 2IH1A 1M1SA 2WV3A 4CVZA 4YWGL 3DX6A 5I1HL 1EGJH 2VLMD 3L5WA 4L4TE 2BVPA 4V1DD 2AJYL 1FC2D 5FM8A 1AD0B 1RQ5A 3EZJB 1JGUH 3MV7B 3IFOB 1I3GH 4M5YL 2Q6WA 1XF2A 2CUMA 4UV7H 4XC1L 3MPCA 1OSZB 4NN7C 1UG9A 5CEZE 1HINL 4JO3L 3TZVC 3WNKA 5CAYB 2NY6C 3P77A 3N9GL 2XWTB 2APVA 2ZCHL 5FGBA 1VGEH 2Q8AH 4KC3B 4G42A 5SWSB 3KYOB 2HAZA 5A1AA 3ZDYE 1FHGA 2R1YA 4MD5B 4XPAH 3LB6D 3PWVA 3PE9A 4PYGA 4QGTA 3KLAA 1FNGA 4NO0D 1R3JA 1S7XA 5JTWA 2DQEH 3U48A 3QFDA 4Q7DA 4ZYKA 5D7LE 3H3BC 4P3DB 3MCKA 3VFSA 1INEH 2EDYA 5AAMA 5TF0A 2I25N 2FBJH 3BEWB 3WSQL 2IALA 3OAYH 5DRNB 4Y2DA 2HTKC 4TPRL 5EWIH 3LRSA 4D2NA 1RUML 4Y5YC 3ZE1E 2ADFH 1MLBB 4KQ4L 4EUPH 4ONFL 5DR5L 4WUUB 4DKFH 5L88L 4GG6B 2DIJA 1XF5B 3IYLW 3MJ7A 5L6YH 4BELD 5E99L 5B38B 3RJQB 1EZVY 4AT6B 3V6BR 4NQDD 1ZWIA 3O3AB 1MREH 4MAYA 3VI4E 5DFWH 5CUSH 3U7WL 3CLFH 2D2OA 4M8QA 3L3HA 3LKNA 4V1DB 3SE3A 5DFTA 1OTUD 2IAND 2VMFA 4HPOH 4UDUB 5GJTL 5EZJA 3GDBA 1MIEL 4J7RA 1F11B 5HYJE 4OCLC 3HNTH 4WHDA 5A2FA 3IDIB 3ZYIA 3FN0L 1JGVL 1N59B 3MUJA 4LAQL 3MJ9H 5JOFA 2F53E 4YHKH 5EO9A 2R56H 4ZNCD 5LAXA 4KKLC 1UKTA 5T1DL 3UZEA 3ILPB 5I1JH 1FFPB 2VIRA 5EOTA 2UZXB 1VEMA 4N0CD 4F3FA 4YWGH 3NCCB 1KCSH 5I1HH 4KTEL 1CE1L 1Y6NR 4BJLA 1LO0L 4PJBA 1LE9B 2XFXB 4MNGA 1R0AL 1DQQB 5IW6A 4YDKL 3NFSL 5D96B 1UJ3C 5F72S 3NCFB 4X9BA 1K5NA 3BQUB 3OR7B 3QI9A 3H8NA 2QADC 4MCYA 5F7HA 3IGAA 4JO3H 4YHML 1ACZA 3OGOE 4F9LA 5CINL 3GSNA 5IVXE 1NC4D 3T77A 2A1WL 1DBBL 1M05B 2LU3A 5I9QC 2YWZA 5D7JC 3RBSA 3QFJE 1OP5H 2OQJA 1E28A 4YO0B 3QWRA 1FJ1B 4NQDB 3K7UA 2XACC 1DEEA 5E6IC 3CPLA 5IM7B 4GBXB 4N0FB 2VDPH 1ZVSA 2CO6B 1UYWL 3VXQB