4X8XA

Crystal structure of dscam1 isoform 1.9, n-terminal four ig domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
390
structure length
390
Chain Sequence
DQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENYFPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVRPKVNPQDKHQFIDVELASSYSLLCMAQSYPTPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Down Syndrome cell adhesion molecule isoform 1.9
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 91
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x8xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x8xA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x8xA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x8xA04
4XMKH 4WTZG 4W6XB 3X3FL 4OLWL 5SWZB 4GKOA 4JFFB 4LHQB 1JCKA 3P30H 5ITBL 2YKLL 3CXDH 3Q3GB 4OCRL 4PJCA 4PJIA 4Z7OE 1V7NL 2Z4QA 3SGDI 1BQLH 2V5MA 3F7VB 4L4TE 3BSZH 4S2SB 1NBZA 3QHZL 5GJSH 3SDAC 2VN7A 1LNUA 5GGRA 4JPKH 1QEWA 2QV2A 2RGSA 3CIQA 5GRJH 5C7XL 4PGCB 2GY7B 1K4CB 1CBVH 5E8OA 1EH9A 1X5JA 4IRJC 5F7UA 1AJ7H 2VAAA 1JNJA 1A4KA 3MNVA 1GZPB 3EOAA 1OQXA 4UUJB 2VXTL 3DPBA 4PJBB 4RZCA 3PQYD 3OQ3B 1AGEA 3P2TA 1GGBH 5F7KC 4PJFA 1FFQA 5HYQA 4RFEA 2E7MA 3AU1A 4RGNE 1MCNA 4QXGL 4HS6A 5FDWA 2ARJQ 5KVMC 1U91A 3LRSA 2MCPH 4OF3A 3MA7B 4OFYA 2W9LA 4KDTC 3QUXA 4PP2A 4NQCB 3TBVB 4U1NA 2ADJB 1NCBL 1MI5E 1S5HA 4ETQA 2YD6A 1L9MA 3UYRL 3THML 3BIBX 3U6RA 4M1GH 4CMMB 5IROC 2A77L 3U4EB 2NY7L 1FFNB 1DBML 5IVNA 5F21B 1J8HA 1RFDL 1FNAA 4LLWB 4JO1L 2A73B 3RZWA 2N7BA 3V4VL 4KWUA 3VWKC 1VPOL 3QCTL 4HHAB 5EBLA 1FJ1A 5E5MB 3ARSA 1GGIH 4JFHE 4MXVE 1A7QH 3B9VA 5C0JA 2CRZA 3CSBA 4YO0A 4DEPB 4CVWA 1XGPB 3H3PH 2NY0C 2AK4D 5D6DA 5EIIB 1M7IB 1Q9LB 4TYUA 1I1YA 3LEXB 1JZ4A 4X4XB 4AM0B 2GITA 2VDOH 5FK9A 1KYOJ 2CLRB 5DD0L 3BP7B 5F8QC 4CMHB 4FQJL 3T2QA 5BQ7B 1MRDH 4G43A 4PLJD 2DI9A 2EE9A 3TNNA 3V0VB 1PY4A 4WU5A 3GI8H 1N8ZA 3A6BH 4ZPTB 5ALCL 1CR9L 5DUMH 4EOWH 1B6DA 5T5NG 3HAEG 3MLZL 5AD0B 1A7OL 4XP9H 4MDJA 5CAYB 3ZYIA 1FVDA 2P47B 4FTVE 4IRSC 4PJ8D 3HC4L 1R3LA 4QRPB 4F7PB 3TO4C 4PY8I 4MMZC 1R3IH 1ZLWK 1MCWW 2IJ0C 2AJYH 2EE3A 4ODVL 2B4CL 5EORL 3R4DA 4JVUA 1U8KA 3L7EA 4YXLL 4YGAB 1A21A 2AJXH 2Y06L 4UAOC 1MCOH 5IHUH 5ID0A 1S7SA 1A3LL 5E4IA 4BH8A 1JVKA 2R8SL 1FYTB 3QJFA 2NY2C 4QRTB 4G9FB 2YD8A 3HTLX 5IVZB 4NNYA 1EHLL 5J12C 4KK6C 4JFFD 3K8KA 3GSUB 3LEYL 4ONGL 4YWGL 4FA8A 4JZOA 2BNRB 2DMKA 2VE6A 4D9RD 1B3JA 3QEGL 1E27A 1BBJB 4A6YB 5DT1L 1JPFB 1DBAH 4F7EB 3L5HA 1U0QA 1C7SA 4GRLA 3O9WA 4LAQH 4P59L 1CGSH 1QRKA 1WIOA 3O2VL 3FRUA 1LE9B 3DX7B 5EOCL 3IAPA 4ODXA 3LN4B 1EVTC 8FABB 4HG4J 1JWSB 1TCMA 5CP3A 1I8IB 5D7LE 3OZ9L 3S4SB 1KFAL 3W9EB 4C56A 4ZQKB 4GG8B 1KN2H 4LL9A 4GKZB 5FO8B 3OKOA 3RTQD 2DQEL 3SO3C 2DD8H 2P5WB 5E6YA 3O2DH 5ICYB 2WSKA 2O61B 4MVBC 3TVMC 1IQDB 4LOUC 4KQ4H 1QRND 3BZFB 5F7HA 3MUY1 4X0KA 4GJTB 5FIEA 3V9FA 5TQ2L 5EZIH 3B5HA 1ND0B 3NIDF 4NQCD 1XF5B 2YK1H 1EXUA 4POUB 4Q0XH 1X5GA 2QTEA 4XCFH 4HT1L 1BFVL 5LCVL 3IAGC 5F7YC 1INQA 3WNOA 1RZ7H 5DGQA 5T1KD 1P53A 4R97B 1NMBH 4YDKH 1K2DB 1OY3B 1QP1A 4RAHA 1PX3A 4DZ8A 4NOFA 4R7DB 1NGWB 5CEZD 3HE7B 5D6CA 4P2QE 3HR5A 1MREL 2HMIC 2C3GA 3CVHH 3B6SA 3CPLB 4L8CB 1K8IB 4OGYL 2WBWB 4G8GE 3U4AA 3VXNA 1UYWL 3TYFA 3J8F7 2VXQH 1SMAA 3MLSL 4UQ2A 3RNQB 1MLCA 2Y6SD 4S1RH 1KPVA 5EG6C 5BS0E 1R3KA 3QXAB 3FRPG 4LRNL 5LBSL 3SE8H 4Z8FH 5SX4I 2CMRH 4R0LC 1JMXA 1MHPH 3OPZL 5SV4A 4L8DB 3AM8C 4FZEL 2OSLA 2NCMA 2Q20A 3T08A 5B21A 1NCTA 2V9TA 4D9QD 4YPGA 3KPSA 1IGCH 3EYUH 4U05A 1AD9A 4HUNB 4P9HC 4OZFH 4W6YB 5A1AA 5DD5L 3GJFK 4R9HA 3MGOB 3HZYB 2C26A 1A3RH 3FZUC 5I75C 4ZUSB 5IWLC 3WS3A 1CICB 4LSDA 5FAAA 3TBTB 4L9DA 4W4NA 2NR6C 3P73A 1S5IL 2QQLL 1O0VA 3S36L 3IJHA 3TJEH 4PB9H 5H2BB 1T0MB 2OMBA 1FYTD 1F00I 4LCCA 1Q9OB 5DK0A 3RVXC 1L6XA 1YEHH 3DLQR 2DS4A 3DVNB 4Q7DA 2QBWA 1KNOA 4OIIL 5C0CE 4JPIB 4YHZH 3OJVC 3OXRB 5KS9E 5IGXH 3MA9L 2C3VA 4PJDF 1FCGA 2WUBL 3MRQB 35C8L 3ARGD 1MFAL 1F4YL 4UDUB 2ADIB 1X5FA 5DO2D 3MLXL 2VDPL 5IVXB 3RKDC 2A9ML 5SX5H 2JIXA 1RZ8B 2VXUH 3LH2H 2X09A 4EN3C 1FZKB 2J8UF 1TENA 3W0WB 3IKKA 4XNUH 4GAFB 4MAYC 5ANMB 4XAKE 4F7TA 2AABH 4OUOA 3RY6A 4TULH 3ZKXB 2XG4A 3QWOB 2A74A 3DTXB 4K9EH 5GGQH 2P5WD 1G7HA 3ARDA 4I77H 5E2UH 4X9IA 5DJAB 3BN9D 4DKFH 3BIAX 5MI0C 2JCCE 3PGCB 1L6ZA 1E4XI 3RWJA 1B0RB 4GOSA 1QNZH 5IOPB 4XNZC 5I1IH 4HULB 3UTPD 5IM7A 2CJUH 1UWGH 4IIQC 3AAZB 5GRXG 3PUCA 2GSGA 2OI9B 3RVTD 2M2DA 1G9ML 1FO0B 1YEIL 1GCFA 5ACZB 3R06B 1UXSB 2H6PB 1XGUB 3MR9B 1Q9WA 4TUOB 3T0WA 5MEOA 3OAUH 4AK1A 4PRNB 3NZHH 1ERNA 4S1DC 1KV3A 1ZKAA 4LVNC 4P4RA 4YHNA 4TOYH 2B5IC 1XH3A 1KCUH 3TZVD 3BQUD 2CR6A 4UT6L 4OFKA 4NHCL 4KZEL 1BWMA 5TE7H 5KBNC 4GFTB 4JFZH 4XP6L 1P4LA 3QG6B 4PJ5D 4Y4KD 3W2DL 2ORBL 2WBJB 5GIRB 5JOPD 1Z2KA 1AI1H 5AUMB 4G6JH 1OTTD 3RL1A 1YYMH 3S34H 4Y4FA 3BXNA 1WBXA 5E7FA 4WW2A 4U1IA 1PGRB 3QH3A 4EDWL 3IU3A 3MUGB 5EBMA 4XNMB 3R0MA 2F54E 2DLIA 1CXKA 4FQ1L 2ZJSH 1U6AL 2X7LA 1MUJB 4E5XB 2OL3A 1M05B 3KPTA 4JM2B 4CNIA 4FQXA 5HHVL 3VFMB 1QLEL 4HS8L 1LMKA 1JF6A 2EDQA 3D1MC 3DUSA 3QHFL 5D1QC 3C5ZB 1LP9B 1MIMH 2F74A 1U36A 3NZ8B 3T0DA 1CFTB 4NOBA 3O6KH 4D9LH 5KJRL 3CMOL 3MRCA 2JB6A 2B4CC 1A6WL 1I75A 1W72B 1KB9J 3E6FB 3ZHLA 3FQUB 5EO0B 5F1NA 4Y5YB 4RGOH 5IKCB 1MWAL 5D8JL 1NLBL 1BPVA 2DLHA 5GRWA 5GSRB 4LHUG 1UEYA 3N1MC 2E9WA 1MELA 1NUFA 4L3EB 1QBLH 5IB4A 3ARBD 3STZB 2EXYC 4U7SA 1S9YB 3AVEA 4HH9A 4XXDB 3I75A 1ED3B 3CSYA 5EIVA 3GUTB 1TVHA 4GRWH 3OKMA 4HWZA 3DX8B 4LCWE 5I1CH 3QI9A 1S7XB 1IL1B 5GGUA 1TJIL 4PJ9D 1KPUB 2EC9U 3WJLC 3BPOC 3H9HA 3VXQA 3SDDB 4AL8L 2QSQA 1IM9B 1QSEA 2R0WH 5CINH 5JUEL 4L3CB 3QDHA 4E41B 1UB6A 2HVKB 3VFNA 1MHEB 1IQWL 3W0WD 5I71C 4JDTH 1GGUA 3MRLA 1UM4H 2BSED 2UZXB 2DLFL 4P46C 4NQDB 4U3HA 5JOEA 3CDYA 3TBSA 4JFDE 3RJQB 1DQDL 1QSFD 4ZYKA 1ONQB 4Q9QL 1YEGL 4OCSH 4W4OA 3U82B 5ERWB 3HPLB 1SY6A 1LO3H 4JRYB 1G7QB 3PGFL 4XH2A 3KPNB 3O6FA 4PR5B 3UTSA 2EIDA 1DL7H 3T4YA 5FO7A 3CFEA 5HI3D 3GSQB 4LLUA 3RA7L 5J11B 3H0TB 4K2UH 3BP4B 2AEPL 3K0WA 5AYUH 1PY9A 5E94B 2IQ9H 1AHWC 1B2WH 3RWGA 1HHHA 2FDBP 1F58L 5DFTA 4D0CB 2EC9T 1JGLL 4NFCA 1CVSC 2MSPA 1UKSA 3QNZA 5DUPH 5CCKL 1YEDA 1MY7A 4AY0A 3ILPA 3V6FA 5DUBA 5EU4B 4N0FB 4DVRH 4OQ1A 3NA9H 3VA6A 3PWUB 3ZYJA 3M8OH 3MFGB 4XNXH 3C9NB 1UM5L 3WO3B 1T5WA 3MRFB 1V7ML 2X41A 1BZ9A 5I1KL 5IESH 1VGEL 4BQCA 4AIOA 2EECA 4MHHI 2FWOB 4BELD 4K8RD 1X5LA 5T3XE 2CLVA 3O8XC 5FCSH 2I07B 1AE6H 1KCRL 4ENEC 2BVEA 1BBDH 4UT7L 4LU5L 5KN5B 2YOCA 5IB5A 2HFEA 4ZO9A 1ZVSB 3PV6A 5EO1A 4X4YB 2IF7A 1KTLA 4PPTA 3QNXB 1UCBH 1P9MC 3L3KB 3L3DB 1AXSA 4FFZH 2NX5A 4JFQB 4B53A 5CJXA 3X14B 3WE6B 3HG1A 1CDCA 3IDNB 3SQOL 4K94L 1ZGLP 4CDHA 4M5YH 3O3AB 5BMFL 2BCKB 2V7NA 2XTJC 4PRAA 1U42A 3O11B 3IJSB 1U95A 2YWZA 4KHXL 2A38A 5HJ3A 5I16B 1TNNA 1U93A 3U1SL 5F7WC 1V3KA 2KDGA 4RX4A 5B8CA 3OTTA 5GGVH 3QUML 1A8JH 4CVXB 4X98B 3WUWG 4RGNC 5J56B 4L3ED 5HYSA 1IGML 4JHWL 5TPWH 2AKRA 1R0AL 4K3EL 3QFJA 3GHEL 3BPNB 4HBQA 4WI3A 4QRRB 1XGRB 5IBTL 2W0FB 4HPOH 1A14H 1JZ8A 3V6ZA 3K74B 2VXVL 5F1IA 4M02A 2YZ8A 1D9KC 4LIQE 1K4DA 4WI5A 2PYFB 3Q6FA 4P2OA 4P4KC 4BUGA 3SKOB 3GGWA 1IM9D 3BEWA 1MCWM 5D96C 3GJFA 3IDUA 1GXEA 4KKCD 5KAQG 3ZTJG 3N9GL 3AMLA 2FJFA 3GZKA 2QKIA 5FGRA 3V4UH 4JHBA 4QOKA 3ABZA 4OGAD 1CWVA 1RK0B 2ADGA 1FBIH 1ZA3B 5BV7B 1OSZA 2DBJA 3SE3C 3VFSA 3WNPA 4TVSa 5ADPH 4OB5H 3NTCL 3LKPA 2FLRT 2ADFL 3PWVA 4PJIB 4JFED 4GMSH 4LPYA 2Z4QB 2AJSL 5SWSE 1NCWH 1G9MC 3TBYB 5TF1H 4HUXA 1NBZB 2RBLA 3P9WB 1LNUB 5GGRB 3BKMH 2OJEA 3D48R 4UNVA 1QEWB 1U2HA 3VDCA 4OM1H 4WHYG 5E8OB 4NKIL 4F33A 4KKLD 3IAQA 2K7QA 3LN5A 1A4KB 4G3YH 3NGBB 3EOAB 5DMKA 5HHOE 5J06A 3HMXA 3FTGB 1CXLA 4QHLA 1RUAL 1IGTA 1BF8A 4KC3B 4RZCB 4F15C 1AGEB 4KAQH 2ZOLA 4DTGL 4AEFA 1BQLL 2AAVA 4PJFB 4NCC1 5HYQB 4RFEB 3AREA 5HVWA 3AU1B 4DW2H 1QZ1A 3ES6A 3LRSB 1KTRL 4NQED 3S5LG 3TN0D 4PP2B 4U1NB 2DTMH 5I1LA 4ODSH 2EE2A 1GOFA 1IVLA 5FOJA 1S5HB 4J3WA 4X7SL 3T09A 5I1GH 4ETQB 2D0FA 1S9WA 2IGFH 1JRHH 1I3GL 4RA3A 2H2SC 3U6RB 3QDGE 1ZHKA 4LSTH 2AI0H 4HBCH 3LPFA 4PJGB 4D0BB 1J8HB 5IMMA 1ADQH 3DI2B 1I8LC 3CUPA 5L6YH 1BQHG 1OLLA 3NVQA 2X4SA 5C0EA 4WJ5B 1GPOH 4F3FA 1KIRA 1LO4L 5EBLB 5D7IA 5DMGC 5I74B 5DD3L 1NH6A 5MHSE 5DYOA 5C0JB 5JIPA 1YPZE 2VLLA 4KJPD 4YO0B 3W9DA 3RQ3A 4H88L 2APFA 5F71A 4NRZA 2RJMA 1I1YB 2VZSA 3D3VA 4URTB 4KZDH 3VXOA 3EDFA 4PJAA 5FKAA 3C08H 1T1XA 4XPFL 4PJ7E 3FHQA 5DEFA 3HUJF 4G43B 4B41A 3TNNB 3FFDA 4WU5B 1EO5A 1N8ZB 3BVNA 4L3AA 2AP2A 4MDJB 4CVZA 3LB6D 1R3LB 3RVVC 4EEEA 2W9EL 1IAOA 12E8H 4JG0H 4NM4L 2FJHA 2HTKD 1U8KB 2FNBA 1MCLA 3L7EB 1ZS8A 3QO0A 2DLGA 3WN5C 4BH8B 3QJFB 4YQXH 3F58H 4WY7L 4PRDA 1M1SA 3PJSA 5D1XA 1MRDL 3TLRA 3VFGL 2ICEA 4LPTA 1ZT4B 3MBED 1W8NA 2VE6B 3VH8G 5ADOH 3I6LE 1E27B 3AS1A 1EAPA 2G2RA 2XQBH 5DJDA 5T3XL 2CGRL 3PWNA 3HN3A 3V52H 4GRLB 4RFNB 3O9WB 2FL5A 1DQMH 2WLYA 4PD4J 1R3JA 5FHAH 1HQRB 1FN4A 1R3IL 2XG5A 1V3LA 1NGZA 3F12A 3S96A 2NYYD 1IM3B 1WZKA 4X4MA 1MCOL 3PWJA 5IHUL 1DUZB 3O3EB 2VDNH 1FE8L 3U2SA 1FL5A 1JV5A 1ULVA 4C56B 2ZZUT 3CCHA 5IF0B 3CNKA 4YK4C 1RD6A 3OKOB 2J6EH 4PYGA 3ZDXE 3QQ4A 1QTYT 2H32H 4HGWA 5EUOA 1U9KA 4G6KL 4EUPG 3QEQD 3BP5A 3VXSA 1W2KT 2QL1A 5CMAA 5HD8D 3U7YH 43C9B 43CAB 3QRGL 4TQEH 4LAQL 3PQYE 1F4WL 4X0KB 1CF8H 2VXSL 5CD5D 3BE1H 4V2CB 4OCXH 2PO6C 3LRHA 1EXUB 2V7HA 4RAVB 4AIZA 2E9BA 3PG2A 4PY7B 5CUSH 1INQB 3NIFF 5IEKA 5KW9L 2V2XA 2R56H 4GG6E 4LIQL 1T03H 1X3DA 2FLBT 4DZ8B 4FZ8L 4XC1L 5D6CB 2XZZA 3HR5B 4JN1L 5I73C 5B39G 1UJTA 3GM0A 4G6AC 3B6SB 4JDVA 4K94C 1G7LA 3VXNB 1FO0H 3T2NL 2BERA 4UQ2B 3WJJA 1CDUA 2WP3T 1MLCB 1PKQA 4IHOA 5C8JA 1KPVB 4Q0XL 2LVEA 3ZTNL 4Z77B 5D7JA 4BSVA 1R3KB 1DUYA 2AK4E 3BZ4A 1S7QB 3P4OB 3MO1B 4XT1C 2OSLB 4O58H 2JKXA 1DBBH 2R29H 4YPGB 4HH8A 1KGCD 4OKVA 1AD9B 3DXAB 2EH7H 2R2HA 3WNNA 1A6UH 3PIQA 1LO2L 3LZFH 1QFHA 5HBBA 3NCJH 1JPSH 4HQQL 3Q5OA 4NKDA 5HHQA 3WS3B 3SE9H 2BC4B 3P73B 4JG1L 3IJHB 4X6DE 5FHBH 2XZCH 4BYHA 1U92A 4ONHA 5HHMB 4LCCB 2RCSH 3P40A 3K81A 2EEBA 5DK0B 3DV4A 5C0BD 3FONA 1MVFA 4XPBL 4RFOH 5MEPA 3OF6A 3RGVA 3RUGE 2HN7A 3QO1A 2AJUH 1KNOB 3EYUL 4ZFZA 5EA0L 5EO9A 4OTXL 2C3VB 1X7QA 5SWZE 4JFFE 1QA9B 3C6SA 1A3RL 5C6TL 4D9RE 4MJ2A 3X12A 4V2BA 4YLQT 4YIQA 4Y89A 3ZT7A 2YEZB 4N0YH 1X5AA 2VJXA 4QY8A 5D1ZD 1I7TA 4NIKB 1N26A 4BSJA 4I0PA 5IEHA 3EYSH 1MCKA 2GJ6D 3U83A 1G7HB 3ARDB 2X89D 4OF5A 1EEQA 3KYKH 3MXWL 1QSVA 1NGQH 1N0LA 5J6GA 4AQOA 3RWJB 3WIFA 4OCWL 2JTDA 1A1NA 5IM7B 5DJ2A 3MNWA 4XC3H 4N0UB 5DEGA 2GSGB 2GUOA 4OLXL 4TPRL 3O2WH 4LSUH 3REWA 4P23A 3VWJB 3STLB 2VXUL 3LH2L 2E9JA 3HPJA 4NRYA 3TYGL 3NH7L 4MJIA 3JWDL 2VYRE 3H3BC 4NQCE 2QQKL 3QISA 4TULL 4P4RB 4YHNB 4APQC 1ZVYA 3SE4C 2BNQA 2BRQA 4DKFL 1G0XA 1P4LB 4YDVA 5E6IA 4CRPA 3X17A 1U8HA 1QNZL 1I1AA 4L29A 5CEZE 1WCBA 3RL1B 2IANA 2CJUL 4I3RH 4LQFH 1UWGL 3JTTA 1OAXH 5DWUL 3BI9X 1EERB 4TRPL 4Y4FB 3VD3A 4KJWD 4TUKH 3GBML 1WBXB 3H9ZA 4WW2B 4LEOA 4PREB 3KG5A 4U1IB 3QH3B 3IU3B 5EBMB 2EDNA 2QQQA 4TSAH 4I18C 3OAUL 2OYPA 3NZHL 1HKLH 1KJMA 3H9SA 3V6BR 4YXKH 4ISVA 4XZUA 2LAAA 1L4IA 2XRAL 2OL3B 4CNIB 4FQXB 4GRWF 3EKCA 1OAYL 3ETBF 4WHDA 1ZOXA 4OGZA 3DXAD 3DUSB 3AB0B 3UJTH 1J0YA 5F9OL 3EFFB 4RWHA 5KSAD 5JHDD 2F74B 3LKOA 2YN3A 3MRCB 2JB6B 3MYJA 4F37F 1MRCH 2LTQB 1Z3GH 5F1NB 4Y2DD 4U33A 4YDIL 5D5MF 4ODUA 1BECA 4K7PL 2ICWA 2HVJB 2VSDA 1DBJH 3H9YA 4P2RA 1KJ3H 2DBLL 1OGAA 3CC5A 1TZIA 4UTAH 5IB4B 3GSNL 1FYTE 4HH9B 3I75B 3BW9B 3H8NA 2HG5A 3CSYB 4JRXA 1TVHB 1MH5B 3OKMB 4HWZB 5C86A 4ALAH 3QI9B 5FGCB 4JO2H 5EZLA 4KGLA 4G6ML 2H26A 4OQTH 1ACZA 2GI7A 3D5OF 5F88A 5GGUB 4KI5D 4I4WA 2DWEA 3RNKA 4ETYA 3VXQB 2UVFA 3B2UC 3ZSSA 1FL6A 1UB6B 3ARFC 3VFNB 3LOWA 1ZGLA 3AS0A 2MQ3A 1OP3K 4FQLL 3MRLB 1ZEAH 4R4ND 4FXGA 4ZUTA 1A0QL 3TBSB 1M71A 3QFDA 4POYA 4XVJL 1Q38A 4GUPA 4ZYKB 1NC4A 3N06B 2EYSA 4LPVA 4H0GA 2P5WE 3DARA 4G6FB 2VL5A 1YQVL 4IJ3B 3HS0A 2JJTC 3O6FB 4YHPA 3UTSB 4OSUH 3T4YB 1A2YA 5FO7B 1B88A 1BOGA 2VDKH 3CFEB 4LLUB 3VWJD 2Z35A 3UTPE 3TF7C 2VDLH 3KYMB 4M9OA 3MLPA 4FQCH 3QZWG 4U6VL 4G8EA 3U9PH 1UM4L 5DJZA 3RWGB 3GSRA 4DCQA 1KIQA 3VG9B 4OD3L 3QNZB 1T2QH 3O3BA 3ZTJH 2BDNH 3NACH 4MQXC 3ILPB 3V6FB 5K33A 5DUBB 4U6XA 4U1SA 2FX8H 2A0LC 5IW6A 1LEKB 1MJUL 4PJ5E 1FDLH 3CFCH 5JOPE 4JO4H 3ULUF 2G75B 5HHPB 3VGEA 1QOKA 4N0CC 1DQTA 3RZCA 1BZ9B 2CKBL 3D39A 4LKXA 2ATPA 3B4NA 3VGGA 5L2KD 4F9LC 4PP1C 4QXWA 2BY3A 1YEJL 3AMKA 4NRXB 2CLVB 3WXWL 4W81A 3G6JE 3QUZA 2HH0H 4RMRA 2E8YA 1V3MA 5IB5B 1A9EA 2HFEB 5DA4A 4RBPH 4IOFC 1E4XL 3PV6B 4RGMC 5EO1B 5JQ6L 5J1AA 4M62H 3RI5K 1KTLB 4HZAA 2IQAA 3KYNA 3MZGB 3M8OL 4PGDA 1CQKA 4PJDA 2R1YA 1AXSB 3RX5A 1WIUA 5D93C 5E5RB 3JUYA 5DHVH 3HG1B 1EJOH 1J1XL 4EI5C 2P48B 1YY9D 4DKDC 4Z7OF 4D2NA 4DN3L 5JR1H 4LCUB 2Y25A 3WS6C 3QPQC 4X80H 2MPAH 2NY1B 5HJ3B 2NXZC 1EZVY 3TNMA 1U93B 4PB0H 2J8UA 3GMRB 4LVHB 5B8CB 5TE4L 2J2ZA 1X5ZA 2DQDH 4JZJA 3KPMA 2XZQL 1KBGH 4ZTPL 3MBXL 4MHHG 2DLTA 2WQ8A 3F7QA 4U1HA 1H15A 1F5WA 2AKRB 5GZOD 1LK3L 3QFJB 1ITCA 1BF2A 1U3HD 2V6HA 1KCSL 5JXED 5FYLH 3QWRD 1NAMA 3UTZA 4PGZA 3QUKA 1I8KA 2BY2A 2A6DA 4ZMAT 1QLRA 5F1IB 1V3JA 1U8JA 1K4DB 3D2UB 4KJQC 5T5NF 4M5YL 1MLBA 3Q6FB 3TH4T 4P2OB 1FLTX 3QEHA 1NSNH 3V5HA 2DL9A 3BEWB 2NY6B 3RIAF 4JHAL 2GTZA 3GJFB 2VUOA 5CEXA 2OR8A 2EO9A 3ZZ1A 4BA8A 1YECH 3T1WA 5DURD 2FJFB 2QKIB 4D8PA 3UZEA 4ZUUA 5ENWB 2PXYD 3BUYA 4QOKB 5CEZL 3IXAB 5TPWL 2ADGB 3W0WE 1OSZB 2BSRA 4GXUN 5ANME 1TETH 3VFSB 3UCRA 1PG7L 4IS6A 1I9EA 1A14L 2YPLA 4JREB 3W11D 2Y4SA 3KAAA 4KVCH 3S97C 1QSFE 1OSPL 5DJ6A 2MWCA 2Z31C 3UTSD 4XGZA 3QQ9D 4HUXB 4HIIA 5IB3A 5KVFH 4DN4H 1F2XK 5MP6L 2FATL 1JF5A 5M94B 4NKOA 4MB4A 4NQVA 4MXVF 3JWDC 2OJEB 1CGWA 3OG4B 4L4VA 3G5XA 1P4IL 1RZKC 2J4WL 3KHQA 4C83A 2WUCH 3S35H 2FIKA 5DMKB 4C58B 4KKAC 1Z9OA 2JJVA 4QHLB 1IGTB 5LGJA 1INDH 3HI6L 2ZOLB 4LSSL 1NJ9A 5I19L 1D5ZA 3GMMA 1MHCB 2FBJH 3DMMA 3AREB 5ILTH 5A2LH 1RUKH 5TF1L 1UM6H 3ES6B 4TVPH 3SDAD 3ZDZE 2YZ1A 1A1OB 1WEJL 5CP3H 5I1LB 3B9KC 4I8DA 1YA5A 3ZKMD 4ZFOB 3A6CH 1LEIA 4IRJD 1S9WB 1G7JA 1JZ3A 3ZYZA 5FOBA 3VXMD 4G3YL 1SM3L 1JWMA 5EU6D 1MAJA 3UBXG 1II4E 5I8OH 3M45A 2DJSA 4XMLH 4YHOL 4A6YL 3CUPB 4M7JH 1B0WA 3SDCC 5IJKA 2DYPA 4C4KO 3QSKB 5C0EB 2NY3B 4MA1C 4GSDH 4N8VA 1JN6A 4QWWD 5DYOB 2CR3A 1LP9E 2VLLB 1GSMA 2R0ZH 2J8OA 3QP3A 5C70A 3LQZA 3MV8D 3W9DB 4ODSL 1AGFA 5CZVH 4NRZB 5F1KC 1NBQA 1QBMH 3D3VB 1Q94A 1N5YH 3VXOB 1NCNA 4PJAB 5FKAB 1T3FA 1GH7A 1T1XB 4YBLC 5DEFB 1DANT 2VNCA 4KY1L 2H1PL 2AQ1A 1HXMA 3FFDB 5LGKA 5L6YL 4BFIA 4L3EE 3QHTC 3LD8C 4CVZB 4ERSH 3I9GL 3D2UD 5E95B 4NM8H 3IFLH 1KSRA 2DQGH 1IAOB 5GGTA 1WZ1H 3SPVB 2NY6D 4KKBC 1I7RA 2FJHB 1JZ2A 5D70L 1SEQH 2IBZX 4BH7A 1L7IH 5L8KB 3TCLB 1L7TL 3QO0B 4DVBA 3G9VA 5A43C 4PRIB 4GLRH 3PGDB 4PRDB 3PJSB 3QIWD 3CFBA 2ICEB 9CGTA 2BRRH 1UG9A 4FRWA 4AMKL 3WSQL 3VGAC 3RAJH 5I8CA 3DSFL 3TPUA 2VZ3A 1RUML 4NQDE 5TDNA 1EAPB 3PDOB 4IRSD 3ZHDA 8CGTA 2G2RB 4K23H 5DJDB 3G6DH 3PWNB 1YY8A 4ODHH 4XPAH 5B22A 2SEBA 1CGUA 1FN4B 3TWCL 4JFEE 2VLJA 1NGZB 2P44B 3S96B 3K46A 3UTTA 3AS3A 3T0EA 2NNAA 3PWJB 4R8WH 2BFVH 2NY2D 2P8PA 3HNSL 5CP7A 3U2SB 3QDAA 4JM4H 4CN4A 3SCMC 4X5XA 3CCHB 4R3SB 1N5AB 1T6WA 2FB4H 3CDGB 1F8TH 4KK6D 3QQ4B 1HWGB 4MS8D 2ZNWA 1N64H 4HGWB 5EUOB 4UQ3A 4PJ8C 1IT9H 5SX5K 1UEMA 4HC1H 4IMKA 2IPTL 2RIKA 3BP5B 3VXSB 1Q72H 4J4PA 1BD2D 2BHYA 4KPHH 3C6LD 4WUUD 4JO3L 1RAMA 4XP4L 1HIMH 4R2GB 1S3KH 3AUVA 4MD0A 1QBBA 3K2UL 4WV1A 5ICXA 5E6ZA 1GC1H 3ZO0A 3VFUA 4JY5H 1FSKC 3LHPL 1VACB 2LABA 3KYAA 2H41A 2V7HB 3CFIC 5CZXD 1HHJA 3CFJB 3GBNH 4AIZB 5J8OA 2VDNL 3R8QA 1ACYL 5IEKB 5HHNA 2V2XB 2AGJH 3MPCA 1MAKA 4GAGL 4K7PX 2OR9H 4LDLB 5BZWB 1HYRC 5D2NA 4MVBD 1MFEH 3TT1H 1MVUA 1GZQB 4HIHA 2FX7H 2NY3D 3O3DB 2O26U 5KG9A 4WDIA 4JDVB 4TQEL 2P24A 4M00A 1G7LB 1CF8L 1JPST 3BE1L 2VDQL 5J9PA 5KS9F 3T04D 3P11H 1OT2A 4OCXL 1FG2A 4RAUA 2ED9A 3V5KA 3OKNA 1PKQB 5C8JB 1I9IH 3S3PA 5D7JB 5CZKA 1JZ5A 5CUSL 1SEBA 3IFOB 1DUYB 2HT3C 4HWBA 1P4BH 2D7TH 4OJFL 3HA0A 4LRIC 1NDGA 2ICCA 5TGBA 4WO4D 1PBYA 4JKPH 1IC1A 2R2HB 5KVDL 1QLFA 4MB3A 1YMMA 1I9JH 3TCXA 1I9RH 5JA9A 1FO0L 2JCCF 1EDQA 4QRRE 5JW4N 4NKDB 4MJ5A 5E8EA 1ZLSH 5HHQB 2Q3ZA 5C9KA 1LK2A 4LVEA 2PR4L 1F6LL 3MOAL 3LEVL 4Q9BA 4PRBA 4TTDC 2ITCA 4X7TA 3CVIH 3CSPA 1U92B 4ONHB 3RDTA 4HPYL 4FQQA 3DV4B 4PRID 2QR0A 3FONB 1EPFA 3MRGA 4G7VH 5MEPB 3RGVB 1MQKL 5FM5O 2HN7B 1OWWA 4ZFZB 5IT2H 2EH7L 4DEPC 4MX7A 3U0WH 5EO9B 2MHAA 1AKJA 1HZHL 4QCIA 3FZUD 4Z18A 1CXFA 3C6SB 3CSGA 3OGCA 4KUCD 1CXHA 1WFOA 4PJIE 3SE9L 1EAJA 3X12B 4K8RL 4OCLC 4Y19D 3NN8B 4CMHC 2XKSA 5FM8A 2YS4A 2GYSA 3RVXD 3O0RL 1I7TB 1LDPL 4Y1AD 2KKQA 4I0PB 5IEHB 3D85D 3LIZL 3V2AR 4PV8A 4DQOL 3EO0A 4X5LA 3ARUA 3BP6A 4KDTA 5J6GB 3I2CL 2Q87A 4HMDA 4H8WH 3WIFB 2XA8H 1U3JA 1W72L 4BM7A 5HYJA 2BOCB 3QEQE 4XVUD 4R2GD 3NPSB 5DJ2B 3MNWB 5FYJL 1SMOA 3P0YH 5DEGB 5EUKB 3VCLA 2GUOB 1JHLH 2ZCHH 3T8XB 3REWB 4P23B 3MV9D 5K9KB 4EN3D 2X70A 4N1CA 1W8OA 3HPJB 4NRYB 1BVLA 4MAYD 2WK2A 1WWWX 1JZ6A 1SJEA 1Z9SA 1HWHB 1KENH 4X7CC 2DQIL 1DEDA 4K3JH 4XHQA 1G7IA 3SN6N 3VWKA 3HUJA 1XCTA 5DFWH 2BNQB 2LFGA 2GK0B 1SY6H 3KYKL 4R7NA 5E6IB 5GHWL 2ICWJ 4HUMB 1T80A 5KOVC 3EDEA 1URLA 1U8HB 3IRPX 3L3HA 4PJGE 4F80A 5IQ9A 1BJ1H 1I1AB 4L29B 1WCBB 3D9AH 4Z78B 2IANB 2DQUL 1FPTH 3NAAH 3JTTB 5C0IA 1U58A 1DN2A 4GMTH 2DQHH 1X9QA 3O2WL 4LSUL 2GSIA 2YD4A 5FEBA 2DDQH 2W9DH 4S0SD 4LEOB 5CLWA 1YNLL 1UZ8A 2F19H 4XI5C 4XCCH 2A1WH 4ZNEE 5FKPA 1A6VL 4S1DD 4PG9A 1D5IH 3MMEA 3H9SB 1KJMB 3O2DA 4YHML 4ISVB 1SJVA 4XZUB 3LN9A 3VD5A 3BH9A 3V7AE 3REVA 2DQCH 5DD1L 3OAZH 3TO4A 1YEFH 1MAMH 2Q6WA 2PTUA 1IC4L 2H2PC 1J1PH 1U2CA 5LGHL 3RVTC 1AC6A 3BMWA 3HC0B 4R4FH 1J86A 1KGCE 2OZ4L 3LKOB 4ZFGH 1I85C 2YMXH 1PG7X 3NCYS 5B38B 5CEYA 5ECJE 3MYJB 4R97C 1PLGH 3U4BL 5GZND 2VLKA 4ODUB 3TZVC 3BQUC 1VERA 4TNVK 2ICWB 2ZWLT 4HCRL 1EO8H 3HE7C 4MD4A 4U1MA 4P2RB 5LXGL 1OGAB 4HJGA 1NFDE 3CC5B 3CVHA 3EO9L 5BW7C 2EE6A 2KH2B 5JORB 4GQ9H 5JW4R 4OZIE 2DQJH 1A6AA 3DGCR 4ONFL 3JWOH 3OX8B 5D1QD 1GYAA 2HG5B 3U7WH 3MRJA 5C0BE 4JRXB 3WFDH 5DDHA 1NAKL 5E2TL 2H26B 1EA9C 3I50L 4O4YH 5F88B 3GIVA 4NZUH 4I4WB 4Y5VA 3RNKB 1FAIL 3C8HA 5E99L 3MQIA 3WIIL 1LVEA 2CKNA 1BLNA 4HK0B 1H3XA 4M61A 1PFCA 1WAAF 2VC2H 3FOMA 3PWLA 2N56A 5I1EH 1DBJL 3GSVA 1FZMA 5C0AD 3T0AA 1EEZA 2CD0A 4P5MA 1QFWH 2EXYD 2EEDA 3S3SA 1ZTXH 4UIKL 4XPHL 3VFRA 5FA4A 5JW4Q 3TVMA 4FXGB 4OZFA 2WWKO 4ZUTB 1M71B 1ZHBA 3V7AG 1NC4B 2NZ9C 4BK5A 2EYSB 4ALAL 3NBNA 1MJJA 3K8LA 4UZGA 1CICC 2CO7B 1TJHL 4OQTL 3E3QC 3BKYL 3V0WL 2R9HD 4UV4H 2DM3A 3B5GA 3HS0B 4L1DA 4YHPB 2EIEA 1FHGA 2ZKHH 2WQRA 5I8KH 4FS0A 1A2YB 1BOGB 2RFXA 2Z35B 4OLYH 4ELMF 1AGDB 1F4HA 2P5EA 3HNTL 3QG7H 1M7DA 4XRCA 5DZNA 4KRNA 3GBLA 4G8EB 2W0KA 1ZEAL 3OGOE 5DJZB 1J5OL 3BUTA 3GSRB 4HJJH 2X9WA 4L8BA 2VLRA 4DCQB 5ISZB 2PN5A 3EYQD 3O3BB 3FJTA 2BSTA 5TH2B 5BOPA 3OJMB 4U6XB 4U1SB 3WDIA 5LQBH 4X6FA 1F2QA 4JAMA 4Z0BH 2R2CA 1QKZH 1MJ8L 4OSUL 5CFHA 3QNYB 5DMIH 3RZCB 1G7MA 1TNMA 2IH3B 4P9MH 3D39B 5IBLD 4LKXB 2VDLL 4M7KL 3ZKXC 3TC9A 3T4AA 2JLLA 1AR1C 4K7FA 1KYOK 2CSPA 3OKKA 1EUTA 5IBUG 5DFVC 1N59A 4YE4H 4PS4H 5AAMA 3DGGA 3QUZB 5BV7L 3C2AH 5DEZA 3HMXH 4NUJB 1E6JH 5H35A 4X8XA 3LKQA 5F1SA 1T2QL 2BDNL 1BQSA 1YC7A 4ZAKA 1INEH 5J1AB 1CQYA 4AH2A 3KR3H 5C3LD 5I1HL 2OI9C 3O81A 5IWLA 4PJDB 2R1YB 1T5XB 4LPUA 3S9DB 3RX8A 5HI3C 3SGEH 3OL2A 4NHUA 2CK2A 3A67L 3DXAE 3PL6A 2IPUG 5I66A 3HZVA 2XWTA 3GHBH 4KV5F 3E6HA 4BZ1H 3TNMB 1NCCH 2EDRA 2J8UB 1TJGL 2DQTH 3EYFA 3OKEA 4ENED 5DS8A 1ZLUH 5FV1L 3RWEA 1NCDH 4JZJB 4E9LA 2WBJC 4U1HB 1H15B 5C09D 1NC2D 3LKRA 3P4NA 2Z8SA 4NT6A 3VD9A 1MCHA 3ZE0F 1NAMB 3UTZB 5HGHA 5JDSB 3QUKB 1I8KB 4FQPA 2A6DB 5GS0L 4LLMA 5F9AC 1YNKL 1QLRB 2OP4L 1U8JB 1FFPB 2XTJD 1TVBA 4NO0A 1MLBB 4K8RC 1Y18A 3BJ91 5DVOA 2BVUA 5JR1L 5DI8A 5FV2A 3QEHB 2OTPA 5F70A 3V5HB 2MPAL 4HG4K 2GTZB 1X4XA 3FQNA 2XFXA 5CEXB 4JM2C 4P3DA 2DQDL 4D8PB 4ZUUB 4DUXA 4LMQE 3BUYB 4NQUA 3SGJC 3C5ZC 5IUSA 2BSRB 4OZHB 2O5XL 1A7RH 3EOBA 1RZJL 5FYLL 4IIQA 4IS6B 5D9SA 1A7PH 3IYLW 2XWJA 1RIHH 5E9DD 2YPLB 2W91A 3BHBA 5ACLA 1G1CA 4QHUA 3UX9B 4LLVA 1NANH 4Y5YC 1BX2A 3VXUA 1CZ8L 5DJ6B 3FO0H 1V8HA 4XGZB 4HIIB 5IB3B 1NSNL 3MSPA 5T5FH 4Z6AT 4AT6A 4NYLA 4NKOB 4NQVB 4K71B 4LF3A 2YUVA 4N0UE 3S3JA 4ZXBA 1YPZF 1UJ3A 3IDXL 4L4VB 5DJYA 4HWEL 2X5PA 1I1RA 4XPGL 1HHIA 4C83B 1DFBL 4X99A 1Q8MA 5ISZD 4HDIA 2FIKB 2ZSWA 4OD1H 1CFQB 2MOVA 2O5ZH 1NPUA 1VEMA 5IG7A 1KULA 5LGJB 4NC1E 4PJ7F 3VRLE 4KHTL 5IFHL 4M6AA 1H3VA 1TPXB 4YHLH 3SDDC 1NJ9B 4XHJC 1D5ZB 5AZ2L 3GMMB 1BVKA 2HLAA 3TM6A 4LSRH 4E42A 5JZ7D 1BM3L 3BH8A 2ZNXA 4O2FA 4OGXH 2HT4D 3BAEH 2DKSA 5D5MA 4LLQA 5INCB 2W0PA 1KCVH 4H25A 4OGAC 2GCYA 5T1MA 4FTVD 2ITDA 1NBYA 4U6YA 1LEIB 1G7JB 4IDJH 4WRLA 5DRNB 3LCYA 1A7BA 5FOBB 5L2KE 2L7UA 3EFDL 2HKFH 5BZDB 1JYXA 3MRBA 4YR6A 1JWMB 4YHKH 1QQDA 1LWRA 3MJ9L 1YJDH 2YRPA 2GEEA 1YZZA 3ZLQC 2DYPB 2HJLA 4HXBL 3NABH 5E8NB 4OFDA 4EKXA 4N8VB 4JQIH 2B1HH 5EU7C 1NGYA 4H26A 2F5AH 2QQNH 2FO1A 3CFDA 3LQZB 1MHHB 1WISA 4CW1B 1QG3A 4KKLC 1AGFB 3D6GA 4M1DH 5AEAA 3UJJL 4M9PA 1CU4H 4JHZA 5F96H 1T3FB 5D72H 5CJ5A 2PYEA 2X40A 3OAYH 1UACH 1TTFA 1HXMB 3HI5H 3BT2L 4BFIB 5F3HA 2ZUYA 4HEME 4WTZA 3VI4E 3WJLA 2VMFA 5DMGD 3BIKA 1RU9H 3FO1A 1IEAA 3RWDA 2R0ZL 1DQLL 3K1KC 4NQXA 1AO7A 4NDMA 5EH1A 1I7RB 4RRPG 4FMFA 2KQNA 4L8SC 4P46A 2VDMH 4BH7B 4DGIH 4ODTH 1N5YL 3BGFC 4NNXA 2L4OA 4PRPA 3EYVA 4YC2B 4DVBB 4TNWF 2ICWI 1WITA 5FYKL 5B4MC 1G9NH 2Q8BL 4BQ8A 2UZIL 1F02I 1NLDH 4W70A 1FAKT 2BMKA 5DRZB 3TPUB 4GG6F 3DX6B 4KJPC 3QPXL 4KTYA 5HSFA 3MC0A 3FN0L 1QPPA 2F5BL 1EBAA 5MENA 2ZUXA 4UILH 7CGTA 3GFUA 1YY8B 3IFLL 4KI1A 2R0KL 2SEBB 32C2B 1CCZA 4EZMA 1AHWA 3I85A 1I3UA 3LS4H 2AK1H 1JNLL 3UTSE 3T0EB 3HR6A 1RUPH 5CP7B 2P8PB 1Y6KR 3P4LA 3BPNC 1T1ZA 3L3GA 4X5XB 5DZLA 3CU7A 1CD1A 4XWGH 2W60A 5BS0D 5JHLL 3TA3B 4NO3A 3D25A 1AD0B 4PJEB 4UQ3B 3LB6C 1CFSA 6FABH 3U30B 4OLUL 1YN7A 4S1SH 2OMNA 2HTKC 4P2YA 4DKEH 4CU8A 3CH8A 1KC5L 4IRZL 1IGJB 4MD0B 3ZYOA 3O8XA 4WV1B 5ICXB 1VFAB 4CN6A 4JKWA 4V1DD 2O5YH 2UUDH 3VFUB 3B3IB 3IGAA 4XMPH 4L4TA 3HC3H 1HHJB 4M48H 4ZUWA 5BVPH 5BV7C 5FUOH 3QJHA 5ABDE 3RJDA 2BVPB 4OI7A 3MBEC 5HHNB 4X6DF 4XAWL 5L7XH 1RURH 1P9MA 1YN6B 1R5IA 4HKXB 1Z9LA 5D2NB 4EDXA 1DBKL 2E9IA 3JV4A 5EU6E 3UTOA 1MVUB 4KPHL 3RUGF 5KG9B 4DFHA 4WDIB 2NYYC 1OHQA 3I6GA 3HAEA 2F8OA 1S3KL 4BFEA 5J9PB 1KB9K 2PO6D 7FABL 5K9OB 1FG2B 4RAUB 3HLAB 3V5KB 4Z7QE 4O2CA 2HWZL 1NFKA 1F45A 3V5DA 3VI3E 2HYMA 3GBNL 4B0MM 3DX9A 3NGBC 2O93L 1SEBB 4WEUD 5IK3A 2W07A 4U1LA 3MV8E 1MI5A 3UYOD 1YDPA 2XXMB 1NDGB 1D9KA 4PGBA 3TT1L 1EK3A 5I15L 2FSEA 4JDZB 5GS0C 4XAKD 1PZUB 4P4KA 4OLZH 1QLFB 4FFWD 1YMMB 3UMTA 2C1PA 2IBGA 2CXKA 2VR5A 1WWBX 2PW1B 4MJ5B 5E8EB 5E2VH 3ULVD 1LK2B 3CFKB 3WFEL 3O6MH 4DOHB 2ITCB 4JQXA 2DKUA 4X7TB 3WKNA 1T83A 4KRLB 2D7TL 4LPXA 3VW3L 1ADQA 3RDTB 3WNKA 2HFFA 1OCWH 4FQQB 3NCEB 5KVGH 4NUGH 3ZE2E 5C2BH 1I1FA 1UWEH 3MRKB 1C5CH 3KXFD 1FG9C 1Q0YH 2QR0B 3MRGB 1RZJC 5I74C 4Q6IB 4JE4B 3VGFA 4NN6B 4MX7B 4YXHH 1CN4A 2MHAB 1AKJB 1FIGH 4QCIB 1UB5A 3DV6A 2JB5H 1BIHA 3OGCB 1CL7H 4JFXA 2NZIA 2ZCLH 4U3CA 5BXFB 4RMQA 1CG9A 5IFAL 1CGXA 1H8SA 1DEEA 3CVIL 3GIZL 3T0ED 4LSPH 2OM5A 3GI9H 3Q48A 3GK8L 2OL3L 1U8PA 4YAQA 2R2BA 3HI1A 4O9HL 1BAFH 1OF2A 4RMVA 4G7VL 1MNUH 2ESVD 3TA3D 1X5HA 3QCUL 4PV8B 4CL7A 5HPOA 2F54D 1IMHC 5FCUH 3FT4A 4XP1H 5EZOL 4J4PD 1NCAH 3BP6B 4NBZB 4C54A 5HYJB 2Z9TA 1OGTA 5E2WL 3PP4H 2X6MA 3SOBH 2ZUSA 3QRFM 1GGCH 1IC7L 3VCLB 1BD2E 2VISA 4WUUE 4M5ZL 4UT9L 5E1AA 1JGDA 1BVLB 3SDXF 1UVQA 1SJEB 1N6QH 2BHUA 4Z7VE 1G7IB 1XIWA 5KVEH 2NW3A 3PF2A 5T1LA 3HUJB 5D7LA 3L1OL 3ZKND 1BEYH 4ZOEA 3HMWL 2B1AH 3TH3T 3EDJA 4GRLC 3O9WC 1MEXL 4M03A 3TP4A 1KOAA 3E0GA 4X9FA 2BVQA 4R7NB 1XGQA 3V4PH 2FD6H 3RU8H 4BKLB 3L3HB 2IG2H 3VG0L 5IQ9B 1AFVL 2NY0B 1MWAA 2E3VA 2QHRH 4J3XA 2EEAA 3QXVA 5C0IB 1U58B 2A83A 5D1ZC 1JHLL 3HCVA 4GRMB 3WKMH 1RSFA 4XP5H 2GSIB 4X6CF 3CU1A 4HLZH 4UIMA 1UZ8B 3HE6D 3T0XA 5FKPB 3KDMA 1NL0L 2J6EA 5T3ZL 3MXVH 1IEHA 1VKXA 3L5WB 2H32A 1KEGL 4APQD 1FL3A 1CDHA 4PBXA 3O41A 4J7RA 2HRPL 5DJXA 2XWBA 4HK3J 2I9LA 3BH9B 1S7RA 3MJ8A 5GS2D 5FUZH 5C9JA 1OAQH 1LD9B 2MKLC 3EOTL 2F53D 1P1ZA 1NGPL 3TO4B 2Q6WB 2FGWH 2R39A 3U7AA 5CSZA 1BVZA 4OBRA 1RY7B 4QHNA 3T65A 4P2QA 4EQ3A 5I30H 4UAOB 1DDHA 3P0VL 5CEYB 4RBPK 3WN5A 2E6JA 4H0HB 2F19L 4G8GA 3DVFA 4WI8A 2A1WL 4XCCL 3CLFH 2FYYA 4NJ9L 1HSBA 1D5IL 3FHAA 1A9BA 4MD4B 3INUH 1K3IA 4U1MB 2Z91A 1WZLA 3CVHB 1JL8A 1JI1A 1MFBH 1A6AB 1MAML 4PRIE 3MRJB 3RIFF 5DDHB 4LLYB 3EJJX 1QACA 4KJWC 5HGBB 2MJWA 4KXZH 3KJ6H 2YXFA 3QXDB 1CYGA 3QA3A 4KKNA 2YMXL 3MUHL 4MAUH 3QULA 5TE6L 1T22A 1RZIA 3GIVB 4X7EC 3G5YA 4Y5VB 1XF3A 2BVYA 3GO1L 2Y9RT 1PLGL 4G7YH 1BLNB 4M61B 3QDJD 2ID5A 3GSVB 1FZMB 1EEZB 4Y19E 5HDQH 4P5MB 3F65A 1G84A 1QVOA 4QKXB 5T33L 1D7FA 4M6NL 5FA4B 3VFRB 3TVMB 4OZFB 5KSAC 2J88H 3JWOL 3GMPA 3G6JF 3LKNB 1NAMH 4Y1AE 1IGIL 5F7MC 1MJJB 5C0CA 5EUOE 4Y2DC 1OAUH 3UTQA 1JWUA 4O4YL 3CDCA 3K4ZA 3VXSE 4UINL 2IAMB 5C07D 4Z76B 4U4BA 4LK4A 4LCCC 3BGAA 2RFXB 2VWEE 1ZE3C 1UGNA 1N4XL 3EJYD 3B83A 2QSTA 1TQBB 3MV9E 1ZTXL 3LQAH 1WUNT 4L8BB 2VLRB 4XVSL 4XB8A 3DUHA 1HNFA 2AJVH 2BSTB 3CX5K 1EMTL 1ITBB 3MLTA 3SBWA 4XB7A 4OM0H 2FH6A 4X6FB 2JCCA 4JAMB 4TTGA 1OARH 2MKWA 3QUMA 1CTNA 2Y36L 1PEWA 2XN9D 3HRZA 3NFNA 1FVEA 1MFDL 1TZGL 3WFCL 1G7MB 5IR1A 3VJ6A 2YHGA 4EBQL 3RY6C 1YYLH 4R96B 2IEPA 4R4NC 3T4AB 2HFGH 4Z9KB 1BGXH 3C60A 1NDMA 3MTRA 1NBVH 1UC6A 2AXFA 2I25N 1PKQE 3QXUA 1SVCP 1UH3A 3DGGB 3S8WA 4HJJL 3N85L 1JHTA 3Q6GL 4HF5L 4LHUA 3K7UA 2DAVA 1G6RH 3IS1X 4ZAKB 4FXKA 4AH2B 2APTA 2IFGA 2A0LD 5A16A 2P8MB 4Z0BL 3VWJC 1QKZL 1FGNH 5CGYD 4NHUB 2X4QA 2PNDA 2BJMH 4HIXL 4N0CD 3PL6B 1JFQH 1T1WA 4Y4HD 1JI2A 4NZTL 3HZVB 2XWTB 2ZOKA 3E6HB 2E8ZA 5IB1A 4PJHE 1DLFH 5DRXA 1EEUA 3OKEB 1KN4L 5DS8B 3MLWH 15C8H 3RWEB 3WEXA 4BQ9A 3IJYA 1RJLA 1IC5H 1INEL 2FEDC 5GISL 2ZUQB 5DC0A 3LKRB 3P4NB 3WL9A 2V17H 1WJ3A 3EZ8A 4NT6B 5FA3A 3PDGA 5HXMA 2YUWA 3HNVH 1YEEH 3N50A 4Y4FC 4WW2C 4LLMB 4EI5D 5JQHC 1QPXA 4QTIH 1WICA 5CGTA 5EC1A 4NO0B 4PGJA 1Y18B 4HJ0D 4FP8L 5DI8B 5HHXL 4QGYA 2F15A 4ZFOL 2NXZD 4GBXD 1A7NH 5I18H 1ETZA 1R5VA 3CK0H 2XFXB 3FQNB 1O7SA 4MXQD 4P3DB 1BOYA 2X1QA 2YC1A 3BKCH 2XI9A 4LSVL 3ZMRA 4CGTA 5MI0B 4PBWD 3AB0C 4QF1A 1A5FH 3ILQC 4WUKH 5C0AE 4Z7WE 3EOBB 4XVTH 2R69H 5ITFA 3VXRD 4IIQB 4ZSOB 5D9SB 1U8LA 1YY9C 3KPPA 2XWJB 2VITA 3BHBB 4QHUB 2LTQC 4LLVB 2BP3A 4KJQD 4MSWB 4QXUL 1ZHLB 1BX2B 1PDKA 2FECI 3ESVF 3VXUB 5CILL 5GGTH 2NY5L 4JM2F 4LCWA 2IAMD 3S7GA 4LP5A 5CJQH 1WC7A 1ZA3A 1YEKH 3MLUL 4AT6B 5AYQA 4ZXBB 3KPRD 5GZOC 4OCYH 3U0PA 1UJ3B 2I26N 4LBEA 3QIBA 3OJ2C 4RSVA 1HHIB 2ZPKL 4X99B 2ERJC 3I84A 4GRWB 3V7MA 3QI9C 4HDIB 2ZSWB 3MV7A 1SBSH 4KFZC 1SYSA 4PRHD 5TDOA 1D6EA 1QO3B 4MA8L 4X5WA 1VFOA 5IG7B 4JR9H 3QUYB 1ZA6A 3X13A 5KZCB 4I2XA 4JFDA 4BQ6A 1KJVA 1MRFH 1BVKB 3JVGC 2Z31D 2C4FT 2KZ1B 4QYOA 4E42B 3BH8B 4O2FB 4TNWK 4YX2L 4WFHD 4YHIA 3OR7A 3V6OE 1GGYA 1Z6JT 5D5MB 4LLQB 2G60L 2HA1A 4Y5XA 4JGUA 1NBYB 1MCPL 2BZDA 1IBGH 4K3DL 2VN4A 4OV5A 1Q9KA 3CH1A 3MRBB 4WFED 4YR6B 3BYTA 1QQDB 2X4RA 2Y72A 4J6RH 3W11C 1JPTH 3WUWA 5I6XB 4IJ3C 3ALWA 3FN3A 5CS7A 3O6FC 1CD0A 2D03L 4AIXA 3LV3B 3QQ9C 4XCNA 4YHLL 2HJLB 2EYTA 1NMAH 4H20L 3KPQA 5DHYA 2EDYA 4Q9RL 1T2JA 2WWMC 4H26B 2IMMA 5SWQA 4F57H 4RWYH 3BAEL 4ELKA 3CFDB 1HKFA 4UB0H 4P5TD 1KCVL 1WAAA 1N0XL 5HY9B 3UYPA 3VG9C 3ZSTA 1C7TA 3BKJH 2A6JA 2HKFL 2XIDA 3P9MA 5JW3L 3SJVD 5DJ8A 4XBPA 2PYEB 4H1LH 4KUZH 1GL4B 3SDCD 4Y16A 4DK3A 3QDMD 5BRZD 5F3HB 3NABL 3FT2A 25C8H 4I0KA 3BIKB 4ZOCA 4YUEH 5C09E 4JQIL 2BXZA 3ARFA 2QQNL 2GT9A 1IEAB 3RWDB 3ZKMC 4LCYA 5I71B 4AG4L 4NQXB 1AO7B 1SBBA 3RGHA 4ELMA 2X4NA 4XCYA 1L9NA 1BZ7A 2XTJE 4P46B 5KTEL 4FQIL 4HWBH 4NNXB 4PRPB 1XMWA 1IGFH 3EYVB 2XKNA 2WIIA 3F7YA 3F8UB 3RWFA 2E27L 2V5SA 4JB9L 1HI6A 4R26L 4H5SA 5DHVA 3IFNL 4QWWC 2BMKB 2WINB 5MENB 2X4TA 5FFLA 5D2LF 3DVGA 4LVHC 5E9DE 4KKBD 2IFFH 1RQ5A 1UH2A 3QIUA 5L88L 2VDML 1TQCB 1IGYA 4R4BA 1R3HA 4PV9B 5B38G 1J05A 1KB5H 2JELH 4HFWA 3I6KA 4OT1L 4KQ3L 1T1ZB 3L3GB 1WFUA 1NMCC 3JV0A 4JFYB 3BDYH 1CD1B 2IBZY 2W60B 2R1XA 4FHBD 1NLDL 3D25B 4NO3B 3KLHD 1CDBA 1CFSB 3MOBH 1J87A 3QUYD 4LARH 4P2OC 4LCIL 5ISZE 5F97E 3O4LD 1YN7B 3BN3B 5A2FA 2NY6C 1BQHA 3FQTB 2IPKA 4N8CH 2APBA 3WFBH 4M6MH 1LGVA 3O8XB 4LLAA 5DQJA 5SWSA 3LS4L 4P3CL 5C08D 3UROR 3CMGA 3IGAB 2AK1L 3MRPA 1RHHA 1UA6H 3QIWC 4ZUWB 3SCMD 5J6HA 5FO9A 1QFUH 2OJZH 1IILE 1VESA 5K59E 4JREC 2Q3AA 5HGAB 3SKJH 4HFUH 1K6QL 2WANA 3QB7C 1QBAA 4G5ZH 2DF3A 4HKZA 5HHOA 3W82A 3AGVA 4M8QA 1J1OH 4JN2A 4DKEL 2QADB 3I6GB 4L5FL 3HAEB 2A2QT 4HLJA 3WDHA 5ICZA 3MRRA 1FGVH 5DXWA 5F3BA 3UO1H 4JVWA 1AGCB 5EDXA 3HC3L 3V5DB 4M48L 5BVPL 1IKFL 2NPLX 5SWZD 4PJIF 4MS8C 2HKHH 5IK3B 4DFIA 2ZCKL 5F9WB 4KRPB 2YR3A 1JGVH 1AY1L 4HIEA 2AEIT 5L7XL 2MMXA 3GM8A 1YDPB 1P2CA 5CJBA 1IAIH 1KEMH 2OXHA 3C6LC 3QDGA 4MNQA 5CJOL 1XEDA 3AREC 4NC0B 3MODL 2Z92A 2FSEB 4LSQH 4JGMA 4K7PY 4JPWL 3BFOA 5FM4A 4GW1A 1ODAA 2GJZA 3VH8A 5HI5C 1IZJA 5CZXC 3EW3B 3MROA 4JKLA 3S88L 1MCSA 4H0IA 1PYWA 3X3GH 1C5BH 1RZFL 3OAZK 1YPZA 2HT3D 3MLVL 5HVHB 4DAGH 2HFFB 1JPGB 1U8QA 1I1FB 1LEGA 4PG2A 2NY3C 4WWKB 4NBYB 5HI4D 4RMUA 4IBLT 4X9BA 3ROOA 3TT3L 3FCTA 4PJ7A 3NFSL 1HILA 2X4OB 4NJAL 5IIEA 2Y07L 4OZHE 3VDAA 1E4WL 4EUPA 2NY5C 4AEIH 5JXAH 3DV6B 3DECA 5E08L 1PX4A 1JUFB 3DUUA 4FQHB 4G80A 1HK6A 3WO4C 1EO7A 1OP5H 2VZTA 4PJGF 3ELAT 1ZANL 3ARXA 3MLRL 3O6ML 4TTDD 1T0PB 3NMEA 1C5DB 1P7QA 4BZ2L 2DKMA 1DEEB 4P5KB 1F90H 3WMSA 4JVPA 4WO4C 1U8PB 5KVGL 3LPGA 5IP4A 2X44D 1JHKH 1A22B 2R2BB 3HI1B 4YAQB 5GPRA 4F15B 1OF2B 1X5KA 4TSBH 1PJ9A 2AQ3A 3DO3A 3HFMH 1RUQL 1OTUD 4ZDHA 4GXVH 2FX9L 1FRGL 4PJXE 4ACPA 3JV5A 2R1WA 1HINL 2JB5L 1OGTB 3B9KA 5E8PA 2ZCLL 3DRTA 1AQDA 2VISB 3MLYL 4LSPL 3LY6A 5E1AB 3GI9L 1IFHL 2MQCA 1JGDB 2XV6B 2R4SL 1HEZA 4V1DE 3DO7A 1H5BB 1RPQA 4P99A 2B2XL 1D5MA 3RIFK 4P49A 4MLIA 1XIWB 5IB2A 1MNUL 2BVOB 5T1LB 1MPAL 1HXYA 1HOCB 3TGXA 5DJ0A 4QRPD 5CHNA 1WVZA 5HYFA 1NCAL 2BVQB 1NFDF 5INDB 1XGQB 4D3CH 1MFCL 2Z0BA 4OZIF 4KMQA 1LDSA 3PP4L 4NPYB 4OF7A 1TZHA 3HCVB 4P57A 4G9FD 3PQYA 4UIMB 3WD5L 3GSNA 1I7ZA 3KDMB 2X10A 2GKIA 1VKXB 2BNRD 2H32B 5DGRA 4HC1A 2VOTA 1B4JH 3HZKA 2XZAH 2P42B 5DJXB 3DOSA 2XWBB 3KNBA 2I9LB 3T3MF 2DWDB 1S7RB 3MJ8B 2VWEC 4JKKA 5I76A 4XVUC 4R2GC 3KPLA 4GG6A 3RU8L 1RULL 1P1ZB 1E6OH 2IG2L 1F4XH 4QRQA 3LMJL 4P2QB 4I1NB 3WKML 5M95B 1DDHB 4XP5L 3JTSA 3WN5B 4Y88A 4XI5D 1H8OA 4OZGF 4G8GB 3MACL 4KJYA 4FG6C 2FYYB 4WEBH 3MXVL 1HSBB 3Q2CA 1A9BB 1FV1A 1XF2A 5J13C 2F8XC 3ULVE 4P9HH 4OI8A 3S37L 5E03A 2Z91B 1KIUA 4WWKD 1DTUA 3SGKA 3MCLL 3QWQB 1DSFL 2AK4A 1S7TA 1HQ4A 2CDEA 4M7LH 2H2PD 2AJZA 3BRFA 3KXFE 3KLAB 5IQ7H 1ZLUK 4DWHA 5TFSH 4J1UA 5C0RH 1JNNL 5D7JC 4XNQB 3QULB 1T22B 3LS5H 3V8CA 1RZIB 1OAKH 3RVUC 3G5YB 1XF3B 3X3FH 4OLWH 1XFPA 5GS1B 4N8VG 4G8FB 4J23A 5ITBH 2YKLH 3HE7D 1V7NH 3BRDA 3VRIA 4KH2A 4PJ8A 3UDWC 4MNGE 4X6DA 3F6LA 4IEFB 3PABA 5E8DL 2D0GA 3T0EE 4ZS6D 2XNAB 1P7KA 3QHZH 2Y7QB 3GMPB 4UNUA 2ARJA 3KGRA 1MIEL 5C7XH 5CIPH 2ESVE 3RUGA 5JLZA 2WMPA 5EPMB 5C0CB 3LKSA 4PJEE 1JWUB 5AWNH 5GZNC 2X42A 3TH2T 2BOBA 2A9NL 2AEQH 4G7YL 4Z7UE 4JFFA 1WBZA 2VXTH 1J9CT 3JWNC 4KK9C 1EHAA 4OLVL 3ARVA 2IMNA 5GSVA 1WK0A 1HYSC 4QXGH 4M43L 2ZG1A 3L5XL 4LLDA 1HH9A 2NZ9D 2C3XA 1KLGA 5KSBF 1GGTA 4Y7MA 1NCBH 4HUWA 3EUUA 1CICD 4CJ1A 4ZFFA 3O6LL 3UYRH 3DETD 1F3JB 2WV3A 1N2RA 2JCCB 5JNYA 4NQTA 2NY7H 3RTQA 1DBMH 1J0KA 3MJ7A 1FQ9C 3H6JA 4LAJH 4UUJA 3HRZB 2FHBA 1CE6A 1FVEB 1DZBA 1RFDH 1Y6MR 2A6IA 3ECBA 5IR1B 4JO1H 3VJ6B 1UZ6E 3BWAA 4I0PC 3V4VH 4LRIA 1VPOH 1T7WA 3PV7A 3C60B 3QCTH 2AXFB 1QRNA 2Y23A 5EZJB 1TITA 1OT1A 4YDLB 3JBG7 4KI5F 5HDBE 3SDYL 1JHTB 4LHUB 1NEZG 4NQCA 3TBVA 1MCRA 1T66C 4WI6A 3TO2A 4FXKB 2R9HC 5KSUA 1F42A 3NPSC 1D3CA 5A16B 5T1KA 5D71H 4P23C 5DD0H 1FFNA 4FQJH 2F53E 1U3YA 1BIIA 3EZJB 1T1WB 1A64A 4LLWA 2A73A 2CRIA 5JDJA 5K9JL 2ZOKB 4LASL 1GHFL 1YYLL 1AR1D 5DC9B 4ODWA 2CQVA 5ALCH 1CR9H 5DFVD 3VFVB 5DRXB 4MMXC 3MLZH 1A7OH 2UYLA 2CH8A 3EYQC 5A2KH 2DN7A 5I1JL 4MJ6B 3WEXB 3HC4H 1RJLB 4L4JA 4RIRA 3M1BA 2HLFC 5SV3A 2R23A 1S78C 3IDIA 3ZL4L 4ODVH 3ARYA 3V6OC 2B4CH 5EORH 3WL9B 1FORL 4YXLH 5FA3B 3RWIA 5JIKA 4WFGD 2ENYA 2Y06H 3P3YA 1A3LH 3BP7A 2R8SH 2OTWA 3IF1B 5IBLC 5H37H 2ED8A 2J1KA 4WI9A 5EC1B 3DYOA 3VRLF 1FLRL 3D18A 3OAYK 4Y0GA 1EHLH 2B0SH 1JRHI 4OD2A 3LEYH 4P2CG 1DLFL 1ETZB 1FZJA 1LO5B 4YWGH 1BJMA 3QEGH 3SDXA 4HW6A 1NUDA 3WHE0 2WBJD 5DT1H 2YC1B 4RMTA 5K93A 1Z0NA 4P59H 5LAXA 3QZWA 4QF1B 3QDJE 1IKNC 1KPRA 2CIIA 3O2VH 1WTLA 2V17L 1RK1A 1ZWIA 1KCLA 2R15A 5ITFB 1PQZB 1U8LB 3KPPB 2VITB 1CDGA 2HJKA 3N1QC 1X6LA 3OZ9H 3WXVL 1KFAH 4HMCA 4ZS7L 1JGUL 5GJTL 1ZT1A 2DQEH 1WC7B 1D5BA 1P6FA 4X6CA 3Q0HA 1QR4A 4JM2D 1OW0A 5C1MB 4GO6B 4EXPX 1EFQA 1TIUA 1JPFA 3B9EA 5C07E 1JBJA 3WNLA 3U0PB 5DLML 3ARGA 3QIBB 3C5ZD 3AY4A 4NGHL 2JF1A 1H3UA 5HTSA 4MA7L 2DTSA 2VTFA 2DM7A 2GJJA 3GSOB 3DX7A 3MV7B 5F7EH 5AZEL 1AQKH 1SYSB 3LN4A 2R0LL 1D6EB 1JWSA 4HXAL 1BFVH 2NY4B 5LCVH 1ZA6B 3X13B 4I2XB 4JFDB 5FYJD 2DRUA 2AXGA 1KJVB 3ULUH 1O5DT 1XR9B 1FH5L 1F6AB 3ULVL 1MJ7L 5C0FA 3VI4F 2C4XA 1YEKL 3UC0L 4F7CB 3OR7B 4G8IA 5DR5L 1EGJL 5EN2A 1T21A 3PNWA 2XN9E 4Y5XB 5JPMA 3KHOA 4AEEA 1J0IA 3UPCA 2VKXA 5ESVA 1S7VA 3DBXA 4OGYH 4OV5B 5BJTA 4XX1E 1Q9KB 1UYWH 3CH1B 1CDYA 3MLSH 2ATKB 2F8VA 3WUWB 2UUDK 3KS0H 4JR9L 5T1DL 1I85A 3SDDD 4LRNH 5LBSH 4XHJD 4XCNB 4E41D 1XGTA 3OPZH 4FNLL 3OKLA 5IHBA 3TZVA 3BQUA 4MD5A 3LRGA 1AP2B 4FZEH 3X11B 1E4JA 1NGWA 5EC2A 4ELKB 4PJ5A 4Y4KA 1CVRA 2W0LA 4NQDD 4NNPH 5BW7A 4MXWL 1F6FB 3Q1SH 3CLEL 1BFOA 5DD5H 4UNTA 2P4AB 2DI7A 4JRYD 3MNZA 1XGYH 4PJCB 2DMCA 3P9MB 4W6WB 2YD1A 4XBPB 5FGBC 4YDJA 3BPLB 5BCAA 1IE5A 3G6JA 4Y16B 1S5IH 3GKWL 2QQLH 5JZ7C 3FT2B 1A6PA 2HT4C 3HAEH 3L95A 2FO4A 2I60L 2KUTA 3GJEA 1GIGL 2GT9B 4U1GB 1TLKA 3MRIA 4GAYA 4LCYB 3S98A 2VAAB 3QUZC 3MNVB 4XMKL 4Q6YA 4ELMB 2X4NB 3VXTA 4XCYB 1BZ7B 1BP3B 4NFDA 3P30L 1FFOA 3MA9H 2WUBH 3CXDL 35C8H 5M7QA 1MFAH 3CJJA 2CDGA 1F4YH 1KG0A 3RWFB 2D31A 4XXCA 4XX1G 3MLXH 1HI6B 5FDWB 3BSZL 4HS6B 3EYOA 4H5SB 5DHVB 1U91B 2A9MH 5GJSL 4AENA 4RNRA 25C8L 3QUXB 5H2BA 2CRMA 4JPKL 1T0MA 4YUEL 5GRJL 4NN5C 1B90A 2X4TB 4L9LA 3NCYP 3DHMA 3QQ3A 1CBVL 3DVGB 3ARBA 3VXRE 3DVNA 2BVTA 1AJ7L 2Q7YA 3DRQA 1RI8A 3OV6A 4JPIA 1D5XA 4JZJC 3S36X 3OXRA 3QIUB 4R4BB 1IGYB 2VH5H 1R3HB 1GOGA 1J05B 5B4MD 3MRQA 4HFWB 4Z7QF 3I6KB 5JIHA 1GGBL 3CX5J 4PJ9A 3VI3F 3W39A 1G0DA 3KPRE 1FJ1B 4LQ1A 5TDPA 1OP9A 3WFHA 2EDKA 1G9MH 1YEIH 2COQA 2MCPL 3UBXA 1FZKA 4IM8A 3W0WA 1FP5A 2HJFA 4PRHE 1BQHB 2IPKB 2GITB 5FK9B 4M1GL 2VABA 1KXQE 3DNKA 5LWYH 1FNEA 1QSFA 4NHCH 5SWSB 4POZC 5EFIA 3U0TA 4KZEH 4XP6H 5MERA 3W2DH 2ORBH 3MRPB 1RHHB 2F58H 5I2IA 2FHFA 4WFHE 4K07A 4N9OB 4QRRD 1CT8A 5FO9B 1Y0LA 3AAZA 2WIMA 2YBRA 1GGIL 1FVDB 1A7QL 4NWTH 4PTTA 5D93B 2D7PA 2YWYA 3H3PL 3ZE2F 4EDWH 2FECL 2DJUA 4WFEE 5HHOB 4M8QB 4OZFG 5FB8A 5IJVA 1T6VN 4FQ1H 2VDOL 4MCZA 4K71C 2Q8AH 5ID0B 1S7SB 3WFBL 5HPMA 5B3JE 1QLEH 5ICZB 4U1KA 4RCAA 5CJ8A 5F3BB 5DA0B 1A47A 4NNYB 1QFWM 1QHOA 3QHFH 3ZT6A 3GI8L 1F13A 1X5IA 3A6BL 5DUML 4EOWL 3EHBD 4JZOB 4HIEB 4XP9L 2HFTA 3CMOH 1T89A 4ZO8A 1P2CB 3ZE1E 2LQRA 1A6WH 3RWCA 4MNQB 3MUGA 2AJYL 3CZFA 2Z92B 3FRUB 3SJVE 1MWAH 5D8JH 2NTFA 4ODXB 2AJXL 4GW1B 2GJZB 4PIRF 3QDME 3VH8B 5BRZE 5DF0A 3VFMA 4NCC2 1FGVL 5ESAA 3OB0H 1PYWB 2CUMA 1YPZB 4LFHD 2OS7A 1DBAL 1KEML 1W72A 1LEGB 3GB7A 4A2LA 2PTTA 3MYZA 1CGSL 3PHSA 4UBDD 4AL8H 4Z7VF 5JUEH 4JCMA 5GS0D 4F58H 5IKCA 4OFYD 5DQDH 4NSKA 3FCTB 4PJ7B 3QUXD 1HILB 2DQFA 1IQWH 1MCBA 4X9GA 5IIEB 4EUPB 2VIRA 4RISH 2CK0H 4L3EA 4KROB 3ZHKA 2EICA 4ZSOE 2D2OA 1KN2L 2DLFH 3UEZA 4G80B 4ZOBA 2P43B 2APWA 3ARTA 1JJUA 2DD8L 1DQDH 3X3GL 4Q9QH 1YEGH 3B43A 1J8HD 1P7QB 3FN9A 3O2DL 2MCG1 4PUBH 3PGFH 4BFGA 1IL1A 4JY4A 2BXYA 4KQ4L 5FYLD 2Z8WC 4FFWC 1IM9A 4L3CA 4NO5A 3TBWA 2IWGA 3TYFB 2HVKA 5EZIL 2YK1L 4ZDHB 4GRWE 4WVRA 5IW1A 4OF8A 4XCFL 4GH7B 3ULVC 2R1WB 2BY1A 4RDQG 3B9KB 1RZ7L 2BNUA 5E8PB 1NMBL 4YDKL 3DRTB 1JGLH 3DJ9A 3O4LE 4I0CC 1AQDB 2UWEE 4JFEA 3WNMA 3KPSB 3CVHL 1JHKL 3DO7B 1OVZA 5C08E 1KCKA 3GDBA 4PR5A 2CIKA 3NCMA 4TSBL 5IB2B 4U6HA 4PFEA 1V7MH 2DIBA 3OBAA 2EZ0D 2VXQL 4X7FC 5DJ0B 1JK8A 3H0TA 1VGEH 4WI2A 5CHNB 4S1RL 3BP4A 1X4ZA 4GXVL 1FNFA 3M07A 1T2XA 2CUIA 4R90H 3SE8L 1X4YA 4DUVA 4Z8FL 2JJSA 1TTGA 2CMRL 1MHPL 3T0EC 1DVFA 4F9PC 1TZHB 2G9HA 4P57B 3TESA 2EDWA 4F7MA 1P7HL 1I7ZB 1IGCL 2V5YA 1OTSD 3TA3C 4KUCF 4K94H 4J4PC 4O02H 5GGSY 4NQEA 3TN0A 3U30C 4WNQA 5BMFH 4A2MA 1YNTA 3KNBB 3LD8B 3O9WD 4GRLD 5GGRY 4MNQD 2RHEA 5I76B 3KPLB 4M7LT 4GG6B 2W65A 3U1SH 3IXTA 3TJEL 3QUMH 2JIXB 4PB9L 5FXCH 2V2WA 5D2LA 5KN5A 1VA9A 3TIEA 4L8SA 5C2UB 1I8MA 4C56D 4F7TB 4OAWA 1YEHL 4X4YA 3JTSB 1R0AH 1K9TA 4K3EH 5EUOF 3K4AA 3GHEH 2A74B 2JJUA 1PKOA 4KJYB 3OB8A 5IBTH 3HKFA 4YHZL 3ZKNC 1FV1B 5JA8B 4S11A 3X14A 3RFZC 1XF2B 2VXVH 5D2NC 1AO7E 5IGXL 3VGAB 1RMFH 4PJBE 3G04A 3U48A 3IJSA 2AK4B 1S7TB 5I16A 1HQ4B 2CDEB 2AJZB 1XR8A 1CFNA 3N9GH 5FECA 1T7VA 1A6ZA 3DSNA 1PAMA 4DZBA 4J1UB 4KROD 2GHWB 4XNUL 2XY2A 3HE6C 1Q9WB 3ORJA 5MEOB 2AABL 5ELIA 2EDTA 4AEHH 2YUZA 1TTUA 4LPCA 1UFUA 5DHXB 4K9EL 1XH3B 5GGQL 4JJ5A 4WEBL 2LU4A 4I77L 5FYKD 5E2UL 3NTCH 4N5EC 5IHZA 2W0FA 5B3NA 2E7LC 3ALXA 2ADFH 4PBVC 3B2VH 3VRIB 4PJ8B 1TCRA 2PYFA 4X6DB 5I1IL 1P7KB 2EKSA 3GMOA 2P45B 3CGTA 4DJMA 3BXNB 2ARJB 5ALBH 2HP4A 4JQVC 4YPJA 5IQ7L 3TJHD 3RUGB 5JLZB 1BFTA 4NKIH 3LKSB 4WTXA 2UY7A 4TOYL 2BOBB 1ORQA 2NXYB 1KCUL 2X7LB 1WBZB 3MBEA 1RUAH 3RDTC 4NCDA 4N68A 5TE7L 4JFZL 5GSVB 3KPSD 4DTGH 1AI1L 4Q6IC 4G6JL 4PJHF 4K55A 5E5UB 3TBYA 4NN6C 1Q1JH 1YYML 5GGSA 4LLDB 1HH9B 3S34L 1KLGB 3O3UN 4CUCA 4HUWB 4X7SH 1A6TA 4ZFFB 3VGBA 1I3GH 4QRPE 5AWNL 1N2RB 5JNYB 3RTQB 3MJ7B 2AEQL 2ZJSL 5HHMD 1BJ1J 3GRWA 3FTGA 1CE6B 1QHPA 2A6IB 3DHJA 3ECBB 4B50A 3QEQA 1M4KA 1EIBA 3BWAB 1AXTH 2YA1A 5GXBB 2Q7NA 2AJ3A 4YFLF 5GS2H 3SEPA 1LO4H 1QRNB 4G9FE 3C5JA 5DD3H 1MIML 3O6KL 4D9LL 5E1HB 1BWWA 1F3RB 2BNRE 3TO2B 3QQNA 4H88H 5KSUB 2FR4A 3H9HB 4D0DA 4NKMA 2DM2A 1QSEB 4RGOL 4U2YA 2JIXD 5T1KB 4Z7WF 4QHMA 4NP4H 1BIIB 4XPFH 3EJYC 4PJGA 2ZP0T 4D0BA 1QBLL 1CLOH 3CDFA 4ODWB 4ZG1A 3ARDD 3JSSA 4WJ5A 3ZKQD 2UYLB 4NKQB 4M3JA 3G5VA 5I1CL 4ZNEA 1VCAA 5D7KD 1RJZA 4XH2B 4RIRB 3M1BB 2W9EH 2R23B 3IDIB 3JZ7A 1F3DJ 2LE9A 4NM4H 2R0WL 3RWIB 5CINL 3BZEA 2OLDA 2OQJA 5D71L 3BISA 2OTWB 4PLOB 4WY7H 4JDTL 3VFGH 1T04A 1HHHB 3D18B 2OX5A 1KXTB 4OD2B 5AG9A 1FZJB 4ZTOH 4I3GA 4OCSL 3SDXB 1YEDB 3UZVB 3VMNA 1LO3L 5T3XH 2CGRH 1VB9A 1J8KA 5GHWH 2XYCA 2FEDD 5LAXB 3QZWB 5MEQA 5J1TC 1KPRB 2CIIB 1Z0MA 1E4KA 1DL7L 1RK1B 1ZWIB 2V5TA 5CGYC 1LQSR 1T5WB 1NFDA 1EV2E 4Y4FD 4Y4HC 2ZUWA 3PHQA 4OZIA 4K2UL 3I02A 4UOW0 1FE8H 2HJKB 3OKDA 5AYUL 5C0BA 2IQ9L 1B2WL 2XTLA 4MCYA 1ZT1B 4QTHA 1X6NA 1ZT4A 1D5BB 4X6CB 2B0SL 4YJZL 2NXYD 5A2JH 5DUPL 4FQXD 1PEZA 4G6KH 3MJ9A 3S4SG 3P77A 4DVRL 1OL0A 3NA9L 3ARGB 4U7KA 4WHYH 3QRGH 3ILQD 1HQRA 1F4WH 2VXSH 2NX5B 4XNXL 5E00A 2EDBA 3TFKD 1BMGA 2ZUVA 3WCYA 1IM3A 2YD3A 3QAZB 5IESL 1DUZA 2V7NB 3O3EA 4PRAB 5D1ZA 4HJ0C 4Y5VC 2ZSVA 1U95B 2AXGB 5F7FA 1W0VA 4GBXC 5KW9H 5IF0A 4NQSA 1AE6L 2GJ6A 5BO1H 5C0FB 4MXQC 1I1CA 3CXHK 1BBDL 4LIQH 3E3QE 2X89A 5KANI 4OZGA 1KLUA 4FZ8H 5HYSB 3SGDH 1WBYA 4G8IB 4XC1H 1K5NA 4ZO6A 1FFRA 5EN2B 5CBEA 4JN1H 1T21B 3PNWB 5JPMB 4GLRI 3P0GB 43CAA 43C9A 1UCBL 5ESVB 1S7VB 3DBXB 4FFZL 3QI9D 5HYIA 4X4ZA 3V6ZB 5BJTB 3T2NH 3E8UH 5DSCA 5F7EL 1AQKL 5DJCA 2FH8A 3WIHA 3ZTNH 4RAVA 4PY7A 1Z5LA 2IAMC 3GGWB 1QSED 3ULUL 1XGTB 3OKLB 1D6VH 5GGVL 1MCEA 3U36A 4HUVA 2QSVA 4C4KT 3I3BA 3BQUB 5IVXE 3TZVB 4MD5B 1TDQA 3VGHA 3QBTB 1TQBC 5EC2B 5T3ZD 1YQ2A 3BESR 4PJ5B 4Y4KB 5DMJB 1OLZA 1W0WA 2EXWD 4XPTH 3FL7A 4HEPG 1OD7A 1BFOB 2VO5A 1LO2H 4GW4A 4HPOL 3LKPB 4HQQH 3MNZB 3PWVB 4G6FD 3EIFA 4WIQA 4XCEA 4U6TA 4YDJB 3O6FD 1PZ5A 3G6JB 4Z77A 2Y5EA 2XOTA 4JG1H 5JOFA 3MRNA 3IVKA 2VUYA 3ZDYE 5IHLB 1S7QA 3P4OA 3MO1A 3L95B 2WWMD 2FO4B 3RHWF 1ZGLM 3GJEB 5F6IB 4WFGE 2C3WA 4XPBH 4K9EC 3V4UL 4F33B 3MRIB 4GAYB 2VSCA 3DYPA 1FBIL 3LN5B 4NNPL 3DXAA 3VXTB 1HCVA 5EA0H 3NPZB 5ADPL 3Q1SL 4Z0XA 4OB5L 4ZAKC 5JHDA 5KSAA 4OTXH 1FFOB 1G6RA 1XGYL 4GMSL 3QCVH 5C6TH 4N0RA 1DE4A 2CDGB 1KG0B 3IDGA 2D31B 3ME0A 1VGKA 3IS0X 5KSBA 1NCWL 2BC4A 4Y2DA 1AGBA 3EYOB 1V05A 4AENB 3WV0A 3PL6C 4RNRB 5K59F 2MQ0A 3L9RA 3BKML 1HE7A 1NCUA 3G5ZA 4QT5A 1P6AB 4L9LB 4P5TC 4OM1L 4FFVD 3QQ3B 3ARBB 2Q7YB 3DRQB 1D5XB 1ZHKB 4JFPA 3MXWH 3R0NA 5IMMB 4M93B 2ZUQC 1QA9A 4KAQL 3KJ4B 4OCWH 4LVOB 2X4SB 3MV01 5I9QB 4PJ9B 1A3QA 4F3FB 1KIRB 3W39B 2NX5D 3WLBA 5D7IB 3WFHB 1OP5K 3HG1D 5TDPB 3T77A 5HDLA 4DW2L 2W92A 4OLXH 4TPRH 1VADA 2YEZA 1TMCB 2X2YA 3BJLA 3UBXB 2E6QA 4EUPH 2DTML 5GRYA 3TYGH 3NH7H 5EBGA 3JWDH 5F7DA 2NY1D 2HJFB 3BMVA 5I1GL 2QQKH 3O4OC 2IGFL 1JRHL 4RX4D 4MZ3A 2NLJA 2VABB 4M6OH 5HVGB 1RZKH 5FYJE 3VD7A 4EVNA 1FNEB 1QSFB 4LSTL 3U0TB 5EFIB 2AI0L 4HBCL 4U2ZA 2VH5L 5MERB 1ADQL 3QFJD 2WZPD 5I2IB 5J3HD 4O00A 3BVNB 1I3RA 1CT8B 1GPOL 1Y0LB 3U79A 4N0UA 3RX7A 5DWUH 2YBRB 4HUUA 4TRPH 4CADA 4PTTB 3GBMH 3VWJA 1JP5A 3STLA 4P2OD 4LGSB 3VDBA 1JYVA 5FB8B 5IJVB 1ZS8B 4MCZB 4KZDL 3OXSA 2XRAH 4ZXBC 5HPMB 5LWYL 3C08L 1UJ3C 4E41E 4LGPB 1GAFH 3KPOA 2VB5A 4OZHF 4QOKD 2XQYG 2WM0A 4U1KB 1OAYH 3EJZC 5D1XB 2F58L 1VDGA 1J0HA 5F9OH 4RRPA 3KLHC 1H9VA 4M7ZB 3QUYC 5J4MA 4OF0A 4NWTL 2K3TA 4DKAA 2FL5B 4PREA 1R3JB 3RWCB 5L2KA 4OCMC 4JRYE 4YDIH 2GY5A 12E8L 4JG0L 3CZFB 4K7PH 4OKDA 3F12B 1EJ6A 2NTFB 2HT2C 3SQBA 2Q8AL 4UV7H 2H3NA 2DBLH 2YPKA 2IH1A 4YQXL 1FL5B 1JV5B 3F58L 5ESAB 3GSNH 4PJXF 3IETA 4F2MA 4Q2ZA 4WU7A 1ZK9A 4ZPVA 2FEEI 3FFCA 5EU7E 5DRWA 3RY5A 4WWID 2D7OA 3EFFA 3VFWA 3W5MA